5CUSH

Crystal structure of serbb3-fab3379 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
182
Chain Sequence
b'EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYYMQWVRQAPGKGLEWVSYIGSSGGVTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGLGDAFDIWGQGTMVTVSSASTKGPSVFPLAPGCLVKDYFPEPVTVSWNSHTFPAVLQSSGLYSLSSVVCNVNHKPSNTKVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Inhibition of ErbB3 by a monoclonal antibody that locks the extracellular domain in an inactive configuration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 182
sequence length 214
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2015-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH01
5F7EH 1TZIB 2BSRA 5HHOD 5MEND 4GXUM 1UFUA 1CT8A 3F58L 3F7YB 1ZT4A 4ZAKC 2R4SL 3BW9A 2YPLA 4ZFGH 4MA3A 3MLVL 5D1ZC 3QIBA 4ISVA 3NCCB 3GBMH 3IKCB 4GMTL 5D70H 2HKHL 3P0VL 5C08E 1R3KB 4JO3H 1C1EL 3V6OE 3MUGB 4L4TB 3KPMB 3W81A 5EH1A 2DBJA 4DUXA 4OZGB 3U1SL 4YK4C 2K3TA 4LCUA 4L3CA 2VZSA 3TJEH 3VWJC 2ITDB 2DQCH 4JVUA 3VMOA 3SJVB 3BOVA 2ZSWB 1BGXH 2A38A 3HS0A 5HVFB 4NWUL 1E4WL 3QA3B 2VDKH 1AD0B 1N59A 3P4MB 4H20L 3O2VL 2IPTL 3MRKA 3KYNB 4YO0A 5D7IA 4N9GA 3FT4B 1KIPA 3DI2B 3TA3A 1IM9D 5KW9H 1JFQH 1JPTH 3AM8C 5T5FH 5C9KA 4KTDH 4B5EA 4LBEA 4L9DA 1S7RA 3FOLA 4M1GL 5ABDE 2AJVL 3KPQB 5D7JD 5LGHH 4LSUH 5CP3A 2FECI 5D96B 5IEHA 3OKKB 2NZIA 4L1HA 3D69A 4PJGE 4QHLB 5C7XL 3CK0H 4Y19A 1T2JA 4UDTB 1S7TA 5INCB 3SBWC 3HPLA 4R9HA 5AZ2H 1JNNL 1H0DA 1G6RA 4NOFA 5IB1B 3W9DB 3U7WL 1ZGLP 4UIKL 3K2UL 5C0DA 3ROOB 1I1FA 1YDPB 4L29B 4S11A 1OF2B 5DRXA 1U8LA 2X4NA 1K5NA 2H2PD 3DETD 1TZIA 3TT1H 4KY1H 2R4RH 4PRHD 4FTVA 4OSUH 1IEBA 1B2WH 1ZS8A 2XY2A 3ESVF 4YXHH 5HHVL 2AJXH 5GRJH 2FRGP 2GJZB 3CFBB 1ZANH 3I02B 1KJMA 1ZHBB 1HXMB 4YDLB 1HILA 2Q3AA 4ZYKA 4PTUA 3GI9L 4FQ2H 1JUFB 1WBYB 3BQUD 2J12B 1YEIH 4C4KO 2NQCA 1A7NH 3HFMH 1NBZA 5H8DA 1U95A 2EDDA 1A1OA 3IDYC 4DZ8A 4O4YH 5DMYA 3MGOB 4WFEE 2AJ3A 1CFSA 4M1DH 4Q9QH 1QHPA 1KN4H 2PN5A 3CDYA 4F7CB 1B0RA 1A7OL 3QUYD 2I5YH 3IXAA 5JMOC 1A4KB 1CN4A 5I1CL 2IAMA 5I2IA 4NUGL 4V1DA 4TNVF 4JG1H 2DIJA 2PNDA 3NA9H 2OYPA 3LD8C 3IU3B 4AEHL 3SE9L 4XMKL 4WFFD 5HYQA 2HKFL 4FFYH 12E8L 4X4YB 3UYRH 5A3IC 5AUMA 3KDMA 1I9IL 3WFBH 3WIHH 4QXWA 4PV9B 3QIWD 4PJGB 5FGCE 4A6YA 3GMNA 1B0GA 2DQTL 1FL3A 4BQCA 2BY1A 2D7TL 1BP3B 2YC1A 3ARGD 2YA0A 2HVKA 3OB0H 4XRCA 1MUJB 2ADFH 3NVQA 4IMLB 4Y5YB 3DBXA 5A43C 2XTJC 1NFDA 2VH5L 1ZLWK 2Z8SA 2R23B 2ZUVA 3ZT6A 2NLJA 4MCYB 5DJDB 2J6EL 1K8DB 5IBLD 4ZXBB 1UB5B 1EHNA 1N6VA 5IW6A 5EU6E 4M48H 3O4OB 3V52L 4QXGL 4F7TB 5EUKB 1J10A 3P4OA 3O11A 3TT3L 3OAUL 3KLDA 1WAAA 1MH5A 4S1DC 3U4AA 3K81A 5HXMA 4MS8C 1PYWB 4I4WB 1N5AA 1M71A 2NW2A 1IKFH 2A73A 4NN5C 4KJPC 4P23C 1XGTB 4PD4K 4HKBB 4GQ9L 1MFDL 1G9NH 2APVA 3MRIA 4F37F 1XZ0B 4TYUA 2HWZH 2CPCA 1MFEH 2AXFB 2VITA 4TVPE 4OZIF 4KZEH 5EB9A 3WUZA 2RAMA 3HG1D 1EBAA 3FFDA 4QNPE 1QPPA 5MEQB 2F15A 5I1AB 3L95A 2YZ1A 1J1PL 1NKOA 5CJOH 1GGUA 2HVJA 4UBDD 2E6QA 2Z4QA 4E9LA 4Z0BH 3T0VA 1PX4A 3HE6B 1EEZB 4P4KD 2DQHL 3F5WA 4JQVC 4L8SC 5HJ3A 2PXYD 1F8TH 3MRQB 4YDJB 3TNMA 2P7TA 1CIUA 1MRDL 1T5WB 1N7MH 2V9TA 4HC1L 1QSFD 1I7RB 1OAQH 4N0RA 5HTSA 1KB5L 5SWSA 1WCBA 2MSPA 1DEEA 4KH2A 3A67L 5FHBL 3FN9A 1M4KA 1A1MB 4XWGL 4B41A 4MAYA 1JCKA 1U3YA 2YPVL 4FQ1H 4JR9L 4OGYL 4MXVE 2CRZA 1T0NB 3OGCB 1EZVX 5K59F 2C1OB 2FH6A 4QXUH 3W5NA 4JY6A 4LCIL 1U92B 2PETA 3P11H 2BY3A 1KBGL 1MF2L 3L3JB 3NCJL 4HV8A 5FYJD 2NY7L 3HNSL 3MJ8B 2FJHA 3WD5H 4BUHA 1K85A 3QUZB 4OZHB 4Y4KB 1JMZA 3BP5A 3WLBA 1K6QH 3UC0H 3CX5J 2GEEA 1D7FA 3QIBD 2XI9A 3FTGA 2YS4A 2RCSH 2GAZB 4YHMH 4QY8B 3RUGF 3FHAA 5CZVH 3TEUA 3ZE2E 5J11C 1A7RH 3OXSA 3HI6L 2AEPL 2CGRH 4PY8J 2ILLA 2IANB 1U8HA 2Z9TA 4LCCC 2EE2A 4Z5RB 1QACA 1YEJL 4Y4FC 2CUIA 2W59A 2JIXA 2NTFB 5KSUA 3VI3F 4GG6E 4TVPH 5DRZA 4KQ4L 2FX8L 2JK5B 1EFXB 5I1AA 1T7XA 3OTTA 1KJ3L 2FZ3B 4PJCE 4PB9L 5DEZA 4XVUC 1RZKL 2AGJL 3TA3D 1IC7L 4Q9RL 2HYMA 3KVQA 4DKEH 4GW5B 3PGFL 2E9WA 3SGJA 5GGUB 2XQBL 4YHZH 1I8MA 5IVZA 1QBAA 1YN6A 1A0QL 1JI2A 4ODWB 2VB5A 2ZPKL 5JQ6H 4Y19D 4BH8B 3MV7A 5DVOA 4PLJD 3VH8A 1KJ2L 3EDJA 3KPSB 1RFDL 2IBZY 2DB8A 4P5MA 4PJHB 2YRPA 4L3AA 4YHOH 2CIIA 2YEZA 2YOCA 3DGGA 1P7HL 2XZZA 4Z76A 3V5HA 5CILL 2EH7H 4PIRF 4RISL 4QTIH 3MJ8A 3SE4A 2CH8A 3HI1B 2KZ1B 3KPLA 4OZHA 5EA0L 2A6IB 5FO9A 5FUOH 1G7MB 3VFOA 1CDJA 1U8NB 3LZFL 4G9DB 1RURL 3NIFE 3K4DA 4JPKH 2AXJA 3TBSA 3WL9A 3C08L 4XT1C 3LN4A 1NDMB 4X8JB 2KDGA 2WV3A 3EOTH 4NQCA 1RULH 1MSPA 2HRLA 5IK3B 2MKLC 2YD4A 4LRNL 3P4NA 1INDL 4IDLA 5DQ9A 2DYPB 1JRHL 3WN5A 5I1IH 1I8IB 1L0QA 3C09C 2IMNA 1TCMA 2IAMD 3G08A 3MBEB 1K8IA 1CICC 4V1DD 5E1HB 2X09A 4P46B 4YHIA 1JNJA 2NYYC 5C6TL 4LLVB 3T2QA 3FB8A 4GO6B 1NEUA 3NIGF 1RZ7H 5DD0L 3ESUF 5GPRA 3JV0A 3CC5A 3O2WH 5CEXB 4X4MA 4KI5D 1UJ3A 5ESAB 2BJML 3WLWD 2P5EB 3ARBC 3RWDA 1AIFB 5AEAA 4LSTH 3AXLB 3VXPA 3ZSTA 4P0DA 1EO7A 5FYKU 3CH1B 4HCRL 1MWAA 2W9DH 5JR1H 4G6FB 1QLEH 2BSTA 4JQIH 3SGKA 3GJFB 4OZ4A 4QCIA 3CCHB 3RWIA 4OCMC 2X89A 4P2YA 1I1AA 1T3FB 4EDWL 5D2NC 3ZLQC 2XRAL 3D48R 4U1KB 4NQSB 3GSNH 3EYFB 3SCMC 2R8SL 5AWNH 3NFSL 3LKPA 4BFIA 4NQEA 3UBXG 1WBXB 1MJUL 1JTOA 3ULVF 5DUBA 1HYSD 1BFVH 2OJZL 1ZWIB 15C8H 1UJTA 3B9KB 2WQ8A 4Q2ZB 4DCQB 2LU7A 1V7NH 3ARFC 5HGBB 4JN1L 5KVEH 5IBUG 5C9JB 1KT2B 2ORBL 1JF5A 2EXWC 3QISA 3N85L 5EO9B 1IGIL 2X4QB 3RNQA 4OCYH 3O6FC 4L9LB 5FUCC 3TO4A 3OR7A 3VWKD 3KPRE 3O45B 4HMDA 1MCPL 3SKOA 2DTML 3EDDA 3G5XB 1A9BB 1PZ5B 1ZLSL 3BEVA 4LF3A 5D5MF 2FNBA 5D7LE 1OAUL 5EOTB 1GC1H 2NY0C 4CKVX 4LDEB 5CJXA 5J3HD 3MFFB 4PS4H 3BD4A 1T1XB 3DV4A 1F00I 1E4JA 1NSNH 1RMFH 2ZG1A 3H3PL 3BKMH 5FDWB 2QSQA 5F1SA 1UKSA 1P7QB 2H6PB 4OLXH 1F2XK 4DGYL 3LKNB 5M95B 1FNEA 2NXYB 3LN5A 1HEZA 1NMCB 1YEHL 4NM8H 3U2SB 3V7MA 1MCEA 3WJJC 1AQKH 4RAHA 4CGTA 1KCSH 1FNSH 5EUOF 4ODVL 4QT5B 3OKNB 1NUNB 4XP6H 5GGVL 5SWSD 1NPUA 2OK0H 3OAZH 4NC1E 3VFGL 1P4IL 2G75B 2F74B 5CSGA 3ZE1F 4MAYD 3HB3D 1LE5A 3QJFA 4J4PC 4WIQA 5CLTA 2Z31D 3F6LA 2A1WL 3F58H 2R4SH 3ILQC 4RGNE 2J4WH 3QUMA 3HLAA 3MLVH 4QEGA 4G6JL 4JZOA 2FO1A 3BIKA 2VC2L 1WICA 2OP4L 4GMTH 4X0KB 4K8RL 2HKHH 3P0VH 5HI3D 2IMMA 1YC8A 3MV11 4WUKL 4FQHB 4UU9B 2ZKHH 1V5JA 2WMPA 4DCQA 1I8LA 3U1SH 1OGTA 4XTRC 2O5ZH 3D87B 3FB6B 1FIGL 3MLXL 2VAAB 3LS4L 5I66A 4YH6A 3U0PA 1NBYA 4NWUH 1BF2A 4BSWB 3CLEL 4H20H 3O2VH 3BGMA 1K3IA 4CNIA 2JIXD 3DV6A 5GSVB 1KLUA 2XXMB 3TN0A 5D7LB 1FZOA 1YYML 4DUWA 2VLME 3RL1A 1K4DA 2RBLA 5JIPA 5LG1A 4AEIL 4M3JA 1AGCB 4HFUL 5KZCB 2X4RB 4QYOB 1N2RA 3BFOA 5C7XH 2VL5B 3ORJA 4FXKB 5H37H 3EYSL 1BQHG 2MQ0A 5FIEA 1IAIL 1JNNH 5ANMA 5EORL 3MYZA 3EYQD 1XF3A 4KK5C 3QEQE 5FYJU 3U7WH 2DICA 1KN2L 1U8IB 4OCRH 4UIKH 1J0JA 3K2UH 4GKNA 4M9PA 4MLIA 3N1PC 1Q8MA 3KYKL 5IVOA 4IRSC 3MV7D 1FZJB 5IOPA 4R26L 1DLFL 3KPNA 1J8KA 2BCKA 4H1LH 5DMGD 4JM2B 4TPRL 4FQXC 1ZVYA 4G8FB 2AXHA 3OX8A 4BFGA 1F4YH 1LWRA 3QAZC 1KB9K 3P0YL 2OZ4L 1JRHI 5HHVH 5DFVD 1EERB 3BWAB 4BUGA 4I0PA 4RGNB 3EO0B 3DO7A 1K2DA 4JPVL 5F8RC 3QDMA 2APTA 3GIVA 3TBVA 3BKYL 3QNYB 2JJVA 1YY9D 1WT5A 3LKSA 3QXAB 3RRQA 5EBWA 4UUJB 1YJDL 3CX2A 3EZ8A 3UZVB 5BZDB 4JHWH 1T5XB 3SGDH 4M3KB 1MCDA 1RK0B 1V3KA 3ES6A 4Y2DD 1C16A 3MRMA 1JIBA 4AM0A 4AT6B 5C6PB 5DJAA 1A7OH 1S9VB 1I75A 4ZUUA 1MPAL 1YPZF 1VEPA 1JK8B 5HVHC 5I1CH 2A74A 4NO0B 2CRIA 4NQCD 4JFHD 4NUGH 3O6KH 3OKLA 5FV1L 4PR5B 5E6IC 2YD2A 2YUZA 4YEEA 2BOCB 1FFOB 1QO3A 3W0WA 3C6SB 3UMTA 3SE9H 2J2ZA 4PRIB 4XMKH 2HKFH 4R8WH 2X9YA 3QG7L 12E8H 2VIRB 3VXUA 2JCCA 5FCUH 4QYOA 5HY9A 1I9IH 2JCCF 2VL5A 3AMKA 3PJSB 5J13B 1U58A 4W70A 1DBAL 2JF1A 4IOIA 1KTLB 3KWWB 3V8OA 2D7TH 5E56A 3ZT5A 4CDHA 4KWUA 1FHGA 4X6CA 1I3VA 3IDNA 5I1DA 3QEQB 1M05B 1GXEA 2BRRL 2VH5H 3SDCB 1U8OA 4M1CC 3LMJL 3CFCH 4WY7L 3BVNA 5KG9A 2VDLL 4GKZA 3ILPA 5GXBB 1WITA 3GMMA 1D9KA 1S9YB 1Q0XL 5IVXF 3H7BA 1R3IL 1SY6H 1FO0B 2ICWI 3TZVC 5SX4I 3TVMA 3SO3C 1XH3A 1JPGB 1BECA 4AYFA 1N64H 1WZLA 2JJTA 1JN6B 4RNRA 3RTQB 3ULVD 4NQED 3TT3H 3OAUH 5FO8A 1J0KA 4WO4B 4F80A 1PSKH 4BELD 2L0DA 3R8BB 4BYHA 5C8JA 2R0LH 1WTGT 1CDCA 3KNBB 4HUMB 3ROLA 3WCYA 4YFLF 2GSIB 1QRNB 2FIRT 4WI4A 3RDTB 1FSKC 3DVNB 4E41E 4I77L 1BD2E 1JVKA 2H8PB 4H25A 1FGVH 4XCNA 5DD1H 3LPFA 4F3FB 4R0LA 1J1PH 2BNQB 4MQSB 1CXIA 3VD3A 4MXQD 2HJKB 5DD5L 4I2XB 4EJ1C 5FGRA 2BOCA 1ZMYA 1XCTB 3UBXI 3T3ME 4L4JA 4PRIA 2YD6A 3VXSA 2O93L 3L5JA 2DQHH 3HR5B 3I6KB 1AXSB 1WVZA 3FZUC 2VQ1B 4RMVA 3Q3GA 4Z77A 5IIEB 1MRDH 1MIML 4HC1H 1NCTA 3QPQD 1G7JA 4LSSL 2NX5B 2VXVH 8FABA 1KB5H 3D9AL 4NYLB 1BWWA 2A0LD 4OLVL 5T1LB 2VWEC 1X9QA 5J1TC 3A67H 5FHBH 3SKUD 3MRLB 4KRPB 3BPOB 4XWGH 3STBA 4D9RD 5C0CA 1Q94A 4JR9H 2YPVH 5KSAA 2HLAB 3OXRA 1VGKB 4XP5H 2MFNA 3PDDA 4KKLC 3WHE0 1JHTA 4LCIH 4Y16C 3V6FB 1NMBH 4YHPB 1Q9LA 3MRPA 2X44D 2NY7H 1IT9L 3HNSH 2XY1A 4LVOC 3ULUF 1JJUA 3MZTA 4ZODA 4HZLA 2DMCA 5C2BH 5ID0B 4M6MH 2NXZB 5HYEA 3G6DL 1H8OA 1ADQL 4JKMA 4OLZL 4WWKB 5B3NA 3TPUA 1UH4A 3HI6H 2AEPH 5D1QC 3CDGB 4AENB 1BFSA 3FB5B 3QXDA 4LAJH 4R2GB 1IAII 4WTWA 4UILL 1YEJH 5DEFA 3UTQB 2W91A 5EIQA 4E41B 1FBIL 1BD2B 2ARWA 3T0AA 4MZ3A 2GITA 3FCTB 2VO5A 2FX8H 4HWBL 3U30C 4GW4B 1KJ3H 4NJAL 1D6EA 1GL4B 4WI8A 4QWWD 4PB9H 2KKQA 3OZ9L 1RZKH 2AGJH 4I2XA 2P44B 3TN0D 1B88A 4Z7VB 3MR9A 4XXCC 3I9GL 2XKNA 3WHXB 5IR1A 2IALA 3T0XA 2PCPB 1UYWL 4NO3A 1LDPL 2VQ1A 1XT5A 5DHVB 5M94B 3QZWG 1NQBA 4MDJB 5DTFB 3MNWA 4QHKJ 2DI7A 2W60B 1WFUA 4C58B 1OLLA 5FYLD 4MQXD 5E2VL 1NGPL 4XXDA 2ARJA 2G5BB 3VA2C 3O8XC 4MHHG 4EQ2A 1DTUA 1KJ2H 3FONB 5T3ZH 1RFDH 1XFPA 2A6JB 3HAEB 4P9ML 2EO9A 2BRQA 4KKBD 5I15L 1BBJA 4KRNA 4U1HB 4Y4HC 4KMLB 4HQQL 5E8PB 4XNMB 1ZHKB 1NLBL 1UH2A 5CILH 3MV8A 3HUJF 4DGVL 3BYYA 1UEMA 5A16B 4RISH 4ELMB 5KVFL 4DK3A 3MNVA 3D39D 2DJ4A 1MI5A 3PWJB 4MMZC 4XAWL 4K23L 2X4SB 3HI5L 5EA0H 1DVFB 4JFEE 5E4IA 3O9WC 2LTQB 1CG9B 3BO8A 4I0PD 4LPTA 4ZO7A 1N4XL 4FXGB 4NIKB 3LZFH 2ZUUA 3DMMD 2W38A 3GSWB 5CMAB 4PJBA 3QDMD 3GB7A 5AZEL 4HH8A 3LEYL 3EIFA 4Y88A 1DP0A 3C08H 2V5SA 2QQKL 1I7TA 5AD0A 4PJDB 2G9HB 4Z7WF 1IL1B 1TQBC 2WWMC 4XP4H 3VU2A 2GSGB 4LRNH 3WIFB 1INDH 3H0TA 2UWEE 4OF6A 1D5MA 4J6RL 2EKSB 5T1DL 3QRGL 2P8MB 3HZKA 1LP9E 4KHXL 1AD9B 1VFOA 3AY4C 3BZ4B 2KQNA 3W0WD 4HIXL 4PGJA 3RGVA 4HKZA 4R7DB 1ND0B 3BN3B 5DD0H 4UINL 3SKJL 3VXUD 3P9MB 2YA1A 3NZ8B 3WJLA 4N90E 3ULSA 3VGHA 1E0OB 2BJMH 5J7CC 4TUJB 5T33H 4WW2B 4HCRH 2O5XL 3N9GH 3IS0X 4XWOD 5JTWA 5CGTA 2J8UF 4EDWH 1F11B 2XRAH 1MCFA 3O3DA 2QADD 3ARTA 4U2YA 3KPPA 3TH4T 1IZJA 4JFFA 1A7BA 5F7WC 2KQMA 2VISA 4AL8H 1CXFA 3HMXL 2X41A 3NGBC 1CFNA 4F57H 4MJ4A 4H8WC 1MJUH 3LEVL 2ADIB 3NFNB 2R1YA 5INDB 1HH9A 2OJZH 5DJCB 4JEGB 1BZ7A 5TFSL 5DJZB 4KROB 5JW4N 1OSPH 4CMHC 3TVMD 4JN1H 3D85B 3U7AA 4JFEB 3VFPA 3T77B 1UACL 2DJUA 4FXGA 1TZGH 1KSRA 4WHYG 3UYPA 4JREC 4EDXA 5B3JF 5JNYB 5SWQB 3KHQA 4MB5A 4XBPA 3EYVB 1QFHA 3OR6A 4DN4H 5D7JC 1MCPH 2Q6WB 3RWHB 4KFZC 2DTMH 3LRGA 4I5BB 4FA8A 5E8EB 3T0EB 3O2DL 1OAUH 5T3XD 1A6UH 1NGQL 2ADJB 2Y36L 1MLBB 4HK3N 3UTSB 1U8MA 2IQAA 4OV5B 4NQTA 4U1LB 4R97B 3GK8L 5ISZB 3FQWA 3H3PH 4NUJA 5JORB 1LP9B 2F53A 5JW4Q 3DRTB 3GSUB 2H2PC 5K33A 3A6CL 3VXSD 3MYJB 3DETC 5DK2A 1U91B 4KXZH 1MVUA 4DGYH 3EYUH 2CXKA 1LILA 3GKZA 1ZE3C 4O2CA 4OB5H 3EDEA 1YEHH 4ODVH 5HHMB 2VLLB 3FQUB 1FDLL 3H2WA 1OAZL 4K3GA 1JZ7A 3NCEB 1XR9B 3VFGH 3VXME 4ONHA 1P4IH 3RVTD 4PJIF 3BQUC 3O3BA 1GSMA 5C0CD 1IQDB 3UBXB 3R8QA 1T6VN 3C5SB 2A1WH 1OGAA 5KSVA 1CTNA 4LLUA 1FYTD 4G6JH 1SEQH 2VC2H 2WSKA 2D7OA 2OP4H 2OI9C 4CU6A 4E42B 1BVZA 4WUKH 5DJ6A 5DGRA 1AFVL 3EYOB 1A6ZB 3BP7A 3QUYC 1AKJA 5D93B 3DSNA 3R1GL 2OCFD 5FB8B 2ZZUT 2YWZA 2DQJL 1IVLA 4XNZB 4ONGL 4X6DF 1FIGH 4IS6B 1SBSH 4L3EE 2C3VB 1E27A 1V7ML 1JPFB 4PJ9B 3CLEH 3I2CL 3KYMA 1VFBB 1MVFA 3KXFE 3QO1A 3QIWC 4LGRB 4P9HC 2ICWA 4TOYL 4ACPA 3BT2L 3V5DA 1YYMH 4OD1L 6FABL 2AS5M 2FR4B 3U4EB 4F7EA 3ARGC 5KANI 3LPWA 5JLZB 4AEIH 2DF3A 3KJ4B 2YKLL 3UTTA 5F3HB 3CXHK 3WYRA 1AP2A 3TV3L 1CFTB 4L4VD 2MOVA 3AS2A 3EYSH 5IBLC 3A6BL 2J88L 4PGEA 4ORZC 1KN2H 1JZ4A 4XHJD 1Z2KA 4CMMB 3LSOA 4OZGF 1GHFH 5I74B 4HT1L 4WI9A 4ZO6A 3KYKH 3WS3A 2GJ6E 4NBZB 3QEUA 5ADPL 4R26H 3QFJA 1NGWB 3O3AB 1CLZL 1P7KA 1FLTX 5DXWA 1DSFH 5JOPE 3BXNB 1RIHL 4GLRI 4G9FE 1FFNB 3QUXB 5D2LA 3ZE0F 4Y2OA 3G6AA 1HOCA 4YHLH 4P2QE 3V7AG 1J0IA 3G6JA 3JZ7A 3WUWB 2NY4D 5HGAA 3E6FB 4XPTH 5KVGH 4QTHA 5DC9B 4BQBA 3G6JF 2Y23A 3MV8D 3S4SG 4G43A 2VZ1A 4U05A 3U46A 1W0YT 4HS3B 3BKYH 3MACH 4JY4A 2JJSA 5F9WC 3I50L 1EPFA 4N8CH 4UBDC 1UVQB 1YJDH 3UTZB 1BX2A 2ZOKB 1MCQA 3EUUA 3FOMB 4C56E 4TN9A 3V9FA 4N1CA 5L7XL 1RQ5A 3WO3B 1IGCH 4P4KC 3GKWL 4MHHI 4L3EB 1GGCL 1LO5A 2VMFA 4JB9H 4LLQB 2E8YA 4DKAA 4Y1AE 1J0ZA 1MCCA 2PXYC 4HLZH 4GRWE 1I8KB 3MV9B 3KXFB 4PYGA 1HQRA 4W68A 1Z0MA 5K93A 4P2RD 1ZLWH 3PP4L 1DQLL 5L9DL 3C2AH 4PJAA 2WIMA 3IRZA 5E2TH 3SPVB 3TNNA 3E8UL 1EGJL 3QG7H 3T1FA 5SV4A 5CJ5A 1CD1A 4JDTL 1BQHB 4LMQE 4JO4L 4QXTA 1I9RL 2GQHA 4NQVB 3R4DA 2IH1A 3BPCA 3FL7A 1DBAH 1XIWB 5C08A 3QI9B 5JHDD 5JO5A 1UEYA 5HHQB 4RAVA 1C5CH 4Z7OE 4KVNL 4U6HB 1GJIA 5IB3B 3FN0L 3OJDB 2DL9A 4U7SA 1KCKA 3LMJH 4G8GA 3QIBC 1TNMA 4F7PB 1GZQB 3RL2A 3VD5A 4OI8A 3MO1B 2FATL 2NY6B 1EEYA 4WHCA 1Q0XH 5I8KL 1R3IH 3TO2B 4G9FB 3L7FB 4JKWA 4JFFD 4O00A 4XPFH 5EIIA 4MJIA 4KU1A 4MCZB 1UWEL 1F97A 5A2LH 1SBBA 3C60A 5C0ND 2ESVE 3CXDH 5HHXL 5LJYH 5IB5A 1KPRB 3RY5A 2I9TA 3FRUB 4UIMB 5IV2B 3CNKA 3R0NA 3AS1A 5DEGB 2VXTL 3WIHA 4HWZA 1X5FA 2V9QA 1Y0LB 4X7TB 1JNHB 2YR3A 5TH2A 4PJGF 2VKWA 4NCC2 3TA3C 5C0RL 4I77H 4Q6IB 2ED7A 1ZVSA 1VB9A 2VLJB 3PP3K 4AIZA 1G7PA 2GJJA 3GSXA 2A6KB 3TYFA 5L2KE 4YDVB 5F6IC 4ZAKB 3HZMB 4GRWB 1WZ1L 4XVJL 5D1ZB 1KACB 4K3DL 2OSLA 4PLJC 1Q9WB 5BRZB 2BNUA 4MXWL 4WGWB 1WZKA 3H3KA 3V0VA 1S7UA 3O3EA 1QA9B 1TTFA 3D5OF 3VRJA 4KDWA 1UZ6E 4PJ8A 1MIMH 4YK4B 5DMJB 3EW3B 1FV1B 1N0LA 1TZHA 1DQTA 4LSSH 1V05A 2R56H 3VWJB 1RUQH 2F53D 3D9AH 1ZLUH 3D3VE 5EIVA 3WDIA 2OBGA 1SJXA 2RIKA 3PWPE 3TBTA 2XOTA 1F3RB 2NY1D 1AE6L 4MJ6A 1TVHA 3PHQA 2QKIA 5D7KD 5ELIA 3IS1X 1JV5A 3UTPD 3T4AB 1NANH 1RZJL 4OFYD 3D0VB 1FJ1A 4PGZA 4N0YL 1PQZA 4DKFL 5C07E 4D0CA 1IT9H 5ICYB 3HRZB 4EI6B 5T5NF 1BVKA 4JHAL 4FMFA 1AXTL 3VJ6B 3JTTA 5EC1B 4D8PB 1WTLA 2X10A 2ZWLT 4JRYE 1A1NB 1Z3GL 5EULV 2ESVB 3QWOB 2IEPA 1M6OB 1TETL 3CAFA 1AKJD 2XTJE 4HUUA 3ZKQD 4KVCH 1S8DB 2H26B 4X7TA 4OT1L 3NAAL 1BIIB 2IAMC 2V6HA 3JTSB 1QR1A 3L3OB 3JBG7 1F3JA 1AQDB 3BX7C 4G7VL 1FBIH 4LEOB 5IQ9B 2A6KA 3RWGA 4GH7B 3Q5TA 3HZVA 1VKXA 5L2KB 5MHSE 4NJAH 3E0GA 2XN9D 4KI5C 3IJSA 3WLWC 1KUMA 5SWZB 3O4LD 3CMOL 4ZFFA 3MRHB 3IDGA 3C9NB 4DWHA 4XPBH 5EO1B 4R96B 4NHUA 4G3YH 2BVPB 5EU6A 3X12A 3UTOA 1UYWH 4GXUN 1LDPH 1U8PB 3UTTD 1JWMB 1ZTXL 3IDYB 4NPYA 1FV1A 4GKSA 2RFXA 1U6AH 1X6LA 4O58L 4R7NA 3RJQB 4QRTA 1NGPH 1CD0A 2G2RA 2OL3L 1HYSC 2E27L 4O9HL 3P9WB 4NM4L 1T20A 4P9MH 3VFTB 3ZT7A 5C0GA 5I15H 1YEKH 4HQQH 1NBVL 1UENA 3QFJD 4G8EB 4I8DA 3AM8A 3LD8B 4K9EC 5BVJB 4B50A 4P99A 5CBEA 4YHNA 5KVFH 3H8NA 4BZ1H 4Z0XB 5EOCH 4K23H 5EU4A 5FKAB 3VJ6A 5FDYA 4QNPF 5B39G 4D8PA 1NC4A 3HI5H 5EN2A 4XMLH 3GMLA 3FO2B 3H9HB 2BHUA 3MOAH 1W72L 3BJ91 1N4XH 2MHAA 1RY7B 5E6ZA 3BAEL 4XGZB 3G5YB 5LVEA 4UTAL 5AZEH 3SDXB 5J3HC 4K3EL 1HI6A 2ZCLL 1Z0NA 2JB5H 4PGDA 4JJHA 4K94H 4UAOC 2XTJB 2QQKH 2H26A 1EK3A 3ETBF 3F7VA 2ZOLA 5HYSG 4B7IA 3I75B 3RA7L 3E3QC 1AQDA 3T0WA 3HR6A 1U8KB 2O61A 1WBZA 3LVEA 2OMNA 2FWOB 4PJHF 2HN7A 4J6RH 3SKNA 5DF0A 5T1DH 3QRGH 4MXVF 2HH0H 3UJIH 2WUBH 5F1OB 1I4FB 3QZWB 2HJFB 2H32A 5D1XA 4HIXH 3GJEA 4YAQA 1CLCA 2DD8L 4NN5B 4UINH 3TIEB 4P23B 4TUOA 3U6RA 3SKJH 4LLWB 4XBGA 4MAYC 3HB3C 3P9LA 5E8OA 1R5VB 2Z31C 4OUUB 1SQ2N 4GOSA 1GGBH 2VERN 2XPGB 5GZND 5C08D 2O5XH 2DLTA 2YK1L 5HI3C 4U1SA 3ECBB 4GSDL 5IMKA 3U36A 4MQ7A 2QHLA 2EYSB 3ZE2F 2AV7B 3VFTA 2ED8A 2H3NA 4IBLT 4X99B 2HP4A 3MLPA 4G8GD 3ZHDA 2QQNL 3HMXH 4GG6A 3UJJL 1NAKL 3WKML 3FFCB 4GAGL 3LEVH 4EBQL 1SHMA 3P73B 4GG6F 5C71A 1LQSR 4OQ1A 4Z0XA 4DVBB 4L8SB 1BJ1J 1QVOB 5TFSH 5FKAA 5GSRA 3NN8B 4NDMA 1MAJA 3DIFB 2E9JA 2VXUL 4PJCF 4MJID 1S7WB 1MFCH 4AIOA 4PG9B 1UACH 5GS0L 3U4BL 3U7YL 3C60D 1FFPA 4CL7A 5IM7A 5F7KC 1TJHL 5ACLA 1EZVY 4OZFB 4IJ3B 3WE6B 4PV8A 3AS0A 4M8QB 1YY8A 1HSAB 4U3CA 1QQDA 2FYYB 2JJWA 5IT2L 4ODXB 1U93A 3C5JB 1NGQH 2I26N 4I9WE 3DJ9A 2EO1A 2Y36H 4XCYA 4U1NB 3SGJC 5GGSB 2AJUL 3EYQC 3GSNA 1FVCB 5FV2A 4HAFA 1N0XL 4W4NA 2EDJA 3GK8H 3UO1L 1JWSB 4MDIA 2J1KA 4ZXBD 3GMQB 2GCYB 3B3IB 3A6CH 3VGAC 2VLRA 4LU5L 5DMGC 3EO9L 3CPLA 5ERWB 5EFIB 5FHAL 5J11B 1KG0B 4PJ8D 3J8F7 2A6DA 4D0DA 2EYTA 3HZYB 5HPOA 2I9LB 4LCCB 1G1CA 5DFVC 4Y4FB 2YN3A 3IB4A 2HRPL 1FRGH 3REVA 3NH7H 1OAZH 4KAQL 5DK3A 3GI8L 3NIFF 3SE4C 3ALPA 2WWKO 4JAMB 5MEPA 1YY9C 4YXKL 2JJUA 1RHFA 5DRNA 3MLRL 1IJ9A 1A6AB 1X7QA 2DM3A 3L3KA 1PGRB 4CDGC 3MC0A 1MHHB 3MPCA 5ETUA 4M02A 4JPIA 4S10A 2HAZA 5GGVY 4HXBL 5ESVB 3L3HA 4U1JB 4HIHA 4Q97A 4M6AA 1AFVH 3DUUB 4WHYH 3F65A 3R1GH 1YNLH 2W9LA 2DQJH 5F89B 4XBEH 5LXGH 3HE6D 2YSSB 4XAKE 7CGTA 1KJVB 2BY0A 4LFHG 3WN5C 4UB0L 4MJ5B 3RAJH 2DM2A 1V7MH 1RZGB 5D2NE 1RJZB 3DXAA 4M8QA 4OLUH 3I2CH 5JXAH 1FC1A 3SN6N 1NAMH 4PGCB 5EU7C 4TOYH 4LGSB 1QEWB 1PZUB 3BT2H 5CBAB 5HYJE 4OD1H 6FABH 1QSEB 3F7PC 2XT1B 5E5MA 2WBJA 1YEFL 5EZOH 5K59E 2EC9T 2YKLH 5C1MB 4RWYL 1UJ3C 2OTUA 4WNQB 2JLLA 2Q7YA 1TQCC 4FOMA 3F8UB 5HPMA 1YUHA 3RNKB 1JZ5A 4HX1B 5IB4A 4G80B 3MJ9H 5EU6D 3SGKC 4JJ5A 3JWDH 4Y4KD 3QHFL 1I1AC 4L8CA 1S3KH 2BNRB 4P2CG 2Z92A 4LSVL 4QGTA 4HT1H 4WDIA 3DARA 1KTKE 3S37H 4GW1B 5ADPH 1B6DA 1RHHB 3MRNA 4M03A 4CU7A 1XGQB 3V7AE 1CLZH 1MJJA 3PABA 1OLZA 1RZ8A 5ECJE 3SDYL 4GG8B 1IGTB 3KPRA 1RIHH 3C09B 1DUYA 1QHOA 2DWDB 3MV01 1UWGL 4LHUG 2EYRA 1R6VA 1J05B 1CICB 3VI3E 3BWUC 2XZQL 4TVPD 3PV6B 3GGWA 4PJ7E 5I1LA 4QOKE 3K2MC 4XNUH 3HC3L 4HWNA 4M6NL 1NC4D 1X6NA 2DKUA 4DVRL 3ARBB 3I50H 5I8OL 4DZBB 5ICXA 5ACMA 1Z9OA 4MXQC 2CO6B 5L7XH 4N8VA 5DUML 5J9PA 5CJXC 1S5HB 5F7MC 1GGCH 3CUPB 2GTWB 2PW2B 4KDVA 5F96L 5D2NB 3LQMA 4D0BB 1BQUA 3SY0A 4JN2B 3SCMB 4U6VL 5KN5A 3INUL 2PTUA 3OJVC 3QPQC 2W1NA 5D6CB 5BXFA 4PGCA 5BJTA 2YD5A 5FGBA 4H1LA 3PP4H 1DQLH 2A0LC 3JXAA 1BQSA 4I13B 5HYJB 5EU5A 2CDFB 1QBLH 5C0FA 1EGJH 1T4KA 1T1ZA 4ZPVB 5C0IA 5H94A 4MNGE 3ARFB 5IB2A 4PG2A 3PQYE 1VCAA 2AK4B 4CAGA 3ZKMD 1CFVL 3GSOB 1WC7B 5JOFA 3VFRB 3RNKA 2VXQL 5D1XD 4AG4L 3O6FB 3JWOH 3GBNL 1HWGB 4WU7B 5BQ7B 2H45A 1CE6A 3DX8A 1SJEA 2CR3A 1H15A 5DJ0B 3VXOB 3WFCH 4OF7A 4DGIH 4GW1A 3WFHB 3G9AB 1RVFL 2NY0B 2PYEA 1WISA 3GNML 4X98A 5BV7L 5F3BB 5HVWA 5CEYA 2CK0L 2F8OA 2FATH 3L3IB 1H3PH 5SX5H 5I8KH 2FHBA 3DUSA 2DIBA 3QEHB 3S4SB 1I8LC 2ITCB 2FHCA 5DT1L 5J06A 2ATPB 2EC9U 3AAZA 1AGBB 4WTXA 3VFMB 1YEDA 4LLYA 4QRRA 4PJ7B 5HHXH 1HH6B 4HS6A 4QOKB 1AGEB 1A47A 2B7DT 4XC3L 2VXTH 4H5SB 4EUPG 3MBED 4PJXA 3KR3L 3RWEA 4QWWC 1YQVH 1T22A 5BS0A 5C0RH 1Z9SA 3NIGE 5FYKL 1N3NA 3TN0C 4JANA 3QQ4B 4LKCA 3DVFA 4M61B 2X4UA 3FHQA 3TCLB 3BRDA 4DQOH 3SKMA 3OKOB 4DN3H 3BP6B 1XGPB 1A64A 4OF8A 4BH7B 1X44A 1WZ1H 1OOAA 2CKBL 2IPKB 4K3DH 5TDNB 3MLSL 4G6FD 3K1KC 4MQXC 2EDEA 3T09A 5CS7A 3VE0A 2EIEA 1QFWM 1I3GH 3Q6FA 4MXWH 1G7IA 1SY6A 3S5LB 3K7UA 4EI5A 2PR4H 1ORQA 2LV4A 4ALAL 1R3LB 3GHBH 4MNGB 1UH3A 4KKBC 3UPRA 4Y89A 5F72S 1JNLL 5IROA 4Z78B 4PJ5B 2N56A 4NSKA 3VXRA 2VLRD 2VL4A 4KKNA 3CZFA 4J8RB 3TF7C 4RZCB 3HC4H 5IHUL 3VXTB 2F8XC 1U8JB 4YZFF 4I0PC 4FQQB 4DTGH 2DQIL 5D4QA 1RZJH 4FZ8H 1DUZB 1UWXK 3DMMC 1XR8B 5DHYA 4N0YH 1T21A 3HE7A 2BY2A 4QRPE 4DKFH 4HW6A 2GT9B 3I6GB 3BP4A 1JGEB 4JHAH 2Q86B 1T0MA 2ITCA 1WT5C 4FP8L 3V8CA 1R24A 3DVGB 4NRZA 4PJEB 1ZKAA 3TBWB 1A6TA 2CRYA 1U0QA 2H9GA 1NGZB 5IW1B 3IFNH 1TETH 5DDHA 2NY5C 3MRRB 4XVTL 3MRBA 3OKEA 4HC1A 1Y6MR 4LIQL 4NKOB 5C0AE 3JWNC 2GTZB 3STZB 35C8L 4OT1H 4PB0L 1KB5A 4IRSB 3WEXA 3MRCA 2E9BA 3CFKA 3JV6A 2LABA 4HUXB 3BH8B 2P45B 1MFAH 3S88H 5IMMA 1UQSA 4RFNC 4FQXB 2NXYD 4GBXA 3WXWH 4NRYB 5A2JH 3DXAD 3QAZB 1RPQA 5DVKA 3DRQB 4C83B 4X5WA 3GBLA 1MHEA 4M6OL 3H9SE 1IEAB 3L5WA 2WBJD 1JF1B 3BH9B 3QH3B 4XWOC 3AVEA 2UYLA 1S9XA 1TVDA 5E95B 1ZTXH 3HKFA 2ZP0T 4NT6B 2QADC 3CDCA 2ZUTA 2XWJA 4LLAA 2P42B 2V7NB 3EFDL 4O58H 1HIML 4Q74A 4B53A 2ERJC 3P2TA 1OP9A 1F4HA 3E2HC 2CD0A 2OL3B 5M7QA 2FLBT 2VR9A 2HA1A 3FO1A 4WUUE 1D9KC 4TSBL 5E8NA 3VCLA 1GZPB 4NM4H 2XWBA 5HVHB 4U6YB 1U8JA 3CU7A 4TULH 3TVMC 2ZUXA 5E6IB 2JJTC 1NBVH 3OB8A 3MRDB 3MJ7B 5BMFL 5IMOA 2EEBA 2JB6A 2P8LA 2R2EA 3SDDA 3DUHA 5ITFB 1QP1A 3KPRD 4QRPB 1QFUH 1DBBH 4JZNB 3IXTB 3GUTB 1W72B 3DURB 5D7LD 1H3WM 1YECH 1BFOA 2AJSL 3IDXL 3BAEH 4WEBL 2X7LA 4NO2A 4Z7VF 1GGTA 1H5BA 3T3MF 4FHBD 4K3EH 2QSCL 3EOBA 3PHOA 2ZCLH 4R0LC 1N8ZA 2D7MA 1Q72L 5C0AB 3FO9B 2NNAA 1F6LL 4JFQB 2ATKB 5CD3A 1KF9B 1KJ2A 2EIZA 3RA7H 4UV7H 5KSBE 4LK4A 4MNQE 3WS6A 5F7DB 1HYRC 1UM5L 5JPNB 1C08A 4KV5F 4LVNC 1DFBL 5TJWK 1T1YB 4TNWK 3TZVB 5F1IA 1KYOJ 3SO3B 3RWJA 1JGLL 3MQIA 2A83A 2APBA 2J8HA 1I1YA 4N0UA 5D72L 3FAXA 43CAB 1OPGH 1SYSB 3MLZL 3RVTC 5BOPA 5TF0A 4EN3B 1P1ZB 2P24B 3VFNA 2YD9A 5KSAC 4LCYA 4NT6A 4RGND 4D9QE 2ZSVA 2CQVA 1HDMA 5LKNA 4ETQB 1TITA 1G6VK 1G7LA 2Y07L 5I1EL 4YPJA 1TTGA 2YK1H 1S7SA 1ZEAL 4GSDH 5HDQH 2VE6A 4N5ED 1NUGA 4WUUB 1T7ZA 4NQDE 4O51A 5EZLB 2CLZB 3M1BB 3W5MA 3S36X 4PTTB 4WVRA 5ID1B 2QQNH 3D2UA 2VABB 5D9SB 1S7QB 3UJJH 1J0HA 1G1YA 2DMKA 1NAKH 1NJ9B 3WKMH 5B39B 1EDQA 2JELL 2X4PA 3GSVA 1G6RL 2EDLA 3NCYP 4HH9A 2KZWA 1MFNA 3RPIB 1A3LL 1G9MH 2VXUH 4WHTB 2IH3B 5GS0H 4QRRD 4PRBB 3FT2A 2WINB 1YEGL 2R0KL 2VLMD 3KYOA 1EUUA 1OD7A 1L7TL 3U0WL 5GISL 1LNUA 5HYSB 2X1OA 4YPGA 2FJGA 2UZYB 1KCVH 5CSZB 4OKVB 2EECA 2Q8AL 5I17B 4Y16B 2X4OB 3S96B 4HCRA 4LQFH 5BS0D 3FO0H 5CAYB 1FG2B 5TDPA 5IT2H 1A6WH 3MRFB 4WW2F 4KTYA 1BBDL 3K80A 3QEQD 4ZOCA 2AJUH 1TMCB 5GGRB 4LVOB 5CZKA 4HULB 1N0XH 4XHJC 1GAFL 3T3PE 5JZ7D 1QUNA 3HCVA 2GY5A 1LO4L 3VGFA 2VJXA 2IPUK 4J3OC 5IWLA 5TE4H 2BVOA 4LU5H 4OIBA 1EBPA 3IU4L 3EO9H 4EI5D 1INEL 4XNQB 3FMGL 5FHAH 3NFPB 1TLKA 4FZEH 3UX9B 2BVQB 5D1QB 3Q1SL 4CADA 2OQJB 3BE1H 2FX9H 3ZL4H 3RTQD 5K9OA 1SJHB 4RAUA 4QHUA 4ETQA 2NY4C 3LEXA 3LKOB 2Z91B 3JV4A 4KAQH 3DX6A 3E6HA 3G04A 3H7LA 4QRQB 3U9PL 3VXRD 1JMXA 5F9JA 1KPUA 3GI8H 5EU3B 3HNVH 4MA8L 3U30B 1NDGB 1G0DA 1HHHA 2FGZA 3CU1A 4YXKH 4DFHA 5IESL 4C59B 4NQDB 3MLRH 3RDTD 1KXVC 2KPNA 1JZ2A 4A6YL 4Q6YA 3MCKB 4LSQL 5IJVB 4HXBH 4X4ZA 4LEXL 4D9LL 3HE7D 1YMME 2UWEA 4Z7UA 3IVKB 3LDBB 5F88A 4OCNC 1AGDB 2Z93B 1IBGH 3VRIB 3FQXA 1LP9F 3NIDE 3O8XB 1L9NA 4P2OA 4UB0H 1HHGA 4HKXA 2UUDK 2DAVA 3W9EA 3CFJA 3PGDB 5F9AC 1E28A 2M8XA 4UTBL 1EH9A 1CF8L 4JRXA 4NRXB 4Y4HB 3QDGA 5E1AB 3FQTA 5DQDL 4X9BA 3PIQA 3EJYD 4K9EL 3BHBA 4RA0C 1IQWL 2HFTA 3RGVC 5J12C 4GBXD 1Z5LB 3THML 1RZIB 1S7XB 2W65A 1DEDA 4RWYH 3WJLC 3MLYL 5C0EB 3O9WB 1CXHA 1Y18B 2AXGA 1U3HD 4JFOB 1CD8A 1Q0YL 3ZSSA 5J6GB 2A2QT 1AGFB 1TJGL 1UG9A 2RGSA 4YJZL 2CR6A 4XNXL 4LQ1A 5JOEA 5FOBB 5FM5M 1LE9A 4O5LL 1FN4A 1FE8H 2FDBP 4RDQG 3MJGX 1J1OL 4LSVH 4OI7A 1UKTA 4LHJB 1TQBB 5JA9A 5F93C 2Y7QA 2DI9A 1DQDL 2X70B 5C0NC 4LP5A 1A4JA 4HIJB 4ZUWB 4WWKD 3QXTA 3SDYH 1HQ4A 5J8OA 1KNOB 3NACL 1UWGH 1FNGB 2R39A 5AYUH 1MLCB 1OAKL 5DSCA 2OXGA 3MLTB 1V8HA 3V0AC 3MCKA 3LRSA 5FECA 2XZQH 2G60H 2AI0H 5EC2B 3SDDD 3B9AA 1ACYH 2F54E 3B6SA 3V5KB 3S36L 3BZFA 5MENB 5CWSB 1J86A 3HC3H 5GS1A 5IEKB 2E3VA 4M6NH 4PJFE 2CLRA 1SYVA 4DVRH 5I8OH 1QG3A 5HGHA 1NFIB 5FYKE 5L2JB 5FUZL 2YMXL 2MMXA 5DUMH 2VOTA 1S7VB 3KAAA 2GW5A 3CVHH 1JWUA 1REIA 3QCVL 1X5XA 1M7IB 5F96H 1PLGL 2I27N 3SQOL 2B4CL 5DJ8A 5B22A 4UQ3B 5IKCB 1OVZA 4U6VH 4I48A 5E1AA 3NGBB 2HFGL 5T3ZD 3ZKSD 2JKXA 5HHNB 3VXMA 3TPKA 5L0QC 1K3ZA 1R3JB 4LOUD 2D0FA 4JQXC 1MCJA 2NY1C 5JUEL 3ZYZA 4CMHB 2OS7A 5C0EA 4QHMA 4NKDA 1FZMB 4OCXL 1JGDB 1DN2A 1OTUD 1J11A 1CFVH 1UB6A 4LCWE 4F9PA 4JREB 2VXQH 4DJMA 1FAKT 1U41A 2CMRH 3QDJE 4XH2A 4G6KL 3RIFK 1NEZA 4NKQB 3ULUH 5DUPL 4LPUA 3MA9L 3QQNA 5D7JB 4BSVA 4L8BA 5JMRA 5C6WH 3KGRA 4HK3J 3FB7A 4O2FB 5I1GL 1RVFH 5FA3B 3GNMH 5BV7H 4LVHC 2CK0H 5EBGA 4CVXA 1NMAL 1QZ1A 4OAWA 1AH1A 2GIYA 3DWTA 4XP1L 1MLCA 5DT1H 1FH5L 25C8L 3D2UD 1EVUA 5LBSH 3VGEA 3V6BR 4APQA 1CD9B 1FL6A 3LY6A 5F6HI 3CSBA 2QR0B 2X9WA 3EOYG 5HHOA 5TDOA 4DAGL 5MENA 4PRHB 5JDSA 4LIQE 2J5LC 4XC3H 3DX9A 4PD4J 3QULB 3KR3H 3ARDA 1CL7L 5FFLA 2R69L 5EBMA 1EAPB 1RIVH 1BZQK 1PY4A 5FYKH 4HHAA 1QLFA 1H3GA 1KPVB 1H3VA 2XA8L 4OF0A 1C7SA 3VFVA 2B1HL 3BQUB 4ZUTA 3VXNB 2I24N 1MCLA 4KJYB 5KS9B 2GJ6A 2CKBH 4HUWA 3RHWK 4M7ZC 3L9RB 5GZOD 1CGSL 1PKOA 3W82A 3X14A 2OI9B 2C4XA 2YXFA 3HG1E 4FXLA 4GMSL 2P5WE 4BKLB 1OTTD 4ALAH 5C3TA 4JVPA 2FO4B 4P2QA 1ZT7A 3MREB 1I1RA 3L1OL 3DTXB 3MRJA 4X6BA 1IM9A 2UZXB 4RQQA 5JQHC 1CBVL 5C2UB 4NNXB 1LEIB 4NQUA 4ZS6D 2XFXB 3QDJB 4P5TA 1YNTB 1AO7E 3QFDB 4JHZA 3T0DA 1KC5L 3OMZA 4MD0B 5IHUH 1VEMA 1QSFE 1MAML 5ACZA 3QIWB 4C56A 2DQIH 4QO1A 2FD6H 3X13A 3O41B 4JFPA 1XF4B 1E4XL 3ARGB 3PDOB 3UEZA 3D18B 1KFAL 4Y1AA 3ZYIA 3VFSB 2JJSC 3T0BA 3MODL 3OKMA 4GRWF 5HGDB 1IARB 2AJZB 4PREB 1EO5A 5F1NA 4EUPH 3D25B 5GGTH 4PRPA 3QIUA 2X4TA 3QP3A 4R3SA 4N8PA 1IAKA 2WBKA 4XVTH 4LIQH 5FA4B 4PP2B 2YPLE 2O5YL 3QUKB 2FX7L 4PB0H 2DLFH 2C3GA 3TM6A 1EAPA 4R90H 2FECL 5IP4A 3ZKND 2VXSH 1RJLA 4KMTL 4P2OD 5JDJA 1D6VL 1A7QH 4KZDL 3L3GB 4FFWD 1R5WA 1HCFX 4V2CB 2DDQH 2ZUYA 4Z7OF 2EDOA 4JRXD 1UXWB 4LAQH 3GMPB 1ULVA 2PTTB 3BJLA 3L7EB 4M6OH 1NCWL 4QF1B 5GZNC 2R0ZL 1TCRB 5LAXA 1FFQA 4CW1A 1IGFL 3IGAB 3HG1B 3QUYA 1YMHB 2AKRA 4RWHA 2R0WL 4G6ML 3DLQR 2ADGB 3DYOA 2DI8A 5IFJA 5D7IE 1HIMH 4ZSOB 5E9DA 1F58H 1KEGH 4FABL 3PWNA 3OHXA 3X11A 4P4KB 1G7QB 3BPLC 3NTCL 4ODUA 3WDHA 1A8JH 2SEBA 5CD5D 1HHIB 4TSBH 3STLA 4ZUSB 2PXYB 4HJ0D 4X6DE 1VADA 3OV6A 4H0GA 1NCAL 5KAQG 3B8SA 5IMLA 5CHNA 1IZKA 1QSFB 4HF5L 4Y19E 2RR3A 4NKMA 5IF0A 3DSFL 3C60C 5BMFH 5JPMA 1I1CA 4PJ9D 4U0RC 5ESQB 3T08A 3ARGA 5L8LB 3PUCA 4ELKA 1XGUB 3QJHB 1KLGA 5BCAA 1F4XL 1DN0B 5J1AB 3RKPA 3GM0A 1INQB 1F4WL 1NLDL 5E00B 2WP3T 1M1SA 2AJSH 4M7LH 4N1EA 1XMWA 4WWID 3D25A 2VDPH 2BSRB 3BRFA 1C5DA 1WCQA 3LCYA 2GKIA 4FTVE 4B0MM 1KIQA 3LKRA 3BIBX 5FA4A 1CT8B 2V17L 1W0VB 5E08H 1OM3H 1Q72H 1ZT4B 5D71L 3BW9B 5L88L 4M4PA 3A0OA 4ZDHA 1UZ6F 1GOFA 2BC4A 4MA3B 3QIBB 4ISVB 2IPUG 3N1MC 4ZXBC 5GHWL 3BDYH 3D3VA 3HMWH 2C7UB 4L4TE 3PWPA 3QWRA 4PY8I 1UM5H 4NC0B 4OZGE 1A22B 1DFBH 3B43A 4PJ8C 5TQ0H 2E7CA 4LCUB 3RVVD 4L3CB 4KC3B 4UOW0 3SJVE 1VESA 2K1MA 4UI2A 3VXMD 1TCRA 5C07A 3HS0B 3MLZH 5DZLA 1DZBA 1N59B 3C8KA 4OJFL 1F02I 4JRYA 3MRKB 3VW3L 4YO0B 5D7IB 4N9GB 4Z8FL 1KIPB 3TA3B 1CI5A 2Y07H 3NCMA 4LBEB 1S7RB 4WV1B 3SDXF 3FOLB 1ED3B 3RX7A 1HHIA 1RD6A 5F6IB 2PXYA 4NZTH 2X1PA 5CP3H 1CGTA 4JPWL 5IGXL 5IEHB 3D69B 4JFDA 4Y19B 5DURD 1S7TB 3HPLB 1UC6A 3WXVL 4XCEA 1A14H 2XZAL 3C6LA 1QKZH 2JELH 1H0DB 4GUPA 1G6RB 1G6RH 1NFDE 1IMHC 5C0DB 1I1FB 5J1AA 3CSGA 4YBQD 3SGEI 5DRXB 1U8LB 1BOYA 3K0WA 4K7FA 2X4NB 4APQD 3EAKA 1K5NB 1A2YA 3R06A 2R0KH 2Z8VC 4ZNCD 1L7TH 3U0WH 3LQAH 3MUZ1 4TSAL 5GISH 1BF8A 5DK0A 3V0WH 1Q9OA 1AR1D 4FTVB 1IEBB 1CDGA 1MFBL 1W0VA 4TVSa 3ARDD 2XKUA 1ZS8B 3Q48A 3GHEL 2IQ9L 1HHKA 1KJMB 4F8TA 3UZEA 1HILB 4ZYKB 2D03L 4PTUB 2Y5EA 1P4LA 3BI9X 2C7UA 4X9IA 5ALBL 3UP1A 1CCZA 1VFAA 1BBDH 3UYOD 2CRMA 4JDZA 1BVLA 4Y4KC 1NBZB 4ORGA 1U95B 3RX8A 5DRWA 1GAFH 3S35X 1A1OB 2GJ6D 4DZ8B 3HMXA 1FFRA 5F70A 1E4XI 5C0JA 2AJ3B 1CFSB 4WU5A 5L8JB 1LO4H 1N6UA 1QRKA 3OAYK 4PP1D 5JOPD 3IU4H 2AJYL 1B0RB 4G9FD 3FMGH 3B2VL 2NY5L 3IXAB 5HYIA 3Q1SH 4P2QD 5GGRY 5GS2H 2IAMB 5I2IB 4V1DB 2X42A 4NCC1 4H88L 1JTTA 1J8HA 4FQJL 3ALXA 5HYQB 1ED3A 4MA8H 4P5TD 3WMSA 5DJXA 4MSWA 3MGAA 5AUMB 1KTRL 3TESA 1JI1A 3KDMB 4A6YB 4C56D 4A6YH 3GMNB 5SWSE 1B0GB 3WNOA 4LSQH 1FL3B 5CP7A 3PWLA 4M7KH 4QRSA 2B0SL 4LEXH 4D9LH 1XAUA 2YC1B 2HVKB 4KPHL 4XRCB 4Y1AD 3IFOA 5CJQH 4WHDA 3DBXB 5F44A 1CU4H 2ICES 3KLSA 4R6UA 5EDXA 4JKPL 1G0XA 1NFDB 5D1ZD 2NLJB 1T1WA 4DOHE 3MFGB 2WIIA 5BZWB 4OLEA 4PRPD 3QIUD 4HKJA 4OCWL 2VAJA 3NPZB 5IW6B 1FVDA 4YLQT 2R2HA 4UTBH 4BM7A 4MVBD 1OP5H 1CF8H 5E99L 1CDIA 4JG0L 3P4OB 1IKNC 3O11B 1MCWW 3ZKMC 5IHLB 1JZ6A 4EVNA 5I18L 3M17A 1MH5B 2E9IA 1N5AB 1IAMA 3EJJX 5D1XC 1M71B 4YNYA 2NW2B 2IFGA 3REWA 2A73B 4E5XA 1MHCA 4GRLA 4UDUA 3LQZA 1UKQA 4KJQD 3MLYH 1KCLA 3MRIB 1WFTA 5DD3L 4UV4L 1Q0YH 2VITB 3VDCA 1B4JL 1S9WA 3JSSA 1CIDA 4FFZL 3FFDB 4XNXH 3L95B 4UAOB 2B5IC 2HVJB 3K4ZA 2Z4QB 1QLRA 3TYGH 4NZJA 1HXYA 4X6EA 5E9DD 3KLHD 1DQDH 2K9UA 1OSZA 3F5WB 5HJ3B 2V5YA 4PRAA 3TNMB 1BQLH 4R4BA 2P7TB 3NACH 1DDHA 1NAMA 1OAKH 2X2YA 1KB9J 5IW3A 3L5IA 3OB0K 2F5AL 5H2BA 4OD2A 5SWSB 1F6AA 1WCBB 4HSQA 1DEEB 2Q1EA 5D8JL 2HTLD 4FFVD 3GSRA 4NGHL 4GRMA 4Q9BA 4MAYB 1KIUA 2DLGA 5IUSA 2Z31B 4YBLC 3BMVA 4LLDB 5CJ8A 5EBLA 3NPSC 3PWUA 4JY6B 3CVIL 4ZNEA 5BZWA 4DOHB 4I18A 2YWYA 32C2A 3MJ9A 2YMXH 5FUZH 3CDFA 4HV8B 3BPNC 5E0QA 2PW1A 3BZDA 2FJHB 3MUJA 4OZHE 2FSEA 1FO0L 1PLGH 3SQOH 3BP5B 2B4CH 3WLBB 3FQRA 3V4PL 1HSBA 1D5XA 1I7ZA 2D9CA 3FTGB 1EHXA 2B39A 2HFGH 3D3VD 1KELL 4X4XA 3PWPD 3QWRD 1B0WA 3CFDA 3LS5H 4LSPL 3N1GC 2VQTA 3VWKA 3UDWC 3OXSB 5TE6L 2IANE 5JUEH 2QQLL 5E5UB 1Y6NR 1U8HB 5JIIA 3WSQL 2DBLH 4NQCE 4JFHE 4OZIA 2FL5A 4LLMA 1T83A 2JIXB 3KPOA 4YQXL 5KSUB 4PLNC 1OWRM 3S35L 5CGYD 5C07D 5DRZB 3W39A 4HS8L 5GRVK 3GMRA 5B38A 4C55A 5C3LD 4I3SL 5E70A 3DO3A 5C09A 3MA9H 4J3XA 2NY3D 4JRYD 2VZVA 1NCBH 4YDKL 2DQEL 2XNAA 5EU7E 1GC1C 3IDMA 5I1GH 4ODHH 4OQTL 2W0FA 4JCMA 1NGYA 1O0VA 1I8MB 2XTJD 3BN9D 3P4LA 4X4ME 5IVZB 3EFFA 1B4RA 4KK6D 5T1KA 1YN6B 4J7RA 4YGVA 4XP1H 4GAYA 4JFDD 1WK0A 3QCTH 4FQCL 3MV7B 4K07A 2EZ0D 4HWUA 1J7VR 3ZO0A 1XGRA 3VH8B 3KPSE 3RQ3A 3T65A 3C6LD 3VGAB 4PJHE 1EGJA 4G7YH 5DMIL 4P5MB 4DAGH 2BHYA 3PWVA 1ONQA 2CIIB 2QJDA 2Z31A 2YEZB 4LLDA 1CL7H 3DGGB 4Z76B 2R69H 3HAEG 2DWEA 3V5HB 1YC7A 1X4YA 3S7GA 4NKIH 2XA8H 3HN3A 4MNHA 2WBJC 2B1HH 4FRWA 4DUVA 3KPLB 4PFEA 5FO9B 4HUVA 1FVEA 1M7DB 3VFOB 3KLAA 3RUGA 5KJRH 1CGSH 3GM8A 3MRGA 5ITBH 1YN7A 3TBSB 3WL9B 4GMSH 2OTWB 1UWXH 4YUEL 3LN4B 4AQ1B 2Y25A 1EV2E 2HTKD 4NQCB 3L1OH 5FO7A 2NY2D 3P4NB 4JHBA 1CBVH 4IIQA 5DQ9B 1KEML 3WN5B 1TVBA 4OGXL 4PJ7F 2W9EL 2GI7A 3BDBA 3O6LL 1VPOL 1XEDA 1I7UA 1KC5H 2H41A 3G08B 1K8IB 2Y5TA 1MAMH 1MCKA 1NH6A 1HINH 1QTYT 2YPKA 4OD3H 4YHIB 2AQ3A 1IC4L 2DN7A 3FB8B 1J8HD 1I85A 2EKJA 1C12A 3AU1B 3CC5B 2P5EE 1UJ3B 2Z35A 4M5YL 1CFQA 3RWDB 1TQCB 5TGBA 1B3JA 3VXPB 2GHWB 1MRCL 4HWEL 1MWAB 1CGVA 4YFLI 2WAHA 3FKUS 2BSTB 4OZ4B 2YRZA 4QCIB 2F9BT 3RWIB 3ZYJA 3GRWH 1I1AB 2AEIT 2FCBA 1L6XA 3PQYA 4JZJA 5EPMA 2QSVA 4IDJL 2FX7H 1LEGA 4OF5A 4BFIB 3LKPB 5GRYA 3MNZA 4NQEB 4NC1C 5FGBC 4X9HA 4KMTH 3MA7A 3O6ML 5DUBB 4KTEH 4IHOA 4Z9KB 1ZV5A 2DQFA 4PG2C 3ZKXC 3RY6A 4HEME 1M7DA 1LD9A 2E7HA 43C9A 2HG5A 4Y2DA 1NCWH 4XMPL 5K9JL 3RNQB 3RWFA 2OTWA 3TO4B 3OR7B 4GRLD 4E0RA 2R0WH 4N5EC 3OF6D 3MLUL 2D9QB 3SKOB 3RI5K 5D5MB 1EAJA 4LARL 3L5XL 5F9DC 4GAJL 1A7PH 3BEVB 4LF3B 1F2QA 1B90A 4PJEF 2XICA 4JVWA 2YN5A 3MXWL 3NTCH 3DNKA 1TIUA 3KPTA 1OW0A 5GGQL 2XTLA 3DV4B 4P57A 5I76A 2VLKA 4KUZL 4OFDA 1NCAH 2NW3A 2P8PA 4HF5H 1EO8H 5ENWA 1KGCE 1MEXH 3DSFH 4YR6B 2L4OA 1NCDL 5ANME 3GIZH 1MCOL 4WV1A 3AU1A 1OCWH 4TTDD 4JKKA 4WEUD 4ZPTA 1FNEB 4X7SL 3LN5B 4WCYL 1HEZB 4RFEA 4PRNA 2D3VA 1IM3A 2F58L 1BJ1H 1F4XH 1IGML 2PO6A 4ETYA 4ZS7H 1F4WH 3T2OA 1NLDH 4KHTL 5I1KL 3P40A 2VDOL 1EVTC 4MX7A 4I9WD 4PRDA 1LEKA 2PYFA 3GJFH 4O02L 1LE5B 2V9RA 1RZFL 3QJFB 4RIRA 4U0QB 4N0FA 3UROR 3JV5A 2V17H 3IF1A 4PYHA 5D71H 5L88H 5JZ7C 3T4YA 3VFUA 3QUMB 4O2EA 3HLAB 1A6PA 1UT9A 4JZOB 3BIKB 1ODAA 5GHWH 4F7MA 2V2XA 1FORH 4J1UA 2A9NH 4EI5C 1AI1L 2IG2L 2C3XA 1OGTB 3CZJA 4WFHE 2Y6SD 5IROC 5I66B 3VD9A 2HFFA 3U0PB 1NBYB 3VXQA 1PW3A 1NC2A 1EHLL 5TF1L 1ES0A 3AMLA 2X05A 1EMTL 4OJFH 3BGMB 5CZXD 5D5MA 4CRPA 4DKDC 1DLHA 3ALWA 3VW3H 3RDTC 4Z8FH 4CNIB 2EH8L 4M43H 3V79C 1RUKL 4L8DA 3DV6B 1DQQA 1KLUB 3TN0B 1FZOB 4HDIA 4AH2A 3W0WE 1MELA 3QHZH 3OKDA 3RL1B 1K4DB 5B8CA 5FKPA 3HE7C 3LB6D 3CSYA 3IDIA 4EKXA 2X1QA 4QHKI 5C09D 2M26A 3I84A 1QFWI 2EDYA 1N2RB 5IGXH 4XAKD 5LGJA 4NC2B 3GFUA 2OX5A 1GIGL 2OR8A 4YR6A 1QPXA 1VGEH 5E2UH 5GS3A 1FL5A 5ANMB 2FJFA 1XF3B 3U48A 1AC6A 5EUOA 5T1KD 4GKNB 4G8IB 2DQCL 4MD4A 3IKKA 5IOPB 5HYJD 3KPNB 1BGXL 2Z0BA 4NZRH 3H9SA 3SE3A 3EJYC 2BCKB 4TSAH 4GBXC 2AV1A 3S34L 3EO1A 3OX8B 1KTDA 1MFBH 4EOWL 1WZMA 4HJGA 3GHEH 2IQ9H 4I0PB 5KW9L 5T5FL 3DO7B 1U3HC 1K2DB 2D03H 4BZ2L 5ALBH 3QDMB 1C1EH 4QHNA 3WUWG 3GIVB 3TBVB 1ZA3A 5LGHL 1R3HA 4LSUL 3QG6A 3FRPA 3LKSB 3ZMRA 3CK0L 5EBWB 1WFNA 2E6JA 1E6OL 3DGCR 4U49A 3GSQA 3QXWA 2YXMA 3ES6B 5AZ2L 3AS3A 1C16B 4LRIA 3MRMB 3MROA 4BK5A 5A40E 4AM0B 2FBOJ 4WWKC 2AJYH 1E4WH 5DJAB 4YIQA 3B2VH 2NY5H 4ZUUB 4RMSA 2R2BA 4X5LA 2IPTH 2A74B 3ABZA 3QYCA 1YNKL 3OKLB 2FIKA 1T04B 4M5ZL 4Y5XA 3C5ZA 5DYOA 1XCQA 4OM0L 3TT1L 4PRIE 4KY1L 3VXSE 1QO3B 2R4RL 1AHWA 3SDDC 3W0WB 4RFNB 1LMKA 3PGCA 1VDGA 4M1GH 3VXUB 2AJVH 2JCCB 1WEJL 5CGMA 1RZKC 1QSZA 2HFEA 5HY9B 3L3DA 4IRJA 4YC2C 2VZ3A 1U58B 5J56B 2CLVA 1J1XL 4IOIB 5KSBA 4NZUL 3RJDA 4MNQA 3ZDZE 2B0SH 3HC0A 2YD3A 5KSBF 1H5BC 1O7SA 5C0CE 4X6CB 3IDNB 5I1DB 5FK9A 2M2DA 4G8IA 3LHPL 1VACA 2QADB 5MI0C 1U8OB 3IT8D 4M1DL 4Q9QL 2ERJB 2WK2A 5F7UA 3BVNB 5KG9B 4F33A 4OCWH 3E2HB 4GKZB 4RRPA 5HDLA 3ILPB 3WS6C 5I19L 4NBYB 2I5YL 3GMMB 3EDKA 1D9KB 3D39A 4LOUC 1OAYL 3H7BB 4WEMB 4UZGA 3PQYD 1P84J 3TVMB 5E99H 1XH3B 2NTSP 5J6HA 4RNRB 3LV3A 5H35A 5FO8B 1MIEL 1OTUC 1JGUL 1UM4L 1JE6A 3DMMA 3GI9H 2ZCHL 2BDNL 4UQ2A 2VDNL 4MWFA 5C8JB 3QO0A 2BSED 4RGMC 4YZFE 3ROLB 3F6IA 1QRNE 1G7HA 3CXHJ 5FF6A 5DD3H 3DOSA 2GK0A 3HTLX 4H25B 2Z8WC 4XCNB 1B4JH 1YPZA 4FFZH 2BNQE 5AAMA 4R0LB 5MEOA 4I2XE 4HIIA 1T04A 2B1AL 5F1KC 2R1WA 4OM1L 4JO1L 4AEHH 2I60L 4F2MA 3VXSB 2VRAA 1JZ8A 1D5BA 1IAOA 4LVNB 3Q3GB 2VLKD 2KH2B 4Z77B 2NX5E 1ZLVH 1G7JB 3G5VA 8FABB 2Q8BL 1WF5A 2DQTH 4YWGL 2D31A 4WFGD 1IKFL 5D8JH 5E24E 4X5XA 4NGHH 4OCSL 5C0CB 2CDGA 1Q94B 4HGWA 2AVGA 3BZEA 2D2OA 5KSAB 3OXRB 4JY5L 2VR5A 3RZCA 1OHQA 2Z8RA 2PO6D 3T3PF 2J6EH 3RZWA 1JHTB 2K7QA 3MV8E 5GZOC 1U36A 4IEFB 1RI8A 4CJ0A 1Q9LB 3MRPB 5IVXA 3IETA 5E7FA 1MI5E 5CJOL 1BHGA 3V52H 3QEGL 1ZXQA 4P49A 1FO0H 4HIEA 2VDQL 4QXGH 1FZKA 1OTTC 4JLRB 5GRVL 1W8OA 4HZLB 1U8QA 1VA9A 4K7PX 3SDAA 3QNXA 2BSSA 4PJBE 1D5ZA 2I07A 3IJHA 1JGVL 5IWLC 3RU8L 5CKGA 4EEEA 1F8TL 3IJYA 1CTOA 3CIQA 4LSPH 5EWIL 5F7NC 5K9KA 4ZS6C 3TPUB 5EO0A 2EEAA 4GQ9H 4H26A 1MFDH 4HEPG 4LPCA 3QXDB 3WSQH 5DEFB 4YQXH 2W0LA 4PUBL 3S35H 1YMMA 2GITB 1NC2D 4HS8H 2C26A 2DS4A 4HG4K 4HK0A 1D6EB 1KIRA 2BOBA 4QXUL 5T1MA 4YDKH 3P11L 2DQEH 2VDML 3QR2A 4FNLL 1RAMA 4L4VB 4Z7VE 1DANT 1L4IA 3CVHA 3MR9B 3NIDF 4OQTH 4GXVL 4XZUA 2XKNB 3WD5L 4NCDA 5IR1B 2IALB 4D3CL 1U3ZA 4NO3B 3TBYA 5C0AD 2YZ8A 1ZHNA 3UC0L 3MNWB 1LO3L 5F9OL 4P59L 5DS8A 4FQCH 4GAFB 4JDVA 5DI8A 3SOBL 1JTPA 2ARJB 4XXDB 1XF2A 3ZKNC 4KV5E 4P2OC 4KI1A 1EFQA 2CGRL 2EDXA 2YD7A 4OGYH 4FFWC 5DC0A 1AXIB 4POUB 1SMOA 4JFFE 1BBJB 1BLNA 5J4MA 4MAUL 4HJJL 4PLKD 3CFEA 5C86A 2HMID 2NY4B 1A6VL 2E5EA 1FYTA 3Q6GL 3HUJB 1KBGH 3Q5YA 1RV6X 4PY7A 1MF2H 3H9SD 4TVPL 3MV8B 4ELME 3NCJH 1ETZA 5KANG 3H42L 4EN3D 4FG6D 1K4CA 3MNVB 4R4FL 4U6XA 1MI5B 4OGZA 3VRLE 1AY1L 3WFDL 4JLRA 5DD6A 1R5IA 3BO8B 1I3RA 3TIDA 2Q7NA 4PJBB 3GB7B 4YHZL 4ESKA 1P5VA 4WUUD 4OIAA 2VZTA 5CD5C 4YUEH 4PJDE 4CVZA 1I7TB 4HJ0C 5AD0B 3MGTA 1UADC 5JXEA 1CLOL 2Q20A 3ET9F 4BZYA 4TUKL 3JUZA 3EGSB 2F54A 1KEMH 3H0TB 4OGXH 5CIPB 4KQ4H 5FGSA 4YHOL 5DMKA 3V4VL 1D5MB 4PJFA 3O6LH 4S2SA 1VPOH 3U9UA 1JYXA 5B4MD 1BMGA 4UMGA 4PJFF 4Z7NE 5GS0D 3HZKB 3V6ZA 1IC7H 2F53E 4Q9RH 1ZGLA 4L4VA 3C5ZD 2EH7L 3JVGA 3PGFH 4PGBA 1H3UA 3RGVB 4HKZB 5J12B 3AFLA 1P6FA 2XQBH 1X4XA 3EOAA 5DHVH 3KHOA 5GS1C 3QNZA 3ULSB 2CKBA 1A0QH 5FUOL 4M5YH 4IRJD 2ZPKH 5KS9F 5I9QC 3U0TA 4MNQD 4HWEH 1L9MA 1MQKL 1CFBA 1ZT1A 1P2CA 3DX7A 3DYPA 3RVXD 1P6AB 4P5KA 4FS0A 3HAEH 3ME0A 1OGAE 3O3DB 3KPPB 4JFFB 1RULL 2ICEA 2A9ML 2VN7A 3RVVC 1ZSDA 2VISB 3HUJA 1UZ8A 1CFNB 4LCWA 2QHRL 1U42A 1ZA6A 3QDHA 2R1YB 2ZNWA 3W11D 3O6MH 1HH9B 1DANU 3WHE1 1WIPA 5IG7A 1BOGA 2BHZA 1BZ7B 1Q9KA 4D9QD 3CD4A 4V2BA 3VFPB 3P77A 1RURH 3RPKA 1UXSA 4F9PC 2IADA 4XMPH 4EDXB 5FCSH 1MCRA 1BJ8A 4XBPB 1V3LA 4K7PL 3OR6B 4Z7WA 1YJDC 2Y9RT 3VG9C 5E94A 3T0EE 4OZFG 4EUPA 1XF1A 5GGTA 5HHPA 3MSPA 4P2RA 2W9DL 3EGSA 2WW8A 1JRHH 4JQIL 5CIPA 3MXWH 3UTSE 2ZG3A 5GGQH 5GIRA 1EX0A 1U8MB 2BMKA 2IQAB 3GSNL 5ISZE 3H9ZA 1WWCA 4KUZH 4JFXA 3FQWB 4NUJB 4YBQC 4U2ZA 5C6TH 2CJUL 2F53B 4APQC 3ARRA 5L0QB 4U3HA 5DK2B 15C8L 5JHDA 1MVUB 1WIOA 4W81A 5DJ2A 2NY1B 3AREA 4O2CB 3UJTL 1AR1C 3DVIA 4WCYH 4X7SH 5KVEL 3ARDC 2F58H 1OB1A 1ZHLA 5HHME 1IGMH 4KUCF 2GUOA 2MQCA 2R1XA 3QFJE 4HFWA 4ENED 4KHTH 3PL6A 2H1PL 2FLRT 4ZFOA 2VDOH 2Q76A 4ONHB 2HLFD 2J8UA 1EXUA 5MERA 3O3BB 4X8XA 1RZFH 5D2LE 3RZCD 1OGAB 3NOIA 4ZOEA 1PKQA 2LFGA 5KSVB 2HJLA 2R8SH 3NFSH 4LLUB 2W0KA 1DQJA 1GC1L 3UPAA 4I0CC 5I1HL 2DIAA 4PP1C 5DJ6B 1XF5A 3FQNA 1AO7A 1AI1H 3BP7B 1AKJB 4CJ1A 1HHJA 3K74B 3MZGB 2J3SA 2VR4A 1J88A 4KGLA 2B20A 3NCYS 4XPHL 2ORBH 5DQJA 4Y5VA 3AC0A 3SDAD 2V2TA 3N85H 4OLXL 3FT3A 5F7FA 5GRXG 3IDJA 1IGIH 5H37G 1E27B 2YBRA 4ZUVA 3WFZA 4G42A 2NCMA 5F7YC 2J5LB 4NQXA 4U1MA 4POYA 4P5TC 2ED9A 1AQKL 1KCSL 3DROA 4N8VG 3KYMB 4P3DB 1EMTH 4ZFZB 1OP3K 3QO1B 4XPAL 3O4LB 1D5IL 1ZLSH 2EDNA 2ICWB 4CN4A 4KRMB 4PJAE 5SX4H 2IGFL 1JPSL 3V5DB 2R2CA 4U33A 1YMMD 4HMEA 1MJ8L 1TPXC 4F7EB 3PNWA 4LFHD 3B9EA 4H1LG 3UTTB 1L6ZA 2J4WL 3HPJA 4RGOL 2PKDA 1AP2B 3B83A 4M7ZB 5J57B 1GIGH 4X6FA 4Y8DC 3L6FA 5C0BA 5EZJA 4IMKA 5IBTL 3QIUC 2ZKHL 4JQXA 1TNNA 4PGEB 2CDEA 4YGAB 3B9VA 2O5ZL 3MMEA 4UNTA 3LSOB 2V2WA 4MVBC 4M9OA 4NNYA 3WS3B 4G8GE 4UOJA 3QEUB 5I73C 3AB0C 5GGVH 1PAMA 3QFJB 4WJ5A 4OFYA 4PJIA 3TH2T 5HI5D 1P7KB 4MQTB 3QDAA 3S34H 5DJYA 1X5AA 5D2LB 3S98A 4JKLA 3OAYH 4EOWH 2R9HD 1HOCB 3G6AB 4KJQC 4MJIE 2LVCA 5I8EA 4Z18A 3G6JB 5HGAB 5CEZL 5D7IF 4QTHB 2W92A 4NFDA 1NCUA 3M07A 4BZ2H 1MY5A 3RWCA 4K8RH 4G43B 1BZ9A 3U46B 3KS0J 3ULUD 4JY4B 5F7LB 4X6DA 1DE4A 3BEWA 4PBVC 3IYLW 1E6OH 1IGJA 3MLXH 1BX2B 3LKQA 5TPWL 2F8VA 2HT2D 4LHUD 1RJYA 1LK2B 3B9DA 3KLHC 5EOQL 3LS4H 3IFPA 3CJJA 1LO5B 4KRLB 4OCRL 3MTRA 1P84K 2ZNXA 2OJEA 2XN9A 4P3DA 4U1IA 5A2FA 3MV9E 4ZFZA 5JXED 1YNKH 3O4LA 5I0ZA 1HQRB 3QQ9D 4CN6A 5BOZG 4M5ZH 4OM0H 2F54D 4PJAB 2HTLC 5F6HJ 4FFVC 1OQOA 3TNNB 1F4YL 3F7YA 2EE3A 3T1FB 4HFUH 1CD1B 1WEJH 3NBNA 4QXTB 5FYKD 1WWBX 2IH1B 3IKCA 3BPCB 1J1XH 1R3KA 3OL2A 3MUGA 4L4TA 4NZUH 5C08B 3KPMA 1IAIH 5JO5B 5EORH 2E7LA 4RAVB 4OZGA 4GS7C 3VGGA 5LQBL 3LHPH 3NABL 2YA2A 2ITDA 2WUCL 4JHWL 4XPGL 3SJVA 4G8GB 1DLFH 2ZSWA 3CGTA 4NZDA 4KDTA 3RL2B 5A2IH 3BPLB 5EZIL 3QA3A 5I19H 4TPRH 1AD0A 1EEYB 3P4MA 1OAYH 2J7LA 3KYNA 1V3JA 3P0YH 1XGYL 2OZ4H 3FT4A 3O6KL 1JP5A 5EIIB 1CK0L 4MJIB 1EIBA 4LCWD 1MIEH 3C60B 4JPVH 1JGUH 1UM4H 5FM5O 2ZCHH 2BDNH 4R8WL 5IB5B 4U0RB 3QDJD 1NBQA 5CGYC 2I9TB 2DLIA 3KPQA 2VDNH 4XC1L 5FCUL 4OTXL 2M1KA 3OKKA 4HWZB 4QHLA 2LE9A 4KI5F 1N5YL 4MZ2A 2NY3C 4UDTA 5INCA 5TH2B 3V95A 1VENA 1LK2A 1TJIL 4NJ9L 1DL7L 4XNYL 2EDRA 2UV3A 2VLJE 1FLRL 1ZVSB 3NCFB 4J3WA 5IB1A 4GJTB 3W9DA 1G7PB 3GSXB 4NN7C 2ENSA 4X7FC 4OFIA 4AIZB 2E6PA 3TYFB 4K94C 3ROOA 4YX2L 1MPAH 3BN9C 4XI5D 4KK6C 1YDPA 3CFCL 1NFDF 1OF2A 4L29A 2B1AH 2OSLB 3TH3T 2EZ0C 5BRZE 4OM1H 4JO1H 3OKYA 2I60H 4KQ3L 3RIAK 2BNUB 5BVPL 3C6LC 1SY6L 3V0VB 1S7UB 3ISWA 3O3EB 3VRJB 2GJZA 4PJ8B 5TQ2L 3CFBA 1N64L 3I02A 1P9MA 1ZHBA 1HXMA 1TZHB 3S5LG 2Q8BH 1PSKL 2P4AB 1JUFA 5HDOA 1WAAF 1WBYA 4YWGH 3V6OA 1CE1L 2R0LL 3TBTB 2BVYA 3ARED 4MJ6B 4OCSH 1TVHB 4KUCD 2BRRH 3PHQB 2OTPA 1MJ7L 4JY5H 2QKIB 3MGOA 3H9YA 8CGTA 2DMBA 4BQ6A 2RQ8A 1JV5B 4WY7H 3PL6D 1FGVL 1PJ9A 4F7CA 4BSJA 1FJ1B 2VDLH 5DD1L 1Z9MA 1PQZB 2P5WD 4D0CB 1A4KA 3WO4B 1BVKB 1KCRL 3QEGH 3JTTB 2VDQH 1E6JL 3VI4E 2LU3A 2NZ9D 1H3TA 4LPVA 2HTKC 3IU3A 3ZYOA 5IJKA 2BXYA 2NY2C 1JGVH 4X4YA 3RU8H 4DEPC 5DFWH 5EWIH 1AO7D 4HUUB 4LDLB 1A3RL 4PV9A 4PJGA 5ALCL 5HD8D 2VXVL 3LAFA 5FGCB 3S8WA 1QR1B 2Y72A 3X3FL 1I9EA 1F3JB 1MUJA 4IMLA 4PUBH 4Y5YA 3RWGB 4IJ3C 3HZVB 1C8PA 1VKXB 2R23A 4XP5L 3IJSB 4MCYA 4MB3A 5DJDA 5SWZE 4GRWH 1K8DA 4ZFFB 5DD5H 2VDMH 3IDGB 1HWHB 4FNLH 2D7NA 4ZXBA 1NMBL 1UB5A 2R15A 5GJSL 4NHUB 4GXVH 3UCRA 5EU6B 3X12B 4D3CH 1X5ZA 4ODTL 1SM3L 1ZLUK 4F7TA 2YPLD 5EUKA 2ZG2A 4DW2L 5I71C 4NPYB 4GKSB 2RFXB 1LO3H 5C2BL 5F9OH 4P59H 4M6ML 4R7NB 2F5BL 1PYWA 5GJTL 4B7LA 3O0RL 4I4WA 4QRTB 1FP5A 5C0BD 4OLVH 3SOBH 4LDOB 2G2RB 1XGTA 3LOWA 4HKBA 3CLFL 1T66D 1T20B 1VFMA 4ZTPL 1XZ0A 1SVZA 5C0GB 4MAUH 4HJJH 2AXFA 2CSPA 1A6VH 3Q6GH 2YUVA 3I6LD 3GZKA 4U3XA 3QCUL 4RDQF 4BFEA 5MEQA 5CBEB 4YHNB 3H42H 4R4FH 5EU4B 4GRLC 1NC4B 1AY1H 5EN2B 3WFDH 1W2KT 3GMLB 3HE6A 1EEZA 4K3JL 2MHAB 4RBPK 1F4AA 3ZHKA 5I0DA 4L5FL 3BISA 3SDXE 1OTSD 3G6DH 2EXYD 1ADQH 4YDJA 1HI6B 3MRQA 4OLZH 1T5WA 4PGDB 1I7RA 2HT3D 3F7VB 2ZOLB 4UILH 1CLOH 4QKXB 4NHCL 1KXTB 5JW5B 1S9KC 1NL0L 5T3ZL 4TUKH 1A1MA 2O61B 1WBZB 3SGDI 4HWBH 3V4VH 2HN7B 3B8YA 1T0NA 3OGCA 4GT7A 4TTDC 2C1OA 3SKNB 2W07A 3OZ9H 4G5ZL 5DVNA 5ILTL 1U92A 2AAVA 3L3JA 1A02N 1SEBB 5DZOA 3WIIL 4XB8A 2VLRE 2H32B 3I9GH 5D1XB 2H32H 3GJEB 4FTVD 4YAQB 1NCNA 4TUOB 3U6RB 3QUZA 4XBGB 4Y4KA 3P9LB 5HI4D 5E8OB 4OZHF 1FNAA 2DM4A 1HKLL 3O81A 2GAZA 4QY8A 4I18C 5E2VH 4L4TD 4QLRA 1MQKH 3JWDC 4U1SB 4ODBD 5IMKB 4HUKB 2VUOA 3U36B 4MQ7B 2AEQL 2IANA 2B5IB 2H3NB 4Z5RA 4XP4L 2A9MH 2NTFA 2OMBA 3SJVD 1H8NA 1NLBH 4GG6B 2Y6SC 3FFCE 4MGXA 2QHRH 4DGVH 2JK5A 1EFXA 2FZ3A 1JHKL 1ITBB 4XAWH 5GS2D 4PJCB 3TJHD 3VWKC 5GSRB 1ERNA 1EEQA 1FIEA 4NDMB 2XKSA 1CWVA 5CZXC 4PPTA 4GW5A 5IM7B 1FFPB 1T83C 5GGUA 3LEYH 3LN9A 1N6QL 3LB6C 2COQA 4K7PH 1IC1A 3DXAE 4PV8B 4ODWA 1YY8B 5T33L 1F90L 4YBLB 4BH8A 1QQDB 3NPSB 2UVEA 4C54A 3T2PA 4GLRH 3WV0A 5JW5A 3N9GL 3KPSA 1U93B 5AAWA 3S6CA 2MCPL 4PJHA 5E8DL 3GRWA 3BPNB 4XCYB 1QFOA 2XXCB 3N0PB 4Y0GA 4NP4L 3GSNB 2H2SD 4AL8L 4MDIB 1IKNA 4F57L 4KHXH 4LNRB 1SEBA 2CJUH 4HPYL 2VLRB 1B6UA 3HI1A 3CPLB 4IOFD 1OSPL 5FM4A 2A6IA 3UJTH 1H9VA 2A6DB 4D0DB