5CUSH

Crystal structure of serbb3-fab3379 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
182
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYYMQWVRQAPGKGLEWVSYIGSSGGVTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGLGDAFDIWGQGTMVTVSSASTKGPSVFPLAPGCLVKDYFPEPVTVSWNSHTFPAVLQSSGLYSLSSVVCNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Inhibition of ErbB3 by a monoclonal antibody that locks the extracellular domain in an inactive configuration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 182
sequence length 214
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2015-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH01
3CK0H 1ITCA 2FBJH 2BY1A 1JWMA 3CLFL 5JHDB 5IB2A 4G9FA 3QEQA 2J5LC 4Y4FC 1Z3GH 1UB6A 4UMGA 3DXAA 4XAWH 5DI8B 4A6YB 4KUCD 5LCVL 2AK4E 1KJ2B 5L2KD 3VD5A 4A6YL 1DDHB 1KJ2L 2WAHA 4PJFB 3DRQA 2AK1H 1DQQA 9CGTA 4JG1H 1E4KC 1HXYB 1RZJC 5EZOH 4OD2A 2EKSB 3MJ9H 5TGBB 5HVFB 1N5YH 2W38A 3OMZA 5JXAH 3K8MA 1INQB 4JRYD 1PG7H 4POUB 2IH1B 2OK0H 3CNKA 4HULB 3O2DA 4NYLA 1Q9OB 1G9NL 2XN9B 5EU7C 3X13B 1I1AD 3L95B 4PJHF 5SWSD 5GS1C 2XG4A 1NPUA 2CRMA 4L9LB 5GSVA 3IDJB 1YDPA 3UTTE 3FO1A 1S7RA 2ZZUT 2PW2B 4POZD 2ZG1A 3MZTA 3TH2T 1QSVA 1CXLA 2F5BL 2X42A 3MLWL 5B39G 3I2CL 4BSWA 5D2LE 3RVUC 1RZIB 3ORJA 3L5JA 2HTLC 3TBTB 1GC1H 2FR4B 2J8UE 4NQEE 3HE7B 4JPIB 5FCUL 3WNKA 1IM3A 2ICWI 5JXEC 2IQAA 5DK3A 5H37H 4OT1H 1PD6A 5I1CH 4ZOBA 3GJEB 3VE0A 1RK0A 3LQMA 1NBYA 5I1DB 4OLVL 3TBWA 1BP3B 1CQYA 4DKEH 4KKAD 4WDIB 4J3SA 4X7TB 3U9UB 3F58L 3S8WA 4DQOL 3ISWA 1LO2H 3EO9L 3T4YA 3KLAA 3D1MC 4F15B 1XH3B 5IP4A 3MV9D 1EHLH 2HFFA 2BJML 3PWPD 4AEEA 5J6HB 5C0CB 2VLKD 3F62A 2BSTB 4R4BA 3RPIA 3ARFA 4K3JL 1P4LB 3EZ8A 1C08A 5BQ7A 1N6QH 4MD4B 3QQ3A 1NDMB 1K2DB 4EDXA 5DJCA 2H32H 4NM4L 3S5LG 3EO0A 5JW3L 1NANI 4I3SH 3V6OC 1D6VH 2R0KH 4OI8A 4Y5XA 5GGTH 1DBMH 3FAXA 2Q8BL 4R4FH 4XP9H 5FHBL 3S4SG 3PWLA 3ULVC 3MUGA 4XAWL 5DUPL 3S3PA 3P30L 4LHUD 1X5ZA 2ARJA 2OR9H 3TT3H 4A2MA 4KZDH 3K2MC 5D1XC 1B90A 1CL7H 4TSCH 1SJEA 1M7DB 2AK1L 1T83A 4JG1L 3BPNB 1A7PH 4FQ2H 5JIIA 1BWWA 1N5YL 5IB3B 2F8OA 5DJ0B 5EOCL 1C5DB 1KIPB 5I8EA 4HH9B 4B50A 3PQYA 3QDGA 1IGCL 3CDFA 2OK0L 4KZEL 2HLAA 2VABA 4AEIH 1OAYL 1R24A 1XGTA 3ZLQC 4KI5D 3WLBB 3PWPB 1IEHA 4HS8H 2XKNB 2H6PA 3MLUH 3T2PA 2A0LD 5E94A 5ACLA 2G2RB 4MJIB 1MIEL 1KGCD 4XPBH 2HVJA 3BPCA 5D7IE 4HS6A 1MCKA 5J13B 2QADC 4QRPE 4JKPL 1AI1L 1NUDA 4NRYB 1QA9A 5EZLB 3H6JA 3FQXA 3FB7B 3WXWH 1JK8B 3MSPA 1IQWH 1F2QA 1HNFA 3MMEA 4XVJH 3BZ4B 4PTTB 4XTRD 3P11H 4I2XB 3EBAA 2ZUXA 2RR3A 3TO4A 2XWBA 5I1CL 1A47A 1AO7B 4UT7H 1DVFD 1H8OA 5BMFH 2AGJL 1FNHA 3LRSB 1MPAL 4YPGB 3GRWH 3MQIA 1VGKB 4LCUB 4YUEL 5ITBH 3CMGA 3RVXD 3WUWB 3VGEA 5TF1H 1LO2L 1CCZA 4JHAH 5IVZB 2FGZA 4RMTA 1EO8H 1OP5H 4Q6IB 5AWNL 1X3DA 2VC2L 3QISA 3E3QC 1FZMA 3MGTA 3IFPB 1EAPB 1G9NC 3BPOC 2OYPA 3GMOA 4EI5A 1W8OA 1IT9H 3K8LA 4IRJA 4LSPL 2Q20A 5D7LE 5GIRB 4WU5B 3RJDA 5D7IA 3BXNA 2ED8A 1HIMH 4U1JB 1N6QL 3O6FB 4QRPA 3WD5L 3CFJA 2BMKB 4MHHI 5MENE 3KHOA 3S36X 2JKXA 3ARDB 4F57L 1IILE 2AJZA 5ICYB 1D6VL 5DD1H 1FORH 2JCCE 4LVOB 4YQXH 3HPJA 4XP9L 4O4YH 3T8XA 4PG9B 3UPCA 4AL8L 5A40E 4OV5A 5FGBC 4P2OA 2DQUL 3NTCH 1A6WH 3HG1E 1G7LA 3OB8A 2DQTH 2OR9L 3ESVF 1J0IA 3KPLB 1OARL 1CL7L 2V9QA 4TSCL 5D72L 5FCSH 3G6JB 1KFAH 2C4FT 3MYJB 1OTTD 2ATKA 1DVFB 2YUVA 4XMPH 2PR4L 3W2DL 1F4YH 5BO1H 3MXWL 4YWGL 2PW1A 5GRXG 3TH3T 5KSUA 3ZKNC 1B2WH 3B2UC 4NKMB 2ADGA 4GH7B 3RA7H 2Y36L 5D7LA 1MCDA 2Q6WB 1KXTB 2XWJA 4ZTOL 4OQ1A 1YN7B 4BKLA 3ZDYF 2HJKB 4JANB 4U7MA 4U1KA 4Y5YA 4F15C 5KVDH 2WK2A 1LDPH 1IL1B 1ORSB 3UTSA 3JV4B 1A6ZA 5T5FH 4FXGA 1QNZH 3PF2A 3RDTA 3L3DB 4XPBL 3UDWC 1LP9E 2WNGA 2Z9TA 3KPOA 5GQBA 3GMPB 4AG4L 2YD8A 1DN0A 1YEEH 2OX5A 3U4BL 3LN5B 1KJ3H 4W81A 2E9WA 5SX5H 3B9AA 3VRIA 1ZLUH 3WXWL 1GL4B 3W39A 5A2KH 1TMCB 3KYNB 3WYRA 3W0WE 4N90E 4YR6B 4XVJL 3P11L 5DC0A 1AGFA 3IDYC 4G9DA 5HYEA 3TP4A 1F02I 5BMFL 2IAMC 3T65A 3PGCA 4RAVA 4AYFA 3NZHL 2FWOB 5HVHB 1P5VA 3BP7B 4GRMB 1LVEA 1WFOA 2Y1VA 2D7MA 1IC4L 3O2DH 4OF5A 5E5UB 3IETA 1CICD 1EO8L 1QBLH 3VFOA 1FVEA 1XGRA 4YAQA 5HHPB 5I1AA 5F7WC 4DVRL 2FEDC 1IQDA 2JJTA 4IMKC 4YDLB 3S9DB 5A3IC 1Z2KA 1IZJA 3DROB 5DMKA 1Y18A 2BOCA 1S8DB 1FL5B 3HZYA 2AKRA 3RVVD 4G9FD 1DBAL 1G7QB 1S78C 2N1KA 1AFVH 5DMGC 3QEQD 7FABH 3W0WA 3CFDB 3JWDH 3JUYA 4XAKE 2PO6C 1DEDA 5DD3H 2DQTL 1HHIB 1IGYA 3C9NA 4N0UA 1I9JH 3OR7B 4XHQA 4WW2A 4M1CD 4PR5A 2GTWA 1PYWB 5IFAL 4DCQB 4G8GA 2LQRA 4LU5H 2WWMD 3WFCH 4GRWB 2VISB 2DD8H 1I8IB 3TVMA 2VMFA 3DX6B 4QEGA 4Q9BA 3JV6A 5DMIL 1W72A 3S37X 4F2MA 4PJ9A 4RFEA 3ZHKA 2PCPB 5KS9B 5ICZB 2BVPA 1NEUA 5IV2B 4LARL 3V5HA 5KSBA 1D9KB 4Q6IC 5KVDL 3X12A 4J4PA 2D31B 4MNGB 5T5FL 1QNZL 4LRIC 5E9DA 4PJIF 3M17B 5T33H 4U3HA 5M94B 3O6FC 4G7YL 2L0DA 1JWMB 1ZA3B 5DURD 1YEEL 1A6AB 3RWJB 4U1GB 4ODUA 3ARDC 3BGFB 3P4LA 5BJTA 1RUPH 4Y2DA 4MA1B 3BKJH 4M8QA 4BSVA 3IDIA 4OCSH 4ZQKB 2XTLA 4LVOC 1MFAH 1CFSA 4GW4A 3HZMB 1P9MC 4J1UA 2WMPA 2I60H 1DQQB 1NAMB 3MREA 4TPRL 4U6XA 1HEZA 2O5YL 5DUBA 1UB5B 5D2NE 3FONA 4ZO8A 4OKVA 4OZIF 5EOTB 3O2DL 4RAUB 2G9HB 2QV2A 4MS8C 3VWKB 1QBLL 3DECA 4H5SA 2XNAB 5EO9A 5ACZA 3VFUA 3UTTD 4L8BA 3TBYA 1BM3L 4CBPA 2ZUSA 2DWEB 4NN7C 2HJLA 2VXSH 3ARFD 3RKDD 3PHQB 4EI6B 5F7LB 3VFSB 3FO1B 4FQ1H 2YHGA 2MQ3A 1WVZA 2OBGA 2QSTA 4WI4A 5F7DB 2VDPL 4ESKA 2DJUA 1MHPL 2D7NA 2YBRB 5CWSB 3G9AB 3HE6A 1JGUH 1AFVL 2AK4B 4HFWA 1N2RA 1IZKA 2PTVA 4FFZL 1QYGL 2YS4A 3JWDL 1W0VA 1K3IA 3B9KA 2IALB 5TFSL 3DHMA 1II4E 4GFTB 3CUPB 4S2SB 1AC6A 5IHUH 2FECL 5ENWA 2VR4A 5T5NG 3ZE2F 2DQGH 1NBYB 4M7KH 3TBWB 2VQTA 2DTSA 3QDGD 2VLME 1RPQA 5F89A 3L3GA 4AEHH 1OWRM 3QFDB 4QHKI 2CLRA 5CBAA 2Y23A 2WIMA 1XIWA 1F3JB 2FB4H 2AJ3B 1OL0A 1U8IB 4NM8H 5J89A 2HG5A 3MNZA 1ZSDA 4KKCC 4LDOB 3UTTB 3TBVB 2OQJB 1A9EA 3P73A 5ESAB 5C09B 3QQ3B 5B22A 4JEGB 4JREB 5L0QB 5D2LB 5MERB 2EO1A 5AD0A 5KJRH 2EYTB 2J8UB 1TZIB 2L7JA 3KLHD 4NQEB 5FYKE 1E28B 4GW1B 4AT6B 1TETH 3BKJL 4FQLH 4XXDA 4IEFB 2P5EE 1UJTA 1UH2A 2VLLA 1IAIH 2X1XR 1MFAL 4P57A 1H3UA 5GHWH 5FK9B 4R96A 1DE4B 3TO4D 3DUSB 1FZKA 1FYHB 3BYTA 2IPUK 4NZTL 1WJ3A 1ZEAL 1LE5A 1MH5B 3O2VL 5ESQA 3ZDXE 2C3WA 2BVOA 2MCG1 1HXMB 1U8OB 3AC0A 1FFOA 4OZFA 1P69B 2VH5H 3HC4H 1RZFH 3T4AA 4BFEA 2GJ6E 5GRVK 5CP3A 4Y19E 4EI5D 2APVA 4IRJD 4X5XA 5EO0A 2VXSL 2CRIA 5E94B 1GGCL 4QRPD 5IIEB 5I0ZA 1D9KC 5T1KA 3UTPE 1Z6JT 4Z8FH 2Q3AA 3I6LE 2QQNL 4OLYH 2DL2A 4FQ1L 4L3CB 4HXBL 1YEHH 1HN1A 4LPCA 4PBXA 1H15A 3HRPA 2GSIA 2P5EA 5CD3B 5CJXA 4U6YA 3QRGH 1B0RB 2YK1L 4N0YL 4P2OD 3QPXL 1MCWM 3NCFB 4MA1C 5FGSA 3EOAB 1KULA 1KN4H 1PZUB 2F58H 3WL9A 1WICA 2DQGL 5DEFA 1TENA 2IC2A 3HFMH 4P0DA 1N6VA 3BH8A 4I18B 1SJHB 3KDMB 5A2LH 3BP4A 1YMME 4KQ4H 1MCEA 5FA4B 4AEHL 2GJ6A 5E4EB 3IXAA 3VDBA 4JPWH 1MVFA 2FB4L 4AIZB 5D7LD 4NM8L 2C3VA 5AAMA 3ZSSA 3UYOD 5LAXA 3FAWA 2VXTL 4MNQA 1U8LA 3Q1SH 5MEND 4XP1H 3G9VA 2IJ0C 3TESA 3VWKC 4MJ6A 3ZL4L 5DJZA 1ONQB 3QG7L 2XZAH 2HRPL 4QRPB 3RWFB 3F7VA 3TNNB 4F7PB 3RDTD 5HY9B 1RJLB 1L6XA 5KJRL 3ULSA 5EC1A 3CFEB 4JVPA 2VDLH 1MIML 3CGTA 1MREH 4GOSA 5F3HB 4NP4L 1FV1A 1I1FA 1NUNB 5TDOB 3GI8H 2QHRL 1YMMA 2DB8A 2VWEC 5EZIH 3GDBA 1QQDB 3T0AA 4RGNC 2ATKB 2VZ1A 1T5XA 3VG0H 3DVIA 4L4VB 3IDMA 4LASL 1MCJA 1OAQL 2X4UB 1CGTA 2BDNL 2GHWB 5DDHA 2QR0B 4PJ7A 2Q8AL 1R3KB 4M00A 3HC4L 1W72H 5D7LB 1CDHA 3BN9C 4N0FA 4X99A 5FM8A 4PGJA 1S7TA 4FNLL 4NC2B 4BKLB 4WTZA 4X6DE 1AIFB 5EDXA 4F3FA 1G0XA 3ZT5A 5MENB 1R0AH 2RFXA 3A6CL 4G6JH 4NO5A 1NGZA 3FO9B 3ZKSD 1NCDL 3RP1A 5KZCB 4OLYL 2VDRH 1NJ9A 2DIAA 4AM0A 2JCCB 2NLJB 1RJZA 1TLKA 1YEHL 4HIXH 4UV7L 4WEUD 4XNQB 3ZT7A 5FO7B 1UA6H 2NY5H 1CE6A 5I75B 3GZKA 5KAQF 2BRQA 4CRPA 2BSRA 3HG1B 3W0WD 3KXFE 4ZOAA 5EU3A 3OG4B 2DI8A 3NIGE 4OM0H 2OJEB 1TIUA 2DM4A 2XFXA 1TTFA 3W39B 5I8KH 5K93A 4JKLA 4M1DL 2X4NA 3QUZA 1CGYA 1T0NA 4JO1H 1J0HA 5C0BE 4U4BA 4G8GD 3T2OA 4OUUB 15C8H 3GSVA 4Y4HA 5JNYB 3LS5L 1PQZB 5JPMB 2BOBA 3TVMD 3SJVA 4EQ3A 1G0YR 3OKOA 1GGBH 3BUYA 2CSPA 4UDTB 4PJ9D 1FL3A 1F6AB 4DW2H 3HS0B 3V4PL 5GISL 3WFHB 5LG1A 4NKOB 3VXTA 5I30H 4MA3B 4K94C 3Q1SL 4MB3A 3FB8B 4UT9H 4HKBA 3V6FB 3NFSH 3BJ91 2OTUA 4J4PD 3LPWA 3DV4A 1LP9B 1BBDH 3F6LA 2MCPH 1NMCC 2A6DA 5E9DD 2ADIA 5DLML 3SGEH 2BOCB 3FZUD 4NUGH 5E6ZA 4XAKD 2VZTA 5E1AA 1UEMA 3SKJL 4CW1A 1YMHB 4HIHB 4DKDC 2VDLL 3AS0A 4RNRA 3HCVA 3PNWA 1UFUA 3EIFA 3W9EA 3VFNB 4CMMB 4XPTH 2JJSC 5C0BA 4X5WB 4JKMA 1MJUH 1WBZA 5HHQA 5JW4M 4BUHA 3QHFL 5DC9B 1IAKA 1JL8A 2FCBA 3F7PC 5GGUA 5GSRB 1REIA 1G1CA 3FN0L 5BW7C 1UM4H 3GHBH 5IB5B 3EFDL 5BRZE 4U6TA 3NABH 5JHLL 4KRLB 3JV6B 1E4JA 3HAEG 4I18C 4HLJA 1CDCA 4PTUB 4KXZH 4PRAB 4RFEB 3KYOB 3WIFA 4DZBB 4U6VH 1I1CA 1I7UA 3BMVA 3CFBA 1SM3H 2GI7A 1R0AL 3GIZL 1H5BC 3VD4A 4XCYA 1V5JA 1A6TB 1FJ1B 5F7EL 1FBIH 4D9QD 4OCRH 3MBEC 4YO0B 1U0QA 2VDRL 3WSQH 5HDQL 4KTEH 1HINH 1EZVY 1JGLH 5DRNB 3MRMB 4X4ZA 3RY5A 4N5EC 1BQUA 1F6FB 1YEGL 4U49A 1RURH 2YZ1A 1GSMA 4OM0L 1MF2H 3B9KD 3IDIB 5IB1A 5LXGH 3V2AR 4WENB 4WV1B 5HHME 3WE6A 4LHJB 5D96C 5B39B 3DX8B 3D85B 4ONOA 5IGXH 3ARSA 3BKYH 5CZVL 1K4DB 2UV3A 4J1UB 4JO1L 2E7CA 2GSGB 4S1QL 5HPMA 5BRZA 3FT4B 5JR1L 2R69L 1GXEA 5DD5L 1Z0NA 4C56E 1LK3L 5MI0B 2W91A 5F88A 5A2JH 3MUHL 1BX2B 3QQ4A 4Z95L 2EIZB 1LO0H 3QIWC 1XIWD 3BPLB 1GGBL 2DBLH 1WAAE 3QYCA 4Z6AT 4UB0L 2Z4QB 3I6GA 1I7RB 4L4TA 4OLWH 3SCMB 4OZFH 4BFIA 1Q9KB 1MJ7L 1UVQA 1R5IA 2F74A 4OGXL 5CP3H 4LLAA 4UQ2A 1BJ1J 1HKLH 1OD7A 2CPCA 3TZVC 2R8SL 1MI5E 3Q6FB 4L3EE 1Y6NR 1D5IH 4LLMB 4MCZB 4RSVA 1OGTA 1UXSA 3C6LA 4MQXD 3EYUL 2YZ8A 4KRNA 1B4JH 2BCKB 3MBXH 1AJ7L 1N7MH 1RV6X 5B21A 3QXTA 5JMRA 4XGZA 1DEEA 5AAWA 3ALXA 4LL9A 4CJ0A 5HHVH 3QT2A 1EEYB 3S5LB 3LN9A 4ELMA 1ODAA 5MHSE 1A4KB 3O45A 1MJUL 1DQMH 2NPLX 3OAYK 5J6GB 4CU7A 1ZT7B 5D2NB 4K9EC 4FRWA 3S4SB 3D39A 1A7OL 3FB6B 4X98B 5IJVB 1UM5L 2FEEL 5JMOC 3BEVB 2PXYB 3CCHB 1T1ZA 1FIGL 5CBAB 1YYLH 3GMQB 3QIUA 2E7LC 4LGSB 4U6VL 3W81A 4OTXH 3MOAH 4JVUA 2AXFA 3HNSL 5C9KA 4BYHA 3TIDA 4FQPA 1BBJB 4HAFA 3KNBB 1AQKH 3QXDA 5T1KD 4ZDHB 3LCYA 3B43A 4O02L 3VRLE 1X5AA 4ZXBA 4Q0XL 3Q0HA 1Q38A 5I1GH 2DKSA 3C5ZA 5EFIB 4PJGE 3ESUF 3BWAA 2P5ED 2HYMA 3QQNA 2E6JA 1MOEA 5CP7B 1IGIL 5TE7L 4NUJA 1EV2E 3BIKA 1MF2L 3GSXA 4PJEA 3QUKA 4OF7A 1BOGA 1WBYA 3MTRA 3P4MB 1I8KB 3UP1A 4XH2A 1T20A 2V9TA 2AABH 2IANB 2LAGB 2P48B 4HF5L 1AD0B 3LS4L 4LQFH 2GJ6D 3O11A 1QFWH 1QO3B 5D1ZD 5L6YH 1LQSR 4OLWL 1NUGA 3MJGX 2YWZA 4MNQD 4H88H 4GLRI 3F7QA 5MEPB 4MA7L 1YNLH 4LSUL 3CSYB 2WQRA 3VD7A 2CUHA 4H26A 1UQSB 2ZP0T 1YNTA 1NLDL 1FLRH 5HGAB 4JG0H 3HC0A 5FYKL 3H2WA 2I25N 3R0NA 3PP3K 3QCVH 2R4RH 5HVGB 2V5MA 1W0YT 4RGOL 1YEDA 4X4YB 1P2CB 2NW3A 2EDRA 4PBVC 1ACYH 5DK2A 4NHUA 4PJCA 3MRGA 2LTQB 4M02A 4BZYA 5KSAB 1U8PA 3HA0A 5J1AB 4GRLA 3R0MA 1YMMD 1X9QA 4RWHA 1GHFL 1NL0L 5FUOL 4WCYL 5JOFA 4CDGC 1TJHH 4I0PC 1Q8MA 2A74A 1ZANL 4TSAH 1T22A 3PWJA 1A1MB 1XGUB 3SDYH 3LKQB 1D5XA 1OQXA 4Y19B 5D1ZB 2AQ2A 5MI0C 2QSVA 5C0NC 2V6HA 1QUNA 5FO9A 3RTQA 1MJ8L 4XXCA 5EU5A 4OTXL 5F3BB 3MRRB 1ZLVH 5CLWA 3BO8A 2R2HB 1BQHG 2WWKO 4HV8A 3U2SA 3WN5A 2CDGA 3IRZA 1M7XA 4HWZA 1UZ8A 2R0ZH 3UJTL 3RUGF 3SKNA 4KMQA 4I0CC 1NDGB 2DF3A 2P8PA 3SPVB 4YHZL 2J8HA 4V1DE 4FZEH 4H20H 1EFXA 4RMWA 2FHCA 1U3ZA 4ORGA 2NX5E 4XX1E 2JE8A 3QUZD 1JFQL 3EJJX 4LQ1A 4MCYB 2YPLE 4QOKA 2AERT 3ULVF 1YMMB 3NFPA 4CN1A 2E8YA 4PYHA 4Y4HD 3CH1B 1T5XB 1CR9L 3DETC 3SJVD 1QR4A 1GIGL 5D2NC 4OUOA 3O4LE 3TNMB 2ITCB 1TVBA 3HLAB 4YHMH 5CSBA 2PXYC 5DMJB 2HH0L 3QCTH 4UNTA 5DFTA 2B1AH 4MD0A 2EDQA 4FQHA 1VADA 1ZK9A 3F5WB 2VIRA 2XV6B 4PJ8B 3C8DA 4Z7WE 1JNHB 4QXTB 1CLZH 3HMXL 3MR9B 1M7IB 3CX5J 3WFDH 1A0QH 3MLSH 4S1SL 3I6KB 1U8KB 3FT2B 3ECBB 4WI7A 4Y1AE 3KPQA 4IJ3B 2GITA 2R4RL 4W6YB 1YYML 3RWGB 3ARRA 5LGHL 2APBA 2IG2L 5MP6L 3MLVL 1NCBH 3B4NA 5C0BD 4AIXA 4BH8A 1GZPB 1JPTL 1ZA6A 2HT4C 2O5XL 5GGVL 4ZUVB 1RU9H 4GBXB 3O3EA 3QUZB 2F8VA 2HA1A 4RMSA 4LLWB 4EXKA 1F2XK 4L8CA 2F5AH 4LEXH 4RA3A 4PG2A 4AEFA 1KG0A 3L7FB 3ZTNH 4ZUTB 1QEWA 5JQHC 3VXRE 2EDFA 3QDJE 4MXQC 2ESVA 2BSSA 2DQHH 1R3LB 2A9ML 2NY6C 3DGGA 1VFMA 2EC9T 2OMBA 3A67L 4X6DB 4PJFF 2P8MB 2VDQH 1ZGLP 5HJ3A 2BY2A 3SEPA 3MA7A 5FYLE 2ZNWA 3BQUC 4FG6C 3MRQA 3EYFB 1KCUL 2X4RA 3PUCA 2EYRA 3IU3A 5LBSH 3TO2B 4HX1A 3PL6B 2EH7H 3N9GH 2X10A 4ONFH 3UAJD 3DRTB 3KXFB 1MQKH 3QZWA 3WUZA 5B8CC 4OLXH 1F4XH 5C7XH 3TGXA 3MGOA 3OBAA 3QNZB 3LN4A 5DRZA 1MCHA 3MCG1 1T66D 4PJHA 5JIHA 2BZDA 4U05A 4PREA 2VRAA 3WHE1 1DFBH 1FVDA 2C4FU 3EZJB 1AY1H 3L3IA 3QDJA 5BRZD 5KSAC 3ARGA 2AJXL 5B3JF 5FDWB 1JPGA 1JNNH 1T03H 1T2QH 2OJZL 5KVGL 4YHML 4L4TD 3GK8H 3MOQA 3WIFB 1FC2D 4YHIB 4QRRE 1BQSA 3QEUA 4LMQI 1T6WA 1I7UB 1TJIH 5DJAB 5MEQA 3SE4C 1PLGH 4F9PA 4F7CB 1CLZL 3TYGH 1NBZA 4LLVB 4J2XA 1Y6KR 2E3VA 1AXTL 1CGSH 1J8HE 1NBQA 4WO4A 4G3YH 5EOCJ 4KU1A 1UENA 4JM2D 3GGWB 3GBMH 3BSZH 1KB5A 1RD6A 1CXHA 5HHMD 5DGQA 3SE8H 3C60B 2BSED 5BVJA 3C5JA 3SDDC 5IB1B 5BVPL 5D1QA 4H25B 1RU9L 4OGZA 1T1WB 2Y7QA 4C56D 5I66A 4PYGA 3RI5F 3QI9A 1T89C 3VFWA 4LEXL 1OSZA 3ARWA 2ERJB 3EYSH 1UZ6E 3GBLA 5GZOD 5HGBB 1TFHA 1HZHL 1Y6MR 4Y0GA 3QIUD 3SBWC 1G6VK 2MKLC 4EVNB 1KLGA 4MVBC 1IC7H 2VDQL 1DLHB 3QXAA 3UTOA 1MI5D 4HW6A 2BX5A 5JPNA 4S11A 5J56B 4MDIA 5HHOE 3UPRA 5CGYC 12E8L 1J8HA 5JW4Q 2VKWA 5DZLA 3M45A 4PJ8C 4ZXBD 3TJHD 3VWJC 5FEBA 1LEGA 2JELL 1KXVC 4PRIA 3C5ZD 4M7LH 4TYUA 3OX8A 3RZCB 5JQ6H 4RRPA 4JM2B 4GAYA 3AXLB 1IGFH 1K5NA 1JP5A 4RWYH 4MMXC 3GMRB 1F97A 4N68A 3ES6B 5CSZA 5IB4B 1A6VL 5EU6A 2XI9A 3DTXA 3Q3GA 1CE1H 4AK1A 4PRDB 3MUZ1 2D9CA 1MRFH 1F11A 1ED3A 3INUH 4C56B 5E8PB 2BHYA 5F7MC 1LO3H 4XC1H 3SQOH 4JO2H 3K7UA 2NY0B 3S34H 5FECA 5T1DH 2BFVL 4ONGH 2GT9A 1BZ9A 2W9DH 3AFLA 1JZ5A 4UILH 5DWUH 4HAGA 3QIUB 2PNDA 2WM0A 2D0FA 3O6MH 3CVIL 4ODXA 4LVNB 4M43H 4NHCL 2AXFB 1MI5B 1HILB 5M7QA 1TJIL 3TIDB 4L3EB 4XCNB 1OP5K 2NTSP 4WI6A 2QKIA 4Y4KC 4JY6B 1I1AC 1XGPA 4QHMA 5E8EA 1J1OH 1RULL 4UUJB 1WCQA 1KPUB 4JFPB 5ADPH 1LD9A 3C8HA 3MV8A 3E6HB 3S36L 3G04B 1T21B 4QO1A 3AM8A 2YRPA 5J1TC 1MLCA 3RX8A 1V7NH 2DL9A 1X5YA 2XQYK 1X7QA 3PL6C 3GBML 3PHSA 4POZC 4ZFOB 3GI9H 4HPYH 8FABA 4KK9D 1KJMB 4NUJB 4ZFOL 3BIKB 3V52H 1EEZB 4LIQE 1UACH 3D0VB 3MJ7B 1ORQB 3HR5A 1PKQB 3ZDYE 4NSKB 5FM5M 4MZ2A 3MCKA 5IW1A 1LNUB 1KPRA 5F97E 5GRZA 3VCLB 5IROC 3ZYJA 1KEGL 2P24B 1UH4A 5HVWA 3PGFH 3OKDB 4TNWK 1G7PB 2XZCH 3KVQA 4O5LH 1P6FA 4UV4H 1WC7A 4L1DA 2OP4L 3GMNB 3G6JF 4LCYB 1IJ9A 3RTQD 5C6WH 1IBGL 3VXSA 5E7FA 5JO5B 2XKUA 1WZKA 2VZSA 3P9MA 1OP3H 1J86A 5HYQB 1E4XL 1M6OA 2A38A 2C1OB 4PJGB 1BFOB 4OFVA 3FT3B 4J3UA 4P23A 3TCXA 1GCFA 2Z31B 3SKOA 1WWCA 2XA8H 1RZ7H 1SQ2N 4GAJH 1LO5B 2VXQL 1IGFL 3RNKA 1FZJB 3RX5A 1EFXD 2DQIL 3QDAA 4RFNB 4UOW1 4NFCA 4XCEB 5E1HB 1KYOJ 2R4SL 1JYNA 5A43C 2ADJB 3C6SA 5IMLB 3C60C 1CE1L 1RK1A 5CINH 4NJ9L 4ZNEE 4K2UH 1FDLH 5KBNC 4EZMA 1N5AA 5SX5K 5FV1L 3PHOB 5BZDA 5D5ME 5EC2B 1ZLUK 4XC1L 3UBXA 2CRYA 1ZT1B 4KHTH 3P4NA 2A74B 4K3HA 4R3SB 1U93B 4K23H 5T1DL 4MLIA 2B0SH 2W9DL 4UILL 5DWUL 2JIXB 4KMTH 2I07B 4FXKA 4M5ZH 3M1BA 1ADQA 1AQDB 4O2FB 5I19L 4M43L 1S7WA 2GAZA 1MUJB 3SDAA 1U91B 2IBBA 3WN5B 4D8PB 2DICA 1DQJA 4UQ3B 4OCYL 1K8DA 4L8SB 4JRXE 4LCWE 1P7QB 1DBKL 3P9LB 3EGSA 5F6IC 3O81A 1HH9A 4U1IA 1OSPL 1XR9A 1FCGA 3FQTA 3NACH 3DUUA 4HPYL 3WFEL 4P46A 5CIPA 1B0GA 4KJPD 5T3ZH 3RZCC 1HYSC 3V52L 1BIHA 2EXYD 1UACL 5I17A 3EYQC 1A7QL 1XCTB 3O4LD 4Z9KB 4M93B 1GPOL 5IBTH 3EOBB 3V4UH 3OJMB 3K1KC 4XTRC 4POYA 4YDVA 5ITFB 2MPAH 2DQEH 4JFFE 1J5OL 1IEAA 3PGFL 3MXVL 1XGYH 4QRTB 3RKPA 1G9MH 3MODL 2NY0C 4U1LB 4O5LL 3D69A 5KG9B 5C71A 5I15H 5HD8C 4PGEA 1R5WA 4RQQA 1ZV5A 2AV1B 2B5IB 4GRWF 1T7XA 4JRXA 2VDOH 2KH2B 3KPTA 4CVWA 1MCSA 3TPUB 2A83A 4JPVH 2NXZB 3RWDB 4ZPVA 3CU1A 1WTLA 4Q9QH 5KS9F 4V1DB 4I5BA 2E6PA 1INDH 3D18B 3L3KA 4HHAB 3K4ZA 2FX7L 2XA8L 4HT1H 2GITB 4LSRH 5T3ZD 1VPOH 2NX5B 3AAZB 1KB5H 3CXHK 3T0DA 3V0WH 5TE6H 1QRKA 3GUTB 4OZIE 3ZO0A 2A77L 2YPLB 4ORZC 4KHXL 3PE9A 3HI5H 3MFFA 2MNUA 1HH6B 4O2EA 5C0EB 1TVDA 3TBSB 3G5ZB 1FDLL 4LGRB 3QDJD 2R56H 3MRKA 3ARGD 5DHYB 4PJIA 3O4LB 3IJHB 1ND0A 4OB5H 2EEBA 1KG0B 3DVGA 3FQUA 1KSRA 4NDMA 1N59A 4K23L 3H9ZA 1MAJA 4MWFB 4F37F 5FYLD 3D3VB 1OTTC 1OGAA 3RBGA 1JE6A 1QFOA 4EUPA 2HTKC 5F72S 4KMTL 5HJ3B 3O4OB 1HQRB 3M8OL 1CFVH 4Z7WB 3QQ9D 1K8IA 4TOYH 4JZJA 1ERNA 5ICXB 1WCBB 2F53E 4L29A 3HAEB 2UUDH 1ZAGA 1CFTA 4YHNA 1NBVH 4IOFD 4JN1L 1L7TH 2IPTH 3SGEI 4ZPTA 4Y1AB 4KJWD 4U1HB 3NA9H 2YC1A 2HN7A 4WO4D 2CUIA 2CO6B 2HVKA 1S7SB 4OZIA 3LZFH 1A21A 4NKDB 1WZLA 2ICCA 4KRPD 5TH2B 2Z31C 3NPSC 5C0AA 3NACL 4JZOA 5DRZB 1NCCL 4R26L 4PJ5E 4FQXC 4YDKH 5KTEH 2ATPB 1VFBB 3IVKA 4FMKA 5D1QD 4N9GA 3I02A 4Z76A 4RFNC 1Q72L 2FYYB 5CD5D 4JR9L 5HYFA 2V7HB 3VXRB 3GB7A 1QTYT 3QDJB 4ZFZB 2VXVH 3QULA 3Q6GL 1WLHA 5I1KH 2CLVB 4F58H 3B5HA 3RVTD 1UCBH 1OAZH 4KWUA 1MSPA 3QDHA 4ZOEA 3KWWA 4GAGH 1JPSL 1JN6B 5FYLL 2F53A 1DTUA 1H3PH 2AI0H 5I15L 3PABA 1I75A 3CLEL 3TJEH 4LLQB 4P99A 4CVZA 3RHWF 4GG8A 1XF5A 5HSFA 1CICC 3QUXA 4OAWB 4LFHG 1J8HD 1OM3L 5DS8B 2W0FB 4PRID 2D03H 5IBLD 1INDL 2ZCLH 4FHBD 5FYJE 3DBXA 3RY4A 1EJOH 3LSOA 3TT1H 4I3GA 3U4EA 3HZKA 4YZFF 2DI7A 2DIBA 1ZS8B 1KELL 2V9RA 2WQ8A 3G5YB 3NIFF 3NAAH 5EU6D 5EU4B 5TE6L 4CU8A 2UZIL 5HHNB 5D2LF 4KROD 2NXYB 1YZZA 1KIRA 1DL7H 4XC3H 4Z78A 4YHLL 2J8UF 4MX7B 1AR1D 4AMKH 4PGDA 2XT1B 1K6QH 3RGVA 2D7OA 4NT6A 4LBEB 5C07E 4Y8AA 1OSZB 5DJ6B 2BRRH 3OXSA 4ZTPL 4ZUWA 4PJDE 1MFCH 1UJ3A 4NWUL 3QJFB 4KGJA 1NGYA 4QRRB 4LLYB 4YGAB 5CEYA 5HI5C 3TV3L 4M7JL 1C5CL 4RA0C 5EOQH 2DWDB 1CFVL 2PYFB 4G42B 3QA3B 1NCNA 3PP4H 5E5MB 5IMOA 4XPGH 3S7GA 1ULVA 1PZ5B 1NBVL 1L7TL 1OPGL 2B5IC 5DJ2B 4TNVF 2Q76A 2WUCH 4UTAH 3H0TB 3NA9L 3WJJC 1R3IH 2IFGA 2NXZC 4NZUL 5EBMA 2VTFA 3DMMB 4LIQH 4PB9H 2HWZL 4OSUL 4CJ1A 1P4IL 1IKFL 2CRZA 2Z8VC 5HI3C 5F7KC 2OZ4A 4ODBD 3QUMB 3U1SH 1XF3B 3T3PE 1U8JB 4S1DC 4JM4L 1GGIL 5KTEL 3QUML 2H45A 2VITA 4Z5RA 4ELKA 1MHCA 1CDGA 1CU4L 5H35A 1FQ9C 5HYIA 4P9HH 2EE6A 2IH3A 5C0DA 1U3HB 4JN2B 4NZRL 5I1KL 4F58L 2DYPA 5FECB 4TSBL 1UCBL 2GT9B 4PP1C 2H3NB 1F6LL 1CI5A 4P2QE 1KTLA 5AZ2H 2VQ1A 5HHOB 3CJJA 4ODSH 3U30C 4ODXB 3VXSD 1J8KA 4O51A 4OI9A 1ADQH 3UTQB 3N85H 5I9QB 4Q74A 3OKLA 1Z9MA 2RCSL 5CKGA 1KCKA 2XPGB 5E8EB 1S9XA 4QCIA 1IKNC 4P23D 2OL3B 3QO1B 2OXHA 1T4KB 2OL3L 5CEZE 4KAQH 2W59A 3VI4E 5K59F 3REWA 1WBXB 4XVTL 3KHQA 4NGHH 4F7EB 1EJOL 4YBLB 1Z9SA 2Z93A 3RNQB 1ZVSA 1ZHKB 4YDJB 5CIPH 2GFBA 1JNLH 4MSWA 1B88A 5DK0B 5BXFA 1GZQA 4APQA 3WO3B 3VA2C 3QWQB 2D0GA 1TQBB 4XZUB 4XC3L 1U8QB 3L3OB 3EW3B 3TWCH 4PRBB 4LCIH 1WSST 2IWGA 2XQBL 1EHXA 1RJYB 1K6QL 2J6EA 4TQEH 1NC2A 1RZGB 1JZ3A 2BRRL 4DVBB 4HUKB 4QXGH 3OHXA 1FFRA 1EERB 4P5TA 3HI1A 3QEHB 3WHE0 3KPMA 1ES0B 4YHOH 5FB8A 1OAKH 4PV9A 3K2UH 1S7QA 3PP4L 3P9MB 4I48A 5E2UL 1YY9D 3H7BA 3JVGC 3MRFA 1BZ7A 4CADB 4WFGD 5EWIH 1CGVA 3KPRE 3FHAA 1R3IL 4ODVH 4YFLI 1HSAA 2W1NA 1BQHB 1CT8A 2MSPA 3QWOA 3SGKA 3VFTA 3GMMB 1KJVA 5F7HA 1HOCB 4JFHE 4P46D 4LIQL 1V3LA 1VEMA 3KLHC 1CLOH 3VFRA 4MQ7B 4M6NL 4HIEB 2JCCF 1IRAY 1YNKL 2IQ9L 3BKCH 1AHWA 5J8OA 4DK3A 4P2RB 2XG5A 1S3KH 1RUMH 4PJAE 3BGAA 1TDQA 3UBXB 1VCAA 3NN8A 3P4NB 2X4TB 4WWID 4PGZA 5DVKA 3TO4C 2R1XA 3MLXL 3GFUA 3I75B 5FFLA 1JGDA 5J57B 4M4RA 4WHYG 3P0VL 4GW5B 5CJOL 5I71C 2J4WH 1BAFH 3L3HB 1RZKH 3QH3B 4XWGH 4EUPH 3ZKMD 3FRPG 3RL1A 3R06A 5DEGA 4HUXB 3VRJA 2CKBB 1KNOB 4LP4A 4IMLA 5AG9A 3QPQD 2A2QT 1XCQB 1ZOXA 2CKBL 4JRXD 4LCWD 5DT1L 4KUZH 3KPRA 3JWOL 1FG9C 1JHKL 1FG2B 4EI5C 4IRJC 2AEQL 4E42A 1K8DB 3DGCR 3D2UA 4WVRA 5ID0B 2IBZY 3NA4A 4U1IB 3LKPB 3U79A 4ZAKB 4E5XA 2BC4B 2CK0H 2P46B 4X6FA 3BP5B 5C0IB 1LP9F 1NUFA 1C1EL 4O9HL 2YXMA 2A6JB 1JNLL 2JB6B 4E0RB 5D5MB 2C7UA 3DMMC 2BXYA 4XP4H 4JCMA 5JW5A 1QLEL 4S1RL 2DMKA 5FO8B 3TWCL 3E0GA 4LCIL 1Q9LA 4ZYKB 2D3VA 5HYSA 4WU7A 1I85A 4G6FD 4MA8L 4FOMA 3KJ4C 4DGVL 4QXGL 1S5HB 1U3HC 5BS0E 3LQZA 4CMHB 2GJZB 3MRBA 1MHHA 3B6SB 3TN0A 1MCPH 4HK0A 5EIIA 4LVEA 3W82A 4J3XA 4YHOL 4YHYC 1VGEH 3LQAH 5SV3A 3DYPA 5JLZA 4TUOB 2FRGP 3X3FH 5CJQH 3A6BH 3SKMA 5HGGS 4LCWB 1CXFA 3S88H 4LPWA 4MAUL 4Y5YC 5I9QC 2W60B 3V5DB 5HGDB 1YN6B 2CMRL 4G6MH 2UVEA 4KKLD 4ODVL 4R4NC 2Q86B 1DJSA 3V9FA 2EE2A 3IT8D 3RDTC 1XF4A 5C0AD 5T1LA 4Q97A 4KPHL 3OPZL 1KF9B 4R0LA 3SDXE 4QHKJ 3VXUA 4YBLC 3SHSA 4BFBD 1RUKL 4MLSA 1F4WL 4JFFB 3WS3B 5L9DL 4M61A 1S3KL 1RUML 5AYQA 2VB5A 2CGRL 1TQBC 1RAMA 4N8VG 4G6FB 5DSCA 4NBYB 3T0XA 3IFLH 3PWUA 4YE4H 4XCFL 2SEBB 5TQ0L 2F53D 1RZKL 4XWGL 4QYOA 2R2EB 3D9AL 2F54B 1BF2A 2APFA 1FFPB 3RVWD 5E5RB 5F8QC 4U3CA 4JHWL 3CFKA 3K74B 2EDBA 1BD2E 4K55A 4ZPTB 2X6MA 4HUVB 2G75B 4C83B 5A16A 4XPFL 4LEOB 4OLZH 1F42A 3BVNB 2EDEA 5CMAA 5DHVA 1SMAA 4AENB 4JHZA 5D7JC 4DKFH 1WEJL 4CNIB 3MZGB 3MLTB 4F33B 1U95B 1HKFA 2Q7YB 3LV3B 1FZOA 4G80A 3ETBF 2OZ4H 5FF6A 1FNEA 1JPFA 1RHHA 2NY4D 5E00A 3MRIA 5INDB 4QF1A 2YEZB 5HYJE 3QULB 1IFHL 1YEIH 4NRXA 43CAA 3WDIA 2MTPA 4RFOH 4CN6A 4UOW0 1FN4A 2R2BA 3DYMA 4PY8J 3S35H 5ADOH 4TUKL 4PS4H 4JFDE 4RX4A 4XP5L 2LABA 4LSVH 1SBBA 1YUHA 5HGHA 3MRHB 3L3JB 1ZHLA 1A9BB 1UWGL 3T77A 4D0DA 2NY2C 4PJ9C 3ZT6A 3CPLB 5D71L 4OCWH 1NFIA 4N8CH 1CZ8H 3QUYB 5JA8B 3FFCB 4UU9A 2R23A 3JTTA 3JWOC 1KEMH 4ZUUA 4CAGA 4J4PC 4G6ML 4M62L 4WW1A 2JTDA 5C08A 2P8LA 1MCOH 4PJ5B 4KQ3H 3AS3A 2VZOA 2NY5C 4MJ5A 4CVUA 2CJUL 4KK8C 5DD6A 2AXHA 3UJJH 2BNRE 1XMWA 4ZAKC 4HG4K 1C16A 4YK4C 5CFHA 4X6EA 4BZ2L 5C07D 2O26U 4YJZL 4Y2DC 4U2YA 5T1MB 5KN5A 1CDIA 4H8WL 3AU1B 2VLRA 5EU7E 4EBQH 1D3CA 1U58A 4WEMB 4U1SA 2J6EH 4HS3A 4JFDA 2DYPD 4M48H 4U1NB 4ETQB 1CTNA 1EMTL 1WISA 4HIIB 4WUUE 2W9EH 3EO1B 1AE6H 3R1GL 3HPLA 1HK6A 4BELD 3STLA 3V7AE 2FH6A 2XWTB 2FJFA 1A5FL 1T1XA 1WF5A 4LCCB 4QHUA 4Y4FA 3IFOB 3BISA 4KVCL 5BZWA 3QRFM 4LRNL 5IMKA 3O3UN 5I16B 1VB9A 4X8XA 3O6KH 1X5JA 1ZHNA 2BK8A 2XICA 1NMAH 3OB0H 3PXHA 4M5YH 5FYJL 5C6TH 2DQFA 4JHBA 3FMGL 5KSVB 3EOTH 3EFFB 2BNRA 4N8PA 5C8JA 3VH8A 3REVA 2FO1A 4DKFL 4HGKC 1QRNE 1KCSH 3G6AA 1U8HA 4DGYH 3HE6C 1TZHB 5F9WB 3QHTC 1MHCB 2DDQL 5C07B 4LAJH 3WNNA 1PX4A 5L7XL 5GS1A 1T1YB 4WUUA 1NC2D 4PJDB 1FVCB 4NNPL 3NIDE 2AJYH 2QQKL 4UOJA 5IW6A 4JFEE 3FO0H 2NMSA 1MEXL 2ICEA 4P5TD 3UROR 5C3LD 5FOBB 3PJSB 5ADOL 1HDMB 3ZDXF 4XVUD 3U9PH 4LSVL 5K9OB 4XNUL 5K9QG 5GRJH 4LDEB 3DO7A 1WT5C 3OKEB 3BRDA 3V6OE 1V3MA 5F1NB 4HKZA 5SWZB 3L5XH 3OKKB 1S7XA 4JFXA 3BD5A 1T7VA 2A9NH 4N8CL 1BGXH 3ULVE 3EYOB 1ZLVK 3ZHDA 1T5WB 1KEML 2VSDA 2COQA 4HWBL 4D94A 3FQNA 2D4DA 1MCOL 4I1NB 4KQ3L 2YA1A 2H8PB 4LPXA 1OW0C 4XMLH 1HWHB 4N0CD 4MQXC 4IRSA 1S5IL 3ME0A 2GK0B 4YPJA 2GFBB 3BZFA 1JZ6A 4XNMA 1CG9B 3CD4A 5DJDA 1QLRA 1U8MA 3G08A 4G6KH 1FFNA 3RJQB 3B8YA 3RUGA 1HHHA 4EBQL 3F7YA 1V7ML 2PTTB 4FZ8H 5K9KA 4ODWA 3DURA 4P2QB 1CQKA 2OMNA 4M48L 3LKSB 2E27L 5IFHH 4GKZA 4QY8A 3MNVB 1E6OL 3MRPA 2O5ZL 2ITDA 2A73A 2W9LA 2UY6A 3T0EA 5FB8B 1S7UB 4R8WL 1OTSD 1I9RH 5GGVY 3VD9A 4OF8A 1G6RA 4WRLA 3U36B 2N7AA 4IDLA 2NR6D 3FB5B 3KPRD 3MLZL 5TDNA 5C0JA 5CEZL 4JQIH 5I1LA 5DJYB 5D1XA 5EN2A 4X7SL 1SJXA 3D2UD 4U0RB 3MV7A 1P1ZB 3G5VB 3QUYC 4DZ8B 1CT8B 3E1F1 2WP3O 1EPFA 2RQ8A 1NGPH 4OZHE 1T04B 3DO3A 1BOYA 4OD3H 4UINH 4RMVA 1JWSA 3PGDA 5CJXC 4LNRB 3GIVA 1WWBX 2BY0A 5IHLB 3K80A 1VENA 4JVWA 3STZA 3BP6B 3DJ9A 3GSNA 4H8WC 1B0WA 1SYVA 1C12B 1JUFA 4YDIL 5GS0H 4HEME 3GEWB 3FO0L 1KB9K 2ZPKL 2EDTA 2HLFD 4GS7B 4TVSa 5GZND 4YFDB 3TN0D 1TNNA 1Q0XL 2RIKA 2IADB 5DEGB 2Y5TA 5JHDA 2WBJB 5D8JH 3L5XL 5B4MC 4TTDC 5H2BB 3KPRB 3OJDB 4U3XA 1BGXL 4X6DF 3RX7A 4E42B 5DI8A 4KJQD 3D2UB 1KJ2A 2CXKA 2C1PB 1I3GH 3FO2B 1DDHA 4PJFA 4U31A 1I3UA 5DHVH 5TGBA 2EKSA 4HWEH 4B7LA 3VFVB 3VXUD 2YR3A 1A7RL 1INQA 5EBGA 4PJAB 4P3DB 2IH1A 1V3JA 1UEYA 3LH2H 5GRUL 3NIGF 4J12A 3LKNB 1Q9OA 3VMPA 2XN9A 3NCCB 5DR5L 3X13A 4EIGB 4WTXA 3R8BB 3L95A 2XOTA 3AREB 4NQDE 5J12B 4RISL 3ROLB 2YPVL 4X9FA 4L9LA 1NSNH 4GSDH 3IDJA 2F9BT 3OG6B 3GO1H 1MJJB 3BZEB 2PW2A 4ONHB 4HK0B 4YC2B 4OD1H 5D7KE 3H42H 1M05B 4NCC2 3ILQC 2H2PC 5I1EH 2VSCA 5GGRY 3ZDZF 5F6HJ 5FGBA 3O8XB 1RZIA 2IPKB 4HC1L 2FGWH 2N7BA 3TBTA 1QKZL 4KKBC 2FR4A 2G60L 4EJ1C 4U0QB 3HE7A 1LILA 1NKOA 4JPIA 3NCJL 4BK5A 1BJ1H 4XP6L 4D0CB 3GJEA 4J7RA 4HQQH 4XCCL 5C0RH 5I8OL 4UINL 4WY7H 3ZMRA 1NC4B 5AZEH 2EE9A 3P77A 4WDIA 3WIHL 1X4YA 1KTDB 4MNHB 1XH3A 2NZ9C 5E6IB 4HJ0C 1O0VA 5BS0B 4HIJB 1FLTX 5I1IH 5C0CA 5J6HA 2LU3A 2BSTA 4QWWD 3PWUB 3NOIA 1P4LA 2VERN 4MD4A 4Y4HC 1W0WB 3MOBH 4RX4D 1NDMA 1K2DA 2ZUQB 1SVCP 4JY5L 1P4BH 4ZFFB 5EUOE 1DSFL 1BD2D 1JJUA 5IWLA 4HFUL 3BE1H 1EA9C 4MGXA 4OBSA 4R7DB 5T5NF 2P44B 4ODHL 5GJTL 2DJSA 5J4MA 5I73B 1JRHH 4K3GA 4QRQB 1KN2H 4KJYB 5C08D 5DFVD 1RZJH 3MRLA 3SDXB 1MVUB 1F13A 5GPRA 5IB3A 4EIZC 5DJ0A 1KIPA 3QXWA 4HH9A 4JLRA 3MO1B 5EORH 4WI3A 5ERWB 3TCLB 4P4RB 3LH2L 4JGJA 4JM2F 4M1GL 2DQCL 2VLRD 2R9HC 1U6AL 1H8SA 3PWPA 2Y07H 1CBVH 4JFDD 3EHBC 5L88H 3VXNB 1BFVH 2OLDA 1VFAB 3P3YA 4QTHB 3QIBB 1HHGB 2G2RA 2D7PA 3HNTH 4JZNA 1E0OB 4MJIA 1DR9A 4H1LA 3WNLA 2BVQB 3T1WA 3OZ9H 5I1HH 4GS7C 3IDNB 4HGWB 4Y4FD 1E6JH 4OD1L 1WAAF 1BD2B 4G8EB 1UC6A 5I1EL 1N64H 4NRYA 4Q2ZB 3H7LA 2VN4A 3DYOA 1Z9OA 5IK3B 5EZLA 2YD6A 3C08L 2B4CL 4IS6B 3FB7A 3ZTJH 1JK8A 2R23B 2WBJC 3BFOA 1UYWH 4ZUUB 3CXDL 4YXKH 1OAXL 2V2XB 3FRUB 5E8NB 3BZ4A 4JQXC 4PTTA 1LE9B 4I2XA 2BNRD 5DYOB 4RGMB 3MROB 4LF3B 5LGKA 1H0DB 5D70H 1AO7A 1LMKA 5SWQB 2NY1C 3LHPL 5C0RL 3LRSA 3O0RL 2MHAB 4YPGA 5HYJB 3OKMB 1WIPA 1VGKA 4LCUA 5AZEL 5KANG 2V17L 3WUWA 2R0LH 2XRAL 5IVZA 4JDZB 1MLBB 4Q6IA 4WUUD 4K3EL 2WLYA 1NGWB 3VW3H 3IFPA 1EAPA 3IAGC 4MHHG 1RIHL 2CIKB 3B8SA 4LRIA 4MD5B 4WU5A 2VDML 5GIRA 3BDXA 2YRLA 4U1JA 4Z18A 3O6FA 5TF0A 4XHJC 1PFCA 2BMKA 5CUSH 1ZTXL 2IPUG 3RVUD 1T1XB 3RU8L 3U0WL 1P4BL 3ARDA 2J5LB 2Q7NA 5ICYA 4YC2C 1IGMH 1G6RH 3ULVH 1WZ1H 3WHXB 4NC0B 5IEHB 1JTOA 4PG9A 3RAJH 2F15A 2GKIA 4FTVE 1FE8H 1I7ZB 4GAFB 2ZNXA 1QRND 3ARUA 3KPLA 1HSBB 3MV01 3VH8B 1QVOB 4EDWH 3SO3B 5DUML 3G6JA 4QLRA 3C6LC 3MYJA 4IRSD 5TDPB 1DVFA 3GSQA 4PJGF 2V7NB 1ZHBB 2X7LB 1OY3B 5LWYL 5TE4L 3TPKA 4NKMA 4UIMB 5EA0H 4I0KA 4P59L 4HCRL 2Q6WA 2AJSL 3GSNH 4FQCL 1YN7A 2HJKA 4JANA 2Y07L 1N0XL 1CBVL 4HMDA 4ZSOE 3H3PL 4MMZC 1IL1A 1ORSA 3JV4A 1MRDL 3HN3A 3GM0A 2VL5B 1C5BH 2FZ3B 3L3DA 1DQDL 4P48A 3OZ9L 5C6PB 5I1HL 3FQRB 3GMPA 4GQ9H 3ULVD 2ZUQC 3LN5A 3MA9H 4GG6F 1BQLL 2AEWA 4Q6YA 5EO1B 2C3GA 5D1XD 2YD5A 5LCVH 1NEZG 3OF6A 3MV7D 3CZJA 4CVXB 3KYNA 1J12A 1XAUA 4YR6A 1KJ2H 1QRNB 3LMJL 2X9YA 1QFUH 1I1YB 3TJHC 5I73C 5D70L 4HD9A 3CFCL 5E08L 1XR8B 2IBGA 2FWOA 2CLZB 1U41A 3IXTB 5IQ7L 3BP7A 4GRMA 3J8F7 1U2HA 3V0VB 3UYRL 1G9NH 4JFEB 5HHPA 1MCBA 4HDIA 3MRCA 2PUQT 3UYPA 1QBAA 1HHJB 2QADD 4ENEC 2FO4B 4X5LA 1MCFA 3UJIL 4WFFD 3DROA 4LSQL 2F5BH 1S8DA 4KMLB 2XTJB 3CDGA 1FL5A 4MNGE 4Z7UE 3EAKA 5JHDD 3K81A 3MLWH 4X4ME 3I2CH 1G7QA 5F21B 2IGFH 1G6RL 1A3RH 3CFDA 2YN3A 1HHKB 5I1LB 3I84A 1IAMA 4WWKB 3RAJL 5FCUH 2B4CC 5GJSL 1FE8L 1HHIA 5IVNA 5HDOA 4U7KA 4J3VA 6FABL 4K7FB 3E8UL 4EDWL 1H8NA 1PYWA 2EIEA 4DCQA 2EH8H 4OLVH 2VDKL 1VESA 5IFJB 2VISA 1I8IA 1JWSB 1LWRA 3DX6A 5E95B 1OD9A 3WLWC 4IIQB 4DQOH 3EO9H 1D6EA 2XN9D 3VXPB 2PCPA 2ZUVA 5KS9A 5ICZA 5LGJB 1KC5L 3MGAA 2BJMH 4GRLC 1D9KA 5F9JB 4G8IB 5J3HD 5EULV 4K3JH 1F3RB 2ORBL 1QBBA 2D31A 4MNGA 5IHZB 4UDUB 4KFZC 1U92B 2N4IA 4YLQT 4NM4H 3M17A 4WHCA 1D7FA 1YJDL 5JW3H 3N50A 1ZA3A 2Y5TB 4GQ9L 1A6AA 3RWJA 2DQJH 4XXCC 3MA9L 2Q8BH 1K4CB 2YUWA 4HPOL 5FHBH 1FAIH 5DUPH 3HE7D 3P30H 2H26B 4ZQKA 3TEUA 4Z7WF 4TVPE 2UUDK 4OZHB 4PV8B 2X1PA 3HZMA 2C3HA 3SO5A 2DJ4A 4FFVC 1QFUL 2VWEE 2FSEA 1NAMA 5ETUB 3B2UD 4RGNE 2BHUA 2HT2D 5EOCH 3WFZA 1UB5A 3SO3C 1IGCH 4WEBL 3Q5OA 1PJ9A 4KZEH 3P0YL 3BPOB 1PAMA 5EOTA 1OAYH 4RAUA 2G9HA 2QBWA 3VWKA 1Z5LB 3S3SA 2XNAA 5C0CD 4I77H 2DWEA 1F4AA 4D9LL 32C2B 3PHQA 4EI6A 4IHOA 2AEIT 1JI2A 3VFSA 4OGAC 1MIEH 3MFGB 3MX0A 2ARWA 1RUQL 1QACA 5F1KC 2ZUTA 5JORB 4N8VB 4H1LH 1OCWL 4YZFE 5E2TL 5F7DA 5C09E 3NIFE 3TF7C 4JKPH 3C2AL 1AI1H 4HJJL 2YBRA 5CWSA 2IGFL 4OF3A 2AK4A 1A3RL 1P84J 4QXUL 3HC3H 4R2GC 5CJ8A 2IALA 4P5MB 1EHNA 3CUPA 4S2SA 3W9DB 2IAMD 4NQSB 3IGAA 1ETZA 1DP0A 1FGVL 5M95B 4IDJL 2EH8L 2AGJH 4OQTL 1VACB 1MPAH 7CGTA 4U6HB 1BIIB 4ZD3H 4YUEH 3QFDA 2V2TB 3P77B 2CDFB 1BVLA 1PG7X 1MAMH 2L7UA 2W0PA 1F3JA 2AJ3A 4NQDB 5D4QA 1SEBB 1U8IA 2EXYC 2LV4A 35C8L 5AWNH 2VC2H 2HMIC 5I1JL 3WIIL 2FEDD 3RY6C 2BNUB 1A64A 1JBJA 3PDOB 3X11B 5IOPB 3UTTA 2J88L 3TBVA 5A3ID 1A22B 1YPZB 4LSPH 2OQJA 5ESAA 1IAOB 5C09A 4MJID 4Z7QE 3WD5H 5KVFL 1U8NB 4PRNA 1S78D 5D2LA 2HAZA 5DMGD 5CZXC 5MERA 1N6UA 1I7TB 2EYTA 4F8QA 2J8UA 1TZIA 4F57H 4NQEA 1PVHA 3FTGB 5CJBA 1E28A 4F7TB 2DQJL 3I85A 1UM6L 4GW1A 2XTJC 4AT6A 4NQCE 4V2CB 1FAIL 4AL8H 2DQUH 3IDYB 1SYSB 1TQCC 4G7VL 5FK9A 1OARH 1DE4A 4NPYB 4WWKC 3MRLB 2XA3A 2IAMB 3DUSA 3UCRA 5EH1A 1AO7D 1BVKB 5D72H 4JFOB 4LLUB 3VFPB 2FLRT 1S9VB 1MH5A 2PR4H 4R90L 3W2DH 2AEPL 3MXWH 4YWGH 1TJGL 4JLRB 1HXMA 2KBGA 1U8OA 1MY7A 3U82B 3S6CA 1K85A 2C3XA 2Y36H 5GXBB 1CD1B 4ZTOH 2QEJA 4IIQC 3PIQB 3IKCA 4ZUSA 2X41A 1PEWA 4I77L 2H2SD 4XBGB 5HDLA 5K59E 3O6FD 5EUOB 5IIEA 1UZ6F 4JZNB 4Y7MA 4R9HA 1J88A 4H1LB 1HI6B 3X3GL 4L3CA 2M26A 4HXAL 2AW2A 3ARDD 2N56A 3FKUS 2PKDA 3EJZC 1YJDC 4JPKL 4AG4H 3ARBB 2PO6B 2XZQL 4WUKL 3KYMB 4JB9L 3U4BH 5CD3A 4OCLC 2JJSA 1TTGA 3QQ9C 5HHXH 1B0RA 3HC3L 3OL2A 4EKXA 2JLLA 2A6KB 2PYEE 3NGBB 2X4SB 3EOAA 5TJWK 5BW7A 1ZXQA 2ZUYA 2ZUUA 3EOYG 4PFEA 4MAYB 3T3ME 4I18A 4XRCB 1CGUA 1SJHA 3KDMA 5F7FA 4W4OA 2X4PB 2QQLH 3NZHH 1CFNA 4KRPC 5FA4A 4MS8D 4UNUA 4ZD3L 1GH7A 1MFBL 3VGBA 1MHEB 1MAML 3HI6H 4L4VE 4AIZA 1IC4H 5F70A 1R3JB 5ILTL 5F9DC 1PDKA 1M1SA 3DI2B 5KANI 5CD5C 3QI9C 4Z7OF 4MXWH 4DVRH 1ONQA 1JZ7A 3RWFA 2W65B 4JDVB 3TNNA 4F7PA 3KAAA 5DJXB 4X6CE 3OAZH 5HY9A 1RJLA 4P3CL 3MLRH 2X4QB 2AV7B 3GSOB 1QZ1A 3PDDA 1DBAH 1Q9WB 3CFEA 3MLPA 1RQ5A 4Z77B 1J11A 3VFGL 2EEDA 3AB0C 3OF6D 4NN6C 3QO0B 5F3HA 5DVNA 4UBDC 1G1YA 4PD4J 5TDOA 4XBPB 4X80H 2ZOLB 1N0LA 3LD8B 4E41E 5IFAH 1SMOA 1QQDA 2ZWLT 3GSQB 4L4VA 1NGXB 1MRCL 4GRWH 1EJ6A 5DMIH 2X4UA 2ZCHL 4KKCD 2QR0A 3OKNB 3SOBH 1R3KA 2OR8A 3ILPB 4IOIA 4NN7B 4EOWL 3MRDB 4LARH 3QDME 1YEKL 1BHGA 4J8RB 3G5XB 1AIFA 4NCC1 5MENA 3U7YH 2D9QB 3QSKB 4UZGA 2DM3A 1ZLSL 3FO9A 3SGJA 1CFQB 3PWNB 4PJXB 3QNYB 4WHTA 4XB7A 3V4VH 2JCCA 2NLJA 4G7YH 1RUAL 1H3VA 4XNQA 1FYTE 5FO7A 3FOMB 4FTVB 5B3NA 3HG1A 1KENL 3L7EB 2ZJSL 5HHXL 2OJEA 1C7SA 4URTB 1WIUA 3LB6C 1Q94A 1JGEB 3HZVB 3L1OL 1U9KA 5BV7B 4PP2B 1SBSL 4OUUA 1NAMH 4TPRH 2YPKB 5JNYA 5BV7L 1TCRB 1WTGT 1PQZA 3MCLH 2EDWA 2BVTA 2O5YH 4D3CL 5JPMA 2HT3D 2UYLB 2QQLL 2E7LA 1LO4L 2JK5B 4RDQG 3HI6L 4UDTA 2VKXA 4G5ZL 4EQ2A 1F6AA 5JUEH 3HS0A 3H9HB 4I4WB 4ZSOB 3WFHA 4NKOA 3OTTA 5JW4N 4HDIB 3T1FB 1D9KD 4MA3A 2PN5A 1BM3H 3MRCB 4V2BA 3FB8A 4NZDA 5D5MF 3V6FA 1GGTA 4MXWL 3VFMB 4WI2A 2F19H 4C55A 1L4IA 4JFYB 1LP9A 3UC0L 1J05A 1FYTA 1CWVA 3U48A 1I3RB 1QG3A 3MLRL 2VDPH 3CDGB 4ZO6A 2ZKHL 4PGBA 4X6BB 1MHPH 1YMHA 4HIHA 4TRPL 1NANH 4M6MH 3BH9B 5AG8A 4FFZH 1QYGH 2YMXL 3QCUH 3VFNA 3ARBC 2VDNL 1HNGA 5TFSH 4CMMA 1JYXA 1AP2B 4X5WA 1FNGB 2GY5A 2ZOKB 4P23C 1KCVL 4YXHH 4X80L 3NGBC 3MLYH 1J9CT 5GSRA 1JHTB 1F00I 4NN5C 1J0ZA 2WIIB 5IB5A 4MAYC 4I13B 3V8CA 4DTGL 1D6EB 4PTUA 3SOBL 4PRAA 3KYOA 3VWKD 5CCKL 4DZBA 1KCRL 4FA8A 2Z91B 2VE6B 4HSQA 2V5SA 3U7YL 4HKXB 1A1NB 3BT2L 4Z7UB 3BJLA 1A6TA 1FJ1A 1JNJA 5IESL 2Y6SD 4YO0A 3V4VL 4WGWB 3SY0B 5DRNA 1TTUA 3MRMA 2EIDA 1VSCA 2B8OT 1KBGH 5E6YA 3B5GA 2AK4D 4AH2A 4PY7B 1U3YA 3SDAC 4OCXL 4YNYB 4KY1L 4WV1A 3VD3A 3DX8A 3D85A 4RGND 5B39A 4DGIH 2ICWB 1K4DA 3BD4A 2GSGA 2FSEB 3FT4A 1ZEAH 4NZTH 3RIAF 1NAML 3O2VH 1AGCB 3MCLL 3LD8C 2R0WL 1BX2A 1F90H 4QNPE 2EIZA 5HI4C 1X6LA 2Z4QA 1VKXA 1I7RA 3SCMA 1MFEH 2P7TB 5JUEL 3RWEB 4N5UA 4TULL 1Q9KA 3OXRB 3U0TB 2P42B 4XI5C 4OZGE 1GGCH 2F19L 5C09D 4IHOB 2GIYA 3Q6FA 2QQNH 3DSFL 4HXBH 4N1CA 4LLMA 4MCZA 3GJFA 3CZFB 4LHUG 5H37G 5E56A 1TVHB 2AXJA 2BCKA 2LVCA 4NQED 1KXQE 1L0YA 3ZKMC 3B5TA 4M6ML 2DIJA 5KW9L 3UO1H 3AS1A 2R29L 4TVPL 2PTUA 2I9LB 2YK1H 3L9RB 1EEYA 2ZCKH 3QCUL 4N0YH 3S5LA 1A4KA 3QPXH 2FD6L 1NFDE 4ODTL 2EKJA 2HP4A 4RGNB 1ZWIB 1A2YB 3IGAB 5J6GA 4HUWB 3VXME 1ETZB 4YXHL 1ZT7A 1JWUB 5D2NA 3ZZ1A 3MLYL 3S4SA 4NKQB 3FB6A 4X98A 5DRXA 5IJVA 2UVFA 1D5BB 2I5YL 1QR1B 3BEVA 2PXYA 4KV5E 1IGJB 3UEZA 3CCHA 1FCCA 5BV7C 3HMWL 5GGQL 1P7KA 1BVLB 2IANE 3IU4L 2E9BA 5JIKA 3GMQA 1H9VA 2C4XA 1XGQB 4J6RL 1RHFA 3O3DB 4YBQD 2XYCA 2QLVB 5ID1B 2VXTH 2CDEB 1FGNL 1Z9LA 1BBJA 3ZL4H 3KNBA 3QG7H 4JO4L 1I8MB 2QTEA 2HRPH 5D93B 4ZDHA 4WHDA 1JF1A 4PRNB 1ZT4A 1RSFA 5ANMB 4FFYL 1N4XL 4NO0B 5EFIA 3SDCB 5JDJA 3VU2A 1CLYL 1KBGL 1U3JA 5CP7A 3X14B 1MIMH 4KTYA 4JZJC 3UTZB 4R7NB 2R1YB 1MCNA 1WWAX 3DVNB 4TUJB 4YHKL 1SHMA 4NP4H 5IVXE 3P4MA 4DGIL 5DO2C 1I8KA 2QHRH 3LEVL 5MEOB 3OB0K 5FA3B 2IANA 2QQQA 2NQCA 4LASH 2Y72A 3U83A 1AD0A 5IMMB 1BJMA 1OAQH 1F90L 2AXGB 2BDNH 1AGBB 1QO3A 5IG7B 1FO0A 2Q8AH 4NOBA 2EDNA 1MFEL 3BX7C 4PRPE 4OCMC 4K94L 4Z0BL 4LSDA 4FNLH 3IKCB 1OAUL 4ZUSB 4DN4L 1MQ8A 5MEPA 1NMCB 5DA0B 3CSYA 3A6CH 1ACZA 1JPST 1UQSA 4Q9RH 1NCDH 1FIEA 2NTFB 4N5ED 5J1SC 4LK4A 3KPSE 5HGAA 2AS5M 1G7IB 1X4ZA 4PJDF 3NPZB 2X70B 4UV7H 4JAMB 4NQCB 2YD9A 1RFDL 1A3QA 1EXUB 1NGQL 4WGVB 4X4YA 1P2CA 3UO1L 4GXUM 2ZSWB 1HCFX 2FH8A 3SE9H 3CC5B 2ZCKL 3QUXC 3WV0A 4PRHE 1YECL 5KSAA 4HLZH 1IGTB 4M1DH 5I18L 5J1AA 2X1OA 5IBUG 4NBXB 2I9TA 3QIWD 4P49A 2VAAB 4L4VD 1MFNA 3LS5H 4M7ZB 5IKCB 4DAGH 2JF1A 3B9DA 4NKIL 4XVSH 1CFNB 3U7WL 1A1MA 1XGUA 1EK3A 3LKQA 2XQYG 5GRVL 4X7FC 4Y19A 5D1ZA 3U46B 2EXWC 3T3PF 3V4PH 1EAJA 5F9OL 5GISH 2O61B 3TZVD 25C8L 1H5BB 4OIIL 1T0PB 1EEQA 3DARA 3EYVA 4GUPB 4OLUL 5F3BA 3MRRA 3LIZL 2A6IB 2R2HA 4OFIA 3RGVC 3MBEB 2CH8A 4GKOA 2IMMA 4NOFA 5ABDE 5B38G 5IT2L 5KZCD 3ARXA 4YH6A 5DLMH 5C3TA 4RMUA 1NDGA 3SPVA 4HUNB 2B7DT 3SKJH 2ENSA 3CSBA 2FIRT 3SDDA 3HG1D 2PYEB 4UAOC 3TA3B 4Y16C 1IARB 1ZMYA 3BDBA 3QG6B 5D96B 3PV6B 4LSTH 2HFGL 4B41A 4O58H 5ESVB 1FL6B 2KKQA 3H9YA 4MCYA 2HKHH 3FCTB 3QHFH 1N8ZB 2B2XL 4D9RE 4M03A 3JV5A 3VI4F 5L2KE 3FN0H 3QIWB 3IF1A 3CH1A 2UWEE 1NEZB 3THML 1QSFB 3EFDH 3BW9B 5HBBA 5JHLH 4FQJL 3TNMA 2ITCA 3HLAA 1LDSA 4NQXB 1OF2B 4IOIB 5FGCE 1QLFB 1MCIA 3TZVB 3F5WA 4PLOB 1T0MB 2YWYA 3VWJA 3HMXA 1X5FA 3GIZH 3NMEA 1QPPA 4PJ8A 4X6CB 3TFKD 1JNHA 4QXTA 3BWUC 3MR9A 1M7IA 3QXUA 1FYTD 4G8FB 5F7EH 4Q9RL 4NO2A 4WHTB 3NCMA 4Z7NE 4EN3B 5D93C 3I6KA 5HDQH 5EPMB 1U8KA 3FT2A 3ECBA 3TLRA 4F9LA 5ISZB 4PUBL 1YEGH 3DOSA 3RWGA 2OTWB 1OLLA 4N90D 3SDCC 1SVZA 3SE9L 3O41B 5F7NC 4E41B 3CAFA 1GZPA 4ZUVA 4GBXA 4ZS6C 2BHZA 1Q94B 4K9EL 5CZVH 4BQ6A 5K9JL 4LLWA 4S1QH 1UGNA 1QBMH 4P2YA 4Z0XB 5JR1H 1SEQL 2R69H 5DD5H 1CN4A 3L7FA 4ZUTA 1LK3H 3LEXB 2AJUL 4DAGL 1F8TL 4XVSL 4Z95H 3L5WA 4P4KB 1R3LA 3QDMB 4KRMB 4UB0H 4X6DA 2BVYA 2P8MA 5DQDL 1KTKE 3ZDZE 4APQC 1JGVL 1RJCA 4IBLT 1NKRA 5AYUL 5L8LB 1MJ7H 3WXVL 1T2XA 4OGXH 3ELAT 2GEEA 2NW2B 3EYFA 3V5KB 5IUSA 4PJAF 3VI3E 1MWAB 2R8SH 3MUJA 1MWAL 1J05B 1FYTB 3TO2A 2CR6A 3PL6A 2VLKE 5I0DA 3IAQA 4P5TC 3DRTA 3KXFA 3EYUH 5I76B 5I8CB 4PGBB 3GJFH 4XVUC 1AJ7H 4HZLB 3QNZA 4HZAA 2ZSVB 3RWCB 2UY7A 4LSTL 5IF0B 2E9IA 2OR7A 1EVUA 4O58L 2X2YA 3D85D 2V2WB 5IROA 4YXLL 4NNYB 2BY3A 2HKHL 2V5RA 3S96B 1FRGL 5IJKC 1A7OH 1A1OB 4S0TD 1UM5H 3N1PC 2DQDL 3FFDB 3MC0A 2GTZB 3C8KB 4MDJB 5C0ND 4XT1C 5FDWA 4XNZB 1FIGH 3GBNL 4M7ZC 2G5RA 2EDHA 3DV6B 3K0WA 4YIQB 4ZS7L 3SCMD 4PLJC 1A4JB 4K71B 2KPNA 3IDXL 4JQVC 4YHIA 4PPTA 4DUXA 3HNSH 4JO3L 5DJAA 4G43B 3LOWA 3ULUC 4NJAH 1CDUA 4FFWC 4F7CA 4KDVA 4O02H 4XPAH 3EDJA 4LLVA 3LPGA 3LPFA 4Q0XH 4DN3L 1XF2B 1AD9B 2BVUA 3KR3L 3GGWA 1XF1A 4PB0H 4OIAA 2X89A 3ZKXC 1IGIH 5TE7H 4AH2B 2DOCA 3C60A 3OAUL 4ZFGL 5GGRA 3TA3C 1F45A 4H25A 1WK0A 1T1WA 2EIBA 4I0PB 3DETD 3KYKL 2WUBL 4B7IA 1QBML 4OZ4B 5HGBA 2PXYD 1JV5B 3G6DH 4HF5H 4NQUA 4EXPX 3LS4H 4CU6A 3CIQA 1BJ8A 4PLKC 4EVNA 1G7JB 3SDXF 1VKXB 1FO0H 1DLHA 2APTA 4LKXB 4DEPC 2ID5A 4MA7H 2P43B 3U7AA 1V8HA 4ZO7A 4AZ8A 4LSUH 5C0FB 3LDBC 1AKJB 5GGSB 1EO7A 1NLDH 1MCWW 5AUMB 4PIRF 4LLDB 5FYKH 2HLFC 3GJFB 3RZCA 4JM2A 3AXLA 4ALAL 4RGOH 2HT4D 4ZOCA 4EN3C 2FLBT 4FS0A 3GMRA 5FYKU 5IEKB 5CSGA 4BH7B 2J12B 3ES6A 5IB4A 3BHBA 4LKCB 3SE3C 3VXMD 2H9GB 4PRDA 4Z7VE 4C56A 5E8PA 1JIBA 1GHFH 2VLMD 4KJQC 1NL0H 4MXQD 1WUNT 4WCYH 5FUOH 2WP3T 5DRXB 2IAND 1PKQE 1DBBL 1WAAA 4B5EA 3BRGC 3O9WB 3WDHA 1ZANH 1QFPA 1CF8L 1P7KB 4R0LC 2Z8WC 4FG6D 4S0SD 5J7CC 2QJDA 1OTUD 4P4KC 3V6ZB 1MJ8H 4OZGB 1A14L 5EUKB 1MI5A 3QHZL 1HILA 1KT2B 4K8RC 4NRZB 4Y5VB 2W0LA 4L3EA 4XCNA 5ALBL 1NLBH 4NJAL 5GS0C 4JY6A 1JI1A 4MB4A 4UUJA 5DRWA 1KPUA 4JFPA 4XNXL 4XPAL 1JF1B 3E6HA 3G04A 1T21A 3UJTH 1ZT4B 5FYKD 2J8OA 1JMXA 4TTGA 4GMTL 1YEFL 3GNML 4YHZH 2J3SA 4PB0L 4N9OB 4ZFOA 5CS7A 4PJBE 1NFDB 3OV6A 2CXGA 5HXMA 1DLFL 1KJMA 4KGLA 1FNSL 1EEZA 4L5FL 4WFEE 3P0GB 1JHLL 5KSAD 3D0VA 3VXMB 3MJ7A 4C4KT 1CL7I 1ORQA 4ZNCD 1JFQH 1PKQA 1XZ0B 3BESR 4NSKA 4L8DA 1KLFA 1AGEB 1LNUA 4AY0A 3GMLB 3VCLA 2NY6B 1CR9H 2P24A 1GIGH 1JCKA 3G6DL 3OKDA 3U0PB 3NBNA 2YKLL 1G7PA 1YEJL 4Y19D 1FO0B 3BQUB 1CK0L 2HH0H 3K8KA 4HUUB 4XNZC 1FO0L 2G5BB 3GMNA 4LCYA 1GOGA 4ISVB 3PWVA 4GG6E 1PGRB 3UTPD 5JO5A 3I6LD 1R5VB 4UNVA 3HUJE 3KPSD 4K71C 5HYQA 5F8RC 3HMXH 2XACC 1DBJH 5FUCE 2C1OA 4LVHC 1BFOA 4PJGA 1HWGB 3FT3A 4S1SH 5B8CB 4QWWC 2Z31A 2FX9L 1D5ZB 3VGHA 2GYSA 1M71B 2GUOB 2DM2A 3GSWB 4HBCL 5F71A 3SDDD 4PRHD 1LO5A 1QFHA 1N26A 1YYMH 1FZJA 5LGHH 3RFZC 2IG2H 3IFNH 4YHPB 5IVXB 5MP6H 4OV6F 2NYYD 4XCEA 1OLZA 3MLVH 4GMSL 5FKAB 5ALCH 3SKUD 2FATL 1JPTH 2ADJA 2O5XH 5GGVH 5IMLA 3QEQE 3DI3B 3DXAE 2HKFH 5C0GB 3PHOA 5EC2A 1ZT1A 2NY3B 4LOUC 2I9TB 4RZCB 1VDGA 2RGSA 4R3SA 1U93A 1MFDL 4MVBD 5DA4A 3CX5K 1DUZB 4PRPB 4YX2L 2A9MH 3HTLX 3LKRB 4GG6A 3A67H 2FX8H 3SN6N 2JIXA 2I07A 4FP8H 5L2JB 1AQDA 2BNQE 3B2VL 4O2FA 5FXCH 3IJYB 3EYVB 1MUJA 3VWJD 4PJ8D 1U91A 1KCUH 3MUY1 3BEWB 4D8PA 1NLBL 1RIVL 3KPSB 5A1AA 4IOSD 4UQ3A 3VGAB 3NIDF 4QKXB 4QRUB 4L8SA 3ZKQD 1P7QA 3P9LA 3OGOE 3ZHLA 3WJLA 2Y06L 5A2IH 5JIPA 3UX9B 5CGTA 3SDDB 4PRHB 5LKNA 2DMBA 3DX9B 3TM6A 4GXVL 2OSLB 4A2LA 4D9RD 1J1XL 4GBXD 4K3DL 3VGDA 5H94B 1WZMA 1XCTA 4KDWA 2YXFA 2AJXH 3EOBA 4RBPH 3IF1B 5ITFA 2DRUA 1LEIB 3TYFB 4RIRB 2IFFH 4QRTA 3T0BA 2BNQA 5IR1B 1GYAA 1VEOA 2OJZH 4U1LA 5DF0A 5KVGH 3O9WC 4OM1L 4CGTA 5KG9A 4XMKL 1FAKT 1D5MB 3D3VE 3MRNA 4Y4KD 4G6AC 5IM7B 2AV1A 4QT5B 3VWJB 4O2CB 5D6DC 3WJJA 5A2FA 3TPUA 3O3AB 1DBJL 3PL6D 4LMQE 3RWDA 4Y5VC 1JF6A 4NO2B 5DQ9B 4V1DA 1AXTH 3KXFD 3UZVB 3D18A 4HHAA 1H3TA 3LVEA 2AQ1A 2NX5A 3AAZA 3WKML 1DUYB 3IFNL 5FGRA 4NFBA 3GUTA 3HB3C 4OFKA 2YPLA 5ALCL 5INCB 2YA0A 2JJWA 3KPPB 3VMNA 5BVPH 1HH6A 5C0EA 5FKPB 5ELIA 3RI5K 5L2KB 1JTPA 1BREA 2QL1A 1AGDB 4JY4A 3TBSA 2UWEB 3G5ZA 3ZYIA 2HKFL 3CMOH 3VXQB 1BPVA 5DHYA 3HRZB 3O4LA 1KV3A 3IJHA 5D6CB 2JJVA 4CUCA 4X83A 4O00A 1NAKL 4JRYB 4MWFA 5FGCB 1HZHH 3L5WB 4OZHF 5TPWH 3U6RB 4IRSC 3D3VA 4NQTA 2FX8L 3W11C 3MACL 3N1MC 4FP8L 3PQYE 3QDGE 1HQRA 5GS2H 4Z7WA 4OIBA 4Y4KB 1I1AB 1IKNA 1A7NH 3GSRB 1WCBA 5ICXA 5SWSB 3HAEA 1FPTL 12E8H 3L6FB 1I1RA 3ARQA 4XNYL 4Y1AA 5DTFB 4U1HA 2OI9B 2YD2A 2JELH 2VN7A 3CK0L 1E27B 2FBJL 4D2NA 3BRFA 3DPBA 1HE7A 1S7SA 4NKDA 2XXCB 2VNCA 3T0EC 3KG5A 3OKYA 5TH2A 3ALWA 5CBEB 2X89D 3C60D 1S7VB 1Z3GL 1T80A 4X0KB 1A6VH 1DQTA 2VUOA 2ATPA 1VFBA 2NCMA 2FECI 5GS3A 2FYYA 4K7PY 3HR6A 3QAZC 2V7HA 3WS6C 3VXRA 4ZFZA 5EZOL 3MJ9L 3BI9X 2Z92B 5IQ9B 2CLVA 5JXAL 3JTSA 2BFVH 1PG7L 2NY3C 5DD0H 1BECA 2IFFL 2FJGB 1GGUA 2VUYA 2KDGA 5JOPE 5GS2D 1JN6A 3WO4B 1KIUA 3CVIH 1YC7A 4NHCH 1FFQA 3MV9B 4LPVA 4LLQA 3JVGA 2J2ZA 2MQCA 4QHNB 3JXAA 4OAWA 2VLKB 4GLRH 1KTRL 1RULH 5DS8A 1A3LH 2W0FA 2GCYA 3S36H 1LEKB 1J0JA 5DXWA 5EZJB 1CXEA 3OWEA 2NNAB 3O3BA 3VGAC 3VG9C 3RZCD 5EIVA 3AY4C 1HYSD 1YPZF 4BFGA 3EYQD 1GC1L 1KUMA 1ZS8A 2C26A 3G5YA 1CD8A 5EU4A 3CU7A 5HHNA 3TIEB 5GGRB 4LHUB 4YGVB 3NZ8B 3VDAA 3IDGB 1KLUB 1A6UH 4MX7A 4OT1L 3CMOL 1R3HB 5E8OB 4OZFG 5I74B 5DVOA 4LBEA 5F93C 4P2CG 5DGRA 1T3FB 2NY0D 5DJ6A 1B6UA 1KEGH 3IS0X 4HMEA 4C58B 3OGCB 4DKEL 5HD8D 3QJFA 5TPWL 4QRRA 4LLYA 1Q0YH 2OP4H 4P3WA 3H8NA 2DWDA 1UXWB 2PYFA 4G42A 1IBGH 5EG6C 1EHLL 3QA3A 5E5MA 1A7NL 2APWA 4L3ED 1FNFA 1UWEH 1E4XH 1PZ5A 1IM9D 4AIOA 5F6IB 5DJ2A 2H32B 3H0TA 4L9LC 5J3HC 3UTSE 2F8XC 4I3SL 1DQLH 1CIDA 3QR2A 5MHSD 1HQ4B 2VXQH 2R0KL 3DX7B 3DMMA 1G7MB 5GGTL 2CIIB 5EUOF 1DBML 1IEBB 2DQIH 4R4FL 1BFSA 2R4SH 3QUMA 3BHBB 1XF3A 1U8JA 4NJ9H 3TT3L 4KZDL 4Z7OE 3HE7C 3ROOB 4DWHA 4DUWA 4FQ2L 1A7PL 1U3HA 4JN2A 4N0RA 2FIKB 1NQBA 2HTKD 2BP3A 43C9B 5DD0L 5DJ8A 2H3NA 2HT2C 2HFEB 1I4FB 1JVKA 4AEIL 5HHOA 1EVTC 2FL5B 5I19H 4R6UA 3UTQA 1X5IA 4HS8L 3N1GC 1ZVHA 3OR6B 3MLUL 1KYOK 2MWCA 1LHZA 1IM9B 3QJHB 2XPGA 2KUTA 2YSSB 5DRWB 2OL3A 1A3LL 1YY8B 2VZUA 3QO1A 1H3GA 4OCYH 1T4KA 2Z31D 1DBKH 4X8JB 2UZYB 1WBXA 1OSPH 4FQXD 4JGMA 4WFED 2OI9C 4F7EA 3OAZK 3WFEH 3ZE1E 5J06A 3RNQA 1IAII 4Z7VB 5IWLC 1ZHKA 4YDJA 4WNQB 1ZE3C 4KVNH 5DK0A 4F7MB 1IQWL 4XZUA 1A6UL 1U8QA 1LK2B 3L3OA 4L8DB 1A7QH 4KTDH 4PRBA 1RJYA 1GPOH 4UT7L 5JTWA 3WEXB 1RZGA 4N0UE 2HJFA 4DVBA 1OB1B 1J5OH 1UH3A 4P2RE 3BZDA 4WTZG 3MXVH 3GRWL 3BPNC 3S37H 5DEZA 3GSUB 4G8GE 5ITBL 3MODH 5IBUB 2JIXD 1Q0YL 5TF1L 3QEHA 4JHAL 1ES0A 2WBKA 4KKAC 2OM5A 4HKJB 4BQBA 2RHEA 3IJSB 3PWVB 1NCWH 2DLEA 3WO4C 1NFKA 4NQVB 1IT9L 1UWEL 5KSBE 1HIML 2EYSB 5F1IB 1P7QD 5D7JA 2P4AB 3NPSB 4CADA 1T2JA 4PJBB 1RZ8B 2IF7A 1BQHA 3IS1X 2FX7H 1DQLL 4FQXB 5E9DE 3GMMA 2YA2A 1HOCA 5DD1L 5J13C 1FORL 5B38B 4YQXL 3DXAD 1MAKA 4O4YL 2A77H 4PJXF 4KHXH 1GC1C 4DK6A 1EX0A 3NTCL 1A6WL 2WINB 4MQ7A 4HIEA 4M7LT 4GKNB 1AXSB 4JGUA 1U42A 2X4OB 4P2RA 5C1MB 1WV7T 1KFAL 2X4TA 5HDBF 5J9PB 5HI5D 4XMPL 4F37K 1KIQB 1F4YL 3I75A 4OGYH 5BO1L 5I74C 1FH5H 1M4KA 2BNQD 3RL2B 1B2WL 4GG6B 4GW5A 2H41A 1W2KT 4QHLB 1ZVYA 2K3TA 3MJ6A 4MQSB 3L3HA 3QH3A 4XWOD 3RA7L 2VQUA 3HUJB 1CICB 3M8OH 3ABZA 3D87B 4HUXA 2CKBA 1KNOA 1XCQA 4FMFA 1TZGH