5CUSH

Crystal structure of serbb3-fab3379 complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
182
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYYMQWVRQAPGKGLEWVSYIGSSGGVTNYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVGLGDAFDIWGQGTMVTVSSASTKGPSVFPLAPGCLVKDYFPEPVTVSWNSHTFPAVLQSSGLYSLSSVVCNVNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-3
publication title Inhibition of ErbB3 by a monoclonal antibody that locks the extracellular domain in an inactive configuration.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 182
sequence length 214
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2015-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cusH01
4HD9A 4FFWD 1T7ZA 3TBTB 1MCIA 4I3SH 1BM3L 4P3CH 3SO5A 4PGEB 1KTKE 1T5XB 1FFQA 1E4XL 4JJ5A 2DQHH 2AW2A 1JPFB 1CS6A 1VKXA 1UWEH 3VXUA 2VUYA 1PLGL 2Y7QA 1KCVH 1ITBB 2HT3C 4RWHA 1DEEB 4BQCA 1KB9K 4WFFD 3QDJD 3MV7D 1IGYB 1QOKA 2OP4H 2XPGA 4U1LA 4FOMA 2JJWA 4EI6B 3TO2B 3CZJA 3TT1L 1QFPA 3RZCA 1L6XA 1UACL 2HFTA 3O8XA 5DJ2A 3V2AR 4F3FB 3N1FC 4HFUH 1ERNA 4MJIA 2CIKB 1G7LB 2YUVA 2AV7A 2HYMA 2VSDA 4OF0A 5ID1B 5ALCH 2Q8BH 3ARFB 1U8KB 5J4MA 4HH8A 5KSVA 1A4KA 5L9DH 4KI5F 5D8JL 3FAXA 4PP1D 3WFZA 4X7TB 2IANE 4YFEA 3K46A 5B8CC 1IEBA 1AIFA 1RURL 3GSNB 1QRKA 3FJTA 2WBKA 5GGTA 4ACPA 3PV7A 3QPQC 4PJDB 4N8PA 4ORGB 4UT9H 5EN2B 4AM0A 3TBSA 4K8RD 3TVMD 1KIPB 4ZDHB 15C8L 4M48L 4PJBB 4WU7A 3SKOB 3QRFM 4ONFL 2W65A 3WIFB 1J7VR 4LNRA 1OTSD 1WWCA 1MJUH 3D85B 3MROB 3TA3A 4U1IB 4ZUWB 4Z77B 3VD3A 3D3VE 1QFWI 1U3HC 3DLQR 3TIEB 3RGVB 1P5UA 2ZKHL 1X4XA 4JVPA 3GMMB 5F9WB 1WISA 1KIQA 2Z4QB 2JE8A 1CGYA 4R4BA 4M6MH 3E6FB 2CO7B 2XZZA 3BE1H 3LSOA 4UNUA 2ZG3A 2X10A 1Z3GH 2A9ML 1NCDH 4CJ1A 3MBED 3NCCB 5FOBA 2BC4B 5CUSH 1FZKB 4P0DA 5T3XD 1WBZA 5JDSA 3OZ9L 3MA9H 3N1GC 2ZCLL 2ZZUT 3P3YA 5DMGC 2CXKA 1T80A 4LSVL 3O3DB 3CU7A 4XCCL 5I1IH 2CUIA 2H9GB 4HJJH 5ETUB 1IAIM 1U3ZA 1OB1A 3OSKA 1LDPH 3MRKA 3VFUA 4D9LL 3UC0L 4KGLA 3TBWA 5GGSA 1F5WA 3DVFA 1Q9WB 1FL6A 3FT3A 5IB2B 4GG6A 3PWVB 1IM3A 3B2VL 4PRBB 3IU3A 4LCCC 4M6OL 4FQQA 4NWTL 1H8SA 2NY1B 1T0NB 2BVOB 4K3EL 3CLFH 1BVZA 1QRNE 4FTVB 1JHKL 3HNSL 4HMDA 4N0FB 3IJYA 5J7CC 3UMTA 4LBEA 1QFOA 2YWZA 3GMNB 3MNZB 4BQ9A 3CNKA 4N0UB 5ITBL 5GGRY 1CU4L 4XAKD 3UTQB 5HYEA 1RSFA 3DYPA 5F88B 3DVGB 2J8UA 3SE9L 3WCYA 1ZVSB 2DWDA 3G04B 4LVHB 5GGVL 4F58L 4G9FD 4J3TA 4HJ0C 3CFIC 5HYJD 4U3XA 4Y88A 1KELL 3DO3A 4M93C 4ELMA 2R39A 4I13B 4WFGD 4M1GL 3VDBA 1TCMA 4GRLB 5JTWA 5JW4N 4ZXBD 1Q72L 4FNLH 1UQSB 4ZQKA 4NQDD 1Y6MR 4RGOL 4JN2A 2ZWLT 4P5TB 5DVKA 2EE6A 1J0ZA 2FATH 2W0KA 2AI0H 2PTVA 4MQ7A 1A14L 5H35A 1UM4H 4JFEA 4KWUA 3I6KA 4KKAD 4EDXA 2ORBL 4N8VB 3VFPB 2CMRH 5INCA 4EI5C 3MLUH 1QKZH 1A64A 1DUYB 2C5DC 3SJVB 3TO4D 5MEQA 2UZIH 5FB8B 3G5YB 3D0LB 2HFEA 4FHBD 4M7JL 4JFFE 1DVFC 5FOJA 2BHUA 4HUMB 4WEMB 2B8OT 5DURD 3RBGA 1I7UB 3V0VA 1RY7B 1EXUB 1HHGB 3FN0H 4OZFH 2G75A 3P4NA 4BSJA 3SGJC 5IKCB 5DJYB 1FFNB 4DQOL 3SDDA 3ZE0E 3ZL4H 5DZLA 1FJ1B 1KIUA 3NABH 3UAJC 2XFXB 3MV01 3ULVF 4Y2DA 1FO0H 4J2XA 1P2CA 3UJIH 3CK0L 3MV8B 3DXAA 3SDYH 4D8PB 4HMEA 1W72L 4Y4HC 2HTKC 3FAWA 4NKIH 5MEOB 3C6LB 3QNZA 3B9VA 1EZVY 5KG9A 3ARBB 3H7BB 3LEXB 4PFEA 3QBTB 1MSPA 3RY4A 3TIDA 1FYTD 1ZE3C 1P69B 1HNGA 1E4KA 1H3GA 1QNZL 3TH3T 4F2MA 2RCSL 2EC9U 4PJ9B 3TP4A 5FM4A 35C8H 1IQWL 1R5VA 2B1HH 1GXEA 1M7DB 2VLRA 3ULVD 2OQJA 1CDUA 3G6JA 3LRHA 4M62H 1A7NH 3PGFH 4P46C 5CINL 4U1HB 4ODVH 4XPBH 3WLBB 4I4WA 1GIGH 2EXYC 3ESUF 1I1AB 5ILTH 2H1PH 2NLJB 2AQ3A 3DMMB 4JQVA 4KTYA 4XB7A 4JO1H 1J88A 1T7XA 1JRHL 3R0MA 3ZE0F 5DA4A 3HE6A 3SBWA 5EOCH 1Z5LB 4NRXB 4JCMA 3CJJA 1DFBL 2M1KA 2X4TA 4L4TB 3ARDA 2B0SH 1RZ8B 3TN0A 5ICYA 4V1DB 1KPRA 4OZIB 1CDHA 3CFJB 5IBLD 4K7FB 2VZVA 1KB5B 2BDNL 3QUYA 1RVFH 3T0BA 4ZFOL 5L6YL 5KS9E 4PLNC 1NCUA 2A6JB 2EYTB 4LKCB 3HMWL 2EH7H 1ZA3A 5J13C 4HIXH 2Y23A 1NEZG 1BGXH 32C2A 1C5CH 1RHHB 1IBGL 1T1XA 1F3DJ 1CVRA 3LKRB 5TJWK 3L6FA 4LFHD 4MB5A 2C3WA 3X13B 3BIKB 4U6XA 2VLJB 2DM7A 1I7RB 1GGCH 4XMKH 1IC5L 5C9JB 3G9VA 4X4XB 3REVB 2HWZH 3ARFC 4HUWA 3PDOA 1DBAH 4JPKL 1ROWA 2FIKB 2VZUA 3OKOA 3H3PL 4P2CG 1JE6A 2WP3T 3RWFB 4R7DA 4CVUA 4LLYB 3L3DA 1JIBA 2EDYA 4OCXH 5E94A 1KSRA 2HKFH 2ZCKH 4D0CA 1F11B 3WJLA 2NR6C 3K3QA 3CVHB 3KPRA 2XTJB 3T4AB 5IW1A 3D0VA 1MUJA 2JJVA 4M7LH 2VYRE 1I8KA 2AK4A 3KYMB 2A1WH 1L7IH 2AQ1A 4QF1A 3RHWF 4NZTH 1K5NB 5I17B 1AI1L 1IFHH 3BYTA 5IG7B 1MQKH 5T1MB 3RGHA 5KS9F 2BMKB 3IDIB 4U6HA 1Q94A 3U0TB 1XCTB 4HPYH 3I6LE 3DHMA 3VGHA 2M26A 2NXZB 2Y25A 4PD4J 1D9KD 4WWKB 2PYEA 1EEUA 5MHSD 1FNGA 2WUBH 2XXMB 1EV2E 5C07D 3I6GB 3WSQL 1RUQL 2Y06L 4PJGE 3MRCA 3MBXH 5TQ0H 1J5OL 3HCVA 5F6HI 1OTTD 4XMLL 4PB0H 4WUUD 3MRRB 1DJSA 1DDHA 1BAFH 5FGBA 2D7NA 5D71H 1NANI 5EZIL 3PWPA 5DJ6B 3VH8G 3WYRA 5E6YA 4AZ8A 2F74B 5BZDA 4QHKI 3T3ME 4YHZL 1JV5A 2V17L 4JREB 3KPSB 3P73A 5CWSB 2ARJQ 5CJBA 2CSPA 3QUKA 3WN5C 3MRQB 4LIQL 2YXMA 3B5HA 1V3LA 3OBAA 1QLRB 4OZFA 3W2DH 1TZIB 4Z0BL 4HUUB 3RY6C 3C09B 5CGTA 5MERA 5EIVA 1MCHA 2I60H 4LEOB 1RZGA 3IRPX 4BSVA 3P4MA 4QXGH 5KVGH 3U46B 3G9AB 1AXTL 4LLUB 1EVTC 2WWKO 1CICC 2W91A 3HPJA 5KZCB 2X4RB 4K2UL 1A7BA 4PJ8D 4AG4L 2DQGL 1XCQA 3QP3A 2V7HA 1FO0A 5DEZA 4AK1A 3L7FB 4X5XB 5IR1B 3WBDA 4PJGF 5FYKH 4LVHC 5DR5L 1IGTB 4QRPE 4MNQE 2R56L 4XWOD 4KHTL 4U2ZA 2HFGH 4Y5YA 4KQ3L 3RWHA 5C0BB 4R4FH 2OR9L 2DDQH 3O6FA 4LPUA 1FE8L 5JIPA 1A2YB 4GRLC 4KXZI 3FRPG 3NA9L 5K9OB 3T3MF 2GT9B 1NFDB 4J3XA 4ZD3H 1NBZA 4Q9RL 3BOVA 4NPYB 4OSUH 1CLCA 4IRSB 4OKDA 4H0IA 1RU9L 3MQIA 3IETB 1ZLSH 2QBWA 3VFTA 1T21A 4I5BA 4TQEL 4WTZG 4X80L 1IQDB 5LXGL 4KVNL 1R5WB 3QA3A 4NQEA 5F9JB 3GSXA 4XPFH 4JZOB 3OB0K 1F13A 2X4SB 3MRMB 4MGXA 3O41B 4X6DB 1WZMA 2B39A 5MI0B 4PG2A 2IJ0C 1XF1A 2DTML 5TQ2L 4NC2B 4NO0B 3DGCR 3O11B 4DAGH 3UP1A 3RZCD 4MDJB 1AJ7H 5BRZE 3O8XD 2DQDL 3TPUA 1JZ5A 4Y4KA 4MJID 4XNXL 1I9EA 2FD6H 1ADQA 3DROA 4RAUA 5JLZA 5JORB 1EAJA 1AO7E 3WFBH 1S9XA 4HUNB 4POYA 4YHNA 5C09B 3VG0L 1UH4A 5I2IA 3RWIB 2H6PA 2JIXA 3CC5B 5MEPA 1KNOB 2FO4A 3HS0A 3C6LC 1JZ2A 2B5IC 3KPPA 1KULA 4GS7C 4YBHA 2R0ZH 2BP3A 5GHWH 2VL5B 3ARBC 1NAML 1F4XL 5EU5B 2FJGA 3CZFA 2PW1A 3GBNL 1MCBA 4GFTB 4U1MA 2EKSB 2YOCA 3FB8B 4UBDC 4PJ9C 2FHFA 3QI9C 1X5KA 1GOHA 1BVKA 1E0OB 1NLDL 1ZHKA 5J6GA 4GLRH 3LN5A 2P7TA 5D1QB 3ESVF 4KJQC 3EYQC 1FL5A 1DQLL 5C0AA 5MP6L 3RNQA 4DZ8B 5FUZH 3R06A 4UNTA 1I1AC 4CW1A 3DMMC 1SY6H 4NP4H 1CFNB 2KDGA 2WBJA 3QJFA 1IGJB 1PFCA 1I3GH 4NZUH 4PGDB 4PTTA 5ENWB 1NPUA 4L29A 1U93A 2VZSA 2CIIA 3ULUD 4HDIB 3C9NA 1RUAH 3FB6B 1FVDB 3H9HB 2E9WA 3FKUS 3X3FH 1QHOA 1GC1C 4LARL 2IANB 3RWEB 4HKJA 1ZEAL 1U91B 4MJ4A 2H2PC 3LKPB 4K3DL 8CGTA 3PWUA 2X9YA 3FHAA 2VXTL 4W6YB 5JHDA 2D0HA 1M71A 3S36X 4PGZA 3BQUA 3SOBH 1P1ZB 1S7XB 4MQSB 3MLXL 2NY5C 3RNKA 3RVVD 4HLJA 4JZNB 1P84K 4OZHA 2JK5B 3KAAA 1GVIA 4XVUC 4YNYB 2YC1A 3D3VB 1QSFE 3JWOL 5EU4A 3BAEL 3RWCA 1I8IA 4X4ME 4HAGA 3RL1A 2X42A 4F33B 3K7UA 2AXFB 4F9PA 4LSRH 3FOLB 5EZOL 3DRQB 1J1PH 3NFSL 3HZKA 2DL2A 3MC0A 3OMZA 3Q5TA 4MMXC 4F7EA 5C70A 2PCPA 3S34H 4TUKH 3VXTA 3NFPA 5H37G 3P9LB 1KCKA 2CK2A 1DN0B 3HPLA 3SKJH 1S7QB 4HF5L 4XHJC 3O3EA 3S96B 4WW1A 5J12B 1T22B 1JTTA 4P4KA 3TNNA 1PD6A 2OI9B 2OL3L 2XTJC 1N6QH 2H3NB 4JFOA 4Z5RB 3BKYL 3SKUD 2R1YA 1GGYA 3VMNA 1A9EA 4XZUB 2UVFA 3BHBB 5FYJH 1CVSC 2NXZC 3BZEA 1BFTA 4MA3B 4WWKC 4JFED 1K9TA 5KBNC 4E0RB 4DKFL 4EN3B 5BJTB 3D5OF 1ZLVH 2XNAB 4NNPL 1KBGL 4L8SB 5DFTA 3OKLA 4NJ9H 2I07A 4AEHH 2BRQA 2MFNA 4KUCD 1QRNB 3QIBC 4JM2C 5L2KE 2NW2B 1KPVA 5I8EB 3V5KB 5D2NA 5ERWB 3QR2A 4MB4A 5GRJL 1U8OB 4BH7A 1RJLB 3SDDD 2FL5B 3A0OA 1LO2H 4LSQL 3NTCL 2ATPA 5GGRB 3A6BH 1B2WL 5I66A 4LPXA 4JREC 2D4DA 4OCRL 3UTOA 4Y2DD 4R3SA 1IGFH 3BW9A 3BP6B 1E28B 1PDKA 3DXAD 3BP4B 4JQXA 3UYRH 3C09C 1BFVH 3VH8B 2L7JA 2E6QA 2DQJH 4GQ9H 4FRWA 5H94B 2BHYA 3HC3L 1GZQB 3ZYIA 3Q0HA 5SV3A 2HLFD 4EOWH 3O6MH 2FO1A 1Q9KA 2FB4H 1NJ9A 3EOBB 3GSRB 3PNWB 2VLRD 1JTOA 2XKNB 4XXDA 5DHVB 1LP9E 3GK8L 3QDHA 3S37X 1HINL 1K4CA 3KYOB 4DN3L 4XVJH 2ZSVA 4LKXA 3BD4A 4LCIL 3HE6D 3BYYA 1NUDA 1EEZB 1RJZA 3EZ8A 4Q7DA 1QFWL 2NY2B 1CXEA 3D48R 2HLAA 3FFDB 1U41A 2FJFA 3ARDD 4IRSC 5GRZA 1BFOB 3TN0D 4NCC1 2VDLL 5INDA 2OTWA 3QUYD 5DVLA 4RNRB 4N9OB 5IMMA 3L5WB 4G6FD 1KXTB 4HJGB 1SY6A 3PIQA 4PP1C 3OKDB 4HH9A 4NNXA 5E00A 4L8BB 3VFRB 2LVEA 2FWOB 1JNNL 2IPKA 2R2EA 4G42A 3EIFA 5TDPB 5TF0A 1BHGA 2VH5H 4OF7A 2PR4H 4NGHL 4K8RC 4FQXB 3GO1L 3HR5B 4UV7H 1BX2A 3MXVL 4YHKH 3S35H 1UB6B 2OX5A 4NWUL 1J18A 1XF4A 3FZUD 1NUNB 1LP9F 3BEWB 3E2HB 4KAQH 1JWMA 3RTQA 1MREL 5B21A 1HH6A 3KXFA 2J4WH 5A40E 2VLKA 2NXYB 4KI5C 1HYRC 5C6TH 1EZVX 4TTGA 3PL6B 4OF5A 1RZFH 1JF1B 5HGHA 1YPZE 3WLWD 2A6IA 1DBKL 3U1SL 2FHBA 3KPRD 4CN6A 4GQPH 4AMKL 3MREA 3EO9H 2AK4D 1ZT7B 1RMFL 5ACZB 5EU6E 2HG5A 5EG6C 1GSMA 2MHAA 2VXVL 3CFEA 2FHCA 2IBZY 5DMKA 5H2BB 1ZXQA 4ETQA 3T1WA 1UJ3A 2FX9H 5KS9B 2ATKB 4QTHA 5D1QC 5ABDE 4X7DC 4RX4A 2PYED 4R8WH 2XN9E 1CT8B 3OKMB 4WEBH 4FQPA 1M6OB 1BQUA 2NY0D 1NLBH 5B38A 1AE6H 3F7YB 3MPCA 4UMGA 4U6VL 1MLBA 5HDBE 3GMQB 2ZSWA 3IDJA 2J6EL 3E0GA 3BIBX 4Z0XA 3ZE2E 1J12A 1HH9B 2E6JA 5I1JL 5TH2B 3ES6A 1J87A 1A1OB 3GKWH 3PWPD 5L8LB 3ARGA 2VXQL 1R3JA 1TXKA 2VL4A 3UTTA 4PJFE 1WSST 1LO5B 3F7VB 4DVBB 2BSTA 1YPZF 3QJHA 3FCTB 4I9WE 3GM8A 1ETZB 2X1XR 4X6EA 3DGGB 1OGAA 1QBML 3ARZA 4MLIA 1YEEH 4JR9H 1XIWB 1RUKL 4Z8FH 3VW3H 2KUTA 1JZ8A 3MRGB 4J1UB 2DWEA 2DQFB 3TCXA 3RIFF 5D1ZA 3I50H 1ED3A 1S7TA 1KG0B 1TZGH 4EZMA 5AD0A 1K3IA 5F93C 3PWLA 4A6YH 4J4PA 2AVGA 2LVCA 4X9IA 5HYQA 1CF8L 4NN7C 3WKML 5GS0C 1B0GA 4E9LA 4XTRD 5DEFB 3STZA 2NY6B 1HN1A 4HEME 1KC5H 4TTDC 5HI3D 1YUHB 3DBXB 1ZLWH 5HDBF 2OTUB 1X5FA 3ZE2F 3HRZA 5D5ME 4X6BB 2UWEA 5CJXA 3T0XA 3P9MB 1YY8B 5J12C 3W11D 4XBEH 3GUTB 2X4UB 3MOAL 3U0WL 3H3KA 3O6FD 5L2JA 1U58A 4J3UA 2WMPA 4PJFF 3K74B 3MRNB 4QRSB 4UZGA 5KW9H 4QO1A 1S78C 2K9UA 1R3HB 4K94C 3GJFK 1TPXB 1CFQB 5HXMA 4LRIC 5E8PA 1EK3A 4E41E 1RFDH 1MCKA 4RRPA 5DUMH 4EN3C 4HQQH 4FQ1L 3U4EB 1MRCH 1A7RH 4NQED 2VC2L 2V7NB 5BMFL 4L8SC 1EGJH 4XP6L 5CP7A 2X4NA 2A83A 2CDFA 2CO6B 5GRXG 3RDTA 3W9EA 2PO6B 3AS2A 3MODH 5E8OB 5EO1A 5DTFB 4D3CH 3HG1A 2DQEH 5E1HB 4IRJB 2PTTA 3OWEA 1WTLA 1P4IH 4Y4KD 1JCKA 1NCBL 1CLYL 5D5MF 2CUHA 1OPGL 4RFNB 5HTSA 4QRPB 1DQJB 4GW4B 4MNQB 4KZEL 4Y5XA 4WENB 1QR4A 5IB4A 1MCWW 2IADB 1HHHA 3ULVC 5GSRA 3TBYA 3VXQB 1MELA 3BIAX 5TF1L 3B6SA 1YQ2A 2JIXD 4R0LA 4JJHA 3C2AH 1KCUL 3VI4E 3O3BB 4LGPB 2OZ4L 3KPQB 5FM5O 4WHTB 1DTUA 3MTRA 2ZUTA 1S9WB 4G7YH 2BVPB 5DD3L 1CGSL 4WFHD 3RL2B 3EOAA 1BQHG 2XTLA 3IU4H 1DBMH 4O58H 2ED8A 4OJFH 3O6LH 4X9HA 5CIPB 2A2QT 2AEQL 3MR9A 7FABL 3QQ9D 1HXYA 1KEGL 3MLVL 5IBLC 2EH8H 1AD0A 2QQKH 5IEHB 3BDYH 2ZUSA 4OV6F 1G6RH 5C0AD 4PRDA 2H45A 1OD7A 3QDGE 5DJXA 3VFNA 1XGPB 3OHXA 1IC7L 3TYGH 2GI7A 3B8YA 2WBJD 5BRZB 3BPOC 3BXNA 4NZRL 2NY2C 2VN7A 3QAZB 2Z35A 1NUGA 4OD1L 2ZG1A 1HI6A 3IGAB 4KHXH 1AO7B 3P77A 4Y4FC 2A0LD 3IRZA 2AJ3B 5F1SA 4P5KA 4AT6B 2GKIA 4GAYB 1C7SA 2A73A 3IT8D 5FA3B 3CMGA 3VI4F 5C7XL 1TVBA 2X89A 3HZVA 1J8KA 1ZT4A 2QKIB 2X40A 3EYSH 4ZTPH 2B20A 2H26A 2HRPH 5JHDD 3GEWB 1GGTA 4LPVA 3BQUD 2EYSB 5KSBA 2FH6A 1AKJA 2RFXA 2NMSA 2HT4D 5HPMA 1UXWA 4FQXC 4EBQL 4H5SB 5I0DA 1MCPL 5LCVL 5FECA 2CD0A 5HGDA 3EO0A 3NPZB 4QXUH 4Y16A 4IOIB 1TVDA 3QCVL 4NFDA 5JW4M 1DQDH 1JGUL 5DLML 3C87A 3E2HC 3U7WL 1PY9A 5D1XB 2EIEA 3OKKB 1KN2L 2NXYC 3DO7A 1PYWB 1KFAH 4ZPTA 1T4KA 2PUQT 4OB5L 4W6WB 3PL6C 1KPUB 1D9KC 5DQ9B 5TFSH 1KTLA 1MVUA 1UT9A 2ADIB 2DQTH 4WEUD 1EUUA 4A6YA 3AU1B 4P4KD 1KT2A 3WNOA 4JDZB 3W5NA 1BD2A 1EJOL 3G6DL 1DQQA 3OAZK 2HVKB 3O6KH 3VFSA 2PKDA 1F4WH 1FGNL 2P5WE 4OGYH 5F7LB 2DLIA 2PW2A 4TNVK 2X7LB 4U0RC 3F5WB 1FNLA 5FYKD 3I3EA 4G3YL 1NCNA 1P7KA 4ZYKB 1QLEH 1SBBA 4HS3B 4XCEA 1UA6L 1FIEA 1L0QA 3UX9B 1SMOA 5CJQH 3O4OB 1BF2A 2D0FA 2GTZA 1YEDA 5EOCJ 25C8L 1N0LA 2XRAL 3MRFA 4RGND 3ZTNL 5ICXB 2H2SD 3MRBA 1QSFB 1VACB 5E9DA 1AD9B 1ZTXH 1F8TH 4HT1L 1CDIA 5LAXB 4PS4L 2VDKH 2YMXH 1QA9A 1A3RL 3IDGA 3HI5H 1DSFH 4FXGA 3WFEL 1OARH 3CH1A 4N90E 1T1YB 4PYHA 1RULH 4I48A 4J6RL 5DJ8A 5CBAA 1GJIA 4PJ8C 1EGJA 2VZ1A 1VDGA 3HE7C 4HCRL 2F53E 4UTBH 4H8WL 1TETL 1UKSA 3V52H 4XAWH 3TWCH 1SJHB 1UXSB 2RB8A 1YQVH 4APQA 1XIWC 1WZKA 1B90A 1A6WH 3OGCB 4XNMB 3RWDA 2QTEA 3SPVA 4MA7H 1ZGLA 1LO4H 5FUCE 4LLMB 1TFHA 5DJCB 2OK0L 1XH3B 1OAQL 1TQBB 3L3KB 2K3TA 4U3CA 2D31A 2YA1A 4MJ6A 3WFCL 5HDQL 4FFVD 4HBCL 2P47B 3WUZA 1TZHA 3WXWL 2EC9T 3RVXC 3X14B 3G08A 4Z18A 3QCTH 2DLGA 4ZS7L 1S7RB 4ORZC 1GHFH 2NY6C 3ZT7A 1S9KC 1HYSC 5IQ9B 4RISH 1OSZA 2XWTB 4KU1A 4ONGL 2GEEA 4YXKH 1QBLL 1AXIB 4ISVA 1I3VA 1OF2A 2VISA 4PV9B 1YN7A 2R29H 3MFGB 1NGYA 4LEXH 3GJEB 5F3BB 3GMPB 1I9IH 2ADGA 4ZSOA 4JM4L 4YJZL 3SDCB 4XI5D 5L2KB 3MXWH 2BZDA 2ERJB 2EZ0D 1INDH 3HUJE 1JP5A 3O2VL 5D70H 5C2UB 1KUMA 1V7NH 4K23L 1N2RA 1G7HB 1BWMA 2DLFH 5C0GB 4YXHL 3QH3B 4Q58C 5IFHL 1TPXC 1BBJB 2RAMA 4Z7WA 5TDOB 1AGEB 1WV7T 3LS4H 3F7RA 1MJ8H 4DGYH 2LQRA 5KOMC 3V6ZA 4N8CH 4OFDA 2B4CC 3BPNB 1G6RA 1FZJA 4JVUA 3Q6FB 4ODXB 1RZJC 1HHIB 4NKMA 1P4LA 1FH5L 1K4DA 1YMHB 4XNYH 5LWYL 1UM5L 5K9KB 1S7VA 4JN1L 1FNSL 3IF1A 4NO2B 5CEZE 4OD3H 1B0WA 4W70A 4I8DA 3BSZH 1UH3A 3V4VL 4BZYA 2Z31A 4QEGA 4IRJC 2BY0A 3QNYB 2YEZB 3Q6GL 5I8KL 3DVIA 3QG7H 5IVZA 3EDFA 2ZOKB 5DVNA 1EO8H 1MHHA 3L3IB 1IKFL 1IEAB 3K4ZA 4NNYA 3RTQD 2JJSC 3MRDB 5I76B 3KXFD 3U2SB 4LVNB 2P8PB 4ZG1A 1LP9B 3BUYA 4QXTA 3HUJF 2VLKD 3SE8H 3VXME 4UTAH 5DUPH 2VWEE 1AQDA 5IROC 4LCYB 5EO9A 1UM6H 1X44A 2PXYB 1WC7A 4HKZB 4YX2L 2ICEA 4P2OB 3T4YA 5ADPH 4UB0H 4HBQA 3WE6B 2XG4A 3VWKA 4YBQD 3WMSA 4WV1A 3KDMB 4G8GE 2UYLB 3ARYA 3UPAA 5IT2L 4U4BA 3NH7H 3WD5L 3PABB 4ODTH 4YHML 2F54A 1DUZB 5ICZB 1DQMH 4PRPE 2CLRB 4N0YL 1Y18A 4Y1AA 3WUWA 8FABB 2EDJA 2VRAA 4P2QA 1H3PL 1AFVL 4RX4D 4UINL 5JIKA 3D25B 2BRRL 4M9PA 4ZUUA 4NKDA 2J88H 2FZ3B 2GJ6A 3FQNB 4JKMA 2NTFA 5C6PB 1RZ7L 2ADJA 3CDFA 3D18A 5B39B 3MO1B 4JKKA 1T1ZB 4PGJA 1JNJA 4HAFA 3GSVB 4KMTL 2ZP0T 4N68A 3QAZC 4XPHL 3IAPA 4XC1H 2ILLA 4MHHG 5FYJD 4IDJL 5ALBH 5D9SA 5MHSE 2EICA 1PG7X 4PYGA 1FC1A 3MLYL 1NMAL 4PJXE 2NCMA 1YNLL 4Z76B 3ARGD 5IB5A 3CDGA 5CEXA 3B3IB 4I0PA 3UTTD 5F7EL 4NHCH 4RMVA 4ZPVB 1PVHA 4YDKH 5T3XL 5C3TA 4MAYB 4R6UA 4JZJA 4K3JL 1CK0L 1OGAD 3LQMA 3ZTJH 1YPZB 1JF6A 1ZHBB 5JA8B 2Z9TA 3WHXA 1U8QA 1D6VH 2UVEA 3INUH 5I8OL 4B7IA 5D1ZD 1I4FB 5HBBA 5EU6B 4TULL 3SE3C 4J4PD 4NDMB 5EU7E 1MFAL 5D2LA 1LD9A 2X4OA 3EGSA 1HKLH 1NH6A 4OGXH 5D1XC 1VFBB 4Y5VB 3OAUH 2XQYK 5B4MD 3BKCH 3FHQA 2XN9B 1F45A 5D7LA 1LO3L 1Z0MA 1YEHL 1A7QL 3DWTA 1HZHL 3M17A 2I26N 2VDQL 1K8DA 2CLVA 4I3RL 1I1CA 1C8PA 4JFYA 4PJ5A 1QVOA 3GMLB 2IBZX 2BVYA 4OLXL 1F6LL 1G9NC 2V6HA 1XFPA 4PJXF 2EECA 4QTIL 1CE1H 1OTUC 4BQ6A 1D5ZB 1KN4H 3VCLB 4ERSL 2P8MA 4JANB 5CSBA 1N5YH 1YY9D 4CNIB 3AREA 5IW6B 4JLRB 4XP9L 3CFDB 2N56A 2D3VA 4CVXA 3P4LA 2VZTA 3PWJA 4MX7B 1ZGLP 1HE7A 3MJGX 3MJ9H 1U8PB 4GKSA 5CLWA 3PUCA 5J9PB 5E2JA 5EOTA 1R3KA 4HSQA 3B5GA 1WITA 2E8ZA 3GGWB 1IC4L 1XZ0B 1YN6A 3PQYA 3V95A 3MGAA 3O2DH 3AM8A 3VE0A 4H88H 1MFBL 2VMFA 3RDTD 1U8IA 3SGEH 1T0MB 4UNVA 4FZ8L 5T5NF 5DD0H 1Q1JL 4OBSA 3LQZA 3NCEB 4HUXA 1F90H 4KY1L 3VXUE 1WWBX 3AGVA 3CXDH 3HG1D 3RUGE 3DARA 5SWZE 2WIIB 4N1CA 3R1GL 3IFNH 3NCJL 4EJ1C 4GRWE 1ZA6B 1F6AA 1V3KA 5IIEA 3FQRB 1JPGA 2E7LC 2HLFC 1S9YB 4RDQF 1E4KC 1AGBA 2MMXA 1FRGH 5KOVC 3FB5A 4QHUA 5D5MB 4PBXA 5EUOE 2YD9A 4X4ZA 3M07A 3LIZL 1HQ4B 1HDMA 1T5WB 5FCUH 3JWNC 3ZKMD 2EDQA 4UILH 3IXAA 4S1QL 3FO1A 1EHAA 2Z8WC 3VGBA 1ULVA 4YGVB 4AH2B 3V4UL 3OR7B 5BZWA 1KENL 3X17A 3KS0H 3L9RB 2R0KL 3RJDA 2BSRB 4E41B 1XGUA 4YK4C 4U7KA 5I1GH 3QUMA 3EJYD 2CXGA 1G7PA 1SYSA 2QSCL 1FP5A 1J0YA 4HIHA 3TN0C 2QR0B 5FHAL 2R0WL 4TRPL 1FC2D 1XGYH 5T1LA 3FOMA 4PTUA 4G43B 1RK1A 4P5MA 3TJEH 3T65B 3RUGF 2AJZB 5JO5B 5T33L 2ERJC 2DYPB 4LFHG 4GT7A 5EBGA 4GRWF 4LPWA 2WWKT 5D72L 4XX1G 2Q7YA 4LCWE 5EZLB 3S8WA 3HAEA 4JO3H 5I73B 1CGUA 4XWGH 5J6HB 2I9LB 3E8UL 2OXHA 3IB4A 1KLUB 1EA9C 2VLLA 3QFJA 5HHMD 3UJTH 3BPLB 3UROR 1MCQA 3KLAB 4GAGH 5C0CE 3E3QE 3ZLQC 3T2NL 1H3XA 1MFDL 3BPNC 3LH2H 4L3CA 4BFIA 5HHVL 3MGTB 1I9RL 4U1SA 2Z92B 2X89D 5B8CA 1UZ8A 4Q6IB 4HIEB 3FT4B 5J1AB 1EO5A 2SEBB 3K2UH 1LE5B 2E27H 5CEYB 3TV3L 2VE6B 4X98A 1AKJD 1R3IH 2ZNWA 1ZSDA 3R0NA 1NBVL 1I1FA 3ZSTA 5HI4D 2R8SL 1XF2B 1U3HA 1YEJH 2AERT 3M8OH 2ZUQB 3H0TB 2W0PA 1ACYL 2Q76A 3KJ4B 4LVNC 2WLYA 3DIFA 1KV3A 2CKNA 3HNTH 3MUHL 5TE6L 3W39A 3WO4B 2NY3B 3QDGB 1CD8A 3KR3H 3U7AA 4P2YA 2F5AH 4CADA 5J11B 5J06A 1WAAE 1F4AA 3IJSB 2AK1H 4P2OC 2IH1A 2DN7A 3KYNB 1UVQB 5L7XL 2ZUUA 1G7IB 3NAAH 1QQDB 2Y1VA 3NIDE 5E5UB 4BFBD 2GY7B 1AHWB 1MLCA 3ARTA 4HS8L 2FSEB 1IAIH 3DRTA 2WW8A 1EFXA 4L9DA 2GTWA 3RA7H 5FGBC 3PHQA 3MUJA 5GGUB 5I1LB 2P1YA 3MX0A 4QHLA 1P4BL 5DK2A 2HP4A 4UDTB 2JJTC 2VXSH 3DX9A 3LKNA 1HOCA 3F12B 3IXTB 5T5NG 3CFKA 5I30L 1LEGA 1U6AH 1NGPL 2X4PB 5DZNA 4X0KA 4LCCA 4X7SH 5IEKA 1C08A 5T3ZH 3GSNH 4DVRH 5EBMB 2YWYA 4M1CD 3Q5YA 4KK9C 4UQ2A 5BW7C 4OT1H 5E9DD 4PD4K 2NZ9D 4PGBA 5LVEA 4JFEE 4H20H 2BVQA 2YBRB 1U8MA 4UV4H 1EHXA 4MZ2A 1HWHB 1BQLL 3L5IA 3MJ9A 3NN8B 1JHLH 2WLZA 2EDXA 3BZ4A 2B1AH 1OAYL 1Q38A 3MLZH 4XP5L 4K3GA 1QYGL 1WAAF 3RIAK 1QFUL 4OLVH 5DO2D 3LRSA 5SWSE 4DZBB 1W8OA 3MOQA 4M6NH 1QACA 5DRNA 3ZHLA 2HVJA 4EUPB 1WZ1H 3O2DA 2JB5L 3CX5J 3SKMA 3NIDF 5A2KH 5AZEH 4APQD 5JPMA 3J7HA 1DN2A 4ODHH 5E0QA 1VESA 5EB9A 5I16B 3IDUA 2W60A 1MEXH 1CXKA 1TDQA 1XGRB 4Y5YC 1VFMA 5CGYC 2P5WB 3FQWA 4FQLL 4G9FB 4YDIL 3T2PA 3LY6A 3S5LG 5GZOD 4J12A 2Y4SA 2VAAB 4Y5VC 2CDEB 3GIVA 1TLKA 4NRZB 2YSSB 2HN7B 5I19H 4X6FA 2D9QB 1ZANH 1NAKH 3DOSA 4YHLL 2IF7A 4EI5A 1IGCH 4KK8D 5CMAA 1LK2B 5SWQB 1BOGA 1QD0A 4D2NA 2A77L 4PLJC 4QT5B 5DUBB 3EYOA 5I6XC 1F4HA 3AFLA 4GKZA 4ZO6A 1YEFH 1FGVL 4QHNA 1JN6A 2JKXA 5IFAH 3QUXB 3W9DB 5IHUH 2P24A 1ACZA 3VD7A 3QNXA 3S88H 3K8KA 3L3OB 3O2WL 1X5IA 4IRZL 4OBRA 5EC1A 3RKDC 1Q0YH 3LV3A 4IJ3B 3BPCB 3G6JE 1H3TA 5D7IA 2VITA 1G9ML 1DE4B 4HFWA 5HYFA 4MNHB 5E08H 3RX5A 4BFEA 1R24B 1G7QA 2F53B 3X12A 4ONOA 4CMMB 1IL1A 2VLMD 3RWGB 1I7TB 3HLAA 4LQFH 3FB7A 1INEH 1A1NB 4D9QD 2GHWB 1H15A 2QQLH 1R5IA 2R1XB 5FAAA 2Z8VC 3F6LA 2DBJA 5I15L 4PR5B 4BSWA 3QZWA 1AY1H 1NCTA 1MI5A 4M00A 4O2FA 5CCKH 4LASL 2FEDC 2Z31D 3QRGL 5DMIH 2VKWA 3CUPB 1HEZB 2EXWC 4MA8H 5IP4A 1VGEL 2ZJSH 5DK0A 4ODSL 4NQSA 4OQTH 3T77B 4F9LC 43C9B 4P46A 3BVNA 2DM4A 1DCLA 5EBLA 1YYLL 3MCKB 4GAJL 2CK0H 4Q0XL 3WEXA 2PYFA 5LGJB 3CMOL 4FFYL 4M7ZB 3FONA 3HUJB 1T83C 4PB9L 4D9RE 5ELIA 5IUSA 1EMTH 1R3LB 1HCVA 3Q3GB 3MJ8A 4QRRA 2DBLL 3QPXH 4NUGH 4DN4L 1T2JA 1F6FB 4X8JA 3BUTA 3VWKD 3ZT5A 2HJLB 2CKBA 3TBTA 3MRHB 1MY7A 4PGEA 4XPGL 5HGAB 1T5XA 5DD1L 2F54D 1JPFA 3LCYA 5GGTL 3DX8B 4Y1AD 3UDWC 4TSAH 2A0LC 2VDNH 3OX8A 3EJJX 2MQ3A 4LU5H 2IQ9H 4OLUH 2GJ6D 4EI6A 3TO2A 1MRFL 3P11L 4I18B 5I73C 1E4WL 4TOYH 4PJ7E 3RP1A 4F3FA 1J1OH 2HT4C 3CAFA 3OJ2C 4GLRI 4XVSL 4WW2F 4EVNB 2CIKA 3BPLC 4JY5H 5DMJB 1CG9B 1SM3H 1G7LA 3CDCA 5ID1A 3ARFA 1U8KA 4M43H 3RPIB 3SHSA 4AEIL 2XQBL 1ZAGA 3VXMB 3ET9F 4I0PD 4X7TA 2UY6A 2WNGA 3RHWK 2XV6B 5HYSB 3T3PE 2R2HB 3HC4L 3L5HA 3U4BL 1N7ML 4ORGA 4X4YB 3OF6A 3JBG7 1A5FH 5EN2A 1G7JB 1KIPA 1NANH 3UTSE 4ZDHA 4G8GB 4KC3B 4PJBA 3SKOA 3ULUL 1UACH 3WIFA 4WY7L 1HQRB 4POZD 3D85A 3EJZD 3LVEA 3MROA 4U1IA 1RIVL 4ZUWA 1LHZA 3LQAL 1NDGB 1T1WB 2AJYL 3TIEA 4DFIA 4PRPB 3RGVA 5CLTA 3QEQD 4AIZB 2ZUQC 3BKJH 5ISZE 5HPOA 3GMMA 2VNCA 3KJ4C 2Z4QA 3WO4C 5GISL 3H9YA 4LHQB 2NY3C 4OGZA 1M05B 1MNUH 5H8DA 3E6FA 5D7LD 3B9KB 1KB5H 5J11C 3KHOA 4PJ7F 4S2SB 5HHQB 4U2YA 2BC4A 2BERA 1FZKA 1JHTB 5SX5K 4WNQB 15C8H 4KTEH 1CCZA 4PJ5D 4TNWF 1IT9L 3FTGB 3IKKA 5DC9B 1OAKH 3O3DA 1AHWC 2NY5H 1UENA 2EIDA 5ETUA 1ZKAA 3IDXL 3DUUA 4I0CC 2NY7H 1N3NA 1KTDB 1LNUA 2GK2A 3ARED 3C2SA 2NTSP 1HK6A 12E8L 1QEWA 1Q9WA 2ZPKL 5HI5C 2X9XA 5IB2A 3B83A 1EUTA 3KPMB 4F7MA 1YA5A 3RWJB 5T1DH 4PRBA 3WN5A 4OKVA 4IM8A 1OL0A 2BNQE 1T0NA 2NX5E 2BVOA 2ZCLH 1AC0A 3PQYD 3DTXB 4K7PX 1WBXB 2XT1B 4MDIB 3RY6A 1ZWIB 3M1BB 4FTVA 4N0FA 3MZGB 1OAUH 2OS7A 3HHRB 3MACL 4CMHB 5E8EB 3CVHH 4F7TB 4NOFA 3GMNA 3MNZA 2AJXH 2A38A 3OXRB 4R90L 5HSFA 4KZDL 1FL3B 4NQVB 1X5JA 4P59L 4OCWL 4KTDL 1QO3B 5F88A 3DVGA 3K4AA 5GJSL 1ZVSA 4DK6A 4HWBH 3ZDYE 3G04A 3CSYB 3B2VH 2LAAA 4I3SL 2A6KB 4P3CL 4M3KB 1P7QB 1UWXH 3AXLB 3Q48A 2W9EH 1IAOA 1X5HA 3BH9B 3EHBD 5F7DB 5IBTH 4Z7VE 5DRZB 3HNSH 2V5YA 2Q3AA 4GRLA 2WP3O 3JWDC 5IJKC 1UQSA 3BGFC 1RJYB 4JKLA 4Q74A 1X4ZA 1KJ3H 4JKPL 2VSCA 4OQTA 5ITBH 1M7IB 1YMME 4JFXA 4PBWD 4U7SA 4HUVB 1I9JL 2X4QB 4HKBB 4Z7NE 1FBIH 3FO0H 1DUYA 3SJVA 3KG5A 4HFUL 1UB5A 5DHXB 5EUKB 1L9NA 3G5YA 3D0LA 5EFIB 3S5LB 4PBVC 5ALCL 2Q8BL 1WIUA 5L9DL 1VKXB 2ARJB 1RZKH 3VXUB 2CRZA 2Y7QB 4PJEE 2JCCE 3RUGB 1EXUA 5SWZB 5K9JL 4GRWB 4OLYH 4O51B 5IKCA 3ULSB 4L3EE 1T04B 2XPGB 4YPGB 3QFJD 3ZDYF 3NCFB 4LVOC 4UT9L 1S7UB 1FJ1A 1N4XH 2AGJH 1P9MA 2XFXA 1NFIA 4LGRB 5EUOB 1IE5A 1MJUL 3O8XB 4E5XB 4N9GA 4DTGH 3ILPB 1KEML 4Z7VF 5C08A 5FUCC 3MV8A 1QFHA 4MXVE 4D8PA 3HB3C 3QPQD 5MEOA 3C6LA 2FX8H 3ARBA 3H7BA 3LEXA 5GRUL 1IEBB 1AIFB 4M6ML 1GYAA 3BE1L 3LKOB 4Z7NF 3BH8A 1Z3GL 1EHNA 1A0QH 1ORSB 4N0CC 4PJ9A 2IPUG 1YJDC 4AM0B 3QI9A 4WTWA 3CXHJ 5CUSL 3RVWC 1M7DA 2A6DB 2W65B 2MCPH 4JKWA 4HXAH 4F7PB 4U1HA 3T09A 1I8LC 1NGXA 5I1IL 1GGBH 4PJEF 5DD5H 3TA3B 1UJ3C 3STBA 2JCCF 4HJJL 3VRJB 3WLBA 5GIRB 1U2HA 1LDPL 1A6UL 2K7QA 5DSCA 4LCWB 1I1AA 4TN9A 2NLJA 3VXNB 1N26A 3DMMA 4M4PA 4U31A 3FFCE 2N4IA 5DMGD 1Z5LA 4F15B 2KQNA 4NRXA 4W81A 3P30H 3PHOB 5GGQH 3V8CA 2AV1B 1DEDA 2YD1A 5C0CB 2ICES 4YAQA 1JMZA 1EFXD 4YDJB 4OZIA 3CFJA 1WBZB 4K7FA 4MCZA 1KB5A 9CGTA 3CLFL 1RUMH 5CINH 1A4JB 2FDBP 2YXFA 3ARGC 4JFPB 5FYLE 2APTA 2EYTA 4LKCA 1PGRB 3RPKA 1F2XK 2MKWA 3MRKB 4OZFG 3VFUB 5MENE 4I18C 1RHHA 1JRHH 5C8JB 5CZKA 3LKRA 5CBEA 1FL6B 2UZXB 1DFBH 4FG6D 5FM5M 3X13A 3MFFB 2VLJA 5D1ZC 1I7RA 1BQSA 5HHNB 1IM3B 3PGDA 4X4XA 3REVA 4L5FH 4IMLB 2FIKA 4M5YL 2DD8H 5IBUG 2W59A 4CAGA 1IGMH 1A47A 3DX7B 5DGQA 3LD8B 4UIMB 5BS0E 2YUWA 2JELL 5GSVB 5B4MC 3P0VH 4FNLL 2YD5A 1A6ZB 3HMWH 3O0RH 1F11A 4L1DA 1JUFA 4HJ0D 3QDME 4HHAB 3SGDI 4JHAL 4B7LA 2AI0L 3CVHA 2MOVA 1YYMH 1UM4L 5CJXC 5C6WH 3T4AA 4LNVA 3KYMA 4EIZC 2J8UB 2CMRL 3MLUL 1QKZL 2DWDB 4HGWB 1K5NA 3DI2B 5I17A 1IC5H 5T1MA 5C0RH 5JIHA 4DFHA 3U0TA 1XCTA 2QSTA 5E5RB 3S36H 1RZIB 4HWBA 3ZYZA 1OOAA 3D9AL 5CILH 4WWKA 4CBPA 3D69A 2FLBT 5KJRH 4EI5D 3FN0L 4CGTA 5T5FH 3FQXA 3HRPA 4G7VH 1VB9A 5DQJB 3ARPA 3MJ6A 3I6GA 4G8FA 1QZ1A 3VMPA 4ZFGH 3ZL4L 3B5TA 3GBLA 1H8OA 4PREB 4JFEB 5DRXB 3NABL 4JM2A 4EDXB 1T66C 4H25B 1FO0L 3RDTC 3LKSB 3QEHB 3UJIL 4XPTL 4RA0C 5DJ6A 1H0DB 3CVIH 2F74A 5SWSB 4NKIL 3NMEA 5DF0A 4K07A 4YEEA 1Z9LA 5DK3A 5GS0H 3UAJD 4PJAE 3KPSA 4ODWB 2AJSH 2G75B 5HVFB 3P4NB 4FQHB 1MF2H 3ROLB 4MB3A 3MRQA 2KZWA 2GITA 1G7MB 2IQAB 1RUQH 1B0RA 1QLRA 3PDGA 4HUUA 35C8L 3QEGL 1V8HA 2B1HL 2HTKD 3MUY1 5EU7C 4LEOA 3VRIB 2FGWH 3DV4A 1A7NL 3U46A 3PGFL 1BZ7B 3LKQB 1MI5D 4ODVL 4XPBL 2X4RA 1GIGL 1EAPB 5DWUH 1BIHA 1JJUA 5ILTL 2H1PL 3L7FA 4X5XA 3ZSSA 4CJ0A 4DKDC 3QNZB 3K1DA 4JO1L 4K94H 2VQ1B 5EOCL 1IGTA 3Q2CA 4P46D 2GJZA 1HHJB 5L8KB 1XAUA 4AEEA 4NCDA 1K8IB 5C0BA 1X5LA 1OD9A 2XZCH 1R5VB 4QRRD 1RVFL 3G6JB 4JRYE 1KLGA 4U7MA 5K9OA 3ELAT 2GT9A 2X6MA 1NFDA 1ADQL 1TNNA 4PJAF 4NPYA 3QYCA 4IRSA 4HIXL 2YPLE 2ZUVA 3GSWB 1C5CL 4ZUTA 1ND0B 5F9JA 4OM0H 4KVCH 3ZYOA 2R56H 4JZOA 3MRMA 2HTLC 3O41A 1GGCL 4XMKL 4PJDF 2NZIA 1ITCA 1Z9MA 2HWZL 5I1CL 2IPUK 4NO0A 1FV1A 1DBAL 3N0PB 1TTFA 3O11A 3UPRB 4MDJA 4C56A 1FYHB 5KAQG 1MWAB 4WTXA 3QUZB 2JF1A 5F3HA 3ZO0A 3DSFH 4OCXL 4U1GB 4XP1L 2ESVE 4Q9RH 4PG9B 2YN5A 3DECA 4MJ5B 5FKAB 3ARFD 32C2B 4OUUB 4WW2B 4X80H 4HZLA 3S37H 5JORA 3I75A 2Q8AH 1T1XB 1D6EB 1D5BB 3L6FB 4M7LL 4HK3J 3OR6B 2D03H 2O5ZH 2A1WL 1NGWA 3H3BC 4WO4B 3RWIA 5T3ZD 4J3WA 3ZHKA 3CC5A 1DL7H 1KNOA 1MQKL 1CD0A 4JY4B 4HUWB 1URLA 5DHVH 5FFLA 3BZFA 2VL5A 4M03A 4R7DB 3D85D 4Y0GA 2EKSA 3FB8A 3O9WB 2XWBA 2WUBL 4J3SA 3AS0A 5IHLB 3RGVD 2DF3A 1WK0A 3MNWA 4I1NB 3MBXL 4R97B 5D1QA 1YEGH 3OG4B 3HNVH 2X70B 4QKXB 4PB0L 1T03H 1G0YR 1F3JB 4QF1B 1BAFL 4DZ8A 5D71L 5F96H 1K3ZA 3BJ91 4MZ3A 5F1KC 2EE9A 3DPBA 5ITFB 1CFNA 3KS0J 1QR1B 1SJEB 4PJ7B 2AJUH 1U8LA 1I8MA 3VGFA 5E8DL 5ESVB 1F4XH 3BP5B 3GBNH 4JFQA 4GBXB 3Q1SL 4XBGB 5E56A 3IDMB 1MCCA 4HDIA 2NY0B 3FB6A 1FVDA 3EFFB 3ZMRA 1FZMB 3H9HA 4GMSL 1E6JL 1NLDH 3V5HB 3W2DL 3RWEA 1U91A 3MRCB 3LKPA 2IGFH 1S5HB 1WGOA 4M7KL 5IMOB 2I60L 1DQLH 4QXGL 5KVGL 1DDHB 5F8RC 4KRMB 3UTSB 3VGDA 5I74C 5FYLL 1S7XA 3WNPA 5DJ0B 3G5XB 1UWGH 2NY1D 4YXLH 4JZNA 4APQC 3LHPL 1I85C 2JK5A 3MUZ1 1HKFA 4YNYA 3D3VA 3ARVA 4FTVD 5FYKL 4MS8C 2GAZB 5IM7B 4BYHA 1CL7H 5ISZB 2HFGL 4F33A 4ZFFB 4XRCB 4OZFB 2Z0BA 4G80A 4R4FL 3L3JA 1S3KL 2DDQL 3DRQA 4K3DH 3LD8C 2ZG2A 2VXTH 3GKZA 1A7OH 3UBXB 3P9LA 1DN0A 4ZD3L 3ALWA 1I7ZA 1S7QA 3MLXH 3UTZB 4O2EA 3K8LA 4OSUL 3S96A 1T22A 5I1HH 5IB3B 1ZHNB 2H3NA 5F9OH 4GRLD 4Z5RA 3O3AB 4XH2B 3K2MC 1J86A 4DKEL 3BHBA 4LRIA 5M94B 4DK3A 4MA3A 4XB8A 3OPZH 4DAGL 4LVEA 5BVPL 4E0RA 4L4TE 4F57H 4EN3A 1AJ7L 5BJTA 3UZEA 1C7TA 3VWJB 2OMNA 2XNAA 3SJVD 4XCFH 3MLWH 2NX5B 4L8SA 4V1DE 4HF5H 3SQOL 3C08H 3ABZA 3NZ8A 5EPMB 1QRNA 4JAMA 3VFTB 1T21B 1MOEA 3WFBL 2HH0L 1N64H 4ETYA 2NW2A 3QA3B 3GI8H 3V5KA 5ERWA 5BCAA 3WIIH 1QSVA 1FVCB 3W5MA 1ZOXA 4QRQB 3T2OA 1U8OA 1RJLA 2Z31C 2E9JA 5GGRA 1CI5A 2R0ZL 2A9NL 2X05A 5GHWL 2DMBA 4DKFH 2R69H 4WI5A 3OL2A 1H5BC 3BP6A 1E28A 3FO9B 5C08D 3VWKC 3MV8D 1FSKB 4Z7VB 1MAMH 1BEYL 3DROB 1NCWH 4UI2A 5H94A 3C6LD 4PLKD 2JB6A 1GZQA 5E2VH 3ARBD 4O9HL 4LMQE 4YHNB 2WUCL 5FGSA 4HGKC 4NT6B 2WK2A 1AP2B 4UT7H 4NSKB 4UBDD 2FJHB 5ACMA 4PJ9D 3ALPA 3QI9D 1SY6L 4NP4L 1MCOH 3GSRA 5F1IB 5AWNL 1CR9H 1I3GL 4NZUL 4NO3A 3T1FB 1H9VA 2XKNA 5DHVA 3EAKA 2EO1A 5M7QA 3EYQD 1MH5B 4JFFA 4PJIE 5B38G 3VDCA 4DOHE 3KYOA 3X3FL 1I1AD 2JCCB 3DMMD 4P2RE 2C4FT 2P7TB 1II4E 5IVXE 4L3EB 1EEZA 2OMBA 3I9GH 2G9HB 3D2UB 4KRLB 3FFDA 4AL8H 1J05B 3SOBL 3R06B 3GSQB 1RD6A 4IHOB 4CW1B 4YBLB 4Y4FA 1QSEE 2EDOA 2BHZA 4RSVA 4RNRA 1KYOJ 4PTTB 5EDXA 3L5WA 2H2PD 1EHLH 4HJGA 4L29B 1BD2E 1AR1C 3OKDA 2BFVH 4UOW1 4YR6B 3SKNA 3FRPA 3GK8H 3ZE1E 2CIIB 2QQQA 3TYFA 4L8BA 2R2BB 5CFHA 1YNKL 3VFRA 5B3NA 2FWOA 4DN3H 3BEVB 3BX7C 3TBVB 2GW5A 5I71C 5TDPA 4OUOA 3FO2B 4OM1L 1IM9B 1J1PL 3M45A 1JGDB 4FQXA 3HR5A 3QUZC 4U1GC 4TUKL 4UOW0 5HGBB 1UB6A 4XVUD 1M71B 1OWRM 2VLJD 4W4OC 4POZC 4QYOB 3BEWA 2D7OA 5KSAC 4WW2C 4PV8A 1YEKH 3VDAA 1UYWH 1A7PH 2VOTA 5HHXH 1NFKA 4OZHB 1N6QL 3BRFA 3BWAB 2BSED 3JZ7A 1XGTB 2V9QA 2H8PB 4WO4C 2NYYC 4H0GA 4Z9KB 5CIPH 5JPNB 5IVXF 1AXSB 3PL6A 1UCBH 1JF1A 1BREA 5DDHA 5FO9B 2VR4A 3BJLA 3QG6B 4HWEL 5JOPE 1JNNH 4NFCA 3SCMB 5FYJL 4LL9A 3V6BR 4F7CB 4XC3H 1BVLB 4NGHH 3QT2A 2XTJD 4FMKA 1KJ2B 1MCFA 3O9WC 5ACZA 4M7LT 3KJ6H 1UFUA 1DANT 2GQHA 2KKQA 4NJ9L 5H2BA 1LEKB 3NA4A 3QXDB 2DJ4A 3L3GA 3ZE1F 4AEHL 2F9BT 5DEGA 3EFDH 3U0PB 2ATKA 5KS9A 2NXZD 4RRPG 1T2QH 3PP3K 4WWKD 3WNKA 4FFZH 4D0BB 1CT8A 3OKMA 4R2GC 5MENB 3GM0A 4C57C 1M6OA 5E4EC 1P5VA 1NQBA 3F7YA 1LO2L 3U1SH 1HIMH 3GMQA 2LTQB 3A6BL 1L0YA 1ES0B 1HH9A 4JM2D 4U0QB 4GBXC 3FMGL 2ITDA 1JGLH 4LPCA 4RWYH 1BJ1J 1IGFL 5TH2A 3QB7C 3VFWB 2BNRE 1WFOA 5A1AA 4R96B 5DS8A 4KROB 5BS0B 1LO5A 3F7VA 3DI3B 4DVBA 4GQ9L 1JZ4A 3FCTA 3HE7A 1ETZA 3DGGA 4IS6A 2XY1A 3KPSD 3QDMB 2C7UB 5GXBB 1XIWA 4OI8A 3K80A 4XGZA 1CLZH 3MRGA 4J1UA 2DQFA 4BZ1H 3IJHB 2FB4L 2ATPB 1KG0A 5A3IC 2J6EH 5C09E 4G6KH 4WCYH 5F1OB 4R3SB 1S7WA 4DWHA 4PP2B 4G9DA 3BW9B 3GRWH 2O5YL 5D4QA 2QQNH 3EDEA 2DTSA 5KZCD 1G9NH 5DEFA 2VXQH 3U6RB 1CE6A 1L6ZA 1AGCB 3GMOB 4XVJL 1C5BL 4L4VE 3FT2B 3DBXA 3K81A 2OTUA 3SGEI 1KF9B 3OTTA 1QBMH 4X6BA 3P9MA 4PJGA 4X6DF 1YY8A 3HA0A 5C0BD 2YPVH 3GUTA 2X4UA 1NJ9B 1BJ8A 3MRJB 5GJTH 4QRSA 3MRNA 4HC1H 3I3DA 4KQ4H 4PRNB 1KCSH 3OKEA 2OJEA 4XXDB 1CF8H 1R3HA 4EQ3A 1CFQA 4QOKE 1IVLA 3BISA 4IRSD 1U0QA 4RMTA 4PJAB 5JOEA 4H1LA 2VH5L 4J3VA 2PR4L 2Y36L 4YWGL 1OT1A 3U4EA 4UV7L 3VWJC 4AJ0A 2BOCB 2V7NA 4YHKL 3S35L 1W0WB 1YNTB 1TIUA 1WF5A 3GHEH 1HXMB 4CVZB 2EE3A 3PGCB 4KH2A 4NO0D 2WZPD 5FO7B 5INDB 2DM3A 2PO6A 4WWID 5E8OA 2J4WL 4WI7A 4C56D 5E4IA 4RMUA 5L88H 2HJKA 4IRJA 5FGRA 4P2QE 2J2ZA 2EDEA 4OGAC 5CZXC 4K9EC 2GJ6E 4LAQH 3BWUC 2IPKB 3JTSB 4QRPA 1DQJA 2JJSA 5ANMA 4MNQA 4K3HA 4S0SD 5I18H 1I3RB 1I75A 2IADA 3ARXA 4KI5D 3VXQA 3IVKB 3KWWB 1ZT1B 1FSKC 2FNBA 5IROA 3WXVH 2F5BL 5CSZA 5IMLB 2MTPA 4DEPC 4JRYB 1ZLVK 3CD4A 3RTQB 3WNMA 5F6IB 2FX9L 5DHYB 3KPQA 4NC1C 1QG3A 1S9WA 2BVPA 4R8WL 4Z95H 2EO9A 2YPLB 4TUOB 3RL2A 4WEBL 5J0BA 3N06B 3QCUH 1NLBL 1MHEB 3T8XA 1AE6L 4QXWA 3HFMH 4HZAA 4H26B 1HSBB 5BV7C 5D1QD 5A16A 2E6PA 5IEHA 2YRLA 2RR3A 1GOGA 5TF1H 1B9ZA 5IQ7L 1XGPA 2KPNA 5EZJB 3GKWL 5LGHH 4LIQE 1YDPA 4NQTA 5FDWB 5BRZA 2R4RL 2ESVB 4DUVA 2KZ1B 2BSSB 4TSBH 1Q9LB 5D7KE 4X9FA 1FAIH 2LE9A 1YEEL 4FG6C 4JR9L 3IGAA 1AO7A 1HSAB 4Z8FL 5D93C 4S1SH 2AJ3A 2IAND 4GAYA 7FABH 1TZGL 3IDJB 5FA3A 1GGIH 4WGWB 4Z0XB 2DRUA 2QKIA 4A6YL 3VJ6B 1C12B 3RI5F 1IAMA 3QEUB 4RIRB 4IOSD 1IAII 1A3LL 2BSTB 1KC5L 2Q87A 4X6EB 5I1KH 3D3VD 2V2XB 3SE3A 3T0DA 5JW5B 4JHWL 2APXA 4JPWH 3GSOB 3AB0B 4XCYA 5GS0D 5D1XA 4WI9A 4JG1H 3OKKA 2R0LH 1JGEB 3KLDA 4HKXB 3THMH 3H7LA 2WBWB 3RVUC 4RFEB 5AD0B 4TTDD 1PYWA 3PWLB 3KPNB 5KW9L 2P5EE 1KPUA 1UADC 2I27N 1ONQA 5DQ9A 2HKHH 2ADIA 2FGZA 3SCMC 4HK0A 3STZB 3AU1A 4G5ZH 5EC2B 1PG7H 1RFDL 3GRWA 4JDZA 4Q6YA 4EBQH 5KVDH 1MCPH 2O61B 5DUML 4HQQL 5D6CB 2HVKA 5FEBA 1MRCL 1A7RL 5DMYA 3N9GL 3CX5K 1EGJL 2X7LA 2EEAA 5DLMH 1S78D 3F5WA 4P3DB 5TGBB 3RX7A 2VABB 2AEPH 3QQ3B 3PJSB 4ZYKA 5JW3H 3OKNB 1UH2A 4NN6B 2CJUH 4CN1A 4P9ML 4RFOH 5DT1H 4D3CL 2DQEL 4EN3D 3QXVA 3C5ZB 2XG5A 2E9BA 4HC1A 4JRXE 5E8PB 1SYVB 1IC1A 3NFNB 3QULB 1QRND 2LTQC 4QHMA 1QSFA 1EJOH 2Y6SC 1G6VK 4XXCA 4X4MA 5LAXA 2YKLH 4RA3A 1NMCC 2EDTA 3IKCA 1T1YA 1JF5A 3MOBL 4G3YH 2A83B 4KROC 3BI9X 3C2AL 2XA8H 1B3JA 3R4DA 2E7LA 3U30B 3JV6B 3JUZA 1MHCB 1SJHA 4G7YL 2PTTB 1ZHLB 3PE9A 3OGCA 2IAMB 2EDLA 3SGKC 2X1WL 3IU4L 1DBML 1OLLA 4O58L 1XH3A 3MLSH 3O6LL 3L3KA 1T6VN 2F19H 1NKOA 1MFCH 2P48B 5TE4H 1WEJH 2EH8L 1HHHB 3X14A 3TNMB 4OV5B 2QQKL 1G6RL 5B3JE 5HVHB 3WFDH 1S7RA 3WFEH 1L4IA 5IQ9A 3TZVB 3WUWG 5C0EB 3TYGL 5BQ7B 1A6AA 5DVOA 4YHPB 4FQIH 1N8ZB 4PV9A 1WWAX 3L7EB 3TCLA 3VXOB 1WZLA 2DQUH 5F3BA 3GMPA 2MJWA 4JFFD 1JI2A 2G60L 5L2KA 4CU8A 3ECBB 2IBGA 3BGMB 1JMXA 1OWWA 1JPTH 2BY3A 1G7HA 5CSGA 3OGOE 3I2CH 5HDQH 4OCNC 4P3WA 5C0GA 4X7EC 3TJHC 1Z9OA 1VSCA 5JHLH 1AD0B 3EYSL 2X09A 2NY2D 4WFEE 2HRPL 1BBJA 5TDOA 1AGEA 4C55A 3MV9A 2EC8A 3G5VB 1WIOA 3VFNB 3D87B 5IHBA 4HLZH 3LN4B 1B6UA 4Y4FD 3LRGA 4GG8B 3BXNB 3Q6FA 4ODXA 1K6QL 3MGOB 3O45B 4OCSH 4QXUL 5CJ8A 2DMKA 3X3GH 1FQ9C 3MV11 1DQDL 3LN9A 4ZO9A 1ZLWK 3AY4C 5K9KA 5B3JF 4NO2A 2O26U 3P77B 3O2VH 5F9DC 2ENSA 4K23H 3H9SE 2V2TA 1F2QA 2OYPA 1NKRA 4FQXD 4YXHH 2X41A 1KFAL 1FNHA 4OD2B 3QNYA 2YEZA 1FCGA 1IMHC 3KPTA 3LS5L 4OCYH 2ZOKA 3WJJC 2DQTL 5FIEA 3L3IA 1IEAA 5HPMB 1O0VA 5I76A 3UXFA 3U2SA 3RGVC 2P8PA 1LP9A 4R9HA 3I85A 2NXYD 4PJIB 5F9WC 3QO1A 5FECB 4Y16B 1NGQH 3O6KL 2Z8SA 4DOHB 1F4WL 5F7MC 4OGYL 3PL6D 4LCYA 1E27B 1BBDH 3EOTH 2PXYA 4P2RB 4UT6H 1ZLUH 4IIQB 1Z0NA 4HKZA 4UQ3B 2DQIH 1FNSH 5EORH 5IVXB 2WV3A 1PKQA 4P2OA 3WE6A 3QQNA 3ZKXB 5C86A 1QLEL 3KDMA 4ZMAT 4P23B 1JWSB 2UYLA 5CJQL 4OLWL 4FQCH 4CU6A 4O02L 1KTLB 3PABA 1MVUB 4NQXB 4X99A 1QSEB 1DUZA 2HT2D 5ICZA 4Y2OA 4NJAH 2BVEA 2CLRA 4ZUVA 8FABA 1KT2B 2QHLA 1WIPA 1BD2B 1RIHL 5IJVB 2JJTA 1CIDA 1NBYB 1TJIH 4FN0A 4JFDE 2Y07L 5F89B 3D25A 4TYUA 3VFSB 3EDJA 2VDKL 3FQNA 2YMXL 1VFOA 2AJVH 3HI5L 1DSFL 5B39A 4PGCA 3MO1A 1OARL 1JBJA 1RULL 1P84J 4HUKB 1S5IH 3GSVA 3KPOB 2FH8A 5BW7A 1VPOH 2VDOH 2AXGB 2NY1C 5DYOB 5IGXH 2PTUA 5IB1B 4NM8H 3V52L 3UEZA 5IT2H 1YQVL 2MSPA 3QHFH 1A6WL 4MA7L 1LO4L 4Z76A 5F71A 1I1YB 4N0YH 3B3IA 4O4YL 4ZPVA 3G5ZB 3SDAB 2OSLB 3HE7D 3GHBL 2I9TA 3UO1H 1J8HE 1YPZA 4AEFA 1ZHBA 3QCTL 1XIWD 5C0IA 3FN9A 1BZ9B 4GUPB 3MCLL 1GHFL 3OV6A 1QBAA 4RISL 5DJ8B 1F00I 2P4AB 5IMKA 2X1QA 3RZWA 4G6AC 3T0EE 4NDMA 3U82B 1SVCP 4LEXL 5IESH 3AB0C 5HY9B 5D96B 3RVXD 3BO8A 3I6LD 2VKXA 3L5JA 5D7JB 1XEDA 1MPAL 5DRWB 1VFBA 4XBPB 5JUEL 4KKLC 4Y5VA 1YNLH 3MXWL 1Q8MA 1SEBB 2NY6D 1HYSD 1M1SA 2BNUB 4M61B 2E7BA 1EH9A 4U6TA 2D31B 1V7NL 2XN9A 4JB9H 4P5TC 4K3JH 1MAKA 4MD4A 1UCTA 3AROA 4PIRF 5BXFB 3WIHH 1W72B 3KYKH 4C83B 3HAEG 4DGYL 3GMLA 4WJ5B 4N8CL 3C60B 5E6ZA 4P9HH 5KSUB 1OF2B 5AZ2H 2BNRB 2QHRH 1LEIB 3VCLA 4F80A 3V7AG 3NACL 1G1CA 4PJFA 4XNYL 4CNIA 1NDMB 2NW3A 5IW6A 3CFDA 1MCSA 1W0YT 5DJDA 4MX7A 5T1KB 5JXAH 3BSZL 1N2RB 1U8PA 3PP3H 1V5JA 4Z7UE 5J9PA 5GRVK 3C5ZC 1P9MC 3AMKA 1MCNA 3V9FA 3GGWA 1XZ0A 1Q0XH 3PDDA 5KN5B 4EUPH 3TH4T 1YEIH 3V6ZB 4GMTH 4OLXH 1T0MA 5CJOH 4L8DB 3SDXE 2PO6D 5I1AB 3L95B 1MIEH 1P6AB 3SE8L 3QUML 4L8CB 1OQXA 4PLKC 4QY8A 2WIIA 5DUPL 4IRJD 3VFOB 3VG9B 1UM6L 4XP9H 4UIKL 4FZEH 3JWDH 4L4VB 3U4AA 3ZTJG 3FQRA 3ZDZE 3WV0A 1S9YA 3U30C 4GKNB 5ADPL 4UB0L 4QRPD 5D5MA 4MNQD 4ZFOB 4ZNEE 4MXQC 4F9LA 3GBMH 2IAMC 5E2TH 1HQ4A 4PRHE 5HHOE 3NH7L 5C1MB 3FRUB 1T83A 1DQML 1Q1JH 3MRIA 2YD3A 4CVWA 2FYYB 4YGVA 4AH2A 3BUYB 3OR7A 4QOKB 3R1GH 2J88L 1TMCB 5GS2D 5DJZA 4Z7UF 3QHZL 3TZVC 1WC7B 2CPCA 2QADB 4HIIB 2IPTL 4UAOB 4Z7QE 2QR0A 3UDWA 4Z78B 3NVQA 4M5ZH 3SDXF 3TFKD 4G43A 1JNLH 5ALBL 3T65A 2AJZA 5JO5A 2DYPA 4KDWA 1GZPB 3CXHK 3ZKNC 5EZLA 1DP0A 4Y1AB 2BVTA 4L9LB 5BRZD 4NHCL 2I9LA 4YDKL 3ZDZF 4PY7B 4P2QB 1KLUA 3UYPA 2R0KH 4PRIE 2O5XH 2GJ6B 3KLAA 5J57B 3P0YH 2ADFH 5E6IB 1S8DB 1A3QA 1AO7D 3INUL 1D6VL 5IF0B 3F58H 4O2CB 3MGTA 3GSUB 4TSCH 5FHAH 1GPOL 2Z92A 1YJDH 3QIUB 1PSKH 1NEZB 4HIEA 5ESQB 4BM7A 3FT4A 1IZKA 1JVKA 5J1AA 2ICWJ 1HKLL 1LE5A 4OGXL 2VE6A 2YD8A 2V5SA 3CCHB 3OAUL 4HG4K 1R0AH 4NO5B 1TVHA 3E8UH 4Q2ZA 3BKCL 3ILQD 4X6CE 3KLSA 3D39E 4JZJB 3T0AA 1U92B 4EKXA 5EO0B 5FM8A 2RJMA 4NQCE 1U95B 3T2NH 4TNWK 3H0TA 5D1XD 4OIAA 4LHUG 1I9RH 1SHMA 4WI3A 2G5RA 4DCQB 1VHPA 3VXSE 2R1WA 1JRHI 1N59B 5IWLC 3QDGA 3CX2A 5HHPA 1KN4L 4ZAKB 2X4OB 3IDYB 1N5YL 1NMBH 1AGDB 1FHGA 3IJSA 4IIQC 4P57B 1MCWM 4OI7A 4LPTA 3SEPA 2VDML 3ZKXC 4BKLA 1UVQA 4LDLB 1BLNB 4P23C 5CEZH 5IV2A 1QQDA 3MJ9L 1AHWA 3MLRL 5D7LB 1NBVH 2FSEA 3KGRA 4JO4H 3DVNB 1OTUD 1A6TA 3JV4B 4A2LA 4UDUB 3KYAA 2W0LA 5GGUA 5DJAA 1QVOB 1OSPL 3O2DL 1ACYH 4H88L 3MCG1 5JIIA 3WIHA 4UDTA 1OP9A 5DD0L 2NY4B 1DBBH 3F12A 3IXTA 3NIFE 4RMSA 3CXDL 2P8MB 4X6CF 2X4PA 3IFNL 3F7QA 3RX8A 5A2LH 1SMAA 3DHJA 1U3YA 4NRYB 1HNFA 2RGSA 3QZWG 5EBMA 4CVXB 1RZKC 4NKQB 4O00A 1QSFD 4WUKL 43CAB 1FRGL 1T7YA 4JCLA 4GKSB 2YBRA 1L7TH 4HS8H 3LMJL 5C0NC 3S3JA 1INQA 3NN8A 4ZUSB 2J7LA 4TNVF 5FCUL 2DAVA 4UILL 1P4BH 3SDAC 2UUDH 2P5EB 4DZBA 3RVTC 1UZ6E 4EUPA 5ECJE 2XI9A 4RZCB 2Z91B 2E7CA 5I1GL 1CTNA 5IIEB 1JPGB 5CD5D 5I16A 1ODAA 2LABA 3VD9A 1EBAA 1XGRA 1OAXH 3FB5B 5L8JB 2MQ0A 3ARQA 3AS1A 5JQ6H 4XCNA 5IJKA 1QHPA 5FKPB 5D7JC 3UPCA 1HDMB 5C08E 4LDOB 2VAAA 3NIFF 3TJEL 2CDEA 4NRZA 2YSSA 3DNKA 5SV4A 1QFUH 2HN7A 3FO1B 4HX1B 4ALAH 4S1RH 4HWZB 2J8OA 1G0XA 1LVEA 3C8KB 4K7PH 4QT5A 5DUBA 2F8OA 4JRXB 4NN5B 4XNZB 3ROOB 1XGUB 3UJTL 4R26L 4ENEC 3VXRE 4GAGL 5L2KD 5TE7H 3QUXA 3QUMB 3W9DA 3MYJB 5KVFH 2XIDA 1SEQH 3L3OA 5MI0C 4FQLH 1NAMB 3WDJA 1VADB 1W0VB 4YDIH 3BPCA 5T1LB 3D1MC 1DE4A 4OCLC 1UZ6F 4JFZH 2N1KA 2CDGB 2DM2A 1R24A 3F62A 3MV9D 3K2UL 2F53A 3RWGA 1I7TA 3HAEB 1HILB 2C26A 4YHLH 2K1MA 5E8NA 3WL9B 2V5TA 1R3IL 1CDYA 1R6VA 3O4LE 1F02I 3L3HB 3KPLA 4OIIH 2R1XA 1YEJL 2CKBL 5D7SH 2HFFA 3M8OL 2P45B 5FGCE 3C6SB 1I3UA 4U1SB 3HNTL 5B8CB 3KR3L 3CUPA 4LCUB 4NFBA 2ID5A 2ITCB 2AK1L 5GZND 4TVPE 1JPSH 3EW3B 4JPVH 3PWNB 3T77A 3NAAL 43C9A 3MCKA 1I8LA 2OJZH 4JFHE 3W81A 1X9QA 1P6FA 5LGJA 4KKNA 1Y0LB 2D7PA 1U3HB 3HUJA 4KV5E 3MRLB 3VRLE 3IAQA 2PXYD 3RA7L 2VDRL 1R3LA 3Q3GA 4P2OD 2EDRA 3DIFB 3QFDA 3HR6A 2HJLA 1XT5A 2VXSL 3W39B 4BZ2L 3MRHA 1X5AA 4GO6B 4CRPA 1TITA 1K2DA 4DUWA 4EDWH 4JHBA 3QWRA 3WS6C 4GRWH 4X7SL 2FX7H 5T3ZL 4U6YB 4WHDA 5D6DA 3SGDH 4DVRL 2XY2A 4ODSH 1UEYA 2FBJH 4H20L 1MLCB 4UV4L 4KKCD 2G2RB 2MWCA 5A43C 4M4RA 3HMXH 1JHLL 3H9SB 2B1AL 3MLZL 4I18A 2OL3B 4L9LC 5JMOC 2ZCHH 4OLVL 1FDLH 3DYOA 1FORH 3V4PL 3L1OL 4KK9D 1CFSB 3GNMH 2ICWB 3W0WE 2X9WA 1LEGB 1WZ1L 2UV3A 4XPGH 2BJMH 1CZ8L 4EVNA 5FF6B 4X5WA 3BKMH 5AZEL 5E6IC 5IHZA 3DV6B 4X0KB 3RPIA 1C08B 4GW5B 4ODHL 1CFVH 4OZGE 3VRLF 3N85H 4UQ2B 1MEXL 4JGUA 3JVGC 4U1JB 3QIUC 5HYSA 2R2HA 4KJWC 1NGZB 4FXKB 4X4YA 4Y19E 3B9AA 3GZKA 1EVUA 1G7JA 5GQBA 4NM4H 4G8GA 2QV2A 4U05A 1CXHA 1HQRA 4WI8A 5EWIH 2IFFL 1ZANL 3HI6L 1NAKL 2Z93B 5AG9A 1IGCL 1FAKT 5CGYD 2GFBA 1MIML 2OI9C 1A9BB 3RBSA 1NDGA 4ZODA 4U49A 1OP3K 5C0JA 5ADOH 4PRPA 4AIZA 1YEFL 1DLFH 1KCRL 3FL7A 5IHUL 4M93B 5C92A 4JFDB 4OAWB 2ED9A 2GY5A 2XN9D 2H41A 1M05A 1Q0YL 3B9KA 3VMOA 4ZAKC 1KGCE 4XMPL 4PLJD 4S2SA 4C4KO 5HHQA 5DFWH 3IFLL 1PZ5B 1JHTA 4OZ4B 1CL7I 3GIVB 3V8OA 4BJLA 5C0FB 1XR9A 3FTGA 3N1PC 5FO8B 4LSPH 3JTTB 4LHUB 2DQCH 3ZHDA 1RIVH 4OZGF 1BOGB 3LQAH 3RKDD 1INEL 4PJXA 4QRTB 2N7BA 1KTDA 2APWA 2KH2B 4B41A 1JN6B 2QQLL 1DVFB 4I9WD 4WFFE 3QDJE 2YR3A 3MV7E 2NY4C 1J8HB 1AY1L 2BXZA 5EC1B 1XGQB 3KPMA 5CCKL 2C1OB 4GSDH 3RWJA 3AUVA 1Z9SA 2VITB 4R7NB 1EERB 2PN5A 4RQQB 4MA8L 3JXAA 4X8XA 4MDIA 3DTXA 1WBXA 3PG2A 1IL1B 1ZWIA 3M1BA 2ZJSL 3T0EB 4DGIH 4OQTL 4LAJH 3U9UB 4IBLT 4ZO7A 5E8EA 2Y5TB 1JFQH 2ZUXA 2CK0L 3L5XH 3OXRA 2FEDD 5EOQH 2EEDA 4NQVA 1OY3B 1UG9A 2EXWD 4KK5C 4ODBD 4Y4HB 1EMTL 2ZPKH 1QO3A 4PUBH 3QPXL 4NUGL 6CGTA 3GJFB 1JWUB 3CSYA 2CR6A 4JQIH 1MCEA 1B4JH 2ICWI 2A6KA 1P7QA 3NGBB 3AXLA 4DJMA 1NL0H 3BH9A 5F7DA 4UU9B 3AMLA 1C5DB 4J8RB 2VDNL 2LAGB 1RJYA 4LU5L 4U3HA 2IQ9L 4OLUL 1X4YA 3PV6A 3FONB 1RUPH 1U8NB 1M7IA 1SBSL 3UTPD 4Z7UB 4HUVA 2X4QA 3P40A 4HKBA 4TOYL 5LQBH 1BOYA 1PX3A 5F6HJ 4U1KB 2CKBB 5IOPB 2J8HA 1J1OL 3FQUB 2YA2A 4NN5C 5T3XE 4XNZC 5DI8B 5EUKA 4JY5L 4U33A 4N1HB 1SM3L 5EFIA 3S5LA 5E7BA 3B4NA 3R8BB 4M43L 4LLDA 3SDXB 2R9HC 2DYPD 5LJYH 2ARJA 3K4DA 4HV8B 4LRNL 4S1DC 2OBGA 3RUGA 4QHKJ 2MPAH 5SWZA 4O51A 3OX8B 3IAGC 3ULSA 3HTLX 1T04A 4YPGA 3DURB 4JKPH 1A5FL 1QFWM 5J13B 1S7UA 1IILE 1U8HB 2EKJA 5I75B 3KHQA 4IOFC 1I9JH 5EUOA 2VJXA 4MJ2A 3HMXA 3U36B 4E5XA 4PRHB 3ILPA 1N0XL 5HHOB 4KKBC 1YECH 4KUZH 3K8MA 3A67H 1YZZA 3BKJL 1UC6A 1IZJA 1T89A 5FUOH 1KYOK 4OTXH 5IVOA 2NNAB 5K9JH 2RHEA 2YK1L 4M1DH 1MNUL 2Q6WB 1GC1L 3LKOA 3SY0B 1KB5L 5F7UA 1QLFB 3QQ4A 4XAKE 1ORSA 4NZDA 4MNGE 2DI8A 2X44D 2FRGP 4KTEL 2A6DA 2C3GA 1ZS8A 4W6XB 1X5ZA 4AYFA 4E42B 1BPVA 1FLRH 4LSTH 4TVPL 2C3XA 2HT2C 1CD1A 4G9FE 4F7PA 5CAYB 5HYJE 1OAKL 1V7MH 1DBJH 1KEMH 2HA1A 2NY5L 2NY3D 3QDGD 3BN9C 3VRJA 1KTRL 5GIRA 3CPLB 2NY7L 4LCWA 4WFGE 3VXNA 3DX6A 1T2XA 3CSGA 3EYVB 2VIRB 5GRUH 1VGKB 3OKYA 4NQDE 1J1XH 3PHOA 4PRIB 2J3SA 1AH1A 3JWOC 1FLTX 2A74A 2UZYB 2EIBA 4J7RA 2XQYG 2AV1A 1WCQA 5T1DL 5C0CA 1MWAH 2L4OA 4YDJA 3U48A 1TTGA 4YHIA 3JUYA 1CYGA 1LQSR 1A4JA 5HI5D 1OAUL 4JFPA 1U8JB 3OJDB 3MNVB 4FP8H 3CVHL 3V0WH 2WQ8A 3DUUB 2WWMD 2AJXL 5CD3B 1A6UH 5TDNB 2L0DA 1N3NB 4GW1B 4TPRH 1TJHH 1LNUB 1TJGH 1AR2A 3JSSA 5C8JA 4X6CB 2HJFA 1QEWB 3D39B 4M8VA 1I85A 5C2BH 5LBSH 3MFFA 4F7MB 4HWBL 4YIQB 4NQCB 4OLZH 5HHNA 1B88A 4HGMA 3WN5B 4AENA 4OKVB 1AQKL 4IMLA 3VXSB 4N0RA 2W9EL 1VFAA 3DX7A 5IBTL 4LSUL 4UIMA 3TLRA 2VN4A 2VDPH 1FNEB 5GSVA 1WAAA 1MFEH 3QWOA 1A6ZA 4M02A 1CICB 4HHAA 1KJ3L 4O5LL 4QWWC 4X9GA 2P49B 4HIJA 5KTEL 3TGXA 1FYTE 3AAZA 2P5WD 1FZOA 1FBIL 4HGWA 3FO0L 4QCIA 4LQ1A 4NYLB 2E9IA 2LU7A 4FABH 1RZIA 1NSNH 3V6FA 4M5YH 3VFGH 3ULVE 3STLB 4OFKA 1IAOB 3VA2C 3IDNB 3GI9L 4MD0A 1RZKL 3RIAF 1QBBA 2JELH 2B7DT 1LO0H 4OLYL 5DQJA 4WIQA 1OT2A 4JHAH 1N4XL 3A6OA 1CQKA 4PREA 2AGJL 2DLHA 3QUXD 5DRXA 5BVJA 4JFXB 1CGVA 3I02B 5I1EH 1F97A 4H25A 1EEYB 4I2XE 3RU8H 3LKSA 3QEHA 4DTGL 6FABH 5FK9A 2MCG1 1UB5B 2PO6C 1EEQA 4N90D 1J0JA 1H0DA 1PEWA 3VXPB 3E6HB 1DR9A 1PJ9A 2BCKB 1MJJB 5SWSA 2F53D 2FX8L 4OFPA 3D9AH 1A1MA 4ZTOH 1T20B 1S9VB 4ODWA 3GIZH 1A6VL 4RFNC 4FQHA 1H5BA 3ROLA 2ZOLB 1PAMA 1G7MA 2IQAA 1A0QL 4BH8B 4QLRA 3HB3D 4XX1E 3T0EC 2DIJA 4ELKB 1OW0C 1NFIB 4LLVB 2MCPL 3VRIA 5J89A 4HXAL 1BZ7A 3BT2H 3LKQA 4N9GB 5C08B 2YD7A 1GGBL 5DD5L 4XPTH 1EAPA 2B2XH 3VFVA 4XNUH 4N0CD 3MLPA 1X3DA 2B5IB 2Q20A 3RVWD 4GS7B 1NEUA 5J56B 5EU3B 2VQ1A 4PRAB 1OGTB 4MXWH 3P30L 2V5MA 1DLHB 1HHJA 5GGQL 3VXRB 3BH8B 4RAVB 4YC2B 3NGBC 5DC0A 4I0KA 1K8IA 4K8RL 3TFKC 3QI9B 3QEGH 3QXAB 3ZZ1A 3LAFA 1RUML 2YRPA 3MRPB 1BQHB 1NGXB 1MFNA 1S7SA 1FG9C 4MVBC 4ZOBA 4JO2H 1FN4B 2R4SL 1NC2B 5DSCB 3GSWA 3QWRD 1NCAH 4JDTH 5HD8C 1ND0A 4N5ED 1I1RA 3CH8A 1FG2B 3O4LB 4MAUH 3EYFB 3AS3A 4TUJB 4K9EH 5C07E 1MCRA 3HI1B 4P49A 4P48A 3MLTB 3V6OE 3RJQB 5CEZD 4L5FL 4YAQB 5FGCB 2H32B 4NUJA 5AYUH 2DD8L 4MCZB 4WUUE 3UPRA 5IK3B 1MWAA 1IGML 1UWXK 3QUZA 3NCYP 4ZO8A 1ADQH 4IDLA 4Q9QH 4LF3B 3P0VL 4PG9A 2EYRA 3ILQC 3O0RL 4W4OA 3N1QC 5LG1A 3GDBA 4PJCE 1NC4B 3OJMB 4LHJB 4MJ5A 4KRPB 5FKAA 5KSAA 4OUUA 4S0TD 4WW2A 3H8NA 5I75C 1YYML 2BXYA 3DETC 1D5BA 1D6EA 5DD6A 3QEQA 5CBEB 3VXMD 2COQA 3QHTC 3OR6A 1IGIH 4WO4A 4I3GA 4G6ML 2C9AA 3PGDB 5C0RL 4HXBH 1GAFL 5I1CH 4JY4A 5BV7H 4JDVB 3S36L 1PQZB 4G8GD 5CILL 3TEUA 3QIWB 5KJRL 4XP1H 4KDVA 3O9WA 5T5FL 3MJ7B 5I1DA 1JUFB 4G7VL 1KJVB 2O93L 4PRPD 1ORQA 4ZFGL 1IAKA 3B2UC 1TCRB 4PJHE 2YA0A 2DKUA 5E2WL 2X70A 1F3JA 1G84A 4NC0B 5JR1H 2C3VB 3B9KD 4ODUB 5J3HC 3UJJH 5JXEC 3O4OC 5ITFA 1QR1A 3CVIL 1SJEA 1FIGH 3BMVA 4PJ7A 4PJCF 4DGVH 2XA3A 1E6OH 2D7TH 5ESVA 2WINB 3W0WB 3P9WB 3D69B 5GS0L 3V7MA 3BP5A 4GBXA 4XBGA 4JE4B 1T66D 2AJSL 3ZYJA 3IDMA 4HPOL 1MF2L 1ZK9A 3FQXB 3J8F7 3EFFA 1FZMA 4XXCC 4G8FB 4OZGB 3V5HA 3EKCA 3TT3L 1XF5B 4CDHA 3QIBB 4U1NB 4LOUC 1S5HA 4MCYB 4JM2B 5IMOA 5L0QB 5DQDL 5GS1B 2Y9RT 5M95B 2FGWL 4YQXH 4Y19B 3T08A 3UTSA 1F4YH 3H42H 5DJ0A 5DWUL 3G5XA 4JPIB 3KVQA 5E8DH 3JV5A 4K94L 2P8LB 4YGAB 3IFOB 4MJIE 3Q1SH 4PJHF 5CD5C 3BRGC 1FCCA 2GAZA 5IM7A 3LDBB