3JT2A

Cu(ii) n47s/m121l variant of pseudomonas aeruginosa azurin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Azurin
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3jt2A00
1HAUA 2FNWA 2Q9OA 1ASOA 5B1JA 1BXVA 1PZBA 1TKWA 1PF3A 2BZCA 1L9PA 1NWOA 2IDUA 3SBPA 4PCYA 2PPEA 2AFNA 2PP9A 4YVNA 2J5WA 1KBWA 2QPDB 1JZFA 2XWZA 3MBWB 4KO9A 1PZCA 4AKQA 3ASOB 4E9SA 4NB7A 1NTDA 2PP8A 2PP7A 1NIDA 3AG4B 3S8FB 3KW7A 4G71B 1T5KA 3SBQA 2VSMB 3T9WA 5PCYA 1SNRA 1OCZB 1QLEB 1MDAA 3NSCA 3DIVA 1ZPUA 3HB3B 4GYBA 3AG3B 1E65A 3FSWA 4FA7B 3H4HA 1M57B 3NJJA 3AY2A 2IWFA 3RYMA 4DP7X 1ZIAA 4ENZA 1GY1A 1NDTA 2GSMB 4BXSV 1A4AA 4GP4B 2H5UA 2PLTA 4YSAA 1B3IA 2DY2A 4HHWA 4GY4A 2J57A 2UXVA 1V10A 4A2FA 4A2HA 4G7SB 1KCWA 1KCBA 4ZK8A 1M56B 1JOIA 3FT0A 4YSTA 2B08A 2OV0A 3ZX1A 3NT0A 2N0MA 4HCGA 1ID2A 2VW6A 1FWXA 7PAZA 1OV8A 3FU9A 4A66A 4PAZA 5I6MA 2PCFA 1QNIA 4DP4X 1RZQA 4HHGA 4DPAX 4X4KA 2YARA 3CVDA 1CURA 1A4CA 2JXMA 1WAEA 2HX7A 2I85A 4DPCX 4YSUA 2W88A 3T6XA 3TASA 4YVUA 2QPEB 4YSPA 1JZHA 5LDUA 2Y1AA 4UAHA 5F7BA 4NERA 3X1EA 1E5ZA 4AKOA 1A4BA 3NSDA 1WA0X 2BP0A 2YAEA 1KDJA 2IH8A 4KO6A 9PCYA 3NYKA 1OCOB 4G7RB 4GP5B 4HZ1A 2GI0A 2MRYA 1SDDA 3NJIA 1GYCA 3TBBA 1TEGA 3BVDB 1BXUA 2VSKB 1AOZA 5A7EA 1BYOA 2IDSA 3V9EA 1WA1X 3FU7B 1J9TA 1J9QA 1SHWA 2XUWA 1TEFA 5I6PA 2GHZA 2HXAA 4WTQA 2BO0A 3T6VA 4KOBA 3AG1B 1PNDA 1ZDQA 3QQXA 1KYAA 1NWPA 1RCYA 1MG2C 4AX3A 2BW4A 1TU2A 1JVOA 5I5MA 2BWIA 1IC0A 3ZIYA 2OCCB 4AI7A 3CDZB 1AR1B 2ZWNA 1IUZA 2PCYA 2UX7A 3UACA 3FYIB 5I28A 1YLBB 3CVBA 2XX0A 1QHQA 2IDTA 5B1KA 1AACA 3DKHA 5F7AA 2FQFA 5D4IA 3PAZA 1ZIBA 1AANA 3CDZA 3UADA 1JZGA 2VW7A 1E5YA 2XU9A 1W6LA 2EILB 3AZUA 2CCWA 2A3TA 3EHBB 2DYSB 2P80A 2XV0A 2R7EA 2GBAA 1JZJA 3UGEA 3JTBA 2UX6A 2XLLA 2HX9A 2YAPA 4E9TA 1NPNA 2P80D 2GB2A 2IWKA 3IN2A 2AANA 3IE9A 4A2GA 1L9TA 1BQKA 1EHKB 3IN0A 3FU7A 4YL4A 1WA2X 1X9UA 3KW8A 4A67A 1JZIA 1J5CA 4W1TA 3PAUA 3G5WA 3QJVB 3QPKA 1A8ZA 1OE1A 3QJRB 3NJMA 4BDVA 1V55B 1WS8A 1ZDSA 2QDVA 3TBCA 4BWTA 1ASPA 3ERXA 4UANA 2PPAA 3TA4D 3X1FA 3FU8A 1KV7A 1J9SA 2DV6A 1XMEB 4M3HA 2Q5BA 4JHUA 1JXFA 2J55A 2FQGA 1CYXA 4JHVA 2CUAA 3NP3A 5I6LA 2B3IA 2PPDA 4TXVB 3WG7B 3PAVA 4M4RB 1UATA 2CBPA 1BEXA 1BQ5A 4YSCA 4E9RA 3H56A 1KGYE 2EIJB 1CYWA 4BDVB 2H47C 3ASNB 1NIFA 3IBOA 2AVFA 3OMNB 4KO7A 3FYEB 2XXFA 1R1CA 1RZPA 1ZV2A 2X88A 1PMYA 3GDCA 5B7FA 2ZOOA 1BQRA 3QJQB 2DWSA 2HRGA 1RKRA 4E9YA 2BWDA 1MZZA 1OE3A 2CAKA 3WKQA 2TSBA 3BQVA 5ANHA 4DP0X 4QLWA 4G72B 5B3SB 2OJ1A 2QT6A 2R7EB 2BW5A 3L45A 3H4FA 5TK2A 1V54B 2YAMA 4HCIA 1OE2A 1GY2A 4K9JA 2CALA 4E9QA 2FQEA 1GS6X 3FSVA 4YSDA 3PXLA 1AZBA 1FA4A 4WKXA 2GC4C 4P5SA 4KOCA 3AW5A 3PLYA 1ETJA 3NJFA 3SQRA 3ZDWA 2UXGA 2HLEB 1E67A 1PLBA 1W6WA 1ADWA 2VM4A 3PPSA 4YSSA 1MZYA 4CSPA 1AS6A 1GR7A 1SDDB 2NRDA 3DTUB 1VLXA 3FQYA 4W9ZA 2XX1A 2VMJA 2Y69B 1AAJA 1GS8A 2AZUA 5AFAA 4JKNA 3X1NA 4BXVA 4KNUA 3ZBMA 1W8EA 5PAZA 2EIMB 2FWLB 2UXFA 6PCYA 2J56A 3EH3B 4GXFA 3NP4A 3HEIB 3WI9A 2WO2B 4G70B 1J5DA 4Q8BA 1GSKA 4YSQA 3IEAA 2EIKB 3PCYA 1AQ8A 1AG6A 1KBVA 4YSEA 2HX8A 1L9SA 4FAAB 3EH5B 1A3ZA 2BP0B 4BWUA 1NINA 1BAWA 2W8CA 3UABA 1ET5A 1NPJA 1PCSA 4GP8B 5D4JA 1AZRA 2FT8A 5B1BB 4DP2X 3N2JA 2IAAC 1JXGA 4NAJA 5E9NA 1JVLA 1SFHA 1ET7A 8PAZA 3NSFA 1GW0A 2JKWA 3GXUB 4HALA 2FT7A 2FTAA 2YAQA 5I6NA 4A2EA 3CG8A 2GIMA 2H3XC 1CUOA 1WS7A 3C75A 1L9OA 3OM3B 1XB3A 1PAZA 5TK4A 4F2FA 1EZLA 4L0PB 3S3CB 4YSOA 3S3DB 1L9RA 3N55A 1E30A 2TSAA 2YXVA 3X2QB 3OMIB 1FFTB 1AZCA 1XB8A 2RACA 2IDQA 3AG2B 3GYRA 5AZUA 3NJGA 4DP6X 2BZ7A 5I5JA 3JT2A 2FQDA 3FS9A 6PAZA 3T6WA 3NJNA 1PZAA 3ABKB 3X1BA 1A65A 2YAHA 2I7OA 1ILSA 4YSRA 3SBRA 4DP9X 3EF4A 3OQRA 1SF5A 1SFDA 1M9WA 2YAOA 2DWTA 2YAFA 2XVBA 5B7MA 1KDIA 5B7EA 1SJMA 2VM3A 4E9XA 3X1GA 2ZXWB 2E86A 2XV3A 4AKPA 4HCFA 1N68A 2IDFA 2XYBA 1F56A 5I6KA 1JXDA 4Q89A 3D12B 1AZUA 4F7KA 1HAWA 1AS7A 1BXAA 4BWWA 1XB6A 5B1AB 4F2EA 3ABLB 1OOWA 3UAEA 1ILUA 3WNIA 1ET8A 4MFHA 1HFUA 1OCCB 2QDWA 3FSZA 3NJHA 1AS8A 1NIAA 2YQBA 1MG3C 2BP8B 2BHFA 5IY5B 5FC9A 1BYPA 1JERA 2ZONA 2EINB 4N4YB 2I7SA 1NICA 1L9QA 5I26A 4EF3A 2VN3A 1AG0A 1DZ0A 3UAAA 3CVCA 3EH4B 2IH9A 3U25A 4AZUA 2GC7C 5D4HA 5AKRA 5I6OA 4DP1X 2FT6A 1PLAA 3T71A 3T6ZA 2IWEA 2X87A 5B1JC 1DYZA 4QKTA 3NSYA 2HZHA 3OD3A 3S8GB 4KNTA 3WNJA 3CZUB 1NIEA 3FPXA 1I53A 3NJKA 3V9CA 2PPFA 4DP5X 2XV2A 1URIA 1IBZA 4KO5A 1J9RA 4G7QB 4DP8X 1ASQA 1PLCA 2CJ3A 2HRHA 4RH4A 3TU6A 4CSZA 1NIBA 3ABMB 1AZNA 1JZEA 4BK5C 3FQ1A 3FPYA 4DPBX 2YXWA 3WIAA 1IKOP 2WSDA 1AIZA 1OCRB 1PY0A 1X9RA 1SF3A 3FSAA 3WKPA 2FJSA 3QJTB 3S3BB 3MX0B 3NJLA 4E9VA 5EHFA 4HAKA 1NZRA 1N70A 4P5RA 3FQ2A 3QJSB 4KNSA 3OMAB 1PNCA 1GS7A 2VW4A 7PCYA 2MTAA 2UXTA 1IBYA 2JFCA 4A68A 2LLNA 2AZAA 4UF7C 2DYRB 4A2DA 1SHXA 2PPCA 4N8UA 1OF0A 2XXGA 5I5IA 3ABGA 2WO3B 2BP8A 3QJUB 4E9WA 1CC3A 4HIPA
chains in the Genus database with same CATH superfamily
4NN7B 4N1CA 4GS7B 4YDZA 5LJYH 5B39A 1V3LA 3QIWD 3AB0C 4HZLB 3UBXG 5T1DL 3TZVA 3QJXA 1JDAA 1U9KA 4FMVA 2C4FU 4IBZA 3UTTA 4P46B 1NLDH 4NWUL 2AKRB 1JZFA 3WFDL 1K4CA 1YZZA 1F3DJ 5GHWL 2WXOA 3FCTB 4NKIL 4RRPA 3KJ4B 1EERB 5DD1H 3U4BH 4BFNA 1JGVL 4D8PB 1CGYA 3RWFA 1UVQB 3VGDA 3ZMNA 1BBDL 2EXSA 4P5MA 4HU8A 4UI2A 1VERA 2PCPA 2VSMB 1JPSH 1OCZB 4IU2B 4ZS6D 1OXYA 2RMNA 2VR3A 3UJTH 4Q6IC 3TBVB 5KOMC 2W9EH 1BOYA 3W57A 2X6CA 4PRDB 1TZAA 1SMOA 3NJJA 3HMWH 4ZOEA 3SYCA 3BCDA 5ILTL 1SMDA 4G5ZL 5AW7B 2V5YA 4ENZA 3B9KB 3LKPB 2A6JB 3I9PA 2VSDA 4GQZA 3WN5A 1A1NB 1LK2B 2XWJA 5GJTH 4AGPA 4AK2A 4NRXB 5L8JB 5FYKH 1KCBA 4JDVB 4EN2A 3RZWA 1KXQA 2J1KA 3MODL 3RVXD 2B08A 1G5AA 2ZWYA 2OZ4H 3NT0A 3BZEB 1EDYA 4PB9H 5I17B 1YYLL 4Z95H 3H3PL 1INQB 3IK2A 3O4LA 3KWWA 5ITBH 4CDHA 1DQTA 3ARGA 5ADPH 1JPTL 5DJ6B 2NY6B 2YHGA 1U36A 2ZF9A 3QEQA 1NFDB 3DSNA 5FKPA 1A4CA 1HINL 2EEFA 3WE6B 2IPKA 5DD3H 4WHTB 3HZYA 4BIKA 1ZAGA 2DM3A 1NCDH 3DMMC 1WGOA 4LPWA 4U6XA 2A9NH 4N24A 1J86A 2FCBA 3IS1X 4EO5A 3X1EA 3ZGIA 3B6SB 4ZO7A 1ULVA 3AACA 4BZYA 5CFHA 1R3KA 1SGKA 3UP1A 4KUZL 1G6RL 4C55A 1IGFL 4JQVA 5INDA 4EN3D 4ZMAT 3IMBA 1HJBC 2DQEH 1F90L 4OCSL 5E1QA 4ACTA 4G1EB 3BP4A 3MRMB 5IBUB 3C5SB 1M42A 3ZPDA 4NQDE 4AGMA 5MEOB 3BVNA 3JV0A 3CHOA 1F13A 4C56D 3BSGA 3B9VA 1FO0A 4WTQA 1OF2B 3T0EE 4NLHA 3AG1B 3KPNB 4PTUB 5FWRA 2KI6A 4P5TD 3EXLA 3S35X 1NWPA 4WO4A 5SX5H 4JANA 1S8DA 2R2BB 2D8KA 1MVUB 5I8KL 2ZXCA 4HOWA 5DD6A 2ZUYA 1T2XA 3CPUA 1YDPB 3MLZL 2HSIA 4U0RB 2DLTA 2NW3B 4MRBA 3DC0A 1AHMA 3E7JA 5I28A 4BUGA 2IDTA 3EJSA 1LWRA 4HLZH 1HHKB 1KULA 1EO8H 4M02A 5BRPA 1EJ6A 2BMKB 2F18A 2VUKA 2EILB 4AXWB 1FYTB 2W0PA 3GB7A 2RFXB 4KDTA 3FCSB 2YPVH 4HMCA 3EHBC 2JCCA 2ZCLL 3VFMB 4GW5B 4V33A 1NUGA 4QI3A 3U9UA 3GRGA 2YAPA 3VGFA 3C5JB 2YEZA 1HE8A 3I2CH 1JV5B 1PZ5A 3RDTA 2IWKA 1SEBA 1A6VL 1K72A 2NX5D 3SO5A 4LEXL 3IDJA 2BIHA 2MQGA 5KYXA 3KW8A 4I87A 4U1JB 1CE6B 4M8UA 4U6TA 2A99A 3IJ8A 4ZUUB 4B96A 3QJVB 4FQ1H 4XGZB 1Q0EA 3EDFA 4BWTA 5JHMA 3ULUE 2YFNA 4JZJA 12E8L 1XAKA 4UANA 1MFVA 1CGXA 4OI8A 3HLKA 2AQ3A 2MOGA 4AG4H 1I1YB 4FZEL 4XNMA 3WN5C 1R3IH 4A7VA 1OT4A 3LH2H 3P9LA 4WI2A 1Z5HA 4KI5F 4KUZH 4YS4A 1RL1A 2RCSH 3NCMA 4UM8B 5DJXA 1U8MB 4EDXB 3WG7B 1UM4H 3PAVA 2L0DA 2DQDL 4O02L 3U2SA 2JVUA 5I1IH 2HG0A 2X0VA 1VACB 1UHVA 4FKEA 1A6UL 5E5MA 3QIBC 1T03L 3ZHLA 2CKNA 3ILQC 3QDMA 3US1A 4XPHL 4O4YL 4R7LA 1X4YA 3AREB 3F65A 2XXFA 2NSXA 4WWKD 1D5RA 2XZQH 3OR7A 2VXUH 1A7BA 4M43H 4GAGH 1MZZA 3D06A 4G3YL 2NY0B 2Y3NA 3TO4C 1SN2A 4HQQH 4MDIB 3F05A 2FDBP 1RUML 2AV1B 4KRNA 5ANHA 1QFWL 3LPGA 2AMUA 4KZDH 4G72B 1JGEA 1VCAA 4MGXA 1F3RB 2A9AA 2WXQA 2DQ6A 5KSVA 4GSDL 1R24A 5A6MA 5I6XC 1E3FA 4Z0XB 1KN2L 5GS3A 5JIMA 1S7SA 1WHPA 5GS1A 1OE2A 4PV1C 1BPLB 4ICXA 1KYFA 3ZDYE 4U6XB 5BXFB 3VH8B 2WTRA 2X09A 1BF8A 4HUWB 5I71C 3RWIA 2ATPB 4LSQL 4ELKA 4P5MB 3AW5A 1NUNB 2VABA 5T5NG 4OGYL 3ZDWA 1H3WM 4P57B 1E67A 2X4RB 3KHQA 4NPYA 4OLUL 5I1HH 1TJIL 2H3KA 3G6JA 5DS8A 2J25A 4Q9RH 1GYUA 1AS6A 1SJXA 2BFVH 2Y25A 4X4ZA 5G5DA 2IANA 2I9LB 1D5XA 4I48A 3TJEH 3OR6A 2H0PA 5KS9E 3BRFA 1TZHB 1IFHL 1K8DA 1YMHA 2Q20A 1EBAA 2EDMA 1RHFA 3U9WA 2C1PB 1ZVHA 3WHE0 1QVOB 1UCBH 4GBXD 2NY1D 2R4SL 3IJHB 3U48A 2VN6A 2VR7A 4MA8L 1AQKL 2DQCH 5LNGA 1B0RB 32C2A 4OM1H 1PY9A 2D03L 3CUPB 4L8SB 3HZVA 4N8CH 3ROOB 3M88A 3KWWB 1JDCA 2P47B 4WEBH 4BK8A 3ZRSA 1UXMA 3QH3B 4O5LL 4BWUA 4AQAB 3K8KA 1FVEA 3ULUL 1QX1A 4PVLA 5MEPB 3UABA 5I8OH 5CHNA 3STLA 3HZKA 4YQXL 1DJXA 1NPJA 1UWFA 4XP9L 2IV8A 1E6OH 4OV5A 4X6FA 1JVLA 1X5AA 3BN9D 1ET7A 3KPLA 3QXVA 4GIAA 2VLKE 3UDWA 3NSFA 3GXPA 2W60B 1YEHL 2Z4TA 3H9SA 4NPJA 4XPFH 2J44A 4R4FH 4G11A 4G8GE 3WYRA 5I6NA 3B2UC 3MLPA 4N3UA 3MMEA 5GRXG 5CUSL 1QUPA 3IJSB 5INDB 4P2RA 1IM3A 2DI8A 2BNRB 1YC8A 2DLHA 4XWGH 5L8LB 3DURB 1IGTA 2IBZY 1ZHKA 1MJ7L 1UZ6E 3K8MA 4L0PB 1AMXA 4RIRB 1HIMH 5DC2A 2QFPA 2WXRA 2ZP0T 3B7YA 5E7BA 5F7YC 1JIBA 2XCMC 2IOOA 3ZT7A 3U0TA 4X9IA 3GYRA 5C2BH 5A7BA 5C0RH 5BV7L 2KZKA 5E6IB 4L37A 4J3TA 5C7XH 2WJ5A 4OCLC 4R4BB 5AYQA 1XSKA 4B50A 3PUCA 5IFAH 1I31A 2DI7A 3VE0B 4OJYA 3I9GL 4FNPA 3D87B 1UWXH 5DMJB 1JGIA 4B0MM 4X6EB 2VC2H 3UZVA 4IYKA 1V7NH 2V3DA 4R9HA 1QNZH 3BRDA 1DZBA 3QEQE 3HA0A 4FYQA 4MDJB 1ZY9A 4JFTA 2XT1B 4XMKH 4D94A 5FECB 3IGAA 3VACA 3QDJA 3NIDE 4WHCA 2ZP9A 4PQXA 4KK6C 1RHHA 2CU9A 2R51A 3RQ3A 3VSQA 3WUWB 4F3FA 3IRCA 3JV4B 5I1JH 1QBLL 2HFEB 4AQEA 4TUKL 3RNQB 1H8NA 3BT2H 1HAWA 5DJAB 5B1AB 4HXAH 5GGQL 3DVGA 4FNRA 5DJCB 1INEL 4CL7A 5IK3B 4R0LB 1TVBB 2HRLA 2OTPA 3HFMH 4NSKA 2F61A 5B39B 2F9BT 1PX4A 5IFJA 1HCYA 1SRDA 2AS5M 1YMMD 1YYMH 3S5LA 1NKRA 2ZSVA 1IGJB 4ZMQA 2DIJA 1D7BA 5FC9A 4JO5A 4JQVC 3VYNA 4D9RD 3BP6B 1OGAA 2EINB 1VGKA 4U1LB 3K2MC 1NICA 2IADB 3VM7A 1M3IA 4D8PA 3MRPB 5HI4C 1X3DA 4WIQA 4JQIA 2FVNA 3F85A 4XNQA 1RU9H 2HA1A 1IRAY 4I4WB 3L6FA 4PVMA 3BIKB 3WEBA 1YY9D 3ETBF 1HNFA 5D2NA 5GXBB 3CTTA 2NZ9D 3UBXA 3VGAC 4PJ7E 3DRTA 3KYNA 2YIHA 4XNZC 5G5DB 2Y9RT 3HS0C 4KNTA 3EYSH 4M7KL 4QOKB 5DZVA 5TQ2H 3CZGA 3OR6B 2VDRH 3P4OB 4W68A 3BESR 1SYSB 2YA1A 4G7QB 4R4NC 1JYNA 2X0WA 3RFRA 1M05A 1UKQA 3KPSD 2PXYC 3HC2A 1I1AB 1JZEA 4HKBA 3FPYA 5AAMA 4C54A 3CUPA 3L3OA 1BG9A 2OTUA 5GQBA 2D0GA 5EZJA 3LRSA 4OGXH 4MDIA 3WKNA 5E8OA 2OX5B 1H3PH 4PCSA 5AD0B 2EICA 5F1OB 5BUPA 1AZZC 1G7QB 1IBDA 2WLHA 2XDHA 2UUDH 3ZDYF 3TF4A 1R24B 2CO3A 3MFFB 1ZLSH 5ALBH 3SD2A 5GS2D 1KLFA 1VF5C 3HNTH 5D7JA 3FRPB 3T0AA 3CFTA 1UD5A 3PL6D 1RZJC 4EI5B 2UY7A 3QJUB 2IAMA 3TTYA 3KPLB 5LG6A 2VABB 2V3EA 4UT9H 3UG4A 4Y19D 1I7ZA 3EUUA 3ARPA 3EGSA 5ESQA 5B1JA 4QOKE 4D9QD 1YEJH 5E00B 4NZJA 4P23B 1C5BL 4G8IA 1UZGA 1B2WL 3MV11 1U41A 1H8LA 1ED3B 2DZEA 4IJ3C 1JUFB 1XR9A 2ODHA 4Q9CA 2PO6A 2J88H 5DA4A 5TGBA 1NCJA 1KBWA 3S96B 3O6LH 5AB1A 1JGDB 4PEEA 3LIZH 1H3TA 1XGTA 5ICXA 2AC0A 5EU5B 3T4AC 2WAHA 5L88L 1FRGH 2Z7YA 3BRGC 1MAKA 2QR0B 1QUNA 4I0PD 3ZVVA 3P4NA 2VLRA 3QUKB 1PCXA 4G5ZH 2FNBA 2OM5A 3D0LB 3MBXH 4UT6L 3VNYA 1ZSDB 4DQOH 4YAQB 5FGCB 3HZVB 1LEGB 4NXSA 4FQ2H 1IC4L 2WUCL 1LE9A 1GZPB 1HHIA 3EYOA 4M8VA 4JM2D 1MI5A 2O93L 1AFVL 4P9HL 1TCMA 4UM8A 1E2WA 4XPTL 5DJXB 5DTFA 4D7PA 4ODBD 2F0CA 4EKJA 1L3NA 2JKIS 3STLB 4HXBL 4HMDA 4W9CC 3A6OA 4UTBA 4N6QA 1YJDC 1Y6MR 4F3FB 1ACYL 5FCUL 4UBDD 2EXYC 3PQYA 1CFTA 3U0WL 2N01B 2XYCA 4ZOBA 1TR7A 3GBMH 1AYOA 1WE5A 3DHPA 1W15A 1QHOA 4Z8FH 5AOMA 3P40A 1ND0B 2WWKO 3GMNB 4FJZA 2QQLL 4OLVL 1NBZA 4S1DD 3W5MA 1F3DH 1B4JH 3MRNB 1C9SA 2GK0A 3FQUA 4OJFH 3CFKB 3TJHC 4RMSA 5DZPA 1YNLL 3KPMA 2XXMB 3IDJB 4LCWA 4AGQA 2XRAL 3LEVH 4Z1PA 1LM8V 2J1YA 3G5XA 1FNHA 1INDH 3RB7A 5GGTH 1PU0A 2C26A 4JDTL 3KBEA 3CSBA 4NENB 3CBKB 4PMFA 2R0LH 5DZAA 1J18A 4ZSOB 3WIFA 3FO2A 2PW2B 3ZKND 1R5WB 5T3ZD 2KDYA 2BSSB 2XQBH 1SDDA 4I4WA 4LVEA 2CLRA 1LO3L 1N4XH 2GUOA 4ZPTB 2DJ4A 4KDVA 1FAIL 2ZG3A 4F58H 3VXOB 4DVRH 1BQUA 2WP3O 4KQ4L 4UAOC 1ZT4A 1U3HC 4WI0A 2V8LA 1SLXA 4QRTA 1G9EA 5D1ZD 5E5MB 3TIEB 1CFVL 5CLZA 4FQJL 2MSPA 4JW3A 1RCYA 1QSVA 3CDYA 1KTKE 2ITEA 4N8VG 3EGDA 1XGUA 2HKHH 3TN0C 2EUWA 4WHDA 1GW6A 1N59A 3L3OB 1MJUH 5CFAA 3BWSA 2CGZA 1H6FA 2Q3XA 1RJZA 1A14H 1CIDA 4BYHA 2ORBL 4I9WD 3FT1A 3AT0A 1DLHB 4XNUL 5E24E 5ACZA 1X5XA 3TFKD 4B9KC 3ULVF 3KPSE 3GSUB 4PP1D 5FYJL 2F58H 4WAFA 3MFFA 3EZJB 2GSIA 2P5EA 4RZCA 4OI7A 3T2LA 4MJID 3VX0A 3AWFA 2X6UA 2C7UB 2IAND 1BZDA 3T09A 3QORD 4NQEB 1P4LA 3NEOA 1ZHLB 4PPTA 3ZKXB 4IOIB 1CJYA 4LOEA 4NNPL 3VWKA 2Y7LA 4JB9L 2BDNL 4PRIB 3NZSA 1X4ZA 4WI5A 3QUZC 3LPFA 1U33A 2HX9A 4BH8A 2QVKA 1G6RA 2AJUH 4L3EE 2H32B 1ETA1 2EDNA 4FHBD 1PIGA 2GB2A 5DLML 1K5NA 4A2GA 3EYQD 4MBRA 1YEKH 5FLUA 1HNGA 4YL4A 4JO3L 3KDPB 3HFML 3FAXA 1IM3B 3T4YB 3ULUD 3D39B 4KXDA 3WLBB 4FLHA 4UU9A 3WXWL 2WXIA 2I5YH 3L3KB 2E7DA 1LP9F 5IUSA 5E2VH 1FIEA 4GAYA 3TWCL 5D6DA 3MRLB 1ZPLA 5D2LF 4R97C 1Q9WB 3FB6B 5HGDB 4WW2F 4NNPH 3AXHA 3MRCB 1Z0NA 3S5ZA 4OZGF 1U8HB 5MI0B 5CJXA 3MV7D 5F7FA 3GBDA 4HGWB 1PYWB 3BVTA 3MRGB 2EYRB 3MRDB 3CSPA 3EYOB 4W70A 4YMPA 1A7QL 5T3ZL 3APDA 4XODA 4ZAKB 4BFRA 3H56A 4CC4C 5KSBF 2DM4A 2VLLB 4OZHB 4Z3HA 1WTGT 4G9FA 2ORBH 2YD2A 5HHOB 2DYPA 4KXAA 4GKOA 1D7FA 1VFBA 5FHBH 4DKAA 4PJ8D 1BVNP 2UY7B 2R15A 1U3NA 2IQAB 4DK6A 3OG6B 2BC4A 4PJDE 3VG0L 3QYMA 4Y1TA 4PJHF 1LNUA 5TDOB 3V0GA 4AL8H 1JHLH 1UKTA 4NZRH 3VFTB 3P3SA 1SOSA 5DJAA 4HCRA 4R4FL 4NKDA 5DJCA 4HT1L 1G9MH 2VDPL 4AMWA 4GG6A 3F7KA 3I75B 2EYSB 3AMKA 3P9MA 4GSDH 1IGTB 1UWEL 3HE7B 1Y18B 3ZDZE 4YDIH 1FP5A 3RVTC 4X7TB 1LDSA 1EZUA 1RSYA 2HFGL 4PVNA 1FA4A 3SQBA 1TETL 2M26A 3SOTA 1QLFB 2HLEB 2BVOA 5EMYA 4LARL 1DJZA 4FTVD 3P2DA 1SDDB 1NA8A 5JOPE 2XBZA 2XX1A 2DS4A 4JFWA 2MFNA 2VQ4A 5IQOA 1IFRA 1AC6A 2MCMA 5MERB 4ZTOL 4MJ6B 1IAMA 1MXDA 3X1NA 4OJDH 4RMRA 4HPOH 5A3ID 5GJSH 3OAZK 3ZBMA 2RR3A 2E7HA 3FO9A 1DQQB 1Z9SB 3Q01A 2OMUA 1PKQA 4UILL 4GG6F 4GI9A 3SQOL 2QFRA 3LQAL 2DQTH 3NZHH 5E70A 3GINA 4QHMB 2EE2A 1GHFL 5HPOA 4J28A 2NYZA 4QIRA 2HJLB 3CZJA 3H42H 3LVTA 2QGCA 3GMMB 1JP5A 4KTEL 1A7PL 1BAWA 4NCC2 4L4VB 1A2YA 1XEDA 2YD3A 3J8F7 1MFNA 4X7DC 1ET5A 3J27A 2ZX9A 4GXUN 2A74B 5T5FH 1PCSA 5D4JA 3FQWA 5LGHH 3LKRB 2JQMA 3IGLA 2L7JA 3SGDH 3LV3B 3VFNA 1PS3A 4N8VA 3VD3A 2A6DA 2CGRH 4DQOL 1QD0A 3FTWA 5CEYA 4Z3EA 3V0JA 4KVCH 2Z31B 3EOYG 1FGNH 3MNWB 2GT9A 3ZKQD 1XL4A 4ZMOA 5C92A 3LKNB 4CADA 4OW6A 4Y1AD 2IVFC 2YRBA 3TEUA 2Y4SA 5DYOB 5JO5B 1S9YA 1N9PA 3KM1A 3IETA 3DRTB 3KYNB 4NQUA 3GEWB 5KAQG 4PJ9B 2GTZB 4HQQL 4ZOAA 1L9RA 3A47A 3L5WA 4Y89A 4BUHA 3MXWH 3MQIA 5H8DA 5DQ9A 1GZHA 4PWKA 1BLIA 2WLLB 2B1OA 3JT2A 4MAUL 4OZIE 4Z23A 5ICUA 4FQJH 3ABKB 3W9EA 2K8QA 5IFHH 4XO9A 4FN0A 5GRZA 4FXKC 2I7OA 2B59B 2WBJB 1ZSDA 1GGCH 3SE3C 3NJVA 1MNUL 4E0RA 4LVOB 4MJ5B 5BMFL 4KK8D 1V7MH 2B2XH 4XNXH 1DLHA 1PAMA 3QEQD 5DWPA 1DCEA 1DVUA 3CU1A 2OMYA 5SWQB 3OKKB 1HL5A 3F7LA 3BVXA 2OK0L 3MCKA 2W65B 2OA9A 3EUDA 1E9PA 4UTAH 5IHUL 3VXPA 1BM7A 1EDQA 5I6KA 4FQ1L 1TCRB 4C83B 2CIKA 3QHZL 1YAIA 4PWGA 4MMYB 2MOVA 3LH8A 4UV4L 5C09E 3VWKB 1Q90A 4NN6C 4URKA 3ULSA 1JTPA 4FQCL 3EADA 3UAEA 4PSPA 1EHLH 3IKKA 2RB8A 4N68A 5CJBA 2GAZB 4NQVB 5GGTA 5D2NE 3RFZB 5ESQB 2DYPD 2ITCB 5L8KB 2VLRD 4I77L 2EUXA 3EDDA 4B5ZA 3VD7A 5LKNA 4GRLA 3C6LC 5BO0D 4KKCC 5FDYA 1K9TA 3VQLA 2DQIH 2ZX5A 5D55A 1P7QD 4MMZC 3LHPL 3A4EA 1MLBB 3LZQA 1AY1L 3L4YA 3MU3A 4GB9A 4TSBH 3S96A 3NCJH 3WFCL 2ADGA 4XNAA 3L9YA 1L9QA 4P99A 5ENWB 1T1YA 3LMJL 4PLNC 4X9HA 3PGDB 4R96B 4P46A 3U25A 4MQXD 1YN6B 5D4HA 3G5XB 4RNRA 4OU3A 3FO0H 1UOKA 2WHVA 4WO4B 1FH5L 1WJ3A 3B2PA 3TS8A 3WAJA 1HHHA 4LAJH 3OD3A 5EB9A 1AO7E 1OW0A 1VEOA 2YUZA 3VXRA 1GC1L 5MERA 3IT8D 3KPOA 3QAZB 4U1NB 2XXCB 4QCIB 3ESPA 3Q1EA 4N1HB 4S2SA 1E27A 3H6AA 3V4VH 2BSDA 1RVFH 3ISRA 3VI3F 1BECA 1NIBA 2X4UB 3ABMB 4TUOA 3VD9A 3EYFA 2AJZB 4UQEA 2DQTL 5BVPL 4NRZB 2BNUB 3QDHA 1WZ1H 1QI3A 2D03H 4MNQD 1JPGB 5ESVB 4AT6A 1R3HB 3N40F 3VFTA 4TSBL 1ZJAA 4NAQA 3TT3L 1S7TB 3F5WA 4PJIF 1QG3A 4WTZA 4L2YA 2HJLA 5JW4N 3NIGB 1UYWL 4WY7L 3SDCD 3T2PA 3VTTA 1J0JA 1Q0YH 1QR1B 2GK0B 1R5IA 5FA3B 1EZVX 1DQDL 4LHQB 3MLSL 4AVIA 25C8H 5T1DH 1MCNA 2KPNA 1V3MA 1ZTXH 1MCPL 1BSIA 5H4YA 4ODXB 5HHPA 1OAUL 3A0OA 5D2NC 4N8VB 1IBGL 3FKUS 4GS7C 3C08H 3AB0B 4NENA 1K6QH 3HRZA 4ZD3L 4BFGA 1M1SA 1PF3A 4M93B 4X4XB 4JFDB 5CSZA 2IDUA 5E6YA 4ZAKD 5C0AD 1Z7JA 5ITBL 3CHRA 4PCYA 5KUMA 3WEXB 3DTXB 1P5UA 2HT2C 4PCTA 1M1XA 3B2XA 3MV7B 1KJ2B 2QPDB 3F12B 4EZJA 3H9SE 4WW1B 1V7ML 4FHKA 2BNQD 3U2SB 1M2VA 2VDPH 3OF6D 1GA2A 1ZT4B 5TF0A 1OEZW 2OZ4L 2YQ3A 3BKJL 3PG2A 2B4CL 3L8QA 4NPKA 2V3FA 3S8FB 3IRPX 1OGSA 4G1EA 1QHPA 4ENED 4BGDA 4AE1A 4GEJA 1UJ3A 3VQ1C 4IGBC 3VG0H 1IM3D 1YEWA 4FYSA 1H0DA 4PJFE 1N8ZB 2HN7A 1I7RB 2HTLC 2B59A 3EXJA 4OZGA 1I9IL 1NGQL 2EDYA 2PMZA 3QRGL 1A0QL 3AY2A 3PWNB 2Q8AL 1N3NA 5E8NA 4Q9QH 1HEHC 4HGWA 1WV7T 2ZXQA 1LEKB 2XG4A 3B9KC 3UYRL 5SWQA 2A74A 3LY6A 4GP4B 4JFFD 1MUJB 3REWB 4L4JA 4BK5A 2K7QA 2WINB 1BGXL 4WSKA 1AD9A 1V10A 3GSUA 2HAZA 2DQDH 2VDQL 4O02H 1CLYH 4QHUB 4GLRI 5K9QI 3ARTA 2KZWA 2V2TB 1FWXA 1R9FA 4N2CA 2QTVA 2K45A 3QDJE 3QULA 2JQAA 1J5HA 1ZMYA 4JG0L 4H0IA 1R3IL 2BMKA 1DVQA 1XIWD 3C08L 4PJCA 2NY6C 3N50A 4HMEA 1BVZA 4P57A 4XO8A 1KJMA 4G80B 2D0HA 4QTIL 4XZ4A 3GIZL 4FX5A 4G7VL 3FN0L 3WO3B 4BBWA 1P1ZB 5DU7A 2E7BA 3BW9B 5AALA 1JGUL 1I1CA 1QAWA 2WOYA 1LO2H 5GZNA 4KTDH 3VAEA 4AIXA 3G08A 4ADGA 4LGPB 4P59L 2ADGB 1OB1B 2WVUA 3R7QA 4DQAA 1KCRL 3PWUB 3A21A 3BSZL 2IH8A 4WHYH 1UG9A 2WXNA 5FXCH 4G6FD 4HIXH 3SY6A 4U1KB 2LR4A 3CLEH 3WJJC 1KELL 3S3PA 3K2IA 2ZXBA 4HCRL 2B3RA 3QQ3B 3O8XC 2QTEA 4FXGA 5J4MA 1HYSC 5FM5O 3KPOB 2WVTA 4KRLB 2GHZA 3CSYB 2LE9A 4MJIE 2QSCL 1ZLDA 4AQAA 4G9FB 4YFLI 2DLFL 4MD5B 2FWUA 4LVNB 4DOHE 3C6EA 1IAIM 1MG2C 1VACA 4NIYE 5HVHB 5I1EL 4YHKH 3PHAA 5IW1A 1CDHA 4Y2DB 2CXGA 2OCCB 1DE4A 4R90L 2K4AA 4L3EA 2A83A 5KAQF 1DANT 2JK5A 4JPIB 4CVXB 4ODSL 4TLTA 3IAPA 3OMZA 1ZWIA 5IWLA 4NQQA 4DVRL 1S5HA 3HOGA 2XU9A 1A4KB 2G5RA 1CFQB 4HW6A 4PJGB 2ZAGA 2GK2A 2HKFL 3RDTC 4QXWA 1MFAH 4YBQC 3EHBB 2DYSB 3VA2C 1JG9A 4B9IA 1SLUA 5F7HA 5IGXL 3P02A 3I9IA 1JK8A 3MR9B 5CGMA 5CGBA 4RNRB 1J05B 3IDNB 5GRUH 2ZOWA 2CDEA 3CN1A 3VJ6B 5I0WA 3RL1A 3ZTNH 4BFOA 3O11B 2WSPA 3IKCB 4MXQD 1YA5A 1KCVL 3HC4L 4ZO9A 1X9UA 5HHXL 2ZSWB 3PAUA 3MSPA 2P5WA 4PW4A 3SKMA 1SEQH 1JZ8A 1OAQH 3ARGC 3LKNA 5CGYC 5EOTA 2HMID 1E4XL 4N2KA 4FG4A 2V5TA 3DRQA 3ZYOA 1ASPA 3NIDF 1OARL 3HAEB 1KGXA 1NJ9B 2WY3B 4Y4HC 2DV6A 1TEYA 1CL7L 4FKKA 2AQQA 3OGCB 1BEYL 5DZLA 4HV8A 1A9EA 4PJIE 1IGIL 2YPLD 3JV4A 2CH8A 4KJQD 5AAWC 1Q9LB 4NIKB 5F7NC 5KBLA 1F4YH 2A1WL 1TYEB 4HBCH 4WEUD 4FI6A 4LP8A 2IALB 2YGPA 1AMYA 4YLQT 2FATH 1BQ5A 4TVPH 2XWTB 5GRYA 3CX5K 5IEKA 4HD5A 3ZE0F 3BUBA 4X6DE 3GXMA 2OZNA 3L2MA 4KHXH 1F0LA 3OC8A 2PTUA 2WKLA 4Y7MA 4FQIL 3N1FC 1MI5E 5FUZL 1ECYA 3KBPA 1MLCB 4XAKD 3VSUA 1N5AA 2MPVA 3Q2WA 3VMNA 5GSRA 43CAA 4E9YA 5C3TA 1MCFA 4TL5A 5JHLH 4K71B 5F88A 1ACYH 3FFCA 4WO0A 5IJKC 2O26U 4UCFA 4XN2A 2X40A 1Q9OB 3TA3B 2NY3D 4G80A 1KJ2A 3LRLA 4IK7A 2Z1PA 3BDYH 2ARWA 3HI6H 2X4RA 3L9RB 4KK5D 3LIUA 4Z7VE 5F6IB 3U30B 4GXUM 1A14L 3ESUF 4TUJA 4MWFB 1KJ2L 4M6NH 1G7PB 5IV2B 3QYNA 1T6WA 5I71B 3MV9D 3K71A 1EMTH 3HTLX 3NJFA 2VM9A 3AROA 2JJSA 1JHTB 1S78D 4QRRD 4DNLA 5JZ7D 4X98A 5FUOL 5IJVB 4NUQA 1HT6A 3GXNA 4LEBA 3W9EB 2EO7A 3AT9A 4JM2F 3COOA 3BH8A 2EABA 2OJZH 1YNLH 3IDGA 3O41B 5F96L 2DQUH 3GEFA 4ONGL 1O9ZA 3LYRA 43C9A 3MNMA 3T0EC 1HHHB 2EIMB 1I75A 2VITB 3MXVH 1BIHA 5E9DD 5C9KA 2NNCA 3QFJB 2PXYA 1OP4A 4H8WC 2EXWC 2Q7AA 1FVDA 3I9AA 2AITA 2ZD0A 3RWJB 2I9TA 1CFNB 1DSFL 5DWUH 2EIKB 2E6PA 3B5TA 2VLJA 1U8OA 4JO2L 4ORGA 3MRIA 2O72A 3ULSB 1UT9A 4CC4A 4B9FA 3EH5B 4YUEL 4OKDA 3V4UH 3EJCA 5IB2B 1AH1A 1OK8A 3OV6A 4GRMA 3ZUNC 3SGKC 4BH7A 1PG7W 2HFEA 3DYMA 2EDOA 3ECBA 2QQLH 3GHBH 2VAAB 4OCYH 5HHMD 3OKDA 3GRWL 2AAAA 3AS0A 2ED7A 4RX4D 4XWOD 5IHBA 2YPLE 5TQ2L 4A2MA 1JWUB 4MQ7A 4LLDA 4NAJA 1NSNH 1DQVA 1PLGH 8PAZA 3T5WA 1CR9H 4M6ML 5D1XB 1GW0A 3O4OC 4CMHB 1T83A 2JI2A 3L7FB 4I9WE 4J2QA 4JFXB 1CWVA 5HY9B 5KYNA 1IGJA 4PMEA 4M8RA 4HJIA 3MA7A 2ZNXA 4PR5B 4PRNA 1DANU 2AQ1A 5HHPB 4O58L 3MUGA 5L2JA 1J12A 3OL2A 4FI7A 1DBAL 1FN4A 2PETA 3C6SB 3IKCA 1XB3A 3MRFB 4WI9A 1JZ6A 3D4CA 5IESL 2KMWA 2VR6A 4F8LA 1EZLA 4KX7A 5HDBE 2FWOA 4IRSA 1MCHA 3PHQB 3R4DA 4X6BA 5T1KB 1EAPB 4BZ1L 1E30A 3WNMA 1CE1H 3LQAC 4LAQL 4KHXL 5E6ID 1B2WH 4WEMB 4N0UB 4WW2B 3BD5A 2NLJA 4MQSB 5E6IC 2J6EH 3DETD 5DFTA 5IIEA 4HJ0C 4PJDB 2CJSA 3GNMH 1FG2A 5E0QA 4ZXBB 4U31A 3L48A 1T89C 2Y07H 1MFEL 2X6BA 4LASH 3GJEA 4NKOB 1U58A 4FQXA 5TF1H 2A83B 1E2ZA 2OL3B 2L7UA 1NM4A 3BIBX 5F6HJ 1B0GA 1M05B 1TJXA 5GS2H 3SE9H 1BIIB 5K9OB 1R3JB 1JV2A 5DDHB 5B7EA 4X8XA 1D5BB 3S5LG 4J27A 1KTJA 3X1GA 4LHUB 1L6PA 2OMWB 2XYBA 4O9HL 1HL9A 2ZJSL 4JNXA 4W9LC 1G6RH 4M7JH 1HN1A 3L95A 4OZFB 4GIPD 2WVVB 1AXSB 1A6WL 3BFQG 3HNSH 2C9XA 3BP6A 1S7RB 3P0VL 2VMEA 3V0VB 1WIOA 4KTDL 5HDBB 1E8WA 4HLEA 2ESVB 5CSZB 1U8QB 3OXRB 2GW5A 2L3BA 1NIAA 2X3BA 5T3ZE 1MG3C 2IAMB 4JM4H 4PY8I 3CU7A 1MW0A 2F5AH 4OKVB 2V6HA 2J12B 3B34A 4H0HB 5DQDH 5BRZA 5ESAB 4JQIL 1J8HB 3NQIA 5EU7E 4YR6B 4DZBA 2P42B 1IFGA 1ED3A 4HUMB 4JHWL 4GKNA 4FI8A 3E3QC 1QTSA 1RLBA 1UACL 2XJLA 2WOBA 3VMOA 4U6YB 3RP1A 3T0ED 1T7ZA 3SPHA 4UINH 2FT6A 4PGBB 4EEEA 1OZUA 3ARUA 3ILDA 4WGVB 4HJEA 4J1UB 2AEIT 3NIFF 5E9DE 1UOLA 3OHMB 3ZZLA 1DJWA 3T77B 1C7SA 3TF7C 4HULB 4EQ3A 4Q4IA 4PBXA 2Q2LA 2YFOA 4XVTH 1OM3L 4UTBH 5AAMC 2R2EA 4JAMA 5FYLH 1T21B 3SE8L 3CQQA 4EXPX 3QQ3A 1QMUA 4HU2A 1O7VA 4PLOB 1W16A 2DPKA 4WJG3 2PXYB 4XWGL 3U36A 1MUJA 4N25A 4NQCB 5CM1A 5DFVD 2HVJA 4Y8AA 3Q6FA 1CDUA 2F15A 1I7TA 4TUKH 1TSHA 1S9VB 4EXKA 3QFJE 1H3GA 2VUYA 4PJXF 4OCWH 1WRFA 3DUHA 4NZUH 1ANUA 4Z7VF 4PRIA 4APQD 4OJAA 1PKQE 2XNAA 2QVMA 3ESMA 1DN0B 5I1AB 5LN4A 3N91A 3BWUF 2H8PA 4K5OA 1MNNA 3OMAB 4AIOA 1VB9A 4CW1B 3Q9QA 4H20H 3LCYA 4KTEH 3N9GH 1OP3H 3V6OE 3MYZA 4IS6A 4N8UA 1R6VA 5IJCC 3SY0A 2V2WB 5EBMB 5CLYA 1G7HB 4X8GA 3L7FA 4IRJA 1YUHA 2SODB 3MJ8B 3MNZB 1S7QA 4YDNA 2CBMA 2W9LA 1ADQH 5BW7C 1NAKL 4JVPA 4UILH 4ZUSB 4IJ3B 1B4RA 4CN6A 1WIPA 4B95C 4JFYA 3FB7A 4KJQC 2ARJB 3UG5A 3ZYZA 3V8CA 3QG6A 3T65B 3T4AB 2G2RB 1XH3A 1J8HD 1USQA 5T1KA 3HNVL 1HHIB 4XH2A 1KIQA 4DN4H 4Y4HD 3T3PF 4GAJH 2GY7B 3P30H 1JNLH 5DGRA 5EOTB 1FNGA 2ZX6A 3DRQB 4F57L 4XPFL 3SBQA 4NLAA 3RWJA 3SBWC 3SZ6A 3L5IA 3VXOA 4JFPA 4WWOA 2ESVD 3CLFH 4N90D 2HMIC 5CGYD 5FHAL 2Z91B 5GPRA 3D8MA 2X2YA 4H1LA 1THAA 3HB3B 3N85H 3EO9L 3O0RH 1XDTT 3F62A 3FSWA 4KFZC 4MXQC 7CGTA 2VZTA 5FM8A 4WI4A 2VWEE 1HZHH 2E74C 2P49B 4J3VA 2DRUA 4F8OA 2R29L 1FG9C 1NDTA 1T03H 3RWGB 1IGCH 3OKDB 5FYKD 3PREA 4YHIA 4BM7A 2IIJA 1KCWA 4YBQD 3AWGA 3OSKA 2WD0A 4YSTA 4PGZA 3P30L 2OV0A 5J1AA 4ELME 3ZX1A 3OTTA 3DDGA 5IMKA 2VW6A 3CFKA 3LD8C 1UM5L 5DUPH 4LSUL 3ZJAA 4M43L 1KTDB 1Q1PA 3KNBA 4XB8A 4LCUB 5LXGL 3NCJL 5D7IB 2P5EB 3MUGB 1A1OB 1ZRUA 2ZWSA 3I6SA 3T1WA 4ZMVA 2HH0H 2WMPB 3TASA 3ALXA 3FFCB 2JCCF 2VKWA 4KKPA 1KB3A 3PHQA 4X6BB 3UXFA 1YG9A 4JHBA 3UTQA 1FV1B 4ILDA 3OQ3B 4JMNA 3ZE2B 5FUOH 1FCGA 3MLWH 5T1KD 4WW2A 4WY7H 2PYED 1MRFH 2YAEA 1GZQB 4BRJA 4A38A 3QAQA 2ADIA 2PR4H 2YQ2A 4C56B 4YFDB 1NEZB 3TBVA 5FIEA 4JKLA 4N9GA 3TBBA 1GYCA 4BSJA 1HYSD 1KT2A 4LKXA 3CFEA 3TXAA 3O8XD 2O5XH 3IMSA 3QCVH 2YPKA 4LMQE 5I74B 2FLRT 2NNFA 4UTAA 5EC1B 2IMNA 5D1XD 4F92B 3LEXB 4J6IA 4B9PA 4N3TA 1WC7B 4O2EA 1JJUA 2J71A 1RJZB 2CIIB 1GJWA 2IOMA 4U49A 3C2AL 3BI9X 4OTXH 4F9PC 1A8JH 1FL6B 1ZSHA 2VITA 1BW8A 2FD6L 4WI6A 4Z18A 2K3HA 4FQQA 1G94A 4N0YL 3VRJB 5C0BD 4FFZH 1GYWA 3UZEC 4AI7A 4NJAH 1NFDA 1FZJB 4NQDB 4QWWC 1CXKA 2AF2A 1CFNA 2NY6D 4WHTA 4Y8DC 1XIWC 3K2KA 3VXNB 4AMXA 2C3GA 2BY1A 3OPUA 2P28B 1DUZB 4U7KA 5F7AA 1DN0A 5I1AA 3RX8A 1E7UA 2YZ8A 4X83A 4JFOB 1KWKA 3GKWL 3N44B 4HBCL 3W0WB 4KKAD 3VDCA 3G04A 2Y5QA 2CMRL 2F2HA 4JFHE 1MW2A 3G9AB 4O51B 4ZX6A 5DMKB 1Q0XL 4Z7UA 5DHDA 3DLQR 4OFQA 4NKDB 2PWHA 4K3EH 4OR1A 1I8IB 3TCLB 4R5TA 1TO5A 1BQHG 4UNVA 4N0YH 5I8KH 4J39A 2P80D 1G87A 4JLRB 1WAAF 4KBPA 4XR8C 5IQ9B 4M1DL 1PEWA 3SYOA 3IFOA 1J5CA 2G3ZA 1EAQA 2J6EA 1NCBH 4KQ0A 1NGWB 1Z3GL 1C16A 4K7PX 3ETSA 4PY7A 4ZW8A 4IGBD 3QJRB 2R2EB 4JAMB 2QDVA 4NCDA 1EFXA 2AQTA 2BVOB 4ELMB 1FNSH 1XH3B 5JW3H 4R7NA 2EVJA 5D1QD 6CGTA 1KZYA 3IDYC 1IEBB 5CD3A 2X0UA 3MYJB 1YDPA 2APVA 2NY3B 2VLLA 1LHZA 1HOEA 1YNTF 3V52L 2IDCA 4OM0L 2VMFA 2CGYA 2HT2D 4LPUA 2WK2A 3IXTB 4KY1H 1MCIA 3OWEA 5D7HA 2Q87A 2ZPKL 3W39B 4IBTA 4ZAKC 4ORGB 1FJ1B 2FJFB 1NCBL 1ZOXA 4R84A 5JXAH 2R29H 5IB2A 1VAHA 5I18H 1JZ3A 3HMWL 1BIIA 1QZNA 4R90H 4A04A 2CSPA 4HH8A 3GDCA 2SEBA 2QADC 2NY5L 5AOJA 3DX7A 4XPBH 4GEIA 4LSUH 3HLAA 1KNOA 2XIDA 4GKZA 4PHZA 1TG8A 1QEWA 3SDCC 1U8MA 3OKMB 4RSVA 3RWDB 4EDXA 5KYXB 4WUUE 3GLDA 5LXVA 4ZUSA 3VQ2C 1F45A 5EUKA 2AGJH 4XRCB 4AIEA 5KJRL 3BXNB 4PJHE 1B2YA 4I3RH 1NMBL 4IRZL 1OB0A 1KXQE 1FGNL 3WU1A 3HE7C 2EDLA 1I1YA 4XNMB 4E9QA 3QWRD 4ZO6A 4WTWA 2ADFL 2D31A 3HR5A 5JIQA 4ZW5A 3TEWA 1QTYT 1FLTX 2ENPA 4L2LA 4XVSH 1WUNT 3VG9B 2WUCH 1U8PB 3E1F1 4DUWA 2EUZA 5CEZL 2FD6H 3FHQA 4OAWA 5KBMA 5T1LA 3ZY7A 3GRWH 1R0AH 2OFQA 5CIPB 3AM8C 2NRDA 3QEHB 4N9GB 3W56A 1RMFH 5E8DL 3L5WB 2J3SA 3BH9A 1N10A 4YE0A 4PRAB 5DQ9B 2VDRB 3ATEA 4JRYA 2AERT 4PGBA 4V1DE 4I13B 3QZOA 3HPJA 4J1UA 4M5SA 2WNWA 5SX4H 1VFAB 4MQXC 4NWUH 6PCYA 2XWCA 3EH3B 2CIIA 4FXTA 4LDCA 5EN2B 2DMBA 3EDEA 4G1MA 1TZGL 1VPOL 2F74B 2ZNWA 3CK0H 4KITB 5JHAA 3RTQD 4NPYB 5D2LA 3SPIA 2VDQH 2X70B 4KKCD 1FZOA 2X89D 4LCUA 3C6LD 3S3JA 1TTUA 2IEPA 1MRCL 1AXTH 1L9SA 4NQDA 3DX8B 3LKRA 4EI6B 3VFNB 1X5LA 3EJUA 1NLBH 1SJHB 3E8VA 4MAYB 4MMYA 1A4JA 3GS0A 2C9VA 3NRFA 3BKML 2MCAA 1FV1A 3QCUL 3ZTNL 5KVGH 3ZMEA 2IAAC 3AUVA 4WW1A 4ZMPA 2BS8A 4HGMA 4LF3A 1CXHA 5E6SB 1ZLVH 2XIBA 2YWZA 3G6JB 4G7YL 4LMQI 5IG7B 3BZFB 1J8HA 3NRPA 3VVVA 3IRZA 4HX1A 4DZBB 5DRZA 4LP5A 3ROOA 4Z5RA 5K59F 4X5WB 1TUPA 5FYKL 3F58H 2GIMA 4UB0H 4AL8L 2G5BB 4LKXB 5IBLC 3SY0B 4LDOB 4JHWH 4JFEB 3NA9H 2Q8BL 3WTWA 3H2QA 3FTXA 3PV6A 3IJHA 3L1EA 4G2AA 3S9DB 3PV7A 2JCCE 3FB8B 4IQHA 2QZQA 2FO1A 1KGUA 1KB5B 1MJJB 1T4KA 1XB8A 3B4NA 2FHCA 3EW3B 4HJSA 4ODUA 4HFWA 2FGZA 4PJBB 1KN4L 4LOVA 5KYWA 1E9OA 2XWEA 1PZAA 1Y0LB 2DM2A 4NHCL 4Y9BA 4FXKB 3DOIA 3JWNG 4HDIA 2HVJB 2V0AA 5ALCL 1UH4A 1A7RL 4Y88A 1I7TB 3WIIH 4LVOC 1N12A 1M9WA 1N6QL 3HZ3A 4POYA 1Z9NA 4MCYA 2YAFA 1F4YL 1FAIH 1SJMA 1XXFC 5EF1A 1IGMH 4AH2A 2Q10A 4UV7L 2WWOA 3WXWH 4ELDA 5JHDE 1WP6A 1NANI 1ZA6B 4ZO8A 3AY4A 4JFFB 3H9SB 4LCIL 5HDLA 4DSYA 4D8OA 3QCTL 3D18A 3IMVA 2V5SA 4YHIB 2CHNA 5IJKA 2VN7A 4L8CA 2EDKA 1GL4B 1NMCC 5CEZH 2J6EL 5IREA 1KNOB 3WNIA 4MFHA 4DGVH 1HFUA 3LNDA 5KVEH 3ULVC 5ABZA 2B14A 3QQDB 3SDYH 1L0PA 3UZVB 3VX1A 5CEXA 2YQBA 2CM6A 3NEXA 1FVCB 3PJSA 4G6MH 4FS0A 1B4JL 4GIOA 3PU7A 5D7SL 3IVKA 4G8FB 4HK0A 4L8BA 2ICEC 5EIIB 2GJJA 3B8SA 5B3JE 5IBUG 2A6IA 2FJUB 3JTTB 1FZKA 1P5VB 3L4UA 5CKGA 1T0MB 3SDDB 3A5VA 4AQEB 4LPXA 3UAAA 4DIXA 1DVFD 2Y07L 3SDXA 3MLYH 5A3IC 2Y7MA 2A77L 3BPOB 3RKDC 2N0KA 1GZQA 3L2LA 4NJAL 1C5DB 1WVZA 3RKPA 1NSNL 1Y1UA 5B1JC 4CVUA 3PIQA 1HU8A 2K9FB 5MEND 3CFBB 2YUXA 1NIEA 2DTMH 1NGPL 3MRRB 4Y2LA 3FQTB 4JRYB 3EYFB 4KO5A 2ZUTA 3HE6A 4U1IB 3LN5A 3KE0A 2R69A 3EJRA 2R0ZH 5HGAA 1NOAA 5D7LD 3BWZA 1QASA 4NC0B 5F3HA 3V0WH 4BFJA 3IGKA 1RZJH 1S3RA 1NBVL 4TL4A 1XCWA 4AM0A 3UBXI 1BJ1J 3GUTB 4JREC 1PY0A 5CP7A 2Y23A 2HPTA 4A2LA 3VD2A 3EF7A 3A24A 3OKMA 1JZ7A 4JPWL 5ELIA 3REWA 3HIZA 4YZFF 4JVUA 3SJVB 2WINA 3EDKA 2EQDA 2GEEA 3DOSA 5EUKB 4RDQF 5FYJU 1OKEA 1BQSA 3PNWB 1TDQA 4U1LA 3UIYA 5TF1L 1BJ8A 1G84A 1IBYA 3V7AE 1O6SA 2D31B 1WPCA 3H8NA 4PJ8C 4A2DA 2VIRA 2PPCA 1OO2A 3EO1B 3GSQB 5JW4M 3QO0B 4BSWB 1Q8MA 1JFQL 3HUJA 4RLDA 4CAGA 1SLVA 4EDWH 3MRQA 5D2NB 3KGSA 2WCPA 3QK0A 2O4EA 2IFFH 3CVHH 1LO2L 1BXVA 4Z7QB 4M93C 5HHME 4WFFD 3RKDD 4UDUA 3PUUA 4D0CB 1U3YA 4OZHF 1JPFA 1DVFC 3E8UL 4PWHA 2WXJA 1PZCA 1N5YH 5AVVB 3LH9A 4OSUL 5EC1A 5J13B 5F96H 1P6FA 5JHDB 1LE5B 2YGVA 1I7RA 2A4ZA 3ECUA 3MLXL 5EN2A 3TIDB 1EFXB 1HX0A 1VRSA 1PTZA 2BJML 4ELMA 1SLWA 3EGSB 5D2LB 1QSFA 1RUKL 4RGMB 4WCYH 3ULVD 1Y0LA 1FZOB 2BHUA 3GZQA 3GMRA 4X42A 4NZDA 2Z34A 1IX2A 5AAPA 2P5PA 3IWVA 3QUZD 2E9WA 1NMBH 4IRZH 2BSTB 2GSMB 3V4UL 3UMTA 3UIZA 3KJ6H 3MJWA 1D7CA 4QXVA 4YN3A 2G30A 4POUB 3ZHFA 4HSCX 1A3RL 4L18A 2AEWA 3I6KB 3A6BH 2LAGB 5DVPA 4H25A 4P23A 3TVMB 3SBWA 1ID2A 1P1ZA 1UXSB 1U3JA 4M56A 3FU9A 4PP1C 4Z7UB 3DGDA 4Z5RB 5JORB 1RIUL 3QDJD 4P3CH 1F97A 1IV8A 1ZWIB 4WNQA 2G5BA 4YE4H 2XZCL 4MRCA 2V8MA 4OD1L 4KMLB 3LSOA 1ACXA 3BFOA 3TYFB 2YARA 2P1YA 3HHSB 5D1XE 1S7XA 2EDJA 2ZUQB 3IMWA 3WFZA 4FA8A 3X14A 1QACA 2NTSP 1TZ8A 3U82B 2WP3T 3UTSB 2H9GB 2VKXA 4UV4H 5D1ZC 5KUKA 1PX3A 2XC8A 1U3HD 1HWGB 4Y1AB 1X5IA 3CAFA 5IBLD 3V0DA 1AOZA 1UM6H 3D48R 5FV1L 4IDJL 1ZV5A 4PB0L 2I9TB 3GBLA 3V9EA 1A1MA 1WA1X 3FU7B 2QL1A 5IB5B 4KPHH 3D2UB 2XBTA 4CBPA 5I19H 1DEEB 3IFNH 3W2DL 1EAOA 1T7WA 3S4SB 3WBDA 3PDOA 3SDAA 2R0ZL 4JMXA 4PJBF 3KCWA 4MMXC 4GRMB 1PNDA 1AC0A 1ZXQA 5I30L 3RIFF 5F1SA 1NBVH 1L6ZA 4LVNC 1KYAA 2WB7A 1VFAA 5AKSA 4ZZFA 3VFOA 4G43B 5HVHC 1TU2A 2IC2A 3H0TA 4IHOB 1JVOA 3U1SH 4XB7A 1DCLA 4AM0B 5KVDH 4L8CB 2RIKA 1TTAA 3TJHD 4NZTH 2ZWNA 4G1MB 2WJ7A 1JHKH 1IIIA 3FQUB 2PCYA 5K59E 1OT2A 2X1QA 2Y2YA 3WNNA 1VHPA 4OLYL 3GM8A 2X70A 3RTQC 3BDYL 3CVBA 2P9RA 3PJSB 3RUGF 3BLKA 4OSUH 3AU1B 3ES6A 3LZPA 2FQFA 4G8FA 4HK0B 1XD0A 4L8BB 4OLXH 4S1QH 5C3LD 4UBDC 4YFEA 4CJ1A 3QUGA 5ANME 5SWZE 1IT9L 35C8L 4U3HA 3QQ4A 5C9JA 3KYKL 3BAYA 1S6NA 2HCZX 2D7TH 1AJ7L 5EO0A 2PW2A 3R4RA 2ENJA 1KPUA 2GBAA 3SDXB 1XGQA 3BPLC 3IJEB 1IC7L 5I23A 1AKJD 1CF1A 4AIZB 2B39A 2VWEC 1ZD6A 2DQIL 3BAXA 2NLJB 1J9CT 4I0CC 5T1LB 1BQKA 1EHKB 2E6JA 4OFYA 4IU3A 5CIPA 1BWMA 1INQA 1NFDE 1DFBL 3FQTA 1S7UA 3ARGB 1A8ZA 2E5EA 4PM1A 4L0ZA 1IAII 4WLCA 2OL3A 2GSIB 3IJYB 4RZCB 3EYUH 4TSCH 5JPNC 1NAMB 2NT1A 1L7IL 3MACL 2WZAA 3TA4D 1P2CA 3EGDB 1A6ZB 2YSSB 1WQVT 3HE7D 4MZIA 3TP4A 5GRUL 4EMZA 3QCVL 2ZZUT 3GMPA 1OLZA 2WYZA 3EFDH 3ZRFC 2NW2A 4XC3L 5B22A 1C08A 5T1JA 3UAJA 1UB6A 5D72L 2X05A 5LUMA 3NP3A 1I1FB 3DO7B 1H6TA 4TVPE 4YC2C 4APXA 5A2FA 4I5BB 5KSAA 3FT2A 1X5HA 3WDIA 1JWSA 3FOLA 3WIIL 1QQDB 4TQIA 2EIJB 2QADD 3UYRH 5FO8A 5IBTL 2ZICA 4NO3A 4OLYH 1CYWA 2FUQA 3D39A 1NCAH 3C5SA 4RAHA 2JTYA 3F7QA 4XXDB 3QO0A 4BSWA 4UQDA 4YO0B 4W9DC 3G5ZB 2HFTA 1EK3A 3MNVA 2YRLA 5AZEL 2XQYG 5FYLE 2AJXH 5HYSA 3BZFA 1IAIL 4K71C 5CF3A 3NIFE 3MRGA 2XN2A 3KH4A 5C0EA 4B3VA 2OJ1A 4NNXA 4B41A 4NQSA 2EDQA 4NP4H 4WENB 3L3KA 1LD9A 1V54B 1JHTA 1IKFH 2FBJH 4K9JA 5D1QC 3VO0A 1A6PA 4UDTB 1QRND 5AW8B 4CBZA 2XZZA 3U79A 1MFMA 3WY1A 3CBJB 2PUQT 3WNOA 2Z4QB 3QS3A 4KHTH 1QOKA 1U0QA 3BKMH 4HFWB 4P4KB 4Y1AA 5LCVH 2VH5L 4XPHH 3VFMA 2A38A 4W9ZA 5ITFA 1ETZB 3R06A 5DHXB 1BREA 2Y69B 1MF2L 5IVXB 3C5JA 1DQDH 4PRID 1XZ0B 4GG6B 2EEDA 1GHFH 1WO2A 2CPCA 1C5DA 1YY9C 4FNUA 3RRQA 4NQED 4F7PA 3AADB 3HS9A 4GO6B 4MZ2A 3LNFA 3SDAB 4KKAC 2VLJB 2I32A 1OL0A 4MJIB 2J56A 2Q0ZX 3EO0A 3ZZSA 3ZIMA 3CNKA 5K1VA 1YY8A 4JE4B 1QLFA 3JSSA 5B38B 2VQ1B 1TNNA 4OCRL 3GZPA 4YDMA 3C09B 4YHLL 2BHYA 4E5XB 1ZLUH 12E8H 1F86A 3GI8L 4QWWD 3O3AB 4L4TE 1MJ8H 4W93A 4PJEA 1FUNA 3L5HA 2A4CA 1Y18A 4RMQA 3X17A 3EG9B 4LPCA 2B1HL 1I9IH 1NGQH 4Z76B 1S7XB 2QGEA 4O2CB 4PREA 3QNYA 1JK9A 1AXSA 1CDBA 3UH8A 2L7QA 3CC1A 3FUIA 1LVEA 2C3VA 1U92A 2Y24A 1D5ZA 3MUUA 3DV6A 4H2CA 4TRPH 4UIKH 2W0FA 5D1XC 3GMOA 2AGJL 4KK6D 4HKJA 4YLCA 4LHUD 3B9AA 5ID1B 4DCQA 1MAML 4S0TD 1A5FL 2BSEA 4XN8A 4H1LH 1JYVA 5FOJA 4V2CB 1CZ8L 4ZMYA 1CFMA 5SV3A 3KPSA 4QHPA 3CVIL 3MOQA 5JNYA 3OKYA 4JDVA 4UOW1 1ML0A 1ORQB 4TNVK 3ZE1E 4X99A 5KVGL 2AEPH 3FO9B 1RUQL 1D3CA 1F8TH 2Z8RA 3AITA 4WWKA 2VDNB 1S7UB 2C9QA 3PABB 1FHGA 4MZRA 2TSAA 1I9EA 1NCCL 3N41B 1PKOA 1YRKA 3BDBA 4DK5A 5F72S 1KBPA 2F1AA 2OMXB 5HYJA 1R75A 5FWQA 1T0OA 4BE6A 1BVLA 3MLRL 3CC5B 4R7XA 2A1WH 2K4WA 4P3WA 4XBGB 3OKEA 3B2VL 1CD0A 1T21A 4LK4A 1ZLUK 1U30A 1ZK5A 4E36A 1EXGA 4H1LG 1GGBL 3HHRB 4XNYH 2RQEA 4R26L 1SFDA 1B3JA 2YAOA 4MNHB 2G75A 2GBTA 4QXUL 3U36B 2ATAA 5B7MA 4PS7A 2K78A 4MLIA 4IDJH 4PB0H 1FNSL 5FO8B 2OMZA 1QSEB 3OAYH 5HYSG 3OWRA 2A6DB 3HG3A 3FUHA 1F56A 2JKRM 5AVTB 5CBAA 1C8QA 1Z32X 2WLLA 1TENA 5IF0B 2FX7L 4L23A 3P4LA 4HJUA 5CSGA 4MNGA 2I5YL 3LRHA 5HHMB 4A7TA 3EIFA 4MA7H 4F2EA 1NCHA 1N0LA 1NM9A 3O6KL 5CWSA 5DLLA 5C6TH 3UO1L 3ME0B 4PGEA 5BRZB 1GTNA 2P3YA 1QBML 3HPLB 2PCXA 2NY5C 2BRRL 3UX9B 3O3DB 3VI4F 1X6NA 1TQVA 3JXAA 4MJ4A 5AKTA 5I0ZA 1G43A 3DX2A 4MHHG 1JPFB 2FLBT 2VXVH 1XMWA 5K39B 5JIDA 3TV8A 1NC2D 5E1HB 4M9OA 5CILL 4PG2C 3AXLA 4GBXC 3OAUL 3QFJD 5JHDA 4Z78B 3EH4B 2LFEA 3KYKH 4XT1C 4ZX4A 4JFYB 4HIHB 1UB6B 3FH5A 4LEEA 2W92A 5I6OA 4OV5B 1EA9C 1WGVA 2Y5EA 1X5KA 3QUMA 5FO7B 2ZF8A 3L4CA 4HS6B 4AYEC 2KH2B 4H8PA 4G6JL 4MJHA 1EIBA 4NQCA 4P48A 1WBYA 5KZCB 1W80A 1URIA 3KCPB 3QNXB 4F15C 3BISA 1J9RA 3CFJB 3GGWB 4DTGL 4R7DB 4QY8A 3P11H 4X5QA 1OPGH 4ZPVA 1CE6A 4N2HA 5CZKA 4ZUUA 3U46B 1DHKA 2FZ3A 3ULVL 4NQVA 4OD3H 5C7ZA 5DGQA 3RFZA 4PP2B 2WLKA 3WKPA 5DMKA 4APQC 1BEYH 2WPGA 4ANUA 1EGJA 1IEAA 5E6IA 3NJLA 2C1OB 2Z64C 4HKXB 4LZKA 4NO5A 4Y4FA 1YJDH 3US0A 5FS5A 5JOEA 3IMTA 3JWDL 4B7IA 3FQRA 4XBPB 1CLCA 5DFVC 1FIGH 2XG5B 3TO4D 4S0SD 2BRRH 2XQYA 4N2EA 2XQBL 7PCYA 3W5NA 3ELQA 3NZ8B 1A7PH 1KTLA 2JFCA 4JFSA 4A68A 4WWKC 1CLOL 6FABL 1Z66A 3QNFA 4P2QA 1SDAB 3O3EA 1MY7A 5F8QC 1CC3A 4HIPA 1D5ZB 5HDRA 3VFRB 3PF2A 3ZXAC 3QHZH 5D70H 2FNWA 3LEVL 3RY6A 2FBOJ 2G2RA 1PDKA 5I15H 4JGUA 3ZYJA 1ZXKA 5J89A 1TQTA 2AFNA 4NM8H 4QJ5B 1AYRA 4IMLB 2O6DA 1JWMA 3LZLA 2G4EA 1F8TL 2V9RA 1P6AB 5I66B 3VXUD 2ZXDA 2YBRB 3ASOB 1NC2B 2R1YB 3D2UA 3A23A 5LNEA 3QDGD 3KLAA 3T8MA 3CQFA 5LQBL 4U0QB 5EC2A 2YPKB 3VH8G 1YY8B 3BWUC 4WNJA 1X7QB 4Z7OF 2LVCA 1MCOH 2BINA 1NAMA 4BD4A 3CHSA 2YSSA 4E5XA 1XF1A 4F2ME 5BRZD 2EO9A 4XBGA 2BM3A 1JPSL 2BSRA 2AJSL 3M17A 4ODWB 3K7UA 5DK0B 3F12A 2X4SB 3QQNA 3QXUA 4FD0A 5EBLA 2WVSA 4XZUA 3E6FB 1DR9A 3H42L 4OD2A 4QRBA 2J4WH 3S36H 4EPSA 1HQRA 1J0KA 1T1XB 1ZJBA 2OMZB 5G4NA 3EHBD 2Z7WA 4JFVA 4OFYD 3C60B 3LKSA 4DW2L 5CBAB 3FT3A 1J5OL 2N0MA 3F7PC 3WGUB 3UTZA 2WMPA 3R7RA 3LD8B 5EO0B 4DCQB 3CFQA 2UYLB 5L88H 1IBGH 4GRWH 3N41F 4IKIA 2R8SL 4NGHH 5DUML 4HJ0D 1FFOA 1ITBB 2JXMA 3DETC 1M2VB 3FN9A 4G5AA 2CA4A 1JZHA 1KYUA 5ISZB 2BERA 1QBBA 1DQLH 5KVEL 5LDUA 5EEYA 4MYPA 3BEVB 3JWNE 4GT0A 4JO3H 1NDGB 2CO7A 4AKOA 1RZFH 3HPJB 4KV5F 2OMXA 3OLGA 5FUCE 5HYJB 2FX8L 4KDTC 4HD9A 3JWOL 2ZWLT 1P2CB 1GOHA 1OCOB 3BLPX 4WI8A 4X2UA 5IZ7A 4NP9A 5MEQA 5E1IA 4OZGB 1U8JA 4LCIH 2BNRD 2OYMA 1KCSL 1ZHBA 5I74C 1IO4C 2OTWB 2B0SL 1BDYA 1X7TA 2WSKA 3IYLW 2DICA 4EN3C 4JJ5A 2YC1B 3DX0A 2XUWA 2F5BH 5H37A 3VRJA 5ETUA 1L5GA 1HTYA 2WYIA 5DK2A 4AEHL 3DXAE 3G08B 2PWDA 1XZ0A 1OK0A 1CBVH 1JHLL 3F6JA 4NZRL 1ZDQA 4XWOC 4MAYA 1JPEA 3IXTA 4TNGA 3HMXL 2XA8L 1R17A 5EU5A 3UTTD 4DFHA 4DPRA 5FA4A 5IVXE 3DMMD 2APSA 4MNGB 4RGNE 2NX5E 2VCOA 5KVDL 3HI5L 4JFOA 1F42A 3DHJA 1J1PL 4U1KA 3LEYL 5EIVA 1ERNA 2QHRL 4GAJL 4WKZB 3GM0A 3MV8A 2DI9A 2UWEB 3ATAA 3QG7L 4LT7A 5F1NB 1WFIA 3RGBA 1AI1H 5F0LB 3DVFA 1FPTL 5GGRB 1HEJC 4LLQA 1IAKB 3DKHA 4CILA 5H37G 2EXWD 3NESA 1AKPA 3NGBC 1I9RL 3BD3A 2Q7YA 1B6UA 2VE6A 2XKNB 4KPHL 4IJTA 5GRVK 1SUJA 1KTLB 2CUMA 1SBSL 3ZU8A 3CN0A 1TYRA 5EU6A 4AITA 1YEDA 1SVZA 2BK8A 2VJXA 1JZJA 4NYLA 4Y5VA 5FOBA 4Z7NE 4HIHA 3RHWK 3CN2A 1OD9A 4ECNA 1DDHB 1U95A 2FR4A 4PJBA 4RQQB 3IB4A 3QCUH 1A6WH 1IQDA 3HNSL 3L2NA 5D5ME 3QI9B 3WUWA 5JZ7C 5GGTL 1S78C 4A67A 2F7RA 1NUDA 2QZ5A 1QLRA 3CZFA 2D4FA 2ICEA 4P8QA 1V55B 4BEIA 3TBCA 4YZWA 4C59B 2Z1KA 2X4TA 4HXAL 4X99B 3B7UX 5AVQB 4WTXA 2X3AA 4HGKC 1JDDA 3B1TA 3NK3A 3ZOAA 4KK5C 1G7IB 1BP3B 1HL4A 4PW9A 2YK1L 2NY3C 4O9HH 2MQ3A 3EFDL 2BNQB 4PD4K 3I50H 5CJ8A 2CDEB 5BS0A 2UZIL 1VGKB 1IILE 1G0DA 1RSFA 4JDTH 2HUEA 3G6AA 4S1QL 2P5WE 3MRPA 3WY4A 4RAUA 5D7KE 2YKKA 3KVPA 5GGSB 1VEMA 3EGXA 3S88H 1WG3A 4PJEB 3LIZA 2BSED 4NHCH 4WFHE 5IFAL 4FEMA 4Z9KB 4NZTL 4QTIH 4G6AD 1A9VA 4F5CE 1MCBA 3O3EB 1GYAA 2VZOA 4O00A 4OLUH 5DURD 5EIIA 1BQRA 3P3YA 2HTKC 4IBLT 2QGBA 2HRGA 5EN3A 3DV6B 3F83A 2CAKA 3HR6A 2WCGA 4LNRA 5IF0A 2EC9T 1IT9H 1IL1B 35C8H 4QLWA 1XGUB 4D7BA 1SOXA 2CGRL 2VZ1A 4IMLA 5EF3A 3F7VA 3KPRB 4N2IA 2NXYB 4BZ2L 3I02B 1AI1L 3GSVA 4ZFGL 3CIAA 5GGUA 1ORQA 3F58L 4UB0L 1SPDA 1YCSA 1WT5C 5ISZA 4BHUA 1GS6X 3QRGH 1LO3H 3BH9B 1NC4A 2JKJA 2YD6A 3FQNA 3P4MB 3ARGD 3VG9C 2O5ZL 1U6AH 4F7CA 3NCCB 3BAEL 3WKMH 3KH3A 3FRPA 3D52A 4Q4EA 2NX5B 3DTUB 3ZDXB 2J43A 1DSFH 3OB8A 4KRPB 2Y72A 5IHUH 1T4KB 5DK0A 1MFBH 4TKWA 5CP7B 1HI6B 4BH8B 2X4SA 3VGBA 3WD5L 4K3GA 1P4IL 5KYWB 2FEJA 3L9RA 2G4GA 5PAZA 2E8YA 4QHLB 3UYPA 4Z7WF 1JNHB 5HHVH 3RDTD 1MLCA 3DV4B 3RJDA 5BMFH 1TMCB 3FC8A 1H5BC 1G9NC 4ONGH 2NYKA 3DX8A 3O6ML 4CJ0A 3GGWA 3GDBA 5I1CL 2R4SH 3ULUF 3G6DH 1P7QB 1O6SB 5DYFA 4R7DA 5F0JB 4Y16C 4OJCA 1NBYB 4Q9BA 1W0YT 1Q1JH 1Y6KR 3HVDA 2VLRB 1UZ8A 2ZXAA 3ZDZB 1U8HA 1UGNA 1HILA 2EDBA 2W8CA 3D18B 1YN7A 4NO5B 4Y4FB 1PPIA 1FFPA 4P5TB 1KLUA 5B1BB 4IIQC 2WZPD 4FXLA 1EJFA 4MASA 3HCVA 4JDZA 3TT3H 4P2OB 5F1IA 1AGBA 3GSXB 2VGLM 2JKWA 3D2UD 3FCUB 5T33H 3VWJA 1LQSR 1WEJL 1FVCA 3PXJA 5BVPH 3GF8A 1E7VA 1JNLL 3KEHA 1U8JB 5JHLL 1CR9L 1U8OB 1ZHBB 2DWYA 4XBEH 1FFNB 3DYPA 3QXTA 3T0VA 5KJRH 1W72B 2C9UA 1GVIA 2DMHA 1NGXB 2Q1EA 3RGVB 8FABA 4XE5B 4UQ9A 3U9UB 3FTSA 1XTLA 2YXVA 3OMIB 1CQKA 1MVYA 1YNTB 1JV5A 1PZ5B 2KZBA 2IH3A 4YHPA 1G7JB 2GFBA 5AL0A 3NJGA 1HKFA 2CE6A 2BSTA 2FQDA 1A7QH 4AWJC 2UZYA 5BZWB 3R8QA 1KCLA 2NDFA 3LTVA 4PJ9D 4NJ9H 3OLDA 4NT6A 4RESB 1TF4A 2Y36L 1ZA6A 1S7WB 2ZAIA 1CBJA 1BHGA 1X7QA 4H25B 4BFBD 2VB5A 1M7IB 5L2JB 3OQRA 3AS3A 4F7TB 3HC0A 2CPUA 1OSEA 3MV8B 1LO5B 4AJWA 2BCKA 3HS0A 3I6GB 1GIGH 3RWFB 2Z31D 1Z6JT 5AW2B 5EFIB 2WXHA 2BHZA 2W9DH 2B1AH 2ZXWB 3EGXB 1QNZL 2J2ZA 4DN3H 3NFPA 4B0MB 4XZUB 1VFMA 1TTCA 1SEQL 2BY0A 2CRYA 3B9KD 3QDAA 4DGVL 4CN4A 1CLVA 5GGVL 1UJTA 3NDYE 5DF0A 4JKKA 4EIUA 3U83A 1U91A 1YEKL 1M6UA 2A9CA 1XB6A 3DNKA 4BWWA 1NMCB 3D4ZA 3MLWL 4QRTB 2HTLD 2NXZB 5AZ2L 4JPVL 4FJ6A 4Q56A 1CLZL 1WH0A 2H6OA 4XCYB 4N86A 1OCCB 3GS4A 1MEXL 3HG0A 5BCAA 5FO2A 3NCFB 1NCOA 1YMME 4UYQA 5I2IA 4FL4C 3V5HA 1QLRB 1EGJL 4GMTH 2J8UF 3D4GA 4ENEC 4CRPA 3MRQB 2ICEB 3F01A 4JR9H 5A2IH 4XAWH 4U1MB 5JPMC 3K2UH 3QIWA 2HJFA 4F1ZA 3L95B 5EOCJ 3WTSA 2WVVA 3GPSA 3BPOC 1LWJA 2ICWI 3ZQWA 3HI5H 1X5FA 2QMKA 3WE6A 5IUCA 1KZQA 4QKTA 1D5BA 3CZUB 4ODVH 3QUML 1DVXA 1XFPA 5CZRA 4ELKB 2ZX8A 2Q3ZA 1CFVH 1MCQA 4CADB 2VDLL 2DQHL 5FV2A 1OWWA 4HEPG 5DHYB 3H2WA 3LDBB 4QDGA 3D3VA 1PJWA 3Q0HA 5GRWA 4GUQA 1U8KB 2CJ3A 2A77H 5I1LB 3LXAA 4ZQTA 1HQRB 5BZDB 2AJ3A 4F8NA 3QXDA 4YDLC 3X3FH 4CKQA 3WIAA 1A6TA 1A7NL 3RWCB 3TBSA 2OSXA 5KANI 4JREB 3UTSE 1L7TL 4LBAA 4S1RH 5EU6D 5I1KH 5E9DA 3QIUC 1IL1A 3FTYA 4IKKA 5EHFA 3LXBA 1E4WH 4HAKA 4WU5A 4PRHA 2KC0A 3GJFH 4X5XB 5F9WC 5IR1A 5E2VL 1F02I 2ZUUA 3AUWB 1AQMA 1KIPA 2DMGA 3WAKA 2ED8A 4KNSA 3X11B 2DH3A 2MTAA 3RGHA 5F1NA 1A7RH 5CP3A 5DURB 2VLME 1KB9K 1ZTMA 4HISA 2VYRE 4PJ8B 4GRWE 1SHXA 3C6LA 2FK9A 5F1IB 3SEPA 1Z2KA 1IKNA 4Q9RL 2GJ6B 2H26A 3PHOB 3OBAA 4PG9B 5I8CB 5L4MA 1ASOA 3DARA 3VWJB 1JNNL 4IBWA 3UBGA 1NWOA 4BCXA 1U8LB 4RETB 1O5DT 1X5JA 3JWNC 1SVCP 4XVJH 1J5OH 2WTPA 1DVFB 4WV1B 5C07E 3MBWB 3SE6A 1SMAA 3VFSA 4JPKL 4G8GA 4ZI8A 4PG2A 3DBXB 4FCAA 2PP8A 4X4MA 3PJNA 4F8PA 4I2XB 1GTFA 3AG4B 2YD0A 1K8IB 1KGJA 2KYIA 5EBMA 3UZQA 4WEEA 1GOFA 1P53A 5F7LB 4OGYH 1YPZB 2NY5H 4Q6IB 1CXFA 3VI3E 4BJLA 1S7WA 3NACH 3QI9D 3U0TB 4HC1A 5D8JL 2AJSH 3ZDZF 1PZ2A 3QZLA 2IWFA 3D5OF 4DP7X 4XVTL 5LBGA 5J1TC 1PW3A 4NC1E 3UTOA 5EPMB 4KQ3L 1FFPB 4P5TA 1JCVA 4LXFA 5F9OH 3WS3B 4Q97A 3MBEB 2XKNA 2Q7YB 3WELA 2UZXA 3W0WE 2CBTA 2PWFA 1YQVL 4HCGA 3HHSA 3EOBA 2RCSL 4KK8C 4LU5H 1ZLVK 2L4OA 4OM1L 4M4PA 4JFEE 5IWLC 2GJRA 4JPKH 1G7MA 5LWYL 5LHDA 3WCYA 4QRAA 3T65A 3UAJD 4Z3FA 1I85C 1IQDB 2AP2A 1HH6A 1NH6A 3QJZA 4FTVE 1KPUB 4MNGE 1IEHA 3AQDA 1EZSA 3DMMB 4TOYL 1JD9A 3GPEA 2QKIA 3POCA 1YNTA 2CHXA 1QLEL 2VZVA 1MFUA 4PYGA 2ERJB 4HWBL 3JWDH 1SYVA 4QLRA 2Z35B 1RH8A 3Q2VA 4P06A 1SHSA 2O6CA 3UO8B 2AXHA 2JJWA 1M9SA 2YKLL 2FO8A 1UD3A 1LP9A 1WZ1L 3NCXA 3F3HA 1CGSL 1WITA 2VSKB 1ROCA 4ODXA 3ULAB 1IU1A 1OGAB 1RD6A 1TQWA 2ENQA 4CU8A 3VW3H 3X3GH 1E4WL 2P43B 1FL5B 5EIIG 4P2QD 3VGGA 5A16A 4G8AC 1T2QH 1H3VA 1JVKA 1P5UB 3WSQH 4XP4L 4KOBA 5LCVL 4JZNB 1I1FA 4JVWA 3VCLA 3UBXB 1WBZB 4O2CA 1A3LL 4KZEL 4AX3A 2ADIB 1E90A 3MLTB 1KCUL 2HG5B 2CCVA 2WZ0A 3FB5A 2I9LA 1A6TB 2NR6A 1UURA 3BP7B 3RWCA 3TBSB 1TJMA 2N1TE 3QFDB 3TBTB 4F27A 1KSRA 4N2DA 1PGRB 2X3CA 4J3OH 4BZ2A 2EIZA 1WWAX 1CT8A 2CKBB 2Y2TA 5B1KA 1K2DB 4CGUB 2ZQKA 5FK9A 1KIPB 4MYWB 4AIZA 4XNUH 3JZYA 3AZUA 1DFXA 5GGUB 3C60D 4E0RB 2CD0A 3QR0A 2OX5A 4JDEB 5JQHC 1I3RA 2LGNA 5H35A 1F4WH 3AGWA 1YNKL 3DJ9A 3EZ8A 3P9WB 1BVOA 3ARDC 3N1MC 3UTTE 2UX6A 2XLLA 4HG4K 4B5EA 3QUYA 2PR4L 4F7CB 3P0YH 5EU7C 2EE0A 2AANA 1CO1A 1Y6NR 3VXPB 1R19A 3IN0A 2OR7A 3VI3B 3SDCA 2JKLA 2NX5A 4RWYL 5IBTH 4U7MA 3NRQA 3ZDXF 3QULB 4EAEA 3FUEA 5C6WH 1OSZB 2Z4QA 2WGNB 1Z5LA 1IBFA 1ZHNB 2JJTA 1F2QA 4PUBH 3RVTD 2GAZA 5HVWA 2XFXA 2EDDA 1YJDL 4JRXA 4Z7UE 3KM2A 3MA9H 5E4AA 4I5BA 4ZW6A 1XMEB 2YXMA 4GOSA 4M3HA 3B9DA 2PO6B 2D7QA 4TULL 1NPUA 4G8EA 1REIA 1HNYA 2VJ8A 3HZMA 5IW6A 1G7JA 2E6QA 1XSJA 2GFBB 4JHVA 5J06A 1NCWH 1XGTB 5ICXB 4YH6A 4Q2ZA 2VRAA 1T1ZA 4YC2B 1QA9B 1UATA 2CBPA 4KROB 4Y4HA 3K4DA 4XXDA 5ENWA 5HGHA 2RBLA 3BZ4A 2H6PB 3QIBB 1YN6A 3LKQB 5E2TH 2HFFA 4OI9A 1YPZE 3JVGC 1D9KC 1LEGA 4TNEA 1FBIH 1HXYA 2CWRA 3EO9H 4MHHI 1RUQH 1RZPA 1I3GL 2X88A 1YVLA 2YGOA 4N2LA 1T89A