3JT2A

Cu(ii) n47s/m121l variant of pseudomonas aeruginosa azurin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3jt2A00
2JKWA 2PLTA 4BWWA 1WS7A 3FQYA 1AS6A 4YSDA 1HFUA 2HX7A 3N2JA 4P5SA 1FFTB 2J56A 1BYOA 1SNRA 4F2FA 2VSKB 2I85A 2CBPA 5I6LA 1W8EA 1AQ8A 2AZAA 2BP0A 4GP5B 1TEFA 1JZGA 5TK2A 3TBBA 3PAZA 3KW7A 2PCYA 3H4HA 2BZCA 4YSPA 2YARA 3T6XA 3T6WA 3H4FA 4HIPA 1MG2C 4YSTA 4G7RB 1PNDA 2AFNA 3NT0A 1JXGA 1M56B 1WA0X 4E9RA 2FQGA 1CYWA 1FA4A 2FTAA 2I7SA 2J57A 4GYBA 1L9PA 1IC0A 2CALA 2YXWA 4F2EA 1TU2A 4NAJA 4DP6X 3ZDWA 1A4BA 1E30A 1GS8A 4X4KA 2HX9A 3NJMA 1BQRA 1J9QA 1A4CA 2VSMB 1PNCA 4Q89A 1OE1A 1L9OA 1X9RA 2DV6A 3BVDB 4UF7C 4KO5A 1PLCA 3OMIB 4JHVA 5I5MA 4YSAA 2NRDA 4CSPA 1OE3A 3L45A 4FAAB 3FQ2A 1A4AA 1DYZA 1SJMA 1JVLA 2GC4C 1N70A 1OOWA 4YSOA 1KYAA 1ID2A 3NJJA 1L9RA 1NIAA 3FYEB 1ADWA 2XX0A 2JFCA 1NPJA 4HHGA 1KBWA 2AANA 2HXAA 3S3DB 4DP1X 4Q8BA 3GDCA 3D12B 3NJHA 1HAWA 2WO2B 4L0PB 2UXVA 1W6LA 3CVCA 1OF0A 2VMJA 2IWFA 4YSQA 4DP8X 1OCZB 1ET7A 5LDUA 1JZHA 2R7EB 2CUAA 4GXFA 3UGEA 1PZBA 4AKOA 2X88A 3DTUB 3OM3B 1ETJA 1SFDA 1ZV2A 1MZZA 1JZIA 2QT6A 4AX3A 1FWXA 4AKQA 1JXFA 2E86A 2MTAA 2IH8A 4DP4X 4KNTA 2VM3A 3ZIYA 4QLWA 4DPCX 4WKXA 2HRHA 5D4IA 1SF5A 1AZUA 6PAZA 2PPFA 4YVUA 1E5YA 3IN0A 2W88A 3DIVA 1JXDA 1BEXA 4FA7B 5I26A 3HB3B 2GB2A 3EF4A 4BWUA 1CURA 1PMYA 3FQ1A 8PAZA 4PAZA 5B7EA 2EIMB 5EHFA 4BWTA 5TK4A 4ZK8A 4BXVA 2CAKA 1RZQA 2XVBA 3ZX1A 4YSCA 2Q5BA 3S3BB 3NJKA 3SBQA 1PLBA 3WI9A 3AG1B 1AZNA 2XX1A 1M9WA 1URIA 4A2DA 2XUWA 4GY4A 3SQRA 1IKOP 2FT6A 1NIBA 2XV0A 3NP4A 3U25A 1QHQA 1JVOA 4A67A 2YAFA 2R7EA 2CJ3A 4BDVB 3NJIA 2BP8B 4E9TA 2OJ1A 1CYXA 2ZOOA 1KBVA 4DP7X 1I53A 2H5UA 2BO0A 3NJNA 2YAQA 3NJFA 2WO3B 2TSBA 4DP0X 3UABA 5I6NA 3TU6A 1V10A 1GS7A 1GS6X 1OCRB 1CC3A 1EZLA 4M3HA 1UATA 5B1JC 1WA2X 1ILUA 1SFHA 2Y69B 3JTBA 4G7QB 9PCYA 1ET5A 2A3TA 4E9YA 4DPAX 3IEAA 3NP3A 2FQFA 3FPYA 2J5WA 4K9JA 3KW8A 1N68A 1L9QA 1JERA 1KDIA 3FU7B 5F7AA 3TASA 1R1CA 2DYRB 3CVBA 1AZCA 1AAJA 1SDDA 2Y1AA 4BK5C 2TSAA 3FPXA 1NPNA 1ZPUA 2X87A 1BYPA 5D4JA 2XLLA 1F56A 1MG3C 1BAWA 2GI0A 2IDSA 3T9WA 3H56A 1ASQA 1OCOB 2VW4A 1XMEB 4N4YB 1ASPA 4E9SA 2XV2A 1JOIA 1J9TA 1ZDSA 3QJQB 2VM4A 3QJVB 3CDZB 1T5KA 3FSZA 3RYMA 3ASOB 2XU9A 4BDVA 1BXVA 1CUOA 2QPDB 3QQXA 2BP8A 1A65A 1KCWA 1PZAA 1WA1X 3FT0A 4DP9X 5AZUA 3PAUA 4YL4A 1GR7A 3NSCA 4YSUA 2QPEB 3FSAA 3FSWA 3NSYA 4YVNA 3UACA 5I6KA 4HAKA 1NIEA 2I7OA 3QJRB 3T6VA 1ASOA 4E9VA 2UXFA 3PLYA 4KOBA 5FC9A 1OE2A 2EILB 1AACA 2AVFA 4EF3A 2BWDA 3OMAB 3V9EA 1BQKA 1PF3A 1NICA 3PXLA 3G5WA 2IDQA 2UXTA 5I5IA 1AS8A 4PCYA 1PY0A 3FU8A 3SBPA 3EH3B 3FU7A 3NSFA 2IDTA 4GP4B 1ZIBA 2VW6A 2IWKA 3IE9A 3C75A 2IH9A 2XXGA 3AG3B 2PCFA 1E5ZA 3OMNB 1SF3A 1OCCB 3PPSA 1XB3A 1IBYA 4HZ1A 3ABLB 1V54B 2HRGA 1SHWA 1W6WA 4KOCA 1GY1A 1TKWA 3OD3A 2GSMB 3GYRA 4AZUA 3ABGA 2XV3A 5B7MA 2XXFA 2EIJB 3EHBB 3CDZA 2ZWNA 1BXAA 2UX7A 4DPBX 5F7BA 2HX8A 1SHXA 2W8CA 1X9UA 3JT2A 4N8UA 2IWEA 2PP9A 4YSRA 4DP5X 1BQ5A 1DZ0A 1QLEB 3AZUA 2H47C 4QKTA 3WIAA 4G70B 2YAMA 4CSZA 5B1AB 5AFAA 1MDAA 2YAOA 2YAPA 2VW7A 1RKRA 1E67A 5D4HA 2ZXWB 5IY5B 1WS8A 5PAZA 3QJSB 1GSKA 1KGYE 5I6OA 1L9TA 3AG2B 2PPDA 3TBCA 5ANHA 4WTQA 2AZUA 3T71A 4UANA 4AKPA 3NJGA 2FT7A 2HZHA 1JZJA 3CG8A 1NTDA 3OQRA 1EHKB 3ERXA 1RZPA 4GP8B 1KCBA 4KO9A 4A2GA 1GW0A 1J9SA 3ABKB 1GYCA 3AY2A 4BXSV 2P80D 4HCFA 1WAEA 2EINB 3FYIB 2UXGA 1VLXA 3IBOA 2IDUA 2ZONA 2PPAA 4RH4A 4HCGA 5I5JA 4YSSA 1ILSA 2PP8A 3X1BA 4E9XA 4ENZA 3NJLA 2BW4A 3UAEA 5AKRA 2QDWA 4TXVB 4G7SB 4KO6A 2QDVA 5I28A 3WNJA 2GIMA 2YAHA 2BZ7A 3TA4D 3S8GB 2PPEA 1IUZA 1NZRA 3N55A 2BW5A 3CVDA 3NSDA 2FWLB 2Q9OA 7PAZA 5B1JA 3AG4B 2JXMA 5B1KA 3S3CB 2B3IA 4HCIA 3WKPA 2XWZA 2FT8A 3X1EA 1A8ZA 3FSVA 4MFHA 2B08A 3X2QB 1NIDA 1NIFA 5B3SB 4KNSA 1AS7A 2DWSA 2H3XC 2IDFA 3DKHA 2J55A 2VN3A 2IAAC 3PCYA 2YQBA 3QJUB 3V9CA 3ASNB 4DP2X 4NB7A 3SBRA 2FNWA 1NINA 2GHZA 1ET8A 4YSEA 2FQDA 1PLAA 1AOZA 3UADA 3WNIA 2GBAA 1V55B 3S8FB 1TEGA 3AW5A 3FS9A 3HEIB 1E65A 5I6MA 1PAZA 1ZDQA 1PCSA 4KNUA 6PCYA 3EH5B 1NWOA 2N0MA 1YLBB 3WKQA 1B3IA 1JZFA 1AIZA 2LLNA 3ABMB 3X1NA 3X1GA 1IBZA 2BP0B 4AI7A 1NDTA 1J9RA 1HAUA 2DY2A 4M4RB 5E9NA 2UX6A 1PZCA 3BQVA 4JHUA 1QNIA 3CZUB 1JZEA 2WSDA 2XYBA 2FQEA 2P80A 2RACA 4E9QA 4A66A 1KV7A 1RCYA 4W1TA 3PAVA 4E9WA 3QPKA 2FJSA 1L9SA 2BHFA 2PP7A 4A2FA 1XB8A 4KO7A 1AG6A 4NERA 4P5RA 4JKNA 5B1BB 1AZRA 4W9ZA 1KDJA 1MZYA 1ZIAA 3EH4B 3MX0B 2DYSB 2HLEB 1BXUA 3QJTB 1AG0A 5A7EA 2EIKB 4G71B 2OV0A 2DWTA 5PCYA 2PPCA 1AR1B 1NWPA 2CCWA 1XB6A 2GC7C 2YXVA 3IN2A 1AZBA 3WG7B 4A2EA 1J5CA 1SDDB 1AANA 1A3ZA 1GY2A 2OCCB 4A68A 4HALA 3MBWB 5B7FA 2BWIA 4G72B 3NYKA 3FU9A 1J5DA 1OV8A 4UAHA 3ZBMA 4HHWA 4A2HA 4F7KA 5I6PA 3GXUB 7PCYA 1M57B 3X1FA 2MRYA 3T6ZA 2YAEA 3UAAA
chains in the Genus database with same CATH superfamily
1Z9OA 5D8JL 5EWIH 2FB4H 4OGZA 5BV7H 3O45A 1I8KA 4ZG1A 2BSSA 4U1SA 2HJLA 1PG7X 4XGZA 2VN6A 4U4IA 4GAJH 5I75B 4MGXA 3AM8C 5E6ZA 3ZGHA 5CEXA 1P6AB 3L3KB 1MJUL 3LX9A 4JMXA 2BP0A 1CI5A 4AVIA 3ULVE 3PQYB 5GISL 3PNWA 3CE1A 4Z9KB 3HRZB 3WFBH 2NNAA 3L81A 4FQ1L 3QRLA 3KW7A 4MZ3A 4B27A 1YEGL 4IIQC 2ADJA 1HHGA 3FQ4A 1CLCA 5JA8B 2VUOA 3E8UL 1U8JB 4G7RB 5AAWC 2DL9A 2GTWB 2VDRH 2OZ4A 3RTQA 3TF4A 4LCUB 3GMLA 4TSCL 3DIFB 2DMCA 4LSSH 5GZNC 5IG7B 2IPKA 5CN1A 1CBVL 4PVNA 2JKNA 1QRNA 3GSQA 2NW3A 4BUQA 1IKFL 5J9PB 5AENA 3MLTB 5BRQA 3STBA 4C4KO 2H26B 4Z3GA 2C3VA 4NAJA 4U6VH 1L6XA 1OAUH 2DQTL 3JZYA 5IHBA 1A6WL 4F2MB 1E4WL 3PQYE 2V8MA 2VSMB 4LLVB 3NRQA 3K2MC 3ZE0F 3MRIB 2BVYA 5ISZB 1YEIH 2EDRA 3QDMD 4ZX6A 4TQEL 2HVBA 3B3IA 3DI2B 4G6KH 1SJMA 2E3VA 4JGJA 3TT3L 2KPNA 1ID2A 3KJ6L 3P0YL 4IMKA 5L9DL 3E2HC 5F7EL 2A7BA 3S88L 3HHSB 2ZWYA 2IALA 3G5VA 3Q2CA 4HUNB 4W93A 4B97A 4HHGA 5ICYA 1CWVA 3DROB 4HGWB 2ARWA 4FL4B 4ETQB 2OKMA 2G75A 4PP2A 2AERT 4PUBL 5DJXA 1FCGA 1GOFA 5E2TL 3KZ8A 5EU6B 2H1PL 2QHLA 1OF0A 4MQXC 4EKJA 3HB3D 2MCPL 4JDEB 4M48H 5HGAA 1H3WM 3ESPA 5L8KB 2A2QT 4X8CA 2AK4A 4OJAA 3TN0C 4S1QL 1YN7B 5I5RA 1WT5C 4D0CB 2C9QA 3RPBA 4QRUB 1QPKA 2VDQB 2XBZA 3HE7D 1DLFL 3K4AA 4K2UH 4UMSA 3QQDA 2CM6A 2ZXDA 4MJ5B 4WNSA 3NIDE 4XBPB 4J8RB 3OV6A 4K9EL 4U1JB 5D5MF 2F7PA 4DCQB 1L6PA 3O2DH 1L7IL 1BEXA 1IEBA 1N2RB 5ALCL 2AXGA 5I26A 1TYJA 4EI5C 2OCFD 4L29B 4LEXL 2FJFA 3D25B 3NCCB 3V4VB 4KKCD 4G2AA 3N3EA 4XC3H 5IEHB 4HJ0C 3MV8E 3FB6B 2W65A 4XMTA 4L3FA 2CAKA 5ESAA 1FNAA 3LNGA 3C60C 3QWNA 5TE7L 3TCLA 4MAYC 1I8IA 2J1KA 2VDQH 2A74B 3WI9A 4BFRA 2UY7B 5AVYB 4YK4C 4RNRB 2I60H 3GMNB 1B4JH 1YO4A 4K4KA 1WWWX 3NPSB 2EKJA 4HPYL 3AS2A 4MB4A 2DMKA 3DV6B 5DMIH 4V33A 1LMKA 2XHNA 3I50H 2XNAB 3CLFH 4R3SB 1QHQA 4M4PA 3Q7JA 3ABZA 5E8PB 1FG2B 3RHWK 1SRDA 3MJWA 3ULUE 2L7QA 3Q48A 2OJ1A 3OAYK 1UUNA 3V4VH 4HW6A 2V7NB 5D7LB 4MDJB 2FD6H 3LNDA 3K2UH 2IH3A 3HS9A 3WKNA 3UABA 4I0PB 1RULH 1YJDH 1M53A 4W9EC 3L4XA 4YDJA 1ZKAA 2XWCA 4LCCC 1UATA 5DFWH 4TVPL 5B1JC 1ZA3A 1K2DB 4NQTA 1FNGA 1TTCA 2ZICA 5JHLH 2DEXX 4BQ9A 4I88A 1S5HA 1EVUA 4YHZL 5HHPA 5HGDA 5JXEA 4HBCH 2FO4B 3CLEH 3NP3A 1P4IL 4NNXA 1UEYA 4AK1A 2J43A 4QHUB 5DC4B 2HG5B 1U0QA 3PIQA 1JF6A 3F12A 1GMEA 3S37X 3ETTA 3GBMH 4GAGH 4KRMB 5IROD 5IB5B 4PVMA 2UVFA 4QRSB 2FJGB 3UBXB 2FSDA 3D18B 4HD5A 3CXDL 3VXUB 5CUSH 3JWOH 4K7FB 5C08D 1G6RB 4M93C 5J4MA 4NQDD 4HQQH 3TEXA 1F3DH 4MJJA 1ITBB 1G5AA 4UI2A 1UXWB 5CKAA 1XR8A 3GNML 3O3UN 4QAWA 4QKXB 2VLME 1UA3A 5KN5B 3Q6GL 4NP4H 5CP7B 5DJZB 2GJZB 3E80A 2BNRE 5IVOA 1IGJB 2PWDA 4LVHC 1BM3L 1K8DA 1KV3A 2BP8A 2MQ3A 2I07B 3FT3A 3IAQA 3SDDB 1DUZA 4ABQA 2EH8L 1SLXA 1WA1X 1ORQA 4IHOA 4C58B 3NSCA 4YSUA 4AJYV 4BHUI 1T0OA 3UACA 1SDAB 3PY9A 3U6XS 4LARL 1OARH 3DGCR 2JIXD 3ARFD 4NXKA 4XVUD 4IBVA 1JXJA 4YMPA 4PJXB 4L4VE 3L9RA 3ZHKA 4P2OD 4HJIA 1G6RH 3DRQB 3PLYA 4OKDA 4PRIB 3RDJA 2EILB 2N59A 4PHXA 1MCWM 2JVUA 5D93C 2Q87A 35C8L 5F1IA 4ZMPA 1X5FA 1TVDA 5I5IA 1ML0A 2VXSH 3BC9A 1DVSA 1G43A 2DM7A 2WLIB 3SBPA 4H8WH 2FEJA 4R7LA 3BIAX 5TD4A 3TNMB 5EBMA 4HFWB 1EO7A 1C1EL 5EIVA 2DQFA 3S34H 2DLHA 3HUJB 2JI3A 1IQDA 2PCFA 1J1OH 3V0IA 4PJFB 2XQ0A 4XR8C 1YPZF 2D7TH 1AR1D 1NBQA 3U46B 1HIML 1IM3D 5DI8A 1DEEA 2OTPA 1RLWA 2VRKA 1TKWA 2NY6B 5F0PB 3D87B 4I18C 4CDGC 4EOWH 1IGIL 3P54A 3HN5A 3M1BB 3FCTB 3TV8A 2LU5A 1ZLWK 3K1DA 3LKSB 5JTWA 1A7QH 3QEHA 1TCRA 2B9BA 2W8CA 5C09D 2B4CL 4Y2OA 3TBSA 4HJEA 3RNQB 5EIIG 2P5WE 4XC1L 4KZCA 1KB5A 1YMMD 2CUMA 3BAWA 1UH4A 2WLMA 4EBQH 1DL7H 5ICZB 1RI8A 3BWUC 1PJ9A 4TMPA 4R90L 1RKRA 5HYFA 3NVQA 5I74C 2BX5A 2G2RB 3KXFD 1BJ8A 4K5OA 4ZOCA 4ELMF 1SLWA 2F2HA 2YBGA 2ZCLH 2X4PA 4LDCA 2PWHA 5H4YA 5JO5B 3HR5A 4F57H 3O8XB 5I76B 3WTXA 4JNXA 1TZIB 1AHKA 4JPVH 1R3LB 4WI2A 1PAMA 5FCUH 1V3JA 4HKBB 4N0FA 4WGVB 3UYOD 2PPDA 1PKQB 3LY6A 5ANHA 4WU7B 3DYPA 25C8H 3IDXH 4FZ8L 3UTSA 4AKPA 4JFFB 4OZ4A 5KBDA 1NEZB 3G04A 2CQVA 1UZ8A 3RY5A 3PGDA 3ERXA 2A9BA 4UB0L 3LHAA 4KWUA 4ZXBC 3IGUA 3BRFA 3KVDD 2Y5TA 4JCMA 3ABKB 1WEJL 4HBQA 1PDKB 4BFNA 5HD8C 4GQZA 4XMXA 4UQBA 1EJ6A 1D7DA 3NN8B 4YJZL 4JUSA 5TQ0H 3IGKA 4X6CE 2YPLD 1ZHBB 2X4TA 2XJKA 3L4VA 4NZRH 1HCFX 2YUXA 3J27A 1UD8A 5ILTH 1QFWL 5T33L 2VLJA 2J20A 4TNWF 3FC8A 2BNQE 1FL3B 4F15C 1N5YL 4BSJA 3P2BA 4RGND 3IXAB 4Y19A 2IPUG 1YMHA 5E9AA 3N55A 2MMXA 2Q20A 4FQXB 2ZX8A 4LQFL 4KMQA 3NEEA 2C9SA 1FGVH 4JRXB 4ZMTA 2DIAA 2MCMA 3C08L 2Q9OA 3QEQE 5FWQA 1DJGA 3VFGH 3B5HA 1X9QA 3R1GL 1BQHA 3GHBL 4EZLA 3PHQA 2VDPB 2ALWA 4YBQC 4AJVA 3H9YA 4B0MB 2F58L 2QQNH 4M7KH 4ODXA 5DO2D 2EUWA 4PSPA 3TJPA 4R26H 3C6LC 3C9NA 4F7MB 4MNQB 2QVMA 4R6UA 4QRRD 1CD0A 4QOKB 2BIOA 4JQIA 4NLHA 4QXTB 4MCNA 4PJHA 1D9KB 1R3KB 2GHZA 3V6OA 4L1TA 2FQDA 2BOLA 2EIZA 2QJDA 1COBA 3UO8B 1P7HL 5HI3D 5I19H 1MFNA 1E8YA 3LN5A 2Z8WC 5HVFB 3ETSA 4HUCA 5EEZA 1EEUA 1FH5H 3ILDA 1U91B 4HISA 1JMXA 4J6IA 1Z32X 2VDPH 3HCVB 2FHFA 2JJSA 3GZKA 1UKQA 2G0LA 4Y1SA 5L7XL 4U05A 4ZFOA 1WITA 1UXLA 3BVVA 5AW1B 3QRGL 3VCLB 3QZPA 3K4DA 2F8OA 3SY0B 3ARBA 2BMKA 3L1OH 4P4RA 1BX2B 2CO3A 2ICEB 3BQVA 4LLAA 2NY2B 2J8UB 3JZ7A 3QYNA 2Y07L 3H85A 4H1LA 5FM5M 1TTUA 1AQDB 3O4LA 1WFJA 4K8RL 4WKZA 2E27H 4Y4FD 4AT6A 1KBGL 2PP7A 1KIPA 3ASWA 1I1AA 3FT4A 1EAQA 1I1YB 1UM5L 4KTDL 4YDLC 5DLML 4DAGH 4W9JC 3V5KA 4XP5L 5GSRA 1AHWA 3HI1A 3V52H 1S7SA 4XPHH 4RZCA 1FZKA 3GXPA 3V95A 4F7EA 4N8PA 5F3BB 2RQ8A 4EUPG 2RALA 3EJYD 2JQMA 1RZ7H 4XWGH 4OFDA 4U6XA 3RWHA 1FJ1A 2OXGB 2YLKA 4L8SA 5HYIA 3RLSA 1A7OH 3HJEA 2HUHA 4LIQL 3OGOE 4PJEA 1JV2A 1LE9A 4YFLI 4X6DB 5LNEA 1HXYA 4F93B 3BEVA 4XTRC 1EXUB 5DJCB 3L2MA 3UFIA 3CFCL 4U6TA 4DKAA 2Z3FA 2EC9T 4IIQB 3EH1A 1GYAA 5IK3A 3FQYA 4X9IA 3IRPX 1UACL 2AQ1A 4EDXB 1AGBB 5JW3H 5DD1L 43C9A 1KPRA 4Z23A 2AQ3A 3ZY7A 1J1PL 2XWXA 3MJ7B 4HUKB 1CTMA 4GG6A 3L5XL 5E6YA 4M7LL 2K9UA 2QTEA 2AJUL 2O61B 1BWMA 4KXZI 4PJ8A 4GW5B 2R51A 4J3OC 4B5ZA 3T8VA 3H54A 4HH9A 4CADB 2HVJA 2CIIB 3SCMD 4Z3IA 5CHNB 5AOLA 1FFOB 3MRQB 3U30C 4YFEA 1X5GA 2V17H 1EMTH 4IBUA 3WUWB 5DVKA 4WUKH 4TPRH 4XXWA 4Q4EA 5J1AB 1UFUA 1PX8A 4JM4L 4WRLA 5JIHA 4MS6A 4XOEA 4KKZA 5F1NB 5IHLB 4M1GH 1I4FB 2GUOA 5TDOB 1OB1A 2FLBT 5C07B 3ZKQD 4EIGB 5DYOA 2Q86B 1ESOA 1S6NA 2IOMA 4ODTH 4YQXH 3ZYIA 2V9RA 3QYMA 3G9AB 3NESA 2HPTA 3L4ZA 4XNZC 1JPFB 1AQMA 3F2LA 4NKMB 1BVKA 3KL0A 4NRXA 2WBXA 1R0AH 3N6YA 2HX9A 5AVZB 2D7MA 3E2HB 3D85A 1TO5A 1OE1A 3BT2L 1D7BA 1VPOH 1TQSA 4I9XA 1MLCB 3UTOA 3LXCA 5HHXL 3MRHA 4N2DA 1G7MA 4TULH 4Y1AD 3KYOA 3T09A 1RU9H 1F86A 1DYZA 3FQ2A 2KMWA 1JFQL 5GZOD 1WBYA 1N70A 3OMZA 1CFNA 1N5AB 3IRZA 3QUYC 4XMVA 4I3GA 1MPAH 2E0PA 2GSIA 3BD5A 5EF3A 4HCRH 3TN0B 3OWRA 1AY1H 4F7TB 3EJUA 1C12B 1ZPLA 2DQ6A 2OMWB 5F6IC 2J4WL 1GIGL 2BJML 2OCJA 1FL5A 2KKQA 3O0LA 4PRPB 2PO6D 3O3AA 1MCQA 3B8YA 3VO0A 2A1WL 1KYDA 1E6OH 5F6HJ 1FFNB 4JE0A 2XWDA 3T4AA 3NBNA 5BXFB 4D9QE 1LWRA 2EYRA 1TR7A 3UCQA 4K3JH 2X4NA 2A6DB 5CZXD 1JV5B 2BVPB 3WY2A 4KZEH 3MXVH 5J13C 1XGUB 4PY7A 4IEFB 4U1NB 4EI5B 3SKUD 3ESOA 2XIIA 4NAMA 2PTTA 3F58L 3UTZA 2VXUL 2XACC 1F6FB 5HDRA 4KFMA 3ARGA 5G4NA 4ZUTB 1H6FA 3B2UC 1BFVL 1WICA 3QULA 1UJTA 5IVXF 4MAYB 2FO8A 4FE9A 1E7VA 3SE6A 1GGBH 4FA7B 3MNVB 2NT1A 2D3VA 3MFFB 2HG0A 4IRJD 1NDMB 2DW5A 1SUJA 3SJVD 4AGNA 4YK4B 4PB0L 3RUGB 4PRDA 1DBBL 3HMXA 3SYAA 1CURA 2K8QA 4ZX5A 8PAZA 3CU1A 1NC2B 2MQGA 1N4XL 1JNLH 1P7KB 4Z18A 1LL1A 1WGOA 2V9UA 4KKPA 4WHDA 2HLFC 3NFNB 1QFUH 5E5LA 4I2XA 1UD3A 3NJKA 3SBQA 5D70L 3AQDA 5E1QA 4G3YH 2C9PA 3A6CH 5T5NF 4Y4HC 5C0CE 3BDXA 4W9FC 2XX1A 3MCLL 1URIA 2XUWA 3VFRA 3PWNB 3ARDC 4L8BA 4QT5A 1NIBA 3GSRB 5CBAB 5C0JA 4LCCB 5E6RB 3MRLA 3DUHA 4N28A 4P23D 3KLAB 2M83A 4TUOA 2HFGH 4BCYA 1OT1A 4P2QD 1EUTA 1KIRB 4M1CC 2ZYRA 4P2YA 2TSBA 1N0LA 4P46A 3SDAA 1JNHB 4DP0X 2X05A 3HFFA 4JM2A 4BQCA 1DVFA 2XWTA 4NO0B 4YHNB 3CSYA 4G7YH 5L2KD 5KSUB 1SOXA 2R0KH 1U9KA 2EDMA 3PWJA 4KNQA 3QXTA 3WLBA 1R3IH 3E1F1 4OSUH 5CEZL 2QFPA 2J21A 4M93B 4BBWA 2OQJA 2A73B 1EUUA 1VFMA 4JFHD 3QNYB 3QPXL 1C08A 2X6UA 3MACH 4KGLA 4UQ2A 5IJKC 2Q8BH 4ZZKA 3S3JA 2C9AA 2C9RA 3MGAA 2P5EE 5T3ZD 1ZPUA 1GKOA 5I30H 2ATKB 3GMOB 5DJAA 4XNAA 5LGYA 2YD0A 4FDWA 1G7IB 3FUKA 4JQVC 1G0XA 3NZ8A 3KCPA 3ZQWA 5JHDA 3T0XA 1JGDA 1BLIA 3VXPB 4F9LA 4XOBA 2LFGA 2VM4A 2GQHA 2AJYL 2X53A 5HYSB 1T5KA 3L95B 3ZE1E 2BFVL 4EQ3A 4ZS6D 3TS8A 2NQ3A 1TMQA 1IEAB 3ZTDC 1F4HA 3QEGL 3V4PA 3LKPA 3CDCA 4XNYL 5GS0C 4GIPD 4PJIB 4X4XB 2VMDA 2Z6FA 4N5ED 1HHJA 1MVUB 2D31A 3MROB 2BIPA 4IK6A 1T66D 3HI6H 4IDLA 5C0DA 1E3FA 3Q9QA 4H20H 4TTGA 3HVDA 3L3IB 5DHEA 4ZJ9A 3S97C 5CEYB 1K5NA 2E76C 3WMQA 3LPGA 4HULB 4JHWH 4ANXA 5FC9A 3ESMA 3U9UA 2ITEA 3F7YA 4HJSA 1FO0A 4OLYL 1ZSDB 3EHBD 1CDGA 1RZ8A 4WENB 3OF6D 3QEUA 3DX8B 1EAJA 3X17A 4GBXC 5K9JL 3VXSB 1HL8A 3H42H 3HG1E 4WI5A 1RZGB 5DQJB 2AJ3A 5I16A 1ZV5A 4J3BA 5DD6B 1KYFA 4HUVA 1G0DA 4ODSL 4MRCA 3DECA 4G6MH 4OJDH 4PGEA 3OSVA 3M46A 3OKOA 1IT9L 4XCYB 3KPOA 1BGXL 5C92A 1P2CB 4CC0A 1QQDA 1SJHA 1XGPB 1EPFA 3DJSA 3RVXC 5IMOA 4E2OA 4UUJA 2VDNB 3FFCA 2O6EA 5H2BA 3MV7D 3GMQA 3HS0C 4KK9C 4D3CL 4PREB 4ELKB 1MCDA 4XX1G 1Y6NR 4AIOA 1X9UA 1XO8A 1C16B 1RIHL 2CE6A 3RU8L 4XBGA 3A24A 4DK5A 1BZOA 4Z7UF 1T0NB 1WFMA 3CVHB 3F01A 4LU5H 3TA3D 4ZPTB 2NW2A 5EA0L 3VI4A 4FA8A 1PYWB 3VXSE 4HKZB 4WI9A 1E27B 1SXAA 2XVLA 1YZZA 3CDFA 4AQ8A 4ZXBB 3QQ3A 4R4NC 2BRQA 1BD2B 2BDNH 2NXYB 1I7ZB 3FHEA 2FO1A 2DICA 2BCKB 4R8WH 1J1XH 3BJ91 3ATBA 4PJAE 3RY6A 2VDNH 5BZDB 5I6OA 1L9TA 1HZLA 2P49B 5LCVL 4WCYH 2DMBA 1J86A 4FNRA 2X7LA 2W9LA 1H15B 1C5DA 3ETBJ 2Y6SC 4MXQD 1MFAH 4FXTA 4OGYL 4XCNB 1THAA 3TFBA 1PG7L 4I5BA 1KJ3H 3P3UA 4K15A 4YUEL 4B96A 3ZDYF 4KUZL 1GJUA 3BW9A 1E6JH 2OMXA 4F15B 2HP4A 2ZOTA 3CVHH 1JP5A 2P80D 2E8YA 3W82A 3ZU8A 4G8IB 3S48A 3LV3B 3ROOB 5A3ID 5DFAA 4NC0B 5CGYD 5GGSY 3S96B 5LNGA 4C83A 4K3DL 1YEWA 1HQ4B 4BKTC 1ILSA 3AT9A 1EFXA 1FYTB 4JFEB 4AG4L 1E5UI 1Q1PA 4PJ7B 4MLIA 1HE8A 3L3DB 5I2IB 4F8LA 2YAHA 5HJBA 4XN2A 5J11C 4PCKA 2Z65C 1WIOA 2VIRB 4TTDC 1I9RL 3SD5A 1OKEA 5E1GA 3C6LB 1KCSL 3II1A 2F53E 3O6FD 3VRLF 3QO0A 4G8EA 4FNLH 5FM4A 4GI8A 3MDJA 1ZHKA 4AMKH 2JJSC 4NOFA 1W8OA 2F5BH 3BKMH 3BO8B 3DARA 3QFGA 3RZCA 2WQSA 3SHSA 5A6IA 3CFKA 3RWIA 2Y3AA 2J1ZA 2JXMA 4NM4L 5C0BB 2YMTA 5BMFH 4YHKL 5EU6D 1O7SA 1WUZA 4AH2B 3MUJA 4ZNEA 5A2AA 4ZTPH 1KIQA 3GKWH 3ZTCC 3B2VH 4Z7WA 3VXMB 1PY9A 3MRRA 1AGFA 1PSKL 1JWUA 2CKBB 2XFGB 1YQVL 4Q2ZB 3QPQD 4NCDA 5B39A 3F04A 4PJGA 5H4ZA 5IOPA 1S7UA 3SDYL 3IJHA 4TSAL 1XIWC 3NIGB 5C0GB 1XT5A 1LEGB 3LVTA 5LJYH 3IMVA 1CD9B 4ZUWB 3ULVL 4MXWL 2R1XB 4WWID 4ZO8A 1MH5A 4OZGB 4LVNC 3QCVH 2P3YA 3ZVVA 2W1NA 3O45B 5DEZA 1X9LA 2HJLB 4XGZB 3N44F 4UAOC 4YE4L 5C0BE 4H13C 3QA3B 3X1GA 3P4OA 4XNXH 1G7JA 2V7HB 1MRDH 1SYVA 2BP0B 4W9KC 3FUHA 1NDTA 3MCKA 3PNWB 2NNAB 1JZ3A 4XP9L 3L3GB 1KOAA 1G9MC 3FMGH 2BVEA 1NKGA 4HEPA 5F9OL 1LTXA 3VWJD 2ADJB 1TQVA 1YVLA 1ZJAA 3VXQA 3OB8A 5DT1L 3GSXA 4E9QA 4A66A 3S8WA 2Y36L 3MOAH 3QPKA 1L9SA 3GMLB 5KVEH 1ETZA 4AUUA 5A16A 4NERA 3VI3E 2IPKB 4WV1A 4CILA 3P4MB 3NQKA 1QRNB 4I3RH 4OZGE 1PD6A 4Y8AA 3MX0B 3HG5A 4L4TD 4LB8A 5A7EA 2BPBA 4U33A 2C3VB 3N40F 4IJ3B 4NZ8A 3VG9C 2IPTL 4KK8C 3FN9A 4RX4A 1UVQA 4A68A 1E3ZA 3P11H 4FKHA 4HALA 3HBQA 3ZRSA 3FU9A 4I0PD 4DEWA 1JPEA 5AYQA 3B9AA 1EIBA 1HNGA 1N59B 5IWLC 2R0LH 2ZKHL 2OZ4H 4D8OA 1LK3L 5HTSA 4BWWA 4QTHB 3GO1H 3U30B 4YSDA 3B3IB 3WENA 3H6AA 1TJHL 2YUZA 3MFGB 4LKCA 3SYCA 2VJ8A 4N20A 1M3IA 1A4JA 2FATL 3D9AL 3G5VB 4D9LH 3MGOA 3HA0A 5HPOA 5ICYB 4IU2A 3QS3A 3NIFF 1JZ6A 4L37A 2CLRA 3AQYA 4PP2B 5DJXB 1CL7L 3GRWL 4K07A 3INUH 3T3PF 3IJ7A 2RJMA 2IAND 4XNZB 1X5AA 2ZPKH 1HSAA 5HGAB 3DJTA 5DD0H 4J3OH 3VSQA 4YXLL 3MBEA 1U3JA 5FAAA 2Y7SA 2F7RA 1CYWA 1ED3A 1TQCC 1KCKA 2JJTA 3EFFB 3AWGA 5E7BA 2J57A 2F19L 3T3ME 1KGWA 3QQDB 1EDQA 5E9DB 3SDDD 3WS6C 1OP5K 5KTEL 3S37L 3TYGH 3GS7A 4G80A 3QUYB 3UPCA 4Y5XC 4YLBA 1BAFL 3UIZA 3HNSH 1VENA 1I7RB 1VFAA 4LSPL 1YY8A 3LZFH 3HAEG 5F6IB 1KEMH 3FQNA 3HC3L 2D3JA 3WJLC 5I5MA 4M1DL 5FFGA 4WO4A 1E2ZA 1ZT7B 1CF8L 3CU7A 3HI5H 4ES8A 5E23A 4PJ9A 4NQCB 1YHPA 2DQUL 3ARGC 1A1NA 5CJBA 5ESAB 3IE4A 1J0HA 1Z3GL 1ZJBA 2H1LM 2E74C 4ANUA 5DU7A 2G4EA 3ULUL 1I8IB 3QWRA 4MJ4A 3T77A 3T0BA 4EO5A 3QT2A 4DUVA 3ECBB 1JUFB 2ILLA 2DLGA 3DO7A 3D08A 4X9GA 3K72B 4IQHA 4HIEB 1B0GA 1NGYA 1W6LA 3O2WL 3P2DA 5GGSA 1ZOXA 3QUZD 3L1EA 1FIEA 3K5SA 4XPAH 5FA3A 4YLCA 1KBPA 3FQRA 4AWJC 4Y16D 4OCNC 4Z7NF 3ATFA 1QACA 3I3EA 3UGEA 2V5SA 3M1CA 1HYSC 4R7NA 5E70A 1WQVT 4HFUL 3EYOA 5EORH 5SWSD 4XMLH 1OD9A 5EULV 4L18A 4G59C 2NX5B 3B9KD 2E86A 2MTAA 4UZSA 4ZD3L 4D0BA 4DKFH 1LLAA 3CNKA 4ODVH 1A7NH 4TM9A 2UWEE 3D52A 2JQZA 1KENL 2VABA 4WUUE 3B2MA 2MIZA 3BWAB 1C7TA 5JOEA 3HE6C 1FNGB 3KYMA 1S5HB 1UD5A 3G6JE 4WTWA 5HHPB 5HGDB 4RMWA 1CTNA 1SYSA 4NPYA 2XVKA 4NNXB 4Y4HB 5CINL 4LMQI 3U7WH 4P46C 3KPRD 5EZOL 3SDAC 1FYHB 3MRJB 2WQAA 2EIMB 1NEUA 3PIQB 4OLEA 1A5FL 2XG5B 3MJ8B 1DVFC 2TRHA 2VH5L 4ATWA 3ARDB 1UD4A 2AEQL 2BHZA 3F12B 3UJJH 3KR3H 4ZUSA 3QJXA 4MBOA 1BMZA 4R2GC 1H3PL 2X3AA 3QARA 4JFFD 5JDSA 1FV1A 1DJXA 4GUOA 4O9HH 3EOTH 1HDMA 3AG1B 1TYRA 2BLFA 2H9GA 3LDBB 3UO1L 3B5GA 1M9WA 1EHLL 1XR8B 1WWBX 1SGKA 2PYED 1ZEAL 3AACA 4XBEL 5ACLA 3RWEA 1IGYA 4WFHE 2BY1A 5KW9H 3C2AH 3AUVA 3CXHK 3Q3GA 5F9JA 3STLB 3TOPA 5IMKA 3SY6A 1K8DB 2BP8B 3FT3B 2K8MA 1DUZB 2H2SD 3OBAA 1I53A 3CMGA 1ORQB 3KGUA 3V7AG 4G6FD 4KXBA 4G11A 1LO3L 1XGZA 3PL6C 3MRBB 3SE4C 2DM4A 3ALPA 5H8DA 3KPSE 4ZT1A 1MNUL 1OSPL 4MCZA 3L9RB 1JI2A 5DZAA 5DMGD 4BGLA 1E0OB 2BINA 1BGXH 3CZGA 4AYGA 2XN2A 2BK8A 4JRXD 2VLKB 3UP1A 1IGFH 2X1PA 4PVBA 4QO1A 4A1RA 2C7FA 4GRWE 3PABA 5CILL 4PY8J 5EBMB 3LOWA 3L4WA 3B9VA 1EHAA 3UEQA 5F89A 1KGUA 3T0EC 1MEXL 5AKSA 2BOCB 2DQFB 4G8GA 3V4UH 1IQDB 2VZTA 3DDFA 4MNQD 4ZW5A 1I3VA 4QOKD 2IJ0C 2GJ6D 2ZQKA 1WIUA 1D9KD 3MRKA 3VE0A 3H2QA 1DEEB 4G9FE 1TKWB 5GIRB 1JHLH 5ESQB 4CMMB 4RMSA 3MRFB 3OZ9H 5DFVD 3N91A 1CK0H 3PHSA 5I24A 1O6TA 2E7MA 3QEHB 3FUEA 1TCRB 1CICC 3T6QC 2GYSA 3DX2A 2FRGP 1XH1A 4K0OA 4Y2OB 4N0CC 2ZYSA 3O2VH 5FYJH 3AXIA 2AGJH 3PAUA 2B5IB 5D7KD 2YD5A 4FFYL 3MSPA 3NSYA 2C3HA 3CXFA 1I9IL 2CCVA 4QHNA 4QTIH 2YPVA 5AVXB 2HKHH 2NZIA 1R4XA 1T7YA 4LASL 1E43A 1XEUA 4OIFA 5GS0H 3JXAA 1RZIB 2EDDA 4PW9A 4KX9A 1OAZL 2HMIC 3HR5B 3RVTD 4NCC1 2C3GA 5LGHH 4EF3A 1CLOH 4HIQA 5CCKL 4N0FB 2HWZH 1UFGA 2UXTA 3U9WA 1KB3A 4LHUA 5DRZB 3UTSB 3FK3A 2C8NA 4OZ4B 1XH2A 2IDTA 1D3CA 4PLKC 3PWPB 4NO2A 1UZ8B 4GAYB 4Z7VA 1XBDA 4W9LC 4FQJL 5I18L 3VW3L 3MUHL 2Y5TB 1E5ZA 3OMNB 2I27N 1KB5H 5JQ6H 3F64A 1BMWA 4NUGH 2UY6A 1TOXA 2UUDH 2X9XA 4XNDA 2QADC 4FNUA 4ZMZA 2YD2A 5IUCA 4BJLA 2ICWI 2NYZA 4DO5A 1EGJL 3AT8A 1S3KH 2VLJB 1Y6MR 3GXIA 1VZHA 3U82B 2VKXA 3W5NA 4DPBX 3V4PL 4N87A 1HWHB 2CO6A 1MY7A 1P5VA 1MQKH 1RH8A 2IWEA 3N1GC 1YMHB 4OJFL 4Y19B 1U42A 1J8KA 4MAUL 1RZKL 3NAAH 2AXHA 4J28A 3EBHA 4U1IB 2G2PA 1OW0C 1DN2A 4G9DA 4WSGA 1BOGA 2VTFA 4XAWL 1BQHB 4IBSA 1XX9C 3JTTA 3HZ3A 3PHQB 1UUSA 1AP2A 1U93A 4P2AA 5KUKA 3TEWA 3IJ8A 1M6OA 4JDVB 5FM5O 2EDYA 1FO0L 1JF1A 3FAXA 3ZE2E 5HHVH 4NKOA 2PXYA 5SWZE 3SODB 3H55A 4I1RA 3C9NB 3KBEA 4M43L 2BY2A 2AZUA 3QQ9C 2VWEC 4IGBA 1BFOA 4GQPH 4FQ2L 3UZVA 4PJHB 4UYPA 1NTDA 1A7PH 1XF5A 1N0XL 2EIZB 5C07D 3TBTB 1IL1A 1DSWA 1J05A 3AXHA 2NQDA 3LN5B 5GRUL 4AEIH 3AY2A 4TLUA 4BXSV 5J11B 2VM9A 4JO8A 4R96A 4N9OB 3QFDA 1G1OA 5GGRB 2BY3A 4TVPD 3RHWF 3I9GH 3FTVA 4EAEA 1GAFH 2JKSA 4X6EA 3CFDA 1CGYA 3UXFA 2AEIT 2LAGB 3VMNA 2VOTA 4FCAA 4C47A 2V6HA 3KVQA 2WYIA 4GSQA 5F7UA 1DANU 4DIXA 2DDQL 1SQMA 2P45B 2P8MA 4ZFOB 2BZ7A 4OFQA 1TO4A 4TNVK 5T5NG 3ARBB 4JQIH 4FJZA 4P4RB 1CD1A 3B3BA 4A7GF 1CYGA 4OIBA 4I48A 4K5PA 4QHMA 3O4LB 3UDWA 1SJXA 4TQ8A 4WDIA 5HHOD 4AT6B 1KIPB 4BYHA 5TGBB 3FT4B 2JCCE 1T6VN 4PRPD 1S9VA 2VXTL 1NIFA 1S7SB 3SEPA 3TWCL 1FZKB 4NQVA 4N0YH 4F7EB 3NTCH 1TJHH 2CHDA 4JREB 4U6XB 4OI9A 3EGSA 3Q5YA 4UAOB 3UTTB 5ID0A 2DIJA 2WWNA 4PJEB 1JV2B 3S8FB 3RPIA 5BRZE 5D1ZD 1D7FA 5DK0A 3CQFA 3WN5A 2QR0A 1HXYB 4H1LH 3RDTC 4AEHH 1WHPA 2C34A 1X5LA 1EANA 5MEND 4P4KA 1P53A 5IK3B 2N0MA 1YLBB 5D1QC 3ZZLA 3L1GA 3EYSL 2F54E 3BH8A 2O6CA 2H2PC 1CPUA 2QQQA 3BGFC 5I1GH 4NUJA 43C9B 4Y7OC 4C55A 1OO2A 2FECI 2QKIA 4GG6B 4JY5L 5C3IA 4MVBC 2EDEA 3T2PA 1W72B 5IQNA 2JI1A 3NGBC 5HHQA 1NPUA 2PABA 2X0WA 2OP4H 2YEZA 5D5MA 4HH9B 5IQLA 2V2WA 4UTBA 1Z1WA 5JNYA 4MJID 1GZPA 1QNIA 3H9SA 2XYBA 2Z7UA 1U95A 5IQ7H 2VMEA 3ARYA 4A7UA 1DP0A 3CV5A 1S7WA 1WCQA 1S78D 4WUUA 5DHXB 5TPWH 3QBTB 4P99A 3WEMA 1I7TA 1G9MH 3AABA 4PWJA 1OTTC 1OEZW 4TV3A 1WUNT 2GUOB 4JO5A 3A67H 1OB1B 3QJHB 3JWNH 5E2JA 5F1SA 2CPCA 1OSYA 2DYSB 4G71B 2BNUA 3T04D 2PPCA 4HPHA 1WD9A 2YD4A 3P69A 4P8QA 1ZGLP 1W72H 4NRXB 1TENA 5DF0A 3VXRA 2HFEA 3U1SH 3LIZA 4GO8A 4FTVD 2BWIA 2QVIA 4PV9B 1J5DA 2Z7YA 3BOVA 4NENA 2VDML 1O9WA 4ATTA 3NOIA 5LBSL 1BBDL 3MRHB 5B1CA 3KYOB 4KDTC 5DUPH 3VFTA 3LPWA 5IGXH 2QQLH 1WZAA 1AZZC 1JGUL 1WBYB 3P9MA 3MUY1 3QDGB 1PZ3A 3MV9E 2ROXA 4MCMA 1TQCB 5T1LD 4FQCL 1DFXA 2X1QA 5DGRA 1FL5B 1JYVA 3OJMB 2CR3A 2AW2A 3O3AB 3BQUA 4OLZH 4LCWA 4PRHB 2ZG3A 1T03L 3IGFA 1PX3A 3KPSA 4E9LA 1MG2C 2W0FA 1F90L 4Y5XB 2EYRB 1ZE3C 4J4PC 1QAWA 4MWFA 5BS0E 4HUWA 1FA4A 3GSUA 2AEPH 1UM6L 1JG9A 2WAQA 2VH5H 5BZZA 4KI5E 5E2WH 4NPKA 2C9VA 5SX4I 3UTZB 5GRXG 2GHWB 3VFNA 4Q9QL 3QDGE 4IJTA 3ARGB 1AGEA 3QORC 1S9KC 5FUOH 4KJPD 4RMBA 4XN9A 5DURB 3CZKA 3ZN6A 3MBWA 2YWZA 3QULB 2AMUA 4K94L 4DHLA 4OLUL 1G9NL 2P8PA 3LEYH 4KPHL 3SYOA 1MW0A 4HK3J 3DOSA 4NCC2 4PRDB 4MRBA 1IAIL 2ETWA 1ZVSA 5JYLA 3IS0X 3KEDA 1MHPL 3W81A 4PV8B 5KOMC 3QUKA 1G4MA 5D1XC 5D2LF 1LQSR 4F8QA 2OSLB 4UZUA 4WAFA 1RFDH 2FAUA 5DUMH 1JBJA 2NZ1A 2W80C 3GDCA 2IMNA 4MA1B 3QI9D 1KGCD 5L88H 3PG2A 3VFRB 4UU9A 2VMJA 3ZHNA 1B2WH 4QT5B 3DX6A 5HGHA 12E8H 3WN6A 3II3A 4DT2A 1JZHA 1HJCA 4PS4L 1MCHA 1XQ4A 4R83A 3O3DA 4XPBH 5SX5H 1QI5A 4MX7A 3HE6B 2TAAA 3HMXH 3QRBA 1V3LA 5E94A 4TUOB 1ADQH 1BF2A 1EZSA 5FYJU 2G2NA 1X3DA 5EZLB 5IMLA 4WFED 3S35L 4K3EH 4E41A 2GCYA 4P46B 1N0LB 3SDAB 1RAMA 2AABL 5GRJL 4YDKL 1KTKE 1YPZA 3JYCA 4JM2B 4N2AA 1DVFB 1FUNA 3TCTA 3ZT5A 2XWTB 1NBVL 1ITCA 5HI5D 3K8MA 5JZ7C 4IU3B 4YDVA 3PP4L 3PWJB 1DBML 3WIFA 1KLUA 2D0FA 4R2GB 1E5YA 3BPCA 3ARQA 4IDJH 1F58H 3U4EA 3BD4A 5KSAD 1ZVNA 1ODAA 4K8RD 2RHEA 1L3NA 1W0WA 2Z1KA 1C8QA 2OQJB 1Q9WB 1RZJC 2XXMB 3BCDA 3ME0A 3RVUC 1C08B 1PMYA 3L5HA 2NXYD 1PLGL 3GZQA 2H6OA 3Q1EA 4UQ2B 3FT1A 2BM3A 5DJDA 3MA7B 1ECYA 1HH6A 3D34A 4BGDA 2E7HA 3QS2A 3SKJH 1DLHB 5DJAB 3CZFB 5AZEH 5CJOL 4HHAA 4IBQA 2V9QA 4P59L 5IBLC 1AOHA 1OGSA 3DX1A 3AU1B 1IB5A 3NZ8B 4LHJB 3IDGA 3PL6B 3PFUA 2HYMA 2LAAA 1JGDB 3F7RA 3FCSA 4M02A 2XN9A 3Q8BA 2VO8A 1JDDA 3RL2A 3ZKMC 1KELH 3C5SB 2XV0A 4X7TA 3KCWA 4OIIH 4AQZA 4EJ1C 1JYWA 4MMXA 1MELA 4PWHA 3TV3L 4P5TD 2VXVL 1A7RH 1KN4H 4JFED 4QEGA 4NIKB 1B9KA 1U8MA 1HHJB 1PBYA 1WCBA 4KVCH 1UOKA 1FP5A 4J27A 3FAWA 4LSTH 3BSHA 4JKKA 3S36X 5F3HA 2NYYC 3QUHA 1XSIA 1WA2X 5IESL 5BRPA 3MJGX 1U8KA 2Y69B 3U9UB 2D2CC 4E9YA 1RZ8B 4AJWA 1PEZA 2E9JA 4CRPA 2J5WA 3QEUB 1CFSA 2EKSB 2B1AL 3OAWA 1JRHH 1GGUA 1I85A 2I24N 1YN6A 4HS8L 3EDKA 4L3EA 5GRVK 1MCOL 1MCEA 3GS4A 1SDDA 3IU3A 2XA8L 4R97C 2AKRA 2J72A 2FX8L 2KUTA 3IB4A 4PU2A 5I16B 2CRZA 4HUVB 4QRPE 4XNUH 5D4JA 1E9OB 2WPGA 4RWYH 3SGKC 3WFDL 4PGEB 1GHFH 4N2HA 3WIIL 3OKOB 1VEMA 4LSDA 4IKIA 4U1MB 2FH6A 4X7FC 4D7PA 4KHXH 4GH7B 1R5VA 4H44C 2E7CA 1QQDB 5EF2A 3BVTA 1WBXB 4X7SH 3C8DA 1Q9OA 5EEVA 1J9CT 5IMOB 5E8EA 1N8ZA 2O1AA 2P26A 3FFCB 5H2BB 4RA0C 3M07A 2DN7A 3T0EE 3ARSA 1ZLVK 1E4XI 3GXNA 1TYEB 3WTSA 1BA9A 2ADFH 1J8HE 3L3HA 4L2YA 1HL5A 1FBIL 2W9DH 3HHRB 1BXXA 2QPDB 1RIVH 4BHUA 1KJ2A 5HDBE 5LXGH 5CIPA 4YL4A 3CK0H 3ARPA 1WP6A 2NW2B 3VI4B 3OB0K 4JBSA 3R8BB 3MJ6A 4FEIA 4N0RA 2IBGA 1TJGL 1HINH 4IRSD 3UPRA 3FU6A 5JIKA 3H2WA 4WSKA 3QQ3B 4I4WA 2HTKD 4BK5A 3FONA 4APXA 1CDIA 5ERWA 4BZ2A 1JDCA 5GRWA 3I3BA 5BRZA 1VIWA 5HHNA 1LP9B 2Q3AA 5GJTH 2LR4A 2Z4QA 2WXJA 5AVRB 2VDKL 3RTQD 1P4LA 4GIAA 4PVLA 2X7LB 1JGIA 4GXUM 4AJ0A 3FU8A 3FU7A 3KH3A 2DMGA 3NSFA 5HPMA 2WTRA 5K1VA 1NCHA 1OF2A 1RUMH 4A55A 2EIEA 1NAKH 4C56B 1QRND 1H3XA 4DZBA 4GOSA 4QYOA 3BW9B 4B3VA 2OMXB 4OF0A 3BISA 2F5AL 5T1DL 2OX5A 3B2DC 2BOBA 3LRGA 2ALAA 3B1TA 5DVOA 3U6RA 3C6SA 3C5ZA 4JFQA 4FFWD 5MERA 4HS3A 2WXNA 2AEWA 2VN4A 4N68A 4WW2F 1BHGA 4KZDL 1T83C 2OI9C 4LHQB 1A66A 2D4FA 3QAZB 2E59A 2F1EA 3JV0A 2YN5A 5K59F 4AVKA 2CUHA 4W4OA 3WFEL 4ZDHA 4Y2DA 3VNZA 5IROA 2UZXA 1IC7L 3QO0B 4G8EB 2GFBA 5ADPH 1ZLSL 4X9FA 1FGNL 1ZHKB 1NCWH 1NLDH 4YHOL 5I1AA 3QZWA 2EVFA 4OCRL 3CFKB 5HI4D 2AITA 1YEJH 3MLYL 2JXMB 4IOIA 2X6BA 3IMTA 4KJWD 5FYLH 3QJFA 3MUUA 3GHEH 3MJ9L 4O5LH 4OCYL 1BMGA 2B1HL 5LAXA 4FTDA 1DVXA 1A6VH 3AG2B 3DK0A 4Z7WB 3MRRB 1AGFB 2DJMA 1JWUB 3T71A 4FZEL 5CZKA 3MLRH 3LNIA 3KAAA 4NC1E 2R4RH 2B59A 3E0GA 4JPWH 2AK4D 1DJZA 2JELH 5LBVA 4JRWA 1S7UB 5EIIB 3IJHB 5EU7C 1F1AA 4A2GA 3MA9H 4N1EA 4ZFGL 4JPKH 1QBMH 3J2PA 3DO3A 1WAEA 4A2LA 1MH5B 5J89A 5DZ9A 5MEPA 4J6RL 5KVDH 3PV6A 1A6PA 2DLFH 2WBJC 2NXZB 3VGBA 5CNHA 4E9XA 5DJ8A 2AXFA 4DGWC 4JKPL 1Y1UA 3N50A 4G7SB 3CJJA 1SXSA 1UC6A 2HT3D 3VFSA 3GSVA 1G7JB 5FEBA 1NFKA 2K6YA 3FXIC 3MCKB 4FFTA 4C4UA 4GLRH 5BS0A 3DUUA 2WVVA 1OAYH 2PN5A 3NDZE 2WXFA 4AVJA 5TE6H 3MLVH 2YGOA 3KDMB 2ID5A 1SVBA 3MXWL 5E56A 4YPJA 5MI0B 4UYQA 3WNLA 3KLHD 3GSXB 3RWCA 1DQLH 3AUWB 3COOA 5IBTL 1O6VA 3QE5A 1DBAL 1Q0XL 5CR8A 5B1KA 2OTWB 1ETZB 5A16B 1CGTA 1OGAE 1NC4A 1F5WA 5FPIA 1VKXA 4LGRB 3JV4A 3RDTB 2VR6A 1UWEL 4QAMB 1SEQL 5E1AA 2CKNA 4DP2X 4QI3A 2YQBA 2MHAB 4X5WA 3TM6A 5D1QB 3G6DH 2NZ9C 2Q2LA 2OSXA 5EEYA 2W9EL 4NQUA 2HT2D 3MOQA 3BGFB 2A38A 1UM4L 3BKJH 1ET8A 1M2OA 2VDOL 4P07A 4X4MA 4O4YL 3T65A 1UVQB 2APFA 3HBPA 1IE5A 4FS0A 1FG9C 4QXUH 3VYPA 4KJQC 3NGBB 5FYKL 5FUCC 5GGTA 2YN3A 3CUPB 1PAZA 4DGIL 4RRPG 4BSVA 2W0LA 1BQSA 3CVIH 3K2IA 2R2BB 1A0QH 2JE8A 3LRHA 1SBSH 3NFSL 4H0HB 3TVMA 5EC2A 1NBZA 3LIUA 5JXED 1BPVA 2MWCA 4M62H 1A4JB 2BFGA 3MGOB 4ZQTA 1K8IA 1O9VA 2XZQH 4HWBA 3BKYL 4XVSL 4AI7A 1Y18A 4PRNB 4Q97A 1U41A 1MCPL 2UX6A 3QFJD 2VZVA 3QIWA 4ANVA 1G1CA 4OZIE 5IVXA 2ZAGA 1E8ZA 1S9WA 2WSDA 3MRPA 4KKRA 4NFDA 5J6SA 1JHTA 4RRPM 4WFGD 1HSAB 3ZMEA 3D39E 3CMOL 1HHIA 4S1RH 3AVEA 3QCTL 1D5IH 3RL1A 3O3EB 3DRTB 3ZKNC 5D7JC 4NUPA 3O9WD 1KC5L 2KBGA 1ED3B 5JXAL 4D2NA 4XBMA 1MF2H 5DS1A 5C0EA 6FABH 3HG2A 3NJVA 1KFGA 1B0RA 4S10A 5F44A 4DGVL 5IFHH 1I8UA 1NLBL 1WC7A 3FN0L 4G80B 1VZGA 3EW3B 3N85L 2IQ9L 1MIML 3L08A 4LRIC 2LQRA 5G2NA 1JF5A 1O5DT 4RAVA 5K9QG 1VFAB 5FGBC 3ZBMA 2ROYA 1YY8B 3WXWL 1KNOB 3D4CA 2ENSA 2EYSA 4H8HA 4Z8FH 5LAPA 1E5BA 2C3XA 2EYTA 2I5YL 3SE8H 1MXGA 2WINA 3WJJC 2WVSA 2W60A 2JKIS 2BVTA 1CN4A 2IQAB 5KS9E 2CNZA 2OLDA 2Y72A 3LN9A 3VD4A 1XL4A 2V2TA 2G9KA 3CFMA 1T0PB 4EUPB 1E4KA 4GT0A 4F20A 4XO8A 5FYJD 1F11A 2DTMH 3DO7B 2YHGA 3ILQC 4NKIH 1TQUA 4UIMA 1N7ML 4MS8D 3N9GH 1L9NA 1G7PB 1NGYB 5AOIA 5GGSB 4OUUB 2YARA 1B4RA 4FP8H 1FVCA 1NKOA 4FMVA 4N2OA 3QORB 4PBDA 2DKMA 3HLAA 4N1CA 4R7NB 1E8WA 4OTXL 3EYOB 5FHBH 3DMMD 2A9DA 2W59A 4D0BB 2VQ1A 1DVZA 5F88A 2OYKA 1L9PA 1QW9A 5K1NA 1KCVL 1MWAA 3DXAE 4X4KA 5CFAA 5HHMB 2QQKH 1MI5A 2CK0L 3KYMB 1G1KA 4B9JA 3RILA 1QR4A 2MJWA 5FHAL 1SYSB 1QWUA 4NPYB 4NKDA 4HT1L 4MXVE 3DBXA 2YD7A 5EF0A 4M5ZH 5AZ2L 2Z91A 1FPTH 4B9PA 1CZ8L 4ONGH 4WWKA 3ZJAA 2VXVH 3GGWA 4HWNA 4M8VA 3RVXD 1NMAH 3UTSD 5JPMA 4LOVA 5JDSB 1FV1B 1WF5A 3A0OA 4JO4H 4LESA 4JFUA 1HDMB 1L0PA 2H9GB 3L5WA 2E5EA 3D12B 1MLBB 3I9IA 4LL4A 4PG2A 2DKSA 1AQKH 4O58H 1AE6L 3QXUA 1JHKH 4BA8A 2B0SH 1IGYB 5K5YA 5D1XE 1J12A 3Q3GB 4E5XA 5HHME 5IJCC 1KXTA 4M9PA 4N90D 5IMKB 4XP4L 4AKOA 1RUKH 3OM3B 1QLEL 2Y7NA 3QWQB 4HSAC 4QUOA 5DD3H 3SGDI 5INDB 4Z7OB 3H1ZA 2G3ZA 4BZ1L 4HS8H 4PFEA 4QHKI 3KGSA 4JX0A 4M8QB 2VR4A 1XH3A 2WXLA 4RGOL 3QIBD 3KLDA 1GYVA 4MCZB 4Y19D 1R19A 3LQAC 3HNVH 4U3XA 4ZMXA 3OXSA 1DBJL 4OF7A 5BJTA 3ZL4L 1NCBH 1JPTL 2C3WA 3S2CA 3GZPA 1RUPL 1UH3A 3OAZK 1QHPA 4APQA 2OJEA 3HFMH 3QDAA 3U48A 1A9VA 2DWXA 5DC2A 1LMIA 4MQSB 1QYGH 1Q0EA 5A2CA 2CA4A 2QPUA 1KULA 3ZUNC 2Z7ZA 3BGMA 4Z7UA 4OB5H 1TQTA 5FW8A 4G8GB 1RZQA 4Z0XA 1KWKA 3P73B 1RZJH 1OAXH 4M7JL 1ZXKA 2ZP8A 3F83A 1NEZG 3G3LA 4GJTB 4M7LT 1JGLH 5EOCJ 5SV3A 2ZUQC 3OPZL 3HB3C 3MRKB 3VE0B 2FGWL 3IFNH 5A40E 5HYJB 4URKA 1H6UA 1I85C 3FO9B 2AI0L 5I1HH 4KHTH 3VGFA 5J6GA 4RA3A 1RURL 1T4KA 4TN9A 4UQEA 2FJUB 3HE7C 4WTZG 3H3PH 2ZOOA 1LHZA 1KBVA 1B6DA 4CSSA 4NFBA 5LN8A 2Q7AA 1IQWL 1JS4A 5J5EA 3D3VA 2ZNXA 4ANWA 2Z93B 4H8VA 2R0WL 3WIHA 4QHNB 1GS7A 4ALAC 2HH0H 1P7QD 4LLDA 5CJXA 3ARBD 3FTWA 1GGIH 4QRBA 2D0GA 1D5MA 3IDJA 4C59B 2PO6A 2OYLA 4AV4A 1LO0L 4HIXH 3D2UA 4KKCC 3U9PL 3WHXB 1GC1C 1NFDF 1MW2A 2VKWA 3ZZQA 4QTFA 4RQQB 5HYJE 5CN3A 2N01B 4RISL 4LHUB 1I1AD 2JJUA 5HYEA 1RK1A 5AW8B 5EFIA 5JQHC 1U92A 4NO2B 3U36A 5LVEA 2OM5A 4Z7VB 4MMZA 4FQHA 4J3WA 5FM8A 4BK5C 4JQXC 4MDIA 3HZYA 1IKNA 2ESVE 4DKDC 4M5YL 4AEEA 2F8XC 2UY6B 2J71A 1UT2A 3MV8D 3SGJA 3ZTNH 1WFNA 1IZJA 2YPVH 3QIUA 5DSCB 1ZGLA 1ASPA 1G84A 5DQDL 2WVUA 2YKLL 1O5PA 1X7TA 2CIKB 3QJVB 1PG7W 2E4FA 4RDQF 1WZMA 1U8NA 4ZSOB 2H7WA 1OHQA 4B0MM 5FW6A 3UYPA 4OCLC 2E7LC 2QMJA 2CO6B 4OGXL 4QNPE 1S9XA 2CO2A 4WEBH 4EN2A 1GGTA 3WBDA 5B8CA 3CGTA 1GR7A 1LO2H 2WZ5A 5D7EA 4CVZA 3TTYA 4WJ5B 1AGCA 3WO3B 1ZANL 3B6SA 4KXCA 1RUQL 4G9DB 3ULUD 2YSSA 1BOGB 2EXTA 4GO6B 4PJ8D 5HJ3A 2ZX7A 3JTTB 2ED6A 3BHBA 2YA1A 3O6KH 1M6OB 1A3LL 1LE5A 1JF1B 1IV8A 2ITCA 2AVFA 3IS1X 4NKOB 4OV6F 4Q4IA 4X4ZA 4M6OL 3REVB 5IROC 3APFA 1ZS8A 4V1DA 5KJRH 2NR6A 4ABUA 4PCYA 3D0AA 2BRRL 3CBRA 4IGBB 5CSGA 1BFOB 4ZSOE 3A6BL 3FQXB 4PRAA 4YNYA 1ZK9A 4P2QA 1F8TH 2E46A 3R0MA 4JG1H 1XF5B 4OLXL 4PJBE 1K3IA 2OI9B 3I84A 1GA2A 1IL1B 2WD0A 2XXGA 4LMQE 1J05B 4U1LA 3EYFB 4HOMA 2BH0A 4NSKA 2FUQA 4R96B 1XB3A 3TWYA 3QR2A 1NFIB 3QFDB 1L9MA 2EO9A 5H35B 1BZEA 3D85D 1FFPA 4UOQA 4OZIA 3GYRA 5C0FB 1UXMA 3CFDB 4X6EB 3ABGA 2VRAA 3FUMA 1CL7I 4M6MH 1A6UH 2P8MB 3D48R 3GSNA 4JAMA 2X41A 5EZIH 4AGMA 4DKEL 3ARFC 4XVUC 3G7TA 5E7FA 1CD1B 2Z8VC 4NJ9L 5DJ2A 4P2OC 5AALA 1IC4H 3RY4A 4I48B 2EECA 1A64A 1JPGB 2PW1A 2WBKA 3D69A 1B88A 3ZE0B 4WDIB 5FECA 5BOPA 4XRCA 3F7PC 2X40A 4O2EA 1S8DB 4K23H 4PCTA 1S9VB 3I75B 3WUWG 4JGMA 1G7HA 1S5IH 5D7IE 4KKQA 3QZNA 4ZO6A 4S1SH 2WBJB 5K69A 3ARWA 3CZEA 1FLRH 1OAKL 2WWOA 2Y6TE 2QSCH 4PJDF 3EGSB 1AR1C 1VEOA 2JB5H 1RZPA 4GP8B 4H26B 5ID0B 5JW4R 4HWZA 3W38A 2FWOB 3GK8L 2JKTM 4ZNCD 3RPIB 2VXQL 1J5IA 5DK0B 1XHHA 1UGKA 1V7NH 3WN5B 4P9HL 4EDWH 2QR0B 4UZGA 5JW4M 1QTSA 3DK2A 4CW1A 3VDAA 2A77L 3PWVA 4UNVA 4LSQL 3ZE0E 2HTLD 4M00A 5C0RH 3GBNL 1J0JA 3BH8B 3LRLA 4JZJA 5EU7E 3KBHE 4J12A 5CJQH 3ULVF 1HX0A 1B0IA 5I28A 1E9QA 4TL5A 4XPFH 3UERA 1MFEH 2DWEA 2WUBH 3P30H 2VC2B 1IUZA 2YZ1A 2YBRB 3WEBA 5D5MB 5TF1L 3ELAT 2YMXH 5JNYB 3CVDA 4XX1E 1FZMA 4JFDE 1U95B 2FWLB 1OP3H 1P9MA 4Q58C 3RIKA 4C57C 1YUKB 2ZCKH 4YDIL 3Q6FB 3BZ5A 3WXWH 2P5WD 1I7TB 1AXIB 4WU5A 5AVWB 3KVPA 1E42A 4MA3B 4XVJL 1JD9A 1A8ZA 4XZ4A 1TETH 3BP4A 3RGVA 3K71B 3V5DA 3SKMB 1UB6A 2VZSA 3HBGA 1KY6A 4CNIB 2C1PA 2QHRL 1H8NA 4ICXA 5IP4A 1FLTX 2R1YA 2FNWA 4JB9L 1NCGA 1I1RA 4O02A 3VXRB 5AVTB 1AOZA 3UADA 1WFUA 1TEGA 4OCMC 3AC0A 4UTBH 3CCHA 4B53A 4GXVH 4JM2D 3HEIB 4NENB 3ECQA 1PCSA 5KJ7E 5LWYH 5I8KH 2X09A 3M86A 3VFTB 3DTDA 3NABH 4OD3L 4RGNC 5JPNA 4M9OA 1MJ8L 2DI8A 3FTYA 2EC8A 2LLNA 4ZW3A 3FH5A 1IMHC 3TJEH 1T89C 4IRZA 4LEOA 1IRAY 4AOFA 3BN3B 2DD8L 3WD5L 1OPGH 3O11A 2F7IA 3ZQ9A 3H8NA 3UBXI 3BQUB 3S5LG 1QSEA 2EDOA 3CSFA 1JZEA 3LIZH 4WJG3 4CAGA 4K5MA 2FQEA 2P80A 5TE4H 4PP1D 5DO2C 1NMBL 4W1TA 1JAEA 5HDQH 4JPIA 5EU3A 1GGCH 5I8OL 3FFOA 5F96L 3F8UB 5JHDD 1IBGH 3TBYA 5F1OB 4X80L 1CXEA 1E4KC 3R8QA 4A04A 1RV6X 2OW7A 3GSUB 4HUWB 5BW7A 5C6TL 4Y1TA 3QEQD 1BXUA 4FHJA 3NIDF 4JY4A 4ZPVA 5HI3C 2WLNA 4OT1L 3VFNB 4AYID 2MKLC 3W0WB 2E56A 1VADB 4A2EA 3AT0A 2PR4L 3MBWB 3DOIA 3QDJE 4I9WD 2YD8A 2P8PB 3TC9A 4ISVA 4XHQA 3J7HA 1PZUB 3LKQA 3GC3A 2XN0A 3HBZA 2H45A 4KQ4L 1U36A 1TVHA 1KWGA 4NAQA 2HPOA 2LU4A 15C8L 1QNZH 2AXWA 3QUKB 4HJJL 4XVTH 4UTCA 2XXCB 3SBWC 5FFOA 4GP5B 3BAEH 3QISA 4A63A 1TLMA 3Q43A 4H8UA 1S7VA 4Y4FC 4XZUA 3VB9A 3W0WE 4AXWA 1P6FA 4UU9B 3P1VA 1M7XA 3DX6B 3ULUF 1I1FA 4LEBA 3KPNA 4YSTA 5KVFE 3S36L 4CN4A 1PNDA 4NWTL 1Q94B 2BS8A 2E75C 3O3DB 1QVOA 3EJYC 5E94B 5JPMC 5A2LH 1YRKA 5HYSG 3FQTA 3EO9L 5IMLB 1BVZA 4E41B 4ZYKA 2FTAA 5DEFA 1P1ZA 1Z5YD 1BAGA 5IW3A 4Y0GA 3IU4H 1P6WA 3MCG1 1YPZB 2J88H 3ULSA 4WHTA 3L4UA 4L9DA 2YXWA 1OXYA 1Q4NX 3LKNA 4DP6X 4N9GA 3VU2A 1E30A 1NQBA 3WIFB 1KLUB 4Q9CA 3BPCB 5DC0A 5E8DL 5C97A 1SY6A 3RQ3A 1OD7A 3U4EB 3MTXA 2X1WL 1X9RA 3MR9A 3Q1SL 1W0WB 3EGXA 5BQ7B 3QXAA 4JHVA 2NY7H 1QFWM 1DUYA 4TNVF 4Z95H 4NWUL 5DJDB 3T0VA 5AWNH 5BVJA 1KYAA 2Y06L 3SCMC 4U6HA 1L9RA 1IQWH 4HHAB 3BYTA 1T7VA 4AW4A 4QF1A 4ZTOH 1RHHA 4LPWA 4ELMB 3IDGB 5K93A 3FCSB 4I77L 2XN9B 1BLNA 4NN7C 4YXHH 5CMAA 2BS71 1DSFL 1VB9A 1HWWA 1ET7A 2OR9H 2V5YA 2WK2A 5LDUA 3HAEB 1MAMH 2LW3A 3IDNA 4FYTA 2YXFA 4JO3L 4MMXB 1C5CH 4PGZA 4YOKA 4F5CA 1EFXD 2X4RA 4X50A 3W9DB 1CDYA 4R7XA 4DF9A 1ERNA 4DP4X 1MFDH 1QLFB 2C4FT 3FQWB 1I3GL 2PETA 1MWAL 2VR3A 2VGLM 4M5YH 4KGJA 4X8JA 1JWMA 2QVTA 3U7YL 4PJBA 1GZHA 1MRCH 5K9OA 1U8KB 3IN0A 1UWYA 1CGSH 3DHJA 5DYFA 1ZTMA 4Q6IA 3HMWH 2ZUQB 3WLWD 5GZOC 5JHMA 3HB3B 1NH6A 2DQDL 2GB2A 4NZFA 3RZCD 4W81A 1CFSB 5I1JL 3LQAH 4AMXA 1INDH 2A6JA 4PLOB 5E0FA 3BVWA 4G83A 3P2TA 3HAEH 3BSZA 4Y4KA 1YN6B 4CN6A 4NBYB 4P5MA 4X2UA 4L3EB 5CU5A 3V0GA 2VAAB 3IU3B 3KLKA 2YD9A 2AKRB 2CDGA 5IFAL 3GLDA 3QDME 1WV7T 3UZEA 4TSBL 1TITA 2ZKYA 4C8XA 4BRVA 2PO6C 5IHZA 5ALBH 3HE7B 1PFCA 2OK0H 1OQOA 4G6JL 3QO1A 1RUQH 3CN0A 3JUZA 2HJFA 3WMSA 3UTPD 3FTUA 2WXQA 3BVXA 1UXSA 2EDLA 2HJKA 4HK0A 1UA6H 4PWIA 3UL4A 5CZXC 3CBJB 4MMZC 3L3HB 3RKPA 2DM3A 4AITA 5IVZA 3IWVA 4OJEH 2CMRH 3APCA 3D4GA 4LRNL 3QUXD 1MCNA 1T21B 1KJ2B 4B9FA 4P5KA 4HGMA 2NXZD 2DQIL 3UGXA 1X5KA 1NGZB 3UC0L 2H0EA 4JFXB 1SM3L 5DTFA 2VQ4A 3AS1A 1BP3B 3IPEA 4ZAKD 4JRYE 3UAJD 4W6WB 1GS6X 4WI6A 4IRJC 3PU7A 3LH9A 5FYKU 4CDHA 3SE3C 3FONB 9PCYA 4OF6A 3BCFA 1SUHA 4ERSL 4YHMH 4WNQA 2Z4QB 4ALAH 1P4LB 1TJIH 3UG5A 2P24A 4KX8A 1FORL 3FU7B 1O7DE 2KC0A 5HPMB 4Y7MA 5JUEH 2WTRB 4FRWA 5SWSA 5CFHA 4K7PH 3CAFA 1KJ2H 1U3ZA 3EYUH 4DZBB 1NPNA 3HLKA 4YO0A 4QYOB 5AW9B 4MQ7A 4MA7L 3RVWD 3VD7A 4A7GA 5JORB 4NQEA 1FQ9C 4X6CF 2BIMA 2BVUA 3AB0C 2AV1A 1EJFA 2BOBB 4A7SA 1RLBA 4WNJA 2ENYA 3UG3A 5I1IL 3PP3H 2VITA 3C6SB 1XMEB 4JFQB 3BMWA 3U6RB 5MERB 3RX5A 3X3GL 3HZVA 4P23C 4BZ2H 4WFFD 4X0KA 1P4BH 4IHBA 4JFYA 4D0DB 4J3VA 4HS6A 4NO5A 1CLVA 3OX8A 2XY2A 3DWTA 3KPRA 5CSBA 4JHAH 1N12A 1A6AA 3BAXA 1HILA 3JWDC 4JG9A 3D09A 4Y2DB 4ZDHB 5JHBA 1AH1A 1IFGA 5C0IA 3FNKA 1A9BA 2UZXB 3ZLQC 1EZVY 5EUOE 1CCZA 2GFBB 3P77A 4YE0A 4NRZB 5C0AA 2Z0BA 3WIHL 5ID1A 3KG5A 2R69A 3QZWB 1E5CA 5C08B 1ASOA 1CFQA 1VGEH 1RJYA 4GKNA 4WVRA 4EIUA 1YYMH 1KFAH 1XF2B 2Y24A 2EEXA 1NL0H 5JR1L 3QJFB 1J5OL 4RLDA 4ABVA 1PZ2A 3MZTA 5LAXB 3ILEA 3NZHL 1NCDH 5GHWH 4DERA 5KSBA 3HC4H 2YGQA 4OGAD 4QYAA 4PTUB 4K3GA 4AK2A 3MBED 3POCA 2B59B 4PGJA 1SMOA 2ZWLT 4F9PA 4KI1A 1YNKL 3QH3A 4X5XA 4K7PX 5E00A 4Z3TA 1FZJA 1MIEH 3BFOA 4AQEA 1U2CA 4OD1H 2JIXB 3ARFB 5F6HI 4RGMC 3TT1L 2F08A 3WFZA 4MASA 2ICWA 4LP4A 4HJGA 2G3NA 4I0KA 2WNWA 1V54B 4ZS6C 5F0JB 2ZP0T 4P2OB 4WY7H 5MEPB 3WS3A 3US1A 2EDTA 3OD3A 4IKNA 1AXTH 3PV6B 1UJ3A 5C08E 4NRYB 3PREA 2XXFA 5DJ8B 2AXFB 4MJHA 4NQDE 1AR2A 4N5EC 3GSWA 5E95B 3VG0H 2I9TA 2YO3A 1U8CA 1QBAA 2RCSL 4WO4D 2HX8A 1T66C 4PJCE 4ANKA 4AY0A 3MPCA 5JOPD 1Z9SB 4FFVD 4PJ9D 2ARJQ 2WVVB 1JZDC 2XTSA 5DQ9B 5F97E 1BYNA 5CBEA 4GW4B 5KBPA 1WBZA 5CR1A 4OJYA 1PY4A 1I7UB 3QWRD 1S7RA 2YAOA 1NAMA 3LMJH 3IVKA 3EHBC 1KCUH 2PCXA 3CX5J 2J6EA 3AREA 3L3OC 5BV7C 1NC4B 5BVPL 5IMMA 1OM3L 1VKXB 2G5UA 3JV4B 5PAZA 1TG8A 4QRQA 1KY7A 3PGFL 3WDHA 1OTUD 1I8LA 3QC6X 4R0LC 5E1AB 4ZI8A 1UD2A 4L3AA 3LEXB 2OZNA 1IO4C 4X5WB 1QOKA 5C09B 1Q1JL 5C9JB 3FW6A 2OMBA 4ONFL 5ECGA 2L4OA 1CJYA 2YJQA 4WEUD 3T65B 1IAII 3DO4A 3QG6B 5ITBL 1EERB 2A9CA 4NNPH 4HCFA 1IAKA 1BSIA 3JTSA 2X6AA 2XZCH 1QG3A 4BSVB 3OKMA 3F65A 1BZ7A 3H7BB 1DBKH 1K3ZA 1TIUA 3DETD 2PMZA 4HCGA 1CGWA 1X4XA 4LDOB 2VLRA 3ZDZF 3CC1A 3SDXE 4XAKD 1B0WA 3NJLA 1QKZL 4R4BA 3CFJB 5I75C 1QR1B 1P84J 3TA3C 1MFCH 1XF4A 3DVGA 4GMTL 3TA4D 5ADOH 3QZMA 1K8IB 4WK4B 1E90A 3HIZA 1KTDA 1CIUA 4H88L 4JO2L 5EEUA 3IGAB 1MXDA 3QIWB 1TTBA 5DJYB 5C09E 2J6WA 3VYOA 5IVXB 4N2BA 4OLWL 1S9WB 1U8PB 3UPAA 3MRPB 1NCAH 1JHTB 3KJ4C 2WW8A 4JCLA 4GUPA 1YMME 4J5VA 3K4ZA 5GGTH 3BH9B 3TCXA 2YPLB 3FCBA 3S3CB 4J2XA 3RL1B 1CO1A 3NH7L 4U1HA 1W15A 4L5FH 3FSVA 2Y1VA 4MXQC 2DQEH 4JFZL 3X2QB 3KXFE 1MREH 3UTQA 2AJZA 5D2LA 3FULA 3ZO9A 5C0EB 1AS7A 5C3TA 4UWQB 2G60H 1A21A 1B0RB 1OHZA 1K4DA 2EDQA 4P3CL 4Z77A 5A3IC 4HWBH 2UZYA 5CGYC 2O4EA 3WNIA 4OQ1A 2ZUUA 1YQ2A 4Y89A 1ULVA 4NOBA 5IHHA 5J3HD 4XCCH 5DO8A 2WINB 4PJGF 3SKNA 1DCEA 1CLYL 2D03H 1R33A 2H8PB 2W60B 1F0LA 1B3IA 2ZWZA 4HPOL 2YPLE 3L9BA 3VFUA 3O6FC 5EOQH 3UP6A 4M7ZC 4PJ5A 2PW2A 4JO1H 1F11B 2ZX9A 1KTBA 3N5AA 4FL4C 2NUPB 3LHPH 4RGNE 4UT6L 2J8OA 3TTSA 4I1PA 4JZOA 3UJIL 3KS0H 4NP9A 3MRMA 1XR9B 3HLAB 4KQ3L 4Z3HA 3KS0J 3GJFB 5AUMA 2F6AA 4KRPB 2FBJL 3QPQC 1N19A 2EC9U 4OZHE 2CH8A 1KSRA 4NGHH 4KK5D 4JJ5A 4NNYA 2L7JA 1IGML 4OZFG 4F8PA 2VQ1B 4OGQC 3BJLA 1KG0A 1UCBH 2OMUB 2Y06H 1XMWA 1NWPA 3LKOA 3IMUA 5E2UL 4O02L 4GUCA 3L7EA 4QRRE 1T20A 1AGDA 3GLEA 3FBKA 4F91B 1MI5B 2CLZA 1X5JA 3MLSL 5I6PA 5E99H 3ZYOA 1UHVA 2DQHL 5EBGA 3EOYG 2XKSA 2MRYA 4Y4FB 1LQBC 1HKLL 3DBXB 5GJSH 4PW3A 3V0FA 2ORBH 2Z91B 3RNKA 4OD2A 2P44B 4JN2B 3GJFH 2HKFH 3KWUA 1KGXA 4RFNC 2XPZA 1IILE 4WWKB 2F74A 3O0RH 3NCYP 1UASA 2IFFL 2R56L 4K73A 1YJDC 3VWJC 4JZNB 4LHUD 2ZOWA 5JPMB 1DTUA 4DVRL 2WN2A 1JZGA 5TK2A 2NNCA 4YDNA 4PB9H 5CCJA 2AK1H 3CZSA 5D1ZA 1HZHL 2NY5C 5FA4A 4JRYA 3OGCA 1FL6A 3H4FA 2GIXA 2DJUA 2P7TB 4NZJA 2GSGA 2PCPB 5C0ND 4FKKA 4LCIL 1C9SA 3T2NL 5BPPA 1AKPA 4H40A 4JFOB 2OTUB 2BSDA 4K5NA 5KVGE 3CFEA 2XVGA 4RMVA 4DGYH 4GYBA 3JWOC 4I0PC 1GPOH 1IC0A 4GKSB 2DEWX 5L6YL 4KBPA 2GK0A 4LLUA 5E6UB 4AQ1C 3SCMB 4MJIA 2OMNA 4FFZH 2FZ3A 4CJ0A 2NY1D 5EOCL 4G7VL 1EAPA 2WO4A 1HHKA 1HEZB 1ACYH 2ARJA 3AU0A 1E50A 5A6LA 5DK2A 4YSAA 3L1FA 2Z92B 1DQQA 1NMCB 1CS6A 3U0WH 4B9YA 1OE3A 3L45A 3DV4A 2QGCA 4Z7UB 1T1ZA 2PXYD 2ZG1A 2X1XR 1N6QH 1ZTXH 4Q9RL 2IG2H 1H8OA 3VXTB 2WHVA 2QGEA 4IGBD 5EU5A 5I8EA 3FTZA 5FKPB 2HXAA 2O5YH 4KJYA 4N85A 2EO1A 4MQTB 3WFHA 3AQZA 5D72L 3K6FA 3VM7A 1MNNA 3ZE1F 1HAWA 4L0PB 4FTVA 3OKNA 2BWQA 5EUOA 3WJMA 3WELA 1XBRA 2GT9A 4RFOH 2YRBA 3Q5TA 1MJ7L 4MNGA 5CM1A 3MUGA 5FYKD 1RUAL 3V5HA 5B38A 3PHOA 1JGEA 1HNYA 3FQUA 3MHZA 3UZEC 1E9PB 1KN2L 1MDTA 3FRUB 1LEKA 5J6GB 3NCFB 3M17A 2NMSA 2A9NH 3SDDC 5E8NA 1MZZA 1JZIA 2QT6A 5BOZG 3EGDA 1GJIA 4AKQA 3ZDYB 2K3HA 3D3VB 1QWHA 2VM3A 4FLRA 3ZIYA 3KH4A 2KPWA 3A6OA 4FQIL 1ECZA 4L8DA 3DSNA 5AOMA 2HRHA 5T1LA 5I1EH 4XP1H 3EYQD 2IPUK 4MB3A 1U58A 3IDJB 2X38A 2PO6B 2Z35B 3DVIA 3OKEB 3NCBB 3D2UB 2DEYX 2WMPA 4FNPA 5FO8A 4WW2A 2AXJA 2VR5A 2E9GA 3QCUH 4LBEB 4EPSA 1NGPL 1BQHG 5L2JA 4MAZA 2EH7L 5I1CL 4JKWA 4MZRA 5ITFA 4QRAA 5IW6A 1RK1B 4WEMB 1H8LA 1U92B 4ZK8A 4MMZB 5KANI 4FQHB 5FUZL 5DR5L 1A3RL 2YQ3A 5EZPA 4HJUA 4MDIB 2XVBA 4Y1AE 3HZYB 3ZX1A 2VISB 2OMZA 4FYRA 1A9EB 4NJAL 1NCOA 3ZMNA 5FB8A 3S3BB 3OJ2C 3FUJA 3QUZC 4PJCA 2KLSA 3ZDYE 5JW5A 3GWJA 1ZLUK 3OKDB 4Y16C 3FB8A 1HK6A 2GY7B 3W1ZA 2EVIA 1HNFA 3DPBB 2VDLB 3SQOH 1IKOP 1TEYA 2M1KA 3EJQA 4D8PA 4E42A 1U8NB 3HZMA 4IRJB 4NPJA 4MHHG 3GPSA 1C7SA 3B9KC 4LSVL 4P2RA 5F1KC 3U25A 3V6FA 1G9EA 2IADA 4PS8A 1MCIA 2EAEA 4OCXH 1JXKA 4P4KD 1S9XB 4PW4A 1XZWA 3SPVA 1MUJA 2PWGA 1KACB 1F13A 1UKTA 4QJ5B 1K6QL 1OAQH 4G5ZH 5B8CB 4CVZB 3UYRH 1AGCB 3FU0A 4ZUUA 3B6SB 2PNDA 4ONOA 4MZIA 5ETUA 1T3FB 5HJ3B 3BN9D 3CHXA 1QTYT 5DRNB 3BHBB 1U2HA 4ZZFA 4PJAF 1ZSHA 5ELIA 1QASA 5IBUB 3RFRA 4R5XA 4H1LG 4FGMA 1D2PA 3H9SD 5D2NE 2Q6WA 3RBGA 3AB0B 1X5YA 1AO7E 2R29H 4DPAX 4LNVA 1ZS8B 5FGCB 4K55A 3VGDA 4WUUD 4EXKA 4DFHA 1M2VB 3BSZL 3SJVE 5JMRA 2DQCH 4P2QB 4BZYA 1Q0YH 2XKNB 4YHLH 1IBDA 2BERA 5DUJA 2RMNA 1DR9A 3X3FL 3PYCA 2XLLA 1EO8L 2WWKT 4U1LB 1F56A 5CCHE 1FIGH 1V7MH 4HH8A 4EZJA 5IV2A 2Q8AH 1DJIA 1EZUA 1T7XA 5L2KB 1G5GA 2CGRL 2FEEL 1J10A 3KYAA 2R15A 3FF8A 3VXRD 4HV8A 4N4YB 5KAQF 1FFPB 1H3VA 1QBLL 1GKEA 5JYMA 3IDUA 2H2SC 4HZAA 3D8MA 3IFLL 1QRKA 3VGAC 4F9PC 4UM9D 1VZIA 4B95C 4KRNA 4DQAA 3GSNB 4JAMB 4POZD 3MLUH 3JWNG 4EIZC 2LHAA 4OM0L 1T2QH 3MMEB 3F6LA 4F58L 3GLAA 5AG8A 5C6PB 3FU3A 4FXKA 5DMGC