3JT2A

Cu(ii) n47s/m121l variant of pseudomonas aeruginosa azurin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3jt2A00
4E9VA 1AS6A 3NJLA 1ZDSA 2P80D 1NPNA 2E86A 1GW0A 2GIMA 2BHFA 2EIKB 2HX9A 2YAQA 3TU6A 1URIA 4RH4A 1BQRA 1E30A 1JZIA 1PLCA 5A7EA 2BW4A 1BEXA 1KDIA 2Y1AA 2BWIA 4A2HA 4YSTA 3IE9A 4ZK8A 1N68A 2BZCA 3FYIB 2DWTA 2VM3A 3IBOA 4HCGA 5I6KA 2VSMB 2CAKA 1BXAA 1J9QA 3IN0A 3X1NA 2XV0A 1KGYE 3BQVA 1AACA 3T6ZA 1CUOA 1NPJA 4KNUA 2XUWA 1ZV2A 2XVBA 1MG3C 1PMYA 2OV0A 2YAFA 4KO7A 1GS7A 2HRGA 3CG8A 4BWTA 2X88A 4L0PB 2A3TA 4A2EA 5TK2A 3NJFA 3PPSA 1L9OA 2FT7A 1ILUA 1A65A 1JVLA 1ADWA 2IH9A 3NSDA 1F56A 3FT0A 4E9YA 5I6PA 2I7SA 1NWOA 4F2EA 3HEIB 3T6VA 3FSVA 1XB8A 1AZBA 1OCCB 1BYPA 2XWZA 1JXFA 2VM4A 4DPAX 1NZRA 1E67A 1PNDA 1AR1B 3PAZA 3V9CA 2EINB 3UABA 3QJSB 1ET7A 1J5DA 1SFHA 2BWDA 4YSDA 4FA7B 4AKOA 2UX6A 3MBWB 3CDZB 3PAUA 3NJMA 3SBRA 1WA1X 5LDUA 4N4YB 3NJJA 1AIZA 2H5UA 1QHQA 4DP6X 3FU7B 3HB3B 3FSAA 1I53A 3OMNB 3GDCA 1BQKA 2XV2A 2FNWA 2TSBA 1WS8A 2VW7A 1SDDB 2H47C 3WNIA 3NJIA 1SNRA 4HCIA 4X4KA 3NP4A 1OOWA 1N70A 1V55B 2UX7A 2W88A 4A2DA 1NWPA 1V10A 3FQYA 3EF4A 3X1GA 2J56A 6PAZA 2XX1A 2CCWA 1IBZA 4A67A 2XXGA 3UAAA 1QLEB 1L9SA 4YSUA 1L9PA 3FQ2A 1SJMA 3TASA 1RKRA 3S3DB 1BXUA 4MFHA 1TKWA 2QDWA 3S3BB 4W1TA 5I6NA 2YXWA 1KBVA 2CALA 1JVOA 4KO5A 1RCYA 1NIEA 2GB2A 3UACA 4E9RA 3FSWA 3FU9A 2MTAA 2CUAA 4Q89A 4YVUA 2IWKA 2AVFA 4GP5B 1CYWA 1WAEA 4DP4X 4G72B 4YSQA 2XX0A 5D4IA 4YSSA 3TA4D 4G7RB 3GXUB 3T6XA 4QLWA 1T5KA 4AI7A 3NP3A 4E9QA 3EHBB 1V54B 4HALA 1J9RA 4NERA 5I6OA 2EIJB 3ASNB 4GP8B 1AZNA 1L9RA 3BVDB 1GS6X 3EH3B 1PLBA 1B3IA 3ZX1A 3X1EA 3TBCA 2QPDB 1W8EA 3T6WA 4AX3A 4PAZA 1E5ZA 3AG3B 4DP9X 3OD3A 4BWUA 1SHWA 4DP0X 2IAAC 5I5IA 1JERA 3FU7A 2EILB 3L45A 4KOCA 4WKXA 2PPDA 3KW7A 4Q8BA 2GHZA 2HX8A 4JHUA 1SDDA 1ET5A 1AG0A 2HX7A 1XB6A 1KDJA 2Y69B 1UATA 3ABMB 3UAEA 2PLTA 4N8UA 4CSZA 1PLAA 2GI0A 2LLNA 1M57B 1A3ZA 1ASPA 2I7OA 4E9TA 1BQ5A 2TSAA 1AG6A 3X2QB 1PF3A 2QT6A 2JXMA 3PLYA 5F7BA 3NJKA 3X1BA 4AZUA 5B7FA 1NDTA 1FWXA 1YLBB 1KCBA 1OV8A 2PPCA 2JFCA 4GXFA 1PAZA 2R7EB 4TXVB 1JZGA 2AFNA 4YSOA 2X87A 5PAZA 1NIFA 3S8FB 3AZUA 4DP2X 1M56B 3JTBA 5IY5B 3C75A 2BP0B 3IEAA 3ASOB 3NJHA 3OQRA 2BO0A 1EHKB 2YAPA 3QQXA 2CBPA 2N0MA 1OE3A 2DWSA 1R1CA 2QPEB 2QDVA 3QJTB 1KBWA 4HCFA 4DP5X 1OCOB 3SBQA 2GBAA 1JZJA 5I6MA 4UAHA 2IDTA 5EHFA 5E9NA 3WI9A 3X1FA 9PCYA 1AANA 3NYKA 1L9TA 2PPAA 4E9XA 5B1KA 5I28A 2I85A 3FU8A 1J9SA 1BYOA 2EIMB 2Q5BA 5I26A 4HHWA 3AG4B 2RACA 1HAUA 1SFDA 1OCZB 2YAHA 1GYCA 1OCRB 5I6LA 4P5RA 4BDVB 2J55A 1CC3A 4JKNA 5AKRA 2YQBA 1TEFA 1GY1A 1ID2A 1RZPA 2FT8A 3ABLB 3ABKB 1VLXA 2NRDA 2HLEB 2YAOA 4HIPA 2YAMA 4F7KA 1AS7A 1ZIBA 1ZDQA 2HRHA 1OE1A 3JT2A 6PCYA 3WIAA 3H56A 3N55A 4W9ZA 1HAWA 3NSCA 3AW5A 1JZFA 4DP7X 3NSFA 2FJSA 2BP8B 2IDFA 2VN3A 4HZ1A 8PAZA 1CYXA 4PCYA 4M4RB 4YSAA 2XU9A 2WO3B 2PPEA 3ZDWA 1WA0X 2IDQA 1ET8A 5D4HA 2R7EA 5TK4A 3CZUB 4A68A 2FQFA 3T9WA 2YAEA 3PAVA 1AAJA 1RZQA 2IH8A 2PP9A 2AANA 7PAZA 1IBYA 2AZAA 2BW5A 1SHXA 4M3HA 2Q9OA 2FQDA 4UANA 4P5SA 1ILSA 4KO9A 1JZHA 4DPCX 1MZYA 3CVCA 3DTUB 1MDAA 3CDZA 4KOBA 1PNCA 3D12B 3WKQA 5I5MA 1BXVA 4A2FA 2VW4A 4G70B 3MX0B 1GY2A 1WA2X 3CVDA 4A66A 2J5WA 4AKQA 2HXAA 3CVBA 2B08A 3OMIB 3WG7B 1PZCA 1AZUA 2PCYA 4JHVA 4AKPA 4G7QB 2GC4C 1TEGA 2JKWA 4BDVA 2PCFA 2XXFA 4KNSA 4NB7A 1XMEB 3U25A 3T71A 4WTQA 4CSPA 3H4HA 3ERXA 3EH5B 5AZUA 5B1JA 3EH4B 1JXDA 1GR7A 2GSMB 1AZCA 2W8CA 3FPXA 3UGEA 4GP4B 4G71B 1NTDA 5I5JA 3KW8A 1DYZA 4K9JA 4KNTA 1IKOP 3ABGA 2YXVA 5D4JA 1BAWA 2IDUA 3OMAB 2UXTA 5B1AB 4F2FA 2ZXWB 1SF3A 1KCWA 2BP8A 2XLLA 3FS9A 1A4CA 1ETJA 1FA4A 1JZEA 2DV6A 2HZHA 3ZIYA 2FTAA 1M9WA 2FWLB 4A2GA 1AS8A 4GYBA 1MG2C 2PPFA 3AG1B 4NAJA 1NIAA 1JXGA 3V9EA 2DY2A 2H3XC 1DZ0A 1ASOA 3H4FA 1W6LA 2FQEA 1X9RA 4DPBX 3DIVA 3DKHA 4HHGA 4BXSV 5PCYA 4EF3A 2ZWNA 3PXLA 1GSKA 2ZOOA 2IWFA 3TBBA 1SF5A 3PCYA 1AZRA 1A4AA 2BZ7A 3NSYA 1W6WA 1J9TA 1MZZA 1PCSA 1EZLA 2YARA 4QKTA 4BWWA 3SQRA 2IDSA 3AG2B 5B1JC 2PP8A 1E65A 5F7AA 4BK5C 4DP8X 1ZIAA 5B7EA 1ZPUA 3QJUB 1FFTB 3WKPA 4E9WA 3GYRA 1GS8A 3NJNA 5B7MA 2J57A 2GC7C 3QJRB 2P80A 2UXGA 2VMJA 4HAKA 1KYAA 2UXVA 1CURA 3FSZA 5AFAA 3FQ1A 7PCYA 1JOIA 2WSDA 5B1BB 5FC9A 1AOZA 3S8GB 1QNIA 2B3IA 2XV3A 3IN2A 1IC0A 5ANHA 3N2JA 1ASQA 3WNJA 1X9UA 2MRYA 2VSKB 4KO6A 1L9QA 2AZUA 1NIBA 1AQ8A 1J5CA 3QJVB 3FYEB 4BXVA 4ENZA 3SBPA 3NJGA 2CJ3A 4E9SA 3NT0A 4YSCA 4FAAB 1TU2A 1KV7A 3AY2A 3OM3B 2PP7A 3QJQB 4UF7C 4YSEA 1E5YA 1PZBA 2DYSB 1PZAA 4G7SB 3S3CB 1IUZA 5B3SB 3QPKA 4YL4A 4YVNA 1OE2A 2DYRB 2BP0A 1NINA 2FT6A 1WS7A 1HFUA 1XB3A 4GY4A 3ZBMA 2FQGA 4YSRA 2OCCB 3UADA 1OF0A 2UXFA 3FPYA 2VW6A 2IWEA 4DP1X 4YSPA 3G5WA 2OJ1A 2WO2B 1A4BA 1NICA 3RYMA 1A8ZA 2ZONA 2XYBA 1PY0A 1NIDA
chains in the Genus database with same CATH superfamily
1AGBA 2R56L 3Q2NA 2RTTA 2EXSA 4ODUA 3MVSA 5IT2H 3NQIA 1KOAA 3WS6A 3DRTA 3HHSB 4JFEB 1C9SA 3S97C 3BW9A 1QBBA 2OK0L 4YHOL 4S1SL 2YGVA 3MCLL 4JFYA 2OL3H 2BWIA 3WL9A 4F7PB 2CIIA 1FNEA 1DJSA 3MMEA 3ZSSA 4ZFGH 4L0YA 3MRJA 3KPSB 4HKZA 4RDQF 5C09B 1SQMA 4AY0A 4EOWH 1JUFA 5LNEA 5B39G 2F8XC 3TF4A 4N0RA 4QY8A 1R3JA 2DTMH 4NC1C 5LB1A 5IMLB 3BWUF 1MHEB 3FU6A 1OO2A 4APXA 4XVTL 2B3RA 2NXZB 3L7FA 5KZCB 2VKXA 1L3WA 5B8CB 1BGXH 4OZFG 4BWTA 1A6VL 2BVTA 1KB9J 4O2CB 4ZTPL 4Y8AA 1RK7A 4J3UA 5CJQH 1LM8V 4WWKD 1IC4H 4S0SD 3GSOA 2DQJH 5E6UB 1BIHA 3QIWB 1T6WA 2WK2A 2BK8A 3O2DL 4ABVA 2N7BA 3N1PC 4JM4H 4FQ1L 1G1YA 3K2MC 4OKDA 3MJ8A 3EJYD 2OQJB 4PTUA 4XN2A 4TPRH 3KAAA 4K94H 2LU4A 4LEEA 5EO1B 1HESA 4Z7UE 2EZ0C 5HHXL 5C07A 3MI6A 1K2DA 3ULSA 2FE0A 5SWSA 4O02B 4FYRA 5E4AA 3ESPA 3B6SB 3CHXA 3MX0A 3LPWA 1TPXC 3KLSA 4G7YH 3EDKA 4M1CC 3PPEA 1TCRB 3PAZA 4P05A 4TNGA 3FO1B 5GS1A 4UINH 2EICA 3BFOA 1BAFH 4KHXH 3FQTA 4JB9H 1SBSL 2NQDA 3P2TA 1TQBC 3EFFB 1DVFC 5FHBH 1D2PA 3ECWA 3WLBB 4GPVA 4AQEA 1EEYB 5LDUA 3VD9A 2ICEC 2QQNL 3AITA 4FQQB 4GG6F 2FZ3B 2DW5A 1KTDB 3JV6A 5C0IB 1Q9WB 4AIOA 1I53A 3VB9A 4X9IA 1QO3B 5FYKE 2H45A 4YHML 3KVDD 1D5MB 3HUJF 1G9NL 1MFAH 2W9LA 1TZHA 5IQMA 4K4KA 4DCQA 1U3JA 2HAZA 3TBTB 3MV8A 2C1OA 3T3ME 1B6UA 5DHEA 2J6EL 2XFXA 4YBLC 1WAAA 1DN0B 5C0BA 3S96A 3L3GA 3OGCB 3IDXH 1UM5L 1COBA 2B8OT 3RFRA 1FPTL 3S3DB 7FABL 3JZ7A 3PXJA 1F86A 1MWOA 2IADB 2V0AA 4LSTL 1OGPA 1XZ0B 4KV5E 4WW1A 3RZCC 5E08H 2YXWA 4QRAA 5DMIL 1AD0B 5EZIL 3WDIA 1KTRL 4BSWB 1RUQH 1X5FA 3MXVL 4ELKA 4JQIH 4NBYB 5JHAA 4ZXBD 4QTIH 1YY8A 5AOLA 3DO4A 3QRBA 4TVPE 1BD2D 1CS6A 1JHTB 4XBEL 2IV9A 2AHIA 4FYTA 2NNRA 3INUL 4BBWA 4TM9A 1YNLH 2Z91A 3TA4D 4WFGD 1LXMA 4V11A 3FTYA 2HT2C 4OFDA 2BSED 4KJPC 3T08A 1ZT1B 2P7TA 4KDTA 4PJAA 4I0PA 1KFAL 4JDTL 4LQFL 4X4YB 4G9FA 1WV7T 3MRHB 3QDJA 3TNNB 3IJ9A 1XD0A 4PI0A 4XNQA 3ELQA 4PGJA 5L7XH 1SVBA 3ZX1A 4ANXA 4N2CA 3TBCA 4FQ2H 2NX5B 4HCRH 1MCPH 3QFDA 3T6WA 1JGLH 4OQTA 2H2SD 1DUZB 3VA2C 3NZ8A 2NXZC 1W15A 1GC1C 3ASWA 3CFKA 1MCQA 4A7VA 3VG9B 2E7LA 3OKLA 4HXBL 3OV6A 1ET5A 4E0RB 2P24B 1XB6A 4EN3C 4GAJH 1YY9C 4XX5A 5ALCL 3VXRE 3UG3A 3TIDA 1KDJA 1DANU 1W0YT 4IRSD 2DEWX 2APXA 3WE6B 1ORQB 1CIDA 5DZJA 5HGDA 1E4JA 1SYVB 4RDBA 4B9PA 3PWUB 4QHLA 4N2FA 3B3IB 4FULA 5GRVL 3ZO0A 5IG7A 1TZAA 4AWJC 2JB6A 2JXMA 4JCWA 4PBWD 2MCAA 4QHMA 4P0DA 2EDMA 5D70L 2E5EA 4X6FA 4H20L 3GLAA 2X2UA 3SB3A 2R27A 4ONGL 1XMWA 4I1PA 2E8ZA 2IOIA 2XWXA 5J6GB 1OW0A 1EBPA 2H7WA 1BREA 4PRIB 1C5BH 2VDMB 4G8GE 1M56B 5IY5B 5D1ZB 3TEXA 1I1AC 4OFYA 4GSDH 4Q56A 2DMBA 3F01A 2C1PA 4FI7A 4JRXB 1DSFH 4V1DE 4AIZA 2OW7A 3V6ZB 1NKRA 3RUGE 1W72H 4AK1A 1ZEAH 2CJSA 1KF9B 4S10A 2X3CA 4QRRE 3HG1A 4URTB 5DU7A 3U4EA 3PWJA 4ZNEE 4TTGA 4IGBB 2MHAB 3PE9A 5ISZB 5AZ2L 1LO4L 1U58B 4PY7B 4FYQA 4Z76B 4D0BB 3JWDC 3WHE1 3APDA 1N6UA 4Z7AA 3OPZH 3IXTA 1RUAL 4X4ME 1J5HA 1PZ5A 3IGUA 2IGFH 3K72B 5HHQA 1J5OL 1YNKL 5BCAA 1INDH 4LIQL 3ZE2F 2QVTA 4MSWB 5FKAB 4D9RE 2IJ0C 3EIFA 4HS6A 5I0VA 3IFPA 5KTEL 4EMZA 4MYWB 3JT2A 1QR1B 1A3RL 5TF0A 3WIAA 3QR1A 1USZA 4OH2A 2V8MA 2APVA 4NKDB 1KB3A 4ZW7A 5F9AC 3BRDA 3IMSA 1MIEH 5EV7A 1J9CT 5F6HI 1YCSA 4MA8L 2Q7YA 4XN9A 3MJGX 5E8PB 2R0LH 4PRPB 1PJ9A 2VDKL 2AAVA 2PTTA 2NY4D 2BVOA 4RFEB 2W9EH 2YKLL 4RMRA 1A14H 1CB4A 3MNMA 1NC2D 5I0XA 5HYJA 2R7EA 5J1AB 5GZOC 1P1ZA 4WFFD 3G3LA 4FQCH 4M3KB 2FQFA 2E9IA 2X10A 1IM3A 2OR9L 4KHTH 5MHSD 1I8KA 3U9UB 1J8HE 2H3KA 2OM5A 2CXGA 5E00A 1UCTA 2W0FA 5CP7B 3U7YH 1KJ2A 3D9AH 4U49A 3NAAH 1XGTB 3OKMB 3LS5H 1KB5L 3BVNA 2XA8H 5HDWA 1QD0A 1ZVSA 2APBA 3ES6B 4KO9A 2I27N 5CS7A 1VSCA 1WBZB 2WW8A 3SPVA 4TUUA 4K7PL 4B5ZA 5LNGA 1QLFA 3JWOC 3RWFB 4W9CC 2VDQL 4YIQB 2B5IB 1WA2X 3DXAD 1MW2A 3UFIA 3K71A 1KYUA 3ETBJ 4M7LH 4P59L 1X4YA 1S7VB 4RFNB 3RX8A 4X4XA 2FSDA 5CGTA 4UDUA 3D07A 3U7WH 2GC4C 2AJUH 4BDVA 3CSPA 1YPZE 1EDHA 4G6KH 1EAPB 4DN4L 3K46A 3A21A 4U1LA 4HJ0C 1Z9SB 4NQCA 3U4KA 4W4NA 3OLEA 5F7WC 4MLIA 3PV6A 5JHLH 5JOFA 3WEOA 2D4FA 1T2JA 2WQRA 3D25B 1FIEA 3B2DC 1ODAA 3FT1A 1KLFA 1BEYL 4BINA 2OSXA 1E8ZA 1ZKAA 1BVZA 4KNTA 1ADQH 3GMLA 4LPWA 5D1XE 4OSUL 4CADB 5D1ZC 1UACL 3UYRH 3SQBB 2RCSH 1U8NB 2VMCA 5TQ0L 3IPFA 3T2NH 3FH8A 4BHUA 4PU2A 1E2VA 1KIRA 2XWTA 5T5FH 4EQ3A 4A2GA 2VDRL 1NIAA 5C7ZA 4PUBL 1NFAA 5EU4A 1G4RA 3U9WA 3FTXA 3H4FA 5AVSB 5C7XL 4PN6A 2XKNB 3EYQC 4DPBX 1UA6H 2FATH 4LCWA 3LZFH 1RZFH 4FA8A 1KY6A 4G80A 5C0CD 4PREA 1J8KA 1YDPB 2ZCLH 3HC3H 2ZOLB 2WHVA 4LHJB 3SKJL 4AYGA 2FBOJ 5GGUB 4BFGA 1G6RH 4LASH 3UBXA 1BQSA 1KIPA 4L4VB 3TH3T 4BWWA 4HPHA 1WFIA 2NDFA 3QJHB 1E65A 4LSQL 1ZIAA 2H2PC 3PS6A 5FOJA 1KC5H 1YG9A 3D05A 3VGAB 5D93B 1OKEA 4AQ1B 3M7OA 4PGZA 4WDIB 4KJQC 1VEMA 3TO4C 1KZQA 3DIDA 4K9EL 3MRNB 3U36A 3S5LB 4P4RB 2AJVL 2P80A 2NY3B 1F4WH 3A24A 1YEFL 3HTLX 2BOCA 1EHAA 2BIOA 2K3HA 3QE5A 5GPRA 5LBSA 2D4DA 3STLB 3B2PA 1RZIA 3BE1L 1B2WL 3QHZH 4GI6A 1HSAB 4XP6L 3SDDC 3AT9A 3D69A 1THAA 1T20A 5DEJA 2XV3A 3RVVD 4CVXB 3KEHA 2N3JA 4NAMA 4ZODA 3FTGB 2VH5L 1IGTA 3O0LA 1A7QH 2J72A 2ZSVA 4ZFZA 1A6PA 4JDZB 4A6YL 5IMKB 3VFNB 3UDWA 1OVZA 1IM9B 4OCRL 4AJ0A 4I1RA 4YHIA 5LLIC 5DVPA 3CMOL 4YSCA 1OGAD 3JWNG 4PG2A 1NLDL 3VFSB 5DZLA 3AGVA 1JRHL 2WANA 3L3KB 3U6XS 1L5GB 1PZAA 1T0MB 4U1GC 4QWWD 3QPKA 4YL4A 3DVGB 1VACB 2QGCA 4Y2NA 4ETQB 3S7GA 1KCSH 4PRNA 4BFIB 4YDLB 3VXUA 5BMFH 5I0WA 1LP9F 2OP4L 2W38A 4KI5E 1CD9B 4POZC 2A83B 4JZJC 5I66B 4ZPTB 1T03H 3H0TA 2FLRT 5HI3D 4ZMXA 1I9RH 2P5WD 2CDFB 5GS0C 1BFSA 4ENEC 5FA4B 4HF5L 2X38A 1NICA 4W81A 5TTRA 2WLIA 3WKYA 1NIDA 1CVRA 1NEZA 4N0UE 3TT3H 4LRIC 4DPRA 2E86A 5AYUL 4Y4FD 3DX6A 4NNPH 1WTLA 3OAZK 5A7EA 3E2HB 3L3JB 2AKRB 5EC1A 5GGVY 2XIBA 3D7PA 3CFNA 1F1GA 3PHOB 1ZV5A 1KGXA 4OIAA 1QRNA 2R9HD 4KJYA 4U2ZA 3IE9A 4TN9A 4DZBA 2DWYA 5I1DA 3CHRA 2ITCB 3W56A 4XMKL 2QQQA 4MQXD 1KLGA 5I6KA 2FX7L 3CPUA 3QYCA 2I24N 4G1MA 1QOKA 4GKSA 3GWJA 1BD2E 4APQB 1N19A 1L3NA 3NFNA 1CUOA 2JH2A 3L54A 4IYKA 1A3QA 1QX1A 3L4YA 4M4RA 3IS0X 2NYZA 1QLRA 4WFGE 4ZD3L 5JTWA 5FV1L 2NSXA 1GS7A 4QPEA 1F3JB 2F58H 5ERWB 4ZMNA 5ITFA 3D3VD 2SODB 4GJTB 3UEZA 3TWYA 5IV2B 1A66A 3CK0L 1D7DA 5JOPD 3BMWA 2VDOB 4AH2A 4YFDB 1XX9C 2WP3O 4YK4B 2QLYA 4S1RH 5DDHB 1JK8B 1JPTH 5LN8A 4WU5B 3DGCR 1GIGH 3MODL 5CEYA 43C9A 1F6AB 1IILE 2VUKA 4K3JL 1IKFL 4E9YA 2O61A 3O6LL 3DK0A 5IHZB 3MV7B 5TDOB 2VDNB 3AQZA 2F2HA 4XO5A 1CXFA 2AXFB 3SE9H 3SJVA 1Z0NA 2OK0H 4K7PX 2P42B 4OTXL 4AYID 1YAZA 4MBOA 5FHAL 4JFPB 5FO8A 4U4BA 3FB6B 3ULVC 2VOTA 1MPAL 4KK9C 3PGDA 4WENB 4J3OC 3RWGA 1I1RA 2EINB 2IPTL 1IKNA 1J5DA 4PYHA 1NAMA 3MLUH 3HE6D 4FJ6A 4M48H 4HOWA 1WA1X 2EKSB 3TH4T 3BKYL 1PYWA 1U3YA 3VFRB 4KVCH 4XH2A 3RDTD 2V3FA 1IQWH 3Q2CA 4LSVH 3VH8B 3FZUC 1FLTX 3QIUA 5I1EL 4DP6X 4ZTPH 4CW1B 4DAGH 1A9BA 1Q72H 3A67L 4OZGE 1N0XH 1ODUA 1INQA 4OB5H 4PGEB 3VXSD 4NLAA 1QLEH 2VW7A 4GRMB 4B5EA 3VWKA 4X7SH 3A0OA 3BJLA 1QI3A 3NCYS 3MUY1 2W88A 4UUJB 5D2NE 3VA6A 1S7RB 3SE3C 3CPLA 2BJML 3L48A 5CZXD 4HZLB 5A16A 3GRBA 3TJPA 3AM8C 4TUJB 3ECQA 5D6CB 1F1DA 3QO1B 1AIFA 3MRGA 5FUZL 3VFVB 4PBVC 3V6OE 4F8NA 2V6HA 1KBVA 3OHXB 4R4FH 2CKBH 2C26A 3IGLA 1RCYA 2YC1A 1BV8A 4NZTL 1NIEA 2GB2A 1PG7L 5DK3A 5L6YL 2PXYC 2D03H 3F84A 3GK8H 2NY1B 5C08B 4NKOA 3WNKA 1WD8A 1IVLA 2WQ8A 3NGBB 4I2XB 4X0KA 3GMMA 4ZTOH 4TNFA 3QT2A 3R4DA 4FZ8L 1L4IA 4P4KA 3JWNC 4JRLA 1KGCD 1JZ5A 2JI2A 2VL5B 5DMJB 1XR8A 3CH1B 2EKJA 4K8RC 3E2HC 3I3EA 3KL0A 3B7UX 5LVEA 2FHBA 25C8L 3GXMA 3DX7B 4GMSH 3AQXA 2C4FU 3GSXB 3M7FB 1E6JH 2HKHH 4Y16A 3ILQD 2EIDA 4NDMA 1BYNA 4XMXA 1QSEB 5CINL 5DVNA 1JFQL 2E6QA 1ACXA 3ULVF 1A9EA 1JCVA 1FO0B 4JZOB 3H2WA 2X9XA 4J3OF 4HLEA 5HYFA 3FCSB 3IJHB 1YMHA 4M7LT 1PEZA 1OAKL 2G3XA 2YMTA 3FAWA 5C86A 4Z8FL 3GZPA 2Z3FA 5E1AB 4RFOL 3RB5A 3BGAA 1YEDA 5J8OA 5CZKA 5JW4R 3S37H 4LSTH 4A7UA 4Z0XA 1DUYB 3SDXA 1UM4L 3QDMD 1BVNT 1BX2A 2JJUA 4WFFE 3DHJA 5DJ0A 2DIBA 1AJ7L 1SEQH 5EEYA 5MHSE 1QSFD 1VB9A 3K8KA 4RQQB 4R3SB 3PP3H 5D7IB 4Z3HA 4KK5D 4EZLA 3QCUH 2IANA 1F2XK 3B5HA 1UOVA 4N2OA 4JY6A 4YDZA 5DTFB 4HUXA 1EEZB 4Q52A 3DO7A 1ASPA 1U8CB 3OMZA 3D34A 1HL8A 6TAAA 2CGRL 4AITA 1BLIA 3T6QC 5CGYD 3RAJH 2V2WB 2WVVA 3AREA 3ATBA 3D0LA 4DOHB 2IH1B 3LQAC 3FT3B 3LHPH 2V7HB 3LXUX 3OKNA 1Z9LA 3QZWA 3MRDA 5G4OA 2JFCA 1E3FA 3QQ4A 4LQFH 2ZJSH 3AGWA 5F96H 3VFUB 1J05A 3DXAE 4I77L 4F9LA 1FNGB 2V9TA 3C09C 3P9LB 3CQPA 3N50A 4QD2E 1ZS2A 4UU9B 3ECUA 1ZTXL 3F8UB 4YWGH 1IEHA 2XC8A 3W1ZA 4DP2X 3HFML 3RNQA 4HEPG 4J2QA 2WQWA 4F37K 3E0GA 4K23L 3CFDA 2WUCL 5L4FA 5GISH 5HHPA 4MTMA 1J0YA 2H6PA 2IXQB 4JUTA 4XAKD 1BWMA 4KMQA 3B5TA 1OCOB 3PWPB 5DMKA 3SBQA 1JE6A 3ROOB 3GSUB 4F5CE 4UQDA 4OIIL 1ZE3C 3BEWB 3TEYA 3WFBH 1L9TA 2ZKHH 3OKEA 4A7QA 2DRUA 3FDWA 3O3DB 3WLWD 1K9TA 1FVDA 3C60C 3KBHE 4TTDD 2EVHA 3ATEA 2Q6WB 4NO3A 3KH4A 4NN6B 4NIKB 1E27B 4X6DA 1QWUA 1JPSH 2Y7NA 4XB7A 4XXDB 4UQCA 2HCZX 2OTWB 1XFPA 1RVFH 4N5ED 4NQDB 3D87B 3G6DH 2OMZB 1MJJB 4I88A 1ID2A 3BAEL 1MCHA 2GHWB 2ZSWB 2X6MA 1VLXA 4Y2DC 2VAAB 5I24A 5E2WL 4HIPA 5C9JB 3OHXC 3EYOB 3OB8A 1AS7A 1KN2H 5IMOB 1MCOH 1FZOB 1BW8A 1CLVA 4U1SA 1P7HL 1ZK5A 1KIQA 5T1KA 4D0CB 4N6RB 5JDSA 2VJ0A 5C3LD 5C0CE 1U8MA 4LVOB 2VLRA 5CEZD 4PWHA 3H1ZA 2JVUA 4PI2A 2FYVA 4BQBA 3AADB 3DX4A 2R1YA 1T2XA 3ARVA 5CJBA 4BEIA 3IS1X 3QA3A 5CEZH 1P5VB 3V4VB 5FA3B 3IFNL 3APCA 4BFRA 2Q86B 3QNZB 5AB2A 4PLOB 3ZIMA 1AQKL 3TONA 5LQBL 2F1BA 4WU7B 4P2QE 4JFZL 3I9IA 3VACA 4X7TA 1XWVA 1N8OE 1JRHI 3U1SL 4P23A 2F1AA 2HTKC 2ED7A 4HJSA 3SBWA 2BSTB 4IW4C 3ZRCC 2BVPA 1DBAL 2XNAA 4IS6A 1HYRC 2Y7OA 1U92B 2ZE0A 3B9DA 3BSZH 2VW4A 5G55A 3WSQH 4WSJA 1LDPH 4WV1B 2BH0A 3P11H 1A3RH 3QHFL 2PCXA 1SXAA 4FQHA 4K7FB 3RL2B 1FGNL 5DJ8B 4U1JA 2YUWA 4EI6A 2X89A 3LH2L 3QFGA 1VRSA 2DDQL 4IM8A 1KBBA 4X99B 2YPKB 4QRTB 4ODSH 2KL6A 3R1GH 2D2CC 2ZNXA 5E4EC 2FVNA 2R1WB 4P5KB 4KNSA 3VDCA 1VGKA 2VDKH 1MF2L 2Q2LA 3QGVA 5FDWB 3KGTA 5E9AA 3T71A 4N3UA 2CUIA 2BOBA 3O6KL 1MFBH 5E5RB 3ZOAA 2P49B 5AZUA 4MQ7A 1RD6A 2YGOA 4O2FA 4I48A 3VXMA 4BK5A 3PL6C 2G2RB 3RIFK 3QQ9D 4JFVA 5CMAB 2OR9H 4YOKA 5L4MA 3KZ8A 3G6AB 4QYOA 3UCQA 2WXGA 3CQFA 1I8IB 4Z7UB 1PG7X 1S7UA 4POUB 1T04A 3QULA 5F97E 4AM0Q 5EPMB 3V7MA 3RVXD 3SDCB 2CLVA 1IIKA 2BHZA 2KZKA 3D18A 2UY7A 1TU2B 3C2AH 3G9VA 1ID5I 4TVUA 1AE6L 3FB5B 4K3DL 4JPKL 2FWLB 3RDJA 3FT4B 3PGFH 1AGDB 4H1LH 3V5DA 1MNUL 4LLQB 4DGYL 2ZOKA 1NGXB 2QGDA 4OGZA 4HG4K 2PWEA 3MRIA 4PPTA 4XCCL 1GZPB 5LG1A 4KKAD 1EXUA 1OPGH 2R0KL 3ABZA 2YA1A 4L8BB 4NFBA 5EBWB 1L9NA 4X4ZA 4HHGA 3US9A 3W0WE 2FR4B 3EYFB 1QEWB 2ZWNA 4JY5H 4UT6A 3M1BB 2DWDA 5IROD 5SV3A 1BWWA 1DR9A 3ZZLA 3DJSA 2Z8WC 2A73A 4IQHA 5HGAB 1CU4H 1P53A 4MCYB 3SYAA 5KYWB 4L23A 1PKQE 1C7SA 4WTZG 4Y5VA 1M71B 2PUQT 5FXCH 1W6WA 3MBED 4KXZI 3T3MB 3T3PF 2OYMA 4L9LA 4JM2B 2EXWD 1BEYH 4X50A 5IB4A 2C3GA 5B7EA 1MRCL 4LL9A 1OLLA 2WGXA 3OF6A 3P9MA 4KZDL 1MJ7H 1W2KT 3D3VE 3STZB 2MNUA 4PV1C 4XCEB 2VZUA 5JOPE 3C5ZA 1AGFA 1MIML 2HPOA 5TQ0H 5D7IF 1RJZB 4X6BB 4BJLA 5H8DA 1F3DJ 3QNYA 4G5ZH 2FIKA 4BFJA 2W07B 4HPOL 5B1BB 4Q9QL 1CFSA 2K9UA 5JNYB 3IDJA 3E3QC 2DBLL 1A6ZB 1MLBB 4KGLA 2Y5TA 3AXLA 4JPVL 1X9UA 1NCNA 3HUJA 2CBOA 2EDEA 3RTQC 1X5YA 3QJFB 3J8F7 4M5ZL 3CXDL 3EJQA 1BMWA 5EH1A 3H8NA 4KK8C 1H3TA 2D8KA 5LBSL 4L1DA 1UB6A 5M95B 2DYSB 2OMWA 3OQ3B 1ZHKB 3EHBD 4W9EC 4I87A 2DYRB 3VWJD 5I1LA 1O7DE 4NN5B 3H54A 1UH4A 2ZOWA 3MCKA 2J4WL 1NCWH 2FT6A 4P9HL 3TTYA 4WV1C 4PWGA 3A4FA 3CZLA 1I85C 1JN6B 3CFCL 1MAKA 3I9GL 1KXTA 3K6DA 3LZRA 4XXWC 3TURA 3BT2L 1RZKL 3VXSE 1FCCA 1CZ8L 3MNVB 4B9ZA 3BE1H 3V52L 1JDDA 2ADJB 4YHNB 1A8ZA 2NDGA 3K7UA 5I19H 3U48A 3U0WH 1AS6A 1A47A 2VM9A 1FVCA 1RMFH 3TTSA 5DYOB 2GJPA 3NOIA 4NPYB 4YXHH 1J5IA 4NM4L 1WFUA 4RBPH 3IB4A 1CFVL 1MWAB 4JHZA 5EU7C 2X4PA 5TPWH 4JO8A 2R2BA 1S9WA 12E8L 3FN9A 3U7YL 4DKFH 3KLQA 4L3CB 5DJAB 2B9AA 1JGEB 5G4MA 3WD5H 2VQ1A 5F71A 3FO9B 2DMCA 4K2UL 4JFOB 4NQUA 1SVZA 4CDGC 3R4RA 2YJQA 4XGZB 5CNHA 4H13C 4ZOBA 1BXAA 4I1NB 4NFCA 5CCGE 1DVFA 2YK1H 4ONHB 5KSAB 4FJYA 2Z7ZA 3RKPA 4QHKJ 1CJYA 2VR8A 4GRLA 4HWBL 2ICEA 4G8GB 4RMVA 5E99H 1I3RB 4P2AA 1K8IB 2OV0A 4KO7A 5LGJA 2DYPA 2ZUYA 4V1DB 2ZKYA 5JIKA 1OK0A 3QI9C 1XGRB 4NZUL 2WYHA 1UD3A 4FHJA 4KQ3H 3ULUH 3RUGB 3QUYC 4JG5A 2C9RA 4UOW0 4QRRB 1O5DT 4O9HL 3QEHA 3RY4A 4AMXA 4AZ8A 3T65A 4XBGA 3KPOA 2VQTA 2J8OA 4P5TD 5AOJA 1LK2A 5AVXB 4L8SB 4OF8A 1EK3A 4QOKA 3P4OA 3UTSD 5LG6A 3HEIB 5AW6B 2VUOA 5LAXB 3TVMA 3TYFB 4XVJH 4AGMA 2QQLL 1JMXA 1ONQA 2VN6A 2XG4B 2EDYA 2BS71 5I1CH 3HVDA 4NZDA 4CKVX 1X5MA 4LSSH 3QAZB 1FZMB 5F7EL 1U8KA 1UZ8B 4JPIA 3L7EA 4XXCC 5D5ME 3F5WB 1QSFE 2GFBA 2P8PA 2MTPA 4JFHD 5FUOH 5A43C 4KX9A 3QJSB 5HD8C 1CR9L 1MN4A 2A77L 4PRAA 2R4SH 1D6VH 2DWXA 2E27H 5D9SA 3ATFA 1NC4D 3NJMA 4OZIF 5HJ3B 3LZOA 4KMTH 3UERA 2EEFA 3OZ9H 4LPXA 4JFEA 4XWOC 1A5FH 2C3XA 2F7PA 2FEEL 5GGRY 3GO1L 5JR1L 1JPST 1PLGH 1ZVYA 1TMCB 4MD0B 3KPSA 4B3EA 1YEJL 4HCIA 4Z7UF 3NA4A 3L08A 1IKFH 1NAML 1MHEA 4XP5L 1J8HB 4MVBC 3ZKNC 4WNQA 3MRLB 4JG0L 4KXZH 2VDLH 3FQ2A 3CFBB 4K5PA 3U1QA 1SJMA 3F7VB 3GBMH 3RU8L 4XBPA 1WCBA 2EE3A 4J8RB 4JO1H 2R0ZL 2FX8H 3L5XL 2Z4QA 3GMRB 4EN3A 4KO5A 1YZZA 2OR7A 3QIWA 2PTUA 1A6AB 3FU9A 3T8VA 5DD3L 2EJ1A 2H4EA 2LAGB 3NRFA 3HNTL 3W3BA 1AMYA 4WF7A 1Q0XH 5D4IA 1E4XH 4EZKA 1YPZB 5EO1A 1H5BC 1TZ8A 4J8QA 3GXUB 5KVGL 3HG2A 4JM2F 5D7SH 4O02A 4ODXB 4X5PA 4C4UA 4WO0A 5JHDD 2YD6A 3DSFL 4DZ8B 1TCRA 3MA9H 3QWOB 3FO1A 3C8DA 4IKLA 4IMKA 5T1MA 1J8SA 5LGHH 4U0QB 1I1AA 1Z3GH 3EFFA 3UX9B 5CCJA 3WLBA 2GJ6D 3O3BB 3D4CA 5D1XB 1ULVA 2R39A 1SHWA 5CSZB 4FQQA 1KBKA 3TWCH 1KTDA 4A1RA 2WKGA 2Z31B 1MHCB 1Q9WA 1RULH 4Q8BA 2Q10A 2HFTA 1QO3A 2GHZA 1D5MA 2DQTH 4RWYL 2OKMA 3NCJL 4D94A 2HX7A 5FB8B 5L6YH 4HJTA 3TBTA 5BJTB 4FE9A 1KCVL 4MA3B 4LIQE 3KNBB 4HUWB 5DEFA 3TPUA 2DQFB 3KXFA 4KRNA 3ESNA 4L8SC 1YJDH 4LVNB 3Q13A 2JKLA 1NCGA 5CN3A 2A6KA 1LEGB 1MFVA 2AXJA 2NNAB 1W0VB 3IJYB 2QT6A 3NCBB 5EIIB 4LOUC 2B0SH 4X9GA 2IADA 5DUBA 4HOZA 1KCBA 2EP6A 2IFFL 1UWYA 2DJ4A 4YX2L 4HWZB 3ZDZE 3TFBA 3QAZC 2OBGA 3BWAA 3FXIC 3I75A 4Y1AA 4JCLA 5GRVK 3RWHB 1WITA 1KELH 1JHTA 3N44F 2ZF8A 3S34H 3WAJA 2ODHA 5MERA 3BAKA 3REVB 3C75A 4I0PD 5AW0B 4FZEH 4Z8FH 3TJEL 3QDJD 4PTTA 4OI8A 4WWKB 1N67A 4MCMA 3DETC 1CMOA 4BZ1L 2DQGL 4LHUD 5DHVH 5GZOA 4L18A 3QJTB 1R4XA 1RZ8A 1JZJA 4AW7A 3MRHA 1UA3A 5D1QC 1OT2A 2KQMA 5DA4A 1YC7A 3UPRA 1K6QH 1G7MB 3ZDXE 4R96B 1OGTA 3PFUA 4G8EA 2K7QA 1VFAB 1IAIH 1TJGH 3QUMH 4ONOA 3HS8A 3V8CA 1E6OL 1ZLVH 4N5UA 3RL1B 5TQ2L 4NHCL 4OZHF 3AG4B 1DUZA 2IPUK 43CAA 1FYTA 1T5WB 1VFOA 4XN8A 4BHUI 3UYPB 2GBVA 3VNYA 1MH5B 2G2PA 3BT0A 2CPUA 4LLYB 5F21B 4ZMTA 1GY1A 3V0WL 5AL0A 5GRXG 2I5YH 3MNDA 4E0RA 2P24A 2NRDA 1IRAY 3IRCA 4M6MH 1U8JB 3B43A 3GI8H 4JVWA 4PLKC 4FQXD 3WE6A 2HYMA 3RUGF 1ZJBA 1ORQA 3JVGC 3OR6B 4PVMA 1SYVA 3HFMH 4U3SB 3B3IA 3N9GL 1WUZA 4MBRA 4OLXH 2JTYA 4LLAA 3BXNB 3GUTB 1VHPA 4PCYA 2JLLA 2WZPD 2K6ZA 3AAZA 4RESB 4HOMA 1AI1L 3FF7A 5J9PB 5ACZA 2WKLA 3NCFB 1GPOH 1G94A 5DJYB 5F0JB 4URKA 5J6GA 4N0UB 3QUXD 3W5MA 5F9WB 5AKSA 4PRIA 4M6NL 5BV7L 5D1ZA 3QO0B 1E5UI 3H3PL 3SY0B 1UT9A 3LQZB 3IU4H 3C08L 4JMNA 5IF0B 1LO2H 3V6ZA 2GI7A 3QZPA 1L0PA 3EXJA 4JG1H 2H26A 2W0LA 3VXQB 1LP9A 2JLPA 4N9OB 4P2OD 4J39A 2IH3B 1BD2B 2MHAA 3AMKA 2AQ1A 3NH7L 4JPWL 1UFGA 5ISZA 1GY2A 1U58A 4PY7A 1IB5A 4Z76A 4D0BA 1J1PL 3ARGD 2FEDD 3MKKA 2XWCA 1BPVA 3ME0B 2B08A 5GSVB 3LRKA 2OULB 5EF0A 4XRCA 4ZO7A 4JFUA 2R51A 2PCYA 2VJ8A 3K72A 4AKPA 3F62A 3T2LA 4E5XA 4LVNC 4ZOEA 3W5NA 4MKTA 1P9MA 1XMEB 3U25A 1ZT7B 1IGCH 2H3NA 2HT3D 4MSWA 5FKAA 4AEHH 3VXTB 5EOTB 4L37A 4UOQA 3IFNH 1QR1A 1SY6A 3L5JA 3ALPA 1IKOP 1GGIH 3TO4A 5E4IA 5C8JB 3BVUA 1FH5H 3V4PL 1N9PA 2ZXWB 4GW1B 1EEQA 3STBA 4PRPA 3ZE0F 5A40E 4NJAL 3SDDA 4RFEA 3Q06A 4P3CL 1FRGH 3F7PC 1LVEA 4IRSB 4UB0H 3O4LD 1C5CL 4HUCA 5J1AA 3POCA 1HEJC 1KCUH 1Q9OB 4I9XA 3M17A 4CMMA 1H6FA 5CUSL 4DESA 5D8JH 3EGXA 1IE4A 1D7FA 4AJYV 5CWSA 1JZ3A 5CILL 1XGTA 3OKMA 1FAIL 3CSGA 3TA3C 2MQ3A 4OGAD 3PFQA 2XTSA 3THML 9CGTA 2VMFA 1WBZA 4PJEE 3UL4A 3PCYA 2WOYA 4IOSD 3HBPA 4OT1H 2MMXA 4PCKA 5D2NB 4QGTA 1EZLA 4WO4C 4C4KO 4R7DA 1IGFH 1S7VA 2B1AL 4JZJA 4HFUL 4NQCD 1TJIL 4WK0B 4DH2A 4ZMLA 1SJEA 4W6WB 5DZNA 5AAPA 1GS8A 2WZ5A 3TBVA 5KAQG 5KW9L 4GLRI 2VZOA 3QS2A 1M6UA 4JPKH 5TGBB 5E8DL 5T33H 4FCHA 3DBXB 4LRIA 3D25A 4R7VA 4XPFL 5FGBA 2AK4D 2R0WL 2FEEI 2Y6SD 3MDJA 3UTSE 3ZHFA 3VI3F 3HS0C 4HH9B 3LV3A 2ZXAA 2M83A 4FLSA 4CADA 4M7JL 4YDIH 4GKZB 4JN2A 3SQBA 4KZEL 2ILLA 2AABL 2VXVL 3OM3B 2Y2YA 4JFHE 3LZQA 1PZBA 1KLUB 1GOHA 2CRIA 5MEPB 1XIWD 1Z9NA 3EUDA 5B22A 4XMUA 3UO8B 1S7WB 4ZXBC 1OE2A 4RBPK 4F9PA 4YHKL 2UWEE 3ZMRA 1GGBH 1Z9PA 1JS4A 4HW6A 2G2NA 2JF1A 1XB3A 3ZBMA 3DYPA 4D9LH 3BJ91 4LLUB 1E4WL 4JQXC 2NY4B 3EGDB 3ZN6A 1FN4B 1MHHB 1BM3L 4U0RC 1A7PH 2IAMC 3G5WA 2ZOLA 2Z7UA 1P84K 3T0ED 4Q9QH 3MC0A 4XX1G 4XMZA 4D3CH 4LAQH 2W9DL 1W8NA 1ZLDA 3X12B 2DBLH 2VLKD 4NJ9L 5EU6D 5C0AD 2P80D 5C2BL 4M93B 2FH8A 3U79A 3II1A 4FFYL 1IVTA 4GT0A 4M5ZH 3CDGA 2YUZA 2MFNA 1MJUH 4XMLH 4ZPVB 5E6IB 4AE1A 1O9ZA 3MRNA 5K9KB 3WTTA 2EDJA 1FORL 3H85A 1XF3B 3KD4A 5DLMH 2K1MA 2ADIA 3O41B 1UURA 1NMAL 2JKRM 4PRHD 4CGUB 3DXAB 3W11C 4X8XA 5C07E 4HKJB 2L7QA 1CFQB 2EVIA 3IN0A 4IRSC 1J12A 2Y6TE 2WNWA 4XO4A 1BFVL 4KC3B 3HZYB 3FTGA 3F7LA 5HJDA 1Q9KB 3VFOB 3O9WD 4JDZA 5IMKA 3BRFA 4X7FC 3VFNA 1P2CA 1B4TA 1QBLH 1FFRA 2A3TA 2MPVA 4MS6A 6FABL 2V5RA 1RZKH 1U3NA 3O8XD 3VFSA 5JHDE 4G7VL 4LLMA 3UZVB 2YD7A 3L3KA 1EZSA 1L5GA 4POYA 4WI7A 1T0MA 3PQYD 5KSVB 3F85A 2FT7A 2G3MA 2WWNA 1ILUA 1TT6A 3DVGA 1VACA 3WFEL 1NCIA 2R29H 3FO2B 1BXXA 3KYMB 5AB9A 3MJ7B 2EYRB 2GJ6E 4KAQH 2AXHA 3X11A 2F7IA 4ORGB 3AM8A 4MZ2A 1NWOA 4HIJB 5HGGS 4F2EA 2NCEA 1OIOA 5I66A 5KOVC 2WO4A 1ZSHA 2WBWB 4NYLB 2XWZA 3FH7A 1CDGA 1U36A 3KLKA 3ZU8A 4K2UH 4OGYH 1CXLA 4EI0A 2MQGA 3II2A 1T1ZB 3V6OC 5IVZA 1S5IH 2Q7NA 3VFPB 5FA4A 4P5MA 4C56D 5HPMA 1EZVY 1PSKL 2K6WA 1X4XA 2WUBL 4DPCX 1R0AH 3RWEB 3M88A 3EYUH 4S11A 1QRND 2WXIA 4RISL 2AJYL 5MI0C 1XHHA 4HT1L 2ZYIA 2KDYA 4JM0A 4M6AA 4OF0A 1GAFH 1A7OH 4UQIM 5C0CB 2AKRA 3C6SB 2LOEA 4JKMA 1NMBH 1W16A 5KUMA 3HG4A 3T0VA 3PHOA 5ALBL 5EBMA 5JW5B 2F19L 4ADGA 4EUPG 5F8RC 2HLFD 1S78C 3TT1L 5E6ZA 3QQ3B 1N70A 2YLKA 3QXAB 4XP4L 4UNVA 3BAXA 2D9QB 5EZOL 4G8IB 1H8NA 4IJ3B 1CICD 4PJAE 1WZKA 2CCWA 3HPJB 5LN4A 3VFGL 5DO2D 1UM6H 3QDJE 5IBLC 2QQLH 4ANVA 4G82A 1G7QB 4PGCA 5ERWA 3QH3B 4FG4A 5IW6B 4I5BA 1KYOK 4JVUA 5DDHA 3ARPA 2JCCE 5EWIL 4WU5A 4HSQA 2NUPB 1BF5A 1EGJL 2FB4H 3C87A 2H1PL 2WCGA 3C5SB 3DX8B 4OW6A 4QDGA 5EORH 3WGVB 5IHZA 3BN9D 2WCPA 4OJAA 2J25A 4YSQA 1GC1L 2AXFA 2FJFB 1MW1A 4UM9A 2XX0A 3LS4H 1HIML 5SX4I 1GTNA 3OX8B 4G7RB 1A1NA 1ZTXE 3TIEB 4Y1SA 4JFPA 3VJ6A 2JJTC 3SGEH 1EO7A 5IB3B 3UG4A 3JXAA 2EXYD 3FB6A 2WXNA 1MQKH 2JJSC 3MOAH 5DMGD 2EIJB 3ASNB 1WGOA 3WXWL 3I9PA 1Q9LA 3H55A 3CIAA 4WJKB 3P02A 4XP5H 3WEBA 2CA3A 4WCYL 3FTVA 3VFRA 4NGHH 3OD3A 3VH8A 3ZR6A 4F37F 1V05A 4X5XB 5I5IA 2OZ4H 4CW1A 1TIUA 1DDTA 3ZTEA 2F7RA 3KW7A 2R0ZH 2A0LD 1OARL 4GRMA 5GGVH 1TTGA 4BD4A 2Y1ZA 4JR9H 4UUJA 3C60A 3E38A 4Y4FB 4RSYA 4DGIL 4HZLA 3BPLB 35C8L 3HNTH 2BINA 3S5LG 4DUWA 3QRGH 4TUJA 2X6BA 3VG0L 3W0WB 4ZAKD 3X2QB 2Q3XA 4BH8B 4BUHA 4XO8A 5D6CA 3QO1A 2C9PA 4Y2DA 3V6FB 3IJEB 1UCBH 1KIUA 3OHXA 5GIRB 2EH7H 2JB5H 1LILA 1PKQB 1PAZA 4A39A 4W4OC 1V7NL 1NM4A 2ITDB 2XVLA 4DEPB 4QAWA 4WGVB 5C08A 1ZLVK 3ZK0A 4ZDHB 2O5YL 4FTDA 2NNFA 3OB0H 1M42A 4FCAA 4I2XA 2OMBA 3D3VB 3F7YB 3HZMA 4IEFA 4TSBH 3ZL1A 4LLVA 3IEAA 4UV4L 2GCYB 3V4UL 2BXYA 4U1HB 3U1PA 1DBML 4XOCA 1Y7VA 3VD0A 3DX7A 1OE3A 1R1CA 4DP5X 4XI5D 1HOEA 3L1OH 3GSXA 4FQLH 1IO4C 2AQQA 1GVIA 5K1VA 2VDPL 1RK1B 3WUWA 3RVWD 3EADA 3EOTH 4GXVH 1QSEA 3UJIL 5C0EB 1MCLA 1MCKA 5DVMA 9PCYA 1HC1A 1T1YB 1FO0A 2LABA 3KJ6L 4FFWD 4JZOA 3WIHL 2I85A 3ZTDC 3NZHH 3R19A 3FCSA 3LSOB 3IDYB 3IJHA 4FQJH 4JANA 1J1OH 4FFVC 1YHPA 4WUKH 3RB7A 5E1AA 4G6JL 4MXQC 4OLWL 5L8LB 2BY1A 1KBGH 1PFCA 1DUYA 4JCMA 3O4LE 2CSPA 3TFKC 4EPSA 3HE6B 1FQ9C 5E8NB 3GM8A 4GIAA 1HEZA 2DL2A 5FUCC 4OCSH 4BZ2A 3UAJC 5E5MB 2IOMA 4K07A 1OTSC 3DJRA 4PB9L 5F1IB 3RDTB 5KBPA 5D7IA 2V37A 3RX7A 3WKNA 4F20A 3KLAB 5DTFA 1KXVC 3HC4L 3DVNB 1EEZA 3LKSB 1S9YB 4W9IC 4X7DC 3NSFA 4UTAA 4NSKB 4JE4B 2V2WA 3VXSB 3TF7C 2IH1A 3FT3A 1UT2A 2F74A 4Y9EA 2HUHA 4Z95H 2V7HA 2OTPA 1CYGA 2WWMD 2PPEA 3U83A 3PL6A 4K3GA 4AQAB 3VYNA 3VFUA 3CX5J 1TQVA 2HJFB 4N0FB 4F15B 1FNGA 1GGTA 2NY5H 3CZUB 3GHBL 3P9LA 4Q6YA 3RIFF 1NCTA 4W68A 3RBGA 4WKZB 4NQCE 4U31A 4AL8L 5BRQA 1IBYA 4M7ZB 3W81A 1IMHC 4J23A 2A5UA 5LKNA 1OZUA 3P0VL 2R15A 2IXQA 2FJGB 1OK8A 1G1OA 2MQ0A 3CHOA 3HHRB 4XR8C 5F1SA 5BUPA 2NMSA 1MDAA 3D12B 1R33A 3PWPA 4ZYKB 3ROOA 2AK4E 1B4JH 2F5AL 3ENEA 3GSUA 4MMXB 5B3NA 2DD8L 2YSTA 1RV6X 4ONFH 3BEWA 4Y19D 1MCIA 4WW2B 2X28A 1M7DB 2VTFA 1DQKA 4YDVB 5DHXB 3SCMC 1U41A 3RTLA 1MFCL 4RA0C 5IWLC 2Q6WA 4U6HA 1E27A 1F4YL 3BPLC 1OT1A 4AC4A 5DD1L 2ESVA 2DQCH 4XXDA 5IJVB 2R9HC 2EDHA 2OTWA 1K3ZA 2Q8BL 3GHEH 3ILDA 4NQDA 4MQXC 4UDTB 2OMZA 2K4AA 5CCHE 2VAAA 4AE0A 3BIBX 4WI3A 2OI9B 1CGUA 1CTNA 3EYOA 5IMOA 4UT7H 4WHTB 3B8SA 1YEKL 3QORD 4G71B 2K0RA 5J6HB 1R9FA 4DEPC 2ATAA 1NBVL 4P06A 2AJ3B 5DHYB 4M62H 4N6RA 4XC1H 2ZCKH 1D7BA 1ZLSL 3IKCA 3QDMB 5AALA 5EFIB 1JZEA 3T0EE 5D5MB 4DKEL 2D3LA 1HXYB 1QSFB 1JNNH 5JPNB 1ZS8B 1I9EA 2LE9A 3KYNB 1MG2C 1WZ1H 2VCOA 1P5VA 3FT2A 5C0AE 5HYSB 3V4VA 5I71B 5FA3A 3QNZA 3FUNA 2EDFA 1SY6L 2DI9A 4KBPA 4WU7A 4BQ8A 1DZBA 3OAYH 2FQEA 1L6PA 3IGAB 4LVEA 1M7IA 4OVVA 3U7AA 4EI5D 4P46D 3DJTA 5EEUA 3HZ3A 2GUOA 3HI5H 2UV3A 5IHHA 4Y9CA 1SYSB 2BSTA 1BQHG 1MI5A 2ZUXA 3LOWA 4B9FA 3CXFA 4PRHE 3ZQXA 2IWFA 1D5BB 2G30A 2G9HA 1U92A 2BZ7A 3DX1A 4PJXF 3HE6C 3Q1SH 1K8DA 4WV1A 5DFTA 3MBXL 4HHAA 5DI8A 1GRWA 2QKIB 1KWGA 1GJUA 1LHZA 5DJ8A 5DZPA 3RDTC 3WIIL 4ZQKB 3W57A 3BMVA 1A4JB 3CDFA 4QRTA 2OMVB 3V4PH 1YYLH 2R1WA 1G87A 2HPTA 1PZ2A 4A63A 4OZIA 1TZOA 5FDWA 3VXUE 4L8DB 3FSZA 3PQYE 2BIQA 5LXGL 1NGPL 2JIXA 5GRWA 2WSDA 5TE6L 5FC9A 1QNIA 2JE8A 4FLRA 1CT8B 1YSOA 5I73C 3CE1A 3OKDB 5I1HL 4WUUD 3K8MA 5CZXC 1T80A 3G6AA 1BOGB 1N5YH 2VRKA 4MZRA 4FLQA 2O6CA 1I8IA 4LSPH 4Z7UA 5IEKB 1ITBB 5EPMA 4EDXB 5FM5M 1DQJB 1FAIH 4FAAB 1DBJL 1A7BA 1TU2A 2G60L 4M5YL 1RI8A 3FB5A 1IUZA 2ZUVA 1JNHA 2QELA 3BN3B 1QRNE 1NGXA 2W80C 4NO2B 3BUYB 1P4UA 5BS0A 2VN5A 3DMMB 1JYWA 1HQ4B 2BIHA 4L2LA 4LPCA 4GY4A 3QI9A 3GRWH 3I74A 3V55A 3GSVB 3FCGA 5I0DA 3G08B 5EBWA 1I31A 4BKLA 2FR4A 4BFKA 4Q4IA 2WXHA 1BZQK 2QQKL 5IBTH 4AYBA 2ENPA 3KPRD 4BH7B 4DVBB 4MCYA 4U1MA 5KYWA 1TJHL 1A4BA 2ZAGA 3ILQC 1JWUB 2VZVA 3M07A 3GMNA 1AH1A 2BC4B 2WKOF 2BVEA 4JM2A 2CJUL 1NDMB 2YWZA 3NA9H 1BJ8A 3VGDA 3GGWB 5CJXC 1BFOB 4PQXA 1T22B 1ZTMA 4DFIA 3PU7A 3VI4E 3STZA 3BKJH 4JDEB 4N22A 2BRRH 4M7JH 4RAUB 2QGBA 4XCEA 5MEOB 2X4SB 1NKOA 4XAWH 4DJMA 2F7OA 1HCVA 2VXVH 1HHKB 4XXCA 1P5UC 2HFGL 3CSTA 3NIGF 3O2VL 4L8CA 3L3OC 3ZDZB 3LPOA 2EVFA 2WSKA 3SJVE 3P3TA 1J9QA 2W07A 5D7JD 2WJ7A 2XPZA 3FQUA 1EMTH 5CKAA 1N8ZB 5TE7H 1A6ZA 1QUNA 2LTQC 2HWZH 1MLBA 4B6ZA 4R84A 2VXQA 1IAKA 5IVNA 3PGCB 5I71C 2BNRD 3QYNA 2OMTB 3X17A 1Q94B 2WIIB 5IB5B 3CG8A 5CGYC 4LSUH 4U1NB 1BM3H 4ELMB 4F8LA 3ULVL 4WI4A 3NJFA 2CH8A 1ZK9A 3GXFA 3IDNA 4GUPB 5H37A 1KB5B 3RJOA 2X1OA 3ZDXB 3MACL 3VMOA 2MKLC 1ADWA 3BDBA 4RMQA 4WY7L 1KENL 3DOSB 5JDJA 4PD4J 1DTUA 1HNGA 2CGZA 2VDQB 3MJ9L 1ZXQA 3BQUC 1JN6A 1YNTB 2X1XR 2ZTBA 1OF2B 3CBRA 3L4CA 5I17B 4TLUA 3D08A 4XHJD 4WW2F 4TYUA 5I76A 4UYQA 4QYAA 5JPMC 3MNVA 2OYLA 1NMAH 4XE0A 2EZ0D 4GKOA 4OUUA 2ADJA 4JKPL 4YHNA 2YOAA 5KVGE 3R7RA 3UABA 4N6QA 1AOHA 1RIUL 4Y9BA 3WLWC 3GBNL 4N2BA 1H5BA 4LU5H 5EIQA 2WGNB 4L3CA 5DJAA 1KNOB 3EOBA 3PWVB 2GSGB 1EXGA 3FSAA 5I8KH 5JUEH 2WP3T 3FO9A 1F11B 5I1JL 4JFOA 2DIJA 2G5BB 4G7VH 1L0YA 4YUEL 3MBEB 4NZ8A 2CO1A 2XWJB 2P46B 4X4KA 4YC2C 2JJVA 1BMGA 5C0JB 4BFNA 4ONHA 4A2DA 4BFOA 2Y25A 1DJXA 1NWPA 1V10A 1MELA 2XN2A 3OXSB 2YSSB 1I3RA 2VDRB 2DQHL 1A25A 1K8IA 2YD4A 3V0AC 5C70A 7CGTA 2LVEA 3KPPB 4V1DA 1L9PA 4AVKA 4B9JA 1OAJA 1CDYA 1L7IH 4HBCL 2EEXA 3TZVC 4FFZA 3RUGA 2G9KA 4UIMB 2P8LA 1VADB 4ZNEA 3TCTA 1OT4A 4W9KC 2IALB 5CLXA 4CNIB 3HVNA 2UZXA 3RZCD 2WBJC 1T66C 5T5NF 4L8SA 4HPYH 4F80A 1WHOA 4NQED 5E2VH 5EG6C 3SDXE 4GRWE 2A6DB 2JKIS 3I6LD 4JFFD 5IKCB 5LAXA 3TYFA 3MZTA 1PEWA 3BFQG 2XG4A 4FYSA 4M61B 3T4AC 3MRKB 5FV2A 2F19H 3B2MA 4IK6A 4N2EA 3EHBB 3QCVL 1FZMA 3VWJB 5T3ZE 2KH2B 2B2XH 1N6QH 1WJ3A 4GP8B 4DGVH 3I6GA 5FR3A 3QUHA 3NRPA 3GRGA 4JJHA 4HWNA 2EIBA 3B7YA 1PFOA 3QQDB 4MWFB 1KG0B 2PWFA 3CHQA 2MCG1 1EEUA 3JYBA 2WAHA 4PWIA 5HXMA 1G0XA 4LP8A 1UXSB 3WFZA 4NCC1 4Z3IA 3BP4B 4WKXA 1A7NH 1S6NA 2BCMA 4J1UB 4A6YB 3HC2A 1E4HA 5GJSH 2IBZX 4Y5XB 4OLYL 1H3PH 3DHUA 3MYZA 3ZPDA 2J5LC 2NY7H 3CVHH 1DVYA 3OB0K 2OMXA 5HDBE 4DSYA 1FFPB 1T6BX 3FHAA 1P4LA 3K6IA 3NFPB 2E75C 3WFHB 4F8QA 1UGNA 3MRLA 4FNQA 4Y2OA 5DJCB 4EN3D 1YY9D 1WWCA 1WC7B 3BSHA 4UT9A 3CUPB 3N3EA 4E9TA 3CFBA 1B4RA 1VKXB 4LEXL 3F7VA 3QWRD 4YQXH 4J8RA 4JO2L 2D7NA 3GSNH 3WO4B 1JGUH 1P0SE 3GMRA 3L2LA 4PJEB 3DTDA 4DQOH 5ICYB 5JYMA 5KVFL 2VZ1A 1HU8A 4YGVB 1A6AA 5E24E 4W70A 2E4FA 3JVGA 1HOCB 3F3HA 1CFTA 4P8QA 4IHBA 3IKKA 4K5LA 4IHOB 1KEMH 5DSCB 5L2KA 1Y6KR 1DQDH 1MJ8H 3JV0A 4MB1A 5L0QB 3PAYA 4ZW5A 2LVCA 3LKNB 4G8FB 4QO1B 1YA5A 2O6PA 1EHKB 4XN1A 1NFIA 4JO3L 1R24B 3SOBL 2DWSA 5ICXB 4KUZH 4P5TB 3K2KA 4N26A 2N1KA 3O2WH 3QWOA 3UTSB 1FHNA 1O9VA 3OGOE 2W81C 5B1KA 4IRZA 3RY6A 4HC1A 4BA0A 5AVYB 5BQ7A 1OCZB 4NUMA 2C4XA 1HKLL 3IFOB 4QI3A 5I6LA 3FUKA 2ENYA 1MHCA 1KWKA 1KT2B 2XRAH 3DRTB 3UBGA 1J87A 4P9MH 1CDJA 4HJEA 3DNKA 2FX9H 1SLXA 3FH5A 2CNZA 2A74C 1QZ1A 2EYSA 1H3VA 5F6HJ 4YPGA 4ANWA 5FB8A 1NC4B 3WL9B 1V7NH 2C3HA 5DWUH 3RQ3A 1FNEB 4PBDA 5EDSA 2HRHA 2UWEB 3MMEB 3B7TA 2GY7B 3MRJB 3KNBA 4HUWA 4ELMF 2DQFA 3H56A 1JUFB 3KYKL 1S8DA 1UTDA 3AW5A 4F1SA 5IGXH 4DN3H 4QY8B 1R3JB 3RWJB 5KVDH 4M8UA 1DBMH 3VI3A 2BS8A 3PP4L 3KLLA 4L5FL 2FUQA 4YFEA 1QWHA 4Z0BH 4ETYA 3ZDWA 4DTGH 4LOVA 5K9QI 5E5LA 1GYAA 2VDPH 3ZTJH 5JIHA 3EDDA 4YDKL 3EHBC 3LVEA 4K9EC 1MCFA 5ABAA 3VWJC 1SZNA 3VFMA 1ZGLP 3BP6B 3FFOA 4AUYA 3FULA 3IXAA 1KULA 2H0JA 5E1QA 5GZOD 2N4IA 5D7KD 3VXME 3HBGA 3B4NA 3EYVB 4BGLA 2DQMA 2B9BA 1BM7A 1C7TA 1DEEA 2WY3B 3QBTB 4WWKA 1E42A 1LQBC 4G6JH 3V0IA 4BM7A 3ARTA 1SN2A 5ESQB 1XGYH 4PTUB 5C07B 1K2DB 1MAMH 3VU1A 4I18C 1X6NA 1FYTD 4Y5XC 4ODTH 2JKJA 4WUUE 4E68A 3MX0B 4A66A 4R96A 5E4OA 1VFAA 5CHNA 1ZAGA 2OR8A 3RL1A 5FYLH 3TA3A 4OD3L 3FQTB 1GL4B 3BRGC 2BVQB 5EF3A 3L6FA 4PJFE 5JHDB 1MH5A 4AV4A 4LLYA 3WY2A 3C8HA 3K6OA 3VRJA 3IYLW 3T0BA 1J1XL 3LNEA 2YA2A 2CO6B 1AGCB 3LDBC 4RNRA 1U8JA 4HJ0D 5HSFA 4QXGH 1JXDA 2GJ6B 3GHBH 2W8CA 3FPXA 3OAYK 5FGCE 1NTDA 4R97C 1VDGA 1TZHB 5JO5B 3OR6A 2D7QA 1DLFL 1WVZA 4U3SA 2LLGA 2YXVA 4OM0L 2I9TA 1BBDL 1QSZA 4PM1A 3AU0A 2XFXB 2Z8SA 3QCTH 3BXNA 3S96B 4UQBA 1A6UL 2XT1B 2P1YA 3KPRE 4Z5RA 4Y4HC 3SE8L 1QKZH 2G4EA 2AEQL 5FF6B 1FHGA 2K7PA 2ZYSA 2BSCA 3P4NA 5J9PA 2MQCA 2HH0L 4NNYB 3HS0A 1N10A 3AG1B 3WTYA 3EO1A 1XGUA 4B27A 5F88B 4L2YA 1XXFC 3QO0A 1X9RA 4A2MA 4GG6E 4KGJA 1M6OA 5ADPL 3SY0A 3T4YB 4G6FD 1DVUA 5DD1H 3LQZA 5IF0A 5J13B 4BXSV 3F58H 5CIPB 4GQPH 3HUJE 1GJWA 1HQRA 3EYQD 2W1NA 4KX8A 1M05A 4IDJL 5I30H 3ARFC 3ARYA 4ZXBA 4TF4A 2H6UA 1IT9H 1I1YB 1FYHB 4J3WA 1BD2A 3WO3B 3GEFA 1MZZA 5I8CB 1B2YA 3CFTA 4GW4A 2YGNA 4PJAB 1CE1L 1KGWA 4I0PB 2Q76B 5KANG 2BNRE 2K70A 5DQDL 3ME0A 5EC2B 5GSVA 3SKMA 3QDJB 4BCYA 4JQXA 4NC1E 3WKPA 3NN8B 4HKXA 4XNQB 4L3ED 3ZTNH 2Q20A 2DQ6A 2IAMA 3QJRB 4HCRA 4X9FA 2V3EA 3QFDB 1BZ9A 4XP1H 2FWOA 3M46A 2JCCB 3QSKB 1DE4B 2ZKMX 1EZVX 3FO0L 4KJQD 3NZSA 2WQUA 5EOTA 3CFKB 3UGUA 5A3ID 5AOIA 3S4SG 3SO5A 3OKLB 3UXFA 4HWEH 3I2CH 5AG9A 4U1IA 5C0RH 3SDDD 1I7UA 4PJEF 2LAAA 5D7LD 3W2DH 4PMEA 4PWKA 3RG1C 3SKNB 3TIDB 1CBVL 1N7MH 5BO0D 2WAQA 4IKJA 4GW1A 4NKMB 4IIQB 4WEEA 1FSKB 1F58L 1FZKA 3BAJA 1PD1A 2PP7A 4UF7C 3PRZA 4IRSA 2JB6B 2CWRA 2B4CH 4KXAA 4AEIL 4GINA 4FQXB 4QTFA 4XNUH 1BQLL 4LNRB 1Q9OA 2Y06H 4X6FB 3L3HB 1E3XA 3LKOB 3WJJC 3WTUA 5EIIG 3WIIH 1R34A 2Z0BA 4QKXB 4IRJC 1SXZA 2ENQA 1NSNL 1KCRL 3EO9L 4KY1L 3MLVH 2X70A 2IWEA 4YH6A 1GMIA 2BM3A 4P3DA 3MXWL 3N42B 4POZD 2MCMA 3DJ9A 4N20A 1T4KA 3QUXB 1W9XA 4YHZH 2E6JA 1OSZB 1X5JA 2L3BA 3QZNA 2ED8A 4AIZB 3WFDL 1W72A 4IMLB 3OPUA 4E9VA 3H42L 1ZDSA 5EZJB 3FAXA 3NRQA 2YJLA 1ACCA 4RH4A 2XBTA 1JZIA 4LOEA 3BZ4A 5AW9B 4IBLT 5IQ7L 3V6OA 5LGKA 4P2OB 1N68A 2DOCA 5C3IA 2G60H 3FYIB 4HCGA 3TBSB 1YJDC 3HA0A 3DI3B 5CO1A 1P6WA 4PMFA 3ARGB 4OF7A 4BQ9A 4NQEE 5JIMA 5LCVA 4WEBH 1KUMA 3HAEB 3BGFB 2CZNA 5C0GA 2ADFH 3T6ZA 4JFFE 3HNVL 2E9JA 4CMHC 4M8QB 3CVIH 3V0GA 4HH9A 4NQVB 3O0RH 3BEVB 3IFPB 3R7QA 1AZZC 5K9JL 1XH1A 5GGTA 4UV7L 1Z3RA 4AIEA 4NWUH 1G0YR 4KQ4L 4HK0A 1E8XA 3MLWH 1G9HA 3FQXB 2H0EA 3D1MC 3P30H 2Y22A 1GYUA 2BVOB 2CJUH 1P4BL 1R17A 3QYMA 2LT9A 2VC2H 3FUEA 1INEH 5TFSH 2NR6C 1WZLA 5J57B 3MLSL 4LLUA 1FN4A 1I8KB 1MHHA 2EDDA 1NC2A 4FX5A 3O4LB 3BDYL 2MSPA 5E00B 2CK2A 2C7FA 3X14B 3ZE2E 4HDIA 3A6BH 2W0FB 4RGOH 4OQTH 4P2CG 5E5UB 1BZOA 4C57C 3V9CA 3BVNB 3IMTA 1ZVSB 2DICA 1W0WB 3SO3B 1VGEH 4DWHA 5I1IH 3ULVD 1NGQH 4YR6B 1QLFB 3MTRA 1DJGA 3CDCA 1QFUH 3K71B 4ZPVA 4B9YA 4JHWH 3ZLQC 1XF3A 1F02I 4PJ6A 3U30C 3CFIC 3FZUD 3SYOA 2VERA 3BOVA 3DXAA 1SNRA 1AXSB 1A64A 3A47A 3BUDA 1OAZH 4HKJA 2XTJD 4IBZA 4PYGA 4DHLA 1CFQA 4R8WL 4OD1H 1MVYA 1DEDA 4NQCB 3A5VA 1FGVH 3P2DA 4FQXC 3FU5A 5JOFB 4TUOB 1Q9KA 2CK0H 3KGSA 2XXGA 5B4MD 2WXLA 2YR3A 5LBVA 1TQSA 4A2LA 4M43H 1KXHA 2A38A 4FNLL 4M9OA 4XZUB 3S2AA 2AK4B 3MUZ1 4XPAL 1ZWIB 1QMUA 4F5CA 5KSVA 4G6ML 1HSBA 1K72A 4E9RA 5E7FA 1A0QL 1H3GA 2EYRA 1HXMB 4LARH 4EAEA 3U4BL 3EFOA 5IQOA 2XWTB 3DRQB 4YL9A 3HN3A 5FLVA 2QSCL 3GBNH 4HIJA 3NABL 2PXYD 5GS2D 1OM9A 1UASA 4M5TA 4MNHA 1OY3B 4L3AA 2CHWA 3Q48A 5C9KA 5EOCJ 4LGSB 3KXFE 1YAIA 4YUEH 3NP3A 2G5UA 4ABUA 4W4OA 1T1ZA 5J1TC 2APSA 4JN1H 3VFPA 4CN6A 1J9RA 1QPPA 4H40A 1TO5A 5F1KC 5EOQH 1PG7W 2FWSA 4PREB 3RWEA 2VXSH 4BZYA 2YPVL 2XVKA 1NUGA 3BD5A 2R2HB 2FEDC 1G6RA 3L81A 2A99A 4YMPA 2J2ZB 3BGFC 2NQCA 2QVMA 4NZJA 2YO3A 3AG3B 2YIHA 5CJOL 1M2OA 2AXWA 1Q4NX 3N1QC 4Y1AE 3CHSA 4U6YA 4PLJD 2XXCB 3GI9L 5JW5A 1TQCB 3T0EB 3ZMNA 3U6RB 1RJLB 2D7MA 4HLZH 3BVTA 4XNZC 2HT3C 4PJ9D 3BYYA 3EKCA 2P8MA 1OP3H 3S36L 3U2JA 5DD0L 5C0AB 3ZKMC 1Z66A 1C1EH 2BOCB 2X1WL 2Y69B 5J4MA 4E42B 3GMPA 2GI0A 5D7KE 3NCWA 3HPJA 1I3UA 1T20B 5IB1B 2I7OA 1G7QA 3QH3A 4HJIA 4RGNC 1IGTB 3T0AA 5IW6A 5DMIH 1YN7B 3ZL4H 4PRHB 5IBUB 1NDTA 4YFLF 3MNZA 3ZY7A 3BVWA 3QP3A 4YHIB 1FYTE 3CZFA 1KJ2H 5AQ0A 4N8VG 2X42A 4UM9D 4F57L 2NUPA 4YSOA 4MKMA 1R3LA 1KXVA 3O9WB 3ATDA 2NY0C 3IDUA 3DX8A 3NEXA 4O58H 4NO5A 5AAMA 5C2UB 4PGBB 3N42F 3SO3C 1H15B 1IQDB 4W9HC 1FG9C 1OGAA 4CGTA 2HT4D 3ASOB 2WZAA 3OX8A 3TCLA 1CDIA 1T5XB 3VXUB 4ZFOL 4KTYA 3PQYB 2HB0A 1LO3L 2EEBA 1OP5K 1FV1A 3VO0A 3H0TB 5I74B 3BUIA 4LCIL 3SGDH 4AG4L 1SM3L 5DK2A 4NC2B 1WO2A 5KYXB 4GOSA 5CSBA 2VXUH 4FQPA 1A6TB 1BYOA 4I8DA 4TQ8A 2XY2A 1HTYA 5HP5A 3CH8A 1VPOL 2NQ3A 1A6WL 2P5WA 5IB2B 4EZJA 4LEXH 4PJXA 2JKXA 5HHOD 5TF1L 2ICCA 4ERSL 2A9BA 1CPUA 4JREB 3A6OA 3DX6B 4GAYA 4ZX6A 1E40A 4GXUN 5EC1B 8FABB 5M94B 3ABKB 2AMUA 1WEJH 1QRNB 3UCRA 3M1OA 2CHXA 1UJ3B 3MRCA 4DZBB 3SCMA 5HDOA 5I1DB 4Y4FA 2JSFA 2J20A 1EJOH 1KLGB 4NBZB 5IWLA 3HI1A 3VX0A 3APMA 3N43B 2I60L 1LP9E 1EO8H 2BP3A 2N59A 2UZIL 3ARUA 3FUJA 2V3DA 4FTVD 4WWID 2BP8B 4BH8A 3FTUA 5IT2L 1Z9OA 3V6FA 2UUDH 4M4RB 3HS9A 3IJEA 2Y2WA 1RSFA 3C12A 5HHNA 1JV5A 5F7MC 1KPRB 2OL3L 5LXVA 1XIWC 4D2NA 1IBBA 4AH2B 2OA9A 3QDAA 1GYWA 3FQWB 2R1XB 2FRGP 3VD1A 3FCTA 2O6EA 5ES4B 4EOWL 4N2HA 5KOMC 2AANA 4L3EE 3VI4B 1ETZB 3D3VA 7PAZA 2VKWA 1TCMA 2BW5A 2DTML 2WYIA 3F7YA 4JQVC 3VMNA 5AUMB 1DQMH 5KS9E 4HISA 3Q6FA 1XR9A 4DEWA 4KX7A 1G7LB 5GRUH 3SJVB 3CDZA 1BGXL 5JXEC 1PNCA 2HTKD 1TQCC 5AVRB 3T0EC 3WKQA 1NUDA 5CJQL 4XNYL 5FO8B 2BIPA 1MVFA 1IC5H 1SDAB 3QG6B 1IC4L 4E36A 3L5WA 1T1YA 2DQJL 2EAEA 3DURA 5D7LE 3PGDB 2EDOA 3KYKH 3LSOA 2FEJA 3GFUA 3MRRA 1NAMB 2WNXA 4JM4L 5JLZA 2WKOA 3B2VH 3H2PA 2O5XL 1PYWB 1FL6A 4ZMAT 4Z3TA 5JHBA 4L5FH 4TPRL 4K94L 3GSQA 3IFLL 1LO0H 1AKPA 1HHGB 1JTOA 3HE6A 4MMYB 3SPVB 1RZJH 1DJWA 5E5MA 1INQB 4JRYD 4HJGA 3RDTA 1RZKC 3JTTB 4X6CE 3N40P 1U91B 4G7YL 3SDAD 4PWEA 3LKSA 3DVNA 4UINL 1S9YA 5DC0A 1DQVA 1BAFL 1PKOA 3PL6D 4KHXL 1T83C 5D4JA 1EVUA 1R3KB 4JB9L 5B1AB 1CG9B 1T1WB 2Z92B 4NSKA 5A16B 5FHBL 3VXSA 1WTGT 3BHBB 3O8XC 3RGVD 1FA4A 3IJSB 1J0IA 4MXVF 1WBXB 4AQAA 4QHNA 3KGUA 4LKCB 4XCFL 2HJLB 1AIFB 4N0FA 2CKBA 1CF8H 2HFEA 2H3XC 1MCRA 1CGYA 3MU3A 2YC1B 4F27A 4ZAKB 2IDCA 4JGMA 1E2ZA 4NN7C 5KVEH 3U6XA 1WD9A 1NEPA 2GTQA 3MUHL 1EPFA 4EF3A 4Z18A 5J11B 3IDXL 2FJGA 4P4KB 4PHXA 4YXLH 4ADIA 3ZW3A 2ZOOA 1WUNT 3FRPG 2NY2D 3LB6D 3A23A 1JG9A 4ZYKA 3MYJB 4JREC 2PWHA 4MMXA 2WB1A 1V8HA 3DUUB 4NT6B 5E08L 3SQRA 4WW2A 1M7DA 2AV1A 2DIEA 2ZCHH 4YDVA 1UJ3C 5HYEA 2NT0A 4NDMB 1RUQL 4JQIL 1P6FA 2J6EA 4QTIL 3S36X 1XSIA 5AG8A 1LK3L 5IJVA 2J57A 4XP9H 2Y36H 2XV6B 4JG9A 1YQVH 4MZIA 5BPPA 2EO7A 3D2UD 4PS3A 4UDTA 3ZZ1A 2AEQH 2QBWA 1G6VK 3BKCH 1YNLL 1CCZA 3G6JE 2CKNA 3MCG1 7PCYA 1JOIA 2AEPH 2P26A 5CD3A 2ARJQ 4HIXH 2KKQA 3G7TA 2LW3A 4Z0XB 5CJXA 3SDXB 5FCUH 4GRWB 5J6HA 2HJKB 1IC7H 1ERNA 1QI5A 2E9BA 1TF4A 3FQRA 3PWLA 1TUPA 1CICC 1EXHA 4OGQC 2AJ3A 1SLUA 2ZF9A 5DHYA 5DO2C 2X6AA 4NXKA 5D7HA 3VRLE 5L7XL 3LCYA 2O93L 3QJVB 4ENZA 4MB5A 4DKTA 3NT0A 3QDMA 4JY6B 4FQ2L 4HUXB 1MCPL 4OV5A 2PMZA 1F6LL 3RTQD 1JGLL 1KGIA 3HR6A 1SVCP 3HN8A 1WBYA 4YPJA 3L95A 3F2LA 1QSFA 5D5MA 5D96C 4J7RA 2WVVB 2AQPA 4XWGH 1RPUA 4C4KT 4KK8D 2WVSA 3ULVE 5HYSA 2BP0A 4XPGL 3B2UC 4XTRD 3QQ4B 2DJMA 3CD4A 4ESKA 4GAJL 4BK8A 1HFUA 4QRQB 3IGAA 5F1NA 1ES0A 1AGEB 5K1JA 1T6VN 4D8PB 1XZWA 4FGMA 3UADA 1UYWL 1B3JA 5JW4N 3PG2A 3RNQB 2XWDA 2ZXEB 3NCEB 4UI2A 5IHLB 1JHLH 2AJXH 5HHPB 4MXWH 3EAKA 1E9PB 5DMGC 1CXEA 1WGVA 1UC6A 5HDBB 3TJHD 2H6PB 3SBRA 2ZCZA 5HHMD 3IAQA 3WN6A 2NXYB 3FBKA 3AVEA 3CFEA 4NENB 5DMKB 2D3NA 2V7NB 3VSQA 5CCKH 5I75C 3TN0D 5DUPH 4ZQKA 4BE5A 1OQXA 2JIXD 2OMVA 4OFVA 4H0GA 4OJYA 2BW4A 5JPMA 1T2QH 5F7UA 1C5BL 1JZ4A 1PZSA 5AWNL 2A0LC 2DS4A 1N2RB 4GSDL 1MW0A 3S35L 3N43F 2VNCA 4WIQA 3HW7A 2DAVA 4AEIH 4IOFD 4LLWB 3WTSA 5JIDA 1MCNA 1IE5A 1CT8A 2XV0A 1TYRA 1W72L 3OKDA 1ZEAL 4GG8B 3B9AA 4N1HB 4Z23A 1REIA 4OFIA 1FIGL 4KDWA 4ZUWB 2UVEA 2XETA 3B7SA 2JQAA 5IEKA 2ZKXA 1KCRH 4L0PB 2F1EA 5BV7B 4KRLB 1RP9A 5BS0D 3JWNE 1KIQB 1A3LH 3OPZL 1UHVA 4MDJA 4RGMB 5JDSB 3VI4F 3NCMA 1U8MB 1MRFH 3KDMB 3UO1H 3QORB 2C9AA 3KM2A 4HA1A 4TSAH 3VM7A 3QUYD 5E03A 3WFDH 4NO2A 3BUYA 1INDL 4MA1C 2OCJA 1HQ4A 2R2CA 1AFVH 2I7SA 3NCCB 5EF2A 1UWEH 1NCDH 2KQNA 4H88H 3TZVA 1KSRA 4KKZA 5I1GH 4R26H 1XF2B 4CU7A 4X7TB 1MSPA 4BH7A 1CI5A 1MIEL 1I75A 4XI5C 5AYQA 1BLNA 4DVBA 2WBJA 3GPSA 3ARSA 2R0LL 1BAGA 4HFWB 3T8XA 1X9QA 3MN8A 2BVPB 2W9EL 4AMWA 2COQA 3WYRA 1A14L 1NDMA 1OXYA 4FFWC 4EI5B 3O45B 1AO7D 3GGWA 3L4UA 5JMOC 3BSZA 1BFOA 5HD8D 4FQCL 3VSVA 3T4AA 4JDEA 3FBQA 5F6IB 4RAUA 5MEOA 1Q1JL 4KHTL 2A4EA 4EIZC 1HVXA 2AXGB 4NI6A 3CLFH 2ZYHA 4U1JB 3UJTH 1HHKA 1HI6B 5D2LE 4XWOD 3V4PB 5C1MB 2TSBA 3D9AL 2EDNA 4OCLC 3NAAL 1PY4A 1DBKH 1TTAA 3LS5L 3QJXA 1OOWA 1YEIH 3V7AE 2XA8L 1UZ6E 3OJMB 4KKRA 2ZXQA 5G2NA 1WLHA 2F54D 1YEEH 3QRFM 2YZ8A 6PAZA 3VXMB 1AXTH 1KV3A 3PGCA 4A67A 4IJTA 3EO0B 2OMTA 4BELD 1Q94A 3MLSH 4N2GA 4YNYA 1Y6MR 4I3RH 5DJ6B 4NPJA 2NY5C 4M7LL 3ZKND 1JZ6A 3DO3A 4ELMA 2XWRA 1QHPA 4M03A 4HEMA 4ZUUA 3FN0H 5IVXE 1S7UB 3U7WL 1IZJA 1XAKA 1KB5A 4G6KL 4WUUB 3D18B 4G5AA 2HVJB 3KL3A 1DP0A 1IC1A 5KVFE 5JHLL 3DOSA 4H1LA 1E50A 2AVFA 1CYWA 4XBMA 4K73A 3V5DB 4G72B 4DO4A 1GZQA 4HS8H 4UZSA 1B0IA 5HHOE 3QJOA 4HMEA 5I17A 1OF2A 5FW8A 4PJFB 3M1CA 1ADQL 4AI7A 1OP3K 2VDML 2CHZA 3LZNA 3VAEA 3BIKB 1EHXA 3D39D 4PY8I 1EXUB 3HOGA 1IAMA 5I6OA 1M3JA 1BFTA 4XHQA 3UYRL 2RCSL 1N5AA 4R8WH 1G4MA 1F5WA 5FGCB 4FKKA 1TQTA 2A73B 5DJDA 1O7SA 2OFQA 3BAIA 4QTHB 1YC8A 3S48A 5T5FL 4EZMA 4Y5VB 4MNGE 3NPSB 1KEGL 1I4FB 5T8IA 4FTVE 4DP0X 5IROA 3AFLA 2IAAC 1KNOA 3PWVA 3KPRB 1L0XA 3CIQA 3KH3A 5A3IC 3EJSA 1F11A 1P4IH 2G5BA 5KBLA 1OTTD 3MBEA 2FATL 5BV7C 3LZFL 2XWJA 2BOLA 1RZFL 5C0JA 3C6LC 1LYQA 3IMUA 2ZCLL 3HC3L 3CSFA 3ZE1F 3UAEA 1NMCB 2YSSA 5H2BA 3U4BH 3ZT7A 4DK6A 1L7TH 1HWGB 2FIKB 1M57B 2H8PB 1G6RL 4LASL 4RMWA 1CFSB 4GG6B 3NABH 3SE6A 4A37A 3KPPA 1QSEE 3PJSB 5T3XH 1VZIA 4N2DA 1KACB 3TOPA 3AXLB 3HUJB 4AZUA 5IJBC 2WQSA 4QHPA 1R3IH 2A74A 4UIMA 5D7JB 5HPOA 1IU1A 3QIBD 5K59E 4ZS6D 4GSUA 2V8LA 2B1HL