3JT2A

Cu(ii) n47s/m121l variant of pseudomonas aeruginosa azurin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 31
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3jt2A00
4A66A 4YSQA 3S3BB 2DWTA 2DYRB 1WS7A 2HX9A 2NRDA 1AOZA 1AZRA 2AFNA 4JHVA 4DPAX 3ABGA 1PLAA 3DKHA 3CVCA 1L9TA 3NJFA 7PAZA 1V54B 3L45A 4HCIA 2AVFA 4GY4A 4DPBX 2JFCA 2VM4A 1ETJA 4YSOA 2QDWA 3AZUA 3ZIYA 3ASOB 5F7BA 4F7KA 1PNDA 2FT7A 5I6KA 1SFHA 1J5CA 4AKPA 4BWWA 3H56A 1TU2A 2BP0B 2QPEB 3NSFA 5B7EA 1FFTB 2RACA 4A2DA 1ZIBA 1AAJA 3AY2A 3PAUA 1JOIA 4DP9X 2FJSA 2B3IA 4GP5B 3UACA 2XWZA 3OQRA 1JZEA 3NJLA 1NIEA 1L9SA 4N8UA 3FPYA 1NPNA 3EH5B 3ERXA 2FWLB 3T6ZA 1PZCA 2XV3A 1KGYE 3WIAA 3S8GB 4KNUA 2Q9OA 1ET8A 3IN2A 2FTAA 1WS8A 2CJ3A 1JZIA 2IDQA 2XXGA 4MFHA 4QLWA 1AG6A 2PP9A 1KBWA 1KYAA 3SBRA 2BZCA 5D4IA 1GYCA 1ZV2A 1V10A 2XX1A 3WNJA 3GXUB 5AKRA 3NSCA 4EF3A 2WO3B 3FQ1A 3ZX1A 4YSSA 1GW0A 4JKNA 1M9WA 5IY5B 2YQBA 2BW4A 3QJUB 5EHFA 3S3DB 4UAHA 3IN0A 4KO7A 5TK4A 2VSKB 2GBAA 3NP3A 4YVUA 1A3ZA 2DYSB 3FSWA 3WI9A 2QPDB 1NICA 2GC4C 3UAEA 5I6MA 2EIKB 4DP4X 1NINA 1ZIAA 2HZHA 3IEAA 4A67A 3GDCA 1X9RA 1ASQA 3AG1B 4JHUA 1NIBA 1CC3A 1UATA 1URIA 5ANHA 1A65A 1N70A 1OCRB 3H4HA 2P80A 4YSCA 4WTQA 4KO6A 3NJMA 1WAEA 4KNSA 1A4CA 1J9QA 5B1BB 2W88A 4KNTA 3QJVB 1SHWA 2MRYA 4E9XA 3PAZA 2GB2A 2JKWA 2EIMB 2UXVA 3CVBA 2EILB 1JVOA 4AZUA 5F7AA 4FAAB 1IUZA 2UXFA 2IDTA 4RH4A 1WA2X 2YXWA 1J9RA 2EIJB 1RZQA 4G7RB 2XVBA 1PLBA 1SDDB 1SJMA 2UX7A 4A2FA 4CSPA 3NJJA 5A7EA 1J9TA 3QQXA 2XUWA 4HIPA 4NERA 1MZZA 4E9WA 2J57A 1KDJA 3AG3B 2CBPA 4NB7A 4NAJA 4DP6X 2XU9A 2N0MA 2BW5A 4KO5A 3BQVA 3NSDA 1W6LA 1PNCA 1T5KA 1A4BA 4AKQA 5I6OA 2LLNA 5I6NA 3ABLB 3KW8A 3FSVA 1CUOA 1AS6A 1RKRA 2PP8A 3IE9A 3FQYA 3WKQA 4A2EA 2IWFA 4BWTA 4GYBA 1AZUA 2HRHA 1EZLA 3FT0A 4HAKA 3EH3B 4Q89A 2XLLA 2HXAA 1NTDA 3T9WA 1OV8A 3CDZB 1W8EA 3JT2A 2GC7C 2XV2A 3EF4A 4HCGA 1ASOA 3AW5A 1E5YA 2Q5BA 2HRGA 2YAPA 1A8ZA 3FU8A 3OM3B 3UGEA 4AX3A 1VLXA 1XB8A 3FPXA 2YAOA 3DIVA 3BVDB 3ZBMA 1BYPA 1PMYA 2TSBA 2FNWA 3CG8A 4E9SA 5B1AB 2BZ7A 1EHKB 4N4YB 1F56A 1GS7A 2GHZA 2PPAA 1CURA 2YAFA 5B1JA 4E9QA 1J9SA 1KBVA 2OJ1A 5I6PA 2R7EA 1JZGA 1IC0A 3N55A 3EHBB 1NZRA 2IWKA 2PCFA 2VSMB 4P5SA 1L9PA 1PY0A 2YAEA 1OCCB 2PPDA 4YSUA 3UADA 1SF3A 4BDVA 2XX0A 1A4AA 1L9OA 4ENZA 1ET7A 1BXUA 1ZDQA 1M57B 3NJIA 5PCYA 3X2QB 1E65A 1SDDA 1HAWA 4AKOA 1PF3A 2IDUA 2J56A 4X4KA 1OCOB 2PLTA 1ZDSA 3D12B 2IAAC 1AZCA 3X1EA 4BXVA 1BQKA 4DP8X 2ZXWB 4E9YA 2FQDA 2I7SA 2W8CA 1OE1A 5B7MA 1GY1A 3FS9A 2UXTA 4TXVB 2B08A 3T6VA 5AZUA 2BWDA 3KW7A 8PAZA 3GYRA 1E30A 4YL4A 2MTAA 3N2JA 1E67A 2OV0A 2PP7A 3NJHA 4GXFA 2CUAA 1GR7A 4GP4B 1QLEB 1I53A 3QJRB 3TBCA 2CAKA 4UF7C 3TA4D 3CDZA 1MZYA 2XXFA 4DPCX 4YVNA 3PCYA 5B7FA 4DP7X 4YSEA 3S8FB 3OD3A 5I5IA 1V55B 2OCCB 2UX6A 3CVDA 2ZONA 1TEFA 5E9NA 2PCYA 1HFUA 1SFDA 1ZPUA 1OF0A 4DP1X 3ABMB 2R7EB 2I7OA 1W6WA 2JXMA 3QPKA 1XB6A 1TKWA 2HX7A 1M56B 4BDVB 3S3CB 5TK2A 4M4RB 2P80D 4DP0X 3NT0A 4PAZA 1SF5A 3X1BA 3G5WA 6PCYA 5B1KA 4YSPA 1AIZA 3ABKB 2GIMA 1AS7A 1MG3C 3C75A 1BXAA 1GS6X 2BHFA 2WO2B 3SQRA 3OMNB 1AG0A 1AACA 1RCYA 4YSAA 2QDVA 3TU6A 2XV0A 1SHXA 5FC9A 4KO9A 5I5MA 1DYZA 2X88A 3HB3B 4G71B 4HCFA 5PAZA 3FSAA 1GY2A 2VN3A 1OE2A 3QJSB 1ET5A 1QHQA 2UXGA 1KCWA 2FQGA 2J5WA 1CYWA 1N68A 2BP8B 1BQ5A 3RYMA 3OMAB 3NJNA 4E9RA 1KCBA 4PCYA 3PLYA 3TBBA 1ILUA 1JXDA 4L0PB 4BK5C 2GI0A 1OE3A 2YAMA 1IKOP 2H5UA 4FA7B 1XB3A 1NWPA 1WA0X 2A3TA 1ID2A 2FQEA 3QJTB 2AZAA 2J55A 4G7SB 1JXFA 9PCYA 2QT6A 1E5ZA 2ZOOA 2VM3A 2FT8A 1BEXA 6PAZA 2IDFA 2BWIA 1JZHA 3FQ2A 3NJGA 1BXVA 3U25A 1AZNA 3H4FA 4P5RA 3FU9A 2IH8A 3WG7B 4UANA 1ILSA 4W1TA 1X9UA 4QKTA 3X1GA 3SBPA 4HALA 2EINB 4BXSV 3SBQA 3FYIB 2XYBA 2Y69B 4KOBA 1TEGA 3EH4B 1NIFA 3DTUB 2BO0A 4A2HA 1KV7A 1AS8A 1L9QA 4DP5X 3MX0B 1BAWA 4WKXA 1NWOA 1IBYA 3FU7B 2PPFA 2HX8A 3UAAA 1ASPA 1R1CA 2IWEA 2IH9A 1DZ0A 4W9ZA 2TSAA 1GSKA 2PPCA 3V9CA 2I85A 4HHWA 2VW6A 4DP2X 1RZPA 3X1FA 3WKPA 3NSYA 4M3HA 1AZBA 1KDIA 3AG4B 3FYEB 1QNIA 3MBWB 4G70B 4K9JA 4YSRA 4Q8BA 1J5DA 1JERA 2FQFA 3AG2B 4F2FA 2H47C 4E9VA 2DY2A 3PXLA 4CSZA 7PCYA 1AQ8A 2BP8A 3CZUB 1JZFA 1L9RA 1WA1X 2CCWA 4HHGA 4A68A 2H3XC 1ADWA 1OOWA 2PPEA 3JTBA 3PPSA 2YARA 2Y1AA 4YSDA 1NIDA 1PAZA 1FWXA 1PZAA 2HLEB 4ZK8A 1PLCA 4BWUA 2DWSA 1PZBA 5LDUA 4E9TA 5D4JA 1CYXA 1XMEB 3X1NA 2ZWNA 2VMJA 3NJKA 3V9EA 1SNRA 3IBOA 1YLBB 4G7QB 3T6XA 5D4HA 1GS8A 3ZDWA 3UABA 4AI7A 1MG2C 2BP0A 4YSTA 4KOCA 1AR1B 4A2GA 3PAVA 4G72B 1BYOA 2WSDA 2X87A 3FSZA 3QJQB 2CALA 2IDSA 4F2EA 3ASNB 3HEIB 2YAHA 5I5JA 2FT6A 3FU7A 3NYKA 3TASA 4HZ1A 1IBZA 2VW7A 2E86A 5I26A 2YAQA 2DV6A 1JZJA 2VW4A 1B3IA 1NDTA 1NIAA 5B3SB 5AFAA 2AANA 1AANA 5I6LA 1HAUA 1MDAA 2GSMB 2YXVA 3NP4A 3T6WA 1NPJA 1BQRA 1OCZB 5B1JC 3T71A 1FA4A 1JXGA 5I28A 1PCSA 3WNIA 2AZUA 4GP8B 3OMIB 1JVLA
chains in the Genus database with same CATH superfamily
1D9KA 2HX9A 3ILDA 3KPNB 1AOZA 4K3DL 1XAKA 2R2EA 3FOMA 3ZDYE 2GJJA 3KE0A 3IKCB 2JKJA 3RGBA 1JK9B 3C6LA 4LLVB 3WXWL 4PV1C 3QWRD 5J57B 5KVFL 4BYHA 2A77H 3U4BL 4GAFB 2ZAGA 2B1AH 1L0PA 3NIGB 3U7AA 4ORGB 3WKMH 3L13A 3P11L 3S34H 3U30B 3VQMA 2O4EA 2YMXL 4LE8A 1OALA 4DOHE 4HOXA 1MRCL 4P4KB 3DUUB 2FX8H 5CHNA 3B2VH 3BEWB 3FUFA 3NZSA 4LSPH 5L8JB 4LMQE 2BFGA 4OSUH 1QNZL 3HB3C 3QJFA 2AVGA 2Z92A 3BPNB 4PG2A 4YDJA 5TH2B 1JOIA 4FABH 4AEHH 5BUPA 1NGXA 1GKEA 2PO6D 1R0AL 1W16A 1F11A 2XWZA 3FN0L 4TSBL 1CICB 1LK3H 2HVKB 3I74A 3QDMB 1AQKL 5F7FA 3JBG7 1XVSA 4JY5H 3RRQA 1BVNP 4RFOL 1W80A 2AV7B 2XPYA 5EU5A 4HPOH 4KNUA 5DGRA 2L7EA 4PRHD 1Q90A 2RCSL 5DO2C 4OZGA 2HVJA 2ZSWB 4NDMA 2QQLH 2YPLE 1BD2B 3SZKC 4O2EB 2W60B 1HT6A 2UVEA 2Z7ZA 4PW4A 1IGMH 3EYSH 3ZX1A 3ZO9A 2XTJD 2OZ4H 1UVQA 2Y2TA 4QRQA 3PHOA 5EN2A 3RX8A 5CEZH 2FB4H 1E9PA 3FQWB 4M62H 2EEAA 1QKZL 3FU5A 1SLXA 5E51A 2A99A 4PRPA 2O26U 2EVHA 2FNBA 4KTEL 4LEEA 4N90E 3HCVB 3UEQA 4H88L 3BWSA 1YEFL 2C9VA 4JPWH 1OCWH 3MV01 2OAAA 4Z0XA 1GRWA 1WDAA 1XF5B 2WYTA 2GK0A 2Y2YA 2NLJB 3GSUA 4L4TB 4O51A 1A5FH 2DIJA 1OW0C 1ZHBB 3BISA 4HUVA 1HILB 4JHUA 4ZMXA 1DL7L 4PJAF 3DX9A 5L2KD 1RZ8B 1URIA 4TUOA 2F68X 5T3ZD 3H6JA 5HJDA 1EFXA 1UB5A 3C5JB 4FZ8L 1BFVL 3IDNB 3GIVA 1UFGA 4Y1TA 5DS8B 4KMTL 2Q10A 5M7QA 2W88A 4JPKL 5AW7B 4PV8B 3HI5H 3DRQA 1UGNA 5I82A 4NENB 1TCRB 5DEFA 1RJYA 1MNUL 4UZGA 1IEBB 2BNQA 2MPAH 5D2LA 3VM5A 3ME0A 3B5GA 3LN4B 5DZJA 3O6FC 3MR9A 1NCOA 5IM7A 5D5MA 4K55A 2P5EE 5GGUA 1N59A 1A7BA 5E9DA 4OFDA 1JP5A 4OCRH 1CFTB 4NKIL 1J8HA 3GSRA 2WANA 4XVTL 4OLWH 1KDJA 3VE0B 3JVGA 4UT9L 4DP6X 3LKOB 4ZNCD 3V5HB 4YFLF 3WS6A 1CICD 1XD0A 1WZ1L 3S96B 1OWRM 3HNTL 1H19A 4YXHH 2YWZA 1AHWB 4HG4K 3MCLH 1TETL 3EG9B 1D7DA 3FSVA 3GB7A 3L5XL 5EMYA 4P5KB 3RIFF 3X12A 1OPOA 3WKQA 4UDUA 4L4VE 1XV8A 1E3ZA 3H54A 5JXEA 3QO0B 4OF8A 5LGHL 5D7JD 4YUEL 4Z7VF 4LKXA 1OK8A 3ARDD 5AWNL 2YPVH 2HXAA 2WBJD 5I1GH 3BJ91 5E4EB 3BT2L 1IC7H 2X2YA 3C5ZD 4JZOB 4JGNA 4JO8A 4P57B 1U8OA 3VXSD 4X9FA 2ALWA 1UGKA 4XB7A 1BVKB 1EV2E 3ECBA 3RNKA 4D8PA 4D94A 2RALA 4TSAH 1EO7A 2CZNA 3VG9B 3F01A 4PGDB 3AFLA 5ID0B 3SYOA 3WFHB 1S7SB 5EO0A 2NY1D 2ESVD 4G7VL 3E3QE 4N2GA 5F8QC 3SQOH 2PPAA 5B1JA 4HZLA 4LPYA 3VD4A 3LKPA 5DJDB 3O4LB 2DH3A 4PGEB 4BD4A 5C0NC 5IF0A 4ABUA 1OP3K 1OCCB 4OD2B 1AZVA 4OT1L 3WBDA 1OAXL 2NY6B 2V2WA 5ANME 4KVPA 3MCG1 4RGND 3T1WA 3WIFB 3LPPA 3QIUC 5D1ZD 1SLWA 3MLSL 3HHSB 3U1QA 4W9CC 2QQKL 3LZPA 3SJVE 5T1JA 3D12B 1VRSA 3OKOA 2N1KA 4FNTA 3FFOA 3NTCH 1P9MC 1CDGA 1L3NA 3KHQA 3KM1A 4U4BA 3BI9X 1JGEA 4MHHI 3GSWA 2QHRL 2YKLH 2XY2A 2CO1A 2ITCB 2VUOA 5BV7H 4R4BB 3GHEL 1FFOA 4Y4FD 2WXMA 5KVGH 5EOQH 3VYPA 8PAZA 3GYRA 3QHZH 3DVGB 5D93C 2ZX5A 2P28B 2R1YA 2A2QT 4ERSH 2FJUB 3QEUA 4YGVB 5DWUL 2R9HC 3KPSE 4JFQB 3MLXL 1NJ9A 2Y36L 4GINA 3R06A 2OJEA 1CE6A 4UINL 3PCYA 2PXYA 3S8FB 4G2AA 1KWKA 1OAUL 3PWPD 4KU1A 4MCNA 5D7SL 2X1QA 4O58H 1UZ6F 2HLAB 3LPGA 4QXWA 3NESA 3IDYC 1K3IA 3MRIB 4RBPK 5CZXD 3VFWB 3IFLH 4YDNA 5MP6H 2DWEB 5FYJL 2VQTA 3QPKA 3QUZA 3PHAA 3T3PF 3S3CB 1AMYA 1U2HA 1XCWA 3NT0A 3L3GB 3MJ8B 2I9LB 4P2QD 1AI1H 4OF0A 3OHXC 1WGOA 1DE4B 3DX7B 3OKLA 3S37X 3VXPB 4C83A 1DJYA 1YYCA 3HMWL 4CU8A 3HS0A 4L8SA 1OLLA 4HOMA 2G3XA 4OJAA 2I24N 4Z7NB 4GRWH 4ZMYA 2F54D 1F58H 1RULL 3HKFA 4XNYH 2P5EA 4HIHA 2J8UB 3ZRCC 4P9HL 2AAVA 4QTIH 1T20A 3ALPA 4KO9A 3N1QC 2EP6A 3QXUA 5AAMC 4S0SD 5PAZA 2DQUH 3WFCH 1YHPA 3U1SL 5E23A 2FQGA 5DGQA 2G9HA 4WDIB 1N68A 4JVWA 5FK9A 3RYMA 1V3JA 3F58L 4NPYB 2O30A 4AMKH 4F7MB 1OARL 5HI3C 5C0IA 4L4VA 4D9RE 5F3HB 3HR5B 4B3EA 2CQVA 1ILUA 3KM2A 4ODVH 4BK5C 1KY6A 3GD1C 5EU6B 1QLEH 4NOBA 4GQ9H 2QGDA 1A6WL 2H9GB 4YHYB 5DJ6B 4EI5B 4F20A 2Q7YB 4QY8B 3WN5A 4FG0A 4QCIB 4IOIA 4GO8A 4XVSH 5HDBE 2A6KA 4PVMA 1L0QA 1HNGA 1T2JA 4X5PA 4J6RL 4P5RA 1WEJH 4G6AD 4GSDH 4BFEA 2Y24A 3NRPA 3QDGD 3L1OL 5B1CA 2ATKB 3KLHC 5FUOH 1Q9WB 1MRFL 4UCFA 2EINB 4KKLC 2BHYA 2WIMA 4FC3E 4FQ2H 4R7NB 1CXKA 3ARED 4ZS6D 3TEXA 3DTUB 4BH7A 1CD8A 2JJVA 2GSIA 3MX0B 5EUOE 1B4RA 2OCFD 1NMBL 5EEXA 1IGCL 1J86A 3SKJL 3U7WH 4NM8H 3TPUA 2CR3A 3VFMA 1JPTL 3WYRA 4QT5B 5CJ8A 3V9CA 5ANMA 4DP2X 4LVOC 3N91A 5EO1B 2OMNA 1TOXA 1GYVA 4ZX6A 2Y9RT 1JV5A 1OTUD 2YUZA 4I0PB 3LJ3A 4TUKH 3ULAB 5ILTL 1CB4A 3SJVA 1KCRL 5JW3H 4J3UA 4S1RH 5IHHA 2CIIB 4NFCA 2CGRL 1PDKB 3MBEC 1G9HA 1T6WA 1AGDA 1E4KC 3MUGA 3P9LA 3LMJH 3NDYE 4GBXA 3C6LB 1OTSC 1AO7E 3EJSA 5DR5H 3NFNB 1IL1A 3BDYL 2PPEA 3IKKA 2DIEA 2AQ2A 5CCJA 4U1JA 1UZ8B 2R1XA 2VRAA 2YLHA 2HLEB 1TQBC 1WIUA 2VAJA 3MXWH 3PXHA 2DWSA 1G9NC 3KPSA 4KKBD 3QEHA 4UOW1 4XMTA 5J11B 3QPQC 1BG1A 3WHE0 5G5DA 4HAFA 5CHNB 3P40A 2WZ6A 1G9MC 3JWDC 2ZWNA 1FV1B 2Z92B 5IB2B 5C08E 4P46C 3K7UA 1X5IA 2E59A 1QBLL 4LEXH 1NGXB 3D25B 1XF3B 3SE3A 4A04A 3BIKB 1TTBA 1I8IA 3SDCD 2MWCA 5CJOL 5C8JA 2F5AL 5TE6L 8FABB 3D3VE 2HTKC 3P3RA 1U92A 5HVHB 5I16A 3ML9A 4HS8H 1G7QB 2R0ZL 1JDDA 3E8UL 4MA1B 4OIFA 3W5MA 2DICA 4TTGA 2YK1L 2F74A 3KDPB 5IMOA 4LCYB 2WGNB 3DGCR 3MV7E 1PX4A 3VGDA 2R59A 3QC5X 4BFOA 3VFPB 1IGJA 5F7NC 4G5ZL 2VW4A 1NGQH 2OKMA 4Z3EA 1B3IA 5JNYA 3EJRA 1DLFH 4K3EL 1K4CB 2EYTB 5I15L 5I6LA 2CKNA 3FNKA 3VA2C 4I3RL 4I3SH 3ATEA 5EN2B 5FB8A 2XKUA 3JT0A 1TITA 1XFPA 4FRWA 4NO2B 3WHXB 3MNWA 4ZX4A 3Q6GH 4ZQKA 2L04A 4TOYH 2I60L 4YQXH 4F9PC 4ISVA 1M6OA 3NSXA 2X6UA 2NR6D 3O6FA 3GSUB 4O51B 1Q0YL 2WXHA 3GQFA 2AVFA 1F6LL 4WEBL 4Z3FA 2O6FA 1ZLEA 2RTTA 4WNQA 4KPHH 2X1OA 3WIIL 2YPVA 4OI9A 4TUOB 1CD0A 2L8AA 3P30L 2P49B 4ZUVA 5I6KA 4UDTA 3FCSA 4ZW3A 1HHGA 5L88H 1IC1A 3CC5B 5A6LA 3GLDA 2K4AA 5F72S 4AYID 2NUTA 1NEPA 3MRBA 3DRQB 5H8DA 3W2DH 5I23A 3CFDB 3VNYA 2P9RA 1MCKA 1A0QH 5ICYA 2HT3C 3MTRA 1O75A 1CL7I 2FYVA 2E3VA 1XF4A 32C2A 2WXFA 3DXAD 3ME0B 1RP8A 3FPYA 1HHJB 3SE6A 4PRID 5TQ0L 3RFRA 2IBGA 1JYXA 2VC2B 4UQIM 2X1XR 4DVRL 5GGUB 1IRAY 4U1KA 5EUOA 1T80A 2QKIA 4UV7L 4WWOA 5T5FH 3TOPA 3GSRB 2HUEA 1HSBA 4U33A 3VYNA 1GGYA 1BJMA 4H1LA 1J0ZA 1MN4A 1KYAA 2BZCA 1QA9A 3CDGA 5C0BB 3MFFB 3US0A 1W2KT 5JHLH 4S11A 2AEPL 1YAIA 1FJ1A 5LNEA 1J18A 2WQWA 4N2NA 4D3CH 5EF3A 3QRLA 5ALCH 4U1GC 2OMTB 4B9KC 2A0LD 4X4ZA 4P23D 4JFHD 3GB7B 5JHMA 2GUYA 5G55A 5IB1A 4UDUB 3VGHA 4YLCA 2K6WA 5CILL 3S98A 1AD0A 2GT9B 3B3BA 5SWZD 2Y1VA 3RDTC 1HVXA 2Y6TE 4NO0D 3LPFA 2GC4C 3P3YA 2F1EA 4LKXB 3UAEA 2A77L 3ZU8A 4NKMA 5IROA 1KCUH 2X70A 3KXFD 5E1HB 2G30A 1AO7A 1TJIH 4Q7DA 3WKML 4YXLH 4HIXL 3S34L 4XP6H 1X9RA 1VPOH 4NC1E 4AMXA 3AC0A 3FCGA 3KVDD 1LILA 1ZK9A 3ZTJG 4HJTA 4LSPL 4WK0B 1HQ4A 1HTYA 1MOEA 4YIQA 4OSUL 3RNKB 4FQXB 4NRZA 5FYKH 3Q2NA 1G1OA 1KC5L 5JMRA 3HFMH 1UKTA 3VDCA 4FABL 3SGKC 4IM8A 3WCYA 4DOHB 5C2BH 5EO0B 2B4CL 5GGVH 4D7PA 3EFOA 4JQVC 4JHWL 4O2CB 1LK3L 1FIGH 35C8H 4G43A 4PP1D 1HZLA 5GRUL 5C08A 4P3DB 2A9AA 4GT7A 3BZDA 1RIVH 4FP8H 4GO6B 2FO4B 2V5RA 2V2WB 4E5XG 2FLBT 1BFTA 6CGTA 3D3VA 2IBZY 4IGBB 1D5XB 1URZA 2QQLL 4L9DA 4X5WA 3C5XA 4XP5H 1M3JA 4A2FA 5LNGA 2Q20A 4I13B 1E50A 3MRCA 5LN8A 2Q3AA 3MV7A 2LHAA 3QK0A 4E9WA 4L8CB 4OQTH 1L6XA 1CGWA 1S78D 3EYSL 5LLIC 1Q9KA 2ZUVA 3B9EA 4DGUA 2OZ4L 3OKOB 3TCLB 4IOFC 3VD7A 2PTVA 3EYVB 4M62L 2A74B 3D2UA 5FEBA 4AKQA 3UG3A 4PJDB 1JGEB 4X8GA 5MEOB 3ZJAA 1HXYA 2E0PA 3WL9A 2AJ3A 3ABLB 3DURA 4GUPA 5DK0B 2FWOA 2BNRD 4U6YA 3KGRA 2AKRB 4JPWL 1F2XK 4KX9A 5EU4B 3LKQB 4A2LA 1HE7A 3KG5A 2R1YB 2ZYRA 4IBVA 4MAUH 3DK0A 4KQ3H 4NEHB 5D1XB 2AXJA 1NJ9B 4FLHA 4U31A 4W4OC 1XSIA 3R06B 5A2KH 1CE6B 2XV2A 1K2DB 1AGBA 5KYUA 3HPLB 3RWEB 3PGCB 4YN3A 5EN3A 3IETB 1KLGB 5HHNA 3V4VH 3HI5L 3L3OB 3BPCA 3PGDB 1NDGB 2HKFH 2Y06L 4YBHA 3WO4B 4NKOA 5AAMA 3QUZB 5C6TH 2ICES 3M46A 1TR7A 3NEXA 4UZUA 4JM2D 2BSRA 3V4PH 5I6PA 1NC4A 4AEEA 3UPRB 2DBLH 5INDA 2IH1A 5I1HH 2KI6A 4XBGB 1R19A 4FDWA 1A9EA 4P5SA 1RSYA 2PPDA 2IAMD 3OKLB 2VDQB 1G6VK 1L9OA 3L4CA 4OCRL 4FQXD 4L8SB 1REIA 4UOW0 2FEEI 4OLWL 4O02A 2P5EB 1M7XA 4HIHB 4CC4C 2VDLL 2IPTH 3QZWG 4I9WE 3ARFC 4YXHL 1M2VA 2OQJA 4A7TA 4RX4A 2YD8A 1QPXA 4XVUC 3TYFB 2AJXH 4AH2B 3MCYA 2EC9U 1W0YT 4LCCC 1V8HA 3GWJA 1EA9C 2F2HA 4W81A 5EC2A 4JGMA 4EIGB 1FL6B 2R4RH 3Q2WA 5IQ7L 3VWKD 5L8KB 4M1GH 2VE6A 1EAJA 2PYFA 3QUMH 3EUUA 4FQQA 3WAKA 1HEJC 3CZFB 2IJ0C 3MKKA 4BJLA 3JYBA 3MMEA 4EO5A 5C0IB 4ZT1A 2YPVL 4FYRA 4JG5A 1BM3H 4D9LH 5I1GL 2XN9B 5HPMB 3MRHB 3D18B 1NEZB 3P4MA 4P2RD 4OLEA 2EDRA 3TC9A 1AD9A 2CGYA 2G0LA 1JK8B 2Z3FA 3CDZA 2DM7A 4Z18A 5IHZA 3VFUA 3G9VA 4HGKC 4YVNA 2ZZUT 1EO5A 3A24A 3OD3A 4FF9A 4M7LT 1BF8A 2A6KB 1Z9MA 5FYKE 1KXHA 3SQOL 4DP1X 3ZT6A 3ZZQA 1T03L 1YQ2A 1MY5A 1YEEH 5IBTH 3KYMA 5CSZA 2EDMA 2Z8VC 4XX1E 1F02I 3M17A 4U6VH 5DMIH 3LN9A 1KYOJ 5D1XD 4M4RB 3QDJD 1E4KA 4X7SH 3W0WE 4BH7B 2GSIB 2LR4A 1U3NA 1JN6A 4I18A 3QG7H 2WTPA 4C54A 5IQLA 5CLZA 3MRMA 25C8H 3TPUB 3VFMB 1G87A 3D1MC 2NQCA 1TVHB 4WHTA 5CCKH 2JI2A 1KACB 3D9AH 2VLJE 3L3DB 2ZUXA 3OMNB 1I3VA 3TBVA 2EUWA 5JOPD 3A23A 4XB3A 3SY6A 4YSAA 3NRQA 4B9GA 2NY3C 3NTCL 2NYYC 4TUJB 2J5LC 4JVUA 3ZMEA 1UXSB 5ISZE 3GF8A 3HB3B 3MJ9H 2HFFA 4M5TA 5BV7L 4HSCX 3QNZA 1SUJA 2A4EA 4HCFA 4CKQA 4OGAC 4GLRI 4TVPE 1ZT7B 2VDOL 1CI5A 5EOQL 1Q1PA 4Z77A 4R4ND 4YR6A 3P9LB 4ETYA 5K9KA 4CN4A 5DZOA 3CV5A 5DMKA 3IMRA 3VMPA 4ERSL 3HE6D 4X99A 3ZVVA 1PY4A 3U6XA 5IIEA 3GUFA 1JDCA 1B4LA 2ARJQ 5ACZA 1CXIA 3PYCA 4AQ8C 1O6SA 5TE4H 4U1JB 2BY1A 4NZ8A 4DGYL 1IKOP 4WO4A 5AYQA 4E41E 3LS4H 1OPGH 1CDYA 4NQED 1KELH 1BQUA 3QEHB 5HHQB 1QW9A 4WHYG 3S6CA 1A02N 1EVUA 1JZHA 2P8MB 4RMTA 2DQEL 2YBRA 3IFLL 3F05A 5GS0D 5HI4C 3BMWA 2ZNWA 4Q9BA 1AZNA 1UWGL 2NT0A 3WG7B 5C09B 1P53A 4DVBA 4W9JC 2WLYA 4LLMA 3PQYD 4DKDC 3FB6A 1AI1L 2I9TA 4BFFA 5T3XD 2X4OA 1S7VA 4HK0A 3DYMA 3VDAA 5C8JB 4AM0Q 3PNWA 5F71A 1WJ3A 2K78A 3FBQA 3CPLA 3OKNB 1OANA 3D08A 3V6OC 4J7RA 3EOBA 5IMOB 1BF5A 3GXPA 1GJIA 5IGXL 5J6GA 1F58L 4FQCH 4NUJB 4HC1H 4IRZA 4H8QA 3EFFB 4XNYL 4W9ZA 5C7XH 5EDSA 3OF6A 2AQRA 2FSEA 3RFZC 3JUZA 4GAYB 5JNYB 1B88A 1F86A 2FE0A 4KHXH 3ARGA 1U8KB 2YRPA 3TV3H 3PP3H 1A7NH 4RISH 5AL0A 5F7LB 3WFCL 5FB8B 2EYRA 2QVMA 5ESVB 1J0IA 3PXLA 2R2HA 2DJSA 4NM4H 1AYOA 1NGZB 2AJSH 2VT0A 3PFUA 4ZQKB 2GJZA 4Y2DD 2WLMA 5ESQB 3OKKA 3APFA 4JPIA 1M6OB 5AL8A 3EHBC 2V7HA 2WINB 3N44F 4ODVL 5I18H 4G6JL 5CZKA 3O6FB 1YY8B 3LNFA 3ZKXC 4GQ9L 4AGOA 4JNXA 3JTBA 4XBEL 5KYWA 4WNQB 5C07D 2DQHH 4YSDA 3NJXA 3TPKA 1NIDA 3NQIA 1H3GA 2W0LA 2GFBB 4YE4L 4KI5C 4ODWA 2Z4QA 3WUWA 3B1TA 2C3VB 3TJPA 4I48B 1WEJL 2CO2A 3FCSB 4JFFD 4UDTB 5D7LD 2ICWI 4AW7A 4G82A 2NUTB 1GHFH 2OMUB 1UWYA 3LV3A 1E4WH 3H3PH 5HDBB 3HG3A 5TD4A 2F58H 2EXSA 4AIXA 3STLA 3T6XA 5C2UB 4FQ2L 4OCYL 4NO3A 3ZN6A 3AT8A 1DVFA 5E70A 1J10A 1NM9A 3UJJH 5AVVB 32C2B 3FB7B 3IJEA 3ZRSA 4PWHA 3X17A 5IUSA 1G5AA 3ATDA 3QJQB 4QI3A 1XF1A 4LEOB 4NM8L 5DO8A 4FS0A 3U7WL 3VXRE 4PQXA 3P0GB 4F7CA 3IE4A 3W0WA 5DFVD 1KJMA 4Y0GA 5I5RA 2VCOA 1KIRA 3T3PE 4POYA 1UH4A 5CU9A 4YHNA 2I32A 2OBGA 3ZPDA 3KBFA 2WB1A 1CLZH 4YPJA 5EZJB 3GI8H 4TUKL 3OXSA 2VLJA 2YEZB 3S48A 3BQUC 3S5LG 5DRZA 5HDWA 3KZ8A 5JW3L 1TZ8A 4S1RL 3QJHB 3E9UA 1FJ1B 3HHRB 5FA3A 1FH2A 2YWYA 2UZYA 3ZW3A 2CO6A 4OQTA 1MQ8A 2VN7A 1PCSA 1KB9K 4JQVA 1YSOA 4GRMB 5ISZA 3GS7A 3LMJL 1QR4A 5IB1B 1T1WA 4XXWC 4HETA 4IRJC 2DS4A 5FX3A 2D7MA 4KK9C 1AD0B 1OGTA 1A1MB 2J8HA 3OPUA 3BE1L 3DPDA 3H8NA 4R7LA 4W6YB 1FAIL 3HG1D 5I8OH 4LF3A 3IFPA 4CVWA 1CBVH 3MXWL 2ZKHH 4R97C 3RKDD 1MPAH 3ISWA 3NZUA 1P7KA 2G75A 2NW2A 2XPGA 3UBXB 1Z32X 2JFCA 1PZ3A 1BBJA 4X4XA 3QIUB 3ZQWA 5LAPA 1HQ4B 4AQEB 5KVDE 4FHJA 1IKFL 4IHBA 1HL9A 1HXMA 4NRZB 4E41A 3WFEL 2A9MH 5HHVH 3ULUD 1EHNA 2IMMA 3FAWA 5EBWB 1J5CA 4J3SA 2EH8L 1JXJA 1S9VA 4LEXL 3RUGF 1VKXB 1QEXA 4L18A 2CJUH 5KOVC 2XQYK 2VN4A 3NCXA 2FO8A 2XBZA 3PAUA 2M83A 4HFWA 3OR6A 3U4EA 2FH8A 4HS8L 1I85A 4EN3C 4UOJA 3HE7C 3CN4A 3K2UH 4GRLA 2CU9A 3CIAA 4R4FL 2NW3A 3RIKA 3CLFH 3VI3E 4AGMA 2XIIA 3UTSB 1EX0A 3T6ZA 5D93B 5E8DH 1NOFA 3BD5A 1P5UC 3D3VB 4RMRA 1FGNH 3BP4A 1QZ1A 4X5WB 1GGCH 1PZ2A 3DV6A 4P05A 1B0RA 4IHOA 1DLFL 3CNKA 1EMTH 2DWYA 3LB6C 3NIDB 4JDVA 4MFHA 1L0XA 3SPVA 4WFEE 3T0EE 1Q9KB 4M1DH 1ML0A 4L1TA 3EJZD 1KPRB 5CLXA 3QEQD 3D2UB 2F19H 3IDYB 5CS7A 1YY9D 1JMZA 1HXYB 2UZXB 1KB5A 5KSAD 4CNIB 2BWQA 3QAQA 3MA7A 3Q6GL 4K4KA 3ROOB 1WF5A 2FWOB 4NC2B 4U6YB 4YQXL 3HFFA 2JIXD 2JF1A 2IANB 3ECWA 2GTWB 3B9KD 3QFJA 1FFPA 3KWWA 5C0GA 1TNMA 2XVGA 3OHXB 3U0TA 3FF8A 1BAFH 1QAWA 3WI9A 3O3EB 3QUMA 4MD5B 5E8OA 1AKPA 1S6NA 2WXRA 1BFSA 1LDPL 2AXFB 2H0FA 3NCJH 4OCMC 2IH3A 1AGBB 1M1XB 4TYUA 5KYUB 5L88L 1CC3A 1UATA 5TFSH 5HYEA 2P80A 3ARFA 1KXVC 2KH2B 5HHNB 4WTQA 3MSPA 3BPCB 3T6QC 3SDAD 4GSQA 1BQHG 5C0ND 1A0QL 1CI3M 1GAFH 5EEVA 5DS2A 5FKPA 2H45A 5JHDD 4LCCA 5L4JA 4MXVE 3GGWB 3UTQB 3GHBL 1XEDA 2BSRB 1Q94B 4IRZL 1NC4B 1S46A 3F7VB 1A4JA 4TULH 4MYWB 4ELMB 3OZKA 1IM3A 1QLFB 5D1QC 1JVOA 4AZUA 1NCAH 3FTXA 1MCHA 4RMVA 5CUSH 5FCSH 5B3JE 1D5BA 1RHHA 4RESB 5T5FL 4F3FA 2JVUA 4NJ9H 4NRXA 2AEWA 4O02B 1RZQA 4MMZC 5A7EA 3OGCA 2Z8RA 3RG1C 3QQXA 4UIKL 4MJ4A 5HHOD 5JHLL 4H20L 1E4XI 2OQJB 3GRWA 4PTUA 3WIHH 1OOAA 4C4UA 1T22A 1NOAA 3C60C 3NSDA 4HJIA 4MQ7A 3Q3GB 5TDPA 1ZHKB 1ZTMA 4KJYB 4RIRB 2EVFA 1J1OH 4PBDA 4C56E 4EZMA 2D7PA 5LB1A 3WFDL 2ITFA 4HDIA 3MDJA 4QHKI 5DUBA 4FQQB 2PYFB 2GK2A 1BLNB 4D0CB 2QGBA 3MJ9A 1AGEA 5HGAA 1I9EA 3ISRA 3AQYA 4NQQA 3OL2A 3C08H 4JZNA 4E42A 1TJIL 4GYBA 1YQVL 4YXLL 4MNQE 3P4MB 1YJDH 3BZ4A 4LAQH 4B9JA 1VPOL 1AD9B 2XLLA 5CBAB 3CDZB 1XH2A 3NIFE 2JKIS 1U3HC 4LVOB 5FYKL 5IKCB 2SEBA 3RB7A 3HFML 3TVMC 1JWSA 2VYRE 2A4ZA 2UZIH 5KUKA 5AVQB 1NC2D 3EOYG 4G8GD 5GGVL 2PWHA 2IAND 3ZBMA 4JFWA 4XO3A 35C8L 5TPWH 1DQQB 2H0EA 2K6ZA 4HG4J 3KYMB 1MAJA 5CSZB 4KVCH 5DRNA 5E00B 1KY7A 3M17B 4AVIA 1CU4H 3MBEB 2BS71 1RIVL 1R34A 3V0DA 1ZY9A 4ICXA 4UBDD 3H2WA 5GJSH 1I1FB 4XP5L 3O8XC 1UT9A 4QXGH 4ZXBC 3VI3A 2IC2A 4JLRA 1G6RB 3OLIA 2OXHA 4KHTH 4FTVD 2NNAB 2V17H 3IJSA 4WHTB 4E9LA 5DZ9A 4YDKH 3JSSA 5F1IB 1S7TB 4OQTL 4B6ZA 2GG1A 4UMGA 1TQBB 4P8QA 3TBVB 1P4IL 1PS3A 5DQ9A 4XGZA 3FRUA 3QUXD 3WU1A 4CVZB 4M5YH 4NZUH 3O2WL 3W39A 4UUJB 3RDJA 4DFHA 2H6PA 3O2VH 1UKQA 1ZSHA 3HUJE 4N3UA 3QNZB 3T0EA 1X5HA 3NCMA 4J6IA 4P46B 5JLZA 4EI6A 3T3MB 3DC0A 1CDIA 1TTAA 3B9DA 3WNMA 4OZHB 4Z77B 4TLUA 4ZTOH 3NH7H 5K9KB 1YMMD 5DUPL 3TO4C 1CFBA 5BQ7A 5DMKB 2IPKA 5DJ0B 3NFSH 4MAUL 3K6OA 1G1KA 1E30A 1I8KB 2D7TH 1CBJA 5ACZB 4HKXA 2OZNA 1UEYA 2CK0L 1S7QA 4GXFA 1IJ9A 2V2XB 4JAMA 3SCMC 3D39D 1EJFA 4L29B 5I73C 4HV8A 2CAKA 2XY1A 3CN2A 4P9MH 4JRLA 4AGQA 3RFZA 1V7MH 5AZEL 3V4VL 4KRPD 5AYUH 2HKFL 2EKSB 2YBRB 4HWZB 5GSVA 4PRDA 3KLHD 4QHUB 1SFDA 1S4IA 5E9AA 4DVBB 5GXBB 4F7TB 3VFOB 2MCMA 1J1XL 4Y9GA 4LLMB 4PP2A 3V4PL 4I2XB 3REWA 3FB6B 3GBNL 2I9TB 2DBLL 2X4OB 1S7VB 5EV7A 4RGOL 1FC1A 1LE5A 3Q8FA 3PNWB 2UY6A 3B1UA 2OMBA 4LCWE 1BSIA 3BW9A 4GAJL 4GQRA 4FMFA 4OI8A 2OMYA 4H8UA 3T0BA 4M6ML 4O5LH 1ETZB 2B0SL 3V4LA 5DVKA 1BXAA 2IPTL 4D0DA 3GLZA 1J8SA 1KB5L 3SQRA 3L4YA 3WKNA 4Y9FA 4ZFFB 1CT8B 2A9NH 1AACA 1DBKH 3F84A 3AS2A 2AJXL 2DBJA 3HC4L 4BA8A 5EOTA 1A6PA 4ETQA 4PJ5B 1U33A 4HOWA 1TZIA 3AY4C 4P2OA 2R4RL 2EYRB 2G5UA 3OHMB 1AXSB 1E2WA 3D85D 4M1GL 3UG5A 3QUML 5MHSE 2R2HB 4ODSH 3VWJD 5MI0C 2W38A 3SDDC 5L9DH 1HHHA 4XTRC 2RGSA 3KL3A 1BM3L 4G8IA 4C56A 1CYWA 3QZMA 4JPIB 3IM1A 1QSZA 4N0CD 4Q4EA 3VSTA 4D9LL 3G6DH 4EQ2A 1CTOA 1S9YA 5D7IB 4L8DA 1IZKA 1MJ7L 2KQMA 3TA3D 1QVOB 4B41A 5SV3A 2HTLC 4HJJH 1PQZB 3QFGA 3IU3B 2FUTA 2NNCA 3IAQA 4MNQA 5E56A 1A66A 1ID2A 3AXIA 1MFBH 4ODWB 3WUWB 2IBZX 4B27A 1IO4C 1FIEA 4FEIA 4K07A 4NAMA 4XHJC 3NDZE 2E76C 5I19L 4QYOA 3QZBA 4ANWA 4EIUA 5IBTL 5CEXA 1MCEA 4P48A 3MOBH 3RB5A 5FYLE 2YPKA 3MACH 4I1RA 4WFFD 1GYUA 1WT5C 1WZAA 2X2UA 2YMTA 4IMKC 3STLB 4BQ6A 4UIMA 3I3DA 4U1GB 4NO3B 1KN2H 1DVFB 2BSTA 1GTFA 1BA9A 3KPRB 4GKZB 4XXWA 4IRJA 3IJHB 4Z7OB 4UMSA 5B4MC 3GSXA 5TDNA 3EH4B 4LNRA 1U42A 25C8L 3RDTB 3J7HA 2WTRB 3T04D 3VDBA 1AS8A 4IEFA 2CR6A 3GRWL 3UTTE 4C57C 4OAWB 1KJMB 4U1NB 1A7OL 1WRFA 3D9AL 3PDOB 1DZ0A 4ES8A 2B3RA 1H5BC 3P4LA 4Z95H 3VB9A 3DX2A 1YN6B 4XP9H 3EBIA 3MJ6A 3N41B 4ONFH 3SGJA 3L3IB 2WKLA 3EYOB 2VLJB 4PGZA 3MJ9L 5DRZB 5HHPA 2UZYB 4J3OC 4HIQA 4AYFB 1RXLA 1H6TA 4QAWA 1GZPB 2H47C 2DY2A 4PY8I 3EYQD 2ZKXA 4MDJA 3HUJA 4XH2B 3SEPA 1TIUA 2J2ZA 1OGTB 4CSTA 4XR8C 2HPOA 1L9RA 2CCWA 5DD5L 4F9LA 5GISH 1P5UA 3PFQA 3LS4L 1OPGL 4U6TA 3VW3H 1YAZA 5J13C 1KELL 2NY0C 1P7KB 3LNDA 5KVDL 2XPGB 1JRHI 3G5YA 2DYPB 1VF5C 5EIIG 3WY4A 1SY6A 3HJEA 1E9QB 4FXLA 4X4XB 3L3JA 2WJ7A 3TESA 1VERA 3AS0A 5GS1C 4PRAA 2HT3D 5I1EH 4ADJA 3I2CH 2PF6A 1CYXA 2W59A 4HHAB 3HBQA 5JOFA 2HT4C 1DEEA 3VFTB 2XPZA 3OR6B 1QATA 2R29H 2NW3B 2QVKA 4XOEA 4JE0A 5JORB 1QBMH 2WLHA 4A2GA 1SBSL 5TE7H 3TYGH 4EBQH 4HC1L 3P4OA 3TX4A 3AXLA 1SXZA 2WLKA 4FL4C 4X7DC 1H15A 3BP4B 4LCWA 3RE0A 2YFNA 3FU7A 2J25A 2VXSH 4NZTL 3VXTA 2LGNA 4K94H 2VZ3A 1B0RB 1BDYA 2R69A 4IHOB 4ENEC 4KHXL 2D7OA 4JDVB 1OP3H 3SPIA 1A7NL 3B3IA 3INOA 4RISL 2O61A 4FYQA 4OJFL 3IS0X 1KXVA 2WGXA 2DQFB 3DJ9A 4JFZH 1OCZB 3L4ZA 4P59L 4NM4L 3GSNH 2AJSL 1OP5K 3RDTD 5JXAH 3QIWD 3ARBA 5GRZA 3WIHA 4I4WB 2GY5A 4B9IA 2VH5L 3QFJB 1RZGB 1BIHA 2NRDA 1WS7A 3S3BB 4HJUA 5I18L 1TTUA 3KEDA 1JI2A 1N10A 3WLWC 2ZXEB 5DLML 3ZQXA 4J28A 4R90L 3DIDA 1TFHA 4MQXC 1RUMH 1HNYA 1WIOA 3DA0A 1M71B 3DPBB 5IB5A 5DJCA 3W11D 3MYJA 1LEGA 3MLYL 5JUEL 4AK1A 2QZQA 3ARFB 1QTSA 1Z5LA 1E4WL 1ZXKA 4KRNA 3V0VA 4XO4A 2X1PA 3NQKA 4FXGC 4DWHA 3QXTA 5FKPB 1FFTB 4OM0L 3V0AC 4LCCB 3UJJL 3WFZA 1X5LA 1YPZE 3AY2A 3ZT5A 1MFMA 3A6CH 3GXNA 3K1DA 4AG4L 5K39B 4K8RL 1A4JB 2XQYG 1KPUA 3NJLA 5IWLA 4RBPH 4D0BA 5CZRA 1D5BB 1RHHB 4YMPA 4YFLI 3WIAA 3VGEA 5E24E 3L4UA 1BJ1J 1S5HA 3MNMA 3UTTA 4QUOA 1CLZL 1HWHB 2VDMB 2YJLA 1QSED 1CD1B 3B8SA 3UAJC 1LO0H 4FFWC 1CLCA 1ED3A 2FDBP 2FR4A 4XNUH 1DO6A 3L1FA 3P3SA 1WCBA 4QLWA 2PP9A 1T22B 1O9ZA 1XSOA 2IPUK 4MQ7B 5TDPB 1AKJA 1T7WA 4AC4A 5BRPA 1FYTB 5DUBB 2GJ6E 4IRSD 5F7DA 5I8EB 3MV8B 1G0YR 2DM4A 3ECUA 4M8QA 5CGYC 5D7KE 3DDFA 5I8OL 1CBVL 2HVBA 4U6HA 4X42A 3OAWA 3IF1A 1LE9A 4XP1H 4KWUA 2X9XA 4ZXBA 1NINA 5I74C 2K3TA 2PETA 4TM9A 2VR6A 1X4YA 1TTGA 3BYTA 3EDJA 3Q6FA 5HHMD 4A67A 4A6YH 2K7QA 3DWTA 1JWSB 3VI4F 3WXVH 4ESKA 1QD0A 1T04A 3OJVC 2NY3B 2CJUL 2X6MA 3QP3A 4EIBA 2J5LB 1WV7T 1DCEA 2E9JA 5IMKA 1IEAA 5ABAA 2F8OA 4WHYH 2H0JA 2VDKH 2Z93B 1SOKA 3K2UL 2FYYB 2MH4A 5K69A 1SHWA 3C5SA 4PY8J 4XMUA 2JJTA 3O2DA 1K85A 1UENA 4HIJB 4NGHH 3MNVB 1HZHH 3RJDA 2BK8A 5TF1H 2NXZD 5AG8A 1IQWH 2EILB 1FGNL 3V7AE 4ELKA 1GGCL 1CXEA 3VXUA 2PTTB 4N25A 5FFOA 2YGNA 5AVXB 1TSHA 2VXQA 2WUCL 1MHCB 1EMTL 4JFDD 4XPAH 3V0JA 1W8NA 3IJSB 5ICUA 4XVUD 3Q2VA 1A9BB 4LHUA 2ZUWA 1W9XA 3ULVE 5BNXD 3B7SA 2F19L 5CEYA 3D33A 4NAJA 3DBSA 4NQXA 4NUGL 2A7BA 5E03A 3F7YA 2ZKYA 3CE1A 3ZL4H 1ITBB 3BQVA 4YX2H 5BO1H 1IARB 3MZTA 4EI6B 2VXVH 1HSAA 2P5WD 3H1ZA 5E6ID 3IPFA 4G9DA 4QGYA 2LLNA 2ZNXA 4MAYA 1TPXB 2VM9A 1XAUA 3BDBA 3ULUF 3G7TA 2E8YA 4PJIF 3ZE2E 4QDGA 3RWGA 2VLRE 3UYPA 4XRCA 2Z31A 3UPAA 3NCJL 4JAMB 4HAKA 2CUIA 4MRBA 4AYEC 4K0OA 4YO0B 3V9FA 3ECQA 3EO1A 5CIPH 2XDHA 3D0VA 5TFSL 3RFZB 5BZWB 5GZNC 1T66C 2EE9A 1WBZB 4OKVB 4BQ9A 5GSVB 1GAFL 4OZ4A 1LEIB 1LO5B 3G9AB 2N7SA 3KWVA 3TFKD 3BVDB 2MHAB 4HSQA 1KG0B 1A4KA 2DJUA 3EGDB 2KZWA 3IGFA 3REWB 2O72A 5DJ8B 2XG5B 3O0LA 5KEZA 2Z1PA 1LE5B 1O7DC 1EHLH 4LCIH 2OJ1A 1NCAL 5CUSL 1YPZA 1IGIH 1S2EA 3EJTA 3B7UX 3CCHB 5LCVH 2OMYB 3EHBB 4FA6A 4NJ9L 2C7FA 1MI5E 3ZKXB 2WXPA 2GBTA 1FH5H 2FD6L 2E7CA 3RHWK 1EBAA 4B9PA 2BVUA 3CSYB 3P54A 2Z1KA 3W9DB 4D0DB 4MJ6A 3WIHL 1UXLA 1CXHA 3CMOL 3S35H 2BCKA 3H7LA 1VAHA 3LTVA 3GBLA 4NNYA 5E99L 5EOTB 2IDUA 5T1MA 4ETQB 4JY4A 5E8PA 4JG1H 5CN1A 1RU9H 2VQ1A 4M7ZC 4LSDA 3BUQA 3O11A 2A6JA 4R0LA 1NFAA 4IMKA 2WZ0A 4KFZC 5F7EH 1WBYA 1OAYH 2ED6A 1PPIA 1KFAH 3C08L 2JELH 3ARUA 4N24A 1GY1A 2BFVL 4MZIA 3VXME 4QJ4B 1P7HL 2B08A 4ODUB 5J5EA 5EPMA 2O5ZH 2F53E 1TENA 2GJ6A 3GXMA 4L8DB 5F21B 5F89B 3D07A 5E4OA 4G8FB 5EF0A 2CBMA 4FKEA 2E6JA 4YZWA 5A43C 5LKNA 1CS6A 1SJHA 2BVOA 4PCKA 3BUPA 4GO9A 2H26B 5KBDA 4MLIA 4HBQA 1UXMA 2UZIL 1H5BA 4P3CL 4CGUB 1HEHC 5D9SB 4JKWA 4AT6B 5FYLL 3SY0A 1SHSA 1KCKA 5TPWL 4Q56A 4QYOB 1QPPA 1UA7A 1HFUA 2VWEE 3D50A 4X0KA 2D73A 1CU4L 3REVA 1W72B 3ETBF 4LU5H 4UIMB 1BECA 3P77A 2BSTB 4JDTL 5DCCA 5FWRA 3ILEA 4B9FA 1CLVA 4IRJB 2IWGA 1DQLL 4NSKA 1P1VA 3QQ9D 1KT2B 3CBJB 4OCXH 5JQIB 3OV6A 1N5AB 3N0PB 3HG4A 4O00A 2CRZA 2E7MA 2AQ3A 4KHTL 4PWFA 2R29A 2RR3A 4YDKL 1FL5B 5FDYA 3KR3H 3T4YA 1WUZA 2GKIA 5FW7A 4QEGA 4NZUL 2ILLA 4JPSA 4NFDA 1XCQA 4XOCA 4LZKA 4JDEB 3DBXB 3O2VL 1ZAGA 1FCGA 2J1ZA 4HSAC 1NCTA 5SWSD 4ZUTA 5EWIL 3UFIA 3HVDA 3BJLA 4WU5A 1KTLA 1ETA1 4ZFZA 4B53A 1E8XA 4OGZA 4ZTOL 3WEXB 4IU2B 4MDJB 2Y7MA 1NH6A 4FJZA 3FRPB 2OMWA 3NFSL 4IBWA 4EN3B 3HE7B 3FCUB 4JX0A 4KBPA 1OSZB 2IALB 4J3WA 3G5VA 3JTSA 1D9KD 1P5UB 2OTWA 2EIBA 3KYKH 1OXYA 2VLRA 1C08A 1PFCA 3G5YB 1V7ML 2YAMA 3D0LA 3L3JB 5AYUL 1NWPA 3OAUH 3DROA 2WOBA 4RETB 2J55A 3GINA 5JYLA 3UGUA 4WUUB 5FF6A 2Y1ZA 4GXVL 2H0PA 4MMXA 2P52A 4H5SA 3SODB 1BXVA 3H9SD 5FCUH 2D7NA 2NY4C 3FU9A 1HQRA 2VXQL 4OF5A 2CDEA 2ZJSH 4WWPA 1X7TA 1L6PA 3ALWA 1H9DA 4KUCF 2CPUA 5HDLA 4XCFH 2X41A 4Q14A 3P4OB 1P84K 4XWGL 1AR2A 3SDXE 3LN5A 2C7UA 1D6EA 1DO5A 1ZHLA 4MTMA 2DKUA 3FU7B 5AW3B 3BQUD 1OVZA 2IWEA 1MI5A 2BNUA 2IH9A 1QRNB 4AITA 5FYJD 1T5WA 2VW6A 1I1AD 2O61B 4A7GA 1UQSA 2WLLA 4KROD 1QWHA 4LDCA 4UTBA 4L9LC 3FO2A 1QNIA 3FL7A 4TNEA 5DZAA 4U4IA 2KQNA 3PWUA 3AG2B 3II1A 4U3SB 4L3EB 2UWEF 2C1OA 4W6WB 1BQLH 3C12A 3G6DL 3UZVA 3O6KH 4J3TA 5FGCE 1AIFA 1NCDH 2R2BA 5D1QB 4PJEF 1MVFA 1A3RL 2CMRH 3T8XA 4HJJL 1YEKH 3BN3B 1TTCA 2QV4A 1MLBA 5EZIL 3VXMA 4CSSA 5LQBL 3IMTA 2J4WH 3UPCA 2FL5A 4PJFF 5EBMB 2JWYA 4OZIE 1MFBL 2QQNH 5DJXB 3ESUF 4BKLA 1B2YA 4JRXE 4Q6IA 4MMZB 2CCVA 2EIDA 5DD1H 3SYQA 3UAJA 4JEGB 1P6FA 1GGUA 3MOBL 1Z5LB 3BH4A 1PZBA 3V0VB 4I0CC 2W0FA 4MKTA 4WY7H 3HE7D 1DSFH 1XCTA 2VDRB 3C60B 3K6NA 4A6YA 4F8PA 1KN2L 1NAMH 4TQEH 3MRDA 1H3PH 2ERJC 3NCYS 5IMLB 4Z7WB 5F0PB 4X4YA 1EFXD 4ZMAT 2X09A 5FS5A 1EDYA 1ZVSB 1FQ9C 4BV1A 2G2RA 3CK0L 1KUMA 1N12A 2EQDA 4UTCA 1I3GH 4M6OH 1N5YH 1CFVL 4D0BB 4JO2H 4S1SL 3UDWA 1YMHA 1RZKH 4GKLA 1ACCA 3TZVD 2V33A 3RVWC 1S9XB 4LGRB 4Z95L 4PLKC 4XP9L 1C5BH 2BNQD 5E1AA 4X6CF 5GQBA 5A40E 3BUDA 1FO0A 2FEDD 4HCRA 1MCWM 1TZHA 4WGWB 3CVIL 2FR4B 1TSRA 4ANUA 2X7LA 2DV6A 3ZO0A 3KCWA 5JR1H 5E9DD 1CDCA 1AKJB 1FVEA 4YHMH 5CNHA 1MF2L 3AT9A 1KJ2A 4Y16C 1U91B 3ISYA 4ZW5A 1BVLA 2W91A 1ORSA 5LJYH 3F62A 3QA3A 3BMVA 5KN5B 1EUUA 1MCOH 3WNIA 3T65A 4M3KB 1XR8A 2A9CA 4M8QB 3DO4A 2QL1A 3MRJA 4L0YA 1IX2A 1HOCB 3VW3L 1JHLH 3EZJB 3K4DA 5F3BB 2AXWA 3GPSA 3O8XB 3HKZA 1FFRA 2ITDA 2HWZH 5GJTH 1QLRB 4ZXBB 4AVJA 3DUHA 5KS9A 3HAEB 2HMIC 3NJFA 1V54B 4HCIA 1R3JA 3EIFA 1ZS2A 5I1EL 3I2CL 1ZLWK 1S7UA 3N0AA 2E27L 3O9WC 1UJ3C 1JTOA 5CGMA 1F0LA 5FFGA 4F7KA 3CLWA 4Z7UF 4S1DD 2DLHA 3NSFA 3EJJX 3NJVA 3OC8A 5T3XH 4BQ8A 2R29L 3GBDA 1FZMB 1UOVA 1OTTC 4A2DA 3C5SB 1A8JH 2H1XA 1KBBA 1TJXA 3QZPA 5TE7L 3TYGL 4LQ1A 4EBQL 1R4XA 2J44A 3TO4B 3VFNA 3MREA 3OQRA 3BGAA 4HS6B 4ELKB 3VXUB 2HFEA 4NWUH 4K94L 3OR7B 3DSNA 1PZCA 1T5XB 2GQHA 3BVUA 4Y4HD 5I73B 4TNVF 3ULVL 5EULV 3SDXA 1LEKA 4LHUB 2ADYA 2ZUUA 4CW1A 4X6BB 3N42B 4AQ1C 1LP9E 5FIEA 1KN4H 2VMDA 2IDQA 5GZNA 2C3GA 5CEYB 1GIGH 3F7YB 4OFYA 5FM8A 5D4IA 4H0GA 1V10A 2B16A 1W0WA 1R5IA 4WI6A 1MRDH 1ZE3H 5DJZA 5GGSA 1HSAB 2XBDA 5EO9A 3P69A 4YSSA 1Z2KA 4G9DB 4PLNC 1IIIA 5IOKA 2IPUG 4Y1AB 1DQJB 2YPLD 3N5AA 2G2NA 3AU1B 3DOSA 2PYED 4PJGB 4UAHA 2LU5A 5T1KB 3S5LA 4D9QD 1U3HD 2VLKB 3RBGA 3NIGF 1WBXA 1HNFA 2WAQA 3TVMD 4M5ZH 3O4OC 3APCA 4HJGB 3KJ6L 5E8NA 4WV1A 1SLVA 4DH2A 1UA6H 3EO1B 1ZIAA 2P47B 2MNJB 2C26A 3MRLA 3A67L 5I76B 3CFJA 4IS6A 1L7IL 1Z9SA 3QH3A 4OZIA 4F57H 1W0VB 4OZ4B 4YGAB 4JRXA 4N90D 1N70A 4DKFH 1B9KA 4DERA 3MLTB 3QIBA 4XPGH 2PXYD 1QP1A 2ZX6A 4XAKE 1XGPA 2PW2A 1QTYT 2EDBA 4Z76B 1WHOA 3FBKA 5C0AE 1MWAA 4Y4KC 1DBJH 3SDDB 1SN2A 2NDGA 2EIMB 1GGIH 3KNBA 1Z0NA 1SJEA 3CVBA 2HT2C 2J88H 1OKEA 1JG9A 2BHUA 3DMMC 4Y2OA 3T1FA 3O81A 3GJFK 4UTBL 4P06A 1LO0L 2ICWB 1R5WA 4W6XB 1I1YB 1X5KA 4XNUL 1OAJA 2XVBA 4KV5F 2GIYA 4U7MA 3FQNA 1GOGA 4DZBA 1B9ZA 1JUFB 3FTSA 2P7TB 4HUUB 1JSYA 4HKBA 2BDNH 4JY4B 3WTXA 2QZ5A 2N0MA 1M53A 2VQ1B 4ZUSB 4MCYB 4W9DC 3BAKA 5CJBA 3BVNB 4OB5H 1OF2A 5F9WC 3W9EB 2AJVL 3N3EA 3SCMD 4BIKA 1EGJA 4XP1L 1LNUA 3O6LH 1FDLH 4YHLH 2X6VA 1D7FA 3LSOA 4N1HB 2WBWB 1SJHB 1QX1A 1IGTA 2BVOB 3IMUA 1X5AA 4A6YL 3Q8BA 4NQSA 4ZPTB 5K1VA 3ES6A 4GUOA 1EANA 3OZ9H 4X0NA 2VISA 4GH7B 1H5BB 3T9WA 4Y9EA 3ARPA 3D34A 4L4VD 3ULUH 3SY0B 4OZFH 3CHRA 3AW5A 4BK8A 3FU8A 2DLIA 2YGVA 3AB0C 4MXWH 4R2GC 1VLXA 2XJLA 2VDKL 3HI1A 1FNLA 1KNOA 3ZZ1A 5H37H 2NSXA 3FU0A 3P2TA 1CFSB 4M4PA 1T1XA 4K7PX 4XZUB 3P77B 4NGHL 2MEJB 3U6RA 1TXKA 1EHKB 5TF1L 4N4YB 1GS7A 3VTMA 2FZ3B 2GHZA 4DCQA 5FLVA 4OD1H 4HCRL 4PS8A 1IE5A 1BQHA 2ENQA 1GTNA 1CWVA 4XPAL 5FYJU 4EOWH 4YSUA 3X14B 1DCLA 3BAYA 3B2XA 4IBUA 3L5HA 2WVVA 3BVWA 2YD3A 2VUKA 5J13B 3VU2A 2EXWC 1BXUA 3K71A 1HEZA 4IJ3C 1JGVH 2O6EA 4JM4H 3SKUD 2QVTA 4FJYA 4NHUB 5GS1B 5BO1L 3KPPB 3N06B 3V6FB 3UAFA 5CGBA 1LP9A 3TNNA 4XTRD 4BH8A 2VXVL 1S7XA 3FK3A 4J1UB 4WU5B 3RTQC 3BP5A 1YUHA 3MAWA 3BAJA 4BQCA 1AZCA 3U2SA 4W9GC 1OHZA 1RUQH 1BQKA 1TVDA 1MHPH 4QNPF 3HHMA 3RL2A 2OMWB 2G0KA 4PGCB 4DKAA 1M7UA 2KZ1B 3P02A 5JIDA 4A7UA 4YFEA 1F97A 3APDA 3SJVD 1R3IH 1XGUA 4DHLA 3VG0H 3G5VB 1YNKH 3MPCA 4R5TA 3U6XS 2OTWB 3DHPA 2D31A 3H9ZA 4DKTA 4FL4B 2WWMC 3W3BA 4P0DA 3ZE2B 2ETWA 4LDEB 4PI2A 5KSUA 1JZ4A 3VH8B 1MIEL 4WFGD 4GBXD 3D0LB 3MGTA 4UOQA 4MNGE 1DJWA 2Z91A 2CRIA 3JWNG 3WE1A 2RD0A 3IU4L 5D1ZI 3X3FH 3GKWL 4UQEA 1U8CB 2VITA 3KYAA 3IGAA 5IFAH 5B7FA 4YSEA 5F7UA 3L81A 2XZAH 5FF6B 4ZAKC 2YUXA 1EZVX 3BZFA 1TEFA 2PCYA 1UM4L 4X7TA 1ZA6A 3KPSD 5I9QB 4CA4A 4YEEA 1EHLL 2I7OA 4LCIL 5BJTB 2EE2A 5J12C 2UVFA 4EJ1C 1IGIL 1XB6A 3S2CA 3PWVA 4OTXH 3WDHA 1HKFA 4FXTA 1KIQB 3S88H 3VI4E 5TK2A 4PJ9C 3O41A 5C0AA 1CIDA 1F6FB 1GZQA 1FH5L 4W70A 1XIWD 2C7UB 5GGTH 3K46A 5EBLB 1JWUA 4N5EC 4U1HA 2XN0A 3RWHB 2IGLA 2GUOB 4FERA 3CFEB 5ICXA 1NBYB 3S35L 4XNQB 3C75A 2E7BA 1PG7X 1HWGB 2EAEA 5F6HI 1UQSB 2JQZA 2OLDA 4N8CL 1IJNA 3T08A 4G8EB 1RU9L 2VN6A 5AW5B 1ZT4A 4FXGB 4JJOA 2G4EA 5GHWH 4YPGB 1PTZA 4Z7AA 1U30A 1OAYL 1R24B 3ZKNC 4PB0H 3RVTC 4YLBA 1RUKH 3KBHE 4KXBA 2O5ZL 2XYCA 1KULA 1P1ZB 1P6WA 4MD0A 2NY0D 2YJQA 4PJBA 1KGXA 2VKWA 5EFIA 2X0WA 4KVNL 2J43A 3AS3A 1MLBB 1VDGA 3T2LA 3ARTA 2FIKB 2Y6SC 3CN3A 2FL5B 4E9RA 1J0HA 4ONOA 4FNSA 4JJHA 2A83A 3RWJB 1JXDA 4Q6IB 6FABH 4KQ4H 4ADIA 5AENA 4WI0B 1YEJH 3GZKA 4HKZA 3AMKA 4WWKA 4TVUA 2TRHA 5HGBA 1E5CA 3KLDA 1MWAL 4ZSOE 2KS0A 5EEUA 2ZXDA 5CBEA 3LH8A 2DWDA 1XCTB 3IDIB 2BIOA 1J1PL 4LU5L 3UC2A 4D9RD 1N18A 1N26A 4KRMB 2ZWZA 3GRGA 3UJIL 4X4YB 4UANA 1ILSA 3GTNA 3FN3A 3LZLA 5CMAB 2HH0L 1KXQE 3QI9C 2P45B 4Z7NF 5HD8D 5EZLA 3VAEA 4KUZL 3KVPA 5ETUA 5KTEH 1QFWM 1YMHB 3KR3L 4WSJA 4IK6A 1XGRA 2J1YA 1D3CA 5I74B 4XC3H 2PPFA 1VGEH 1ASPA 1FO0B 4WF7A 4B7LA 4PRBA 5CSGA 1JZ6A 2MKWA 2WK2A 3OKMB 1OGPA 2HB0A 4FMKA 3TH3T 1EGJL 2AV1B 4MJ2A 2MQCA 4YSRA 1KJ2B 4MMYB 2V37A 2D9QB 1BVLB 4H2CA 2Q6WA 3QA3B 4IDLA 4QTFA 5EIQA 4IKKA 4KKCD 3BXNA 1GZHC 4F2FA 1PJ9A 1U8NB 1XR8B 3L5JA 4HJ0D 2ENYA 4X9YA 1EAOA 1E6JH 2X4PA 3S3JA 5A2BA 4Z5RA 4JCLA 3KYKL 2KDGA 3AJ7A 3M1BA 3UP6A 5FDWA 4LSSH 5KS9B 2FX7H 4HQQH 1KTDA 4M5SA 4X6FB 2OJZH 1Q9OA 2LLGA 3OAUL 2ARJA 2BSED 3S97C 3HLAA 4FFVD 2R0KH 2R39A 1XZ0A 1COBA 3VD9A 4J4PA 5IROD 3KPLA 1C5DB 3PNRB 3EDEA 4JRFA 1AO7D 5D55A 2C3XA 1VSCA 5FCUL 4MNGA 2WOYA 4N0UB 3UL4A 3POHA 4Y9BA 5AEAA 2XWBB 2KMWA 3I6KA 4GIAA 2ZJSL 2WNGA 5KBKA 1GSMA 1JGLL 4ZUUA 3ECVA 3U7YH 2CXKA 4GI9A 4UAOC 3H3BC 1K5NB 4XCFL 2F1BA 1DJXA 3MREB 4TKWA 2X4NB 4GW4B 2W1NA 1YJDC 2AK4B 3X13B 1X5MA 4WCYH 3DSNB 3C6SA 3VI4A 1Y0LB 2FIRT 1A14L 3RHWF 3V0GA 4F37K 2ADGA 4G9FB 5C08D 2EE3A 3K4ZA 4FLQA 3SDXB 3QUHA 4HZ1A 1UD6A 2LFEA 4ONHA 4ALAH 4YHKL 3PY9A 5J9PA 1LO2H 1CZ8H 1M05A 2X9WA 2NYKA 4BGLA 2BH0A 3SYAA 1CPUA 1ZLVH 2PO6C 3PGFL 1HH9A 4ATWA 5FO7B 3RI5K 2X4RA 1F6AA 1W0WB 1R5IB 2XRAL 2CWRA 5CGYD 3MV7D 1WITA 4MJ5A 5DVPA 3OG4B 2K9UA 3UJTH 5HY9A 4FQ1H 1RMFL 4WSGA 4WQOA 5I28A 1QFWI 3DVIA 2N3JA 4POZC 1R3HB 2EH7H 5K9OA 3FQ4A 2CMRL 2CSPA 4A66A 3LZQA 4YSQA 3GDBA 3WEBA 4AJWA 2J4WL 2Q7NA 1FNEA 3UEZA 2AQSA 2I69A 1OD7A 2EXTA 4E0RB 1A3LH 2QQNL 4JFEE 5E8NB 4UB0H 3SKOA 2ENPA 4WV1B 5DD1L 2ZOWA 2HJLB 4OF6A 4OVUA 1MLCB 2DQJH 3BRDA 2I25N 2YZ8A 3SO5A 2BOBA 2XTJC 1Z9SB 2YD4A 5SX5K 5F6HJ 1PFOA 3FTUA 1DSFL 3WOVA 1JI1A 1L4IA 5D6CA 5F7WC 4LVNC 4MGXA 5DFAA 5DYFA 2W9LA 5DHVH 1PNDA 4ZSOA 2PW2B 4M7ZB 1IU1A 4APQC 1HHKB 1R46A 3HTLX 3WS3B 1WCQA 1S9WB 3CFKA 1LJMA 3G6JB 4PMFA 3CLEL 4M6OL 2DTSA 4DEPC 5BS0B 2B3IA 3KNBB 1WP6A 2X89A 3CVHA 2AAAA 1EDHA 3MO1B 4M7KH 1RZKL 3PP4H 4OZGF 1H3VA 4L23A 5A2CA 4PG9A 1NFDA 4Y2OB 1AHKA 1KXQA 3RGVD 1NPNA 4AJ0A 4FE9A 1BIIB 5EU7E 1PY9A 1MELA 3IVKA 4R9HA 1ONQA 2F8IA 2M26A 4XCNB 3S8GB 2L4OA 3SDYH 3FQNB 5ESAB 3B34A 2WCSA 2APVA 4ODXA 4YHML 4HKBB 4WEMB 1EEZB 2IOIA 3C09C 1OT2A 1KSRA 1SDYA 2WXNA 2P8PB 1SRDA 1U3YA 2XX1A 4MS8D 2A6DB 1NBZA 4M03A 4IYKA 1OGAA 4NI3A 4JL2A 4Y2NA 1Q1JL 2XZQL 5DHXB 3VXNA 5F93C 3WD5L 1M9WA 3QNFA 2BW4A 3DI3B 3QNXB 3GKZA 5GJTL 2HWZL 5TK4A 1CD9B 3LSOB 3O6ML 4UM9A 3JWOC 1NEZG 4Z8FH 2XFGB 3ZHLA 4NQSB 1ZHNA 2HG0A 3ES6B 4DP4X 3FFDB 1U36A 5E5MB 4NOFA 4FLSA 4OW6A 3T2PA 3UERA 3BEVB 3TT1H 4HVBA 2HA1A 2WKOF 3QO1A 3BUIA 4CMMB 5I66B 1ASQA 1BMGA 1L5GA 3ILPA 1T2QH 1JPGB 3QGVA 4PJEE 2Y2WA 3PS6A 4EZLA 3VRJA 4HPHA 1ECZA 1NBVL 1IAIH 3RTQA 5BRZE 1T1XB 3FC8A 4BCXA 2KYIA 2QFPA 1A4CA 3U6RB 5D7JC 1FG9C 3K6SB 2X3BA 4AYDC 1I9IL 3ARDC 1PKQE 4V1DD 4KKQA 2XZZA 3MUJA 1D5IH 3H42H 4JS7A 1DJHA 5D5MF 4A7SA 2WBJC 5KW9H 3PXJA 3CZEA 1BQHB 2KERA 4JHBA 3EBGA 2F7OA 3IJ9A 1AOHA 5E7BA 2QR0A 3C5ZC 4LLWA 5DD3H 1N0LA 5C9JA 2WVVB 5CP3A 2XETA 2GTQA 1HEZB 1TZGH 2MFNA 2RB8A 1T2XA 2XQYA 4I3GA 4N2LA 3K74B 4CSPA 2NY1C 4EE2A 2J1KA 1SJXA 4NKDB 2OTUB 3DV4B 5CZVH 4NERA 5ECJE 1MRDL 2J57A 3TNNB 2IADB 3T77A 4ZAKA 4F2MB 3ROLB 2WXJA 4O4YL 5H94A 3S5ZA 1DUYA 1NKRA 4F8LA 2N1TE 5EU3A 1UOKA 2NY4B 3M07A 3BSGA 4QTHB 5FUCC 1SGKA 2Y7QA 3HZVA 3AITA 4RGNC 3B5TA 5KVEE 3KD4A 4LSUH 5D1ZC 5I2IB 5JHBA 2H32A 2HKAA 3VD5A 4Z7QB 1Y18A 4KX7A 2DQCL 7FABL 2ZWKA 4NJAH 3KGSA 1H0DA 1PBYA 3KPQB 4XMWA 3NG5A 1JMXA 4F57L 2WLIA 3BX7C 4JFEA 3M7OA 1NTDA 5D2NE 2BRRL 4MSWB 1GPOH 3OC5A 3EF4A 1IBDA 2WM0A 2VITB 3RX9A 4DKFL 3IGAB 2CLVA 4XPGL 3SKMA 1DN0A 2ZP8A 3KH4A 2XG4A 4L9LB 4WO4D 2D03H 2JQAA 4OLYH 5C0FB 2WXKA 1ZA6B 3BP7B 1NGWA 1MEXL 3O3DA 4PJAB 1RZJH 4BFIB 1DBJL 5BXFB 2K3HA 4EN2A 2GI7A 5CP7A 4DFIA 3QUYA 1HHIA 1GZQB 3GT6A 1JZGA 3QFDA 4JHAH 1PAMA 1TYJA 2IWKA 1HKLH 4Z7UE 2IG2L 2W65B 3PV6A 4U1HB 2VO8A 2GBUA 5K33A 4KX8A 3P4NA 2CBOA 4P04A 3LZFH 4S2SA 5CZXC 4QRPD 5I0ZA 4FQIH 3ZE0B 4AZ8B 1A1OB 5DZVA 2P46B 1BZEA 1J87A 4LL1A 4MJIB 2J56A 3BAEH 1E3XA 1OCOB 4OB5L 5FGSA 2K8QA 2EEDA 2GVYA 1CGVA 5A2LH 5I1LA 1WAAF 5FPIA 2ERJB 1XGQA 1EFQA 2Q86A 1K8IB 3ZMNA 1F3DH 1D5MA 1K4DB 3ARGD 4ZOAA 4JFOB 4PMEA 3LEYH 1M42A 2OR9L 3O6LL 3PAYA 1FDLL 3DX1A 1NKOA 3GMNA 4I9WD 4PJBB 3BD4A 3GHPA 3FS9A 3TN0A 2ZF9A 3CBKB 5KZCD 5T3ZE 2UV3A 2ZCHH 4K3JL 3NMEA 1HYSC 3OSKA 4YL4A 1RJLA 5AAWC 3V5KB 3LXUX 1ROWA 3OG6B 1A22B 4C4BA 5I1JH 4HKZB 1ZS8B 1BWWA 1MCJA 4MXWL 1QR1B 5ICZB 1P4LA 4Z7VB 3QRGL 1LK2B 2YN3A 3LKRA 2V9QA 5CBEB 1P7QA 2VQUA 4MZ2A 4X5LA 1U21A 3OAZK 4X8XA 3NIGE 3CVHL 2O5YH 2DTML 5FO9A 1V55B 2R0LH 2DLTA 2EXYC 4Y16B 3F8UB 2P3YA 3CQPA 4G6FD 4PJEA 4PYHA 1I8UA 1JNNL 3L7FA 4A37A 4G5AA 4JE4B 2ATPA 5DYOA 4AV5A 1VADA 4H40A 3PDDA 3MBXL 5BRZA 1TKWA 2LAAA 3P11H 3LS5H 1MHHB 3WMSA 2YMXH 4KXAA 1PKQA 4GB9A 5EBGA 5ETUB 3BUYB 4Q52A 1MRCH 5FYKD 4F8OA 5K59E 3KPOB 3QDME 4LLAA 3HN5A 1QNZH 1XGRB 4JM4L 2YSSB 4JZJA 4FGMA 3UGXA 2CKBA 4HWNA 1NCUA 1R0AH 3BVTA 4G6AC 1GS6X 2L7JA 3FN0H 4TSBH 5HYSA 3W0WD 3KCPB 3LH2L 5IHWA 1JAEA 1BWMA 1NMAH 1IFHL 3O9WB 4NN7C 3UZEC 2WY3B 4M00A 3TIEA 1BD2E 2YSTA 2WB7A 1XF2A 1VFAB 1X5FA 2XNAA 4RFOH 4ZS6C 2N59A 3AREC 5DEGA 5FGBC 2RCSH 2X88A 3W81A 4QRTB 1R3IL 4GEJA 4A7QA 2YQGA 3VG0L 3QJSB 1HX0A 1YNKL 2X4PB 4YOKA 3IMVA 4Z5RB 4F8QA 2X2IA 5J7CC 2O6PA 4M61A 5ISZD 1EBPA 1QUPA 3KLAA 3QCTL 5DTFA 3QISA 2ARJB 1OTUC 2ESVE 3HLAB 3RLSA 2DMKA 3UBXG 3VFVB 3X3FL 4AQ1B 4PJ8D 1KV3A 4XN9A 3CUPA 4L4TE 1RV6X 4NRYB 5GRVL 2DLFH 4Y8AA 2PW1A 2FQEA 2UY7A 4AEIH 4MNGB 5D2NA 3LX9A 3LZOA 2VM3A 2JXMB 1YEFH 5IEKB 1KTJA 4UYPA 3ZL2A 3H9HA 5FUCE 1AFVH 4OTXL 5IOPB 3H4FA 1IAKB 4E41D 1OB1A 4PVNA 1VJSA 2CO7A 2MQ0A 1DL7H 1HU8A 5DHVA 5ACMA 1ZLSH 3CXDH 2OM5A 3OKDB 2P24A 1JPFB 5ITBL 4KK8D 4AM0B 1EEUA 2ZOKA 3C6SB 4FZ8H 4KKBC 2ADGB 3O4OB 4AE1A 1DBBL 1XD1A 1SOQA 3CZLA 1KYUA 1NWOA 1IBYA 2NY5L 4M9OA 2GJPA 2QPSA 1QSFB 2QGCA 4XCYA 3UAAA 4Z7UA 3Q8CA 5F9AC 3KS0H 3G6AB 4YDIH 3VQ2C 1MNUH 2HJFB 2L0DA 1RZPA 1HH9B 4M1CC 5C92A 1URLA 4YJZL 1G4MA 2X4RB 3EYFB 3SDCC 2NNXA 3BC9A 1RUKL 5HY9B 2Q87A 1JF1B 1QO3A 3VACA 2GYSA 5ADPH 1BZ7B 2VL5A 1NCWH 4XVTH 5E1IA 1UKSA 1PZDA 2JJUA 1WVZA 3PWPE 4UT9H 15C8L 4Y19B 5JPNA 1H8SA 4LLDA 2BC4B 3DMMB 1R17A 3HNTH 3SKOB 3R8BB 6FABL 3RY5A 2X1WL 1YEJL 3KPNA 1CN4A 2F5BL 4AJYV 2BOBB 5IV2A 3OWEA 4OGXH 3CFUA 1SN5A 3IKCA 4J23A 2Y1AA 3LVTA 4YDMA 1JK9A 5D6CB 1E40A 4LLVA 4FFYA 1OTTD 4QRFA 4U1MB 1PLCA 5GZOA 1HC1A 4YUEH 4ZSOB 3ENEA 1HI6B 4K3GA 1IBGH 2WSKA 5F9WB 4ORGA 3MA9L 4L3CB 2NR6C 1FF5A 2E74C 2VMJA 2HLFD 1NDMA 4BKSC 3T4AC 5ALBH 1WTGT 3ESVF 3M7FB 3E38A 4N22A 5KTEL 4P4KA 3BEWA 1NFDB 4X7EC 1ZVHA 3HVNA 2NYZA 5TH2A 1F41A 4XC3L 1VGEL 4GG6A 3O4LE 3UTPE 2KL6A 4DO6A 3IVKB 4R26H 3ZTNH 2WXLA 3ZE1E 1ONQB 4G7VH 4IJTA 3AM8C 1IM3D 1CICA 4CBPA 3QDMA 5AB2A 2VW7A 2XFXA 1PSKL 3NEOA 4F8NA 2RAMA 3AB0B 2AV7A 4R2GB 3VXRD 1FHNA 4NQTA 1JTTA 3LKNA 1MSPA 1OAXH 2A1WL 1UADC 2ROXA 3QBTB 1E42A 5CR8A 1OGAB 1BD2A 3VXNB 1FA4A 1JXGA 5D7JA 1E6JL 4J3BA 3ARDA 5KUMA 2BVEA 2N0KA 2WBJA 3MLSH 4NHCH 4KMQA 4HF5L 2QQKH 4LSSL 1UEMA 2FX7L 4HQQL 4M3JA 4HUWB 1WYJA 4UM9B 5DMYA 4ES9A 3BH8B 4AV4A 1XZWA 2R0KL 3V4UL 3DK2A 3D4YA 3FQWA 1L9TA 2IQ9H 3BWAB 3LRKA 2GCYB 2C9XA 3IYLW 1NANH 4IJ3B 3VXQB 4UQ2B 1CF1A 1XBRA 3QO1B 1HL5A 5HDBF 3GHEH 1KIPB 3HCVA 2ESVA 1F4HA 2A0LC 4P23C 1VESA 4EPSA 4MJJA 4Y4KD 3AQZA 2ZF8A 2NLJA 4L4TA 3VRJB 2EEXA 4NBXB 3WSQL 1UUSA 2KDYA 3RTQB 4F8TA 3U7YL 1ZHBA 4URTB 1HILA 2HT2D 4AKPA 2VR8A 4JN2B 1UG9A 1RZ8A 4XO8A 4ICWA 4LPVA 2MQ3A 4KXDA 4WCYL 2CKBL 1DJZA 1OAUH 1BX2A 5DS8A 3IDNA 2BSCA 3QUGA 2QR0B 2NXYD 3K4AA 5D7SH 4JFXB 4PV8A 1WD9A 3NCWA 3ERXA 4NXKA 1KCVH 4NENA 1TCRA 2XQBH 2FGWH 1LO2L 1CZ8L 1KGYE 5DWPA 1KTKE 2MPVA 4L2YA 5JMOC 3ARWA 1V3MA 3CD4A 1IEBA 3ESPA 3L3HB 3H0TB 4B97A 1WS8A 3LN4A 2CJ3A 5JW5A 1HDMB 5FA4B 4Z7NE 1GC1L 5TGBA 1IC5H 3MRKB 4ZAKB 4NQUA 3UJTL 4I87A 1KEMH 4HLEA 4FQ1L 3U4AA 3X11B 2J8UE 4Y4FA 3QPXL 3OLDA 1CFTA 1X5JA 2EYSA 3TXAA 5KVEL 1KWGA 5J12B 2EE0A 1RULH 3VE0A 1XH0A 3LKOA 4IMLB 5IY5B 1G7HB 4WFED 3T0ED 3V5HA 3S96A 4UB0L 3BWUF 2H32B 2WLJA 1Y18B 4YVUA 2DQJL 5SV4A 3QYNA 3PWPA 1S78C 1VZIA 2GEQA 2BOLA 3EG9A 1KYOK 5SWQB 4TQIA 1DFBL 3V5DA 4FOMA 3QO0A 3MLRL 2E9BA 4KTYA 4L1DA 5EU6E 2CLVB 3UO1L 1C8QA 1DN0B 2BOCB 3F58H 2XG4B 3HNVH 3SO3C 1OCRB 2PR9A 3SQBA 3O3DB 3CC1A 4NQDB 4BQBA 3F12A 2C9PA 4JR9L 2CK2A 4L37A 3EADA 5FYKU 3MUZ1 4P57A 5A7BA 1DJGA 4QF1B 4M7KL 3PP4L 2DM3A 4MZ3A 1K72A 2MRYA 4QHNB 1HHIB 1BZ9B 3MGOA 1RI8A 5ID0A 3QFDB 4PGDA 5HXMA 3PG2A 1S7SA 3RIAK 5IVXA 5ADOH 1OIOA 3CFNA 1GCYA 4Y5XC 5MENB 2VC2H 5DJDA 3O4LA 4PGEA 3L1OH 5JW4Q 4LLYA 1U8JB 4HXBL 3I50H 4OD2A 2OULB 4KY1L 1IBHA 3ZKQD 5I1DB 5J56B 3KJ4C 1LO3L 5KG9A 1RIUH 4JM2C 1MZZA 5EH1A 4HIIB 4MAZA 2Y7NA 1JZ3A 5AZ2H 4MB5A 3V6ZB 1O0VA 2Q86B 1XGQB 4PI0A 3SKJH 3WIFA 1UH3A 4MCMA 2IAMC 4JFPB 1D5MB 2GITA 3MKGA 1TYRA 2DL2A 3GMNB 4P2OD 3QI9B 1P0SE 1XMWA 3HC0B 1M9SA 3POCA 4OFIA 1F00I 1BJ8A 1QASA 5F70A 1HCYA 4G6KH 1RJLB 2V4LA 2X38A 5ILTH 3TT1L 2NPLX 4C56D 4R4BA 3EH3B 3V2AR 5AB9A 1U6AH 2CGRH 1MHEB 1NCBH 2VMEA 3WUWG 2BHZA 3DVGA 2UUDK 1ASOA 3FFCD 2BJML 3VWKC 1IFGA 4P49A 5FO9B 3UZEA 4KJPD 3JWNE 4MNQD 1Z7JA 1E8YA 4JFQA 4PJ9D 5HJGA 1XX9C 2WHVA 3AREA 1VACA 1LMIA 1BYPA 1D5IL 3P3UA 4ZFOA 4UNUA 1M3IA 1Z9PA 2VSDA 2D0GA 5DD3L 2HLAA 2OPCA 1H9VA 2G60L 5BVJB 2RIKA 2Z7WA 5F9OH 1TZGL 2DWEA 4QOKD 4L3AA 4JFTA 1UT1A 5FFLA 3ZSSA 1N4XH 2BPBA 2YO3A 4W9HC 3DGGB 5IHUH 3O0RL 1DN2A 3F7RA 1UWXK 3JV4B 4LBAA 3L3GA 1YEDA 3MJ8A 4DETA 1E65A 4Q2ZB 4RGMC 1DE4A 4GUQA 4FNUA 3IJ7A 3SD2A 2YK1H 1SXSA 4WTWA 5DEGB 4FJ6A 5AKTA 3V0I<