1KCUH

Crystal structure of antibody pc287
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
QVKLQQSGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMAYISYSGSTTYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTAIYYCARGGTGFDYWGAGTTLTVSAAATTPPSVYPLAPGSATAAASMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PC287 IMMUNOGLOBULIN
publication title Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
pubmed rcsb
molecule tags Immune system
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kcuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kcuH01
3MV9D 2ZUSA 1XF5B 5ISZA 3H6JA 5DMGD 2BZDA 3W11D 3WFHA 3MRJB 4LMQI 3FHAA 5JUEH 3BGAA 1ZEAL 1ORQB 2ESVB 1MNUH 3FN0L 5L8LB 2FATH 4HBCL 4NSKA 1EHLL 4HHAB 3KYMB 5DEFA 3V4UL 3RGVD 4P2OD 5DJYA 5HVHB 1YY9C 2ZP0T 5FIEA 2DI8A 1NCCL 4PTTB 4YIQB 3I85A 4HUVA 2R0ZH 3LHPH 4Z78B 4RRPG 3VFRA 4YHIA 3ZE0F 4PGDB 3BDYH 3QJHB 3REWA 5C07E 4LRIC 2VR9A 4N90D 1H3PL 3HAEG 1JF1B 3U0TB 3L6FB 2HKFH 2JB6B 1GAFH 4BH8A 5C09E 4X4ME 3BYTA 4OD1H 3GNML 2IJ0C 5DHVH 3V6BR 3SDYL 5BVPH 1A6TB 1U3HC 4JKWA 3MJ9A 2R0WL 3PXHA 2ZG1A 2BSSB 1OGTB 3IDYB 4KK8D 5A2FA 5DRZA 2DQCH 1T1ZB 3STBA 1AY1L 5IIEB 3ZE2F 2E9WA 2GK2A 4U1KB 4PJ5A 1GGTA 1KLUA 2I07A 3RFZC 2DLHA 3K46A 1NC4A 3B9KA 4RMTA 5FYLD 1TTGA 3FRPA 3OHXA 1VPOH 5DR5L 5CLTA 2LE9A 4NRYA 3ZE0E 1KTLA 3WFDH 1L7IL 3DSFL 3L3IB 3OPZH 4JFQA 1JFQH 1NCAH 3G08B 3GK8H 3PWUB 4XMPH 2P5EA 5EU6B 3EIFA 5L88H 1SY6L 1LEGA 4PPTA 5SWSA 1HXMB 3D18B 1A21A 4CW1B 4LLDB 2SEBA 4V2BA 3ULVD 4G7VL 4LOUC 3ARGC 1TPXC 3I75A 2ESVE 2AGJL 3DNKA 2R0LL 2HT3C 4MJ6A 5C0RH 2JK5B 4R96B 4F7TA 3MV8D 2R2EA 5C2BL 3ZE2E 4RAHA 1J8HB 3S3JA 4OFYD 4PS4L 5HI5C 4YHYC 1XF3A 4BQ8A 2NTFB 1A0QL 1D5IL 3QJFA 4PRHB 4K7PY 4XAWL 4XC1H 3ZKXB 1LK3L 2A6IB 2D0GA 5I1HL 3QQ9D 4Z7VB 3INUH 2EEAA 4M93C 3VFUB 2AJYH 3L3JA 3QXAB 1XGRB 4AT6A 1BQLL 3TN0A 5GJTL 4FQQA 2PW1B 5BRZB 3V5HB 4WV1C 1DUYB 4P99A 2JJVA 2FB4L 3GSNB 1XGUA 4JCMA 5D1ZA 4OZFG 5AZEH 2NY5L 5HI4D 1YYLH 2P24A 4V1DD 32C2A 2EDRA 4LSPH 1CDJA 1DLHA 1BJ1H 1EEUA 2B4CC 4S1RH 3VCLA 5IHBA 5ICYB 2DOCA 3LZFL 1QBML 3QPQC 5E9DD 1SJHA 2GK0A 2H8PA 4H26A 4HWZB 1JRHL 1NFIB 4XCYA 3VXPB 4WCYH 3CMOL 3LAFA 1XIWB 3LQZB 4Z7VF 2GJJA 3EFFA 1CFNB 2NY2B 3WSQH 3NCFB 1FLRH 1IQWH 3QNXB 5E6ZA 2KQNA 4F57L 2Q76A 4NM4L 3IU4H 5BS0D 1FH5L 3BP6A 3OGOE 3H7BB 3EYSH 5GZOC 1BPVA 1QLFB 4JKPH 4P2RA 2H1PH 3GMRB 5INCA 2BNQE 2A1WL 4LSSL 1OSPH 1DCLA 1MCEA 3TV3L 5DFWH 2E5EA 5SWZA 3UTSB 4ZPVA 5EU6E 4AH2A 4J4PD 1CXFA 1JUFA 1M05B 2DTML 5FYKU 4D0BB 4NWUL 4R4BA 3TH4T 4NBZB 3VFNB 5B39A 1DVFA 4U6YA 4JJ5A 1FNEB 3GMQA 1AP2B 3EJZC 3U2SA 2AK1H 1A4KB 4RFOL 1A6ZB 3W39B 1TZHB 4FTVA 1ZLVH 4O02H 3PWJA 4KDTA 3SE4A 3BKML 3JVGC 2OL3A 3MRMA 1FZOA 2ZNWA 5IKCB 5C0DB 4IOIB 4DKFH 1J8HE 3FAXA 5EIQA 4IS6B 2P7TA 2FR4A 2GJZB 2XZAH 4C56B 1E4KA 1S7TA 3P3YA 4H1LG 2GY7B 2I25N 2OQJA 3RI5F 4PRHE 4UT7H 1B3JA 4WEMB 1MRFL 4Z7VE 1YN7A 1MHCB 3TVMC 2CIIA 3C5JA 1QACA 4HX1A 1HEZB 4MCYA 5DC4B 3V8OA 1TJHL 5DUBA 5HHQA 3EYOB 1ZWIA 2APFA 4PB9L 5BRZE 1ZSDB 1L9MA 1D9KA 4PJHA 4FFVC 5K93A 2Z31B 3HC0B 1ULVA 2BY0A 4N8VB 3O6LH 1MCWM 3AAZA 4QWWC 2V5RA 1B6DA 4FXKA 3MLRL 3CFBA 4I2XA 5BZWB 5F7DA 4DQOL 5GGVH 2F58H 2XZZA 3BPOC 3HMXA 5LAXA 4WI2A 1NANI 4Z95H 5DO2D 5JW3H 4KXZI 3FFDB 1YEGL 4DK3A 1D6VH 4LSUH 2FD6L 4JG0H 4M00A 3ZKXC 5I1IH 4YBLC 4CMHB 2AKRB 4I13B 1K5NB 3MUGA 1P7QB 5CZXC 1WQVT 4Z77A 3BWAB 5IK3B 3TBVA 1VGEH 2VH5L 3Q5YA 4XNQB 1NAMB 5I1AB 2WIMA 3JV6A 1UJTA 3SE8H 1YN6B 3T65B 2FECI 3QHZH 4B50A 2ED7A 2LABA 1CDCA 3F7VB 3SCMA 1NFDA 1HOCB 3UPRA 3STLB 5EO1B 2WIIA 1QTYT 2PCPB 1FAIL 2D03L 2QSVA 5C0CA 1VFMA 4BSVA 2DWDA 5ICXB 1BQHB 3UTSE 4GO6B 4TNVF 1CLOL 4QEGA 1IAKB 5E8PA 5JORA 1L0XA 3BSZH 1KCVL 3GBNH 1D6EB 5IBUG 1YEKL 5F7UA 1H0DA 3NN8B 4XXDA 3NFNB 4L29A 5JTWA 3QWOA 4TPRH 3ARYA 3MV9B 1N2RA 2VUOA 3S36L 3PHOB 4XVJH 3BMVA 1N59B 3EUUA 3OKLB 4CL7A 4X5XB 4C56E 4PJXA 3LQAC 4HPOH 4MA1B 4ZTOL 2EIDA 2VN7A 3AC0A 1WCQA 3RGVB 35C8L 4TUKH 4QYOB 3C2AL 2O26U 4U05A 3VWKD 1F6LL 2BVEA 2Y36L 4PTUB 4IIQC 4QRSA 1DQJB 2IMMA 3VXUB 3BP5A 2JCCB 2YBRB 3WHE1 5EORH 4UBDC 4D0DA 1NLDL 1DTUA 2H3NA 4HKZB 2X4UB 2BVQB 2GKIA 1AGDA 1ZHBA 4HMDA 5AZ2L 2QQNH 5E6ID 4R2GD 3BPLC 4DN3H 5ANMA 2AS5M 1FNGB 2UVEA 1S7QB 1VGKA 4ERSH 1DUZA 3SDXA 1JHLH 5MP6H 2R1XB 3BQUA 1AXSA 3IFOA 4RMVA 1B2WL 1ZA3A 3MGOB 1BBDH 4H88L 4OLUH 1HI6B 4HSQA 1S9YB 5J9PB 2XTJD 5TH2B 3WFCL 1RURH 2G60H 4YDLC 1XFPA 3IXTA 1KBGH 2JCCF 3O6ML 4WTZA 2W65A 4FMFA 5EFIB 2Z31C 2FH6A 3N1GC 4GQ9H 3K4AA 2XQBH 3EDJA 2D2OA 3NZHH 1CE1H 5DJ2B 4L8SC 2ADGA 1ZVYA 2QR0B 3TO4C 1DQTA 5KSVB 3MRFA 5KVGL 1F4WH 1V3JA 1MHEA 3N50A 5E8NA 5MEQB 1M4KA 4GRLA 2ADFL 5I19L 2XPGB 5HDBF 1JGUL 1LO3L 1IM3A 4XCFL 5F96L 2ZOLA 5D1XD 1MFAH 2YPLA 5I1CL 3RWGB 1AR1C 4HT1L 1A1NB 4KZDH 3ARWA 4YXKL 4YDKL 2AP2A 1A6VH 1WK0A 3MV9E 1E4XL 1I1AC 3QIBA 5EU5A 4DFHA 4F2MB 3BUYA 4O2EB 3UBXB 1U8PB 3D0LB 3RWEA 1LGVA 4CVXA 1RPQA 3E8UL 1NMCB 4ZUTB 3IAGC 2Y23A 5DFVC 5T5FL 2YK1L 1CK0H 1KJ2H 4HGKC 4MD4A 4UV4H 4XT1C 3VRJB 4PUBL 1C8PA 5JZ7D 1AQKH 3D39B 5DRNA 4OQTA 3WLBB 3IDMA 2ADJB 3P4NB 5DT1H 2JCCE 3VXUE 5FB8A 4XNXH 1C5BL 1H3UA 4AM0B 4KZEH 2C4XA 3ARZA 1FGVH 2LU3A 4LEXL 1G1YA 5IBTH 4DZBA 4U6XB 4XPTH 3CSYA 3G5XA 4Q2ZB 2C3HA 1VEOA 3FB5B 4QLRA 1XF4A 1UT9A 3OBAA 3QO0A 3BGFB 1CN4A 3C8DA 4OCXH 4KKAD 4P9ML 5D7JC 5HDBE 4DKAA 4LLVA 3TPKA 4ODXB 4V1DB 3Q2CA 5MHSE 1LNUA 1UB6B 3IDIB 4OCRL 4XGZA 4NJAH 2P47B 4Z7WB 4YX2L 4AZ8A 3IVKB 4ONGH 1R5IB 3IAPA 1G7HB 5GHWH 5IV2A 1CQKA 1DDHA 3DO7B 4R4NC 5FYLH 1RUAL 4K7FB 1M7DA 2ICWA 3BXNA 4WU5B 3AREA 4HS8H 4M6OL 2FSEB 5BVJB 3ALPA 2Z4QB 1FJ1A 1TQBB 4HKJB 5CWSA 3ZTNL 2DQDL 4ZO9A 3OXRB 4D8PB 5BS0B 4GMTL 1XGTA 3FB7B 3IDJB 4UDUB 5J1SC 4K8RD 3AVEA 4R3SA 2LTQB 3ZDYF 2NY1B 1PKQA 4UI2A 1CLCA 4X6BB 3CLFH 3TBYA 5J57B 2WUCH 4H0IA 3QG6A 4IHOB 3QCUH 1FL6A 2HTKD 4K3HA 5HDQL 5D8JL 3U7YL 3ZLQC 5JW4R 4P2QB 4Z7WF 4P4RB 3ULVH 2QADB 5DTFB 2EH8H 3TBSB 4NKDB 3P73A 8FABB 3SKMA 4NQCB 3RGHA 2AXFB 4GJTB 3BD5A 3H0TB 3MV8E 4P4KC 4URTB 1OAZL 3D39E 2QHRL 3C2SA 3L3HB 2BJMH 4K94H 5D1QA 4NRZA 3GJFB 4L9LA 4JZJB 1MCKA 4NQSA 1PQZA 1TCRB 3PDGA 5KSAA 1MOEA 5I8CA 1C16B 5IW3A 2Q8AH 4G6AC 5HYSA 5DMKB 5LGKA 3LKRB 1WWWX 4HK3J 2HLAB 1E28A 3DVNA 4M1CC 3ARFC 4NGHH 1J1OH 2AJSH 3DV4B 2XTLA 1HKLH 1EAPA 3HZKB 3RVWD 4J7RA 5KSUA 5DVLA 4PJFB 4G6ML 3CCHB 1WAAE 2FWOA 4V1DE 5HYFA 4HWEH 3QAZB 4WEBH 1NEUA 4JE4B 1QNZH 2GT9A 5E8EA 3MLVL 3QCVL 1QYGH 4GLRI 5E9DE 2DJ4A 5CBAA 4Z7WE 2YPVL 5I30H 4OCYH 2ICES 1BVLB 3KPMA 3DX9B 5IJVA 1QSZA 3AXLB 3C5ZB 3MRPB 4E5XB 3EJYD 1MHPL 4U6HB 3RUGA 1MRCL 1XR9A 3UO1H 4OCWL 2OL3L 4ZS6D 2PO6D 2VDKH 5DYOB 1CIDA 3OSKA 3MRDB 3SBWC 3HUJB 3QDAA 3TBWA 4WHTB 3UYRL 4L9DA 2FJHB 3BKJL 5L2KA 3S35H 4LEOA 2HTLC 5CBEB 2B20A 2CLVB 3SDDA 5EIIA 5BS0E 1E6OL 2CO7B 3GB7A 4K9EL 1RJLB 4PJFF 4TSCL 5GJSL 3IKCA 3OKKA 5JXAH 2ZCHL 1A22B 4JRXA 4OV6F 1H3GA 3GSRA 3QA3B 5E8DH 3BOVA 3BFOA 5IESH 3EDFA 4PJEA 2ED8A 3NCMA 5FM4A 5C0JB 4P2QE 3H2WA 4KKBD 1VFAB 1MLCB 4K3EL 4KTEL 3EZJB 1C1EL 3FQTA 1J1PL 4NQCE 3HCVB 3B3IA 1NEZG 5ALBL 3HMXL 4OLZL 4N1CA 3TNNA 2ATPB 3HUJF 4NO5A 3GJFH 3FHQA 3TCXA 4ZNEE 4RFNB 4L4JA 4MD5A 4HEPG 2Z35B 1LDPH 3IETB 2CK2A 2ZKHL 1CFQA 3MOAH 3HC4H 4LU5H 2G2RA 1ZHKB 3VWKB 3ULSA 1MEXL 4GKSA 1U8HA 4MXQC 4QT5A 1CBVL 4NBXB 2BY1A 2CKBL 4Y19B 3CFIC 5CJOL 5DD0H 3REVB 3BPNB 2VXQL 4DWHA 4PJFE 1NPUA 2MPAH 2QADC 4HBQA 2VABA 1G6VK 3O3DA 1KPRA 4EOWL 3DGGB 3KYNA 1T1WA 3OR6B 3OWEA 3S35X 5HGDB 1WBYA 4OD3L 3LRSB 5ESVA 1OPGL 4R2GB 4JZOB 4X4ZA 3I50L 4OF6A 4N8VG 3MCLH 4RWYL 2P43B 1BAFL 2D7PA 4W68A 1JHTB 2VLJA 4TTDD 1ADQH 1DQLL 3T09A 4QHMB 1DQML 1JNHA 1WBXB 5J3HC 4NM8H 3QHFH 1F8TH 4H8WL 5I1GL 1QVOA 4LLWA 1QA9A 2EXYC 2FYYA 1OWRM 1SQ2N 3W81A 2XN9D 3EYFB 5IHLB 3HUJE 4YXLL 3F7YB 3K0WA 4G8IA 4BJLA 4IRZH 1YNTA 2Z92A 3O81A 4KRNA 4N0YH 1J9CT 2UY7A 4TRPL 1D5XA 5FEBA 2VWEE 5BXFB 2ZCKL 4I3SH 1KTDB 3NFPB 5KVEH 1G7QA 4LCWD 3OKDB 4Q6IA 3SO3C 2Q3ZA 3NZ8A 3QAZC 4FOMA 1BF8A 3HS0B 5J1AA 3BE1H 3WNKA 4YAQB 5ALCL 4BZ2H 1KXVC 3OAYH 4L3EB 2MKWA 3Q48A 2J8UA 5KN5A 3VDCA 1FFPB 3BUTA 1RSFA 2AXJA 4EXKA 1U42A 5D1XB 5FYJL 5FECA 1MJJA 4F9PC 3QO1B 3HNTL 3C6LA 1HHHA 3AB0C 4B53A 3LB6C 5IJKC 1ZT7A 2EDYA 4IRJA 1SBBA 4ZXBD 3VRIB 4KFZC 1FZMA 1MUJA 3CIQA 4OIIL 5CHNA 4DZ8B 5B3NA 1LO4H 1RIHH 4ELMA 2H32A 4XRCB 1G6RB 5F9JB 2EYTA 2VWEC 1I7ZB 1JMXA 4WTXA 4YHPB 1KB9J 4GRMB 1K9TA 4L1HA 5DZNA 2IG2L 5E5MB 4EN3C 1T21B 4PG2C 2WWKO 1NBZA 1CD0A 4M9PA 5IWLA 4CDGC 1U3YA 4PLJD 1FFQA 3SDAC 2W9EL 1TZGL 4FXLA 1P9MA 4Y19E 4W6WB 4ZFGH 4HS3B 4AL8L 2AAVA 1OCWL 5JMRA 3PJSB 5EBLA 2VITB 4G8EB 1ND0B 4JHAH 3V6OC 5J4MA 1ERNA 5ERWA 3FQUB 5C8JB 3HI5H 3O3BB 1UWEH 1HH9B 3UTPD 3LQAL 2D4DA 3P4MA 2VXVH 4WI8A 3UJIH 3U0WH 2XRAL 3VDAA 2AQ3A 2IANA 3GI8H 4JDTH 4PJGB 4PJCB 1FQ9C 3ARVA 5I2IA 1A3LL 3IU3B 4RFNC 1URLA 3THMH 2YN3A 3QUXA 1HNGA 3QI9B 1MREL 2CJUL 3GSOA 4XVUC 1BIHA 5T1LA 1XGQB 5DVOA 1T1YB 3I9GH 4WW2C 2W60B 4CAGA 4Y5YC 2C3WA 1ACYL 4PJ8B 4U1HB 2CUIA 1LO5B 4XVTL 5HD8D 5FGBA 3NABL 4LKXA 4QF1B 2VLLA 3O9WA 3T0EB 4NZRH 4OQTL 1HDMB 3BZEA 1JNJA 1AHWA 3PWLB 1IARB 1RUPH 5EUOA 3OB0H 2J8OA 1OSZA 1N64L 2GUOA 4YHOL 3U7AA 3VFGL 1RULL 4P23A 4PJGF 4PJCF 1VKXA 3WNLA 1UH2A 2BFVL 5ENWA 5B3JF 1A3RH 5CEXB 2VO5A 3MRBA 4TNWF 5E1HB 3VFSB 1FFNA 3WDIA 1NGWB 4L4TA 5IQ7L 1YNLH 2AV1B 3RL1A 4MZ3A 1G6RH 1NGPL 5C08A 1CTNA 1AO7B 1LK2A 4S11A 4PLKC 4ZS7H 4G6JL 4HJ0D 5TPWL 4KVNL 3VXSA 1BF2A 1KIUA 1MFCL 1A7QH 2X4TA 4M43L 4NNXB 4F37F 3I2CH 4OCSL 3PGCA 4BKLA 1O5DT 5CLWA 4M7LT 4R97C 5KJRH 1MH5A 1UYWH 1WBZB 1I7TA 3KLHD 2N7AA 4FQIH 4TULH 4IRSA 2HKHH 4JM2D 3LOWA 5HHPA 3BRGC 1NJ9A 1T3FB 1GC1L 4M4PA 5SV3A 4Z18A 4NKIL 4PJGE 4ENED 2XWJA 4PJCE 3TBTA 2YRPA 1NQBA 1EHXA 3OGCB 5FO9A 4XTRD 5B3JE 5CEYB 5IP4A 2BHYA 1RJZA 2DQTL 3NPSB 1P2CA 1CU4L 3RVVD 3QNYB 2LFGA 3L3KB 2CUMA 3IFLH 2XWBB 2OJEA 1NANH 1I7RA 1M7IB 4KXZH 4DGIL 3I6GA 2QSQA 4UIMA 3T0EE 3LEVL 1JF5A 3C60C 3KPSA 3BJLA 5BW7C 4KRPC 3MXVH 3O3EA 3MLTA 3P77A 1F4XH 5FK9A 1DBKH 3T0WA 2V2TA 2C3GA 3UZEA 4MZ2A 5CJQH 1JWSA 5DJDB 1F42A 1YEDA 2G9HB 4HCRH 4K8RH 5MERA 3FQNA 5JQ6L 1J1XL 1IGYA 1GH7A 5DQJB 2Y07L 3O8XD 5L9DL 1WISA 1S9VA 3HE7C 1I4FB 1I7UB 3FQWB 2OK0L 1IC4H 5E1AA 4BM7A 1I85C 4APQB 3B5TA 1T0MB 3VRLF 4FFZL 4U6TA 3KYOA 4G42A 4PJ8C 4U1SB 1I8IA 4U1GB 3SJVB 1AO7E 4I0PB 4DGVL 1N6VA 3TIEA 1T1XB 4P3CL 3GEWB 5JA8B 2O5ZL 3ESUF 3WO4C 5I1EL 1U8JB 1YMMD 2FHFA 3FT2A 1UJ3A 2ATKA 1V3KA 5IEKB 5CCKH 4XPAL 5DD6A 2Y9RT 3QIUA 1DQQA 4OZFA 3RY4A 5F6HI 1QG3A 4X4YB 4HIJA 1HQRA 3SPVA 2YD4A 4FABH 4ZOEA 4YR6A 4NN5C 3OKOB 5CJ5A 2DWEB 1JI2A 3L5XL 2ED9A 3I02B 3RPIB 3OKEA 5F7EH 2UVFA 3RWJB 1CLZH 4YHMH 3DX7B 1VEMA 2DKSA 3VRLE 3QUYC 4RIRA 1UH3A 5FHAL 1FFRA 3MBEC 4UOJA 4WNQB 1WTLA 3LMJH 1RK1B 3RWFB 4LAQH 3MLSL 5B4MD 3FKUS 1BZQK 3QQ3A 1T5WA 4UQ3B 2X4PB 1I1FB 5ACLA 1NGXB 5F6HJ 4RAVA 1JNLH 3SY0B 4G8FB 2DDQH 4Y4KB 4LPTA 2X4RB 4S1QL 4OM1H 1F4HA 3PIQA 3CD4A 1SJEB 4MVBD 3UAJD 1BFSA 5DJ6B 2NYYD 4LCWB 4LIQE 4O9HL 2WLZA 3BZFB 3SO5A 4X4XB 4MA7H 2FX9H 5JW5B 1S7SB 4CUCA 2EDDA 3P0VH 2J4WL 3G9VA 3MLYH 3NPSC 1F6AA 2NR6C 3JWNC 4N1HB 4JPKH 1RIUL 2KZ1B 4OZ4A 2Q86B 3MZTA 2AXGA 4NO0B 1KLGB 1CDIA 2OXGA 3LIZL 1FSKB 3V6ZA 2A83B 3MRQA 2UWEE 3SJVE 3NOIA 3MA9L 3BWUC 2BSTB 3L7FB 5I71B 4EQ3A 3ZMRA 1MHHA 5IBLD 1IAOB 4IM8A 1O7SA 3N1PC 3VWJD 4HWUA 4M7JH 3C8KA 1VADA 1WEJH 1JGEB 3QWRA 2QKIA 4WO4C 3EKCA 1NGZB 5ISZD 1U8MA 3AM8C 3QQ4A 5ESAB 3IJYB 4U7MA 4XCCH 5CP3H 3ARDB 2R2HA 1JYVA 1D5BB 3QFJB 1RZFL 4LFHD 1MRDL 2NY0B 5H2BA 3OMZA 5E4EC 4APQC 4C4KT 2ZSWB 2HRPL 3UTQA 3PWPA 4Q9RH 2GAZB 5DZOA 4QHUA 5LWYH 4TSAH 4X7SL 4U1GC 4TOYH 3WNOA 3LKNB 1JZ3A 5E08L 3FFCB 3VGAB 1PG7W 2AJVL 4HUNB 15C8H 2A6DA 2WBJB 2B8OT 4J12A 1V7NL 1A7NL 3U7WH 3M1BA 1ZLSH 5IMOA 1J87A 2B1HL 4NQUA 4EUPB 4XHJC 4H0HB 3ULUD 2WQRA 2ZUXA 5F6IB 2JJWA 5DA4A 3RWDB 2I27N 2NY3D 3LN9A 2AV7A 3H7LA 4Y4HA 1ZEAH 1IEHA 1KIRB 4JLRA 2HFTA 3V6FB 5L6YH 3T04D 4X99A 1K6QL 3MACL 5ILTH 3ARQA 3GHEL 4FS0A 1J86A 3B6SB 2UZIL 2A77H 5GSRB 4X7TA 3KXFA 1IC5H 4LF3B 4NKMA 4PJ5D 4LCWE 2VL5B 4OLWH 5LVEA 4KI1A 1U8IA 2VE6B 3B2UC 1IAII 5I73B 3ZL4H 3L3OA 3HG1A 3HRZA 1T7WA 4Y89A 1NC4D 1X5KA 3B9KD 2YA1A 2DD8L 3DXAA 4NYLA 5CD5D 4U0RC 4ZYKA 1OF2B 1S78D 4LRIA 3C08H 2J88L 1SEBB 4MQSB 1MF2L 2E9IA 5FA3A 3U30B 3ZT6A 1YY8B 1CGYA 3B43A 3SDYH 1N6QL 1Q0XL 2NXZD 2WUBH 3B5HA 3FB6A 4KPHL 5GGRB 4NUJA 1U3HA 1KOAA 3GMOB 5IROC 4LHUD 3JWOL 3F62A 3CVHB 2P5ED 4NKQB 3TZVA 2YC1B 4Y4KC 3WUWA 5SWSD 1HHGA 3L5WA 5E56A 3T4YB 4P5TB 5CMAB 1SM3H 2IFFL 2OSLA 1LD9B 3RBSA 2VIRB 3QCTH 2APWA 3QFJE 3ZYJA 5HI3D 5EZIL 2DLFL 1F97A 4HAGA 4X6FB 5HHNA 5C07A 3U4BH 4XPFL 5TQ0L 1BJ8A 1MCOH 5SWQB 3WLWD 3EO0A 3R06A 1P7KB 1A6UL 1CFSA 2V2XB 4M8QB 5C09A 2R1YA 3U48A 1HHJB 3DSFH 3F6LA 3P40A 3FFCE 5DEGB 1BP3B 3HLAA 1OP3K 4Q97A 2W38A 5FKPB 5DHVA 1OL0A 4M1DL 2HT2C 3TN0D 3IDNB 3QDHA 4MDIB 5J1TC 4EUPH 1KYOK 5DDHB 4U1JA 3R1GH 4CU8A 1G1CA 1JN6A 1NBYB 2QEJA 4DTGL 2CRZA 4QXTA 3MREB 4LPXA 5BJTA 4MX7A 5I6XB 1PFCA 2V5YA 5D1ZD 1XGPB 2CMRH 2CUHA 2HJKA 2IQ9L 1FZJA 2KKQA 4GLRH 2R69L 4RZCB 4N0UB 2R0LH 5IB4B 1YPZA 5KVDH 2NY0C 3MLWL 2Y5EA 3MFFB 3MNVB 4TQEH 3MNZB 2PNDA 3WNNA 3ILPB 2V5MA 3S34L 3O0RH 1TETH 3H9SB 1F45A 1IGFH 3DSNA 1UENA 3PHQB 2HLFD 1FNHA 1WZ1H 5D6CA 2NCMA 4O51A 1LEKA 2ZG3A 4K7PL 4LSVL 4G9DA 1QKZL 3X12A 4ALAL 4PGEA 2G75B 2W9LA 1QSFA 3FT4B 3PWVB 4Y4FD 4D94A 5GJTH 1JCKA 4G7YL 5ITBH 4JFYA 4YUEH 5DURD 3BH8B 4HIIB 4JY5L 4Y16C 2FL5A 3DURA 3RJQB 1CFBA 2WW8A 5DJAA 4FP8L 3MRHA 3RNQB 5JHLH 2FB4H 4ODVL 3SOBL 4TVPL 4P2RD 1XF5A 2BC4B 4CMMB 1UZ8A 3MRJA 1RUKH 1HXYB 4UTBL 1RZJL 4IJ3B 4I3RH 4M1GL 5GRJH 3QG7L 5F9WC 2ESVA 5SWZD 4LDOB 1AI1H 4CN6A 1IGML 3J8F7 4Y2DC 4HHAA 3KYMA 4GG6B 3M17B 4Z7UB 1DVFD 1F4YL 4RGOL 1YMMB 2OBGA 4FTVD 4JAMA 4LQFL 4Z78A 2W9DL 4PGDA 1ZGLA 2VKXA 1IT9H 1T20B 1RUQL 2JB6A 4NM4H 3RZCD 1FH5H 4BQBA 3N06B 5CFHA 1JWMB 5F71A 5I1KL 3MRCB 1KCSH 3TESA 3WUZA 1X5XA 5JOFB 1X5LA 2VXUH 3UC0H 1A6TA 3O11B 5JA9A 1PEZA 2BSSA 1OGTA 1D9KD 1U2HA 4ODUB 4JVWA 3RIFF 1PGRB 4GG6F 1FNSL 2ICCA 1T1ZA 1CL7L 1W72A 3GSXB 4Z7UF 5IIEA 4U1KA 1N7MH 4N0UE 1FG2B 4JQVC 1U2CA 2PR4H 3T8XA 3GIZL 3JVGA 1OP9A 5KVFH 1P6FA 4NO3B 1PSKL 3ZT5A 3H9SE 4ELKB 2ICWI 1EIBA 1A14L 1PZ5B 2ZPKH 3DX6A 2F5AL 4G6KH 3L3IA 1OTTD 3DBXB 2YHGA 1S5HB 3LDBC 4OB5H 4PRPB 3G08A 5IOPB 4P46C 1QLRB 3PWUA 2BRRH 4P0DA 2K3TA 5EU6A 2CSPA 3BH9A 4ODWB 3SCMD 5I6XC 1HXMA 2DB8A 3A6BH 3D18A 4JFZL 2C1PB 1VDGA 4KKNA 1G7LB 5C0CD 3DMMB 1SMAA 1IKFH 2ERJB 4GKZB 1WWCA 1MWAA 1BM3L 3WCYA 2PXYD 4GG6E 2GSIA 2JK5A 4R96A 4KRMB 3LV3B 2ICWJ 4Z7UE 5TE6H 3SE3C 1J8HA 3A0OA 2RHEA 2RBLA 1YMME 2VZTA 2R9HD 2NTFA 2D7MA 3DHJA 3FQXA 3ILQD 1WJ3A 2A6IA 4Z7VA 5ISZB 5ACZA 1DE4B 3FO9A 2VXTH 1PAMA 2WMPA 2IBBA 3QXAA 3VFUA 1KJ3H 1XGRA 1KEGL 5EO9A 4NZTL 3AMKA 2Y6SD 3LY6A 2PW1A 1NLBH 5BRZA 3V5HA 4YHKH 5DEFB 1CZ8H 3CU1A 1DUYA 3X14B 4D0CB 3GSNA 3CFCL 1TNNA 3PXJA 4I77L 5EZOH 2EE6A 1ZV5A 4WUUB 1C5CL 4IJ3C 5IB1A 3W5MA 3QEQB 5CEZL 2V7HB 3REWB 1MCBA 1NAKL 4ZOBA 5ICYA 5FYJD 3S88L 4DN4L 3RA7H 2YR3A 1WITA 1NFIA 3VXPA 4C55A 4P59H 1C5DB 3LQZA 4JREB 1CFNA 3BQUD 4ZUVA 3QNXA 1OAUL 5GRYA 4H5SB 5J06A 1UXWB 4A2MA 3H7BA 1T2QL 2EDNA 1QLFA 2IQAB 3BESR 4KROC 3NA9H 3GMRA 2VZ3A 3FOMA 3IYLW 1E6JL 4PRPE 5K9QI 3MYJA 4FQJH 4H0GA 1PEWA 3UTSA 1NC4B 3U0PB 2NTSP 2RFXA 4CDHA 3JWDH 1M05A 1OY3B 4D0BA 3HN3A 4X6CB 5CKAA 3OHXB 4JN1H 3VFNA 4UOW1 1NCWH 1I3GH 5DQ9B 4PJ9B 1FNEA 1AP2A 5T1KB 3IGAB 3O2DL 1A6ZA 3W39A 3D9AH 1TZHA 4KV5F 1MCLA 3PV6B 4OGAC 4GRLD 1JGLL 4K3GA 3QH3B 5TF1L 1CGSH 1UC6A 5IKCA 5C0DA 4IOIA 4U1LB 2YPLD 3EHBC 4IS6A 4ZODA 4LHUB 2GJZA 1C12B 4C56A 3U79A 4M3JA 1HHIB 2X89A 4H88H 1CICC 2FBJL 25C8L 1UM4H 5DK0B 5SWSB 5ISZE 2YSSB 1MHCA 1DFBL 3QIBD 2SEBB 5C3LD 3WXVL 1HEZA 4Z6AT 2VLKB 1GIGL 2YD2A 4M7LL 3KJ6H 1UM6H 1ZSDA 3TYGL 2Z31A 2BX5A 2DI7A 3HC0A 3SE9H 5EB9A 4PGBB 3OJ2C 3MRRA 1DBML 4X6CF 1ITCA 2EE3A 2BVOB 5DJ0B 1XF3B 3WXWL 1G84A 1T0PB 1S3KL 3HHRB 1EJ6A 4WUUE 5BZWA 3DMMC 2ERJC 3QJFB 1BQSA 5AYUH 1ZA6B 3QEQE 2FO4B 1S7XA 2V5SA 5GS1B 4HF5L 4P2OC 2DQJH 4FQ2H 4UINH 1REIA 4KTDH 5D72L 3ULUH 3FFDA 4KV5E 2VZVA 2BDNH 2FHBA 4KJWC 4LARH 2AKRA 1K5NA 3KLDA 3MJ9H 5H35B 5D1ZB 1P7QA 1I1AA 2XG4A 1A3QA 3BWAA 3QUMB 5IK3A 3GFUA 1EEZA 5T5FH 4EUPG 5JUEL 1FP5A 3VXRB 5BO1H 4XNQA 1NAMA 4F58L 5I1AA 3T65A 1MNUL 1VCAA 2EYSA 2FATL 3VDBA 3V8CA 5I76B 1HOCA 2E6JA 4H26B 1C5BH 4XP4H 3STLA 3U36B 2B5IB 1AXTH 2PCPA 2HT4C 2DQIL 4KK8C 5ICXA 1BQHA 5LGJB 4X7EC 3LHPL 1FE8L 3JTTB 4M4RA 1IAKA 4Y4FB 3LN4B 3BDYL 4U2YA 4X6CE 3ARED 1D6EA 5E7BA 5I66B 2CRMA 2HKFL 1P7HL 1GAFL 3NN8A 3NBNA 3BP6B 3NFNA 4XPBH 3S3SA 2ZSVB 4OD1L 3PHOA 5INCB 5BVPL 3SQBA 2QQKH 1N59A 2HFFB 1EJOH 2OTUA 3OAZK 4X5XA 5SWZB 4ZPVB 2P5EE 4W81A 1HZHH 4WFGE 5SWSE 4WUKL 1CCZA 4QYOA 1DQDL 3U2SB 2DQCL 2A6KA 2VLKE 4PTUA 1DQJA 1S9KC 3VXUA 2JCCA 2YBRA 1YJDH 3U4EA 4M5ZH 3MRMB 4HKZA 2X4UA 2BVQA 2IH3A 1IVLA 5D1QD 2FR4B 3A6CH 3CH8A 3FTGB 3ULVC 2XKSA 1OAYH 1A6PA 5KSAD 3RZCB 1VPOL 2EDHA 1DN2A 3PWNB 5HYJB 4PRNB 3RI5K 5J12B 4NUGH 2VAJA 43C9B 2YMXH 1FNGA 4MCYB 3WFDL 2CDEB 2XQYG 1RZKC 1U92A 5DWUH 5HHQB 3IS0X 4GQPH 1ZWIB 4RDQG 2R1XA 3RDTC 1J10A 3N9GH 3OPZL 4WFED 3I3BA 4PJHB 4U1NB 1NCAL 4IMKC 3GK8L 3MGOA 3NPZB 4XMPL 3AAZB 5ADOH 1HI6A 5L88L 1S9YA 4YHNB 3I6KA 1T80A 2UV3A 2PW2A 3OJVC 4O00A 4OCLC 5I8OH 4MDJB 3VXRE 3CVIH 5EU7C 3WJJA 2ORBH 3BZDA 4RA3A 1OAZH 2W0PA 4HZLB 5C0RL 3GI9L 5DJ2A 4UTAH 2QR0A 3MSPA 1I8KB 2XACC 5KSVA 2D7TL 4Z8FH 5D93B 5D7KE 5MEQA 4XC1L 4IMLB 4KUCD 1Z5LB 3INUL 2XPGA 1KGCD 1QPXA 1T5XB 5L2KD 5I8KH 3RWGA 3ARBC 4JQIH 3SDDD 4J6RH 1A1NA 4PJHF 5E2VH 1CG9B 2HVJB 4HAFA 2EC9U 3V0VB 4PGCB 4EBQH 1CXHA 3G6DH 4JRXD 4KUZH 4F2MA 4O2EA 2ZUTA 3UBXA 1U8PA 4GS7B 4MJIB 4XAKD 5AZEL 1LWRA 1FN4B 1YYLL 4ZUTA 5SWZE 5E8PB 1B90A 2PXYB 4LSPL 4RQQB 3VRJA 4S1RL 3MLPA 3BI9X 3D39A 4OFYA 2ZJSH 3WLBA 1MHPH 3H42L 4JFXB 1H0DB 2F8VA 2J6EA 4XXDB 4RGMC 4ZPTB 4YDVB 3AROA 3IXAB 4U6XA 5C0BB 3E6HA 3WSQL 4D9LH 4Q2ZA 5AAWA 1FLRL 1IQWL 2P44B 3FB5A 4PJXB 2FJGB 1DBBL 2JE8A 4Y5XB 3TA3C 5HPMB 5HYJE 2EZ0C 5DHYB 5GJSH 1B9ZA 1YA5A 1T7VA 3HI6H 1OAKL 3IU4L 1JZ7A 3EYSL 4JKPL 4U6VH 1TENA 3TH3T 4LDEB 3W5NA 4ODXA 4V1DA 3OX8A 3PNWB 3KHQA 4D0DB 2ZUUA 4PJHE 1UB6A 3IDIA 4RNRB 3BDBA 1OSPL 3O6KH 3OJDB 2LAGB 1U93B 1EPFA 3IVKA 3MUZ1 4TUJB 2AK1L 2MHAB 1R5IA 1JNNH 4WI6A 4ETYA 4TVSa 1G7HA 3DO7A 3VFPB 2VLJD 4K7FA 2NZ9C 1M6OB 3BQUB 1AJ7H 4WU5A 2FSEA 3P4OB 5BVJA 5B38B 3QDMB 2Z4QA 4HKJA 5JW4N 2MKLC 3CX2A 3OXRA 1ZA3B 2XZAL 4IEFB 1TVHB 3V7MA 3HC3H 1HCFX 3FB7A 3IDJA 3IXTB 4JB9L 3D48R 4GW5B 3NCCB 5EOCJ 1KULA 2NPLX 5GGSY 4X6BA 3H3PL 4TUOB 2AK4A 4IHOA 4WFFD 3KPLB 4R26H 4EOWH 1IAIH 1NFDE 4NZDA 2GITB 3O6LL 4P2QA 4CVZB 4P4RA 4OD3H 4MJIE 3TBSA 4XI5C 3I50H 4NKDA 5E8NB 1NGQH 4ZMAT 1X6LA 1BAFH 4NQCA 5TGBB 1XT5A 2AXFA 5EBMB 5GGVL 2F58L 1DQLH 2YUXA 3H0TA 3QP3A 3L3HA 2YPLB 4IDJH 4Z95L 4ZNEA 3GJFA 2PTUA 5JW3L 4I9WD 4JZJA 1TCRA 4OCNC 4PG9A 3C6LD 4HXBH 1D6VL 4JG0L 5I1IL 4MQXD 2QLVB 3L95B 4LSDA 3KPNB 2YA0A 4IRJD 4YBQD 5DMKA 4H20H 1Q9WB 2IC2A 1MAKA 5C0BE 5J13B 3Q0HA 2HLAA 2F8XC 1RIVH 4PJXE 4J8RB 1VGEL 4OLEA 5GS0D 3DV4A 3HZKA 2EIBA 1E0OB 3SE8L 1D5MB 3QHZL 4PJFA 4OFPA 5GRUH 1JWUB 5IM7B 1T7XA 4ZFOB 5FB8B 1INEH 1BZ7B 1HILB 4LFHG 2VQ1B 3Q3GB 1AQDB 1AGFB 5FYJH 1DBAH 3E3QE 2IWGA 3GBNL 1BVLA 3CFKB 3DX9A 3AXLA 4F9PA 3C5ZA 3MRPA 3FZUC 4E5XA 2I5YH 3IDGB 4U6HA 1KPUB 1UKQA 2XOTA 4OGZA 4TPRL 4K71B 1W0YT 2R29H 2IAND 3RWIB 3MRDA 4P9HC 3HUJA 5IJKA 1QLEH 4RX4A 2PTTB 3QUXD 4G5ZH 4XVJL 1LNUB 3QDME 5E6IC 2CLVA 3ALWA 2A74B 3E6FB 4HPOL 3LEYH 1RJLA 5AAMA 4TUKL 2J3SA 5I74B 3CX5K 4PG2A 2X1WL 1FL5A 5CIPB 3QA3A 3UTTB 5EIVA 3SDAA 5EZJA 5IV2B 4OUUB 3O9WD 2JJTC 2DF3A 2XTJC 3AREB 5C0JA 1XZ0B 3PABB 1IC7H 3QSKB 1VFAA 5CGYD 2E7CA 1V7MH 1U91B 4ODHH 3K1DA 1G0YR 1R3JB 3O6FB 2DI9A 4GFTB 1I9RL 2ADIB 1PYWB 2QQNL 4R4FH 5F21B 1HQ4B 4P23D 2ATPA 3FRPG 4ERSL 2BNUB 4RSVA 2YPLE 5DD1H 1NUFA 1JHLL 5MP6L 5FF6B 2IAMB 4J3VA 4Y5VB 2Z35A 3QG6B 5HHMD 3IETA 2APTA 4PJAB 2QL1A 1O0VA 1ZHKA 1BBDL 4L4TD 3VWKA 1Y6NR 4OLUL 3RU8H 4WW2A 1KYOJ 4LHUG 1RURL 2G60L 5C08D 5EZLA 1KBGL 4Y5YA 4I18B 3HR5B 2BVPB 3QXUA 4JANB 4Y19A 5FM8A 4OQTH 1JPST 3REVA 1SYVB 3U46B 4GQ9L 4AG4L 2XQBL 3VXSD 1IMHC 3GKZA 3NZHL 1LO2H 1CE1L 5JHDB 1UH4A 3DGGA 2Y72A 5BV7B 5KSAB 3VXTB 4JM4H 1OP5K 3B4NA 3VFMB 5HGDA 3Q6FB 4M48H 4JZOA 1F4WL 1LEIB 5I17B 1XAUA 5GZNC 1JHTA 4KJQD 3DVNB 4PP1C 1VEPA 1NUDA 1MFAL 4IRSD 2VDML 4PJAF 4KZDL 1QRNB 5IQ7H 1A6VL 3EYFA 1OTSC 3F7YA 4X80H 3L3GB 5H8DA 3MROA 4N5UA 4U33A 4J3OC 4R7NA 3NCEB 4FA8A 1CK0L 1KJ2L 5BXFA 4UV4L 2DJSA 1KTDA 3NFPA 4OCSH 3OKDA 3S37H 3K3QA 5DT1L 3HS0A 5L7XH 4YAQA 4XNXL 4KZEL 1CF8H 1FGVL 1OLZA 4L3EA 3KPSD 5FYKE 1CFVH 5ID0B 1FFPA 5C6TH 5IBTL 2VDQH 4XPTL 1DLFH 1G9NC 3QO1A 4BQ6A 5EIIB 3MFGB 1FV1B 3T1FB 1Q72H 4MA3A 4OCXL 2OYPA 4HDIB 4MNGB 3VRIA 4YPGB 5IW1A 4DZ8A 2H45A 5E2UH 4XRCA 2LU7A 1G6RA 4CADB 5F9JA 4B0MM 4PJEB 2I60H 1I7ZA 4PJAE 3GHBH 4KQ3H 5BZDA 4YHPA 4NJAL 4R90H 4JO3H 4K8RC 4GRMA 5E5MA 5I74C 2XICA 1T21A 1VB9A 3F65A 3QIWC 1ORSA 3FQTB 4MD0B 5T3ZD 4ONGL 3MNWB 1L6XA 3ESVF 2HTKC 2E7BA 3BIKB 2AQ2A 4HS3A 5B39G 5GHWL 3PJSA 5MEPB 2VITA 4G8EA 1ND0A 5BW7A 1S8DB 4KJPC 4MD5B 5JHDE 3FQUA 4HS8L 4PD4J 3O6FC 2MTPA 1JMZA 5C8JA 3O3BA 2OMBA 4NO2B 2C1OB 2FDBP 2BNRB 3ETBF 3LD8C 2G2RB 2ARJQ 1A64A 2NY4C 2A9MH 3MRLB 5HVWA 4GKSB 3QIUD 4PJGA 4QT5B 4PJCA 4UU9B 2CK0H 4L8CB 3CUPB 3IU3A 3S37X 4K2UH 1MVFA 2IAMC 4Y8DC 3QI9A 4OF5A 1EFXB 1A7BA 3CLFL 1JPGB 4PJEF 3GMPA 2WUCL 4XP5L 2G5BA 4QHNB 1QRNE 1VENA 3QCUL 4LSQH 1BLNB 1WWBX 2VABB 3AS3A 3ELAT 3CK0H 4FFWD 2BHZA 5E95B 1T1YA 1BQUA 4KKCD 2W60A 1R3KB 4I18C 4PJ8A 1AFVH 2EH8L 1LO5A 2LAAA 2MFNA 2EDTA 4QF1A 4RGNC 3T0EA 1NMBH 3KR3H 3U6RA 1I9IH 4Q9CA 5BOZG 1RAMA 3LN5B 2BY3A 1PLGH 3EOBB 2BJML 4K94L 2X7LB 4X83A 2FIKB 1CDGA 1UKTA 4JO4H 2EKSB 3IRZA 4E9LA 2Q8AL 4HCRA 1JE6A 1KXTB 3CDGA 1AD9B 1I8MB 4E42A 4NGHL 5F7HA 1J1OL 3MR9A 2AJSL 3AS0A 4UT6H 5CEXA 1WF5A 1UQSB 2UZYB 3VFSA 3MRKB 1F5WA 1NGWA 1SYSB 1V3MA 3EYUH 2AV1A 3CXHJ 3LPGA 4MNGE 2WWMD 2IFGA 4Q6IB 3WE6A 2LVCA 4XAKE 5BCAA 4QXGH 1AO7A 4HWEL 2J8UB 4JJHA 4PJEE 1GZQB 4WEBL 1QNZL 1JPFB 3PL6B 3TJHD 1QYGL 4WI3A 2Q6WB 5C7XH 5I30L 4OCYL 2QBWA 3C6LB 5DUPH 4C59B 4IRJB 3UO1L 3FRUA 1WBZA 3HFMH 2VDKL 1FZMB 2I9TB 4P5KB 1TJIH 1MCWW 3LSOA 5C9JB 3QWRD 2BNRE 2XWTB 1H15A 2FGWH 2E7LC 1RJCA 4MB4A 1T3FA 3WYRA 4GW4B 5DSCA 3K4ZA 1Z3GL 4WWKC 5E8DL 5DRWB 5CEYA 2J8UF 3HR6A 2PKDA 3CDFA 5F9AC 5IESL 3BHBB 3QNYA 3L3KA 2AJUH 3PWPD 5KS9B 3LIZH 5JDJA 1T7ZA 2XWBA 4G6FD 4L8BB 4PJDB 2NMSA 5DGQA 2NY6B 4GRWH 1IGTB 1HCVA 2GHWB 4C83B 3GBMH 4OIBA 1BECA 5GS2D 3DIFB 2DLIA 4NHUB 2B2XL 1NBVH 4MXVF 2VB5A 5DJDA 1LDPL 1UCBH 2BOBB 2G9HA 4X9BA 4Y4HD 3MOAL 3HC4L 4LU5L 2LVEA 4ZUSB 5DQJA 3HZVB 5C1MB 3AM8A 1MCCA 1CD1B 5TE7H 1I4FA 3FQWA 2VLLB 4BZ1H 4WY7L 5DD0L 4APQA 1U8OB 3KXFD 1T0MA 1YY9D 3UXFA 2OTPA 5KS9F 2MPAL 4WTZG 5HYIA 4JFHD 4PJDF 4U1SA 3HG1D 2XNAB 3SJVA 4I0PA 4YE4L 2J8UE 5GS3A 3DXAD 3PGFH 4DVRH 5L0QC 3MRIB 4P23B 4PJBB 3CXDH 3MCLL 1VKXB 1U8JA 1ADQL 4EZMA 1AH1A 1HIMH 2X9WA 1PX3A 3MRBB 4XBPA 5IEKA 4NM8L 3QHFL 3RY5A 1F8TL 4XC3H 1U3HD 4FZ8H 5E8OB 3V4PH 5EBGA 2FLRT 4RWHA 1EO7A 5GS0H 4X4YA 2EO1A 4IRZL 4MXVE 4N0YL 4ZUUB 1HSBB 5C2UB 1RK0B 1A1MB 1A7OH 3D69A 4J3SA 4I3SL 2X4NB 4OFKA 5D7IB 5KVEL 4D3CH 3OKOA 4BKLB 3PGCB 2ZUYA 4F37K 2DWEA 3I02A 4KGJA 1II4E 1MJ7H 3RPIA 2EDKA 1YEIL 4X8JB 3IRPX 3RWJA 2OTWB 4BZ2L 4PJBF 3DX7A 3SKJL 1BVZA 5JQHC 5KS9E 3P30H 3V5KB 2VXSL 4WNQA 4ZFFA 3CDCA 1RK1A 4M6MH 4PJDE 5C09D 3RWFA 2GSGB 4NDMA 4MS8C 1IAIM 1NJ9B 2P49B 3TP4A 3U1SH 1OARH 2HRLA 4UQ3A 2IANE 4HS6B 2XWJB 2QQQA 4JY4B 4YBHA 5DJCB 2X4QB 2W92A 2YEZB 2V9TA 5IROA 1MQ8A 4G8FA 1LO4L 1RIHL 3WKMH 2HFGH 1P2CB 4XB7A 5AUMB 4Y4KA 1WFOA 2X4RA 1N5AB 1FNAA 1SHMA 1SJEA 5FUZH 1QFWI 5LKNA 5D7IF 1XCQA 3ARGD 4XNUL 4NJ9H 4X4XA 1YDPB 3FCTB 5JW5A 1S7SA 2HT3D 1U3ZA 3KPSB 4GUPB 4Z7NF 2HVKA 2MCPH 4ZFGL 1X7QB 3A67H 4DOHB 2Q86A 3BDXA 5HI5D 4NO0A 5EUOE 4JHAL 1KLGA 4D9QD 3ES6B 2APBA 4YK4B 2NY6C 5FCUH 3QWQB 5HD8C 2A83A 1YEDB 3HI5L 1QSFD 5MI0C 1BEYH 1DL7H 3L7FA 1H3VA 4PJBE 3EO1B 5DMJB 2VXVL 3UJIL 3WO3B 3U0WL 4UV7H 1Q9KB 4F9LC 4D9RD 2X40A 3QQNA 3GI8L 4JDTL 1IAOA 1S9VB 1KJMA 4Q0XH 3THML 1T03H 2EDEA 3L3DB 3TT1H 1AKJB 3IJSB 5E1AB 1NGZA 4AIXA 2X9XA 3KYOB 3I9GL 5ESAA 5F89A 1ZGLP 1I8IB 3QT2A 3ARDA 2ESVD 1A2YB 4KJYA 4XP1H 1D5BA 3QFJA 5K9JH 4OFDA 1TZIB 1W0WB 3DV6B 2VZUA 2NY5C 2ZSWA 7CGTA 2X2YA 5DVMA 4NZRL 2GAZA 2NX5B 3FN3A 5D7IE 4AQ1B 1QKZH 5K33A 2ID5A 1MIEH 2R8SH 1RUPL 3KPTA 1GGBH 3DJ9A 1ZK9A 3FFCA 5E0QA 3IAQA 5KSBB 4Z7NE 1A02N 1ZLUK 2WBJA 3WD5H 4MB5A 1PBYA 1ZT1B 4OV5A 4Y16A 1IGCH 3SOBH 3NMEA 3HE6B 3EYQD 2MNUA 2AEQH 4JFFB 5HYSG 1R3HA 3VXNB 5C0NC 3RWDA 1D5ZA 4FQXB 5EOCH 1S7UB 4F8TA 4GAGH 1KIRA 4XWOC 1HYSC 1J11A 1H3TA 4HH9B 3V6FA 4J3UA 1YNLL 1J0IA 1G6RL 5GRVL 3CFDB 4JM2C 3RJDA 1K8DB 3B6SA 4ZS7L 3P2TA 4RIRB 5F1NA 4ENEC 5GSRA 4LF3A 4R0LB 4XVSH 2VL5A 3D6GA 4HUKB 5FGSA 1A7QL 2VE6A 4WI7A 4XTRC 1F58H 5FAAA 5C0FB 3O45B 3I2CL 5KVMC 1G7PB 4HIHB 3KPSE 5KSBF 4RAVB 1OF2A 3PHSA 5SX5H 5KJRL 3MJ7B 2VZ1A 1TQCB 1B4JH 3H3KA 4C54A 4DOHE 3QXVA 2E27L 4FQIL 1PG7H 4TULL 1EGJA 3PIQB 2HKHL 1NCBH 1FYHB 3SHSA 3FO1A 1X6NA 1K3ZA 1RY7B 3GMOA 1W2KT 3N1MC 5H37H 2YPKB 3CVHA 1FNSH 4FFVD 2FRGP 2YC1A 1BWMA 2ZG2A 2VZOA 3OF6A 1T04B 5LG1A 2DQGL 1RHHB 4OZ4B 5K9QG 4P5TA 4HJJH 5T3ZH 3BO8B 4HWBA 3EGSB 3IFLL 5CMAA 3DETD 2HP4A 2HMIC 3DRQB 1LD9A 1QSEB 3HZYB 3HPJB 2WM0A 3PE9A 4Y1AA 2YZ1A 4O2FA 4X6FA 3DYPA 1MAJA 4MAYB 4CVUA 3K80A 2NX5E 4LLUA 1ED3B 1A14H 5SWQA 1HINH 3MXVL 1F4XL 1VADB 1DBKL 1P7KA 4QGYA 2F5AH 1HHJA 5DEGA 4LP5A 5CJQL 4DUVA 2GEEA 5KSBE 1Y0LB 4HCRL 4MDIA 2GJ6A 1JJUA 2A0LC 2FECL 4LASH 3D0VB 5DDHA 5BRZD 1NBYA 2R1WB 2WBWB 4KI5F 5DQDH 4JFFE 3UTQB 4ZO6A 1IC4L 4KHTH 4N0UA 5IB4A 4N0CC 1PG7X 5CSGA 2EYRB 3MNVA 2A6DB 3MNZA 2C7UB 3ILPA 3JV0A 1ZHNB 3PUCA 3SN6N 3H9SA 3M1BB 3MCKB 4L8DA 5IMOB 5I9QB 3PHQA 1FGNH 3R0MA 1UA6H 1VFUA 1EHAA 2G75A 4EI5B 3PWVA 2AV7B 2NY2D 5CCKL 4L5FL 4LKCB 4HIIA 5BQ7B 4X8XA 4X99B 5A43C 1OP3H 3RNQA 3QHTC 4FQXC 4MMXC 3ME0A 2BC4A 4FABL 4CMMA 4F80A 1C5CH 5GISH 1HXYA 1QZ1A 3O2VH 3IS1X 5LGHL 4UBDD 2F5BH 2AVGA 5KANI 2HJLB 4ZYKB 4GG6A 5F7EL 1KXQE 3D2UB 3M17A 4M61B 5FFLA 1KT2B 1UWXK 2IGFL 4N1EA 4Z7UA 3UAJC 1CLZL 3VH8B 4YHML 4R0LC 4OF0A 5HTSA 3RIAF 3GRWA 3LMJL 1QSEE 4LAQL 3WS3B 2CGRL 4X5WB 5IB2A 4JQXA 2YRZA 3FB6B 2ZOKB 1OAUH 1UEYA 2E9BA 3GIVB 4OGYH 1TQCC 4XX1E 1FC1A 1T20A 2ENYA 1DP0A 4HGWA 4C56D 2X89D 3O41A 1JNLL 1EBAA 1JWMA 5CINH 3MRCA 2B39A 3VXMD 2DDQL 1WGOA 1OGAB 5JOFA 4OM1L 3T0BA 3O11A 2OSLB 3VWJC 4NT6B 5B22A 4XPGH 4KI5C 1KCRH 3RZWA 4ODUA 5GRWA 2Z31D 4KRLB 4XH2B 2FX9L 3SKOB 3P0VL 3MLYL 3GSXA 4JPKL 4HPYH 5DXWA 1BIIB 1FG2A 2V9RA 1TIUA 1WC7B 1MJUH 1IILE 1QHPA 3ET9F 1ZLVK 4HKXB 2VISB 5GS2H 5JO5B 3EYVB 4NO3A 4UT9H 1G9MH 1QFHA 4MAYC 4U1JB 3QEHB 2EDFA 5KZCB 4M7JL 3S98A 1WEJL 2HA1A 4GT7A 1PZ5A 4U0QB 1P7QD 2AEWA 1I1AD 4POUB 2BVUA 5L2JB 3V7AG 3ARGB 3DBXA 1YPZB 4X0KB 1S5HA 4PRPA 4XCCL 5IOPA 5DFVD 1QLRA 5HYQA 4ODWA 3LKQB 1UXSB 1N4XH 3HZMB 2DIBA 2C1PA 1I8LA 2KH2B 1G7LA 4YHYB 4JFHE 4Q9RL 4O51B 4OAWB 3DMMA 4POZC 3C6SB 3FN9A 3HG1E 1CXIA 4GKZA 4TSAL 5LWYL 3ECBB 1QSFB 4FNLH 4TOYL 4M93B 15C8L 1NCNA 3DURB 3P9LB 4UILH 2MQCA 3U7WL 3EJJX 1ZLSL 3SGJC 3IFNH 4OLVL 4PV8B 2DKMA 4WV1B 4EI5C 1V05A 1UZ8B 1DE4A 4TSBH 5D7JD 3X11B 3MOQA 2NNAA 1KB5A 4F58H 5FUCC 5E03A 1YPZF 1WZKA 5L6YL 2DAVA 2NXZC 3MGTB 5D4QA 2CH8A 5ILTL 1JGVH 3X14A 4D0CA 4EJ1C 5GSVA 1OGAE 4MQTB 3BKCH 1Z0MA 2A77L 2DQIH 2D7QA 3EOYG 3VXUD 1L4IA 4WUUA 5C0EB 4JAMB 1IC5L 4OLWL 1FE8H 3QEQA 3WL9B 2V7HA 2XV6B 3ZL4L 1OW0C 1SEQH 4LVOB 4R4ND 5DRXB 1ZGLB 1F3JA 1YC8A 2P8MB 3C08L 4P2YA 1EMTH 6FABH 5HI3C 2Y06H 4U1IB 4KU1A 1C5DA 3MLUL 5C6PB 3MCG1 4F7CB 1VHPA 3BMWA 3WDHA 1V8HA 2WUBL 4N8PA 2P1YA 5MHSD 4QRTB 2DLEA 4P3DB 4H5SA 5T33H 4WUKH 2AQ1A 4LL9A 2DLGA 3RIFK 3LS5H 1DQDH 1UXWA 2JIXB 4L3AA 1W72B 5EOTA 2IQAA 3TN0C 5IEHB 3NCYS 5JPMB 1BREA 4NN6B 1FFOB 1YPZE 2CKBB 4GW1B 3BEWB 3SDCC 2Y1VA 1SM3L 3T8XB 1INDH 2IADB 3QCTL 3U0PA 3M8OH 3MV7B 1OQXA 4X6CA 5J7CC 1LDSA 3KDMB 5IVZB 3U4BL 5JIPA 5DQ9A 4PJ9A 2X44D 1E4WH 1MCOL 4D9QE 5T1KA 3IGAA 2RQ8A 3PV6A 1QSFE 1VSCA 5EDXA 5I18H 3RAJL 2YN5A 3DX6B 4G6AD 3QH3A 3TVMB 1RI8A 3U83A 4D9RE 4U1LA 4GAYB 4ETQB 1MY5A 4LHUA 1C12A 3ARFD 4MWFA 1ZTXH 3R1GL 4ORZC 1HHIA 3BH9B 4RMRA 5FM5M 5HBBA 4IMKA 3PGDB 5DK0A 2YSSA 4LCYA 2VLKA 2CMRL 5BMFH 2M2DA 1MWAB 2B4CH 3HTLX 1HHKA 3B83A 3BPOB 5KVDL 3GI9H 2GSIB 4FFYH 5HGBB 4PGBA 3D39D 2P8LB 2VLRB 4TQEL 3MRNB 1S7RB 1SJVA 2BVOA 1TETL 2D7TH 2JELH 3O0RL 5DJ0A 1IGFL 2JJUA 3FQXB 3KYKH 3I3DA 1MSPA 5J11C 1WZ1L 1ZA6A 4YBLB 5ACZB 4E0RB 2FO4A 3FO9B 3O3UN 5GS1A 1FDLH 3KJ4B 4NC1C 5EO9B 4DGYH 4OJFH 4QHKI 1UM5H 5ITBL 1I75A 4EQ2A 4HJGA 4YUEL 3TYFA 3UDWA 5DJ8B 3SE4C 1KELH 2HTLD 3ARBA 3BEVB 5JHLL 3UROR 1EGJL 1X5FA 5H35A 4HC1A 1E4KC 3QUMA 3GSWA 1RUKL 5IB1B 3VXRA 3OZ9H 3CVHL 4K9EC 4I3RL 1C08B 5GRJL 1W72H 3F6IA 3FOLB 3FQRB 1AI1L 5I76A 5EOQH 3H42H 1DBJH 5IMLB 3MPCA 5CJXC 3U36A 3NTCL 4L4VB 3S3PA 5LGJA 1YQVH 4LVOC 3F5WB 3JTTA 3MX0A 4Y4FA 3SGKC 3STZB 1NSNH 3LN4A 3MV7E 1QPPA 4ZUVB 1GGCH 1DBBH 5EULV 1BFOB 1IT9L 1MFEH 3U9PH 1OAQL 5I66A 1OAKH 3TA3A 1ZHLA 5A2KH 2ZSVA 3VXOB 2FX8H 4LCUB 3HI1B 1KCSL 3FOMB 2PYEB 5E5UB 4IIQB 4HFWB 2VXUL 4MXQD 4M3KB 4XNMB 2HFFA 2NY1D 3G6JB 5TQ2H 3UC0L 1U3JA 1XR8B 3MYJB 2AK4D 3VI3F 2RFXB 2E3VA 3R8QA 3RX5A 1YECH 3MXWH 1FCCA 4NNYB 4P2QD 2QADD 2N1KA 1ZVHA 1MQKH 4IDLA 5FGRA 3W9EB 4NN6C 4O2CB 1MWAH 3AU1B 1QBLH 4HULB 4KY1H 4Q9QH 1N7ML 4NQCD 3S97C 3BPLB 1HWGB 2PR4L 1G0DA 1LO0H 4LLMB 3S8WA 1KTKE 5F7MC 1CDBA 2VLRE 5KVFL 1U6AH 4D2NA 3RP1A 3FTGA 2R4SL 4OF3A 2OP4H 3E1F1 3RZCA 3PWNA 5HYJA 4X98B 1J0YA 1C7SA 1AGCA 4PRNA 5DK3A 3NCJH 4JB9H 3VXMB 43C9A 2D7NA 1ES0B 1MJ8L 2ZPKL 2CDEA 4YDLB 3CZFA 4XX1G 4G6KL 3H3PH 3G6JF 4XWGH 2R9HC 4PRIB 4H8WC 4U1NA 3S4SB 4OB5L 3GSNH 3GDBA 1BBJB 3MRRB 2BRRL 4L8SB 1BD2A 4YHNA 4KDWA 1MCQA 3OAZH 3A6BL 3TO4B 3QUKB 3QNZB 4JPIA 4MDJA 1S7XB 2FIRT 3VI3E 1IKFL 5F1SA 4A6YA 2K7PA 4HZLA 4I0KA 1UZ6F 4KK9C 2PUQT 3ZSTA 2MMXA 5TE6L 2VQTA 1W8OA 1X5YA 1I8KA 3C5ZD 4NKOB 4L4VE 4YH6A 1OB1B 4XP6H 4LHJB 1CD8A 4IMLA 4HUXB 1Z5LA 1I1AB 3KJ4C 3LB6D 2VXTL 4RX4D 1T5XA 1EEZB 1KJ3L 2R39A 2H9GB 3BIAX 5GGUB 1WFTA 4JHBA 3RTQB 3NFSH 1CG9A 2HVJA 1NLBL 1QFWH 2EYSB 1EVTC 1FRGH 1FL3B 1VFOA 2B0SH 3V0VA 4YHKL 4PGCA 1EO5A 4GXUM 2E6PA 3S5LB 1CZ8L 4WFHD 4PIRF 4EN3D 2PYEE 5CUSH 3DUHA 4MJIA 1E4JA 3G6JE 1MCPH 5EZOL 3GUTB 4GBXB 3SDAD 1FN4A 2PXYA 5D6DA 4PY7B 3ZO0A 1RU9H 3O4OB 4RQQA 3RHWK 2OI9C 3HB3D 4JFXA 3V5DB 1MCRA 4I5BB 3RA7L 4KVCH 4YDJB 4ISVB 5HGAB 4FQPA 4P59L 1UZ6E 4ZPTA 5F7NC 4YDVA 3G9AB 5D7JB 2D0FA 3IXAA 5AEAA 5C0BA 1T0NB 2DM7A 3OL2A 2OTUB 3GO1H 2FJGA 4ZTPH 2C3VB 4Y5XA 5HPMA 1JP5A 4XVUD 5DHYA 4XMLH 4NQDA 3VXME 4ZD3H 2ARJA 1KJVB 3BGMA 2A6KB 5HGHB 4N5ED 4HV8B 3NA9L 3K2UH 3PNWA 4PRIE 3U4EB 2CKNA 4RNRA 4Y19D 3WUWG 3OJDA 4ORGA 4FQJL 2QJDA 2IH3B 2JJTA 1U93A 3QIBC 3JWDL 1X5GA 2UYLB 4JN1L 1I9RH 1I3GL 1NCWL 4OKVB 3ZKND 2ZNXA 4TUJA 2MHAA 3S6CA 4N0RA 3D9AL 4O5LL 6CGTA 1N5YH 1A6WH 3CFEB 1GXEA 1TVDA 1U92B 3VFPA 1KPVB 1GOHA 1CGSL 1CYGA 4GMSH 1M6OA 1P5VA 4U7KA 1JYNA 3P4OA 5B38A 3QDMA 2BMKB 1TVHA 4Y2OA 3NH7H 1UM4L 3I6KB 2PW2B 2YWZA 4JFEA 4GW5A 1NAMH 4HLZH 3JUYA 3KJ6L 3WIHA 1UM6L 4TUOA 4AG4H 2DN7A 3RKDD 1U8QA 3KPLA 4P4KB 3VFWB 2GITA 2BSRA 3SE9L 1IRAY 4CVZA 2F53B 3ZE1F 2C9AA 5JXEC 1FVDB 5D5MB 5H94B 5IHZB 5AYUL 3WEXB 4L3ED 5TGBA 5EBMA 2AJ3B 2OLDA 1GZPB 1Y6KR 2DQJL 4FQ2L 3S96A 4UINL 4KTDL 12E8H 2VDMH 3ARFB 2W0LA 3ULUL 8CGTA 3DUSB 1G7JB 2X4OB 3L95A 1WSST 5HHOB 2BDNL 3KPNA 4LARL 5DFTA 4LNRA 5ABDE 1Q9WA 3MJ9L 3DLQR 4JPVH 2QQLL 4J8RA 3RTQC 2XXMB 5AG9A 1B0RA 5BO1L 3FO2B 3QXDB 1GC1C 3OKYA 3LPWA 1D5MA 4MB3A 1TTUA 1ZS8B 4DEPB 1JWUA 5IM7A 4OI7A 3H3BC 3X3FH 4ZFOA 3S7GA 1BZ7A 1T2JA 1HILA 4GBXC 4XP4L 3QB7C 4OI9A 4JVUA 3LRGA 3KGRA 1AXTL 5CJ8A 2VQ1A 5D5MF 1P4LA 2J7LA 3Q3GA 3O4OC 4Z7OF 3J7HA 5KG9B 3E6HB 1AQDA 1AGFA 2RCSH 3C60D 2PN5A 3CFKA 5ACMA 2E8YA 3V2AR 3IF1B 3IDGA 1R24B 1KPUA 3RQ3A 4XPBL 4YNYB 5A16B 2OXHA 3RWIA 4YFLF 5D1QC 4L9LC 3BJ91 3QULB 5E99H 3OX8B 2PTTA 1LP9A 2K1MA 3N85H 2QQKL 3QI9D 1EJOL 4MA8H 3QBTB 4RAUB 1WFNA 3OV6A 1WCBB 2A74A 1HZHL 3E6FA 3KS0H 1KUMA 5A2IH 4YWGH 1A7RH 1CDUA 3UMTA 4PJ8D 5CIPA 2DMKA 1CGUA 3UTTA 5DJXB 4GH7B 4OUUA 1YJDL 1BZ9A 2EDBA 3T0ED 2OR8A 4M5ZL 5FA4A 5IFJB 2VLME 4U3XA 5I8EA 1XZ0A 3PABA 2F53E 1H8OA 5AWNH 3T2QA 1U91A 3A6CL 1OAYL 1R3JA 5D5ME 3O6FA 1RFDL 5C71A 5HYEA 3UCRA 2CXKA 2ADIA 5TDNB 1PYWA 2GIYA 2HG5B 5J8OA 1XCTB 4NUGL 1IBGH 1HQ4A 1NC2B 4Y7MA 2YMXL 4W6XB 1TNMA 5C92A 2BNUA 5DWUL 3TF7C 4RMUA 4XP5H 2IAMA 4Y5VA 1J18A 1Z9SA 5FF6A 2AK4B 2FGZA 3C9NB 3N9GL 4PJAA 4IOSD 2Z91A 5KAQF 5KTEH 1I9JH 2VDNH 5ADOL 2ITCA 5JPNB 5I8OL 4YGVB 1AO7D 1CVRA 4I18A 4XMKH 3HR5A 2BVPA 3CVIL 2LU4A 4JANA 5M95B 2ORBL 3LEXB 5D71H 1SYVA 1T7YA 3U46A 3SKNB 4XP9H 2J6EH 2Q20A 4OTXH 1CT8B 1FPTH 1U95B 4BA8A 5JHDA 5T3XE 3UZQA 4UTAL 3VXTA 2FJFB 4PG9B 3VFMA 3QDGB 4QTHB 3Q6FA 5FO8B 4Z8FL 1LEIA 4JZNB 5I17A 3ISWA 3H8NA 3RRQA 1IL1B 5GGTH 4ZNCD 5I8KL 3BISA 3LKSA 4JQIL 4J6RL 5E2VL 3IKKA 5A40E 1QRNA 5EC2B 5JNYB 2M1KA 4EBQL 3ZDYE 3L3GA 4Z7QF 3SO3B 3G6DL 4KQ4L 4KUZL 1YEJH 2VN4A 1OTUC 2F9BT 1FAKT 4LGSB 2NR6D 3CSPA 3RVUC 1PDKA 2J1KA 4DEPC 3AY4A 3UZVB 4YHLH 4AEFA 2ZJSL 5IR1B 2C4FU 3X3GL 3T3MF 4Z9KB 1FO0A 3AB0B 4MHHI 5ID0A 3OXSB 1N0XH 5HY9B 4M7KH 2WINB 3MGAA 5EWIH 4D9LL 5FDWA 4YDIH 1DEEB 1UVQB 1FV1A 3T1FA 2E7LA 4OLXH 1I3RA 1Z3GH 4EN3B 1IKNC 3HI6L 4HDIA 4MNGA 1FL5B 3DROB 2R23B 4YPGA 4U6VL 4UB0H 2NW3B 2EDQA 3D5OF 5EZJB 3SDAB 4NC0B 4CADA 4KK5C 2AK4E 1CGVA 5IVXB 3O6KL 4APQD 1T89C 2L7UA 4NQXB 4F7EB 4Z7QE 2FX7H 1N0LA 4MD0A 5IMMB 3SJVD 4I0PD 4Z0BH 3MNWA 1QBAA 1JNNL 3BIKA 3P9MB 4WEUD 4XPHH 5MEPA 3HAEB 5MEOA 2B2XH 4JFDB 1S8DA 2YUVA 4AEEA 1AJ7L 3DARA 4XHJD 3WN5C 5FO7B 3QDGE 4P5MB 1O7VA 4JR9H 4NO2A 4UMGA 2C1OA 3T3ME 2BNRA 4ZQKB 5K9KB 3HC3L 3MRLA 1J7VR 1GJIA 4WW2B 3TNMB 4UU9A 1J12A 4BFIB 5EZLB 3CUPA 4Y5YB 4L8CA 4N8CL 5IFHH 1PVHA 4WY7H 3WJLC 4PYHA 5IW6B 1EFXA 2IF7A 1JPGA 5IVXF 2BVTA 4YQXH 1UACH 4QHNA 4YBQC 1BLNA 4R26L 3DTXA 1IAIL 4RFEB 1GGUA 4JN2B 1BX2B 4YE4H 1R3KA 2XA8H 4S10A 3B2UD 1WT5C 1Z9MA 1NGQL 1QUNA 5GGVY 1SJXA 3WHXB 3KPPB 2DKUA 4Z76B 1EZVX 4OSUH 3LN5A 3EOBA 5J0BA 2XI9A 3ARTA 4IDJL 3DHMA 2WAHA 4RMSA 2X7LA 4LBEB 2FIKA 4WW1A 4LCCB 5ICZA 4HXBL 2EKSA 3O3AA 2H6PB 4OIAA 5CILH 1NGYA 3ALXA 4WW2F 3MROB 4H20L 1A7PH 3LKOB 1MIMH 4R7NB 2EEBA 1CR9H 1DR9A 5D2LB 4KK6D 4MNQB 1AD9A 1KF9B 1RIVL 5IG7B 1I8MA 4Y4KD 4JDVB 3TCLB 3UEZA 5DS8B 5TFSH 1UQSA 1ZKAA 4Q9BA 3MRKA 4WFHE 1SYSA 5GRUL 3JWOC 2XG5A 1ZOXA 5DD3H 1YEIH 1INEL 4HLZG 4R97B 2DQEH 1GZQA 5IVXE 3G5YB 2O5XH 3SKJH 5TDOB 1JPFA 4G9FB 3PL6A 4HUMB 4AYFA 3S5LG 4LK4A 2VXSH 2PYFB 4KGLA 3TH2T 3V6OE 2P5WB 4NO0D 3VG0H 2Q6WA 2OR9H 1DBAL 3G5ZB 1CXKA 1BQHG 3QXTA 3P0GB 5IQ9A 3DVIA 3EOTH 2I5YL 4MA3B 4K3DH 2HT2D 2R29L 5IW1B 1AHWC 4JFDE 2I9TA 4P5KA 3T0DA 1BGXL 1QLEL 4OBSA 4W4NA 4G5ZL 5D2LF 3DYOA 4Y88A 5C9JA 5BZDB 4JO2H 2XWTA 2ZCLH 3MUY1 2WSKA 4GW4A 4XNUH 3BT2H 3LEYL 1H3WM 4OFVA 1ORSB 3TC9A 3ARDD 3QFJD 2R2BB 2YOCA 5IB5B 2NY0D 1SY6A 1OD7A 5DRWA 4TVPE 1VA9A 1OD9A 3BD4A 3C60B 3BHBA 1HK6A 2N7BA 4JKKA 1FVEB 2GI7A 4KRPB 4OD2A 5KS9A 3F58L 3MMEB 4L8BA 1KSRA 1IC7L 4PJDA 1V7ML 4ODHL 3H9YA 3FFCD 2GTZB 1IGTA 4C83A 4FHBD 5D96B 4R4FL 2WBJD 4PJ7B 3DIFA 4NHUA 4Y16D 5F1IB 5JIHA 1F90H 3HE7B 5DD1L 1GL4B 3WNPA 1NKOA 5C0AA 2DQUH 3GMPB 2G5BB 2BOBA 2WNGA 2R4RH 3BX7C 5INDB 4ZUSA 3HZVA 2AJZB 4X6DB 3RU8L 5D2LE 1CD1A 2EDLA 3K74B 4MNQE 2FEEI 3U6RB 3BP7B 4XBEL 1U8OA 3WO4B 2MSPA 5IT2H 1RZJC 3I84A 3O2WH 4LPWA 4ZFOL 2GTWB 2V6HA 1LO2L 4FG6C 1S5IH 4JM4L 2XNAA 4YHZH 4K55A 4L3EE 4M48L 5CJBA 4G9FE 3MRIA 4PJBA 4PJ7F 2P5WE 3ZKMC 1I9EA 3CDGB 4PJIB 2VDOH 4H1LB 3U4AA 4E42B 3MR9B 4N9GB 4LCCC 2CXGA 5D2NB 1BOGB 5E24E 4S1DC 3T2NH 3WE6B 5AD0B 5E8OA 4NN5B 4X6DF 3CC5A 4X80L 2R2CA 3A6OA 4ZUUA 1HSBA 3OF6D 1XEDA 3QRGH 1RK0A 1A1MA 4P5TD 1RZIA 3QUYB 3UBXG 1GCFA 3MBEB 4P57A 2WP3T 2X4NA 4OZHB 5D7IA 3PDDA 3S37L 4I0CC 4Y1AD 4PP2B 5FUOH 4QKXB 4X8JA 3FRUB 5L7XL 2OTWA 4NHCH 1CF8L 4MJ2A 4HMEA 1CFVL 1P69B 3V5KA 5C6TL 2E27H 3LSOB 2VDQL 4PJIF 4HUWB 3MA7B 5MENB 2F8OA 4UNUA 1DLFL 2GSGA 1H15B 4HMCA 2EECA 1NH6A 1CI5A 5I1JH 2O5YH 4HS6A 1K85A 5DSCB 1Q72L 4JY4A 2GJ6D 5DJCA 4PJ7E 2X4QA 5EU4B 1IQDB 2IPKB 2YEZA 1UJ3C 5F3BB 4PGZA 1NDGA 4JG1H 1QP1A 3FONA 5K9OB 5E2UL 4HXAH 2DQGH 3VG9C 5AUMA 2I60L 3GHBL 4KQ3L 1N5AA 3MJ6A 4R90L 4JO3L 4NQEB 3HMWH 4X6DE 4OZHF 4OI8A 1WZMA 4BQCA 1MCIA 1YDPA 1B0WA 1NCTA 4CRPA 3FCTA 1YEFH 4CU7A 2P48B 3CNKA 4WI9A 5KAQG 4GUPA 4F15B 4FFWC 3H9SD 1X7QA 1GVIA 1CLYH 1KIPB 5BV7L 3ES6A 3X13B 3UTZB 4EDWH 2QV2A 3F12B 4WO4B 4O58H 3E2HC 1FYTD 1GGIL 4XNZC 4S2SB 5D96C 3EO1A 2A9ML 1Q9KA 1Y18B 4GXVH 1LE9A 4PJIE 1MVUB 2CK0L 2R56H 1QR1B 4J3TA 3TWCH 4MJ4A 4W4OC 4K2UL 3NCBB 3L3DA 3RY6C 3QUZB 1AKJA 5E4EB 3IJSA 1RD6A 5D2NE 1P5UA 5F70A 1FVCB 4LSQL 5E2WH 4R8WL 3CK0L 1F13A 2ZUVA 1A2YA 3BZ4B 4JRYA 1TZIA 1AFVL 1W0WA 3DV6A 1I3UA 3WIFB 4F7PB 5B21A 1YZZA 3WMSA 3CPLB 1JZ8A 4KHXH 1NMBL 2WWMC 3KR3L 4ZDHB 1I9IL 2NX5A 4GSDH 3EFDH 5DI8B 1PLGL 4XBPB 4HIEB 4L5FH 5B8CC 3TJHC 1UGNA 1KENL 4NOFA 4NQTA 2QSCL 5KSBA 4JO4L 5ESQA 1TVBB 3CSGA 3QPXH 2NLJB 1RVFH 5J89A 1ZT1A 4UZGA 5MENE 3HE6A 2X6MA 4JFFA 5D2NC 3VXNA 4LRNH 4UT6L 4FQXA 3D69B 1S7UA 1EH9A 5LGHH 5DC0A 4HH9A 4F7MB 3EYUL 4UNVA 1JPTH 4ZSOA 1F02I 3CFDA 2IGFH 4PY8I 4QXGL 1K8DA 2ZUQC 4U0RB 1ZVSB 1V5JA 1QFUH 4ZUWA 1EK3A 4NQEE 4ZFFB 5FV2A 4ZOCA 4R0LA 2CGRH 3VXQB 4LSTH 4NDMB 5C7XL 1FCGA 4QRQB 4OGAD 5C0FA 3O45A 1ONQB 2OMNA 5DUPL 1G7PA 4HIHA 4LCIL 1DN0A 1KFAH 1JPSH 1QBBA 3MJ7A 3HFML 4G8GB 1KG0A 5IF0A 1EERB 3OKMB 1TJIL 3G04B 4ONHB 5IMKB 2AEPH 5F7YC 3V9FA 1ZLUH 4B7LA 4LIQH 1OWWA 2FGWL 5D70H 3HNSH 1XCQB 1G9MC 1EZVY 2BXYA 1S7VB 3SGEI 4PRPD 1JZ2A 4PY8J 2YPKA 4LVHC 3C5SB 4BSJA 5FHBH 5HHXH 2HVKB 4Y4HC 2OJZH 1T04A 9CGTA 1ZANH 5C0IA 3JSSA 2DQHH 1RHHA 4AY0A 2AJUL 3BO8A 4XB8A 3EGSA 1GOFA 3DMMD 3DRQA 3WKNA 1CS6A 1QSEA 3HPJA 3HPLB 3HZYA 4L1DA 4OGXH 2BHUA 4F15C 1N8ZB 3GBML 1GPOH 1U0QA 3D85D 4MAYA 1K4CB 1KJMB 2BCKB 2H2SC 1ED3A 5D9SB 3MUHL 1NBVL 4KJWD 3Q1SH 3MLZH 2JB5H 4QHLB 1UCBL 1Y0LA 3TPUB 1A6AB 5F89B 5JOEA 2NXYB 4KJYB 3D0VA 3ZT7A 2AJXH 1MFBH 2R1WA 3PDOA 2XKUA 1EEYB 5CZVH 3QUZC 3WDJA 5TE7L 2DQFA 4JPWL 1KB9K 4BZ1L 2JLLA 5D7LA 4WUUD 4MQ7B 4J3WA 4GKOA 4FQLH 2HT4D 1OVZA 3TZVC 3QEQD 5E5RB 3IJHB 1RJYB 1NCUA 2EYRA 4LLQB 1YEHH 1CGTA 4NNPH 2C7UA 4DVRL 3NVQA 3PGFL 5FYJU 1ZAGA 1ZHNA 4LPCA 3CXDL 3MCKA 4KKLC 4OV5B 4Y16B 4OLVH 3V4VH 3D1MC 5F88B 1HWHB 1R3HB 3SGJA 1HIML 1D5ZB 4EI5A 1H9VA 2W0KA 4XC3L 4LKCA 4F8QA 5BQ7A 1K8IB 4FZ8L 3V4PL 4G8GE 5F9WB 5GS0L 4BFGA 4Y2DB 5F1NB 2NW2B 4LQ1A 2BNQB 4KMTH 2ENSA 3CSBA 1HNFA 1A7OL 1S7WB 1WIUA 1NDMB 2WBKA 4JHZA 4AENB 5CD3B 4D3CL 2DS4A 2PF6A 3MC0A 1MJ7L 1OW0A 2HJLA 1GHFH 5DMIH 3D2UA 4M61A 5T1DH 1KT2A 1X5ZA 3VH8A 3F8UB 2GFBA 4PJ9D 1PJ9A 4YC2C 5HHVH 5T1KD 3RVTC 3LKPB 3P30L 3MLUH 4M6ML 3WS3A 4LPYA 1KC5H 4X5WA 3RNKA 4OZIB 1A8JH 4HUUB 2ZOKA 3U1SL 1XF1A 1OARL 4AMKH 3GIVA 3ZKQD 3FO1B 3KPQB 2YD1A 3RDTD 2W91A 4YEEA 2Y4SA 3P11H 4JHWH 4WFGD 3DVGB 3ABZA 3WKML 5EUKA 2HFGL 3VFTB 4HKBB 1OGAA 1PZUB 2VLKD 4BZYA 2HWZH 3GMMB 3C09B 4NT6A 5FUZL 5ITFB 4Y1AB 1A5FH 3SDCA 4NJ9L 1R3LA 4O2FB 4XH2A 3SKOA 1U8NB 2EDXA 1CTOA 2X9YA 4LLUB 2CIKB 2C5DC 2MCPL 3IT8D 1GGYA 3A67L 3FO0H 1TDQA 3RAJH 1BIIA 1Q0YH 3VGFA 5KW9H 2UZXB 4LDLB 1WC7A 1AGEB 3BRDA 5FCUL 4U1MA 1UWXH 5ID1B 2CLRB 4HKXA 2VISA 3CDYA 5GIRB 4OZIF 5FXCH 2BVYA 1BEYL 5HVHC 5JO5A 1RZ7H 1DL7L 1KEML 3EYVA 2GJ6B 3AUVA 1L6ZA 4QNPF 4OZGB 3QEHA 4UV7L 3LDBB 2I26N 3ARBD 4P46B 4Q0XL 2IPUK 1T03L 3LH2H 5HVGB 3TT1L 4GG8B 4UQ2A 4DJMA 5L2JA 2NXYC 3EDEA 3ARGA 3VXRD 4X0KA 2VKWA 3EYQC 3GSUB 2EIZB 3OAUH 5DF0A 4XP1L 5K9JL 3WS6C 4GAJH 3LKQA 4QRPD 1JI1A 5JOPD 4JGUA 1UXSA 5IHUH 4L8DB 4WHDA 3HZMA 2F15A 4QCIA 2W0FB 4F33B 3IDYC 4M02A 2O61B 4OAWA 4QOKB 3C6SA 3O4LD 5D7KD 3ECBA 3EDDA 1FYTB 1MIEL 1NEZB 2R8SL 3W0WB 3LRHA 1GGBL 4P2CG 1INQA 1YYMH 4OZGF 3RL2B 3P9LA 3WD5L 4CJ0A 4QRRB 1EGJH 3TA3D 4MCZB 1IGCL 2EZ0D 43CAB 4PV8A 4WV1A 2AEQL 4OZIE 1MAMH 3AFLA 2Q8BH 3X11A 4K23H 4QNPE 5EOCL 1Q9OA 1Z9OA 2X10A 3CVHH 1OAXH 4GAGL 4ZAKB 3WBDA 1PX4A 3TJEH 3MGTA 4IOFC 3MZGB 1EXUB 4HWBH 2HFEB 4YO0B 3NTCH 3OR7B 3M07A 3RIAK 5CJXA 4BFEA 5C0EA 4XVSL 2CLZB 2EXWC 2F54B 2P46B 4Y1AE 1UG9A 5IB2B 1R5VA 3WL9A 4J1UB 1F58L 5DRXA 5IFAL 2RR3A 3SGKA 1OAQH 2NZ9D 3FB8B 5D7SH 4HGWB 2P8MA 4UNTA 1A9BB 3DETC 1B4JL 3O41B 5HYJD 3VU2A 1Q94A 1CXLA 4JFOB 4U1IA 2KZWA 1PG7L 2F19H 4F7CA 4KROB 1W0VB 1NCBL 1DANU 2GJ6E 4OZGE 1FORH 4QRTA 4W70A 2WANA 4P3DA 2MQ3A 2JIXA 4CU6A 4YZFF 3ZDZF 1BD2D 1KV3A 5IEHA 2CQVA 3QISA 2ICEB 2X42A 3C09C 5JPMA 5BOPA 1FFOA 3IFPA 4HJJL 2CKBA 4PB0H 4XI5D 4GW1A 5T3ZL 3BEWA 2IADA 2R4SH 3I6LE 3MV7A 3KDMA 5IVZA 3K81A 2XXCB 3PF2A 1S9XB 4QOKE 1HINL 1RUMH 1CICB 1DANT 1MJ8H 1FYTE 2HN7A 1CVSC 2L4OA 3W0WE 3TVMA 4PR5B 5JMOC 4GAYA 4ETQA 7FABH 4LASL 5HYQB 2X70B 5J56B 4ZOAA 4QRRE 1G7IA 2H2PD 1XIWC 5LBSH 4PFEA 3PGDA 1XH3B 2NY2C 3RWHA 1JVKA 3FMGH 5DQDL 4NWTH 2AI0H 3MBXH 2OR7A 3KHOA 4MJID 4KHTL 1X5HA 3UP1A 2D9CA 4P2OB 1KJ2B 1B88A 4YZFE 5HGBA 3ZDZE 2P8LA 2VLRA 3D85B 3F7QA 3MRNA 3DUUB 3GRWH 1S7RA 3VGHA 4BSWB 5C3TA 3JTSA 3FZUD 1FGNL 2F54E 1J0KA 3QEUB 1MFNA 1UA6L 5HPOA 4E0RA 1UWGH 4MJ5B 4RA0C 1I1YB 2NNAB 5C0BD 1KB5B 3UJJH 1D3CA 5DVNA 3TT3H 4EI6A