1KCUH

Crystal structure of antibody pc287
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
217
Chain Sequence
QVKLQQSGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMAYISYSGSTTYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTAIYYCARGGTGFDYWGAGTTLTVSAAATTPPSVYPLAPGSATAAASMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
pubmed rcsb
molecule tags Immune system
molecule keywords PC287 IMMUNOGLOBULIN
total genus 40
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2001-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kcuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kcuH01
4PJFB 1F3DH 2JIXA 4X6CB 3RI5K 3DVNA 3KYNB 3FB6A 1H5BC 3EYSL 3GSNB 2YZ8A 1G6RH 1RZKH 4NHCH 1GJIA 3VXSB 1A64A 4X7SL 1XF2B 4RIRA 2JJUA 1A7NH 5GGRB 2DQHH 1RJLA 4FP8L 4Z5RB 1FO0B 4UTAH 5IVZB 4NRYB 3ILPB 1MCWM 4RGNE 5CJBA 2QJDA 4FABL 4XC1H 2APFA 1A0QH 1D5ZB 4P2CG 5BVJA 5BVPL 2JJWA 2WK2A 3TM6A 5HPMA 1IAKB 1J7VR 2ICWI 4N0FA 4D8PA 3SPVB 1JGLL 1U8IB 4UINL 3GHEH 4LLMA 3QEQB 1EMTH 3BN9C 3CIQA 4MXVF 3VXQA 3ROOA 5FGSA 3OXRB 2V2WB 5F89A 5I8KL 5JQ6L 1RK1B 4WWKD 1PY4A 5DJ6B 1KN2L 5GRWA 1XIWC 3VRIB 1RJZB 4YBLB 3T77B 4QF1A 2AEQH 2CD0A 1KCLA 5I0ZA 1DBML 3TYGH 1OTUC 5EIIB 4NC1C 2GT9A 2WNGA 4H1LB 5T5FL 4LCWB 4A6YH 1URLA 4NKIH 4CADA 1V3KA 4NP4H 4KHXH 4Z8FH 5C0JB 5FYKE 1CGUA 2R2CA 4Z77B 4Y7MA 3QJFA 1GGIH 4K8RL 4NM8H 1DE4B 5L88H 4NQDE 3RBSA 3LB6D 3MXWL 4OUUA 2QSCH 3MJ7A 3ZHKA 1KG0B 4ONGH 5T3ZD 4ONFH 5MP6L 2G5BA 2WQ8A 5C0NC 2I27N 1JPFA 3H9ZA 3LKPB 4J23A 4J3WA 4OCXH 3GI9H 1O0VA 1A1NB 2XN9D 3KLHD 4MZ2A 4UNUA 3SDYL 2A73A 1NMAL 2XXMB 5GS0D 1I1FA 4MJIB 3RWEB 3QUML 1G7MB 5I8CA 2H32A 2AI0H 1BQLL 3CH1B 3RWDA 3ZKNC 3ROOB 4Y19A 2Y7QB 3GJFK 4GRLB 2NXYC 1Z9SA 4PG9B 3RX5A 3T2QA 4I9WE 4FNLH 4K9EH 1QO3B 5E9DB 3UYPA 5L7XH 2CQVA 4UT6L 4WUUE 4OQTH 7FABL 5TE7L 3P0VH 2WBJA 4Y16B 2Y23A 5DRNA 3RWEA 3B9DA 1ZGLA 3GDBA 1F3JB 4ZFZA 3FKUS 2IBZX 1QVOB 5K9QG 5CP3A 3G6JA 2AXHA 2X5PA 3VFTB 5FF6A 1CIUA 1HI6A 1MH5B 1XGQA 4RMTA 1BJMA 2DF3A 2OTUB 5T1KD 1T6WA 2H26A 3B3IB 2EDNA 3GMRA 5SX5K 1AY1L 3CX5K 5D2NA 4IJ3B 4M93B 2ZP0T 1TQCB 3T4YB 3I50L 4PRPA 1U3HB 4LVNB 4I4WB 2I9TA 1MH5A 4QGTA 3WNKA 1R5WA 4OZIB 1RUKL 4YXLL 4UAOB 3ILQD 5IV2B 3BKJH 5CD5D 3LRHA 4EI6B 5KSBA 4OV5B 3S35L 3PGDA 4UZGA 3TN0B 1A4JB 4YLQT 4I48A 2DQJH 3O2WH 4TSCH 4FZEH 4Q9BA 5DLMH 5D1XC 5IB4A 3DX8A 2CLVB 1J11A 4P0DA 3GSOB 2OL3B 2ZCHH 2F58H 2WUCH 2YPLA 1GZPA 1DBJH 2BHUA 2P42B 3MYJB 4HK0A 5DYOA 1IZJA 2EDBA 3O6KH 4X4MA 3VFSA 2OSLB 4ISVB 3SCMB 3TZVA 4NN5B 4X6DB 1AE6H 4PGCA 4Z18A 3MRBB 4CKVX 3FT4A 1NAKL 4PTUA 4U1HB 4QTIH 5ALCH 3PHSA 5D6CA 4PS4H 2FCBA 3N1QC 4X9GA 2X41A 2APXA 4JM2B 4M7JH 1GPOH 3B8YA 4L4VD 4TUKL 4J1UA 1JN6A 1BAFH 3RKDC 4FQ2L 3P73B 4DZ8B 2X42A 1IARB 4BA8A 4JAMB 2Z91B 1MJJA 2X89D 5GRUL 4L29A 5EO0B 3ES6B 5BZWA 3K3QA 4GMTH 2D7PA 3P9MA 2XN9B 2J8OA 2IGFL 4LU5L 3U36A 4XXCA 5MEPA 4M43L 3ROLB 3AC0A 4KK6C 5TGBA 1F90L 3TIDA 3DHMA 1UVQB 2BRRH 1M7DB 1OGAD 1CG9B 5HHQA 5DMJB 5I8EA 2AXJA 2ZUQC 4HH9B 2DIAA 2I07B 4NO0D 4FQCH 3TA3D 1MHCB 5E2UL 2AJUL 1YPZF 1WWAX 5AWNL 2J6EL 3SDCD 3VD3A 3Q0HA 4QKXB 1ZLWH 5ITBH 4X7TB 4JPIA 2L4OA 4PTTB 1AH1A 1XGUA 1K6QH 5ID1B 2XWTB 4OM1H 4L8SB 5F3HA 1HDMA 2GTWB 1OD9A 4IHOB 3P11L 4NQUA 5TH2A 1TNMA 1ZS8A 3KGRA 3MCG1 3J8F7 2WQRA 1FCGA 4Z7UB 5GSRB 1ZVYA 3ELAT 3Q6FB 1QBLL 4HGWA 4PUBH 4FQLH 3SDAB 5C0FB 1RJYA 1KXTB 3QWOA 4N8VB 2PYED 1JWMB 1KN4L 3VXQB 4ODXB 2VKWA 1Q8MA 5D70H 4UQ2B 5FK9A 5CJXC 3ARFB 5IB2A 4JZOA 2MCPL 4ZUVA 5HHME 3Q2CA 5SWZA 5CZXD 3SDCA 3S34L 2FX8L 1NBVH 4HKJA 1E4WL 1F97A 3FCTB 1GOFA 4AH2B 1RY7B 2GCYA 1X4XA 1ZKAA 3L3GB 2KZ1B 2FATL 1RK1A 2UVFA 2DQTL 4KK8D 4QHUB 4YDIL 2X9XA 3NZHH 3HZMB 3CH1A 2GJ6E 2F54A 3CK0L 2W91A 2HLFD 3HZKB 4G43A 2CIKA 2VR9A 1GZQB 3I6LD 1BX2B 3V5KA 3S37H 1OF2B 5GRVK 4NRZA 2BY0A 2X7LA 5J12C 3NFSL 3NGBC 1KPUB 1KG0A 4NQXB 2XA8H 3VDBA 1WZKA 3DOSA 4O02L 1Q9LB 1OB1B 3B5GA 3M8OH 3QQ4A 3D3VA 1ORQA 1S7QB 4P23B 2IH1B 2V2TB 2HT3C 5FA3B 3FRPA 3BD4A 3V4VL 3TVMA 3VXNA 4JFDB 4AT6A 3V0VB 1XF5B 1CICA 3MXVH 4J6RH 2R2HB 1TZGL 3UTOA 5HVHC 1RMFH 3GJFH 3L5XH 3OMZA 2OXHA 5C2UB 1M05A 1PZ5A 4JB9L 1T21B 4YR6A 4W4OC 1UM4L 3BGFB 1OB1A 1DBKH 4L3AA 3OXRA 3P30H 3LS4H 1JUFA 5E24E 4CGTA 5J12B 1NGYB 1MELA 2IG2H 5EOCH 5IV2A 2ADFH 2V17L 2R69L 3V52H 4CNIB 3NFPA 5ALBH 3L9RB 4KKCD 1CDHA 3BDBA 1Z9MA 3MR9B 3ARDB 1F58L 3GSNH 4X80H 2VLJE 5GPRA 4WO4A 4I18B 3PNWB 4HMCA 1EEZB 5F7EH 2D2OA 2ZUUA 3SDXB 1AD0B 4NO5A 3U9PH 3MRCB 1KPRB 2BC4A 3QWRA 2AJ3A 2NQCA 2NZ9D 1Q0YL 4LKCA 3UTSD 3OKKB 4KROC 1WAAE 2M1KA 1A7BA 1CDJA 2A77L 4UT9H 5EORL 4F57L 5BVPH 2A6IB 1ZLVH 2GTZA 2UWEA 2OMBA 1OAKL 1P4IL 1OLLA 4ZO7A 4PJHB 4AY0A 3GMLB 2GITA 3BPOB 4PRPD 1MFDL 3UYRH 2Z4QA 1PSKL 3ME0A 1RZFL 1T1ZA 4MJ5B 2ADIB 4NZRH 3HG1D 2FWOB 3HPJB 3P0YL 3CVHL 2X4UA 2R2BA 4HV8B 4HGMA 3JSSA 4N8PA 4WTXA 1YC7A 5EU6A 5IJVB 3P77A 2YUVA 1EFQA 1T83A 2UY6A 4MNHA 1LDPH 1JGEB 1WJ3A 1WWWX 3P40A 1FYTA 4NQSB 1NDGA 2NY0B 3TBTB 4QXUL 3VGBA 4KI5E 5AZ2L 3L3IB 3ZDXF 2ADGB 2V7NA 1UENA 3SQBA 4AK1A 4H88L 1Q72H 2BNQA 1S9YA 4UU9A 2PKDA 4OLZH 4L3EE 5EBMA 1G7LB 1NLDL 2ESVE 3CXDL 5DJ8A 4HGKC 5CILL 4UDTA 3E6FA 4ZOBA 2YXMA 3JTTB 1KIRB 1F6LL 2VZ1A 3O9WD 1Z2KA 3H9HB 3W0WD 4AL8L 1YEKH 4K2UH 3BO8B 3SJVA 1JWUB 3MA7B 5F1NB 5AD0A 3SDYH 1NMAH 5JO5B 4ZFFA 3GBML 2LQRA 4ODTH 5GRZA 1AGDB 2MNUA 2SEBA 3KYMA 2B4CH 2GY7B 2Q20A 2YUWA 4X5XA 3TA3A 2XZCH 1T1ZB 3JWDH 4MJ5A 1AQDB 1INQB 1KEMH 4YHIB 2PETA 2X1WL 3P4MA 1KLFA 32C2B 4JFDE 2E5EA 4HC1H 4WU7A 1UB5B 3P0VL 1QR1B 4P5MA 4JZJC 1L0XA 3KLAB 1AFVH 1NC4A 1A6VL 3ARVA 3KYMB 3MLUL 3KS0H 3KLSA 1FGVH 1OAZL 4F8TA 3WIIL 4F15B 5EBGA 3HMWL 5LQBL 1K8DB 4OD1H 2EEDA 3TZVB 2E27L 2FO4B 4YHML 1EFXD 1A3RL 3LS5H 3QXAA 2Z31A 2C1PA 4F3FA 3RWFB 4TOYH 1W72A 4ZS7H 5JOFB 3I50H 1YMMA 2APWA 4DKDC 1TJGH 4GRMA 4PLKD 4G8GB 3VWKD 3VFNB 4YH6A 2X6MA 3HUJF 3UCRA 4YHOL 1FZMB 2W07A 4L8DB 1JFQH 3X12A 1EJ6A 1UWEL 3TWCL 1S7QA 3PDOB 4K3GA 1E4XI 2AXFB 5F1KC 3D39E 3QNZA 4FZEL 3C60C 4IOSD 5JHLH 1KSRA 1Q94B 1D9KD 4JGMA 5GRXG 2XN9A 2G75B 5HD8C 4KRPD 2NY6C 1WTLA 3P3YA 4YXHH 3ZKMC 5T33L 9CGTA 4Q6IC 3TV3H 5LAXB 5E99L 3KS0J 1YEDA 2W1NA 3FO9A 3QEQA 1YN7B 1YYLH 1BVZA 4X0KA 3DWTA 2ZKHH 4MHHG 1FHGA 2JE8A 2AK4A 4PGDA 3WEXB 2P5ED 4ZAKB 3EDKA 1ND0B 3S3JA 3MMEB 1MCOL 2EYRB 1MCJA 3JV6A 5L2JB 4OZFH 1CU4L 2WIIB 3GB7B 5GS1C 4E9LA 4C4KT 3ARDA 3DXAE 1A14H 3WS3B 2ZWLT 2XKSA 4FQ2H 3QFJA 5HGDB 4D0DB 1OAYL 4Y5XA 4K23L 5CSZA 4JQXA 4EI5B 3ARGD 2BOCA 3B6SA 1NCDL 2PR4H 2FO1A 3NCMA 4ZO8A 3NABL 3UEZA 5H35A 4K7FB 3NCYS 3GO1L 5L9DL 3PDOA 5I66A 1OTTD 4R8WL 2D0HA 2DQEH 4JRXE 1C5BL 4RZCB 5GS1B 5D96C 4ELMB 3KR3L 3TT3L 3NIDE 4OJFL 1IAIM 3VMPA 1IGIH 4PRIA 4NPYA 5GJSL 1UWXH 3G6AA 2VWEC 5E2UH 4KJWD 4EI5C 2CMRH 2Z8RA 2IAMD 5JPNA 1F45A 5FGCB 3TNMA 5C2BL 1CBVH 1ES0A 4OFVA 5ETUA 1I3GH 4P48A 4KMTH 4XAKD 3S4SG 1CXHA 2HFEB 3PWPD 2X4RA 1TPXB 4MD4A 3DMMA 4AEIL 5D96B 4KVNL 3LCYA 3JV0A 3AM8C 3DECA 1NBYB 2HN7B 2C9AA 3FT2A 3SKNA 3EUUA 4BKLA 3HG1A 4BSVA 1AXTL 3BZEA 4I3RH 5IHLB 4MA8H 1YDPB 1ZGLB 4Z7WE 3ARPA 3C2SA 2JELH 3SGDI 2Y9RT 1F4YL 2J4WL 5C0DA 3FQTB 2PTTB 1OAXH 2AEQL 4XCEA 2AXGA 3VMNA 5LXGH 3TO4D 3K0WA 2XACC 1PGRB 3H3KA 4NUGL 4UDTB 2EDWA 1G7HB 3DBXB 3BZ4B 3SN6N 4X98B 1A7RL 4XBEL 4NNXA 3BO8A 4IRSC 4Y5VA 5DJCB 5DMIH 1G9NL 5MHSD 5BRZA 4K8RH 1SJEA 1WFTA 4YBLC 5JO5A 3LB6C 4X6EA 3MLRL 3D2UD 2DQGH 4OZIE 1EHAA 3FFCD 4PRAB 4KGLA 3QH3A 3MXWH 2QSCL 5T5NF 2P5WB 4MQXD 1QSFA 3L3KA 4KRNA 1U8LB 3VD9A 4V1DA 3PP3H 2CKNA 4GAGH 5DYOB 3EHBD 5DWUL 1HNFA 4P4KD 3HZYB 3O6FD 5AG9A 2V7NB 2W60B 2H41A 3BSZH 3RVVC 5EBMB 1X3DA 4QWWC 4Y4FC 4YPGB 2Y5TA 3HNVL 1SM3H 4NQEE 3KJ6L 1U58B 4UI2A 4OAWB 2D31A 3O6MH 1LILA 2YPVL 3LQZA 4KTEH 3OJDA 4LLDB 3V4VH 5K9OB 3NTCL 5TDNB 4G3YL 3CGTA 4LQFH 3EOBA 2QLVB 5CJ8A 4WUKH 3QBTB 3RUGE 4ZXBA 2LU4A 2Z4QB 5C9JB 5KVGL 4WFFE 3RDTB 4Y4FB 2NMSA 1BVLA 4LK4A 3IU4L 4WV1B 5KVDH 4YUEH 3MRJA 3UTZB 5JHDE 3KHQA 3IJYB 1MCIA 4PJIA 4WFED 2IAMC 5E94B 1KLGB 3U6RB 1HDMB 2GTWA 4HPOL 4X80L 4AM0B 5FHAL 2I9LB 5DD6B 5EFIB 5L2KA 3DARA 1U95B 3MRFB 1ZA6B 2GK0B 3O4LD 1EIBA 5ELIA 2NY6D 2ADGA 2CUHA 1MVFA 1T5XA 5IM7B 4Y8AA 4EQ3A 4GRWE 5AUMA 1B0GA 4P9HC 2C3HA 1KJ3L 4F7TB 3BKJL 1PYWA 5D7KE 1YYMH 4C57C 1LK2A 1I8IB 3S35H 5C0EA 2JCCE 4FXKA 4XCCH 2YSSB 3NIFF 5GZNC 2Y07L 3QQNA 3DVNB 2FYYB 1VACA 3UO1H 2FX9L 1C7TA 4PJHF 5FYJE 1EH9A 1KJ2A 3IXAA 2A83A 1A21A 4EIGB 5CGMA 5E9DA 1MFDH 2BVPB 4NJ9L 2WUCL 3VWJC 4OCNC 4ZDHA 1DVFB 1NSNL 4BQ6A 1J1OH 4LPTA 3ZYIA 1RIUL 2XWBB 3A6CL 1T04B 2ZG1A 4K7FA 5DURD 2V9QA 1WSST 2CJUH 1NH6A 1NAKH 3VXUE 3VDCA 1QRKA 2IADA 2BERA 3VGAB 5K9JL 3T8XB 5F1OB 4HKXB 3QIWA 3HE6D 1JHLH 3KPSE 3FN0L 2DJ4A 5IW6A 4PYHA 2WZPD 5LCVH 2DOCA 2R4SH 2GCYB 3GMMA 1RUPH 4NO0A 2WANA 2ZOKB 3QUZB 1T0PB 1I85A 4LSTL 4PJBA 5C07D 2X4SB 4ZAKA 4OZHF 4OSUH 1I7ZA 4NC0B 3HZVA 4OCWH 1OPGL 1YN7A 4OF6A 4RGND 1KCSL 3O8XC 1I4FA 2A1WL 3NACL 4Y19B 4CN6A 1LE5A 4J8RB 4L4VB 1UVQA 1RVFL 3JWOC 1FL3B 4M03A 4M43H 2BHYA 5C07A 1H3XA 5HHVL 2AQ2A 1KGCE 3BKYL 1KOAA 2BX5A 5FUOH 4G7YH 4FFYH 5F1SA 5IMMA 2VLMD 5FA3A 5DD0H 1G6RA 2B1AL 1MUJB 1CXLA 4FQXA 2GJZA 1B0WA 4M61A 5I75C 3V0WL 5E6IC 5FM8A 3VH8B 3FJTA 3MJ8A 5GRYA 5TJWK 2HA1A 2IPKB 4XC1L 1KPUA 1A0QL 5D7LE 3S37X 3CFJA 3GJFB 5CHNB 2G5BB 3IU3A 3FAXA 3WNMA 4HFUL 3DSFL 4CVZA 2EKJA 1BBDH 5ICZB 1HSAB 4XCNA 5JNYA 4JM2A 3H3PH 5GSRA 3GHEL 1A1NA 1CGXA 2CLRB 2X09A 2AKRA 3QUXB 5TF0A 1UKSA 1XGYL 2CXKA 4HXBH 3MJ8B 5CGYC 4O4YL 4LCUA 1U8LA 5I8KH 3REVA 3QA3B 4M1DH 1OP5H 1HHGB 3CSPA 5D7IB 2IANB 4NDMB 4ZS7L 3O3DB 2NW2B 1IAII 3PIQB 3QI9A 2XZZA 4LPWA 4XNZC 2F8VA 1R3JA 1KJ2L 2X4UB 4HV8A 1BVKA 1LQSR 4N9GA 2V6HA 3I2CL 3QULB 5GZOC 1VPOH 3QDGE 3BJLA 3MLYH 5IR1B 2DTMH 4ZFOA 1YEIH 1NGPL 1TETH 1HKFA 5IK3B 2ARJQ 3GMLA 3CFEB 4W4NA 1HILB 2AV7B 4WU5B 4N1HB 5DRWA 3MV7D 2K9UA 2C4XA 3MOAH 4TNVF 3ARFC 4XBPB 5KS9A 4I3GA 1N5AB 3ABZA 4ONOA 3DYOA 4HUUB 1QSVA 2YKLL 4PJAF 5E2WL 4MQXC 4QLRA 1EGJH 4JRXD 4ZUTB 4WDIA 3TV3L 2R1XA 2UZIL 3ISWA 5A2KH 5IFJB 4M6NH 2CPCA 4ENEC 2MJWA 5K93A 1MNUH 3ULVF 2ZKHL 3WFDL 3INUH 3BGAA 4IRSD 3I85A 3RKDD 1T2JA 4RBPK 3U7AA 5H94B 4Y2DD 3O2VH 1HQRB 3UPCA 5I30L 1DUZA 1KF9B 2NXZD 5DVNA 5IIEA 1OTSC 5ESAA 4JPWL 3C09C 3U0TA 1RMFL 1YEJH 3WXVL 3RVXD 1BGXL 1GZPB 4JG0L 3TLRA 1N0XH 3KYKH 2OQJA 3ORJA 3WIFA 4TNWK 1DBKL 2G9HB 2XQYK 5ICYB 3VWKA 4ETQA 3L3HB 3VXSA 2HLAB 1ODAA 5I8EB 2HKHL 3FQWA 1PYWB 5HHOA 4L5FH 3MGOA 5TDNA 4JGUA 1SY6H 2XZAL 5DUPL 3N85L 1AY1H 5K9QI 3VWKB 4HWNA 2YD5A 4JFYB 4LAQH 3WJJA 3ULSB 2A83B 1SVCP 4Z7QF 1K4CB 4FQQB 4YXLH 2P24B 1OF2A 3WFEH 4R7NB 4JAMA 2HT2D 4WRLA 2XTJE 3HCVA 2ZUTA 4GG6B 1NC4B 4Q9QL 4UT9L 2EZ0C 4WWKB 3WUWG 1RIHH 1G9EA 3QJFB 1CFTB 1JCKA 3RVUC 4LPVA 2EDRA 1AR1C 4LRIA 5DMKB 3FO2A 1F8TL 3GNML 3ZE1F 2DBLH 3PWVB 2RAMA 4RDQF 1VSCA 5CEYB 4I0PD 4JZNB 2VL5B 5DJ0B 5EUOF 3DO7B 2OL3L 4H20L 1J0YA 1I85C 4NO2B 1UEMA 1CFNB 1WICA 3OKDB 3SGEI 3IKKA 5DJYA 5D5MF 3GK8H 4XBGB 4IJ3C 2PCPB 2DJSA 4PJAE 4E42B 3C8DA 4LVNC 4UIKH 3JUYA 5FDWA 1WWCA 3GUTB 5C71A 4QRUB 3PABA 3T0XA 1J5OL 4GKSA 3L6FB 3HFMH 4NKDA 5TH2B 3MV8D 3KXFB 3BIAX 4TUKH 1FV1B 4TPRL 1ETZA 3WLWD 1N59B 1BAFL 1BJ1H 3MV9A 4IEFB 1DLFL 4HKZB 5DJ2B 5BS0D 2EDFA 3C8KA 1CI5A 4F9PC 1SY6A 5AZEH 3O45B 3QCTH 3WN5B 3MRQA 4MCYB 5E5MB 1RIVH 2F74A 4TUJB 3VFVA 4LHUG 4AM0A 2K3TA 2VMFA 1VGKB 1L9MA 5CINH 4W70A 3B5TA 1QUNA 4ZFGL 3HN3A 1VERA 4YHLH 3FQXB 4F7CA 1FG9C 4CDGC 4ZPTB 2IFFH 4TRPL 3CUPA 1QO3A 5MI0B 3BUYB 2AJVL 4F8QA 1I4FB 4FQHB 3QFDA 2XZCL 3WNOA 1ADQA 2X4TA 4K3JH 5C0CE 3DGGB 4KDTA 3MRMB 2DQFA 1LE9B 4YWGH 1XCQB 4LQFL 2GFBA 1JHKH 4Q74A 1Y0LB 2JJVA 4FN0A 2PTVA 4KI5D 3MMEA 4ZSOE 3SE4C 3VRIA 1K6QL 1NPUA 4WJ5A 4MA1C 3TNNB 2OJZL 3IU4H 3ARED 2OM5A 5IVXB 2AQ3A 2CKBA 4D0CA 4PJIF 1F42A 4YDVB 3TN0C 1WEJL 5HHOD 3EAKA 3KLDA 4JANB 1AGEA 3LS5L 1U8NA 2YBRA 3BHBA 2EE6A 3SKNB 5DD1L 3ARSA 4P9MH 2F8XC 4NWUL 5CP3H 3GSXB 5ACLA 3QISA 5FB8B 4YHOH 5I66B 3QRFM 5GGRA 1EFXB 3MJ7B 4DKEL 3HUJA 1CZ8L 5GGVL 2FH6A 4WUUB 4TTDD 5I18L 3BH9A 1G7HA 3CPLA 4RGOH 1KPVA 2Y07H 3EFFB 2WUBH 3NN8A 1D5MB 5SWSB 4J3VA 5IOPB 4YDIH 1IAMA 3FQUB 1HSBA 1F13A 1GVIA 4LHUB 3DURB 1D7FA 4LARL 3H42H 5T1DL 3I6KB 4S2SA 1WT5C 1YEFH 2LAAA 4HX1A 1KTDB 3MLSH 3T4AA 5DK2B 2NY5H 2X4NA 1ZT1B 1U8QA 4MQSB 4PJEF 2EIDA 5F7FA 4EBQH 5DC0A 1IEBA 3KVQA 4LSVL 2FR4A 3QXAB 4F3FB 15C8L 1A6WH 4NBZB 1A4KA 2VAAB 5B22A 4LKXA 1IGML 4ODWB 1AGFA 3MOBL 4Q2ZB 1KCVL 1M7IB 3E8UL 1OAYH 3EKCA 4N1CA 4Q97A 1F4WL 1FAIL 2WLZA 4Z6AT 5GHWH 3D1MC 1LDSA 3P30L 1UH4A 3AM8A 4PJXE 4P4RB 4XT1C 5I1GL 4ELMA 3RGVD 3DXAD 1HYSC 2QTEA 5DUBB 1MCKA 3DMMC 4JO1H 2NY0D 2NY1C 1AQDA 3QIBC 5C92A 4XWGH 5EDXA 5DA4A 2Y5TB 1SYSB 1CDIA 4YHYB 3AXLB 1WGOA 3RA7H 4OCMC 2VDPL 3HC0B 4BZ2L 1WITA 3HI5L 5I1HL 4WFHD 1PJ9A 1FZOA 5IB4B 1IE5A 3U4AA 4FTVE 1FZKB 3WKML 5C2BH 1CBVL 1VFUA 5CZKA 3W9DA 1GGUA 2XPGB 1S5IH 2NY1B 3QIBB 2VLRB 2Z8SA 4IDJH 4NKDB 4QY8A 4URTB 1LK2B 3VXRB 4HIJB 5FA4B 5KSVA 1A6AB 2NNAB 5D8JL 3MRIB 4HXBL 1ONQA 2OTWB 2PYEE 1MCWW 1ZT4A 5J11C 4LGSB 4PRBA 3H9SA 4MA8L 5J1TC 4IRJA 4YZFF 2VL4A 5DT1H 3PV6B 1C08B 1CL7L 1FG2B 3ARDC 4JR9H 1YN6A 1LWRA 1GGBL 4FFVC 4I3SL 1GGCH 5SWQB 2YD2A 1BWMA 5GQBA 2O61B 4ZTPH 4PJIB 3OQ3B 3CSYB 1E28B 4LEXL 3ZDZE 4OM0L 1VPOL 4UQ3B 3X11B 2BSTA 4PJEE 1P2CA 2L7UA 3NGBB 3ULUC 1RZ8A 2MQ0A 2MOVA 3LD8B 5HTSA 4ODHH 4H88H 1AQKH 5FYKL 1IBGL 4LLMB 3NIGF 3VRLE 1UZ8A 4HS8H 1OVZA 1YEGL 2FGWH 2J88L 1ZHBA 2VDKH 4ELKB 4QRRD 1FPTH 1IQWL 2W92A 4APQA 2DYPA 3CU7A 1D9KA 3O4LE 5JOFA 1MCRA 1JPSL 4IMLA 5KVEL 4IDLA 1U2CA 5BOZG 2DLGA 1TENA 4OLWL 3V2AR 4JKPH 4BM7A 3VDAA 3BDYL 2IH3B 3Q1SH 5E4EC 1EHLH 4L8BA 3RTQB 1A1MA 4OT1H 3KJ6H 1G7QB 1DP0A 5DQDH 4HKBA 3VFGH 2FBOJ 43CAB 3O2VL 5D6DC 3MJ9L 4ZPVB 4S1DC 5F9WB 4EUPG 4Y0GA 2FJHA 1EA9C 1DQLL 2G75A 3QUMA 1FVCA 4JPWH 2NY0C 3UX9B 4QOKA 5E8PA 1BGXH 2C1OA 2OS7A 3REWA 3MLUH 4NBYB 5I2IB 3MV7B 2XOTA 3P0GB 4PJHA 4YUEL 1NAML 4WW1A 5TFSL 2EE2A 2AERT 1Z6JT 1T2QH 1AHWB 3TVMB 2AK4B 1I7TA 1SY6L 4P3WA 4I2XA 5D5MB 3VWJD 5F96L 3LN9A 4NRXB 2APBA 2HMIC 1FFNA 1RFDL 2PYEB 3H9YA 2MMXA 3LV3B 5HVGB 3F7QA 1TJGL 1MFNA 3EJYC 3PUCA 4U31A 4OGAC 1H3PL 3CCHA 2A6JB 4U2YA 2WMPA 1D5XA 4KK8C 4F9LC 2BNRE 3O81A 3TNNA 5KS9B 2DKSA 3L1OH 5EN2B 5IMKB 3W0WA 3VJ6A 4PTUB 3G5ZA 3K4AA 3T0EE 4PGCB 1ZV5A 4MDJB 4E41A 1R3IH 2I25N 4OCRH 4S1SL 5I17B 3BPCA 4HDIA 3LQMA 1MCBA 4N0CC 1OQOA 1V8HA 1J0HA 2WBKA 2VXSH 4MXWL 3T2NH 1KTLB 4LOUD 4F58L 1MREL 2FJHB 5D2LA 4JFXB 4PRNB 1EAPB 5DVMA 3X3FH 1ZS8B 1Q0XL 3QFDB 4ACPA 4P4RA 3AFLA 1JNLH 3WN5C 1RJYB 3QDJE 3O4OC 2Q3ZA 3GHBH 4KKBC 1FVEB 4GLRI 3BFOA 3PWPE 5JIKA 1WBZB 5SWSA 3S36H 3C6LC 1S8DB 5DGQA 3QSKB 4DEPC 4WUUD 5H94A 4HUXB 3ARBA 3OTTA 2ZG2A 4P2QD 4OTXL 2CKBB 4JKKA 4D0CB 5DQJA 4P5MB 4HWBH 4ZNCD 3QG7H 4K23H 2HJLA 4GXVL 5FGCE 3CFIC 2G2RB 3TYFA 3GKZA 3T0BA 3VXPA 1NDGB 4KAQL 4KK6D 5HGGS 4X6DE 4LLYB 3MUZ1 2DLIA 3QDJB 2OR8A 4RNRB 1ZHKB 4UTBL 5ITFA 4U1SA 2CIKB 1LO0L 3BZ4A 4ZUUA 5SWZD 4JFFD 5I74B 1S5HB 4FFYL 1FG2A 2G60L 3Q6FA 2GY5A 4G5ZH 4PRBB 4BFEA 3VG0L 4WCYL 3UAJD 4MNQE 5KAQG 2IH1A 1IJ9A 1OTTC 1MCDA 4YDLC 3ULVL 2H6PA 2GJ6D 4FS0A 5GGUB 1T20A 2O61A 2NY1D 3QIBD 5TPWH 1AO7A 3OPZL 5IW6B 3FQRA 4KVNH 1CF8L 2Z31B 1K4DB 2J5LC 4O4YH 3MNWB 3PE9A 3BIKB 1BD2D 2AJYL 1IRAY 5F9AC 1NJ9B 4NNYA 4HZAA 2JB5L 2NYYD 3PABB 1NEZB 1PKOA 1FZOB 2JELL 3DUSB 3ARBB 1U8MA 4HWBA 1YPZE 2WV3A 4LSSH 2J8UA 3GMQB 3UTPD 4BFIA 4FQQA 2F54B 3I9GL 2IH3A 4O5LH 5ID1A 2VIRA 4CJ1A 3MO1A 4J3SA 1QBML 5DJYB 4ZSOB 1LO2L 4LCWA 3D39D 4QXTA 4UIMB 4M8QA 3MLYL 3QUKB 3ZYOA 2F19L 2WINB 1NFKA 3RX8A 3H9SD 5IMMB 1H5BB 1I1AA 1W72H 1G7IB 3P9LA 5JOPD 1S7WA 4PJ8B 4TSBH 3QDAA 2F54D 1RURL 4PJCB 1TJHL 3MA9L 3N9GH 5CZXC 5FCUH 5IW1A 1SYSA 4HGWB 4XPTL 2F8OA 4PD4J 4UOW1 3EHBC 5KS9F 4UB0L 4TTGA 5HJ3B 4U05A 4XC3L 4Y4KC 1XIWB 4MDIB 4KZEL 4GKZB 4M6MH 3K74B 2VXTL 3TJHD 2PO6C 1KELL 3FO0L 3IDGA 4JRYB 3JV6B 5L2JA 3EO9L 2R1WB 3S96B 4EBQL 5JPMA 1OGAE 2ZOKA 5HGHB 1F02I 4OZFG 3NMEA 1EEYB 3JV4A 4CVWA 1ZEAL 2YPVH 3X13B 4R97B 2FBJH 4OZIF 3QO1B 4LSQL 1MHEB 4GRLC 1YJDL 1AKJB 2YXFA 4OZHB 2MPAH 4WO4B 3U2SB 4GAFB 3THML 2ILLA 2RCSL 3G9AB 5IVXE 2HT4C 1PG7L 1ES0B 4JG0H 5I1AB 4WUKL 2HJFA 1S78D 5FDWB 1MFCH 2EIEA 4NJAH 3ZKXC 3FB8B 4JFFB 2P5WD 1DSFH 1CLZH 2XFXB 3AMKA 4TN9A 1NCAL 2D7QA 4XPAL 1QOKA 3VI3E 5KN5A 4QXTB 3P4OA 1I9JL 5JDJA 5D9SA 2XZAH 5DUPH 1PKQE 3DYPA 5E6YA 2D4FA 5DEGA 1TQCC 4JQIH 4JGJA 1F2XK 2VLKE 3FQUA 5IBLC 4P23A 1OP3H 2V2TA 4J3UA 3SOBL 4BSWB 3BEVA 5HYJE 1R5WB 1CICB 2NXYB 3ZKXB 5B38A 4PB9H 1CFTA 5A16A 4HULB 5JW4M 4CAGA 5KVMC 1YEEL 2RHEA 4XTRC 5GRJH 2Z92A 3BPLC 1U6AL 4P9HH 5FO9A 3V95A 4IDJL 5LGJA 2N4IA 2W9LA 3SKMB 3D69B 4Y2DB 4WIQA 5ABDE 4WO4D 3B9EA 1RK0B 5D71H 4WW2F 4UT7H 3TO4C 1NUGA 2ICES 4XNXL 4KKLC 1ZANL 1BF8A 1FFPB 5IK3A 4MAYA 5C0BA 1A9EB 4X6CE 2ITCA 4NZDA 4Y5YA 5ENWA 4XHJC 3FQWB 2YPKA 1PKQB 3TH3T 2X1XR 4N5EC 4PJ7E 1CR9L 1ZVSA 5FYLL 4QRTA 2KBGA 2FJGA 2IBGA 5LCVL 3UDWA 1KCUH 4MVBC 1VKXA 1J5OH 3QUYD 1RSFA 3RIAF 4NQCB 1AQKL 1OAUH 5JR1L 4HUWA 1P7HL 4JO4L 1EEQA 3RPIA 5JZ7D 1FPTL 2D9CA 1XH3B 3H8NA 5ADPH 4DVRH 1JPGA 3MCKA 1MIMH 1Q9WA 2H2SC 1T22B 3VXTB 4XMKH 5C0AB 4KPHH 1D6EA 3HC3L 1CE6B 2XTLA 3BMVA 3TH2T 4L9LC 4LSUL 1H3GA 2YC1A 4JPIB 4LGRB 4YHZL 3STLB 2P5EA 1S7UB 5GGTA 3U36B 4OGAD 1MLCA 3BPNB 1MJUL 1TVBB 3RUGF 3JTSB 3HC0A 2NX5D 4N9OB 2X1QA 4POUB 1FJ1B 4KDVA 2ICWB 3TCXA 4D3CL 1B3JA 4XP9L 4GAJH 1T7XA 3GKWL 1K85A 1T0MB 3TT1H 5KSAA 4OLUH 2Q3AA 3UTSB 1MRDH 4L9LB 4QT5B 3MACH 5TF1H 1CLOH 3ZKQD 3SDXF 4JY4A 2FB4H 1HQRA 4NC1E 2XICA 2VNCA 5C86A 4F2MB 5KSAC 4WI4A 1DL7H 4H5SB 4XNYH 4GKZA 4IM8A 5DD3L 2W38A 3SPVA 1Z3GL 3G6JF 5C0ND 3NIFE 5HPMB 1FORH 4ESKA 4WGWB 3PWLB 2NZ9C 4YX2H 5F3BB 5DA0B 3Q5OA 2AVGA 3UC0H 4NOBA 1YEIL 1T5WA 1TTFA 4BSJA 3HRPA 4XPBH 1TETL 3L5WA 2VUOA 3AY4A 1YEHH 1CXFA 4ZODA 2XWBA 5ESVB 4PV9B 3DX6B 4XX1E 2Q8AH 4WFHE 5E2TL 4RRPA 4RGNC 2RFXB 3ZE0F 3OR6A 1U58A 4IRJD 1MREH 4MQ7A 1H3WM 4LARH 3HE7D 3LN5A 2ATKB 1KJ2B 3IXAB 1FDLH 1G7IA 3C9NA 3P9LB 4F33A 5F1IB 2NY5L 2LU3A 1JVKA 5ESVA 2HJFB 4UNTA 3SCMD 5EU3B 3LHPH 1PVHA 4Z7UE 4Z7WB 4WENB 1N2RB 1UWXK 3OR6B 3JBG7 3K8LA 3IFLH 3SGDH 5HHXH 4JFPB 3G6JE 3RWJA 1JPFB 4M1GH 4X6BA 3GSWB 2PN5A 4QGYA 4C59B 2BHZA 3VXMA 4AENB 1XIWA 1VHPA 4DCQB 4ELKA 3RBGA 3PGCA 2BOBA 2ZPKH 5C6TL 1FAIH 3RWJB 1IMHC 3GGWB 3JWDC 4MAYC 4HJGB 1JGUL 1AKJA 4OZHA 1JYXA 1QKZL 2Y6SC 2Y7QA 5DHVA 3NCBB 3WNPA 2A2QT 4BH7B 2R1YA 2XRAH 1UFUA 4RFOH 4JJHA 5HYFA 2YWZA 4PV8B 4MJ6B 1NCTA 1QVOA 3IDJA 2CUIA 4S1DD 5IHZA 4U1IA 4ZTOH 1X6NA 1BD2B 3I6KA 1IVLA 4UTAL 2WBJB 3VI4E 4YPGA 4G5ZL 3NPZB 1JHTB 4HIEA 5C0DB 4EUPH 3NBNA 1Q9KB 4L4VE 1FFPA 2YPLE 5HVHB 2JCCB 1HHIA 2L0DA 5ECJE 3ARQA 4ZNEE 1A6AA 3CSGA 1CFSA 1UQSA 3FFDA 3A6BL 1MPAH 1J88A 4HKBB 3OKLB 2H8PB 2Z93B 1DANU 4BZ1L 3MBEA 4LCYB 4U1LA 2XV6B 2XKNA 1Q9LA 3HUJB 1NC4D 2F5BH 2W9DH 2X05A 4JJ5A 1NGXA 5DUMH 1FYTB 4JQVC 1BLNB 3V6OA 5DJCA 3WDIA 4QNPE 3S96A 2RJMA 5DT1L 1R3KA 5FYJU 3UJTL 5C0AA 4N1EA 3IJYA 4TVPD 1WCBB 4DUXA 2ITDB 3ZYJA 4D0BB 1DBMH 1FNFA 2PXYD 1L0YA 4O5LL 3QQ3A 2OLDA 3H0TB 5IFHH 3L5IA 4GQPH 4KRPB 1HQ4A 2NR6D 5IP4A 5FO7A 1WIUA 5C08D 4OM0H 4NP4L 5INCA 1XR9B 3LIZL 4AIOA 4PD4K 3UJIH 5B38G 4PFEA 2YR3A 3DETD 4YHPA 3ARTA 4CVXB 4MJ6A 1JGLH 3TC9A 1KIPA 3QYCA 3AAZA 5C07B 5ENWB 4MVBD 4BFGA 4XCYB 3MA7A 5F1NA 1KTLA 1S7UA 3EDFA 3EZ8A 3NH7L 2YSSA 4NM4H 5EZIH 4OKVB 5CEZL 2BC4B 3TBYA 2VN4A 3ULVE 4JVPA 2I26N 1BM3L 2PTTA 5GJTH 2XKUA 3QDME 5C8JA 5IKCA 4XXDB 2B2XH 2BSRB 3BWUC 3EYVA 2LABA 3VE0B 3BDYH 4KVCH 1FYTD 5F7DA 4TRPH 1P1ZA 3MRNB 3QUMH 1I1AC 5TDPA 5I1KL 4A6YL 4BQCA 2AI0L 2P5WE 1ZEAH 4Z8FL 5CCKL 5I1LB 3QZWB 5KBNC 4P46D 5IEKA 2E9JA 4M9PA 1CE6A 4Z5RA 4EVNB 4M4RA 4NM8L 2EDYA 1Y18A 1HKLL 1X7QB 5IVZA 1NMCB 1GYAA 3QIWB 3B8SA 1JPTL 4CDHA 5EU6B 4YFLI 5IJVA 3QJHB 3R8QA 1ZHNA 2JJSC 3MREA 1QD0A 2K7QA 1DSFL 4ONGL 5FGBA 1B4JH 3OAUL 4AEFA 5GRVL 4KTYA 5C0EB 3MLWH 4GRMB 5F9WC 1T2QL 2ITCB 3T3PF 3B2VL 5CWSB 4B0MM 1B2WL 5DD1H 4PGBA 3VXSD 1Y6KR 3S3SA 4L3CA 4P9ML 4J2XA 5ACMA 2EC9U 4OZGE 4QNPF 2F54E 3V7MA 3OJ2C 4M02A 3I02B 3KXFD 4GAYB 1U92B 4LIQE 4LVHB 5GGVH 3DRQB 3IJHB 5TE7H 1XGPA 2CR6A 2O5XL 3MNZA 4Y8DC 5T3ZH 2Q76B 5CUSL 1NL0L 4XP5L 5DSCA 1UJTA 3U48A 5HD8D 4H1LG 4PJ5A 5D7LB 1ZA6A 4GSDL 5H2BB 2D7TL 2EZ0D 3ILPA 5D71L 5I9QB 3T2NL 2A9MH 3LKNB 1DBJL 3OGCA 2AXFA 4IIQA 3REWB 4LNVA 4RFEA 1LEIA 4LLQA 5B8CB 2EH8H 1J12A 4XP6L 2CDFB 4AQ1B 1JGVH 4C83B 5BRZD 5EU7C 2VIRB 4P5KB 2ICWJ 1FAKT 1HWHB 5GGRY 25C8H 5IHBA 4JFHD 1HHJA 1HOCB 4P4KB 2WSKA 3QUKA 4GG8A 3FB7B 3S36L 3UJJH 4MQ7B 1IM9B 1HZHH 2R39A 4MNQD 4O9HH 2Q8BH 4F80A 3WN5A 3KJ4B 3IDNA 4XP4H 4OD2B 4A6YB 1W72B 5T1LA 2AJSL 2Q86B 4BH8A 1YQVH 1G9ML 4WGVB 4DGVH 5F6IB 4HMEA 2BCKB 3P9WB 2OP4L 2RGSA 3LSOA 1HHIB 4JO1L 1XF3B 2C3WA 5MEND 1V3JA 4BH8B 4XVUC 2VLJB 5KANG 3H7BB 1JF6A 5D5ME 1MFEH 3D6GA 4BK4A 1L6ZA 3LKSA 3ZL4H 1DDHA 3ZT5A 4GRWF 5J6GA 3DRTA 4P3DA 4C54A 3MV7E 2XIDA 3GZKA 1C1EL 3OGCB 5A43C 1KJVA 3PWUB 4PY7B 1EO5A 2DYPB 1UB6A 1I7RB 5FKAB 2EYSA 4YDJA 4NKMA 5E8EA 3RGVA 5CLTA 3V5DB 2X4RB 5GRUH 5EU6E 1HQ4B 2DRUA 1U8HB 2AXGB 4CBPA 5J1AB 3P11H 3SDXA 4N9GB 5JXEA 3AU1B 4O58H 3SQOH 4HUXA 1IKFH 1E6OH 5HY9A 4I18A 5HYEA 3ESUF 2JB5H 3O3EB 3ULUE 4FQIH 3BZDA 3DMMB 5T1LB 1CL7H 4JFEA 2BVUA 4JFPA 3WL9B 2BFVH 5BQ7A 2JB6A 3MYJA 4G6ML 3OR7B 5D7JA 1OGTB 4TQEL 1KCRH 1FORL 3MOQA 5AWNH 2KZWA 3OKLA 1A6ZB 3BXNA 4FZ8H 2KL6A 2PF6A 5IJKC 1FLTX 1T2XA 1TZHA 1W8OA 2VO5A 2FX8H 4UOJA 3PWNB 1JV5A 5D6DA 1LO4L 1X4YA 4NN6C 4QCIA 1ADQL 4U4BA 3G5XB 3SJVE 2EEAA 2XWJA 4GMSH 5ICXA 3MV8B 1IKNC 4R0LA 3NZHL 1RURH 1F2QA 3EYOB 1IQWH 5IQ7L 4U6XA 3N9GL 3VFPB 3L3DB 4NZUH 1KJVB 2XNAA 3OG4B 1KN2H 1D9KC 5T3XH 3OB0K 4L4TE 2DQCH 4PJ8C 2VLKD 1EHLL 3U46B 3KYOA 4KC3B 5D70L 4M7ZC 1M6OB 3TBWB 1GC1H 3U2SA 4Z7OE 3AMLA 5J13B 2APVA 1TDQA 1SBSH 4O02H 5DMGC 1CE1H 2HJLB 3B2UD 2CKBL 3TJEH 3IDUA 2MCPH 3KWWB 3NAAL 4Z76B 1HHKB 3VXRE 3MC0A 2VSDA 3UTQB 1ZHKA 1QRNE 2Y25A 2LU7A 4GAYA 1QFOA 4YK4B 5MERB 3L5XL 4DK3A 4ZQKA 3CLEH 2FATH 3K46A 5L8JB 4K9EC 1U8QB 3LD8C 1YMME 3UTTB 2Q76A 3CFBB 1KPRA 2L7JA 4HT1H 5E6ZA 3R0NA 4FTVB 3STZB 4R97C 5I76B 1WZ1L 4CMMB 2OYPA 3EO1A 2X4QA 3HE6C 3DPBA 4QCIB 2QQQA 3ARDD 3S6CA 3NFSH 4NBXB 3QCUH 5LGHH 5D93B 1RZGB 3D39A 4UAOC 1RUQH 3RZCA 4HZLB 4YK4C 4DKFL 1JYWA 1C5DB 4BYHA 1ZAGA 3BQUA 2XN9E 4QOKD 3L3DA 2MKWA 4J6RL 1Q0YH 5L7XL 5IB1B 5EOCJ 1YZZA 1KB5A 3MROA 4IS6A 4K3EH 1S9WB 5SV3A 4PB0L 1DQDL 1QQDB 3G08B 1A6PA 3TH4T 1MHCA 2OR7A 4AMKL 5JOPE 4F7TA 3V52L 3QIBA 4JPKL 1PSKH 5GIRB 1I7UA 1N7ML 2OXGA 1JNNH 3SCMC 4XNXH 4YAQA 3BRFA 1AXSB 5MERA 1KV3A 1BHGA 2N7BA 5TDPB 2SEBB 3CSYA 3LEYH 2VISA 3SKOB 4R4FH 2CO7B 2X9YA 4DN3L 1LK3H 1WK0A 1LDPL 1EEUA 1U8OA 1QLRB 3P4MB 2WIMA 1Q9OB 3MRJB 3UTZA 1YMMD 4U1GC 1ACYH 3LIZH 3SDAA 4CW1B 5I1JH 3VFMB 3BEWB 2CDFA 4GW5B 4F57H 3O2WL 4TSCL 3PWUA 4R6UA 3HMXH 4XH2B 1NLBH 1YN6B 3QG7L 2NY4C 2OMNA 5E8OA 3GM0A 3F58H 3U7WL 2JJTA 4ZS6C 1DLHA 2FECI 1B9ZA 4LCCA 4P3CH 5K9KA 4LDOB 4QHMB 2OJEB 3O6KL 1QBAA 5IMOB 4OGZA 3GMPB 3LN4B 1V05A 4WW2A 2BDNL 4KWUA 4XVTL 2OR9H 4XCFL 3LRSA 1N2RA 2HKFH 3CDGB 1FLRH 1S9VB 5HI5C 5T1KB 1XCTB 4Q9RH 4R7DA 1KXVC 1AGCB 4YHZH 4EDWL 3EGSA 4FOMA 3MJ6A 4PS4L 5HI5D 4CVZB 5BV7B 2NY7L 1S3KL 3AU1A 4HEPG 2O93L 3QXTA 4LHJB 1XR8A 4B7LA 3E6HB 3L7FB 3QB7C 2ZOLB 4HC1L 2NCMA 1I8KA 4P46B 1Q1JH 1HXYB 2F53A 3E1F1 1AFVL 1MWAL 3IT8D 5DD5L 3W39B 1NLDH 4HS6A 3F7PC 4DEPB 5D7SL 5HHPA 2Y6SD 5I16A 1TQBC 4PJ9C 4PRID 4N90D 1PY9A 1RUAL 3T3ME 1Z9LA 3EYQD 3FRUA 4TUOA 3QAZB 4D9QD 2R2HA 3BH9B 3CPLB 4HIXH 1P7QB 2AJYH 3TN0A 2WWMD 2CDGA 3M1BB 4ODUB 1A3RH 1I3VA 5GGSA 4DVBB 4OCLC 3G5VB 3OB0H 3HMXA 1I7RA 1MHEA 5KSUB 1MCHA 3QDJD 1A7OL 1VFOA 4G8FB 2NY5C 5I15L 1GH7A 3K2MC 1A3LL 5C6PB 4MD0A 1U9KA 4RA3A 1BFOB 2ICCA 5E56A 4P2QB 3O8XB 1F3RB 1GOGA 1EEZA 5D1ZB 3PNWA 3G6DH 1V7NH 1W72L 2IPTL 3QUZD 4LF3A 4OZ4A 3WIIH 1NBZB 5F7WC 4I77H 3N06B 4XX1G 1YA5A 1TJHH 2D7TH 1F4AA 2HVKA 1TCRA 1FJ1A 1XGTA 3GRWL 5ESQA 5L6YL 3O8XD 4P2RA 1CLYH 5GZND 1N6QL 4FQLL 3A67H 1I8KB 4LGPB 1T0MA 2EH8L 4P46A 5TQ0H 5DO2D 4KUZH 4KKLD 1GAFL 4XVUD 5IBTL 4HW6A 5EULV 4YGAB 4OV5A 1XF5A 3MV9D 1CFBA 1TXKA 2Z91A 1KEGL 3LPWA 3U1SL 2CLVA 3QUXC 1R3LB 5IVNA 1JWSB 5KOVC 5BW7C 3KPPB 4XMPH 4QHLA 3CX2A 3RWFA 3CMGA 2X10A 2VXQH 5I1LA 5DK0A 4OKDA 1VGEH 1WQVT 3BP7A 4UV7L 4KUCD 5EU4A 3QCVH 5C8JB 2F53D 5IKCB 1WV7T 1QFWI 4HWEL 3V5HA 3KPSD 4EKXA 3VXMD 1XAUA 1DUYB 4WEBH 4GBXB 4KDWA 1FZJB 5DVKA 3DIFA 3CFEA 4LMQE 1WC7B 3IRZA 2YD6A 4JN2B 4L1DA 4M1CC 1JI1A 2Z9TA 5TE6H 4Z7VF 5GJSH 4XBPA 2R0KH 2YRPA 2R0LH 1F11A 1FNAA 4KY1L 4AG4H 5DJ0A 3DO7A 3AB0C 1YEEH 3O6FC 3QWOB 4N8VA 5DTFB 3MFFA 1BFTA 2X4PB 3EOAA 3WJJC 2AV1B 3HI6H 3CVHA 1IGCL 3GMMB 1D6EB 4K3HA 3X12B 1CLCA 2EO9A 3IETB 2IG2L 5EOCL 1FNSL 1MHHB 1X5FA 4K94H 4N0YL 4YO0B 3KPSA 2I07A 3CFDA 1KB5B 2P7TB 3V6FA 4DGYH 3EIFA 5IBLD 3VWKC 3OKNB 2FL5B 1EBPA 5C0RH 5F7EL 2DLTA 4WW2B 2P8MB 1OGAB 1N3NB 4PJBE 4RDQG 1I8MA 4O2FA 4XBGA 3KPNB 2PTUA 2FO4A 1ERNA 4YDKH 4XAWL 5K9KB 1QSEB 4PLNC 1MJ7H 5KW9H 4AIZA 5H35B 2BNQD 1CFNA 3OKDA 2PO6B 4PV8A 2W0PA 4G43B 4WFEE 5E1HB 3QXUA 3MLRH 1WC7A 1CDGA 4Z77A 3I3EA 5I76A 1NGWB 5EUKB 4M7ZB 1G9NC 3K4ZA 4ZD3H 1OLZA 3VFWB 5IQ7H 1J8HE 2P4AB 3PQYE 5HYSB 3MRLB 4H1LA 1AXTH 4GAGL 4NZRL 4Q58C 5ISZB 4Y2DC 2R4RL 3SGJA 5IF0A 1GC1C 1UB6B 1NCCH 3WXWH 5FK9B 1WBYA 2X4TB 4NRYA 5HVFB 1P53A 4JFQB 4YBQC 5GGVY 4U6VL 3BPOC 4X4YB 3LDBC 1J0IA 5ADOL 3PWVA 4FFZH 3AREB 4ODBD 3TJEL 5CSBA 1CWVA 1OCWL 2QHLA 1YNLH 5GGSB 1S7SA 1FYHB 1BZ7A 1YUHB 4PR5A 1FNEB 5EFIA 4G3YH 2FSEA 1UG9A 1U3ZA 1MCLA 4Z78B 1EO7A 2DQGL 1I9EA 3MR9A 3L3OA 3D0LA 5JW4Q 3Q48A 4HPYL 4ZDHB 3FB6B 3P4OB 4OLUL 4S0TD 3BRGC 2ENSA 1JHTA 4HIEB 5CWSA 1IGJB 3D87B 3GSRA 5KVDL 3CU1A 5BO1H 2B39A 4HIHB 3C6LD 1AI1L 2ZOLA 1RJLB 4G9DB 2RIKA 3FB8A 4TVPE 4RX4A 3E6HA 2EDEA 4JM4L 3D0LB 3WJLC 1KBGH 3MODL 5E70A 2BOCB 3D25A 1WIOA 3GSRB 3RWCA 5A3IC 1JZ7A 4ODVH 4G6KL 3RNKB 2IBZY 2C26A 4LSPL 3TIEB 1S7VB 2C4FT 3WL9A 3FN3A 1RU9L 3O6FA 3BPNC 5F97E 1RZKC 3REVB 3JV5A 2W60A 2ZUWA 3WKNA 3QDGD 2YPLD 3LEVH 4HUVA 1DQDH 5DFVC 2O5YL 4MDIA 4J12A 3D3VD 4S1QL 3D3VE 3OKOA 1BMGA 5J1AA 4DAGL 5JW5A 3AREA 3NCEB 1MOEA 5C1MB 3RDTC 1XH3A 2V5MA 2VB5A 1A6TA 3QPXH 3O8XA 4P2RD 5DRXB 4HWZB 3OKEA 3X13A 4HPOH 4PJ7F 1NCWH 5F7YC 4HFWB 4Y1AD 1Y0LA 5DEZA 4ZAKC 4XPGH 1G6RB 2FJGB 4IOFC 1BBJA 5D7JD 4MJID 2XNAB 2X4NB 4UV4L 5TQ2H 4F15C 3PWJB 4OV6F 2OSLA 3BZEB 2VSCA 5FAAA 3ET9F 3E2HB 4TSAH 4WI6A 3ARZA 4WV1A 3VFRB 1YYML 1JHLL 1MLBA 3JTTA 5HHOE 2Q8BL 2VKXA 4O9HL 3G04B 1S5HA 1HH6A 4BQBA 5BW7A 1I3RB 3O6LH 4XPFL 1IGTB 3PDDA 5EO9B 4LP4A 2FX9H 2AKRB 5E1AB 2C7UB 1BQHB 3AUVA 1AR2A 1TVHA 4OCWL 2R23A 1HHGA 2KUTA 4Y4HD 5F8RC 1KCSH 2A1WH 3IETA 1FVEA 3U0TB 2NW2A 4X6EB 5C0CD 2LFGA 4DW2L 5E8NA 3SGEH 3M07A 4JG1L 4P46C 3MFFB 4CL7A 2ID5A 3ZDXE 2P8LA 5KSBF 5A40E 5JNYB 3BP6B 3SDDB 3F7YB 3P2TA 1RAMA 4ZTOL 5B3JE 3VD4A 1L0QA 4U1KA 5BV7H 3TCLA 4Y4HB 1SMOA 1Y6MR 1M7DA 5KSAB 3EO0B 1EERB 4AQOA 3GBNL 3GIZL 3VMOA 1DUYA 3WUWA 3DSFH 3O9WC 1KULA 4BZ1H 1W2KT 3SGKC 1U8OB 2YK1L 3K7UA 4A2LA 5K9OA 4PJAA 4CUCA 1EXUA 1FL5A 3MV8E 3NABH 4AIZB 1FNHA 1IKFL 1E6OL 5F9OL 1WVZA 3B9VA 2VAAA 3EOYG 2BNQE 4M1DL 5FUCE 1MRFH 3KR3H 1A5FH 1FNGB 5DRZA 4GRWB 1OOAA 4MZ3A 1R3LA 1VADA 5CJ5A 1NFIB 2H1PL 2E7LC 3WSQL 3MJGX 4WEUD 1CDCA 4FZ8L 3RI5F 3A0OA 3PDGA 1FO0L 1JK8B 2EIBA 1JZ5A 4KMTL 3IXTB 5CIPB 2QQNH 3FO9B 5CP7A 3MGTB 5E6IB 3MX0A 1EO8L 2IQ9H 1T20B 4Y88A 5B38B 3QEUB 4XVSH 1V7ML 3DROA 4XZUB 3HC4L 1M05B 1T7WA 4Q0XH 4JREB 3C5SA 3MGOB 4K7PX 4XB7A 4F33B 1UCBL 4HXAL 3GRWH 4G6JH 4FFVD 5J11B 2B4CC 1JMZA 2BVEA 5A1AA 2EC9T 5I1AA 2AEIT 4MCZB 1ZGLM 2HRPL 2E8YA 2CDEA 4E42A 4JN2A 4KQ4H 3H7LA 2VWEE 4LSDA 2DL9A 5KVFH 3INUL 2R15A 4RGMB 4ZSOA 1IFHL 1H8NA 3E3QE 2CRMA 3O3BB 3UMTA 1WWBX 2WW8A 4IRSA 4OB5H 4Y5VC 3K2UL 5BMFH 5KN5B 1A7RH 4XBEH 4PJ5B 2DTML 4RMUA 4PRPB 1MJJB 3PL6C 4X4XA 5IB5A 2RR3A 5IWLA 1E6JH 5D2NB 4KK9D 3FHQA 2VXQL 3N0PB 3D85A 1OSPH 3STZA 2IMNA 1N0XL 3SDAC 4M6OL 1VGEL 4O2EA 5A3ID 5I1CH 3EYUH 3BAEL 2R29H 1R24B 5EZLA 5T3XE 2MFNA 1MFBH 1FVDB 4BJLA 1WZ1H 1BFOA 4UQ3A 1X9QA 1T80A 1ZSDA 5FUZL 2ZG3A 3DGGA 4MD5A 1P9MA 1G0DA 4P59H 4K94C 3QCUL 2XXCB 1BQSA 3HAEG 4JPVL 3PL6B 2BJML 1G1YA 4R2GB 1UXWA 5SX5H 1H3UA 1WFUA 3AROA 2DI9A 1I1RA 1TVDA 5CIPH 5F21B 3IAQA 2MHAA 1XZ0A 4BK5A 4GH7B 5AYUL 5FHBL 1A9BA 3GMOB 3QEQE 2YS4A 5MHSE 3HB3D 3F7RA 1IZKA 2KH2B 2GUOA 4N8VG 3VRJA 5KVGH 1NGXB 2GQHA 2W9EL 4N5UA 5FO8B 2CSPA 3T0VA 3GB7A 4AMKH 1NUFA 2X7LB 3BQUC 3QNYA 5BQ7B 1HK6A 5EN2A 4MGXA 1E27B 1QRNB 2IMMA 2RB8A 2Z93A 3RZCC 4E41D 2XQBL 3ULUH 4YQXL 4QRRA 2GUOB 1C5CH 5L0QC 3N85H 3IFPA 4XP6H 5EPMA 3DUUB 3QNXA 1T3FA 5HYJB 2ERJB 5K59F 1L7IL 3VFMA 2BVQB 1DTUA 2EKSA 4MA3A 1YMHA 4UIKL 4KV5F 4PJXA 2CUMA 2GI7A 5GS1A 4ELME 4C56D 3LY6A 3AAZB 1JBJA 1R5IB 4JLRB 2FWOA 3HPJA 2R1YB 4LLYA 3MRRB 3L3JA 4PRIE 4LLVA 4M48L 3KDMA 4HWZA 4Y5YB 3ALPA 4Z7QE 5AZEL 4NJ9H 1JGDB 2P8PB 5INDB 1VEPA 5DVOA 5CS7A 5HI3D 2R4RH 2AEPL 4G8GE 2EIZB 2WAHA 1SBBA 1JZ4A 5E5UB 1GCFA 1AGCA 3G5ZB 1GIGL 1PW3A 3TJHC 1CDUA 2CJUL 3FB5A 1E4XH 2XYCA 2FIKB 1FSKC 2DIBA 1UC6A 2E3VA 2G2RA 4BSVB 5GIRA 4M5ZH 5T5FH 3ZL4L 1T7VA 4LKXB 4OFYA 3QUXD 4ISVA 3HAEB 3W2DL 4U1NB 1A47A 1NFDE 1ITBB 4NGHH 1WZMA 1DJSA 4Z7WA 3E6FB 4NQVB 1N8ZA 4PJFF 3OXSB 4OFPA 4NQDD 4UOW0 3H9SE 1XF2A 3T04D 1A02N 1J9CT 2DQIH 5I6XC 2IC2A 4LSTH 2E6JA 1BP3B 4L9DA 5IJKA 1EHNA 1DLFH 3WFHA 3MCKB 5FYKD 1HYSD 4X7DC 3SE3C 5M7QA 1RHHA 1MFAL 2R2BB 3MLXH 3VGEA 3WO3B 1OPGH 2MQ3A 3RWHA 2PW1B 2Z31C 2D7OA 1FSKB 1Q94A 4Z7NE 1HINL 5BRZE 4OCXL 3E3QC 4PLKC 2JCCF 2CR3A 3IDXH 4JLRA 4CU8A 4G6AC 4GS7B 1Y6NR 5IGXH 3NN8B 1RHHB 1QR4A 1MAMH 5CKAA 1QSFE 5I74C 4FXKB 4G7YL 3IDIA 5I0DA 5JXEC 4KQ3L 2OZ4L 1C16A 4NSKA 4JZJA 3QPQD 4JY6B 2V2WA 2D9QB 2AK1L 4YNYB 4IMKC 2D7MA 3ZLQC 1P84K 5ID0B 1K8IB 4QXGL 4D9QE 4NYLA 3KLHC 3GEWB 3TA3C 1S78C 1CN4A 4NRZB 3BD3A 4JVWA 2IJ0C 4Y1AA 3RJQB 3VW3L 1QFHA 4KV5E 1VADB 1EJOH 4R26H 3U6RA 2OJZH 4PJDA 4LSRL 3VE0A 5DRZB 2DWEA 4HIIA 3WFCH 3F7VA 3MLVH 3SBWC 3D85D 3QNZB 4H26B 4H25B 5L6YH 3H42L 5IQ9A 3U0PA 3LH2L 4ERSH 1CLYL 1N6QH 3KPLB 2VXVL 4TTDC 5I1EH 3DI3B 5KTEH 4QOKE 4YR6B 3LQAH 3X11A 3MCLL 1DVFD 3GBLA 4FFWD 3DROB 3BKCL 3WE6A 1ZLWK 5GGSY 1GL4B 3FQXA 4F7CB 1ZHNB 1CE1L 4PJIE 2CKBH 3CVIH 3KPRB 1CZ8H 2CGRH 3LPFA 5DUBA 3U1SH 2YZ1A 1A6WL 4ODXA 4PJHE 4OLYL 3ZE2F 4HSQA 3LMJL 3MUJA 4KKAC 4IIQB 1ZWIB 5L8LB 1NGPH 4DOHB 2VZUA 2BNUB 4RGOL 3CXHK 5DO2C 3N1FC 5C7XH 1KIRA 1I9IL 4ONHA 5LJYH 2OTWA 1XF3A 2COQA 4LKCB 2ZCHL 4PR5B 2NR6C 1XCTA 3JVGA 3VCLB 2NY6B 5FIEA 4QHUA 4Z7UF 43CAA 5E2WH 2NXZC 2OTPA 2ZCKH 5HI3C 2JCCA 4Q6IB 1CDYA 3UPRA 3HZKA 4KJPC 4GT7A 5J57B 3MV9B 3W0WE 3U0WH 5DS8A 4IIQC 4OD2A 3WLBA 4A6YA 3BMWA 3G6JB 4L4TD 1U8NB 4WW1B 5DR5L 4JHWH 1XF4B 3ARGB 1S9XB 3KPRE 1TLKA 4RCAA 1FE8L 2EKSB 5SX4H 4LMQI 3GBNH 2VDLL 3DV4A 3QQ3B 1IC4H 1TITA 3VXUA 3M1BA 1JNHA 2CDGB 2DN7A 2P47B 1F4WH 3HI6L 3UAJC 4HJGA 5GHWL 4FQPA 4Z0BL 5D8JH 4WFGE 2HKHH 2OBGA 4NO0B 1YMMB 3UTTE 1YY8B 2Z8WC 1JMXA 5F9OH 3PWPA 4PJGE 1RUML 5IT2H 4X7SH 1H0DB 3PL6D 1IL1B 4RAVA 5DJ8B 2GW5A 1FZMA 4FA8A 2DLHA 4TNVK 5HHNB 4W4OA 1I8LC 2C7UA 3BOVA 1TZHB 4JDTL 5CZVL 2N56A 3FB5B 1QLFB 4X7EC 4IMLB 1BF2A 3NCYP 3QDMB 1CICC 1Q9KA 3KXFA 4PP2B 1SQ2N 3I3BA 1QFUL 4X4ZA 3F8UB 3ZYZA 2UY7A 3FFCB 2GIYA 1D6VL 3ULUD 4FABH 2JB6B 1NANH 1DCLA 1BLNA 4X6DA 2HFGH 1S7XB 4M3JA 3UZEA 3RNKA 2XKNB 2W0KA 4UINH 5KSAD 1MLBB 5J9PB 1SJEB 1R5VA 2C4FU 3QEGH 4NZTL 4XMLH 3WUZA 3QZWG 1RI8A 1R5IA 5D7LA 3NA4A 2Y1VA 1IM3B 3QFJD 3DRTB 4I9WD 32C2A 1YECH 3EFFA 3MREB 3EO0A 5J3HD 2QQLH 4Z7OF 1NEZG 1YMHB 1A4JA 2FHBA 4XVTH 1U8JA 3KDMB 3Q1SL 1E4JA 3H0TA 2HKFL 4I3SH 5HVWA 3L95A 1IGYB 1QYGL 1KENL 1TPXC 2DICA 2NY7H 4KHXL 1UGNA 4EJ1C 1DEEB 5LGKA 4RBPH 4LRNL 5E4IA 2W65B 5CJXA 5L88L 4TPRH 3VFSB 1IBGH 1T4KB 1KXQE 3TYFB 5T3ZE 4HLJA 12E8L 2BXYA 3SJVD 5J3HC 1U92A 1TVHB 2J8UE 3I75B 1A4KB 3BD5A 3MNZB 1RUAH 4ZFOB 4UU9B 1MFBL 1LNUB 3EOBB 2B5IC 3CZFA 2R0ZL 3EDDA 4XVJL 2VLRA 3HKFA 4G9FE 1MCNA 4ZFGH 4LCWE 3GI9L 3D0VA 4JN1H 1JF5A 4JM4H 5KZCD 4PJAB 1AKJD 1BPVA 3V6OC 1X7QA 1L7TH 1A7OH 1S7VA 5IIEB 2CIIB 5DQDL 1IC7H 3VFGL 1JWMA 2XWJB 5ICXB 1MQKH 4OCSH 3ES6A 4NWTH 5BZWB 1UKQA 4K3JL 2N7AA 3RZCB 1G7MA 3W9EA 1DQLH 3F6IA 2VQUA 3AXLA 1TCMA 4GW4A 4YO0A 3ESVF 5HHMD 2IPTH 1A6TB 3MNWA 4S1QH 5TE4L 5DJZB 1JK8A 4WTZG 3O2DH 4OBRA 1OGAA 4TVSa 3UZVB 3ZT7A 5T1MA 5TFSH 3QXVA 2VXSL 4XXCC 1C5CL 4Y16C 2AS5M 3MBED 1EUUA 5E00B 5F7KC 4KK5D 1NCWL 4YC2B 3VGDA 3V4UH 3TBSA 4NWUH 1NGQL 1L7IH 3VXSE 1MY7A 1RUKH 4M7LL 5EU3A 4H8WC 3UTSA 5MENE 4ALAH 3EOAB 2Y72A 5JUEH 1A2YA 3IS0X 2H3NB 5EO1B 3SKJL 1I7TB 3S3PA 3LVEA 2QEJA 5MEPB 2CK2A 3OF6A 4XPFH 1ORSA 5HDOA 4C56B 2DDQL 5SWQA 4U6TA 4RFNB 4P3DB 1T66D 3J7HA 4EOWL 1N26A 3BUYA 4MMZC 4X5LA 3VXOB 3QQ4B 4GXVH 2A6DA 3UYRL 1IAIH 5E8NB 1N4XL 4UQ2A 4Q6YA 4GQ9L 2EXYD 1FL6A 1MCEA 3MUGB 4HKXA 5F3BA 1WF5A 2FSEB 2NY3B 3TPUB 2J8UB 3GMQA 2NX5B 3IF1B 1AE6L 5JW5B 1K3IA 4QRUA 4M62H 4CMHB 5D1XA 3QRGL 3QAZC 4U6HA 4ZYKB 4M5ZL 1FN4B 2EXWC 4KKAD 2BNUA 4LSVH 4R90L 5TE6L 3GHBL 4YDVA 4X5WB 4H0HB 4OBSA 5D9SB 1N64L 2X70B 4KJQD 2DLFH 2YN3A 4F7EB 3ULVD 1EAJA 3IVKB 5HDBF 5GISL 1FL5B 2XG5A 3PG2A 5C0BE 3QHZL 5A2IH 4U7KA 2CXGA 5EA0H 5MEOB 3MRPA 4OF7A 5MEQA 4P23D 3T65B 4F7PA 4HC1A 3T2PA 5HGDA 4D0DA 4KJYB 4MAUL 3DO3A 1A2YB 3C08L 4LASH 3QIUA 5DJDB 3O3AA 3CUPB 5FECA 5FO7B 3PGDB 1C7SA 4P57A 1LP9E 1LO0H 1ORSB 2GTZB 4C56A 4YHKH 2PXYB 1T1YB 4HJJH 2BMKA 2BRRL 3DUHA 2VLLA 3O9WB 2NZIA 4HUMB 4NQEB 1OM3H 5J0BA 3DMMD 5D7IA 2WBJC 4X7FC 3S7GA 5B39A 4S1RH 1YPZB 4G8FA 5DHVB 4WCYH 1H8OA 4RMSA 4MXVE 3C5ZA 3WCYA 4NQDB 5JTWA 4QHLB 5JPMB 1V7MH 1ZXQA 1FGVL 4N0UA 1OAZH 3RL2A 3MRDB 3KPRD 2ZUQB 3AB0B 3OPZH 1S9YB 2GEEA 5HYQB 3MROB 2HH0H 4LL9A 5BJTB 4OD1L 2EO1A 1FRGH 2ARJB 5TDOB 4M9OA 5JQ6H 3LH2H 4L9LA 1P4LB 5EIIA 4UB0H 2DQDH 3WBDA 4LSSL 3MCLH 4PRDA 1IGTA 3T65A 4OF8A 3O11A 4LLAA 3KYNA 1A6ZA 3BXNB 5J6HB 3S4SA 5EU5B 5J9PA 5MENB 3NCJH 3CVIL 2ARWA 3V6BR 3RAJL 4ORGB 5BS0E 4JM2F 4DFIA 4OLYH 2ADIA 1OCWH 4Z9KB 2F19H 2XTJC 1NBVL 1EVTC 3GMRB 5FYJH 4Q9CA 1NDMB 3MRHB 3BGFC 1I7ZB 1KNOA 3UDWC 5L2KB 3QA3A 4O00A 4HJ0C 3EDEA 4M4PA 3EYUL 1AHWC 4YHNA 2QSQA 1JPST 3HUJE 3PJSB 4ONFL 1CXKA 2BSSB 4TULH 4NQTA 2DB8A 3KWWA 1WZLA 4XC3H 1MHHA 5E99H 3JWOL 2HWZH 3C5ZB 3KPPA 1KBGL 1CS6A 2VLKB 5HYIA 4DOHE 3NZ8A 4XCYA 5DHVH 3ZHDA 3M8OL 4PJFA 4Y16A 5DRNB 1T04A 3DLQR 4JRYD 3RVXC 4B53A 3LQAC 2E8ZA 4WY7L 1OQXA 2HRLA 5GS0L 3K8MA 3DIFB 1HWGB 4HUKB 1NCAH 2HAZA 4P5TA 1OSZB 4P23C 2NYYC 3GSUA 2C5DC 1IT9L 3MLTB 4X7CC 1H5BA 1I1AB 3O3DA 3QXWA 5BVJB 3HI1B 2DQEL 4PJBF 2Q7YA 3C5JB 1Y18B 2Z8VC 1DBBH 2YC1B 4CJ0A 1KB5L 1QSEA 1SEQL 4O2CA 3O4OB 4QTHA 5E8OB 1BJ8A 3KPSB 3DGCR 5T1LD 5HI4C 4UV4H 4K8RD 1P7QD 5CLWA 2EE9A 4WI9A 2IQAB 2FL5A 1ZT7B 3VI3F 1GZQA 3DUSA 3ARBD 1I3GL 5DRWB 2VDOL 3IF1A 1N6UA 2DQJL 4RMQA 1U6AH 2DAVA 3MRLA 4P9HL 1OAUL 5JR1H 2GT9B 4PJCE 4EN3A 4GRLA 5FYLD 4YZFE 4GBXA 3TBSB 4CADB 4DVRL 4RNRA 4U1JA 1O7SA 1RZFH 4UT7L 1AGDA 1EV2E 1MIML 2GJZB 4L4JA 3HB3C 5EBLA 4X99A 2PO6A 3P0YH 3CVHH 5HYSA 1TCRB 1OAXL 4JG1H 4Y4KA 1GIGH 5LXGL 1JP5A 4P2YA 1OW0C 3D85B 1MAJA 3RY6A 2CLZB 4E5XA 2BOBB 3OKMA 5IVOA 1LHZA 1YNKL 5GS0C 1D5ZA 3FO1B 2VDQL 5DDHB 4DCQA 2V5RA 3FOLA 4NPYB 3RWGA 4P2QE 1M7XA 4KKBD 1OTSD 5CBEA 5ACZB 1MHPL 5JPNB 2IANA 3LN4A 4Y16D 4RAVB 1PLGH 3Q6GH 5JW3H 2DM4A 3L3IA 3MUGA 3TESA 4QTHB 2CRYA 3AGVA 3GKWH 5DI8A 1PEZA 2C3VB 3F6LA 4MNQB 4PJEA 5TF1L 4OZFA 1W0WB 3FB7A 4G80A 4GG8B 4QRTB 4XI5C 3GMOA 4XMKL 1HINH 2EDJA 4QF1B 3HC3H 1CL7I 3EYSH 1VEMA 4ZS6D 4JFZL 2MHAB 3IDXL 4ONHB 1HCFX 4HH9A 3GUTA 1YNTB 5FCSH 2AJZB 1I8LA 5CSGA 1RJCA 3WS3A 3IB4A 3GBMH 4LF3B 4ODTL 2BRQA 4G9DA 3RVWD 4LP5A 5CSZB 4U1MA 5L2KD 3GMNB 3CC5A 3NTCH 5IFAH 3WSQH 3WS6A 3EJZC 5E7BA 5D1QB 3R1GL 2QADC 1T1WB 4AZ8A 2QQNL 3OAZH 5D7LD 1U3HA 1UM5L 4FG6C 1M71A 3QDMA 3W11C 1KFAL 5LAXA 5DRXA 2BNRD 4LSRH 3GSQA 2EDXA 4Q0XL 3IGAA 2NX5E 2R0WL 2P5WA 3HNTH 4X4YA 1JF1B 5B39B 1DEEA 3ZMRA 1JWSA 3OKOB 2FB4L 2EYRA 2Y5EA 3CDYA 5FHAH 5FKAA 3MRRA 5JORA 1A6UH 1SJXA 4RFNC 5DK0B 1MIEL 5T5NG 3LQAL 1KN4H 3BP5B 1CXEA 1VENA 3MSPA 3B2UC 2WM0A 1RV6X 2DI8A 4ALAL 5C0GB 1I75A 1VFBB 5JW4N 5BMFL 4HK0B 4OB5L 1NCBH 3NIGE 1K5NB 3MRGB 3ETBF 1KIQB 2VE6B 4U1KB 5JMOC 3UC0L 5IEHA 3ARBC 3D0VB 3MRPB 1E4WH 3TVMD 4JFFA 5L8KB 3RNQA 2X4QB 2ZCLL 4KROD 5DEFB 5F7HA 1QLFA 2WWKT 3C6LA 4LPXA 4MWFB 4RSVA 3QO0A 1WLHA 3MA9H 5FCUL 1CVSC 1IAIL 1EHXA 2EH7H 2FIRT 1OGTA 5D7JB 4U33A 1VFAA 3MRKA 5FM5O 5EOTB 3T0AA 3T0EA 3S37L 3EYFB 3IDMB 4M6ML 1DN0A 4E41E 3QO0B 1LNUA 4FHBD 3MLZL 4CU7A 1BOGA 3WNLA 3QRGH 4M5YL 2BJMH 5JMRA 3VA6A 1YEDB 4M1GL 4PJ5E 5ERWA 4IBLT 4X5XB 3X3GL 4H5SA 1U8JB 4NCC2 3VA2C 3SBWA 1U36A 7FABH 3TO2B 4X9BA 1N5YL 1NAMB 4WHDA 1EXUB 4FG6D 2AABH 4JB9H 2VQTA 4BUHA 2QR0B 1UM4H 3DVGA 2H9GA 3QDJA 2FJFA 3QUYB 3PHOA 2BVYA 1UZ8B 4P5TD 5D72H 3WD5L 4XPAH 3PGFL 5SWSE 1AO7D 4QWWD 4UBDC 2BY1A 1RVFH 2UYLB 4K8RC 5L9DH 8FABB 1NMBH 1F58H 2NNAA 1C5BH 2Y06H 5DFVD 5J8OA 3DRQA 3IJHA 4FFWC 2ZNXA 4RMVA 5EU7E 3TT3H 1ZT4B 2AAVA 2MWCA 4BZYA 3BI9X 5EB9A 5B3JF 5DVLA 3UPRB 4PRHA 4LNRB 2CMRL 1KNOB 1FP5A 2ED9A 3L3KB 1AXSA 4PLOB 4PGEB 5GRJL 1NGZB 4HFUH 4BQ9A 4LHUA 2P7TA 2VABB 3V6FB 1OAKH 2GJ6B 4K7PH 5ETUB 2HTLC 2XT1B 4XH2A 4OLVL 5JQHC 3K8KA 4X8XA 2WP3T 3MV7A 5TGBB 4LCCB 4MNQA 1F4YH 2A6DB 1FZKA 1ED3A 3DVGB 1A1OA 1FBIH 5SV4A 1E4XL 4DTGL 3S5LG 2AP2A 4Q7DA 1KJ2H 4NKQB 4HFWA 5BV7C 4PY8J 4OZFB 4APQC 5DJ6A 1T03L 5CCKH 5E2JA 4M7JL 3FFCE 3WHE0 2ZUVA 4JHBA 2VDRH 4JO3H 2VZOA 1ONQB 1Q72L 2PYFA 3MRCA 3U0PB 2VISB 3T2OA 3ZKSD 4DUWA 2QBWA 3MOAL 1IC5H 1B4JL 1ZHLA 3I02A 3CC5B 2E9BA 4XRCA 1KJMA 3MLWL 2C3GA 3FRPG 1JTTA 2C3XA 5BZDB 1QLEH 2J12B 1B6DA 2HWZL 3WO4B 5CJOH 1IGFH 4HCRH 4XPHL 3B2VH 4JN1L 4UDUA 1T21A 1CD8A 2R2EA 4PBXA 4HCRA 2C1OB 3WFDH 1JUFB 5H8DA 3KPOB 3IFOB 5FOJA 4NRXA 4YBQD 1XMWA 3CAFA 5J56B 4PRIB 2HT4D 1BD2E 4OCSL 5CD3B 1KEML 4QHNA 5DK2A 2AK1H 5DJXA 1WCBA 1OT1A 3F62A 3GIVB 3ALWA 2HG5A 4FQHA 2O5XH 3HR5B 5D2LF 4HQQL 5CUSH 3N50A 4GAJL 3GI8H 1TQBB 4NQXA 1EJOL 4KKNA 4OM1L 1CD0A 2HLFC 4MXQC 5H37G 3OKKA 2A9ML 5EPMB 1G7QA 4D9RE 1MI5A 3Q3GB 2JF1A 3VXNB 3PWNA 1KYOJ 4KHTL 1CFSB 1UQSB 3FFDB 4DKAA 5K59E 5IVXA 3O41A 1P6AB 2GAZB 2IPKA 5JXED 4WHTB 1E27A 1QRNA 1QA9A 1DL7L 5KTEL 1NKRA 2YRLA 2V7HB 3ALXA 3S5LB 3UBXA 4K71B 1UT9A 5DJAA 5EIQA 3T1FA 2IAND 5D1XD 1JFQL 3LMJH 4GXUN 3U7YH 1RIHL 4XP5H 5EWIL 1VCAA 3KYOB 2OZ4A 3K4DA 2VLKA 3ARWA 1W0VA 2E7HA 5HGBA 4GSDH 3EFDL 5INCB 3PL6A 1KPVB 4GQ9H 4DGIL 2E9WA 4Y4HA 3RGHA 4TVPH 1RIUH 3PHOB 4XZUA 1FDLL 3OHXB 3FZUC 5JLZA 3SO5A 1UH2A 2ZCKL 4CVXA 3RWIB 4YHPB 5C70A 1XEDA 1UXSB 3HRZA 2NW3A 3Q5YA 1JGVL 2FEDD 4MNGA 2XPGA 4HK3N 1HHHA 4YAQB 3U0WL 2Y4SA 4M62L 1FIEA 25C8L 5LVEA 1MF2H 2UZYB 1YNKH 4IRJB 3BESR 2FIKA 3EBAA 4GS7C 2V9TA 4OFIA 3O3EA 4QRPE 3EYVB 1I3RA 4I0KA 3MXVL 5D1ZD 1GHFL 1JPGB 4JDZB 1MI5D 4GKOA 3ARUA 3O11B 5GISH 4QRRB 1DN0B 4L4TB 1G9MH 2BVTA 4DGVL 3QHZH 4OI9A 4JJ5B 1Z5LB 4PJ7A 5HDQH 1KB9J 3D9AL 5EOTA 1JRHL 2FGZA 3DVFA 4MNHB 1JGUH 4HJ0D 1INQA 2OP4H 1QKZH 3B9KC 4FMFA 2EDHA 4LASL 1F11B 4NNPL 5GGTL 1RZGA 3D39B 3PQYB 5CEYA 1IM9A 1ZHBB 5IT2L 5HHVH 3RIFK 4HLZH 3F65A 3TO2A 1JTPA 5C0GA 5KAQF 4I48B 1FL3A 5C6WH 2OQJB 3WIFB 5HGBB 3DX6A 4PP1D 4JDTH 5CZVH 5GSVA 3ROLA 5IFAL 3SE4A 1HYRC 2DKUA 5AAMA 4JO2L 3V5HB 1YC8A 1HEZA 1AC0A 3NZ8B 4L3CB 2HN7A 2X44D 3O3BA 4KDTC 1AD9A 1LEGA 3OL2A 4TNWF 4JFYA 2VLRD 1UACH 3H3PL 3W9DB 3FT4B 4WWID 3IAPA 3IDNB 2YA0A 4FQIL 4HIJA 5FA4A 4OLXH 3ZTNL 3HCVB 4GG6A 5C0IB 3ZKND 5EU5A 3BX7C 3W9EB 3DTXB 2BFVL 1UA6H 2F53E 3WIHA 2OI9B 2VDML 5SWZB 4G6MH 4J4PC 1NBQA 5IFHL 3O3AB 3MRHA 5HXMA 1SBSL 4F9PA 4G8EB 1MCFA 4I0CC 2ESVD 4MX7B 3W5MA 1LEIB 5CP7B 4UBDD 1RZIB 1IGJA 1G9NH 3DX7B 4MD5B 3DSNA 1BVKB 2FYYA 1ADQH 3UYOD 2WUBL 2ZCLH 4GMSL 3LN5B 5KANI 3OKYA 3OZ9H 3IAGC 3NH7H 4QO1A 5DZNA 1A1MB 3KPNA 4HT1L 5IMLA 2OI9C 4XWOC 1A7PH 4D2NA 1EGJL 3L5WB 1JZ2A 5DI8B 5GJTL 4Y4KB 4HEME 1G84A 4X7TA 5T3XL 3MLZH 2B20A 1ETZB 3GSWA 2J3SA 1B90A 5BXFB 2H45A 2B4CL 3BEWA 4LRIC 3VXUB 3C8HA 3LKQA 4F7PB 5ISZA 3LEXB 2NTSP 3C5ZD 5EC1A 4ODUA 2ED7A 5IB5B 3RDTA 3MOBH 2FD6H 1BIIB 3QIUB 5LBSL 3SY0A 5C0FA 1I1FB 1S9XA 3HR6A 3FRUB 3KYKL 4Z7UA 1CTOA 3SKOA 5GS0H 3QG6B 1PG7W 2PXYA 1MRCL 2VC2H 1W0WA 4IRZH 1ROWA 4JZOB 4PJXB 4KXZH 2O5ZH 2P46B 1LO5A 3LKRB 4O2CB 3WIHH 2E27H 4YHMH 3VXME 5GGQL 5IR1A 1HH9B 4GBXD 1YNTA 1BECA 2FX7L 2PW1A 2VLJD 3WV0A 1T22A 1QBBA 1KTRL 3JWNC 3OB8A 5DHXB 3CDFA 1SEQH 4PP2A 4NOFA 4R4FL 4OZHE 3WJLA 3SKMA 1LK3L 5DGRA 1BJ1J 2CK0H 5FXCH 1PX3A 3QNYB 3KJ4C 1VFAB 3SKJH 5E5MA 2R23B 3BYYA 3HS0A 3UBXG 4XCCL 2UVEA 3MRNA 1EAPA 4NKOB 2CLRA 3HNSL 4YFEA 2M8XA 2R56H 1H15B 2V2XA 3DBXA 43C9A 1JZ6A 2R8SH 1ZVSB 4P3CL 3LEXA 5EC1B 4H20H 3MJ9A 3FO2B 4ZNEA 5IG7A 1W8NA 3A6CH 1JNJA 5IHUH 3F12B 1VKXB 2GITB 4MJIE 1GGBH 4KTDH 4MA7H 1FBIL 4JRWA 3MZGB 4DTGH 1AGBB 4MMXC 5ANME 2DWDA 1BZ9B 3BPLB 2IFGA 4EDWH 2Z92B 4R90H 5C09E 3E2HC 5FO9B 2I9LA 5DD6A 4PJBB 3WDJA 4RRPG 3D69A 4Y2DA 4ZO6A 4AEHH 3T3PE 3ZTJG 2VH5L 4HG4J 1MHPH 5C0AE 3U9UB 3HMXL 1M6OA 5ERWB 5JW3L 1FCCA 4HS8L 1YEGH 2FGWL 3IYLW 2J88H 1QFWL 2VDKL 4XNQA 1ZT7A 3ECBB 2DD8H 1MI5B 1UADC 3F58L 3K1DA 3U7WH 3RVVD 3VD7A 2NTFA 2HFFA 3MRBA 4IS6B 1FFRA 4PRDB 3C08H 5CINL 3KPMA 4PTTA 2BDNH 3LOWA 4R8WH 1HH6B 3G04A 3BW9B 4WI5A 4ORGA 1J1PL 1MUJA 1D5BA 1MFEL 2A0LC 4HJJL 1KLUA 4CN4A 4Q9RL 4ZAKD 5CEXB 1PDKA 2HTKC 2YA1A 1IGIL 1OSZA 5DD0L 4ORZC 4JM2C 3VGGA 3V0WH 3PQYA 3UTTD 3CFCL 1I1CA 2GSIA 3QJHA 3C5SB 2P48B 3R1GH 1D5BB 3QIWD