5C0ND

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQTPASVSEPVGGTVTIKCQASEDISRYLVWYQQKPGQPPKRLIYKASTLASGVPSRFKGSGSGTDFTLTISDLECDDAATYYCQCTYGTYAGSFFYSFGGGTEVVVERTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDCTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, adipocyte
molecule tags Lipid transport
source organism Mus musculus
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
total genus 48
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD01
4KDTA 3EFDL 3TN0C 1I1AD 1MHPL 1KPVB 1MI5E 4Q0XL 5C8JA 1A14L 1DN0A 3TZVB 2BVEA 4XCEA 4CVXB 2QHRH 1M7IB 3MZGB 4P0DA 4E5XA 5EZIH 4F2MA 4Y2DB 2WQ8A 3WFDH 3UBXB 1NLDH 4KK5D 3B8YA 1QZ1A 5DXWA 2BNQD 4I1NB 4CRPA 1F3JA 5BO1H 5GGSB 4U3CA 4ORGA 3GIZL 3QRFM 1NGQH 3F12A 2IQ9L 1YC7A 4KTDH 5FYKE 1FVDA 2P45B 2Y5EA 1NBQA 3G6DH 3OR7B 4ZUVA 1R3LA 4OTXH 3EGSA 4UQ3B 3CUPA 4JDZA 5C0DB 3OGCB 5TGBB 4D0CA 1KJVA 4O4YL 1G1CA 2DIJA 3L3HB 2H6PB 1QBAA 5GRWA 3ETBF 3VWKB 2DQIH 5EBWB 2H3NA 4DOHB 1QOKA 5F89B 3UJTL 3GBMH 1IT9H 4WEBL 3GMLB 1W72H 2PYFB 5FV2A 4BQ9A 3QHTC 5FYKL 1D9KA 1MCBA 1ED3A 1V05A 4TQEH 4R96B 4UQ2A 4IRJB 4XCYA 2YS4A 1QSFA 1MAJA 3DO3A 1JHLL 1P6AB 3DYPA 1MFDL 5EOTA 3N50A 3DTXB 3LPGA 2IBZY 2VQTA 5ISZD 4PJ8B 1ZA3B 1X5JA 2HAZA 3LV3A 3MRDA 1KC5L 1ZT1B 4M48L 1IKFL 2BY0A 4J3XA 2VZOA 4YPGA 3LD8B 4KZEH 4H88H 4U4BA 3OL2A 4U1JA 2O5XL 3FQUA 1KXVC 3FFCA 2GFBB 3JTTB 4BSWB 4E0RA 1QHPA 1YDPB 3QIWA 4JFDA 5DRWB 1MNUL 4X6DE 5CJOH 5E6ID 3GRWH 5IB1B 1Q9KB 3NIDF 4Y4FC 1K4CA 2OL3H 4H0GA 4TNVK 3DGCR 4QCIB 5H94A 3M17A 1T22A 4CU8A 4IRJC 3DXAA 3QNZA 3P4OA 5HYJE 1AXSB 4LEOB 1A9BB 1KB5A 2AJZB 5J12C 5JQ6H 2FH6A 2XWTB 2X4SB 2AJVL 4K9EH 1CXFA 5L2KE 1UJTA 5C07B 4XPTL 3LHPH 1U8NB 2DKMA 5LBSH 1IGTB 3VFNB 3HMWL 3JV6A 4MAYB 4MMXC 3EYQC 4FFYL 2JIXB 2IMNA 5D70H 4X7EC 4FXGA 3HNTH 5FYJD 4ZNCD 5FO8A 4P2CG 4YFLF 1RHHB 4X0KB 1IGJA 1CVSC 1XEDA 4HZLB 2RJMA 1FFOB 4KJQC 1QPXA 1ZT4B 4JFZH 1UQSA 5D6DC 5GGSA 2VQ1A 2VERN 5J12B 3OAZH 4PGDA 1L6XA 3TPUB 5E24E 1J86A 1XGPB 4QYOB 5IFJB 2DLTA 2Z31B 1TPXB 1C1EH 4POZD 3CX5J 5GS1B 5F9AC 4QRQA 3O4LD 3GJFK 3MV8B 4YHYB 4MJ6B 4YWGL 4X4XA 1G9NC 4P9MH 3MREB 1AI1L 2BVQA 3T0DA 2B5IC 4RWHA 4LCWD 4QRSB 4P4KB 4HWBA 4LSRL 3BN9C 3ALXA 4RX4D 5F3BB 1NGWA 3BPLC 2QQKL 3DHMA 5ADPL 12E8L 1AQKH 1TJHL 1W2KT 4MS8C 4NO0B 4EUPB 4IRZL 2M1KA 4QXGL 3QEGH 5EOTB 1A6VL 2WNGA 3IGAB 3C08L 1VFBB 1U6AL 3SGDH 1OLZA 1WFUA 1MPAL 3ARDC 3V0AC 4ELKA 4JQVA 3R1GL 5F9WB 3LQZA 4MSWA 2UWEA 3FB6A 1MCWM 3JWDL 3BDXA 5IWLA 2ENSA 4NRZA 3RZCA 5L8JB 3M8OH 5GGVY 5C0CB 5JR1H 1ORSB 3BEWB 3CVIL 2ZCKH 5CEZH 2XPGA 4RGND 4LGRB 4BZ1H 5KJRL 3D3VB 4HIXH 2N4IA 5EUOF 2PO6B 4XNUL 4NPYA 3MRGB 3BPLB 1JFQH 4M5ZL 3FB8B 1HXMB 4JFFA 3VCLA 1ZEAL 4LEOA 5E2VL 4KRPD 2KPNA 2ILLA 5C6TH 1DQLH 1K4DB 5C07A 4NUGH 3F7YB 2FO4A 2PETA 4MAYA 4OFVA 5JIPA 2Y23A 2ARJQ 4P4RB 1EV2E 2A9MH 2VRAA 3E8UH 2GK0B 1Q9OB 4YXKL 4F2MB 2LU3A 3P9MB 1TZIA 5BVPH 5JOPD 1MCDA 3O3EA 4IMLA 1MHEB 3VGEA 3IETA 1I1AA 2BFVH 2AEWA 2BXZA 4Z7UA 2VLKB 1A1OA 4JFHE 4XP4H 1JPSH 2EEBA 3HN3A 1DBMH 3T2QA 5FECA 4QYOA 5C0IB 1HINH 4TSCH 5HHXL 1DBKL 5FYLL 1BZ9B 3TPUA 1X4ZA 3DV4B 1TZGH 5JHDD 4F58L 3T04D 1NEZG 4RWYL 5HDBE 4G9FE 4M6NL 1AR2A 1YEIL 1C5BH 5SX5K 5J89A 3UYPA 4AEIL 1PAMA 1GHFL 5GRUL 1DVFB 3PHQA 1BBDH 1CQKA 5DVLA 2A77H 3GSNA 6CGTA 3GMLA 1ADQH 3N85L 3NFSL 2NY1C 1EERB 1QRNE 2HLAA 3HC4L 3VXNA 3IAPA 1DEEA 2HYMA 4J4PD 2HVJB 15C8H 3QQ9D 5I6XB 3CXDH 4F57L 4P2OA 3EOAB 5EDXA 4LVOB 5GSRB 3PWLA 4HHAB 3KPMA 4L4TE 5EZJA 1CDGA 2HFEA 1A6PA 5CEXA 4MQTB 5HDOA 4K3EL 3E2HC 3MA7A 4DVBA 4LMQI 3DSFL 1MIEH 3HG1D 2V5TA 3WFHB 1GPOH 1BREA 3D3VA 3NCJL 4M43L 3FHQA 3DURA 3I85A 2J12B 4P57A 1NFDB 3OAZK 4I48A 2K9UA 3P9LB 3O6LL 1M7IA 3B5GA 3QCTH 4OF3A 5SV3A 1JZ8A 5SX4H 2B1HH 3C6SB 1BFSA 3NCEB 3MRPB 3S3JA 1AR1D 4PJ9C 2NNAA 1UKSA 1U3HD 3ULUF 4P46A 1GPOL 1Z9SA 2Q1EA 3L3OA 2G9HB 2XZZA 5I73C 1JF5A 4XMPH 3FB5B 3V5DA 4QOKA 1IC5L 2XI9A 2ZP0T 1Q9KA 3EOTL 1NGZB 1CDCA 1RFDH 2VE6B 3PXHA 3I3DA 2IWGA 3BUTA 2E27H 4MNQD 2PTTA 3QIUB 4PR5B 4K94L 3SKJL 3RA7L 3MXWH 3UJTH 4GW4B 1V7ML 1N6UA 5ETUB 3RPKA 2AAVA 2Y36H 4HBCL 2OYPA 1EFXB 3WCYA 2AI0H 3S6CA 1ZLWH 1UQSB 5C0JA 4RGNC 4WEUD 4XWOD 2IEPA 3FQNA 4JRXE 5E8NB 1L6ZA 3AU1A 3WSQH 4PB0H 3BPOB 1KCSH 4F7PA 5IFJA 3TJHC 3VXSE 2LVEA 5B39B 4PJIB 1OPGL 3PDGA 5GS1A 1LO2L 3EO0A 4PRID 3ROOA 4XWOC 1QLRA 5HTSA 4M1DL 3SGDI 2B4CL 2OTUA 4OZ4B 3QULA 3V6OA 1A4KA 4JM4L 2DLFL 3PJSB 1OSZB 1Z3GH 3QH3A 4AQ1B 2BZDA 3GHBH 3OKKB 1HSAB 1DQDL 3BRFA 5TE4L 1G7PB 4QRUB 3BDBA 1U36A 1F6LL 1ORQA 3CFDA 4G8FB 2XWBB 2GSGA 4UTBH 4G6AC 2CO7B 4QXGH 4Y4KA 3DRQA 5J9PB 3BJ91 4X4MA 1QFOA 1OWWA 3ULUL 3O4LB 1G84A 1YMME 1BJ1J 2NMSA 3BPOC 4LHUB 1NFIB 2R1XB 4BKLA 4O51B 5IW6B 4GXUN 1MF2L 1VFBA 2HT4C 2RR3A 2D7OA 3RWDA 2B4CC 4CDHA 4CN6A 2UV3A 5DEFA 3ARYA 3T65A 5EC1B 1XF3B 5LGHL 1KJ2B 1NGXA 1MRFH 2DD8L 4L8BA 5D7LE 1LWRA 3DJ9A 1N0XL 4M6NH 1A0QL 4OV5A 3HTLX 5FV1L 3O0RL 4BQCA 2I07A 2WMPA 4ELMF 4IOIA 1WWBX 5HHXH 3TH3T 1XGYH 1AO7E 4RFNB 1F13A 2Y6SD 1A7QH 5IM7A 3VWKC 4FNLH 3ARSA 3LMJL 3VFVA 4WY7H 5ISZE 5FM5O 5L6YL 4HCRH 2NW2B 5MEQB 3P9WB 1AD9A 2CUHA 1OAQH 3S36H 4MJIB 4YH6A 1BBJA 3FB5A 3MPCA 1KCSL 3CCHB 1J5OL 4KWUA 4GQPH 4MXWH 4QT5B 5GS0H 2NY1D 1BQLL 4K8RL 5JPNB 4CKVX 2VQUA 4QTHB 4UB0L 3W0WD 3CDGB 1MRCH 4Z7UF 3MLUL 5CHNB 2OL3B 1QSZA 4K3HA 4X6CF 2H26B 3TWCL 4NM8H 4YHZL 4C56E 2E27L 2E6PA 1URLA 4I3GA 5DJ2A 5E6IC 3BKCH 1A2YB 2OP4L 3HI5L 4Y4FB 4OZFB 2OMNA 5JOFB 3SE4A 3ZTNH 2H2SD 1OGTB 1CLZL 4M7ZB 1JGDB 4GJTB 1XF5A 5FO8B 3RVUD 4K7PX 3MLVH 4IS6A 4XCCH 4N5EC 1KPRA 1NSNH 1ND0B 4B7IA 4X6DB 1KCLA 5FKPB 4PS4L 4O5LL 1CS6A 5F7EH 4BFEA 1A4KB 4KROB 4QGTA 5D1XB 1IVLA 3RIAK 3LZFH 4H26B 1ZT7B 4TVPH 1PY4A 5LXGL 4MD5B 5E70A 4X5LA 3RKDD 4NRZB 3TA3A 4G3YL 5DD6B 2ED8A 3H9ZA 4KQ3L 1MREH 4HIEA 3TN0B 1S5IH 1DQMH 1FYHB 1HNGA 3NN8A 5I71C 1L4IA 1ZLVH 4X99B 5IUSA 4AEHL 2F54A 1A7PH 4WV1A 2XKSA 1PYWA 3O4LE 1ROWA 3BGAA 1NAMA 2R4RL 1N2RA 1T0NB 1XGQB 3QIBC 3GSXB 4KHXL 1FCCA 4LSSL 1YMMA 3EDDA 5KW9L 1OAZH 4KROC 3O3BA 4YDLB 4D0BB 1RVFL 1AP2B 1II4E 3W9DB 4F37K 4TN9A 4GKSB 4QRRA 3IGAA 4QXTA 3VFGL 3OGOE 3I6LE 4LSTH 3ARDD 1HWHB 1R5IB 2DOCA 4OZGE 5EPMB 1JI1A 3SE4C 1S5HB 3DVNA 4DN3L 2DQGH 3PUCA 5ICXB 1I1AB 1BIHA 3L5IA 5F97E 3ZDYF 4XT1C 3CSPA 3DUSA 1A02N 1NMCC 1VGKB 2Z9TA 5IVZB 2C1OB 4NQDE 4E41A 3L7EA 3WFDL 3H6JA 3HUJE 3GGWB 4I4WB 5FYJU 3MRLB 1Z2KA 5D70L 4P57B 1OAZL 4P5MA 4OQ1A 2P8PB 3QFJA 4LSVH 4KQ4H 5F44A 1BECA 1TIUA 2I9TB 2HT4D 4YDLC 4JDZB 1FP5A 3VJ6B 5HYJD 2X1PA 3V95A 2PR4L 4X9IA 2OTPA 1YNKH 1DJSA 3RIFF 5KS9E 2O26U 5T3XL 3RGVD 3MGOB 2E3VA 1K3ZA 4U33A 4I18B 4R7NA 4Y19E 1T03H 1JPGB 5I0DA 3HS0A 2Q6WA 5JOFA 2OL3L 1H5BA 1KJMB 4MVBC 4X7SH 3X13B 3U1SH 2BOCB 4YFDB 4PY7A 4JPWH 4TULL 3PP3K 4Z7VE 5C0AA 5CCKL 5DD5L 2DB8A 5JOPE 2AK4E 2EDQA 4DVRL 4Y16A 1S7RB 1CI5A 5J7CC 3STLA 1I8MB 4JANA 5DDHA 3L3KB 4Z77A 3WN5C 3PWJA 2ZWLT 3QJHA 3FFCB 3NH7L 4M5YH 1FV1B 3F6LA 5TDOA 4WUUB 1JK8B 3FO0H 4KROD 3WBDA 3DX9A 4L3ED 1T80A 5CUSL 3IDXH 2CIIA 1LEGB 2G5BB 1FG9C 4AEEA 2YC1B 3A0OA 5DUMH 1HK6A 1LK3H 4Y4KD 5EZOH 3NIFE 3HKFA 1KTDA 2H9GB 2FL5B 1IAOA 1JMXA 1V3KA 3VXPA 4GRWB 3O41A 2F53E 1ZHKA 4MGXA 3RVTC 3IS0X 1X5AA 3CFDB 3WIIL 4PGCB 5B3JF 3GBLA 1R5WB 3ULSB 2DJSA 3MMEA 4R0LB 3MUGA 4G6JH 4PRHD 4PJHE 4JY4A 1C5CH 4P48A 5CEZL 2Z31C 1EO7A 3DVGB 3T77A 5GS1C 1LO3L 3TA3C 3GMOB 2NCMA 5JORB 1J18A 3MA7B 4NN6B 2NY1B 1QSFD 5DZNA 4BM7A 4L8SA 3K81A 1CGUA 5J06A 4J3WA 4Z7WE 4X4ME 4IRJD 2QQQA 3SJVD 2WUCH 1A6AB 3IKKA 4B5EA 5K9JH 1IM9D 4U1SA 4NJAL 2OK0L 3ARTA 4XMLH 3WDIA 1EVUA 1DQTA 1JWSA 2OXHA 4Y16C 4RISL 2VYRE 1JZ3A 4JRXB 1SYVA 3OGCA 2JJSA 2FNBA 5CHNA 4E41E 5IFAH 5HDBF 2BHYA 4NDMA 1DDHB 5DUBB 3DGGB 4WCYH 1NAMH 4Y2OA 3VFWA 2EC9U 1UXSB 5HVHC 3S34H 4FFYH 1FJ1B 4L8DA 2R23A 1IJ9A 3MV01 3EYOA 5BVJA 1Q72L 2ADJB 3MLRH 1A4JB 3K1KC 3B2VL 3QCTL 1ITCA 2OJZH 4GO6B 1E6JL 4K3DH 5AUMB 1BFOA 3O9WC 4PJ9B 1CGVA 4XCNB 1ZLWK 1I8IB 4Y16B 2XZCL 4HMEA 2FJFA 2IMMA 1AGFA 5ITBL 4P49A 1A7RL 1GH7A 4L9LB 4NBZB 3PWJB 4D0CB 3BKJL 4HXBH 1CL7H 2D7TH 3HAEG 4PRBA 4S0SD 2FH8A 5E7FA 4I2XB 1A3LH 2FECI 2QBWA 1BD2D 3QIUC 5C7XL 1GOFA 1C8PA 2VXSH 5EULV 2HLFD 4LF3A 4CGTA 1A64A 4IS6B 2I07B 5IQ7H 3D39D 4Q97A 4W4NA 3OHXB 4PRIE 4GG8A 1FO0A 2XFXB 4C55A 1DBJL 4RGNB 4NKOB 1XMWA 15C8L 1UB6A 4ODUB 2V2WB 2X1QA 3QNYA 4EOWL 3IF1A 4JHWL 5E8PA 3KJ6L 4IJ3B 3LS4L 1ZT7A 4ZFFA 5BMFH 4JO3H 5D6CA 4D9QD 3MXVL 5TDNB 3EDKA 1R3KA 3DRQB 4L9LC 5J9PA 4G8GB 1OSPH 4LDOB 3O4LA 3D25A 3LKNA 1EFXD 4WFGE 3SDCD 5JDSB 4XHQA 2N56A 2DQIL 5IIEB 1GAFL 3BPCB 3O2DL 1LP9A 3FONA 3GRWL 3UTPE 5DEFB 5JORA 3MUGB 4F37F 1RIHH 5CGYD 1VA9A 5J8OA 3GO1H 1VESA 4I0CC 3UTOA 4NNPH 5C0CA 3HG1E 4LL9A 1KPVA 5BV7H 3D85A 1CFTA 2VDOL 3CLFH 3KJ6H 1QYGH 3K4ZA 5EG6C 2WWKT 4HIHB 1SM3L 1EGJL 2ORBH 1LQSR 1MQKH 4QRRB 2R2CA 4HPOL 2VABA 3T2NL 3VRIB 4F7MB 1R5IA 1BPVA 5AZ2L 5ESQA 3D87B 5I6XC 1HSBA 4NT6A 1NEZB 4OCXL 1I3GL 3UP1A 4X9BA 5HHOB 4J6RH 3SGJC 2BVQB 3U9PH 3WUWA 1Q1JL 2NZIA 3GMNB 3OXSA 5DTFB 3QUMH 3UJIH 4E42B 4N90D 5C6TL 5IEHA 3QXUA 4MA7L 4TVPE 2D9CA 2CMRH 3WS3A 3CH1B 1Z6JT 4MHHI 4N0CD 5CEZE 2X4RB 4F9LC 2DIAA 3LCYA 4YHIA 1OD7A 4K3DL 1DLFL 4BZ1L 4JHWH 4HEPG 5C6WH 1KBGL 3CPLA 4EN3D 1SYSB 2HT2C 4NRYB 5E2WL 3QO1A 1X5YA 1QA9B 4KH2A 4K7PL 5F96L 4LRIC 5FUCC 3U0TA 4R96A 4UQ2B 4GT7A 4GRMA 5ACMA 2NZ9D 4HS3A 5T3ZL 4DKAA 4ZUUB 3SO5A 3VXME 2BOCA 5IBLC 4DEPC 4NKOA 1CL7L 5HGBA 5SX5H 4Z7QF 2BCKA 2HKHH 3OHXA 4QRPE 3VCLB 5E6IB 12E8H 3ARFA 5E8PB 4HK0A 4H20L 3T2PA 5SWQA 1G0YR 3VXRD 5JO5A 3SE3C 2WM0A 1QHOA 2D03L 5BV7B 4E0RB 4MSWB 3N1QC 2OJZL 2B0SL 3LKNB 1JE6A 1EHXA 5EOQH 4C54A 2X4UA 4G8GA 1CR9L 3L7EB 1I75A 3M17B 3BIKA 5FGCE 5DJXB 1DFBL 4PJXA 4J23A 3W2DL 4R7DB 1AGEA 1XIWA 3MUZ1 2BDNL 4DN4H 2CDGB 3SDAD 3NBNA 1HH6A 1ZA6B 4FP8H 1CGXA 1QTYT 5CJQL 2C26A 4ZO7A 2DQTL 2W9LA 5DMIH 2XWTA 2HRPL 3ZT5A 4PRHA 4CMMA 2R0WH 1N3NB 5FUOH 3O3BB 1AC6A 3JXAA 4MA7H 3SDCC 1FPTL 3ZT6A 1TENA 3GFUA 3U36A 4K7FB 1T4KB 4NZRH 3CNKA 3S5LG 3ISWA 3E0GA 2X70A 3C87A 4UOW0 3FB7A 4IBLT 3V4PL 1JYWA 1AO7D 4LSQL 3RWJB 5TF1L 3R1GH 4LPTA 3EHBD 3CD4A 5I15H 1NAML 1CDYA 4ZOBA 4PJ7F 1MCIA 3PHQB 3QPQD 4IOFC 3D3VD 3GMNA 1B2WH 5L0QC 5KVFL 1TETL 1N7ML 3DARA 3C6LB 1JI2A 3BMWA 2X4QA 4JHBA 4P59L 2FBJL 3G6JE 3MOBH 5E2TL 4FQXD 3WIHL 1XGPA 1HKLH 2VQ1B 4GMTH 1WZLA 2VZSA 5C0IA 4PR5A 5IBTL 1BFVL 5D2NC 1XGYL 1U3HA 4I0KA 3W0WE 3LB6C 4HKJB 3MV9B 1MSPA 4OLUH 4P9ML 4LHUA 3MYZA 3D69A 2HFGH 4OAWA 3U83A 5CEXB 5D7JD 5C09B 3X3FL 5IMLB 4U7KA 5IT2H 4YGVA 4ODVL 4X4YB 4DVBB 4FABL 5JW4M 1Q0XL 1TNMA 2B0SH 4MD0B 4UBDC 1J7VR 1TTGA 4Z5RB 1QA9A 1U3ZA 1PG7X 4OCYL 4PV9B 4C57C 3MGAA 5ABDE 1A6WL 1MCFA 4N5UA 3OKLB 1JPTL 1R5WA 5DMJB 4O58H 4R90L 3U9UB 4APQC 5EZLA 4EOWH 4DZ8B 3ULSA 5EBMA 3KGRA 4WFHE 3T0XA 3MJGX 1H3TA 1X44A 5E99H 4GBXD 3MJ8B 3MLYL 4LCYB 1QEWB 2X4OB 4ELKB 4MCZA 4I18C 4NJAH 5H37H 2OK0H 4LFHD 2A83B 2BRRL 5FGSA 5KOVC 3NA9H 2ZG1A 1IGYB 2E7LA 4J1UA 4RQQA 5I8CA 2X6MA 3L95B 3IDJA 5C7XH 2XPGB 3UTTE 3A6CL 1AXTH 1HH9B 1I9EA 2PYEE 4S2SB 3QIUA 4QHNA 3NAAL 5FDYA 4FG6C 5C2BL 3WJJA 5DMGC 1KLFA 1EMTL 1UACL 1RZKL 4L5FL 5LJYH 3PABA 3ULVC 4XGZB 1QO3A 4DAGH 3HAEH 5T1KD 3TA3D 3LRSB 5CCKH 4OV5B 2Q86A 1SHMA 3C6SA 1C5DA 1WWAX 3U1SL 1JZ5A 5F6IC 4PRHB 5IB2A 5KVEH 4U0RB 4N8VA 2Y4SA 3GSUB 4XNYL 3FAXA 4L4TB 5GRJL 4QXUL 3X17A 5BVJB 3RWIA 2W59A 3CXHK 3GI9L 3UBXA 5ESQB 3D85D 1IC5H 4PRHE 4FQ1L 4CBPA 1T5WB 3EBAA 5I71B 3PWPB 3VFPA 4LK4A 4M5YL 1LO0H 3ARGB 2E9WA 3BZEA 2Q3AA 2UZXB 2DIBA 3T0BA 1M71A 2CUIA 1FRGH 2QSCH 4LSTL 2EZ0C 3UO1H 3UTSA 3PWNB 3GUTB 2B20A 3EYQD 3QIBB 4R0LC 1WICA 4H25A 1RVFH 2EDJA 2X5PA 4W4OA 2Y07L 2FX7L 1XCQB 2C1PA 2EH8L 3GSQA 4OLYH 2XICA 4NN6C 5C09A 1BQSA 1K3IA 3MOAH 2QQLL 4FFVD 4OZ4A 1C7SA 3MX0A 1RZJH 4OLVH 4UDUB 4NRYA 2C3WA 5A16B 3OKKA 4NFDA 4M62H 4X6DF 1KB5H 3CVHA 2ADJA 3DXAE 5GGRA 3ARGC 5F9OL 1Q9LB 1F4XL 3KNBB 4U2ZA 2OZ4L 1UENA 3KYAA 3NFPB 4I9WE 5MEPA 3TM6A 2E7MA 4LSSH 1TETH 3VI3E 3KDMB 4KHXH 1EAPA 2AK4D 5FA3A 1TPXC 5T1LD 2XWJA 4YDIH 1WWWX 1ZA3A 4HMDA 5HVHB 5BXFA 2XZAL 4H1LG 4LPYA 1NL0L 3KPQA 2H32B 5I0ZA 4YPGB 3ZKXB 3VFTB 5FAAA 1ZWIB 4RSVA 4YFLI 3DBXB 1T5XA 2Y5TB 4KKCC 3WNNA 5CZKA 1U42A 4HIEB 1IZKA 4Z7WF 1S7TB 5HI5C 4KJYA 4PJAE 3MBEC 35C8H 2BY3A 3DIFA 3P9LA 2VABB 3G5XB 2ZG2A 3VDCA 4FQJH 5IHZB 3L9RA 2J3SA 3L3OB 5KW9H 1XT5A 2VITB 1FBIL 4OGZA 2F53D 4BJLA 4PRIB 1RK0A 4OZFA 2R4RH 3ARDB 3HR6A 2FIKA 4D9QE 2DBJA 4XXCA 1IGCH 3T3ME 5I1AB 1ULVA 4AT6B 2VDPH 4FQPA 2N7BA 4WW2A 4WFGD 3KXFE 2JJTA 3O6KH 2CO6B 3PWPA 5EWIH 1IAKA 5DSCA 5IQ9B 2HJFA 5L8LB 3STZB 3I02B 3MRMB 2B1AL 2FATH 2Q7YA 3TNNB 3CXHJ 3UYRL 4MNQB 3WJJC 4PREB 2EECA 4IOSD 1XH3B 4JO1H 5C8JB 5E5UB 3TN0D 2P8PA 2LV4A 1RUQH 4WU7A 1RZKH 1HZHH 4LLUB 2MNUA 1FNLA 2X1XR 3H9HB 1RUMH 3FL7A 4Y2DA 2GJ6A 4IRJA 3DV6B 3C5JB 3PJSA 4E41D 1QSEE 5TF0A 1R5VA 4QRQB 1IM9A 4WGWB 3UTQB 1T1WA 1NGYB 4JY6B 2VOTA 1VGEH 3MREA 4E9LA 1F3DJ 4U1IB 5AAWA 1T89A 2Z91A 2HMIC 4HT1L 3MCKA 2GT9B 3QQ3A 4G9DA 4EQ3A 3O41B 5FHBH 3P0YL 4WHYG 2PKDA 4I77L 5CAYB 2BMKB 5FO9A 4GKZB 5EZOL 5E99L 3PDDA 2YA0A 3CU1A 4J8RB 5DHVH 2XWJB 2YD1A 5TFSH 4QWWC 1CG9B 3CH8A 5D72L 4PJGA 1HYSD 1FL6A 3MV11 3ZYIA 1XF3A 3Q0HA 1CE1H 4PD4K 5IOPA 3KYNA 3NACH 1OGAE 3FO0L 4XPHL 2KUTA 3GSXA 3HE7B 3U82B 2M26A 4YX2H 1BD2E 4YWGH 4W6YB 5JXEA 4PV9A 1CBVH 1A6AA 1JTTA 5HPMB 4XPFL 1E4WH 2WBWB 3U46B 2A6KA 2E7HA 2C3GA 3JV0A 5C9KA 2I9TA 4P99A 1PLGL 3CFKA 2DBLH 4JO1L 2BNRB 3DIFB 2GCYA 5BW7C 3K2UL 3O9WB 5CD3B 4O2CB 4OZHF 1ZHKB 3NCJH 1FAIL 3ORJA 1FYTD 5IJKC 2EDWA 2JCCB 3D39A 4HUNB 3TT3L 5D1ZB 1DLHB 3B9KC 4NNXB 4ONHB 3WSQL 2VDPL 3LS4H 3EYVA 5DZLA 2XZAH 1EJOH 5LCVH 4X4ZA 2HFTA 3C60B 2KKQA 4NCC1 2KH2B 2IH1A 4NIKB 1JNHA 2D7QA 4NZRL 2XN9E 3TC9A 4HWEH 5IVXA 4PY8I 1MCPH 1M05B 3G5VB 4JO2L 2ITDB 4K7FA 3MACH 3MNZB 1P69B 3RL1A 2VUYA 4IJ3C 2DLFH 1JK8A 5IF0A 4I2XA 1RZIA 4X98A 5JHLL 1B0GB 4X5XB 1GZQA 2WBKA 3O6FD 4N8CL 5I73B 2GJ6B 2NXZB 4HXBL 1ZLSL 4QHUA 2APXA 1G9MC 3DTXA 4PB9L 2CQVA 1DFBH 3ILPB 4PTUA 1Z5LA 3KWWB 2VAAB 4U6VH 3ULUC 3BZEB 2QEJA 4MDJA 2PO6D 4N90E 5E8EA 1YY8B 4KZEL 4G43A 4LSDA 3QFDA 3UTSB 1ZVYA 3ARZA 1NCTA 1N6QL 1BLNB 3LAFA 4CW1A 1FLRL 1SJHA 3V9FA 1E4XI 1SEBB 3NZ8B 2DD8H 1WIPA 5CEZD 2W0LA 3HZYA 3BP7A 5L88H 5L0QB 4HLJA 1I9JL 2LU7A 3ZDYE 1FGNH 3SCMA 3LN4A 4X99A 4LGPB 3WEXB 1UZ8A 1EXUB 2GTWA 2Z92B 4PLKD 4YXHL 3RX5A 3V6FB 1GYAA 2J8UB 4LLVB 5EU6E 1WEJL 2QQLH 1ZGLM 5D2NB 4HJ0D 4FZ8L 2VO5A 5HPMA 1YY9C 4ELME 2EYRB 3FO9A 3QUMA 2FEEL 4KXZI 2FSEB 3IFOB 2W92A 3T0EA 3PV7A 4G5ZH 3MMEB 4R0LA 4NKDA 1T89C 3O6ML 4F33B 1X5ZA 3EW3B 1T1ZB 5F1IB 2O61A 1J0HA 2EXYC 5M95B 5I2IB 1ETZA 4KTEL 2VLLA 5JW5B 4NQVA 4NWTL 4RQQB 4PLOB 5DD1L 1R3KB 5HGAA 3VXRE 4Q9RH 2ESVA 2UYLB 4HGKC 3DBXA 5E9DE 4PP1C 3MRCB 4E42A 3BEWA 3CFIC 4Z7VF 1S7UA 3Q1SH 1WAAE 4H8WC 1NMAH 4LAJH 1N0LA 1HQRB 1FDLH 4IMKC 4YHPB 2JJWA 4WJ5A 4APQA 4DFHA 5JXEC 3EIFA 4RFNC 2MCPL 4JO4L 2AK1H 3IDXL 4P23C 4W6WB 4JQXC 2LTQC 4MHHG 1VCAA 1AQDA 1KFAL 3AY4C 1ZVHA 1XGRA 1HHJA 3O2VH 3RIFK 5F3BA 1F8TH 2R2HB 1KEMH 3WIHA 3VG9C 2R9HC 5E8OB 3A6CH 4UDTA 4KMQA 4G7YL 1AY1H 3OJ2C 3RNKB 1WK0A 4NQEA 3MR9B 4LARH 1MJ8H 4LKXB 3FQRB 1M7DB 4S1DC 4XVSL 2I9LA 4X6EA 1U2HA 4LNRB 5A3ID 3QT2A 4QHMB 4G43B 2R2BA 3VFMB 1XCQA 4FRWA 4P23B 3MYJA 2LTQB 3PWPE 4GKZA 4M03A 1A6TA 4K3EH 5DD3L 4LSRH 4J8RA 4U0QB 5DLML 4Z95L 2YC1A 5MEOA 1TJGH 3RWDB 3I84A 5EU3B 4PD4J 1ZLUH 4P5KA 3MLPA 3VD3A 3VG9B 1IGCL 2HT3D 3G5XA 1FO0B 3VXPB 3B83A 2VXTL 5B21A 5DEGB 3L1OL 5CJXC 4J3OC 1EK3A 3W9EB 3PQYE 3NIGE 2XA3A 5D2LF 3P0YH 3BISA 3MFGB 2Z4QB 3DXAD 4L4JA 4BSJA 3OKNA 1AGCA 2VZUA 1G7HB 1PD6A 3H9SB 5I66A 5IM7B 3MBXH 2AJYL 4RIRA 4XCEB 1QSVA 3RVVD 4CVXA 2RGSA 2PTVA 3VWKD 4YBQD 3T1WA 2R0LL 1D5XB 1J1XH 4NKDB 3RWCB 1EHNA 1W0VA 4OFKA 4K3GA 5F1OB 1KSRA 3F7RA 3DX7A 3QUML 1J1OL 1RY7B 4XTRD 1NFDE 4OD1L 1VEPA 3LKRA 5FYLH 4RFEA 5SWSA 4ENED 5IEHB 1RJLA 1JV5A 2HH0H 3G08A 1EBAA 4Z7VA 2D03H 1Y18A 5IR1A 3ARPA 5F1KC 3WS3B 5IGXH 1Z9MA 3T3PE 4ODBD 3GM8A 5DYOA 4M48H 4HD9A 3BWAA 1A5FL 2V7NA 2YPLE 4QTIH 4XPAL 4Q9QH 2BNRA 1NLBH 5CKGA 1QFUH 2RHEA 3GSNL 2ICWI 2UZYB 4KK8D 3LN5B 2D0GA 1BVLB 2X4PB 1I85A 3OR6B 4POZC 3IDMA 1UJ3C 2JCCA 3KPNA 1XIWD 4X6CB 1LHZA 5I8OL 3TZVD 2QQNH 4F7CA 1JCKA 5C71A 1DLHA 1FAIH 3MZTA 1D9KB 2EYTA 4OF8A 1KPRB 4S11A 2E8YA 4KJWC 1CZ8H 5FO7B 5E2UL 4M6OH 4NO5B 4P4KD 1T03L 4LKCA 3EOAA 5EO0A 3WO4B 3TBWA 4HKXB 4DAGL 4K55A 1NSNL 1H3PH 3VFOA 4R2GD 1U8JA 2WP3O 3ZKMC 1WT5C 5HYFA 1P7QD 4M6ML 1BLNA 1YDPA 3QIWB 1CTOA 4F7PB 1FLTX 4Y1AA 5B39A 4PGBA 3FFDA 4H1LA 4KHTL 3TT1H 3BKCL 2HJKA 4NQEE 1KTRL 2AABH 1A7BA 2F54B 3P2TA 3B9KA 1LO4L 1FZOA 3RVWD 3S36X 4FHBD 3ILPA 3IF1B 5LVEA 3QNZB 3MV7E 4ODUA 1QSED 2WV3A 2OLDA 3M1BB 2YWYA 4JGJA 1A14H 2VLJE 3PABB 1JN6A 2OMBA 2BVUA 1TVHA 1U95B 3T0AA 2OBGA 3QEQA 4OB5H 4U1MB 1A7RH 1I7RA 3LN9A 3KPOA 3FO9B 1EMTH 3PHOA 4I9WD 4NOBA 4N8PA 3RY6C 1LP9B 2ZUWA 5EU6A 3H9SA 5I66B 1HIMH 3JV4B 4S0TD 1B90A 5C07D 3RWCA 1NGQL 1YEIH 3CDFA 4TOYL 3STBA 2F19H 2P4AB 2EXWC 3SKOA 5DFVD 4R7DA 3VGBA 4FFZL 3IDJB 5L2JA 1CXHA 1GGUA 1HH6B 2XT1B 3AS3A 3KPSB 1MCCA 1T7WA 3G5VA 2CJUL 1OL0A 1B6UA 3U0WL 2AK4A 3V6BR 4PJCA 4KQ3H 4TRPL 2GHWB 3ZL4L 1FNFA 4HKZA 3BN3B 4PJEB 1LO0L 4MCYB 4XBPA 1A5FH 3NGBC 3A67L 2NQCA 5KSBB 4BSVA 4KY1L 4AH2B 4WV1C 2QTEA 4Y19A 5E08H 2VKWA 4I18A 2NX5D 3BKML 2J6EA 4X6CA 5JPMA 5D7IB 1P1ZB 1G7JB 1W72B 4G42A 3CH1A 3L6FB 5CBAB 1GAFH 4GG6F 2V5SA 1KIQB 4MAUH 4ZUSA 3IS1X 4RZCB 2ADGB 1FQ9C 3WE6A 3HE6A 3LSOB 2BNQA 2AEPH 2VAJA 1XF2A 1TCRA 3SBWC 4ZD3H 4YBLB 5IBTH 2IH3B 3KDMA 3ELAT 3HMXA 2YSSA 3MBEB 3TYFB 4HKJA 2DM2A 2VXQL 4CNIA 4X9GA 1JRHI 3VU2A 5ITFB 1A2YA 4WV1B 3ULVL 4GG6B 3GEWB 5ACZA 4P2OD 3JSSA 2FJHA 1KIUA 5CJOL 4J3VA 4OFPA 5I1IH 4M93C 1KNOA 3BW9B 3ZDXE 3IAQA 3C60C 5ICYA 4HJJH 4M1GH 3DX9B 1BWWA 2BJMH 5EZLB 5EOCJ 3IAGC 3HPLA 4PJ8A 2D7NA 3DYOA 2CK0H 4LCYA 4PJFF 3N0PB 4YDKL 3X14B 4JLRA 4OCLC 4OFIA 1GC1H 1E4JA 4K71B 4MLSA 1JGEA 4K94H 5F9OH 3N1PC 4JGUA 3INUL 5C0GB 3U0WH 3RP1A 3SEPA 4U6TA 4Y2DD 3ESUF 1WBZA 1KB5L 4YPJA 2CR3A 5FM8A 2BVOB 1T2QL 1I1YA 1IEAB 4GRWF 3VFSA 1GGCL 1Q72H 1T6VN 3DROA 1A0QH 4HUWA 4LHUG 2NXYB 2IPUG 2OCFD 3ARWA 2DI7A 1TZIB 1J0KA 3KPTA 3P4OB 4XX1E 3GMRA 3RJDA 4NJ9L 5DJZA 1OY3B 4KK6D 4KV5E 4DZBA 3HC3H 3VFRA 3RY5A 3WN5A 4JPIB 5F6HJ 1OT2A 5JIHA 1CK0H 5I1EL 3QI9C 4FTVB 4W81A 2Q20A 3NCMA 3D2UD 4WI3A 3BGMB 5MI0C 4X6FB 1OGAB 4JFPB 3CFBB 4TRPH 3UJIL 4UV7L 4X5WB 3RNQB 3EZJB 2X1WL 1YJDH 1DQQB 2CJUH 4FTVD 1H8SA 5H35A 4XP1L 3X3GL 1JGVH 2O5ZL 5KG9A 1FFPA 5KN5B 4PJXE 3S5LA 1JWUA 3UXFA 5E95B 4FQQB 3GSNB 1G7LA 2VDMH 2IGFH 3I75B 4J7RA 3OSKA 5T3XE 3HE7C 4YE4L 5T5FL 2HRPH 4YR6B 5ICZB 5HDLA 2YD8A 4RZCA 4KDTC 1G7IA 2FJFB 5JDJA 3PHSA 2X05A 2VB5A 2Z31A 3QPXH 1NKRA 1KJVB 1NBYA 2C1PB 2DWEB 3GSQB 2XN9D 4P46C 2G75B 5JZ7C 1FFRA 1NC4D 3ARQA 1NUDA 4MJ6A 2R29H 3LKSB 1YEEH 4P4KA 1YMMB 1LE5A 1QQDA 2AABL 1ZVSB 2WWKO 4PGBB 3RU8H 3U9UA 4H88L 5DO2D 4Y4HD 1KNOB 4XP4L 5C0FA 1YNKL 4XH2A 3V6OE 5D1ZC 3B9KB 3OF6D 3QDMB 4JCLA 3IXAA 3PWUA 2ZOLA 5ESAB 5L8KB 1KCRH 1KYOJ 4LCUA 3EJZD 1QEWA 2H1PH 2X4OA 2GCYB 2I26N 2Y06H 5F88B 4O2CA 4F9PC 4NSKA 4J4PC 4P46B 4PJGF 2L0DA 3OG6B 3OPZL 1KXTB 4IM8A 3QUXA 3TVMD 4LEXL 4WRLA 4WTZA 4L29B 3DROB 5ILTL 4W70A 3D9AL 2YD3A 3GM0A 1I1YB 3QRGH 3IB4A 2CXKA 3DRTB 4YNYB 3Q6FB 3FONB 5C0CE 4UTAH 4DEPB 5EUOE 2UUDH 3LQAH 3HE7A 4P2RE 4JDVB 1NUGA 1IILE 5EU6D 4JG0L 3MV9E 5FUZL 3GSUA 3WHXB 2HKFH 3D6GA 1BJMA 3O2DA 3MLWL 2OQJB 3UMTA 3OKDA 1WT5A 4HH8A 1PQZB 5CIPA 2IFFH 3QEHA 4JQVC 5EU6B 1YEJL 1MEXL 2IAMC 2VLRA 3O3EB 3N85H 5CJBA 2OZ4A 4PJIF 1KACB 3QUZB 1H15A 1MUJA 1FORH 2R0ZL 3SPVB 1F3DH 1I1CA 2NR6D 2ICWJ 1I8IA 3DUHA 2DYPB 3L3KA 4Z77B 3LS5H 4KMTL 1INEL 3AUVA 4PRNA 3MCKB 5IEKA 1JHKL 2Q7YB 1ODAA 3P0GB 3OXRB 1LEIB 3BXNB 3I75A 5FYKU 2AJYH 5A2LH 4LRNH 3HE6B 4NKMB 3MOQA 4LLUA 4PS4H 1FNGB 2ESVD 5F1NB 1ERNA 1E6OL 4GOSA 1A9EA 3U7AA 3QSKB 1QVOB 1AE6L 4L4VE 4DJMA 4NDMB 5F7KC 3IDMB 4DW2L 2IAMB 4M43H 3O2DH 5DWUL 3WEXA 1CR9H 4GXVH 2UY6A 1TLKA 3B2UC 4JVWA 4OLZL 2BX5A 1CGTA 1EGJA 3RKPA 4L4VB 2F54D 3C6LC 3C2AL 3IJHB 5E00B 3L3DB 1MHCA 1DEEB 1LE9A 2JJSC 1K2DA 4HF5H 5K9KB 1I8LC 4IRSD 5HHMD 4U1NB 4WW1B 1QACA 1TQCB 3I6LD 4DGVH 3QDHA 2W9EH 5DVKA 3HE6C 3TV3H 2HTLD 4KJPC 4ZPTA 3VFOB 3I9GL 3VXTA 5EA0H 4P5TB 5DVNA 4QGYA 4NO3A 3CJJA 3GMOA 4OQTH 4WIQA 5GSRA 4LCUB 4PRPB 2P8MA 3U4BL 1P53A 3WLBB 2I24N 1BGXL 3H7BA 4MXWL 5I1IL 3MO1A 4ETQA 4CDGC 5IOPB 3MLWH 2FRGP 4OUUA 3S36L 1KEML 1OTUC 1PKQB 3WO4C 4M4RA 2H45A 4HS8H 4G7VH 3MRIB 3U4EB 4NPYB 4JN1H 3GDBA 5MP6H 2EE2A 1XIWB 1HWGB 4N1CA 3IDGA 4APQB 1JNHB 1BGXH 1X5KA 2C4XA 1MJUL 3D18A 5IESH 3MV7D 5B8CA 3PQYD 2P5WB 3MLRL 1SJEB 5HHOA 3V7AG 2OQJA 1PQZA 4L8DB 3S34L 5FYJH 1MRFL 1V8HA 3GKWL 2F5AH 4N0YH 4W6XB 2CKBL 3BRGC 5ERWA 3SGEH 2JB6A 5GISH 4QEGA 4NQDA 2B2XL 3MCG1 4NQEB 4LNVA 4CNIB 4Z7UB 4H26A 5DRXB 3ZYOA 4MNQA 2NXZD 4FTVA 5INDA 2A6DA 4D0DB 4KK8C 1ZHNB 3O6FC 4O2FA 4K3JH 1QD0A 1D6EB 3HZYB 3I2CH 5F6IB 3HZVA 4U0RC 1BJ1H 2RB8A 4XHJC 1XR9A 5EIIB 2D7MA 1EXUA 1MAMH 4PJHF 4DK3A 3CIQA 2QLVB 2COQA 1Z5LB 4L3EA 4KKLC 3BAEH 4JM2B 3K80A 1U8QB 5J56B 1UM6H 2FBOJ 4ODTH 5K9QI 4I3RH 4B41A 5EFIA 3SOBH 4YIQA 4MDJB 2A2QT 1SJHB 4LSQH 3OG4B 3SE8L 2A73A 3VXQB 4YBQC 4ODWA 2ZJSH 3T09A 4WWKD 1FL6B 3GSOB 3SO3C 4JY5H 1EEYB 5DUML 2P44B 3SGJA 1F4WL 1M7DA 4HHAA 1TMCB 3ZE1E 4R4FL 4KGJA 2DN7A 5C0EA 3MJ6A 3LH2L 3SJVE 3WNMA 1U3YA 4HKBA 3MJ9A 3SGKA 5I9QC 2EDDA 4GLRI 4NQED 3E6HB 3CLFL 1J12A 3B3IB 3MTRA 1WF5A 4S2SA 3BQUA 1M1SA 1D9KC 3MRIA 4Z7NF 1OP3K 4X5WA 2GUOB 5D1QD 4ZFOB 2MHAA 1ITBB 2D3VA 3QXDA 1TZHA 3ARFB 1KF9B 2VLJD 4RDQF 3K8KA 5F21B 4GLRH 2DQCH 3SO3B 2WUBH 4M93B 1FFPB 2ZUTA 5JQHC 1SJEA 3Q48A 4S1RL 4CJ0A 5GS0D 3RDTD 3QDJA 6FABL 1G6RA 3ZKXC 5F6HI 1KENL 2YRLA 1CLZH 1CFQA 4PPTA 3HS0B 2F58L 3VA6A 2DQHL 2XQBH 3QIWC 1W0WB 5IHUH 3C60A 3V0VB 4UDTB 1CT8B 5DHVB 1UM5L 4K71C 2PN5A 4DZBB 4NQDB 3HNSL 5EO0B 1NCCH 3OX8A 4KDVA 3FQRA 1B6DA 1FBIH 3BD3A 3CPLB 4OAWB 4H0IA 1A3QA 1DANU 5CJ8A 3VWKA 3FN0L 1AQDB 2A74B 1JNJA 4X7DC 2Y1VA 4MNHB 3UC0H 1MVUA 2W0PA 3W5MA 4D0DA 5C09E 2R2HA 4ZFGL 4X98B 3D39E 3N9GL 1IC7L 2EIDA 1RZGA 1QG3A 3IVKA 1DN0B 3QCVH 2IGFL 4MD4B 2M8XA 2P7TA 4NHCH 1KEGH 3MC0A 4WU5A 1J10A 1NCAH 2OTWA 4YUEL 4LEXH 1NQBA 4YGAB 4ZQKB 3IKCB 4FQXC 5F71A 3BHBA 4NGHL 5MI0B 5DEZA 2P24A 1F3JB 4G6FB 3BXNA 3QI9A 4BSWA 3BGFC 1T2XA 1B4RA 4UIMB 3RAJL 1G7IB 1Z0NA 2R1WA 1EGJH 5K59E 3CFEB 3GI8L 4JJ5A 2B2XH 4ZNEE 5C0BB 3UTPD 1K4CB 1DSFL 4I3RL 3ZDZF 3DRTA 4NO3B 2CKBH 3MA9L 3NGBB 4RGMC 5EBWA 5DLMH 5A2JH 3RU8L 5C0EB 4P3CH 3WLBA 3TYGH 3HA0A 2X9WA 5C6PB 4LLVA 1ZHLB 1WAAF 1W8NA 2P48B 4XCYB 5D2NA 5BRZB 2PXYD 2HFGL 3W9EA 1HQ4B 3WLWC 4LARL 4F33A 1EUTA 4FXLA 3TBTB 3BGFB 5E2JA 4XP6L 4DOHE 3VXTB 5EBLA 3TVMC 2EE6A 3CDYA 1FL3A 5IVOA 5E94B 1T1XB 1KB9K 3RX7A 2W60B 1FL5B 3N06B 3SE9L 2XRAH 3SDXE 5I1AA 1UXSA 2GK2A 5GXBB 5IMMB 3G5ZA 3ARDA 4R97B 1S9VB 2J88H 4TVPD 1YN7A 1BJ8A 3RHWK 2AS5M 1LEIA 1FO0L 1K6QL 4PGDB 2R69L 5E6YA 4V2CB 4GAYB 3O45B 4YDIL 2EDHA 2Z8VC 4JFDE 4LSVL 4ZAKD 1UWEL 5F1NA 3RAJH 3KPSA 5I1CH 1BEYL 5F72S 1J11A 3V8CA 3VJ6A 1MI5B 1QRNB 3NVQA 2Q86B 4NBXB 1AFVH 3RWEB 3TVMB 1KB5B 1U8NA 5IB2B 1CD9B 4ZD3L 1T20B 1JFQL 3JTSB 5CIPB 1J5OH 1MI5D 5HYJA 3R4DA 4PTTB 1MCQA 2HJKB 5ID0A 5DMKA 5ICYB 4LLAA 4L8CB 1Q9LA 4FTVE 5E9DA 1IC7H 1BZQK 3ARGD 2DM7A 4G6ML 4JHAL 4XNQA 2NXYC 3P11L 3I6GB 3JWOC 4U1IA 1TVHB 4K2UL 2GITB 3ARBC 2P24B 3GMPA 3HZKA 4TULH 4Z78A 3WUZA 3QEGL 5L7XH 4GRLC 5BZWB 4OGXL 2YPKB 1QFWM 2UZIL 1KIPA 4CU7A 2R2BB 3U7YH 2Z93B 4OUUB 5FEBA 4LPVA 2PW2A 3QUZC 2IH3A 2R1WB 3WXVL 1I1RA 2VC2H 4Y1AB 4TSAH 3UTZB 5DQJB 2ESVE 3HB3D 5F8RC 5EU3A 5HHPA 2WUCL 2NXZC 2ZCHH 3RZWA 4UDUA 3GJFH 2PXYB 3GSWA 3F7VA 1BIIA 4PJ7E 5C0RH 3CZFB 4TNWF 4EBQL 5DMGD 4ZS7L 4Z76B 5E2WH 1CFBA 3VXMA 5F7LB 3SDDA 5K9KA 2BC4A 3PGDA 1YPZF 4N9GA 1EFQA 1QSEB 5F7EL 2JIXA 2V5YA 4PJEA 3U46A 2R2EA 1MFEH 4ERSL 4ZYKA 1MY7A 3EKCA 4URTB 5E94A 1GHFH 2MKWA 4PG2C 3LS5L 4KMTH 5GRUH 4JPVL 3B6SA 5I1GL 4B50A 1FCGA 3LQZB 1JV5B 5AAMA 1EO8H 3QDJB 2AXHA 5KSVA 3DOSA 1TQCC 3DX6B 2R9HD 5DYOB 4S1SH 2XTJB 1B0RB 1Y18B 3U7WH 2LQRA 4LVEA 4FFWC 3V0VA 4A6YH 3OMZA 3CXDL 3QDJE 4Z18A 1TITA 3LHPL 2BK8A 4LLWB 3IFLL 3EYFB 1CXKA 1NKOA 2XA8H 3QXDB 2Y36L 1AJ7H 3BQUC 5JIKA 5IVXB 1P4IH 1JTOA 5FFLA 1KN2H 3MV8A 1E4KA 4WFFE 5IHZA 1NBYB 3DI2B 3AC0A 3MV9D 5TE7H 4GG6A 3QHFH 4HK3N 1T6WA 2J5LC 3OKOA 3KHQA 4QRSA 3WFCL 3RL1B 3FO1A 2Y25A 4JFFE 5E2UH 4DN4L 1ACZA 3O8XB 3K1DA 1OP5K 1PZ5B 2E6QA 3X3FH 1GZQB 2CH8A 4XVUC 2J6EH 3NFPA 3EYOB 4FNLL 1XF2B 1CIDA 4OIIH 3QDGA 3HC0B 1X6NA 1H0DB 5I76B 2Y07H 5DT1H 2XTJE 1T0MA 2EKSA 3BH8A 3GSOA 3EO9H 3JWDC 1U8IB 3MRBA 3QXTA 1QLEH 2YPLA 4YHKL 2IPTL 5BMFL 4XRCA 4A6YA 5HD8D 2IAMD 4HS8L 3SDYL 3C5SA 1SEBA 2ZCKL 3FFDB 3HZVB 1C12A 2J8UF 1FG2B 4GBXA 1F90L 1A1OB 3MCLH 2KL6A 3DSFH 4CW1B 2FX9H 1HDMA 4P3DA 1B2WL 1JZ4A 1FVEA 1RURH 2X89A 3EFFB 5CSZB 1G6RL 3NCFB 4JAMA 4LF3B 4IDLA 2F5AL 2DDQH 5GRJH 4JM2A 1UZ8B 5KANG 4AY0A 4NUGL 3O6FB 3F7VB 1IAOB 4JLRB 3HC4H 3K3QA 4MQSB 3QUZD 1G7QB 1QNZL 2CKBA 1G6RB 1ADQL 1RUAL 1NC4A 4JM4H 2P43B 4HIIA 3H3PH 3CFEA 2J4WH 4N0UA 3QEUA 4MJ5B 2EDKA 2NY5H 4DQOH 3UBXG 4TTGA 4PRDA 1NH6A 1CT8A 4F7TB 1QRKA 1X5IA 2VXTH 5DRZA 2SEBA 2E5EA 1CTNA 1MCLA 1WQVT 4BELD 4XI5D 1LDPH 3D85B 4UT9H 3LIZH 3B3IA 2VIRA 2ITDA 3WS6A 4I0PB 2DTMH 4NN5C 2MHAB 1IAIM 1M4KA 3MJ9L 4LIQH 4MA8L 4MXVE 1U58B 5GISL 3G9AB 3VG0H 3L3HA 5KG9B 4CVWA 2C3XA 3V5KA 1MFCH 2O5YL 5IMLA 1VFUA 3S5LB 3CMOL 2H41A 4U6HB 3VW3L 1NGPH 2BVPA 2IFFL 5IT2L 3FN3A 4QO1A 3OKMB 4JE4B 1I3RB 2DWDA 5CEYA 5DD0H 4XNZC 1AE6H 1T04A 3TGXA 3HE7D 2BERA 3MLVL 3ARFC 2IQAB 3JVGA 3JWOH 3IXAB 3T08A 2OJEB 4DKFL 4U1NA 3QWQB 2RIKA 4HJ0C 5IW1A 4PJCE 5HHOD 3OAUH 1HOCB 2FHFA 3MLSH 1PDKA 2CRMA 3GJFB 4Q6YA 1F2QA 4PJDE 5LAXB 3LN4B 1HKLL 5KJRH 1ES0A 3LKSA 4OCSL 1JRHL 3S35H 1C12B 4GBXB 4GRMB 4HGWB 1FAKT 1UJ3B 1FDLL 1MCWW 4MWFA 4IDJL 2VJXA 4FQHB 4NYLB 3H7LA 4G9FD 4QHUB 5HGBB 3K8LA 4NOFA 3HHRB 3EOBA 4M7JL 3D1MC 4HPOH 5D8JL 5BRZE 1A9BA 3C9NB 4QNPE 3P4NB 4WI2A 4Z7NE 4LDLB 3BKJH 1JHTB 3LRSA 3MJ9H 4LIQL 3RA7H 2DRUA 5L6YH 3KPPA 3T0WA 2BVOA 1JHLH 1KTKE 2IBBA 2G9HA 3K74B 4G9FB 4WI9A 5ITBH 3OQ3B 4XWGH 3TCXA 3CGTA 4BQ6A 3OKDB 1AKJB 3AS2A 4U1HA 5DT1L 2ID5A 3UPRA 2JCCE 2X4UB 2VLRB 1RIHL 1AC0A 5E4IA 4WI5A 4FQXB 5ETUA 2W91A 2D0FA 1NC2B 1HQRA 3KPRB 3C6LD 3B6SB 2A6IB 3RIAF 1FFOA 3LEVH 3Q6FA 2NY5L 1MWAL 4IRSA 4DQOL 5DRZB 5B4MC 5BOZG 4OTXL 3ZSSA 1CFTB 1E0OB 1DUZB 1RQ5A 4JM2C 1DN2A 1SVZA 2FEDD 2X70B 3RNQA 4H25B 5CGTA 5FOJA 3L3GA 3IFOA 3T0EB 4Q2ZA 4X6FA 1D6EA 2O93L 3S98A 3VGAB 4GKOA 1NANI 5DHYA 4ZYKB 4RNRA 4YHOH 3QG6A 5SWZD 2PW1A 3BDYH 3QH3B 4Y5XA 5EB9A 1FE8H 5TFSL 3G5ZB 1JWUB 2DL2A 1FH5L 1OOAA 1OTTD 4ZTPH 2NY0C 3BP5B 5E2VH 1MHCB 1LE9B 3O45A 5GZOC 5ESVB 3BI9X 3RJQB 1DLFH 5C0DA 5I9QB 1IFHL 4UINL 1R3LB 1QLEL 1TCMA 2DI9A 2P5WE 1A6TB 4JFDD 1AXIB 1MRDL 2G75A 5F9DC 4R97C 1A9EB 1QVOA 2J8UA 4P23D 2OL3A 4JRXD 5D5MA 5B8CC 3UPAA 3OKOB 4KVCL 1DBAL 1NAMB 4OGAC 1A7PL 2CD0A 5EBGA 4AEHH 1G6RH 4N1HB 3GSRA 1KGCE 4QLRA 1WFNA 3FHAA 5C0FB 5F9JA 2ZUXA 1CF8L 1AGCB 1IRAY 3AGVA 3DX8B 4KKAD 5IK3B 2DJUA 1QSFB 5F7NC 1QLFB 3MODH 5E5MA 4JQXA 5JW3L 3MJ8A 4YBLC 5LXGH 1D5XA 1FYTE 3AY4A 5HVGB 1RIVL 2VL5B 2EICA 3MYJB 2E9IA 1SEQH 3L95A 4OQTA 2AJUH 5DURB 1CZ8L 3DX6A 4KUCD 5DJXA 1EEYA 1HH9A 2X4NB 4HULB 2DQJL 3KLSA 2YXFA 3ARBB 4O4YH 1MHEA 2R4SL 4AMKH 3WFCH 2HJFB 3STZA 2ADIB 4GRLB 4OZHA 3HRPA 5GS3A 3HI5H 5DJAA 2AEPL 2K3TA 2UVEA 1N64H 3EYUL 1UZ6F 2CGRH 2X4SA 4JKPH 1NC4B 4GAFB 4TVSa 1N7MH 1N4XH 3FAWA 3S37H 5D8JH 4ZS6D 5EIIA 2JLLA 3C2SA 4FXGB 2EYTB 1AH1A 3V8OA 2VZ1A 4PFEA 1RZ8B 3A6BH 1DL7L 3RL2A 4OLWH 2G2RB 2AERT 5JPMB 2A77L 4UV7H 4RMQA 3BYTA 5JUEH 4RGMB 4N0UE 4KJWD 1TJHH 2VNCA 1R3HB 1YY9D 4AEIH 3QIBA 4XRCB 4A6YB 1X4YA 5I17B 2GJJA 2EIZA 5LGJA 3QI9B 3REWB 3FTGB 4NQTA 2XIDA 3BUYB 2LFGA 2NY3D 1HDMB 1BVKA 2ZSWA 4LQFL 5IW1B 4CN4A 3QDJD 4YZFF 2R1YB 3QO0B 1WGOA 4S1QH 1JPSL 5LG1A 2MQ0A 4ZOEA 2DLGA 3I3EA 4WFFD 4MQXC 4C56D 2F19L 1RU9L 3TBSA 3QCUL 1N2RB 1T0NA 1XGQA 2EH8H 3VW3H 3MSPA 5IMOB 5FGRA 4U31A 4LSUH 4BK4A 4M8QB 3OKNB 4JFFD 5GGRB 5GZNC 1J8KA 4P9HH 2AJ3A 3BQUB 4GQ9L 1U93A 2GUOA 4ONFH 3WS6C 5TE6H 2J8UE 4ZFOA 4P5TA 4N0UB 5E5MB 3MRJA 1I85C 1OP5H 3ROLB 1I8MA 1PEZA 2J5LB 1UCTA 3MRFB 1GZPA 1JGLH 5DQDH 3MRPA 4PJ5E 4QOKD 2HTLC 4KJPD 5E1HB 4U3HA 4ETQB 4PRPA 4ZFFB 2ATKA 3O8XC 3QUYA 1TNNA 3VXOB 3ULVE 1HHHA 3QDME 5CUSH 1CQYA 1CFNB 4PGZA 3GB7B 1PX3A 3RZCB 4MWFB 5T1LB 5HYEA 2EDXA 2AK4B 1S9WB 2HKFL 1XR8B 1U8HB 3SDXB 4Q9CA 3B9VA 4NWTH 4YEFA 3BPCA 3CVIH 1JWSB 3VDBA 1S3KH 1SMAA 3IFPA 4HWNA 4HKZB 4XC1H 1GGIL 2H32H 3UYOD 1IAMA 3R06A 3TH4T 1JJUA 1VPOL 4OSUH 2NY6C 3OAYH 1ADQA 5FF6A 4AL8H 3T4YB 1YPZA 4LPWA 4WTWA 2YZ8A 1MFAL 3PHOB 4OF0A 5ILTH 1WIUA 1T3FA 4NHUA 5EORL 5DJ8A 1P9MC 1N6VA 4Z7QE 1GGYA 1J8HA 1VKXA 2YKLH 3JWNC 3QXAA 3O9WD 1BX2A 4H5SA 1QLRB 4B7LA 4EZMA 4B0MM 3SJVB 3QWOA 4HPYL 5SX4I 2NY5C 2DL9A 2XQBL 5I74C 4LSUL 3ZO0A 3IYLW 4OCRL 3WFEH 4XMPL 2FHCA 3ZSTA 3ARRA 2VLMD 2VZ3A 3STLB 4IOFD 4HG4J 3O4OB 1P4IL 4Q9QL 2A6DB 5DTFA 4DW2H 1KELH 1FLRH 4R4BB 3V5HA 3HZKB 3VFGH 4PJBE 2NY4D 5BS0B 1BM3H 3PWPD 3S3PA 3RVUC 1HI6B 5SWZA 5IB3A 1DUYA 1KIPB 4K2UH 1YEKH 4BUGA 1U58A 4XNXH 3ZE1F 5DHXB 2PW2B 2VMFA 4Q58C 1RV6X 1KJ2L 1R5VB 4R9HA 2J6EL 1JHKH 1SYVB 4WU5B 2OTWB 4JB9H 3HPLB 3VFWB 1FZKB 3OTTA 5GJTL 5I8OH 1OQXA 4OZFH 4MD4A 3BKYL 4N0FB 4FZEH 2NY4C 3TO2B 5EFIB 2ICCA 3NCCB 5CMAA 1T66C 3ZE0F 4UT6H 5T1KB 2L7UA 4Q9BA 2ADGA 1OW0C 3UBXI 2EYRA 5M7QA 2V17H 5MEPB 3F7QA 5CILH 4QTIL 1TCRB 2WBJB 5CZVL 2VLKE 3FFCD 4NNYA 5GRVL 1MWAA 3MFFA 3NIFF 1U8MA 3QWRA 5KVFH 1T1ZA 1X5HA 5ESAA 2O61B 3WO3B 1YYLH 2EDNA 1YNTA 3IU3B 4NSKB 5JW5A 3KYNB 4DGYL 1Y6KR 4XP1H 4RAUA 3E6FA 1CU4H 4XNZB 2VISA 4GMSL 4Y5YA 3E3QE 1BBDL 4NHCL 1D5ZA 4RMWA 4PLJD 5HHVH 5I1GH 4L3EE 1N5YL 2DQJH 1FIEA 4Z0BH 2P42B 4G6FD 5DJDA 2ZKHL 4XXDB 4FMKA 1NBZA 2V2WA 4PP1D 2BHUA 1CE6B 5HGHB 4GG8B 3TWCH 3B2VH 1MCPL 4P5TC 3QNYB 3QXVA 2CKNA 4PRIA 2EXYD 1AKJA 1CXLA 3O2WH 5ACLA 1D5IL 1T21B 3C8KA 1A7OH 4YXLH 1T4KA 3WL9B 2K1MA 4FQQA 1SY6L 4XAWH 5IVXE 7CGTA 5AD0B 1FNSL 4GAGL 5IROA 1WZ1L 5C08B 2VZTA 1CD0A 3ZE2E 1AGDB 2XQYK 3SPVA 1JNLH 4RA0C 1OAUH 3I02A 2X4RA 5E5RB 5FYJL 3MBEA 3KG5A 4TSBL 4HCRL 1XIWC 1VDGA 4ZOAA 4PV8B 5DJ6B 3T0VA 3TCLA 2OR9L 4R3SA 5HI5D 1EHLH 4S1QL 5K59F 4GS7B 4HDIA 1XH3A 5D5MB 4PJDF 1U0QA 4KRLB 4U3XA 1JGUH 5GS0L 3FOMB 43CAB 3TJHD 4MYWB 4FXKA 3VXUA 4R2GC 2ZNWA 3FQTA 3GSRB 4JQIL 4M1DH 5HGDA 1GRWA 3FQXB 5MEOB 1NEZA 2XRAL 3IVKB 3U6RB 1K5NA 1FGVH 4WDIB 3K7UA 5KN5A 3BE1L 4F7MA 4BZ2L 2JJVA 1NCBH 1X9QA 4MB3A 5E8EB 3IJHA 4MD0A 3A6BL 3F65A 2GSGB 4V2BA 4R4FH 3KWWA 2BC4B 3D5OF 4QRUA 1WBZB 2GI7A 1LO5B 4KK9D 5FYLE 2XWBA 4O02L 1Q0YL 1ORQB 2GW5A 4Y5VB 5C3LD 4I0PC 4NNYB 5AZEH 3H8NA 4WGVB 5HHOE 4XPGL 4X8XA 5K9QG 3BDYL 3KYOB 1U3HC 3G6JA 3WHE0 3QUKA 5I1EH 2HFFB 3QO1B 5EO9A 4KUZL 1VGEL 4DTGH 2IALA 5IROC 4UOJA 3LEYL 4Z7OF 2YD2A 1ZVSA 1INDL 1EBPA 1CLCA 1EAJA 1C5BL 1RU9H 1WC7B 3VDAA 4DKEL 2ENYA 2OR7A 5CSBA 4Z0XB 5IFHL 1J9CT 1ZKAA 4XCFH 3U0PB 1H8OA 5EBLB 3QUYD 2VUOA 3CZJA 1UKTA 5B8CB 4ELMB 2RBLA 4NT6B 4OKDA 4F9LA 2JE8A 3RKDC 4ESKA 5FKAA 5DQ9B 1NJ9A 3BZFA 5I2IA 4WTZG 2VSCA 1IGIL 2BFVL 2IFGA 3BPNB 5HGAB 3IXTB 1OARL 1T7VA 2QSTA 2E7LC 3MRHB 1IAII 4GBXC 4RBPH 1U2CA 4RAHA 3JUYA 4Y5YC 4OQTL 3H3KA 4PUBH 2GJZA 1G9EA 5GQBA 1YUHA 2I5YL 1J8HD 1N26A 4OZGF 1BP3B 4PJFE 5FF6B 2XG4A 3JTSA 4OGAD 1NCDL 2DDQL 2BNUA 4XPBH 3RY6A 1UM5H 1ES0B 4M9OA 2FO1A 1FG2A 2DQTH 3N1MC 2R15A 4Y4FA 3TT1L 4JHZA 3MLSL 1NPUA 1FVEB 4PB9H 3KS0J 1JGDA 1WCQA 4J2XA 1OGTA 5GJTH 2WW8A 1D3CA 4MA1C 3M8OL 1JYNA 2YPVL 4LGSB 3MUY1 4KGLA 3O6MH 3RNKA 2EXWD 1X7QA 3BP4A 4L3EB 2FYYB 2ZUSA 3MRBB 5IJVA 5FHAL 3SY0B 3UCRA 4X6EB 1BM3L 2ATKB 4WI8A 3I9GH 5B38A 5CZVH 5E1AB 3PP4H 4JM2F 2OJEA 2APTA 4AG4H 4AIZA 1CIUA 2QSQA 4F3FB 4JFXA 4OCWL 3LKPA 4HUVB 1C16B 5H94B 5IG7A 5JLZA 3MROA 4FQ1H 3T77B 1CGSL 1PY9A 4ZUWB 5HHPB 3TJEH 4OGYH 3VGAC 4PJBA 5EU7E 2F58H 1MAKA 5EC2B 2IG2H 2LE9A 4HKBB 1LDSA 3HUJB 1J0JA 2Z35B 4UT7H 2F15A 4OIAA 4WO4D 1DE4B 2VIRB 2VR4A 2YMXL 3QWRD 4JR9L 4JKWA 2OI9C 4TNWK 2H2PD 1F6FB 2Q7NA 1IZJA 2NY0B 1X6LA 1WITA 4ODTL 4JRXA 1AHWC 2W9DH 3U0PA 5HGHA 2Q8BH 1A6ZA 5KOMC 5J1TC 1REIA 1UH4A 3QWOB 4PRDB 4XCCL 4LLMB 3DO7B 4KK9C 3WIFB 3SCMC 2WZPD 4EIZC 2PW1B 4HWZA 2X1OA 1AXTL 4EI5C 1UCBL 4U1HB 4AENB 2A1WL 5KSBE 4L3CB 4O00A 4TUKH 3CU7A 1S7WB 3BP5A 1AFVL 5HBBA 4Y16D 5DK2A 3RQ3A 2Z8WC 3WE6B 5CJXA 4RMSA 3SDAB 1JGLL 4KKCD 2OI9B 1KLGB 3TO4D 4JFOA 3ZZ1A 2EH7H 4D94A 4LLYB 5I1KL 5TE6L 1RAMA 1BVLA 4O58L 1TQBB 1BQHB 3LPFA 3RZCC 3VXSA 4HDIB 1O5DT 3LEXA 4OCYH 5JW4R 2J88L 2Z31D 3OR6A 5CMAB 1P84J 1S3KL 5E00A 3HMXL 2MCG1 4F7CB 2JB5L 2EDLA 3OKMA 1H0DA 5CEYB 2UZIH 5I76A 4V1DD 3Q6GL 1U8IA 2NY6B 3PNWA 3RVTD 4WDIA 4XVSH 1MJ8L 1FC2D 2N1KA 4YDJB 3T8XA 1NGYA 3UX9B 1MPAH 2F8OA 3U4AA 5DDHB 4Y4HA 3BZ4A 2FD6L 1T5WA 5DJCA 3TCLB 3QJHB 2VLME 5BXFB 4FFVC 1J05A 3OB0K 5B38B 2VL5A 4JANB 2GT9A 3QQ3B 4MA8H 3MO1B 4JRWA 1TQBC 4NP4L 4XPAH 3IFLH 5E1AA 2A0LC 4P2QD 1A1MB 4XMLL 5IG7B 5JLZB 3QJFB 4OCRH 4U1LB 3U4EA 2AKRB 3BRDA 5T5NG 3O4OC 3QIBD 2X42A 1DSFH 4Z7WB 4M1CD 3V0WH 5BJTB 3C9NA 5ELIA 3IRZA 5DEGA 4KJQD 3B9DA 1FNEA 2W9EL 2BOBA 3B9KD 1S7QB 3U2SA 2HN7B 5ADPH 3V4UL 4MXVF 3MV8E 3HNVL 4XBEL 1JTPA 2DMKA 2ZUQB 1P4LA 5TDPB 1K9TA 1A6UH 4WFHD 4FP8L 3EJYD 5DGRA 4DCQA 5AG8A 2NY4B 5BS0D 4G7VL 1N5AA 1K8IB 2VLKD 3FFCE 4K7PY 4OIBA 5D96C 3SE9H 2DQDL 1LP9F 4WUUD 4U05A 3RWHB 5IHLB 1OPGH 3X12A 3ABZA 1HEZA 1T1XA 5JNYB 3MRMA 3ULVD 2PXYC 2YD6A 3JZ7A 1YEKL 2DMCA 2MMXA 2LABA 4KJYB 5DK2B 5E6ZA 2WBJC 2I60H 5ESVA 5TF1H 4AENA 4PJ5B 4U1SB 1A21A 3WXWH 3WDJA 1T5XB 2Y5TA 4MNGA 4P2RA 4UBDD 3SKUD 2PTUA 2VN7A 4RGOH 4U6YB 4YHIB 2ADIA 2AJVH 1V7MH 4K9EL 4UT7L 4D2NA 3WV0A 2OZ4H 5EO1A 1YEFL 1TXKA 5KSBA 3RRQA 4YHKH 1IEBA 3DMMB 2X4PA 4HPYH 3SGKC 1PSKH 1FGNL 1WZ1H 3EO9L 2RCSH 2R23B 1H9VA 5GSVB 5C0BE 4ZQKA 4LMQE 2F54E 4NRXA 4MQ7B 1UWXH 5IJKA 4K23H 25C8H 2R29L 4PY8J 4HXAL 4PJ7A 4YO0A 2WUBL 4FS0A 5J3HC 1IMHC 2XTJC 1ZV5A 2B1HL 4QNPF 2JB5H 3MRKA 4UIMA 1Y6MR 4MLIA 4OLXL 2ZZUT 1U8OB 2IANA 3PF2A 2BNQB 4K8RD 2RQ8A 4BZYA 3FOLA 4OUOA 1BFOB 4KVNH 1NDGB 4WO4C 5I8EB 5ITFA 2YSSB 2FYYA 5HYSG 2IF7A 2HLFC 5I17A 1N5YH 2P46B 2IQ9H 4MNHA 1A3RH 4WU7B 1A1MA 4NZTH 4M3KB 4AIZB 3WFHA 3VWJC 4PJXB 3U7WL 3EOBB 4HZAA 2YN5A 1R24A 4HS6A 1NDMA 4EEEA 5HDQL 4HJJL 4M1GL 3MACL 1VFMA 1WTLA 1H3VA 3ES6A 5F9JB 1I3VA 4XB8A 3DV6A 4GS7C 1UB6B 3CX5K 4M61A 3W82A 1A3RL 2BOBB 2CGRL 1ZE3C 5D2LA 5LWYH 3DYMA 4XP9L 1FNEB 2APFA 5IKCB 3PL6B 3EHBC 1U8KB 3J7HA 3PV6A 5D6CB 4AT6A 1R6VA 4DVRH 1P4LB 2A9NH 2VXVL 4YQXH 5FYLD 1W0WA 4PBWD 4X8JB 2BMKA 3DMMD 5IB5B 2H2SC 3C5ZD 4FFZH 5CP7B 3H0TB 5FDWA 1IAKB 4FQXA 5DSCB 3VWJB 1SBBA 1CDJA 2FJGA 3BFOA 5DJZB 4LOUC 5JTWA 3VXOA 5L2JB 4Y7MA 3HUJA 1FIGL 4QHLA 4KAQH 3TJEL 2A9NL 4Y4KC 5BRZA 4H8WL 1F11B 5ADOL 1IKFH 2BY2A 4ONOA 2J2ZA 1N0XH 3F6IA 1S78C 3EO1B 3FCTA 3REVB 5D7JA 2JK5B 1U3HB 5E03A 1YNLH 1T7ZA 1RZIB 4GUPB 2AQ2A 3CVHL 3LKOA 4OF5A 3RGVA 5DQ9A 5K9OA 5L9DH 5KS9A 1JVKA 2DKSA 1B88A 4Z8FH 3AXLB 5IB4B 2E7CA 3DNKA 3LEXB 4R8WH 4N0FA 1YEEL 1GVIA 4XVTH 5D1ZA 4BYHA 2A6JB 4QY8A 5GRZA 4NZTL 5C0AD 2JELL 1HXYB 4MJ4A 3ARBD 4EJ1C 4NRXB 3MRKB 4PJGE 4Y4KB 3JUZA 3KXFD 5LGJB 1CFSA 4TPRL 4NN5B 3FMGL 5GRVK 4GW4A 4XNUH 2XKNA 5KANI 3VI4F 3FN0H 3HR5B 1A1NA 1CXIA 4R4BA 3V5HB 1VADB 2HT2D 5L2KA 1CFVH 4TYUA 4EKXA 1O7SA 3AVEA 3TBYA 3CZFA 1MH5B 4Y5YB 5FA4B 2ZUVA 4EI5A 4I13B 2A6KB 3X3GH 3VMPA 5DS8B 3SQOL 2YBRB 4NFBA 5M94B 3EFFA 5CSZA 3V4PH 4CMHB 1RIVH 1U93B 1WBXB 3JV5A 1NCCL 1GL4B 5KAQG 1FPTH 4RX4A 2OTUB 3BP6B 2HKHL 4FQIL 1FL3B 5JO5B 4ONFL 4P2QA 1UM4L 3T4YA 3VXUD 4ALAL 1JPTH 5I30H 4LLMA 1U92B 2EYSB 5C0GA 1A6WH 1RFDL 4HK0B 2P5WA 3C2AH 1I8KA 3VGDA 3BZDA 5DR5H 1PJ9A 4HWZB 2VAAA 3LZFL 3P0VL 3SQOH 2BVYA 2Z93A 1S9VA 3QFDB 4POUB 1F4AA 2AP2A 4M6OL 5TDPA 5DMYA 4KKBD 2ITCB 4WUKL 2DLEA 1EEUA 2YHGA 4RMRA 5A2IH 1P7QB 3ME0A 2EIBA 4YJZL 2UWEE 4R2GB 3BP7B 4F7TA 1KBGH 1NGPL 3BT2H 4Z7WA 1W0VB 2OS7A 3DX7B 4OLUL 3FT3A 1PKQE 4PBVC 4CMMB 4X6BA 1N3NA 5EUKA 5IFAL 2NLJB 3LY6A 3RUGB 4XWGL 5BS0A 1MQ8A 4NQCB 3V4UH 4ALAH 2G60H 4ENEC 2I25N 5D7JB 5C09D 1OCWH 4KDWA 1OW0A 5E8DL 1IAIL 4KRPB 4F9PA 4G80A 5I1DA 5DC9B 2VSDA 1ETZB 4ODHH 1CICA 1CLYL 3RWHA 4TUKL 5J6GA 2ARJB 2V9QA 1FVCA 3ZDZE 2NW2A 2NY0D 4ORGB 1I8LA 1WV7T 5AWNL 3IDNB 2BSRA 1S7UB 1U8PB 2YRZA 1KCVH 1NC2D 3KPRD 1AHWB 3S97C 3ECBB 5DF0A 3N9GH 3B2UD 1UM6L 4ZUVB 4CL7A 4PG2A 3VA2C 4RAVB 4ISVA 4PJDA 4Z7UE 4CJ1A 4Y5VA 1RUAH 4LKCB 1AGBB 3T0EC 1AKJD 4LLYA 3U48A 3SCMB 5DD5H 3ULVF 5I1JL 4MZ2A 1EHLL 2K7QA 3CLEL 1IBGL 3D69B 1U8JB 4Z5RA 1BIIB 5FUCE 3M45A 3TBYB 2VDQL 4OLYL 4OT1L 3NZHL 4YGVB 5E7BA 1E27A 1GGTA 5FIEA 5A3IC 3SDAC 1R0AH 1FZMA 2D4DA 1RULH 5T1DL 4PLNC 3X11B 4M7LL 5T1KA 3IU4L 3MRJB 1JYVA 1GZPB 3OJMB 1NLBL 4RRPA 8FABB 3HI6H 5J1AB 5DJCB 1C7TA 1HCFX 5FB8B 2YD9A 3MRDB 2RAMA 4HIJA 3VMNA 4JZNB 1QR4A 1QBML 3B9EA 3QYCA 1JUFA 3BZFB 4N0YL 3C5SB 4HUXB 1WAAA 3KPPB 2ZSVB 3Q1SL 4LVNB 1D5BB 5TQ0H 1Y6NR 3D0LB 3KR3L 5D71L 1A8JH 1VFOA 5IR1B 3UROR 1K8DB 3KYOA 5GJSL 1EZVX 5IB1A 4P2QE 1G6VK 2ZPKH 2HFFA 5EO9B 1CDHA 4OCNC 5ANMA 5I19H 3IDGB 3O2VL 3UZQA 3HUJF 3FT3B 3NN8B 4AL8L 3GIVA 1OAKH 2E9BA 3IDIA 3CFJB 4U6XA 4MA1B 1UXWB 1UACH 4L5FH 4G5ZL 3GK8H 2BSSB 4POYA 1SJVA 3DMMA 4PREA 4HIXL 1F11A 2CMRL 1T3FB 2NTSP 4NHUB 2ATPA 3RUGA 2Y72A 4ZAKA 1BX2B 1DVFD 3GIZH 1JZ6A 1H8NA 3EO1A 3REVA 1FSKC 2A0LD 3D9AH 4X7TB 4BH8B 3E3QC 5DJ8B 5KS9F 5LKNA 4LVNC 2X4TA 1LO4H 3OPZH 1A7NH 1BQUA 4MDIB 3BO8A 3MUHL 4YHOL 3L7FA 3QZWA 4UT6L 2IQAA 5H37G 5JNYA 1FVCB 5BS0E 3TV3L 3WXVH 1I9IH 1OARH 4WUUE 1MQKL 3VFPB 3MCLL 2NY6D 1C08B 2L7JA 1EIBA 5E9DD 3HI6L 3RI5K 4C59B 3ARGA 2QQKH 1IEHA 3LKRB 4P9HL 3DHJA 3CK0H 5KZCB 3GGWA 2P49B 2W9DL 3FJTA 3KPSE 4LSPH 4K3JL 1TJIL 3FT4B 2R56H 1WZKA 3S9DB 2BRQA 3BWAB 1YUHB 1IL1A 3AFLA 5LGKA 4ZMAT 1ZLVK 4E5XB 3TBVA 2MKLC 2GY7B 2DTSA 1OAXL 3TO4B 1OTSC 1S7VA 3TO2A 2IG2L 1ZHLA 4LQFH 1I9IL 2FL5A 1MLCB 1F42A 1I3RA 2DWDB 3H42H 1JHTA 2NY2B 1VERA 4P3WA 2ICEA 3DLQR 2X7LA 4ONGL 4ODWB 5CFHA 4Z9KB 4OZIA 4V1DE 1UYWH 2EEAA 2FGWH 1INEH 3S96A 1EAPB 5AEAA 4JFZL 1LK2A 3MLUH 4HX1A 5GZND 4PJFB 3DMMC 4NUJB 4M7KL 2ZJSL 4OV6F 1G9NL 3H0TA 4DFIA 3BP6A 3NA4A 2BJML 1ZWIA 2MQ3A 3OBAA 1DL7H 1F00I 3G9VA 4G8GD 1U92A 2EYSA 4CADA 1LVEA 5AYQA 2SEBB 4JFQA 4KI5D 4RMTA 3L5XH 2V9TA 2FLBT 1XZ0B 5H2BA 1MEXH 4ACPA 4DUWA 5DK3A 3D0LA 1S8DA 3WD5L 1UVQA 1S78D 3ZHKA 5IMMA 4H1LB 3TO4C 2PNDA 4NNXA 4UZGA 3BE1H 4OD2B 4ZSOA 5DJYB 2H2PC 1D5MB 4JZJA 1CE6A 1RD6A 4KTEH 1FN4A 4WO4B 4XXDA 4PJBB 4GSDL 2JTDA 3PXJA 3BH9A 1JGUL 1DBBH 2QKIA 1BD2B 4G6KL 4J3TA 4Q6IC 5C08D 2BDNH 1DBML 5KSUB 3FB8A 3T3PF 1PZUB 2GJ6D 4TTDC 1G7MA 2D31B 3FO2A 4QRRE 5GGRY 1N8ZB 2GAZA 1G7JA 1W72A 3MV8D 3NCBB 2X4TB 1HXYA 4K94C 5CWSB 5DHVA 1AR1C 4PJ9D 3QQ9C 4YZFE 1CYGA 3VWJA 5ECJE 5GGQH 3RBSA 2C4FU 4GAJL 2XTJD 3WIFA 2AK1L 4JY4B 3TT3H 4PV8A 2A9ML 5DJ6A 5D7LA 2GKIA 2ZNXA 1Q0XH 1KIRA 3PL6C 1FC1A 3CC5A 1MFDH 2GJZB 3C60D 2WQRA 4OJFL 1AXSA 4N5ED 2W65B 4BFIA 3DPBA 3QDGD 5I1JH 3W0WA 2JK5A 2J7LA 4YR6A 1BVKB 2ZSWB 4GUPA 1IGML 4LCCC 2YPLD 4G80B 4FXKB 3VXUB 2ZUUA 3TLRA 4XPFH 3L5WA 2AKRA 2ZUQC 3QEQE 4JY6A 2XFXA 3QCVL 4MAYD 4YX2L 4HV8A 4P59H 4GKNB 4JG1H 2WBJD 1IM9B 1HIML 5JHLH 2V5RA 5I74B 5AWNH 5D96B 9CGTA 1GXEA 2EC9T 2V7HB 1I7ZA 5MERA 4OD3H 1KIQA 1S7VB 2HMID 1JL8A 1X7QB 3BP4B 5B3NA 2PF6A 4XMKL 1P1ZA 4U2YA 1LO5A 4KKAC 1U9KA 4MJ2A 3UYRH 1YJDL 4FZ8H 1GSMA 1CD8A 1E4KC 4HBCH 2DJ4A 4ZDHA 3RTQD 3SKMA 4BFGA 4LCCB 1EJOL 3AM8A 2IALB 3PWLB 3DUUA 5JHDB 5MHSD 1HHHB 2HFEB 1CGSH 4V1DA 4KY1H 3QUYB 3D0VB 1RMFH 3HC3L 4JPIA 1AI1H 1WCBA 1KV3A 3QR2A 1FFNA 4O9HH 1D5IH 5ISZB 1QBLH 1XR8A 3SDXA 1KLGA 5CGMA 4MX7A 2MWCA 5HVFB 4PB0L 4X7CC 4QHKJ 4PYGA 4X6CE 1B9ZA 1LEKA 3MRRA 1JGEB 1L9NA 1ACYH 3V4VL 1QFHA 2ZCLL 3OKYA 4HBQA 3QG6B 3BH9B 4KC3B 3PG2A 4FQ2H 3VXSB 3EJYC 2BSTB 1S9YB 4Z0BL 2R8SL 1MIML 4IIQB 3HAEA 1XGRB 4ZAKB 2R39A 1CFQB 5EWIL 1BAFH 4N9OB 1G7MB 2D31A 2XV6B 1CD1A 1RMFL 3MRHA 3KPLB 5EH1A 4HUWB 3LH2H 5C3TA 3EJZC 1PSKL 5T3XH 3HI1B 5HHNA 1QKZH 2HA1A 4LU5H 2IH1B 2PR4H 5HVWA 3QDGB 1YQ2A 2XG5A 4N0RA 1A7OL 3S35X 4OZHB 2R8SH 3SE3A 3PE9A 3C5ZB 4YHML 4JFEA 1BOGA 5B4MD 5C0JB 2BSSA 4XVJH 4XX1G 3WXWL 5CILL 5ACZB 5IB3B 2YUXA 5IV2B 2P5EE 3EUUA 4MNGB 2Q76B 2D2OA 4R4ND 1SQ2N 4LCIH 1CICB 5HYJB 1CCZA 4L8CA 4HIHA 4XC1L 4ZAKC 4AYFA 3NAAH 4IHOA 3G5YA 2F53B 1V3LA 2HJLB 3HZMA 4OCSH 4JN2A 5D9SA 5BRZD 1KPUB 1PKOA 4KV5F 1EUUA 1YN6B 4L9DA 4YDJA 3T8XB 1Q9OA 4QXWA 4IMLB 2NX5E 2XZCH 1KJ3L 3MGTA 4OKVA 4GXUM 3QHZL 4Y0GA 5HY9A 3VRLF 1MLCA 1NL0H 5C0AE 1ZTXH 5F88A 3SY0A 1Z0MA 2Z4QA 3C5ZC 4L4VA 1HILA 4O2EA 2ICEB 1G7QA 1QBLL 2KBGA 3L1OH 2W0FA 3Q5YA 1KELL 4HXAH 1OTSD 1AD0B 4JFXB 2V17L 3OJDB 4G8FA 1K8IA 2AXFB 5D7SL 4NQCE 1U8MB 1CICC 1YJDC 2QR0A 3ILQD 1Q38A 4KRNA 4PJXF 3V6FA 5BV7L 3E6FB 2MSPA 3THML 3IFPB 1RULL 3CX2A 2FIRT 2F8XC 2AW2A 3WYRA 5JMRA 4OM0L 3GKWH 2IAND 5J0BA 1M7XA 2HN7A 3QB7C 2KZ1B 4OD2A 4ZSOB 2ATPB 2V2XB 1HQ4A 3U36B 4TOYH 1LE5B 3LPWA 1PW3A 1A6ZB 3K2MC 3QA3B 43C9A 1LNUA 3S4SA 2NY2D 1T83C 3NPSB 4Y5VC 5I1HL 3DECA 3TZVA 4ZSOE 3RVVC 3QZWB 2XACC 4JN1L 4Q7DA 4JJHA 1CDIA 1OF2A 4JVPA 4OFDA 3VXUE 4XP9H 2JIXD 1PFCA 4JG1L 3WIHH 3AXLA 1AD9B 3NOIA 1G7LB 1RSFA 4ZS6C 4U6HA