5C0ND

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPASVSEPVGGTVTIKCQASEDISRYLVWYQQKPGQPPKRLIYKASTLASGVPSRFKGSGSGTDFTLTISDLECDDAATYYCQCTYGTYAGSFFYSFGGGTEVVVERTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDCTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Fatty acid-binding protein, adipocyte
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD01
5EU6E 4J3UA 1A9BB 4M1GH 3WIHL 4QRRD 1ZT4B 5L6YL 3R1GH 5E1HB 1JIBA 1U58A 3LEXA 3NOIA 3QDJA 4X7TB 4XB8A 4MJIE 1BQLH 3KPRD 1RUAL 3E6FB 3MACH 5T3ZE 1FO0L 3MV9B 1YMHB 5IK3A 2VDOL 1DN0B 3BDBA 3VJ6B 1MJUH 4QHMB 4GUPB 5I1CL 3ULUE 4LCYA 3O9WA 4OGYL 3QWQB 4FABH 5IFAH 1U8QA 5KAQF 2CDFB 1SJHA 1UJ3A 4UIMB 3VH8B 1D9KB 2A9NL 4DGVL 4Y16A 3TIDA 4GBXC 2ZUVA 5HVFB 1T6VN 1BQHB 2ID5A 2NY2B 4RX4A 1JN6A 4GW1B 3ZZ1A 4F58H 1ZGLM 1ZA6B 1OARH 4UOW0 1CZ8H 4Z77A 4ZTOL 1B0RB 5J9PB 3O3AB 4XGZB 4L3ED 5D5ME 1QSEA 2RFXA 1CGYA 5I17B 3P4NA 1J1XH 1NCCL 3DETC 3I6LE 3HB3C 3MV7E 2XZCH 4HIIA 1K85A 1MHEB 5F9OL 2O93L 3IDJA 2LABA 2GK0B 1F6LL 4LQFH 2FB4L 5KS9B 1JK8B 3QYCA 3MRIA 3G6AB 4KRPB 1BBJA 5C6TL 3X13A 4RAVB 1IAII 5E6IA 2ZCHH 3VD5A 4J4PA 3VGGA 4E42A 2ZJSH 1VKXA 5GGTA 1NGZA 3D69B 4FFZH 3MO1A 2AVGA 5C0BA 4LOUD 4N0YL 5I75B 1P7QD 1FFOA 1H0DA 1E4XL 1BJ8A 1KJ2L 4FQJH 3MGOB 2JCCE 5C09E 4NQEB 2XI9A 4X4YB 1I7ZB 1MCOH 3QUZD 5EBMB 3BP4A 3QQ9C 4ZS6C 1OB1A 2GFBB 4HWBL 3WS3B 3BN3B 4NQDD 5LCVL 1T1YB 1MWAL 2MQ3A 2YHGA 3MLVH 4LASL 3UJTL 1CYGA 4AZ8A 5I1JH 1WBYB 4NKQB 4NCDA 5L8LB 2QR0A 2VTFA 3Q5TA 4WCYH 1KEML 3HE6D 3EZJB 1MY7A 4NM8H 2B20A 3OKDB 4LHUA 1RY7B 3EO9L 4BM7A 2I9LB 3W9DB 1A3LL 4BSVA 2R8SH 1DQJA 3KPOA 2VZOA 5LGJB 1BJMA 2FL5A 1S9VA 4KQ3L 1UH2A 4LCIL 5EOCJ 2VDQL 3MLUH 1ORSB 2FGWH 3D3VA 4JFEB 3K0WA 1R5IA 2IPKB 4EXKA 3JSSA 4BQ6A 1FIEA 1LEKA 4PRIB 1D5BA 5JLZB 4R2GD 4XCEA 3TO4C 1URLA 3KPMB 1QSZA 4QRRE 3ECBA 2HFEB 1IGJA 3BT2H 4RRPG 3QUYC 5BZDA 3TVMB 1CVSC 4DKFH 1F00I 3BSZL 3KPRE 1YPZF 2BK8A 4JG1L 2DN7A 3EUUA 4OD2B 2Z31D 1E0OB 4P9ML 1FLTX 1RHHA 3PJSB 2F53B 2D0FA 2OXGA 3QCVH 2I27N 2OZ4H 1XF4B 4Y4FB 4EEEA 3MMEB 5D1QA 3SQOL 5CSBA 1VFUA 3JBG7 1VEMA 3NIGF 1U42A 1LQSR 5TPWH 5BVJA 3EO1A 1GIGL 3PUCA 3QH3B 4WENB 5I8CA 4JAMA 4UDUA 1E4KA 1S3KL 3UJIL 3MODL 4MD5A 3WEXB 5A2FA 5C0EA 3ZTJG 4IRJB 4FP8H 5CEZD 5L9DL 4MDIB 2VXTL 4L3EE 4F7TB 2P5WA 2RHEA 5I9QB 2DQDL 5IHUH 1INEH 1LE9B 1QA9B 3KXFD 3FFDB 3QIWA 4PRDA 4BKLB 5F88B 5DMGC 3TCLA 3BAEH 1AIFA 3QCTL 4K3GA 4PGDB 4PLKD 2G2RA 4N0UA 4JZJB 2VLJD 4RISH 4WVRA 3B9DA 3SJVD 3OAUL 2DWEB 2AQ3A 4TPRH 3DVNA 2H1PH 3BD3A 1QLRA 3TZVB 1R3LB 4WO4A 3IKKA 3OKNB 1NEZA 1NCAH 4HJGB 4MB3A 2GHWB 1FVCA 3T77A 2YPVH 1K8DA 3VG9B 1UADC 1AXSB 1ZEAH 4GRMA 4Y5XA 3A67L 2OTWA 4HKZA 5T1MA 2Y07L 1UZ8A 4WV1C 4HJ0C 7FABL 3CVHH 1BQSA 4NQDE 3ZYZA 1EJ6A 3BZDA 3O3DA 4IMKC 4U7KA 5DD6B 5EWIH 1MJJB 2R69H 4C56D 4JLRA 3W0WA 3RHWK 2V7HA 4JY5L 2ENSA 1MFAL 2XA3A 3FQRB 1TQCC 4X9HA 2LQRA 4ZUUA 5HGBB 2LV4A 4H8WC 1NGWA 3D2UA 1QZ1A 2EDNA 4PRPD 3HPJA 4H1LB 2NR6C 4GSDL 1E6JH 2D7OA 3P9WB 4NO2A 2HT2C 2X4NB 3TJHC 4JREB 4PBWD 4OD3H 4K7PX 4LHJB 1UCTA 4N68A 4JQXC 3CFEA 5D1XB 4MHHI 5GS2H 1KIUA 3BKCH 2X9WA 4I2XA 1T7YA 4LRIC 4AT6B 2OMNA 3VXSA 4OCSL 4YHOL 1B90A 3IAPA 1IEHA 1QPPA 3ARDB 4LU5H 4P23D 1JRHL 3FTGB 2BMKB 4FQ2L 1GGUA 3CCHA 4X6DE 3QDAA 3N1QC 1RJLA 4KJWD 5D7IF 3BZFA 2P47B 5MP6L 3DUHA 5FV2A 2R2HA 4G3YH 4O51B 1HI6B 3FO9A 5IGXL 3UPRA 5E95B 2VAJA 4FQHA 2L7JA 5E2WL 5TQ0L 5IFJA 3PHSA 5BO1H 4NKIL 5D6DA 4ZSOB 4HT1L 1TZIA 4J3WA 2C3VA 3C5SB 4MWFB 5AUMA 3U0WL 4M6OL 1AJ7H 4I18A 2F54A 3ZDZE 1FNAA 3C87A 4L8BB 4OJFL 1FFNA 2ICES 1MNUL 1REIA 4HUVA 5CEZE 4A6YB 1KIRA 5L8JB 5TFSH 3GBNH 5EC1A 1UCBL 4GS7C 4EN3C 5IMLB 1YEFL 1L6ZA 4NWTL 4L8CA 5HYJA 4ZO7A 2P24A 3KXFE 3GHBL 3T2OA 3L5IA 3MOBH 2DTML 3QZWA 5A2IH 3BP6A 3CK0L 3O0RL 4HXAL 4JPIB 3VFNA 1AXIB 2ADFL 4HIEB 2FX8H 4HWZB 5D70H 5AD0B 1QR1B 2VLJE 2EEDA 1BM3L 2JKXA 5D2LE 1NL0L 1KCVH 1U36A 1XF3A 3BDXA 3SJVE 2NY7H 3KYMA 1JGDA 2AS5M 3GMQA 5FGCE 4DGIL 1G7QA 1JHTB 5EU5B 1FAIL 3JVGA 2X4SB 2FZ3B 4RX4D 2VXQL 1RZJC 2DI8A 4QHUA 1AI1H 1T66D 1EO8L 4HUXA 4IRZL 1OT2A 4LLMA 4NZRH 3MXWL 4Z0XB 1JZ4A 4NJ9H 4YHNA 3GSRA 1UJTA 3SCMA 1EZVX 1QSED 1KLGB 4D8PB 2QL1A 3MUZ1 3P73A 4QNPE 4NQTA 5LXGL 2J6EA 3FQXB 4FG6D 4HWEH 2YC1B 1GZQA 1FBIH 4C56E 5M7QA 2HKHL 4QF1B 4J3TA 3O6FC 4EUPH 1DL7L 1CGSH 4MQ7B 2OK0L 1XGPA 1BVKA 1IJ9A 1F4WL 5E8OA 3Q2CA 1PZ5B 1D3CA 4LARH 4R8WH 1H3VA 4PRPE 4M4PA 5E6ID 2Z4QB 3T4YB 2XWBA 4MS8C 5D2NB 2X44D 1ZXQA 4MSWA 2DQGL 1CFVL 2CO6B 1MH5A 4KTEL 3ZE0F 3S4SG 3U46B 1T1ZB 5EUOB 3IU4L 2AJYL 1SBBA 5E2TL 3FHAA 5JW5A 2C1PB 1KCLA 2RIKA 3J7HA 2R1XA 1YJDC 4DK3A 4QY8A 3QHFH 3IFNH 1GOFA 5HGAB 5L2KB 4D0DB 5JORB 1S7WA 1F6AA 3Q3GB 5CLTA 2O5YH 4R90H 1JWUA 5K33A 2R0WL 4XBEH 1CGVA 5IESH 2Z92B 4GRLB 2CDGA 5IMOB 3OX8A 1IAIM 3MCKA 4HF5H 3LIZL 3PV6A 1DUYA 4LHUD 1QFUH 1T7XA 1SBSH 2MCPH 3MUY1 2RR3A 1OHQA 4OF6A 2APXA 1SYSB 4JRYA 4PY8I 5EZLB 3ZMRA 1QRKA 5HJ3A 3F5WA 5C0AD 5KSAB 3BUTA 4KKAC 2AI0H 2IC2A 5T3XL 5L2JB 4YNYA 4D0CA 3CPLA 1A02N 4Q9RH 4FOMA 2MHAA 2A6JA 3EOTH 1QEWB 1W2KT 5LVEA 2NY3D 5H8DA 3S6CA 2YUVA 1C16B 2ZZUT 2NXYD 1MREH 5FO7B 1MIML 3DXAA 2C5DC 4G80A 3HTLX 5DGRA 3TIEB 3LKRA 5FUCC 1NMBH 1UG9A 4YHML 3CDGB 4LGSB 4OFVA 4LQ1A 1H5BC 2X4PB 3G04A 4UI2A 3BFOA 4LP5A 5CUSL 1ZLSH 4U7MA 1BFOB 2YBRA 1HNGA 1FAKT 4L4TA 2PW2A 4M02A 1NLDL 4X5XB 1N4XH 3X3FL 2W9DL 1B4JL 2DICA 2JJSC 4P4RB 1X4YA 4KKCD 3V4UL 5J1AB 3FT2B 4L29A 1I3GH 4N9GB 1YEKH 2X4QB 4ZUTA 3O41B 1IEBB 4GKOA 5IW1A 4UBDC 4XNXL 1OLLA 4U49A 3CFCL 3EO0A 2GI7A 3HNTH 4X6CA 4Z5RB 2SEBA 4XMKL 1RZIB 1QSEE 4ESKA 1RZ8B 2WUBL 5LBSL 4U4BA 3LPGA 1W0WA 1N0XH 3QIWD 1EXUB 3SKNB 5DURD 5JOPD 5B39A 3MRMB 4HK3N 3L7EA 3PWJB 4AIZB 4GW4B 5BOPA 5BV7B 3TGXA 1CI5A 4TRPH 1UZ6E 2R9HD 2X42A 1OP3K 1NMCB 2AXGA 3SPVA 4C54A 1RU9H 4F9PA 3DX6B 3RJDA 5IROA 4IMLA 1I7UA 4NOFA 4WO4D 4PRHA 1MFEH 3PE9A 1LO4H 3AREB 5FA4B 1T20B 4U6XB 3T0WA 3ZT7A 4XHJD 4OTXL 3UCRA 5IFHH 1FGVH 1L0XA 1FGNL 3RL2A 3C60B 5FKAB 5HTSA 3U9UA 3MFFB 3QNXA 3DV6A 4R3SB 4F7CA 4KK8C 4X6FB 2CUHA 1RMFL 5DJDB 1PG7X 3GSOB 4HUWA 5CILH 4GFTB 4DOHE 5GGVL 1M71B 2ZSWB 2XKNB 4RFEB 4OAWA 5C2UB 4JJ5A 2CRYA 2IH1B 3T8XB 2MCG1 1N8ZB 1LO0L 1OP5H 1ZV5A 3H9ZA 4PJ7F 3VXOB 1FZMA 2D4FA 4WWKB 2VR9A 2ITCA 3BQUC 4MDJA 4OIIL 3DSNA 5D72L 4OLUL 3OR6B 1NMAL 4KI5D 5TE7H 1JP5A 5KVEH 5ALCH 3V6BR 3RVXD 1OAUH 3D2UD 5C0AE 3CSPA 2EKSA 3TT1H 5FCUL 3U6RA 5HI4C 4I0KA 5HD8D 1FVDB 2AJUL 2YXMA 3EYUH 3JV4B 5ID1B 4Q9CA 1RK1B 4XRCB 2X7LA 3OHXA 2ZCLH 5DFVC 2VL4A 2UWEA 3UTTB 1FNSL 3DMMD 1A2YA 1L0QA 4ODWB 3BIKA 4Y4KA 1KPRB 1V8HA 2YZ1A 1A4JB 2YSSA 1JYVA 1NFDB 1B2WL 5IBUB 5DJCA 2YRZA 1PKQA 5HHQB 1I4FB 5DQJB 4ZFFB 2UZXB 3RU8H 5DJZB 2VH5H 3F7VA 3EBAA 4JDTL 3M17B 1X5AA 1JGUH 1DBJL 4HMCA 4K8RC 1D5IL 4OBSA 5ERWA 4JHZA 1IKFH 1ZTXH 2IAMD 5TQ2H 4X99B 1AP2A 5KN5B 4MAYA 5ICXB 2R15A 1HINH 1KB5B 4NNXA 3VWKB 4DVBA 3QQ4B 3ILPA 3D0LA 4F3FA 3ROLA 5I30L 2OP4H 3OZ9L 1B6DA 1U91A 1QKZL 4HK0A 4AQ1B 3GSVA 4NT6A 3RGVC 4EQ2A 5C6WH 4XPGL 4PTTA 3V5KA 2F54D 1CDUA 4L8SB 4NQCA 5IOPB 1BLNA 5I1EH 1FQ9C 4NUJB 4BZYA 4FQCH 3FQNB 2V2WB 1RUAH 1QBBA 3G6DL 4XNZC 5I2IB 1BAFL 1AD9B 3BW9B 3OL2A 1XGRB 1UWXH 5HYJD 2J8UB 4JQVA 2LU3A 3MRRB 4XZUB 4PJCF 1RVFH 4CVUA 1FO0A 5JOPE 4FFWC 4P3CL 1AQDB 5KTEH 4X6BA 3K4AA 2A9NH 4ZOAA 35C8H 2DM4A 3H9HB 3SN6N 2N4IA 3C8DA 2YEZA 3JTSA 5D93B 2G75B 4NHUB 1EEZA 4PRAA 2NY5L 1MCWM 3IDYB 3U30C 3IU3B 4JM2B 3FB8A 1TVHB 3MLZL 3QPQD 4YDJA 1YN7B 3A0OA 5CAYB 1NCDL 1QVOB 3QFJB 1NCCH 1A7BA 4RFOL 4NWUH 1QFWH 5ESQA 2P5EB 4GKNA 5HYSB 1KTDA 5CGMA 1J18A 4QRQB 1CS6A 2VLLA 4ELMB 5I1GL 3QCUL 2D4DA 3W39A 4QXTB 1SM3L 4N0CD 1WWBX 1XH3A 3FOLB 5B38B 1R5VB 5D5MB 4KI5E 3DJ9A 1YN6B 2PN5A 5HDQH 4BH7B 5ACZB 4LSVH 4RRPA 3B3IA 5AEAA 1DDHA 1A1NA 3D6GA 4ZXBA 1I8MB 2ZCKL 5EO0B 5JHDD 1E6OL 1F3DJ 3HMXA 5GJTL 2N56A 4G6AD 5HVGB 1CE1L 4JFOB 1S7TB 2LVCA 3D18A 3VGDA 2HRLA 3TN0C 1MJ7L 3WE6B 4LASH 4I2XE 3HE7D 4X7SL 3MLWL 3DX7B 4XVJH 4Y2DA 1MWAA 3RAJL 1D5ZA 2R29L 3BPOB 5GIRA 4LLUA 4L8DB 5TF0A 4U6TA 1AD0B 5AAWA 3MNWB 3RDTB 1RUKH 3ARRA 2I60L 4RMRA 4XPAL 2M8XA 3OJMB 2PETA 4KPHL 5J3HD 4JRYD 1QFHA 4J3XA 5IBTL 3KLDA 1K8IA 5DRNA 2DTSA 4KK6D 4MA1C 5FOJA 1LP9A 5HGDA 4DWHA 1FE8L 2VDLL 3FZUC 2VITB 2XTLA 2IFGA 1OTTD 4I0PA 1VFBA 3AS3A 3OG4B 1QRNB 5DTFA 5GHWH 3NH7H 4GXVL 5I74B 1OQXA 2D31B 4D9QD 1EUTA 3GKWL 4Y2OA 1H3UA 5CD3A 3NPSB 2EO9A 3QFDA 4JQIL 5HYJE 3EJZC 4PGCA 2EEAA 5JR1L 3ARPA 5H2BA 5F1SA 3OAYH 4HFUL 5CIPA 1A7QL 3Q1SL 4L5FH 1KIQB 5KJRL 1FNGA 2UV3A 3JUZA 2Q7NA 1GAFL 2AK1L 1FLRL 3KPSD 5JXAL 1J5OL 2R1YB 1GVIA 2KBGA 4YUEH 3RTQA 4R4FL 3SDCD 4TUKH 2CKBB 3UPCA 4CVXA 2DQCL 1YECL 1YYLL 2VXTH 1V3JA 1ZLVH 5GISL 3GRWA 4OLYH 3D25A 1S7VB 1DVFB 2AJVH 5MEOB 1AGCA 2EC9U 3OXSA 3P9MA 4NN7B 1P1ZA 4Q7DA 3S88H 2ESVA 4OM1H 4C4KO 3QCTH 1AHWA 5GGSY 1V3KA 3TA3B 4YHIB 2UUDH 3ZE2E 1JV5B 4UQ2B 5T1KD 2CSPA 1CDYA 3OAUH 2DQFB 4M7KL 3QXDA 5IHZB 3IT8D 5K59F 3O3EA 1EHNA 1XZ0B 4ETYA 3QA3A 1KPUB 2A73A 5E8NB 1OL0A 2D7TL 5IJVB 3B6SB 3WCYA 2H2SC 3BPLB 3QI9A 1JMZA 2ZUYA 2CLRB 2IBZY 3GJFB 4PRHD 4M6MH 1MVFA 1EH9A 5JHDE 1KUMA 4YR6A 4KAQL 2Y07H 4YAQB 3WFEL 7FABH 3QHZH 1FZJB 3RL1A 4Q74A 1IC5L 2CUMA 5EZJA 3S5LG 1NC2B 4HPYL 3MRLB 4JDZA 3FOMB 3CMOL 4BQ9A 4WEUD 3UBXB 4NO0B 3RA7L 2EXWC 4JY5H 1QNZH 1P7QB 3SBWA 2BOCB 2G9HB 5J06A 4G6FD 4NKOB 2DLHA 2IPUK 1I1AA 3LY6A 3ZHDA 3KHQA 2NQCA 1RUML 5F3BB 2FBJL 4QXGL 4Q6YA 2EDOA 3P9LA 3TBWB 1PYWB 3AAZB 4JRYE 4JRXB 5TDOB 1DP0A 2LVEA 1IEAA 3D9AL 3U36B 3GB7A 4OGZA 5BRZD 3HE6B 4PJFF 3KR3L 4Y1AB 1XF2B 4KUZL 5IF0B 4PJGF 4ZD3L 3HC3L 3DLQR 3VXPA 4YHOH 3RIFK 1HH9A 4LCUB 3FB6B 5F21B 2DI9A 1JRHH 1I8LC 2EYSA 4I3RH 4D9QE 5IKCB 3KPLB 4IJ3B 3JV5A 1LEGA 2A6KB 4QHLB 3TEUA 4KZDL 3CFKB 3C5ZC 4Y4KD 4G8GA 5GS1B 1KJVB 4NN6C 5T1LB 4OQ1A 43C9B 4HV8B 2NY6C 4DZ8A 3O6ML 1D6EA 1JUFA 3M8OH 3QP3A 3DO7A 2IALA 1ZHLB 4IS6A 3T0EA 5E2WH 4LVOB 4J1UB 5HGGS 1EUUA 5CSZA 2UZYB 1G9NH 2BCKB 4NKIH 1K6QL 2HTLC 3KPSE 1Y6KR 2W60A 1C7SA 4MAYD 4Y4HD 5C9KA 2GCYB 4OQTH 1ETZA 4OJFH 1NLBH 3IAGC 4LMQE 4K3HA 1G1CA 5ESAA 3GMNA 4LVNB 1NBZA 4DKAA 3UROR 4WV1B 2BXZA 4NC2B 2IMMA 4NWTH 2VJXA 4NQCD 4X4XA 2YA0A 1M6OB 2FEDC 2BP3A 2V5RA 4NIKB 1I7RA 4O5LL 4JN2A 3ULVD 3MUHL 4PJ9B 4WW2C 3SGKC 3GMRB 2F5BH 1NL0H 2QKIA 1CG9A 3BEWB 2VDNH 3GI9H 3WUWG 4R4NC 4L9LA 4U2YA 1NBVL 3L9RA 1CGTA 2QQNH 5TF1L 1IGTA 3BUYB 3QDMB 3IDGA 1J8HD 1YY9D 3ALWA 4MD0A 5E94A 1WTGT 4PJHA 3CUPA 3NACH 4NZUH 1AKJD 3BN9D 3KYNA 2VXQH 4PRHE 1ORQB 1WQVT 2VQUA 5FYJU 2I25N 32C2B 5JPMA 3QHTC 2GY5A 4M6NL 3TJEL 3OB0H 3VXUD 3ARSA 3ULUC 3VCLB 5IB1A 5LXGH 2E3VA 5J13B 2ARJB 2VZ3A 2VE6B 1EAPA 4OLZH 1PY9A 1CFTA 1ZANL 4M1CC 4EBQH 1XCQB 1EGJA 2H8PB 2IH3B 4LVHC 5D7KD 1DTUA 3TO2B 5EBGA 2K7PA 4F8TA 5D7JA 3HAEG 2H2PC 3PXJA 3PIQA 2F5AH 1ZHNA 4K3DL 3BXNA 4JVUA 5L7XL 4R96A 1BZ7B 2DL2A 4LLYB 3CFJB 3O6LL 1NFIB 4U0QB 4U1LA 4YDLC 3ESUF 4ZYKB 3VFGH 3ARBC 3ARFC 1FL5A 1NSNL 2ICWA 2AJYH 5BRZE 3PL6B 3H9SB 2HMID 1T83C 1JGLL 3IF1A 1U95B 4YXKL 3ARWA 2B1AH 2DQUH 3REVA 5EU3B 1Q9WB 3EYSH 3V4PH 4PJ7E 4NRXB 3RWGA 4FFVD 4LAQL 1I1RA 3O4OC 4XXDA 1HN1A 4Y2DD 5DK2A 4C57C 1J0IA 4NQXA 5HYEA 3QIBB 5ISZA 2DDQL 3KNBA 4ONGH 3CC5A 1R3JB 2J88L 4W81A 1PKQE 1AO7D 2DQEL 2VL5B 1RZ7H 5EDXA 1W8NA 4G8IB 4MQXD 3DROB 4LLDA 3HRZA 3U7WL 4APQB 3WN5C 5T3XH 1FZKB 3VXNB 4O2CB 2HJFB 3B9VA 1UXWB 1BHGA 1S9YB 4K7FB 2GJZA 1F13A 3X12A 1WCBB 4ZFGL 1T0PB 3LN4B 3VGFA 4IIQC 5E8DL 1P9MA 3CFBA 5J1SC 3CH1B 2W0KA 1FDLL 1MIMH 1EHLL 1ADQH 1KCSH 4I0PD 1G7JB 5JNYA 3T65B 5JUEH 3ES6B 4NQCE 3RUGA 1YC8A 1UWGL 1JPSH 4YO0A 4TTGA 1TJHL 5I1KH 3OJDA 2X40A 1T1WA 3C6LB 3NGBB 2X1XR 4HS3A 3PDOB 3B9KA 3VGEA 3PGDA 1TITA 4KGLA 1G6RB 2R23A 3X3FH 4MVBD 3D85D 2XYCA 4YDVB 4BA8A 1J8HE 4OKVA 5ID0B 1XGUB 2KKQA 2XWJA 1U58B 3LEXB 5DFTA 3QDJB 2CGRH 2RB8A 3WLWD 1N5YH 3OKMA 3TT3L 15C8L 5IK3B 4PTUA 4Y0GA 4QWWD 5JOEA 3HI6L 4NBYB 1SY6H 4OZGE 1EBAA 4R97C 3T0DA 4LCYB 4WTXA 3O9WB 2Q6WB 3STBA 4PJCE 3VXUE 2BRQA 3MRHA 3OV6A 1J1OH 2E8ZA 1SJHB 1UJ3B 2G60L 1CF8L 1SEQL 4Y16B 4P2OA 3TIDB 2W07A 3BP7A 1MI5A 1EV2E 1JN6B 4Z0BH 5IVNA 3P30L 5D7KE 3BKYH 3SDDB 3UAJD 3TBSA 4MCYA 2VQTA 2ERJB 2AK4A 1JGVL 1RIHH 1XIWD 2RFXB 2XA8L 1NKOA 3P4NB 2Y5EA 4JKMA 2WZPD 1FGNH 4MNGA 1ZLWK 3C5JA 2GIYA 2WWKO 2Y36L 1CL7H 3GSWB 3JWDC 4HIIB 5CZVH 1SEBB 4Q97A 3IDJB 3SO3B 4W4NA 3U2SA 3BGFB 2NMSA 1WEJL 5GGVH 2HFGH 4P9HH 3VFSA 3WKMH 3BPNB 1I1FA 4CMHB 2EDTA 3S7GA 1BBJB 3H0TB 4WI5A 5E2JA 3MJ9H 1WZLA 5E6IB 3U1SL 2DQIH 4E42B 1VKXB 1CT8A 2BNRA 4PY8J 1NGZB 4Z7VF 2M2DA 3G6JF 3MJ6A 4BK4A 2HJKA 1J05A 1YNKL 3QWOA 5C0BB 4OLUH 1NMAH 1FFOB 1H0DB 4LOUC 3E3QE 2DLGA 1AO7E 4IOFD 4J6RL 4PUBL 4KK5D 3EDFA 3RZCA 1KJ3L 1I1AD 4OF7A 5FCUH 5I1LA 3BP4B 3QUZC 2AJUH 1KB9K 4OZ4A 4WUKH 4ORZC 1TJIL 2LU4A 1NBQA 1A5FH 1BP3B 1LWRA 3HC4L 4A6YL 1DFBL 1F90H 1BQUA 3LH2H 3JV6A 5C0DA 3BH9A 4AMKH 4U33A 4GOSA 3VXRA 5BOZG 4MNHA 4BSVB 4MAUH 4J8RA 4MNQB 1DQJB 3KPOB 3UTZA 1KYOJ 2FL5B 1AY1H 4OFYA 4JDTH 2FH6A 1NAKH 3D3VB 2X4UA 1R5IB 4TUJA 1Q72H 1NUNB 1O7SA 1CXFA 4XCEB 4R2GC 5FM4A 3CLEL 3CJJA 3IVKA 3ECBB 3TBTA 2EICA 2VLKA 4JKLA 2X9XA 3CAFA 5A3ID 5BZDB 4ONFL 4TSCH 4OZHF 2YPLB 3H6JA 3IDUA 2DLEA 4Z7QE 2LE9A 4PJDA 2WLYA 4D9LL 1I85C 5IG7A 2Z31C 4JKPL 1AC0A 1B6UA 1BAFH 1QBML 2X5PA 1N26A 4NJAH 3ROOA 2F19L 4PJAA 5D1QB 1GOGA 2IFFL 3RNKA 3CVHA 5BVJB 3ZL4H 3HNSH 3EO1B 5I8CB 4UDUB 5C0EB 2UYLA 3A6BL 2JB5H 3DVGA 4KC3B 2J4WL 1LO3H 1I9RL 3S37L 5CJBA 2QSTA 3I9GL 1MRCL 4ALAL 2ZG1A 2P5WB 4Y7MA 4F7PA 1RAMA 4M62L 3HS0A 3MLZH 3C8HA 1OAZL 1NCDH 3MLSH 5DURB 4F37K 5DHVA 3TCLB 1HQRB 3GI8L 2DRUA 5EZOL 2LAAA 2G2RB 4N0UB 1A3QA 2P45B 5J56B 4PLKC 4AK1A 4UQ3A 1WV7T 3AROA 4EI5D 1QLRB 3LKNA 2NX5D 5GSRA 5K59E 1NEZB 1SM3H 1A6UL 3WO3B 1FVCB 4QRPB 2AV7A 4K94L 1VGKA 1K8DB 4QRTA 2PYED 3K2UL 4GH7B 4PJ5A 4PBVC 1FSKC 4GRMB 3SHSA 4PP2A 2B7DT 1MQKL 1XGTB 3QJHA 4HKZB 1UZ8B 2R4SH 2ZCKH 2OR9L 2J5LB 3CFDA 2H26A 1A1OA 5I1IH 3O3DB 3EAKA 1OAXL 2JF1A 1T2XA 4LSTH 2B2XL 4H5SA 3DX8A 4JLRB 3W0WB 4NFBA 2V7HB 3RRQA 4JFQA 5C07B 2R29H 5MEND 5GPRA 1A0QH 1OGTA 3GNMH 2ITDA 3PQYD 1NGWB 4PJIA 4DTGL 4OZFB 1OWWA 1N64L 5T5NF 3WXVH 2AJXL 4NO2B 1KXTB 2RJMA 5SWZA 2I60H 1MAMH 3EOBA 3PNWB 5IQ7H 3E2HC 1A6WL 4KPHH 3K8KA 4JG0L 4JHAH 3VMNA 5I76A 2MPAH 4JFHD 4AIOA 4PJFE 3VFOA 4Y88A 3DBXA 3VXSB 3L3KA 3A6CL 4G7YH 1X4XA 4YHKH 3OF6A 1FE8H 2AGJH 4UDTB 2VDLH 1GGCH 3BP5A 4X4ME 1NUFA 2VR5A 4P23C 4K71B 3CCHB 3EYOA 4X7FC 1RJLB 3BZFB 5SX5H 4KJWC 3V4VH 4HCRH 4H0GA 2R2HB 3GKWH 5JIIA 3WDHA 1S7RB 3FO9B 3L7FA 3OJVC 1CLCA 3UPRB 3MA9L 2EYTA 5TDPA 3V52H 5JW3H 4FQHB 4JQIH 5IFJB 5FYJH 2VZVA 1ZLUK 1PW3A 4KJYA 5D71L 3D39A 12E8L 4Z7WA 3BKML 4XVSH 5BV7L 1TZIB 3Q1SH 1FP5A 4XCFH 4XCCL 5ILTL 3X11A 2C3VB 1K5NA 3HMWL 5AUMB 5IJKA 4I18B 4QTIH 2F54B 5CSGA 2AK1H 4HUVB 1QSVA 4RMVA 3LQAC 2YD5A 2PYFA 3DIFA 1KIRB 5F9JA 3S5LA 1RFDH 2DF3A 3BE1L 4OZIA 4HKBA 2R56L 4RMWA 2XXMB 5F7DA 4PJHE 1YECH 2P24B 3LQMA 1R5WA 4U0RC 5F96H 1EJOL 1MUJA 2A1WL 3QZWB 1OD9A 4KMTL 3VFNB 2VNCA 4FQ1L 3MLPA 1XF3B 1HEZA 3D5OF 4L3AA 4GXUN 1O0VA 1FFPA 1WT5A 2JJUA 1FCCA 5GRUL 2Q86B 3GMQB 2NX5E 1O7VA 4H8WH 4OB5L 2AXJA 4M7LH 4ZO8A 2W92A 2PYEE 1MI5D 1W72B 5GGVY 3SOBL 4QHUB 2D7TH 1NGQL 4HUXB 1T66C 4TSAL 4P5KB 4ODTH 1CCZA 1MHHA 1IC7L 2V17L 4YHNB 1XR8A 3SCMB 5T5FL 3IGAA 5FDYA 1ZKAA 3FO1A 1P84K 4YBQD 2V5TA 1RIUL 4E41A 5ADPH 2HN7A 1GZQB 4FG6C 4OIBA 4DAGL 2NXZD 4HPYH 1UA6H 4KROB 1O5DT 5HYQA 3CMOH 5MENE 4X5WA 3KWWA 1MRDH 5E9DA 1NQBA 2DLFL 3FJTA 3PQYE 4TNWF 3PWLA 1LEIA 2E7BA 2Z35B 3QDHA 5JQ6H 2VC2L 2Z8RA 2B8OT 4P2RA 2BRRH 3V5HA 4MSWB 1SJEA 4ZFZA 4X7DC 1VFAB 3T09A 1MH5B 1RUMH 1ZK9A 2FBJH 4QXGH 4ELKA 4HSQA 4GO6B 3AU1A 4JFHE 1XCTA 3D9AH 5JW5B 3MX0A 1V05A 5I8KL 4OLWH 1KB5L 2DMCA 2E9IA 2XTJB 3KR3H 3I85A 1IE5A 1S7WB 1F6AB 3LD8C 2FYYA 5J8OA 4E0RA 2UUDK 2GSGA 3HC3H 2B1HL 4ZD3H 5J1TC 4N1HB 5CGTA 4HXBL 3WUWA 1C8PA 2A0LD 3OX8B 1A9BA 3MCKB 4XWGL 3PV6B 1DUYB 3NCBB 1SMAA 3HCVA 5DD1H 3HG1A 4XCNA 3DV4A 4L3CA 1IFHL 3VXRD 2EYRB 3MLYH 2YN3A 1JRHI 1JYXA 3O8XD 1TJGL 3MV9A 3RUGE 1YMHA 5DWUL 2ZOLB 2O5XH 1LDSA 3VXTA 4OFYD 4YNYB 2EZ0C 3CPLB 3OR7B 2HP4A 4YZFF 1I8IB 3O2VL 1LO2L 3NIDF 2DJ4A 2MHAB 1PQZB 1RZJH 1K6QH 2CDFA 2VDML 4UIMA 1NC4A 1D9KA 5T33H 1PY4A 4K23H 2NY3C 3VA2C 1U3YA 1BQHA 1WZ1L 2R1WA 5IBUG 5KS9F 1T7VA 2D7NA 4GW1A 3DXAB 2FWOA 1LK2A 2NXYC 4QHKI 1CXHA 4W6WB 5IBLD 4G80B 1B0RA 4XPBL 2NY0B 4PJ8A 2YRLA 4I3SH 4HFWA 1YEEL 5F93C 1R3IL 5DMKB 1ZT7A 1CLYL 1UC6A 1IKNA 3HAEA 3KYAA 2PR4L 3P0YL 4M5ZL 4DN4H 3G04B 4O5LH 2YBRB 5B3JF 4L4TB 2E6PA 1MHEA 4RQQA 4TULL 2GK0A 4F8QA 4OGAD 4L29B 1JK8A 1KELL 4KKCC 4LCWD 2EKJA 2XT1B 1CBVL 3SE4C 4ZODA 5IW1B 4LL9A 2YD3A 3H7LA 2W91A 2EIEA 1HWHB 3EO0B 2X9YA 4LSDA 3D69A 4KVNH 2APTA 4X6CB 1LMKA 2SEBB 1G1YA 25C8H 3OBAA 4YHLH 1X6LA 1U41A 3TBYB 1WUNT 5K9JH 3MGOA 1YEIL 1CICA 1F4AA 2EXYD 4Q6IC 3B2UD 3RNQB 2Y9RT 5CBAA 1ACYL 4C59B 5B39B 1FYTD 1K9TA 3L7EB 4OI9A 2GFBA 4WI2A 3WS3A 3GBML 3B5HA 5ENWA 2D3VA 2AEPL 1WBYA 3TYFA 3SPVB 5DDHA 3S3SA 1ZANH 3WHE1 1I7UB 1OW0A 3RWFA 2NY6B 1S7XA 3FQUB 2DMKA 4XHJC 1HHGA 3SE8L 3U9UB 5HYFA 5BXFB 1NCWH 4F7CB 4LSPL 4MXVF 4FQPA 1AGDA 2IPTL 4Y5XC 2W59A 2IG2H 3TYGL 1ORSA 1NSNH 2IPKA 4JY6B 3EDJA 2P42B 3IKCB 3BWAB 1QBLH 1RUQL 5JHLL 4JJ5B 5J12C 3KAAA 4YXKH 5JLZA 3INUL 2VUOA 2A77L 4GQ9L 1FZMB 3L5XL 4LAQH 2ITCB 3G6JE 4PS4L 5E8EA 3TVMA 3VXRE 4UV7H 1XFPA 4KI5C 4M48L 1DBAL 1WGOA 4G5ZH 4OD2A 2EKSB 4Z78A 3RVXC 3HI5L 3U4BL 3U6RB 3BIBX 1T03L 2HTKD 3NABL 4BZ1L 2F53A 5HD8C 2C4FU 3STLA 5D1ZD 2X7LB 5C3LD 4GG6A 1XF4A 3OHXB 3MMEA 4WI8A 3IDNA 4GRWH 2UWEB 2PO6A 3IS1X 2YKLH 1B88A 3WFCL 1A2YB 4W4OA 3DMMC 2BVOA 5E8DH 2CKBL 4Y4KB 1JYNA 2EDDA 3OF6D 4JCMA 3GGWA 2YSSB 4LPXA 3O2DH 5DJCB 3WIFB 1EHLH 4EOWH 3F7VB 1P5UA 4PJDE 1C5CL 1CDIA 2Q8BL 1TJHH 2EDQA 3WLBB 4KGJA 1UYWL 2H9GA 1ZT1A 4FXLA 5ANME 1P4IL 5BZWA 4BH8A 4PGDA 1AP2B 3SDXF 4PJAE 1N7MH 4KRMB 2IAMC 3D39D 4NNXB 3MGTA 3ILPB 3D0LB 2YD2A 5HHOA 3ROLB 5CP7A 3B5GA 3KLAB 4LCWE 4AEHH 2VR4A 1U91B 2OQJA 5B4MD 3VFUA 2V6HA 3GSVB 4NT6B 5ECJE 3OKNA 4PTTB 3V5KB 4GAFB 5F7MC 5DZOA 4GKSA 5HHVH 1BLNB 2ICEB 5JO5A 3MZGB 3LMJH 4M1DH 5JIPA 4WY7L 4IRSA 3W2DL 3L3IA 4X9FA 1Q0YL 4V1DB 1OP9A 1F4YH 2R0LL 4OGXL 1XF1A 5L0QB 2FATH 4JFDB 4WU5A 1ZA3A 1FYTE 5BVPL 4AIXA 4X6BB 3TLRA 3U9PH 4PJEF 5SV4A 3MOQA 3UO1H 2ZOKA 1OSZB 1EPFA 2XKSA 5EU7E 1MJJA 3JTSB 2JLLA 3L5JA 1G9MC 3S35X 2B0SL 1ERNA 4PRAB 3B8YA 4P5TC 4MXWL 2BVTA 3FB8B 4H1LH 1JGVH 1GPOH 4YDJB 3JVGC 4U1JA 5HGBA 3QPQC 2CO7B 1RK0A 1S7UA 1XGQB 3NBNA 2HLFD 5L8KB 5SWSD 4HMDA 2YUWA 5D1XA 4GKNB 2VLLB 5DD3L 4CJ1A 2IGFH 3FO0H 5LGHH 3UYRH 2OSLB 1SVCP 3CXDH 4N0CC 1XH3B 3HR5B 3MTRA 1M1SA 1OAQH 3ZLQC 1YNKH 2H32H 4Y19A 2ZPKL 5F9DC 4ZOEA 1DDHB 1A1NB 4ZXBB 4PJIE 5A40E 1BF8A 4PUBH 2R4RL 4OKDA 4P2RD 3RWCA 4AJ0A 3SDAA 2OI9C 4G9FA 4G6AC 3K1KC 3D18B 3R0MA 5C86A 4AG4L 1RZKC 1A4KA 3MRBB 3S36L 3H7BA 3F58H 3HE7C 1UM5H 4Y2DB 1I9JL 4RWYL 4OLVL 5GIRB 2PXYA 4D2NA 4YJZL 3B9EA 3TV3L 3GIZH 3FAXA 4NRZB 3JUYA 4KWUA 4XX1E 1F42A 2DQJL 1DBBH 1E4WH 2P7TB 4JB9L 5GZOD 3UTSB 5CEYA 3G5XB 3MLXL 4G6KL 4HIEA 3MV9D 4HWZA 4UMGA 5DRNB 3FO2A 3D39E 4XMPH 4Z7WE 5D8JL 1LP9B 3EYQC 3BX7C 1UWEL 5HGDB 1MIEL 4U6HB 1OTUD 3LHPL 1VFBB 4ZDHB 5DTFB 2LTQB 1IGFL 1OTTC 1XGYL 2B39A 2NCMA 4IHOA 1D9KD 3X3GL 4DCQB 4RAHA 5KZCB 1QLFA 3L3JA 3HN3A 4HUUB 3U0PA 4OZIE 5EU4B 5DUML 4ODVL 5EZIH 3QFDB 4JKPH 1EA9C 3AS0A 4PGCB 4Q9BA 4RFNC 3LS5H 1ZGLP 2JELL 1YYMH 1QBMH 4MJ4A 5H2BB 5CIPB 4FMFA 1HCVA 3TNNB 1AE6L 3FONA 3U79A 6FABL 1FNGB 3VGHA 4YBLB 3QUMH 1EFXB 5K9OA 3S34H 1I75A 4XNMB 3RTQB 4MA8L 3K4ZA 3PWUA 3SDCC 5DT1H 3S37H 2QADC 2MKWA 5FUZH 4ALAH 4KRPD 4U1GC 3DYPA 4KV5F 4JFYA 4BUHA 1NAMB 5TJWK 4F57L 1PG7H 3M45A 3D25B 4M62H 5E1AA 4YHYB 5EG6C 1AGCB 3BGMA 4M00A 1V3MA 1OAZH 5D2NA 3OXSB 3P9MB 1P1ZB 5E4EB 5EO1A 4CVZA 3B83A 2ESVB 2IF7A 1AHWB 5SWSE 5J11C 4FXKA 5EUOA 2DM7A 1A7NL 4POYA 1BJ1J 4HG4J 3I3EA 4HAGA 4NQED 3QXDB 2ORBL 3GHEL 3O3EB 5L2KA 4D0DA 5JORA 3QA3B 1A6UH 2EDKA 3H42L 2A73B 3ARGA 1F11B 2Z92A 1WLHA 2YD8A 3QI9B 4U1IA 4G7VL 3PP4L 5IROC 2DLIA 1BZ9A 1KC5L 2BNQA 4P4KB 3FKUS 4YXLH 4P2RE 2Y6SD 4YR6B 5GS3A 4KRNA 4XHQA 5LAXA 4OSUH 1C5DA 3V6OA 3RL1B 3JXAA 3QXTA 1VACA 4PJGA 4FNLH 4JDZB 4JFED 4Z7UF 1H8OA 2B2XH 1Y6MR 4FFYH 2IANB 5BS0B 1QEWA 4PRID 2WANA 2PUQT 4XNYL 1X6NA 3T1WA 4NN5B 4OQTA 3C2AL 4KDTC 3ZE1F 3NTCL 5FOBA 4RIRA 3GMLB 3P9LB 1YEDA 3TVMD 2BSRB 3IJHA 1IEAB 4GJTB 1ZHKA 1IGML 3MV9E 4HC1L 3GB7B 3DHJA 1G6RL 4JG0H 5C0IA 4GAYB 2Q76A 3O45A 2F53D 4H20H 1VENA 3QNZB 3VXPB 4Y4FD 3WKNA 3D0VB 4X5XA 2Q87A 1N0LA 4P4RA 1JPGA 3CNKA 4WRLA 5DJYA 5J1AA 2EYSB 3FT2A 4N9GA 4G8GB 1PAMA 3VWJA 4JN1H 3PF2A 3H3PL 3ZT6A 1JF5A 2DB8A 1WIPA 1D6EB 4IRJD 5IB3A 5HDBF 3HZKA 3GJFK 3QUKA 1RZIA 2AEIT 2E27L 2IALB 4IS6B 2NY1B 3T0EB 1NBYA 5D71H 4HQQH 5CSZB 3BKMH 1DCLA 3QEGH 4JR9L 4JO4H 1MCBA 2VRAA 1EXUA 3NIDE 3PP3K 4X6EA 5LWYL 3MRMA 4XCCH 4YX2L 4FTVA 4EJ1C 1FSKB 1ETZB 4E5XB 3K7UA 4KTYA 4MAYC 5KS9E 4Y4HC 3RVWD 5ESAB 5HHOD 3GMNB 5J6GA 1NBZB 4ZPVA 4N8VG 3MXVL 2J1KA 3TZVD 5FUOL 3WO4C 4WFFD 2CXGA 5CINH 5FA4A 1T20A 4JO1L 3SDYH 3OXRB 4X4XB 3DOSA 3EGSA 2A1WH 5HVWA 1I7RB 3B4NA 1JGEA 3RY4A 5MEPA 5F7EL 4OFKA 1Z2KA 5AG8A 2QKIB 4NYLA 1CG9B 4Q0XL 1A6PA 1TQBB 1TZGH 4NQEE 3S4SB 1IAIH 4L9LB 1LO5A 1RURH 3L9RB 4TQEH 2XKNA 4F7EA 2WWMD 3U83A 3IDGB 1P4BL 4DEPC 1AFVH 4P46C 5GGTL 4MD0B 4LPTA 2DJSA 5E94B 3ZKND 1YY9C 4XAWH 3I6KA 3KYNB 3GSUA 3BN9C 1NGQH 1UM6H 3LQZB 5M95B 1U3HB 3KJ4C 5F71A 4DUWA 3QIUA 1IC7H 4J7RA 2IEPA 2XZQH 2EIDA 3KGRA 4DZBA 5IB1B 3EJJX 3PGFL 2A83A 1CXKA 4OCNC 3FB7B 4AENA 4JFEE 5DD0L 1EAPB 2Q3AA 2OYPA 4TTDD 1YDPA 5D1XD 1OCWH 3OB8A 1CFTB 2AQ2A 4LSRH 4WHTB 4PRIE 3UTTA 4UT9H 1EEQA 2MQ0A 3LCYA 4I5BB 1X5JA 4NKDA 5D7JB 1KPRA 1TPXC 2AXFB 3PIQB 3RPKA 4EIZC 1ZHNB 3BXNB 1BX2B 1CLZH 4R96B 3ARDD 3S96B 1ADQA 3HNVL 1I4FA 3UTQB 1ES0A 2EDWA 2NYYD 4WGVB 4LRNL 5DJZA 3QO1A 2FX9L 5LKNA 1JPTL 3DNKA 1FL5B 5KVFL 2ICWB 2VKXA 4M9OA 3OAZH 2F53E 3B2VL 5IMMB 1QBAA 3RWIB 2J8UF 1Q9KA 5B8CC 2HMIC 2NW2A 5KN5A 1MCPH 1KB5A 4DN3L 4DFHA 3P40A 3RWGB 5EULV 4LIQH 4XXDB 4C83A 4FFVC 3C09B 4XP4H 5DK2B 4NQXB 2IBGA 1TDQA 5ISZB 3CC5B 1VCAA 4OV6F 4CNIA 3JTTB 4OM0H 2ZKHL 2CKNA 2V2WA 3E3QC 3EHBD 1BGXH 5CWSA 5I2IA 4LLDB 4JM2F 3HRZB 4MQXC 1BECA 5K9KB 1XGRA 1RD6A 1WJ3A 3ULUF 4ZAKA 4KRLB 4AM0A 3O2VH 2GJZB 1AQDA 3NCCB 2NPLX 1G7MB 1WC7A 2VDMH 2FNBA 3CX5J 4MJ2A 2JJWA 1WZ1H 5T3ZH 1VPOL 4ELMF 2NY4C 4RMUA 2BSTB 4WFFE 5JNYB 4PJBA 4I0PC 3VXMB 4XPBH 4MCZA 3ULUH 2Q8AL 4YO0B 2AEQL 4HKXA 5D5MF 1CQKA 5E99H 1YEEH 1LDPH 1R3IH 2XN9A 1YN7A 3OJDB 2PR4H 3P0YH 1KLUA 1T1WB 5DEGA 1QVOA 1MQ8A 4CADA 3QFJA 4UILH 2IBBA 4W68A 3B9KB 5EOQH 5I18H 1OGAA 2DKUA 1PG7W 2R23B 4PBXA 4M93B 1XR9A 4NCC2 4MVBC 3T3ME 5FYKL 4OKVB 1KELH 3I3BA 5IW6B 1VA9A 1PFCA 2XWJB 1PSKL 5F1IA 1CBVH 3MJ9A 5I71B 1CQYA 4YFLI 4NKMA 1JNNH 3H2WA 3WLWC 4OF0A 4PTUB 3THML 2WBJA 5SV3A 5HHXL 3HKFA 3C08L 5JW4Q 1L7IH 5ACZA 3GMMA 4QWWC 3ZTNH 3MJGX 4EDWH 4XTRC 2ZUTA 2W65A 3MSPA 2CJUL 1I8MA 1CDGA 5GJSL 3MRHB 2BDNL 1VERA 1UFUA 1Z9MA 3G9VA 4P2OB 2BHUA 3GBMH 3PWVA 3BP7B 5DQDH 1MI5B 3WE6A 5DS8A 2AEPH 4Z7VA 1RUPL 3WD5H 1GC1L 4WFHD 4CN6A 4O4YL 4CJ0A 2ATKA 3KS0H 1UVQA 3TBSB 2DWDB 5EN2B 3UTPD 4RGOH 5L2KD 3OMZA 2AK4B 4LSQL 4NZTL 4N0RA 4OLXH 2BJMH 1XIWC 1X44A 4GRLD 4MNGB 3L3GB 4PIRF 4M8VA 2OJZL 3GO1H 1B9ZA 2W0FA 1HSAA 4GBXA 4JVWA 3U2SB 1OOAA 4KHXL 1FH5H 5HHPA 5CJOL 1J1PH 3K74B 1GGIH 4JPKH 5KSAD 4ZUWA 5JHLH 2E7LA 4O9HH 2W9EL 3IB4A 3L3OA 3LRSA 4ZSOE 1CDJA 2DD8H 2VDPL 1CT8B 2BNRB 3MREA 4DW2L 1KBGH 3C9NB 4WEBL 3L5XH 1JFQH 2HJKB 2F8XC 4PS4H 1IGCL 3RVUD 3V95A 3SBWC 1I3UA 1DBAH 4W6YB 3RFZC 4YBHA 4IOFC 3RZCB 3LV3B 4FXGB 4KK5C 5I1LB 1T03H 3BDYH 1I1AC 3OJ2C 3NABH 1A7OL 4NQVA 5IB4A 1AR1D 1IVLA 4G42A 2WUCH 3ORJA 5DVLA 1FL3A 1WBXB 1T6WA 5I19L 5GGQL 2VWEE 4HKJA 4KMLB 4QHKJ 5ICYB 4ZNEA 5FO8A 1IRAY 4OZHA 1YPZB 3JV6B 3BH9B 3MLRL 3TESA 1MAJA 1FRGL 4R0LC 1KF9B 3BKJH 2X89D 4XNUL 1CN4A 4ZO6A 2NZ9D 3E6HA 4QXUH 4S1RH 3ELAT 4RGNB 5EORH 1LK3H 5FM8A 2X4UB 1S7VA 1DVFA 1UYWH 3N9GL 4TUJB 3CZFA 1Z9LA 4KMQA 1P4IH 3ARTA 3RJQB 2C7UA 1JV5A 4UQ2A 1M4KA 1WAAA 3GZKA 2VXSL 3VFMA 1DQMH 1QD0A 2YWYA 2DQFA 1I1YB 2GW5A 5I73C 2VLKB 1W72L 1AGEA 4FTVD 5I1AB 5A3IC 3TNMA 1XZ0A 4UNVA 3ABZA 1ZVHA 5IG7B 3UDWA 4JO3H 5IJVA 1S7QA 3I75B 5E5UB 3B6SA 2QHRH 1IL1A 2VZSA 3MJ8A 5BJTA 2CLRA 4LSSL 3GJFA 3SKUD 3ARED 3EIFA 3LS4L 2J6EL 2J8HA 3F7YB 4OGXH 2X6MA 5HXMA 5D2NE 3ZKMD 3Q5YA 3RNKB 5BVPH 3CVHB 2V7NA 4U6VL 1F3JA 5EUOE 1FZJA 4GMSH 2O5ZL 4X9BA 2UYLB 3QUYA 4UTBH 3DVGB 3VW3L 4WFHE 2B0SH 2BFVL 3MZTA 4GMTL 3JV0A 3UTPE 5L2KE 5DJ2A 3WHXB 4NO5A 4PJXA 1INDL 4EDXB 4UTAH 1CDHA 2BOCA 4KV5E 3MBEB 3HS0B 1WISA 2A2QT 3MJ7B 2G9HA 2YD4A 4WTZG 2X4OB 4M4RA 4WWKD 5DHVB 3K4DA 5DC9B 2XQBL 3TBWA 2FLBT 3AAZA 5TDOA 4WUUB 1DQQA 4UQ3B 3VMPA 3FRPG 1MOEA 4FZ8L 4EI5C 3RWJA 4Y1AA 4YGVA 5GSRB 1XF2A 2C1OB 3QEHB 5IF0A 3ZKXC 1RSFA 2AV7B 1VGKB 4QRTB 3O2WH 3FB6A 4PJ5B 3UTTD 4KDWA 1T0NB 3KPLA 5ITBL 4PP2B 5DA0B 5IWLC 2MQCA 4HCRA 2AABH 1T2QL 2YS4A 4YC2C 1A7PH 4K2UL 5T1LA 1T4KB 2FEEL 2YA2A 2H26B 2Z0BA 1A1OB 4Z95L 5ICZA 5HVHB 5DGQA 1GSMA 1ZHLA 3CXHJ 4GAJL 4JFFB 5TH2A 4AL8H 2WV3A 4X9IA 1IGIH 4H5SB 3DX8B 1OM3L 4ZUSA 2HH0L 4I48A 5D96B 5D7IB 1PLGL 1T2JA 3PWNA 4JFQB 4RWYH 5FGBC 3WXWH 3ZDZF 3LRGA 1HSBA 4YEEA 2GCYA 2ITDB 3VWKD 1X5IA 5EB9A 1IAMA 3N1GC 4ZTPH 2GTZA 4WV1A 3HUJA 4JFPA 5SWZB 5JZ7D 3C8KA 4WU7A 4AEEA 3EOBB 3AXLA 5DRXA 1AH1A 4IMKA 1M6OA 3RIAK 4G6KH 5I76B 3VFOB 5F9WC 4K3JL 4LBEB 5D2LF 3E8UH 3VXQB 4JE4B 4U3XA 3L3KB 5D8JH 5CEZH 4XB7A 4ZAKD 2DKSA 5DSCA 3MUGA 1F2QA 3FT3A 1DQDH 2GAZA 4FTVE 4HJJL 3MRCB 3EYOB 3UJJH 1XGYH 2FO4A 4HPOL 4MMZC 3H3KA 1MCHA 1OLZA 5CJXC 1MFCL 3L3HA 1J0HA 1KCRL 1ORQA 5HDBE 3SQBA 1HHJA 4QGTA 3RWDB 2YN5A 4KJYB 32C2A 4JM2D 4LRIA 3ZDYF 4BK5A 3S35L 4QNPF 1AE6H 3NFPB 3X11B 3FN0L 4UT6L 3QFJD 6FABH 2CLZB 3MCLH 2ARJA 4DKDC 3DIFB 5F9JB 1TCRA 3S5LB 4LCCC 2P5ED 5F9AC 1XCQA 1KULA 4HKBB 4OCXL 4IBLT 2H8PA 2IH3A 5J0BA 4XP5H 5KSVA 1JNLH 4KKBD 4KVCH 4O02L 1G0XA 1F58H 2C26A 5I1DB 4HK3J 3VGAC 1JWSA 3CFJA 1ITBB 1DUZB 3RWHA 3T1FA 1NFIA 2RAMA 4ZYKA 1HEZB 4OCRH 4S0TD 2XV6B 1KENL 1FFPB 3J8F7 1LHZA 3H9SA 4O00A 4POUB 1NUGA 3PXHA 3GHEH 4MZ2A 4KZEL 1A22B 1GHFH 2VYRE 5EU3A 2K9UA 1N6VA 4Y5YC 3UTTE 3DVFA 5CZXC 1IARB 1MHHB 3QIBA 2HT3D 1CWVA 3CIQA 4I1NB 1NFDE 3RDTD 2QEJA 5FM5M 1HNFA 4FQXC 2VXUL 2ZUQC 1J7VR 4Z8FH 3FO1B 3GM0A 5DR5H 4E41B 1YZZA 2HN7B 1VESA 5KSBA 2ADIA 2CR3A 1FZKA 3VXNA 3QT2A 2HJFA 2NXZC 3WV0A 4RBPH 5HYQB 1UXWA 4X5WB 8FABB 4KUCD 4OF3A 3KWWB 5E9DB 4XNYH 5MI0B 4BFGA 3CH1A 3PWLB 1IC4L 3U7YH 1MCWW 4DVRL 2XRAH 2ZP0T 3Q6GH 3V5HB 5TDNA 1QRND 1B0WA 2ADJA 5CJ8A 4HX1A 3ES6A 1KN2L 4Z7NF 4PG9B 3LPFA 1MFDL 1XCTB 1MRFL 1MCDA 3NAAL 3LQAH 4NUGH 3MOAL 3O6FA 5SX4I 2J8UE 3PDOA 2FYYB 4E0RB 4YLQT 4NC0B 2GSGB 5AZEL 3HI1A 3WUWB 2CMRL 4ZS7L 1HZHL 4YDVA 1MCKA 1CR9H 4N9OB 2A0LC 4QEGA 3HCVB 3HG1B 5ID0A 1XGUA 4XCNB 1OTSD 4YHZL 3ULVL 3DV4B 4L3CB 4XP9L 4DK6A 4GAGL 5FECB 5FK9A 1H8NA 4ODSL 4S1DD 1F8TH 1DBMH 2BY2A 1K4DA 3O8XC 2V9RA 3VXTB 4B7LA 1UB5A 2Q6WA 2QSCH 2D7PA 3QFJE 1DVFD 1ZOXA 4K55A 3AB0B 1NC4B 4XC3H 1DSFL 4RGMB 3X17A 1UZ6F 2P5EE 2R1WB 3TA3D 2FWOB 1LK2B 2OM5A 2B5IC 3GMPB 5F3HA 4ELME 4TNVK 3VRJB 1QQDB 3SDDA 2Z8SA 4PJ8B 5IBLC 5FUOH 5IVXA 3WJJC 4HFWB 4PGBA 1ZT7B 1JMXA 5H35B 5GGSB 4BQBA 3I2CL 3HAEB 3MRDA 3O11B 5IP4A 3QUXC 3CDFA 3GSWA 3WS6A 4JY4B 1SEBA 3HFMH 4M03A 4X80L 4Q0XH 2EDXA 4RQQB 4ZFOA 4H26A 3WIIH 3MC0A 2ILLA 4FRWA 4OGAC 5C7XH 4KY1L 5DK3A 3H0TA 1HYSD 4PP1D 3QQ3B 3QUYD 1NC2D 1ITCA 4YDIL 4NO0D 3HMXL 2A6DA 4LF3A 1H5BA 1UACH 2VN4A 1CICB 3SKMA 3QO0A 3F7PC 2EXYC 3B2UC 5CBAB 2NY5C 1YA5A 3PGFH 4H88H 2D03L 3P77A 1RQ5A 5ENWB 1T89A 4JRXD 2NW3A 1HHKA 3TYFB 1EHXA 5DDHB 3QG7L 4QYOA 3N85H 1KOAA 5EU7C 2MMXA 4PV8B 5KOVC 3RWFB 1S7XB 4Y1AD 5JMOC 3ZHKA 3R8BB 1GOHA 4MHHG 3X14A 3K3QA 3Q48A 1HHGB 1QRNE 4MNQA 4XMLL 5GS0L 1I9IL 3UX9B 4LRNH 1R0AH 2FX9H 5JXEC 2W38A 1AGDB 3DUUA 1EO7A 4K9EL 5T1LD 3V0AC 1ND0A 4UOW1 1RIVL 5KG9A 5CHNA 4DGYH 2DBLL 4DN3H 3DX9B 3TF7C 1QSFB 1FHGA 4IOIB 5E8EB 3QJFB 2YPLA 5EIIB 1HKLL 2EH7H 4RZCA 4M7JH 4Z78B 3DYMA 3BO8B 3I02A 4XI5D 3WYRA 2V2XB 2HTKC 3OPZH 4B41A 2Q7YA 3STLB 4GG6B 1U8LB 1DLFH 5C0RL 5D1ZC 3IDNB 3GSNH 1JL8A 2PO6B 1FL6B 5INCA 3FT4A 1F4XH 1KTKE 3P11H 1VADA 4U3HA 2BVOB 4FQQA 4ODHH 4PJ9D 4LLWA 3BQUA 4OCYH 3GGWB 3NA4A 1VPOH 3QWRA 3GRWL 2WP3O 1NAML 4P2YA 2E7MA 5J57B 4P2QB 3QDMD 1QPXA 3RWEA 4NHCL 3NCYS 2CPCA 1AXTH 4WDIA 4K3EH 2H9GB 1ZT1B 3O81A 3KLHD 1HQRA 4O58L 4HULB 5BZWB 4DFIA 4BH8B 1M7IB 1A6TA 2F9BT 3MGTB 3BI9X 5HHOB 2BC4A 5CP7B 5ESVA 3VFUB 2OQJB 4D0BB 1DE4A 1WBZB 2ZSVB 4MQSB 5B4MC 5FYKH 2AJ3A 1KN4L 5IJKC 4GKSB 4XC1L 1OAYL 5EFIB 4QRPA 5JO5B 4YXHL 2QQKL 4KI5F 3THMH 3QBTB 4IRSB 5HHXH 3MFGB 3L3IB 5EBWB 5LG1A 1MFBL 4ENED 4FQIL 2H32A 1BREA 1XGTA 4QGYA 2EC8A 5ADOL 1FIGL 3S3PA 4WU5B 1ZA3B 3G5VA 4R7NA 1L7TL 3V7AE 4JRXE 2ZOKB 1EK3A 4NP4H 4XP6H 4C4KT 4X83A 5I6XC 2YK1L 3EOAA 3RGVA 1H3PH 5C0ND 3VD7A 1KEGH 3IFLH 3PL6D 1YUHA 1YY8A 4TUOA 3UZQA 2FD6L 3H9SD 4Y1AE 1RUPH 3SEPA 2FHFA 4O4YH 1TTFA 3FMGL 1MPAH 5C07A 3TWCL 2CH8A 4UV4H 3VI3F 3LB6C 4U1JB 4NZTH 3JWOL 4JM4L 4OD1L 1RK0B 4L9DA 4OZFA 1S7UB 5DO2D 1PEZA 3QIBD 4MJ5A 4XP1H 4ZOBA 2OJZH 4CL7A 3ZHLA 1UQSA 5I8EA 3PNWA 2HLFC 3WSQH 1DBKL 3NZHL 5C0CA 4S1SH 1Q38A 1VGEL 2K7QA 4O2EA 4APQD 4P99A 4M5YH 3KYKL 4UDTA 1N5AA 4R26L 5DLMH 2VZ1A 2PF6A 2RCSL 2OL3H 2WBKA 3F6IA 4Y19B 1IZKA 2I24N 4UNTA 1S7RA 3RWCB 3SDAB 1QLEL 4LSUL 4G9FB 5F72S 4KTDL 3NCJH 1FFQA 4JO2L 5KW9H 1A7OH 1D6VH 4FZEH 3LRHA 3LZFH 3O3BA 1A4KB 5DJ6A 5GGQH 3H7BB 3LAFA 3DSFH 1LE5A 3C6LD 2PXYB 3HC0B 3N50A 3QUMA 3SKJL 2XZAL 1MCFA 3WFHA 2E5EA 4IDJH 3QDME 4I77L 4P57A 3WBDA 3QDJD 5CEYB 5GZOC 5EOTA 1N59A 1FVEA 2BHZA 3TN0A 4U31A 1CU4L 1G9MH 4BELD 1P4LB 3FO2B 2Y1VA 5DYOA 3ZE2F 2A9ML 3O9WD 3MRFA 2J7LA 1V5JA 2Q86A 5CP3A 1BOYA 4P5MA 5CCKH 4KK9D 1OTUC 3FRPA 4UIKH 5AYUL 1QG3A 2B4CL 4IHOB 4Y16D 3G5YA 2ZUWA 1QLFB 3L3JB 1YEJL 1D9KC 4YK4B 5DEFA 5AAMA 2HRPH 1W72A 3U0PB 5F7HA 2NY2C 1R3HA 4XPTH 4LGRB 5D7LA 4P5KA 3SDDD 5IR1B 1OPGH 1XEDA 2DIJA 3NFSL 4LSSH 5D4QA 1U8PB 3TPUA 1KFAL 3ZDYE 3KPTA 3FONB 5CMAB 3V7MA 2ED9A 4M3JA 1EGJL 2VLMD 2HFTA 5K9OB 4AEFA 3K1DA 1CLOL 3H9SE 1JHLL 5I15H 5C70A 2BFVH 3PWUB 3GSQB 1DQLH 4JZNA 4NNPL 5DC0A 1ZMYA 3SGDI 1D5MB 2VAAA 4JFYB 1C1EL 4KRPC 4NGHH 1S78D 2Z35A 3I50L 5DMIL 5E1AB 2X1PA 4J4PD 3BGMB 1RZKH 4CVZB 5EO1B 4M7ZB 1VFAA 5C0BD 4FXKB 2XQBH 4XPHL 2VABA 5I75C 4Z7UA 4KFZC 1JNHA 4YWGL 1CK0H 4FZ8H 3CU7A 2R0KH 1T21A 3QAZB 1N6QL 5C71A 4M1GL 2FDBP 3ARGB 4X7CC 2OTUA 3R1GL 2GUOA 5ALBH 5F6IB 5E8PA 4UBDD 4U1IB 1BQLL 2C3WA 5SWQA 1GXEA 2Q20A 1BZ9B 3MACL 2BNQB 1NCBL 3VMOA 3LEVL 5C8JB 2D0GA 2EYRA 1MJUL 1SVZA 1T2QH 2Y6SC 4MNQD 5LAXB 1UM4H 1CD1A 1C5DB 3P4OA 3GBLA 1RZGA 3OKEB 5DD5L 2ZOLA 4G6ML 3MRKA 2GKIA 1VACB 2DQHH 4PJGB 5IFAL 5HI5D 1SMOA 5IT2H 2BSSA 4Y89A 5E08H 1NDGB 3OR7A 4GXUM 1I8IA 3I3DA 3D3VD 1TTGA 3RI5K 3VFTA 1OM3H 1PQZA 2HH0H 4J23A 4F58L 1OARL 1CZ8L 1T22A 4P2CG 1LILA 4PREA 1MF2H 5BMFH 5IM7B 3L3DB 5FOBB 3ULSA 3N1FC 4RIRB 3SGEH 3QDJE 3LKQA 1YEDB 1ZSDB 4DQOH 1J1XL 2YPLD 3IJHB 4PGZA 4Z7NE 5DMKA 3TVMC 4KK8D 3Q6FA 5ETUA 4QKXB 1ZHKB 4CU6A 5C0IB 4AQOA 2Q76B 3O45B 4JPWL 5BQ7A 5ELIA 1X5ZA 4LQFL 4K3JH 3AM8C 1R3KA 1AQKL 4BFIB 4H0IA 3S9DB 5D1QD 4Y4FC 5CKGA 1JPGB 5DJYB 4UUJA 3W9EA 2ZCHL 2RBLA 4HJJH 2ZJSL 3BD5A 3V6ZB 1U6AH 3NA9H 3VWJB 1TLKA 3BQUD 4JCLA 3RPIB 4FFZL 1T80A 4FQJL 5IB3B 5C0GA 3HZKB 4PY7A 3QUKB 3RKDD 4IRJC 1QYGL 4D3CH 2Z8VC 2WIIA 2P5WD 3PGCA 1S5HA 3TFKD 2BVUA 3TBYA 1NBYB 1NDMB 4U1NA 5I9QC 3WNLA 3S35H 3RNQA 2AP2A 1D5XA 1S5IH 4X6EB 3RBSA 2HFFA 5JQHC 2VLME 1OD7A 4FTVB 4TVSa 4FQLH 4WCYL 4NM8L 2AJSH 2F58H 2Q3ZA 4JZJC 5J6GB 4XPFH 3ARVA 5HI3D 1OSPL 3RVWC 1XF5A 3T04D 4ZPVB 1JNJA 2AKRB 4G6JH 4OCXH 4CN4A 2Z93A 3TZVC 2R8SL 1HIMH 3FQUA 5JPNB 5KAQG 3EGSB 4QRPD 4HH8A 3L1OH 5FYKD 3NMEA 4XH2A 1KYOK 2GJ6A 1JGEB 5DVKA 5MEPB 5C0BE 3S37X 3MLUL 4NQSA 3VG9C 5BXFA 2FGWL 4LKCA 4K8RD 2L0DA 2E9JA 4NYLB 1BJ1H 3BVNB 3GSXA 1LO5B 4OUUB 1NJ9B 5I1HH 4JY6A 3FFCB 5F1NB 4F7EB 3IKCA 1TMCB 3BWAA 1IQDA 4OLEA 5B3NA 5CLWA 2CK0H 4KZEH 2UWEF 3BT2L 3SY0A 3I6KB 3ZKNC 1WFTA 1A3RL 4NSKB 1T7ZA 3GSUB 3RHWF 2JK5B 4DKFL 3W0WD 1N2RB 4L4VA 5C07D 4XVTL 3QIUB 5GGRA 2BY3A 4JPVL 4WW2A 4MNQE 3SGKA 3T2NL 5FYLD 2OZ4L 4EZMA 4DZBB 2A83B 2WWKT 4ACPA 4AENB 3QRFM 5E7FA 4Q9QH 3WFBL 3D3VE 4LHUG 5DEZA 5TPWL 1YDPB 5EU6A 4JREC 4NNYA 4TTDC 5D1XC 4F2MA 1KCUH 4TOYH 4YE4H 3F8UB 4NKDB 5IIEA 1X7QB 1HDMA 4FP8L 4MJIA 3VXSD 3AY4C 4WHYH 4U1SB 1CXLA 1IC4H 5FCSH 1BEYL 1JPFB 3WIFA 5D7SL 1ES0B 5JTWA 3ARDC 5IHUL 2C3XA 2YPLE 3QO1B 2NYYC 2IQ9H 1KN2H 4ZO9A 3BAEL 2OLDA 3ULVF 3CVIH 1MRFH 1TETL 4URTB 3WLBA 1TFHA 3NAAH 4RISL 1Q9KB 4ODXA 3MOAH 3EFFA 2NW2B 4LNVA 1BD2B 2MOVA 1I7TB 4ETQA 3R06A 4RMQA 4BZ2L 1NCAL 4KHTL 4C83B 3KLAA 1HZHH 2YPVL 3WIHH 5L6YH 4RMTA 1ZEAL 4CNIB 3ULVH 5E6ZA 4OT1L 4AH2A 2ICEA 3ARFA 5CWSB 2P5WE 1FO0H 9CGTA 3EHBC 2VDOH 1EEYB 4OZGF 4OF8A 4Y5VC 1FPTL 3UYOD 1ZWIA 4V1DA 3CVHL 1T83A 4ZAKB 5I1CH 1KLFA 3PABA 4QTHB 4OGYH 4AM0B 3RY6C 4JFDA 4F33A 1MFNA 2EDJA 4N0UE 5GZNC 1WC7B 2VWEC 4DGVH 3F7QA 1DSFH 1OSZA 1A6VL 4F9LC 3NVQA 2FBOJ 1CTNA 4Y8DC 3OGCA 2ZWLT 1U8HA 4PJBB 4QLRA 1CDBA 1OAKL 4FQXB 4ZTOH 2QSQA 4MCZB 2JCCA 1U8IA 4QRPE 4F7MA 1E6JL 5JMRA 4HKXB 5FYKE 1ODAA 5C09A 2XN9B 4PGEA 4G43A 3OSKA 4OD3L 1KLUB 5DEGB 4CADB 1NGXA 4WIQA 3PHOA 1TVDA 3BKCL 2V5SA 1OGAB 1XGQA 3AC0A 3SCMD 2X1WL 4IIQA 4OFIA 1T04A 5C3TA 2W0LA 5F9OH 1U8OB 1XR9B 2FB4H 3FZUD 4M6AA 2X4TB 4LU5L 5F1IB 2OSLA 5C6TH 1CGXA 3HR5A 4NKMB 1S9WA 3W0WE 4EI6A 4KROD 2WBJB 5C07E 1QO3A 4G3YL 1JZ2A 3GMMB 4GQPH 2JE8A 4N0YH 2CIIA 2XQYG 1E4XH 1KJ2H 2W65B 1WIUA 5FYLE 3IDMA 3SE3C 2OX5A 1F45A 4HWBH 3ZSSA 4LDLB 1NFKA 3CX2A 3PWVB 5LCVH 1MWAH 5DS8B 3UJTH 4QRRA 1AJ7L 4Z7VB 3CZJA 2YRPA 3GK8L 2F8VA 3MRBA 5C0FB 2ATKB 1UVQB 1LP9F 3VXSE 1KEMH 3QDGB 2XTJD 4M43L 3KPRA 3EO9H 2MKLC 3ZTJH 5TFSL 4NRZA 3VI3E 3MV8B 3PDDA 4HW6A 2FR4A 2EDEA 1V3LA 3V6FA 2VB5A 1A3LH 3BISA 3WNMA 5E5MA 4AY0A 4GRLC 3P4LA 5K9QI 3MOBL 1I9IH 2MNUA 4ORGA 2O61A 1PEWA 4KQ3H 3L5WA 4LCIH 2W0FB 2P7TA 5D70L 1HSAB 3UTSA 2VDQH 5A1AA 5JDSA 1YQ2A 3G5XA 4GBXB 4I3GA 2LU7A 4CU7A 5HHPB 3EYFB 3GUTA 1I8KB 5CJQL 4ZUWB 4CUCA 1RIVH 5KSAC 2AJZA 3L3OB 3DVIA 2F8OA 3LRSB 1F97A 4U6HA 1H3TA 1HHIA 3MREB 4N90D 4ZDHA 4L3EA 1C12B 2F54E 2IQAA 1AI1L 1XMWA 2DLTA 3QUXB 4DCQA 2H2SD 2VERN 3S3JA 4Z7QF 3RVUC 4HUUA 1HKLH 3BSZH 3GMOA 4JG1H 1TIUA 4P9MH 3DXAD 5EU4A 1B3JA 1U8JB 4QRSB 4NQVB 2DJUA 2NY0D 5IB4B 4G42B 1FL3B 1A1MA 1AR1C 3MRJB 3TNNA 3SQOH 4PPTA 1FBIL 4HKJB 2OMBA 5FO8B 4NBZB 4HMEA 4OZHB 1GIGH 4L4TD 3UJIH 1EFXA 1S3KH 1FNEA 1FV1B 1VFMA 3MODH 2PCPA 1SQ2N 4XNMA 3MNVA 5DQ9A 5DHYA 4LARL 4R8WL 3E6HB 4X0KB 5L9DH 2NZ9C 5GGUB 2VIRA 3QUZA 1NAMA 2DQDH 3NCMA 4NHCH 1WWWX 1TXKA 1DEEA 3CZFB 1M7DA 2G5BA 1VHPA 1JZ3A 1B0GA 2KPNA 2C7UB 3IFNL 3QHFL 3WJLA 3VFMB 1P53A 2O5YL 4R90L 1UKSA 1H3GA 4MXQC 1AGEB 5IESL 1NUDA 1JTOA 4FHBD 3TNMB 5JA8B 1CD8A 4BQCA 4HF5L 2CDEA 3OKOA 5BV7C 1QFUL 3IAQA 3T08A 1S7QB 1F11A 2FJGA 4YXHH 5CEXB 1SBSL 1IL1B 1NMCC 4QXWA 3MJ8B 5BJTB 2NY6D 1DR9A 4XWOD 4P4KA 1MFBH 3A67H 3AREC 2FSEA 3TO4B 1FCGA 3CDCA 5F44A 3B8SA 2AI0L 1FIGH 3ZKMC 2R39A 2V7NB 4Q9RL 1F3JB 3C60C 1L7TH 4HH9A 2EH8L 3QUYB 3EOTL 2HTLD 4EUPG 2BY0A 1KG0A 4NC1E 2XTJE 2UVFA 5DJ2B 5LJYH 4X6DA 1I85A 1MREL 2IANA 4NO5B 4PJXB 4P3DA 5BS0A 3FMGH 1MFAH 2PW1B 4F80A 1NMBL 1PVHA 1QOKA 5IUSA 4MZ3A 4GSDH 4WWKC 3GMLA 4X8JA 2BSRA 1ZLSL 1YEGL 3GDBA 1DQQB 2CIKB 3NZHH 3UXFA 3RWJB 4GAYA 4YGVB 5KVMC 1QUNA 2HYMA 2FX7L 3BWUC 3QNZA 3F65A 4OCSH 2X70A 3D0VA 4XXCA 4N90E 1YEKL 1DQTA 2X41A 4FQ2H 2D2OA 5FIEA 3KXFA 1NANH 4MJID 5MP6H 3DXAE 5HHMB 3STZB 5IGXH 3UPAA 1QLEH 4MLSA 5ICZB 5FF6A 3SJVA 1H3XA 1G7IA 5TH2B 5TQ0H 2XQYK 4ZUSB 2WK2A 4I48B 4TRPL 2J8OA 3LEYL 4HT1H 4L4TE 5TGBA 2DI7A 3PWNB 1RU9L 3U0WH 1HSBB 4M6OH 5F97E 3SKJH 4PYHA 2XZAH 2LFGA 1MFEL 1LO4L 4E5XA 1KT2A 1MNUH 2CR6A 2VDKL 3VWKC 4P48A 1WFUA 2GTZB 4OBRA 4UU9A 5KSUB 1QFOA 5IFHL 1CXIA 1M05A 3HUJB 4JFPB 4PJHF 3EOYG 1UCBH 3NIFF 1YEFH 1IZJA 4J12A 3C8KB 4WU7B 2DM2A 5JZ7C 3AXLB 5DRXB 4K07A 3OXRA 3GHBH 4L8SC 2DTMH 4X6CE 3CK0H 3O0RH 4HXAH 5CILL 2ADFH 4EXPX 3JZ7A 4LLQA 1BM3H 3W5MA 4V1DD 5DSCB 3S4SA 1EHAA 3MUGB 1TQCB 3FT3B 2GAZB 4JFDD 4DGIH 1L9NA 7CGTA 5AYUH 2FO4B 4PRPA 1FJ1A 1FAIH 4OV5A 1BIIA 4PG2A 3L3HB 5TE7L 5D93C 5I16A 1EO8H 3LQZA 1Q94A 5ALCL 1RJZA 1U3HA 1HHJB 4IRZH 1OAUL 3MXWH 3IDYC 2Y4SA 4JM2C 3EYUL 4POZD 2EDYA 4JHWL 2FIRT 2ZCLL 1T5WA 5DK0B 5GSVA 3FB7A 4P23A 1EGJH 1Q9LB 1CLOH 1PKOA 2HKHH 1TCRB 3KJ6L 4XCYA 4WHTA 3CSYA 1DL7H 4N1CA 2BOBA 3FN3A 3EW3B 3KS0J 4NNPH 4YFDB 4I5BA 3RBGA 5KSVB 2OK0H 1F4WH 3VDCA 4W6XB 3RU8L 1EO5A 4KKBC 2AXFA 4MYWB 2V2TA 3PV7A 4N5EC 4YPGA 1BX2A 3Q5OA 1JGUL 3S96A 3L6FB 1C08A 1JWSB 3UTQA 3RWHB 3T1FB 2NTFA 1M7XA 2DQGH 1CFVH 4KTEH 1TZHA 3WMSA 4ZXBD 3IU4H 5E2TH 1ZTXL 5TQ2L 1RI8A 4S1QL 1R24A 5IMMA 3RWIA 3BJ91 2OP4L 1N6QH 2UWEE 4GS7B 4EN3B 1IGYA 3FL7A 2R0WH 3GM8A 2XACC 3DI2B 3MRGA 1G84A 5I1EL 2JJTC 3QXUA 3LIZH 3LSOA 4FQCL 2ENYA 3BPOC 1NCBH 5DRWA 3LEVH 2HT3C 2QV2A 5IHBA 3JTTA 3RDTC 2D7MA 1WIOA 3RUGF 1RVFL 1XAUA 2GTWB 5DD5H 4G6MH 5KSBB 4YIQB 5K9KA 2ADIB 3E0GA 1KIPB 5KTEL 3UTSD 5GS0D 35C8L 3CGTA 2FEEI 1ZVYA 3IDIB 4WHYG 1G7MA 3K2MC 3I6GA 1IAKA 2E7LC 1EFQA 4GG8A 4D94A 3S36X 2BSTA 5TDNB 2ADJB 4HX1B 3VXMA 4N8VB 5I74C 5KZCD 4NDMA 3DRTB 3MROB 4HZLA 5A2LH 1AGBA 3WUZA 4YHMH 3ULVE 2VZTA 1ZHBA 3NPSC 4NWUL 3O6FB 3SGEI 1PGRB 1QFWL 3DURA 4JPWH 4V1DE 4YDKL 5CUSH 4JZOB 3HI1B 4JFDE 1DEDA 1NLDH 1MEXL 1AQKH 4KXZH 2W9DH 1VSCA 1B4JH 3V4UH 1G7HA 2JJVA 1FYHB 5IW6A 1MAKA 4LMQI 1EFXD 3BEVB 3AMLA 1OTSC 5HDQL 4LSVL 4XNXH 5FK9B 3RTQD 3CFCH 1HH6B 1K4DB 2GT9A 4S1DC 4J2XA 3WNKA 2A74A 1QYGH 4XMKH 5F70A 1UB5B 2WUBH 5LBSH 3W81A 1UEYA 1DVFC 5CFHA 2ESVD 4NN7C 4XVJL 3GIVA 3ZYIA 3TA3C 5F3HB 1OSPH 2P8PB 3S97C 3P4MA 1RUKL 5CD5D 3PDGA 3VFVB 5IVXB 2DWDA 5EN2A 3D87B 4YHPA 4PGBB 3F6LA 5C0AA 3MRDB 4OTXH 3V79C 3UDWC 4M61A 3QI9D 3L3GA 1EIBA 3BPLC 2WINB 4P4KD 1RMFH 3RY5A 4HGKC 4ZFOB 4H26B 5C1MB 3VFPA 2DM3A 5FXCH 1OVZA 3OWEA 2VZUA 1QHOA 4A2MA 2VXVL 5GHWL 3NH7L 1LO0H 1HYSC 4PP1C 3ALPA 1GRWA 1A3RH 3C9NA 2Y72A 1ED3B 2IAND 5BS0D 4OIIH 2A6DB 4LF3B 1H5BB 3WDIA 5D72H 3QISA 3T0XA 4XVTH 3SKMB 4JPVH 4PD4K 3QO0B 3T2NH 4G8EA 3LV3A 4FXGA 1PD6A 4ONOA 3UTSE 3VI4F 3P77B 4L5FL 1ZGLB 2OZ4A 3WFBH 1WBXA 2NW3B 1HHKB 1EMTL 3GSNA 4GRWB 2EE6A 4QYOB 3SE4A 4WI6A 1DLHB 4H25A 5FKPA 3D1MC 3ESVF 3MUJA 5C08B 1FNSH 4YUEL 5TE4L 5ICYA 1LP9E 3RIFF 3HE6C 4TUKL 1YPZA 4MA3A 2OBGA 3X14B 4PGJA 3TM6A 1B2WH 1BEYH 4Q6IA 2BXYA 1JF1B 4OLYL 5D7SH 3H3BC 2AJVL 4PJDF 3DUUB 4IJ3C 4G8GD 3S88L 1MSPA 1C7TA 4OM1L 4RNRA 5GS1C 4R7DA 1DBJH 2GK2A 1TETH 1BIHA 2KH2B 1ND0B 1D5IH 5KG9B 4PJAF 2NY1D 3T0ED 1A9EA 5CHNB 4HG4K 4LVOC 4BZ2H 5I30H 4KHTH 5DMYA 3OZ9H 2JIXA 1I1YA 4MX7A 1AR2A 1CFQA 1QKZH 3N1MC 3U0TA 5I1AA 4XPGH 1OP5K 2W0PA 4G9DA 1QR4A 3IRPX 4M6ML 4RZCB 2C3GA 4OT1H 3I02B 3H9YA 3I75A 4LVNC 4UZGA 2K3TA 3G6DH 3SDXB 4XI5C 2Q7YB 2VDRL 4PRNB 4HZAA 1FPTH 3UYPA 3F7YA 3QHZL 2FECL 3EFDL 1Z5LB 5INCB 3FT4B 2ESVE 1PZUB 1VADB 4P3CH 3HRPA 4FQQB 3IFPB 4LLWB 3CLFL 3BQUB 4PJ9C 1CE6A 1H15B 1A6VH 1OT1A 4ZOCA 4WHDA 1QNZL 3K8LA 4WJ5B 5FFLA 5DMJB 1HHHA 1OAKH 3WHXA 2NY5H 4EDXA 3RWEB 3CD4A 1WFNA 5DHVH 1BOGA 3MBEA 3MPCA 4I4WB 2AQ1A 3MJ7A 1KACB 5MEQA 4WDIB 2X4OA 1BFSA 4PJEB 1KJMA 3B43A 1U3HD 5KVGL 3KLHC 1X5GA 4XNQA 1A6TB 3H8NA 2HLAB 4LGPB 3DMMA 4WUUA 4RFOH 2BC4B 3V5DA 5ESVB 1BPVA 4NO3B 5C2BL 4HWUA 1QHPA 4RDQF 3KPQA 4ZQKA 1DE4B 1A6AA 4DJMA 1CFBA 1S8DB 2AJ3B 5I1GH 3QCUH 2KL6A 1MVUA 4X98A 5J13C 2C1OA 3QEHA 4I3RL 5D6CA 2P1YA 4GKZB 2IANE 2KQNA 5BS0E 1T0NA 2H32B 2OL3A 5D7JD 1QACA 3M8OL 4ENEC 4PV9A 4PJIF 5EPMB 5AG9A 2IAMA 1E6OH 1T4KA 4ZUVA 5GJTH 3G5VB 4R7NB 4P59L 1CE1H 1G9NL 3BESR 2AW2A 1UWXK 1CFSB 1E4XI 4HIXL 4S0SD 4JFFA 3EOAB 4ZNCD 3RGVB 1MJ7H 3REWB 3WL9A 4TUOB 1YUHB 1YY8B 5C0NC 4X7SH 3MLWH 3GK8H 5IEKB 3PL6C 4OQTL 1NLBL 5D7IA 3RAJH 4XNZB 4M43H 2I9TA 4Y5VB 2R2EA 1BVLA 3QEUA 4MJ6B 3HZVA 2XNAA 4XBGB 4XBPA 4G8GE 5DO2C 1JI1A 4MJ5B 4Z7OE 3PG2A 5ISZD 4XPAH 3QIBC 1MCSA 3VFRA 4HLZH 1UQSB 5I8EB 2HVKA 5C0CB 2F5BL 5IBTH 2VDNL 3GI9L 3NPZB 3NZ8A 3T0EE 4Z7WF 5CJQH 2E7HA 4KKLD 4LBEA 2J12B 4O2EB 3VXQA 3PWPA 2QQNL 4P5TA 3U30B 4APQC 1FZOB 1ZVSA 4ODUB 1N5AB 3DRQB 3NACL 4NZUL 3MRCA 4GXVH 1U93A 1J10A 1BWMA 2D9QB 4OZIF 2VO5A 2D7QA 1FNFA 4DUXA 3VXMD 3RWDA 5JR1H 1MHCB 3GJEA 3O3BB 2IADA 4WFED 4HFUH 5DJ6B 4FS0A 1I9EA 1U8MA 1A7QH 3NFPA 1U3ZA 1LE5B 1K4CB 4OLZL 3SGJA 1HXMA 5KJRH 2CLZA 3B9KD 3C6LC 4EBQL 3QUMB 1DANT 3NGBC 1GAFH 2PKDA 1FLRH 3WFHB 3DUSA 5JXAH 1J5OH 3QSKB 4EUPA 4R4FH 5F89B 2F5AL 2HVJA 5JHDA 2DQCH 4P57B 1YYLH 3NIFE 1INQA 5GISH 5EOTB 4BSWB 1N59B 1FVEB 3TN0B 3VFGL 2MFNA 4TYUA 1J8KA 5I1DA 1T5XB 3P0VL 1DUZA 3HE7A 5DYOB 3KPPB 4HGWA 1AGFA 3MRFB 5MERA 2B1AL 3O9WC 2DQUL 1IAOA 1N6UA 2GYSA 4PR5A 4P5MB 4WEMB 3EYSL 4M7KH 3V4PL 3BH8A 4KK9C 1A64A 1UJ3C 3G5YB 4P2OD 5DEFB 4Y16C 3AUVA 1YMMB 5EIVA 3EDEA 4ONGL 4WI4A 3ZT5A 2FIKA 1R3HB 4NRYB 5D7LB 4DKEL 3O3UN 3FHQA 3SDDC 1RZ7L 5D9SA 3TPUB 2AK4D 3IXAA 4OCWL 2ERJC 4MA1B 4KAQH 2EZ0D 3WFEH 5EO9A 1X9QA 1Z3GL 1CFNA 3WS6C 2EH8H 1IC5H 3OAYK 1X5FA 2WW8A 3SO3C 5F7YC