5C0ND

Development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPASVSEPVGGTVTIKCQASEDISRYLVWYQQKPGQPPKRLIYKASTLASGVPSRFKGSGSGTDFTLTISDLECDDAATYYCQCTYGTYAGSFFYSFGGGTEVVVERTDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDCTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a therapeutic monoclonal antibody that targets secreted fatty acid-binding protein aP2 to treat type 2 diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Lipid transport
molecule keywords Fatty acid-binding protein, adipocyte
total genus 48
structure length 216
sequence length 216
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0nD01
1HEZB 2R2BA 2ITDA 2KZ1B 2ZJSL 4XTRC 4PJDB 3LPFA 5LBSL 2KQNA 1JGLL 4JO4H 4U0RC 1FNLA 4OLVL 4D3CL 3ARFA 4P3WA 3BP6A 2X2YA 2G9HB 4TQEL 5C0ND 1LK3L 1QBLL 1MJJA 3STZA 2Y5TB 3DV6A 5FKPA 5F88A 1G9NC 1VESA 4HIJB 1FAKT 4OF5A 1DP0A 3QUYC 3BHBB 1LO0H 1Q94A 1DFBH 1RFDH 5D70L 3DMMC 1SJVA 4OV5A 3KLHC 1MCQA 2DRUA 3QNZB 5DEGB 3CDCA 1BFVH 1MJUH 4F9PA 1P1ZB 1QLFA 3IFLL 2L0DA 4K3HA 4QRRE 5FHBL 5FO7A 4YFLF 5F1IA 3VFNB 4F7EB 4L8CB 2YSSA 2DICA 5DQDH 1Z9OA 3D9AL 5B22A 3ZE0E 1FZOA 3CSGA 3ULUL 2DTML 2VXQH 2Q8BL 1QRNA 5DRNB 1A7QL 5T1LB 4H0IA 2AAVA 2XQYG 4Q9BA 2JJTA 1I7RB 5FUZL 2AK1L 1VFBA 3DSNA 1MWAB 3QIUA 4NQDA 4P2RD 3KPPA 3ARGC 4NZRL 3W9EA 1ZHNB 1NGWA 5IHZB 5L9DL 4DZ8A 2IJ0C 5DMJB 3CZFB 3ZDZE 4XCNA 2HTLC 3DBXA 2Z92A 3I75B 1WTGT 4JGMA 1UCBH 1FYTE 4MS8C 3SPVB 3K74B 4DN3H 1OT1A 5J12C 5CJOH 2FJHA 1KB5B 5HHNB 3RX8A 3DHJA 4W68A 4JDTH 2XA3A 4JCMA 4UQ2B 4V1DE 5K9JL 2YEZB 2JJSA 5T3ZH 1A47A 5J57B 4ZD3L 4PJCB 5D7JB 4PJCA 1MJ7L 2C9AA 4U6VL 1U9KA 4NCC2 1T1ZA 4D9RE 3RY5A 2GTWB 3D85D 4NIKB 1P4LB 3T4AA 5I17A 2WINB 4PV8B 3DMMD 4CL7A 4PTUA 3QXDB 3IF1B 3MRBB 3DOSA 4X98B 5DQJB 5D4QA 1NCBL 4JFEA 6FABL 3P0YH 2GKIA 3IAQA 4EI5B 1L7IL 3A6OA 3HS0B 2CLRA 2PXYD 3MRRA 5DQJA 1M6OA 1NGWB 1NGZA 3VFGH 5LG1A 3LH2L 3ALXA 4UV7L 3ZTJH 4TTDD 1TZHB 4F8TA 2VQUA 3SDXB 1ZGLA 3U9PL 1YEHH 3BPLC 2QSTA 1CE1L 1HQRB 2IAMD 4RAVA 1RJCA 4LHUG 5DJCA 5KAQG 3HPLB 1MAMH 1I7ZA 4WTWA 1H8NA 4BA8A 1AHWB 1G7JB 4OUUB 5CLWA 3QUXD 4NGHL 5DGRA 3C6LB 5I1IH 1HINH 3QH3B 5JO5A 3LEYL 5HYIA 3VJ6A 2O61B 1KEMH 3RTQC 2F58H 1A9BB 3GSNA 1KULA 3TZVD 5FXCH 5I71C 2OXHA 3QIUB 4NQDB 1GRWA 2GSIB 3UDWA 5D2LE 4MNQD 4UILH 2MCG1 3HE7D 1HCVA 1TZGH 1ZWIB 2NXYC 3FQWA 1A7RL 1OD9A 2MCPL 4KROB 3MACH 1S7WA 8CGTA 5CGYC 3CXHJ 2IH1A 5CBAA 3FB7A 4LDOB 2HRPH 3SBWA 3BHBA 3WSQL 5CP3A 3MZGB 5F88B 5DZNA 3DX8A 1ZT4B 4WCYH 5EU6B 5IG7A 4ONOA 1T04A 1TQCC 3ULUH 2YZ1A 1HHHA 1NBYB 2ZPKH 3UTSD 4ZNCD 3ARDD 2Z0BA 3IU3A 4ZTOL 2AQ1A 4K2UH 4RIRB 2VLRE 4OM0H 3X3FH 3AS2A 3CC5A 4YE4L 1G1CA 3STBA 4BYHA 1VERA 1A6UL 2XKNB 3DV4A 5CHNA 5A3ID 4WFGD 1S9YB 3KPSB 4JVPA 3DETD 5F96L 3ZYIA 3I3DA 4FTVE 4N0UE 3OGCB 1DQQB 3ZT5A 3ULVL 3MODL 1ZT1B 3MRKA 4WUUA 1CXFA 3RVVC 5C09E 4P0DA 3RTQA 4LARL 2E8ZA 4DUWA 4J4PA 1OP3K 4KAQH 1CLYL 5GRXG 3WDJA 3L5JA 3QPQD 5DVKA 5EOTB 2J8UF 4JY6A 4MA1C 4P57B 1DEDA 5J3HD 1IKNC 3G5VB 1AD9B 4I0PA 4GRLC 3MLZH 1QPPA 4IOSD 4CJ0A 1J1PL 3OXSA 1N8ZA 2QQKH 2D4DA 3UPRB 3MXVL 2Y07L 4NC1C 4LSQH 3PWUB 2ZG1A 1TXKA 4NRXA 3U82B 1WFNA 3MGTB 5GGUA 3DJ9A 4LPTA 4JHWL 5C0CA 1SYSA 3F5WA 4P4KC 5C6WH 1AXSB 3AXLB 4PJAA 2YKLL 3MO1B 2WAHA 5E94A 1NDMA 3B4NA 3BQUD 5SX4H 3CMOL 3HMWL 3SHSA 3CDGB 4X4XA 3WIIL 1SYVB 2VZ3A 3DVFA 1NBVL 4NM8H 3VA2C 2BDNH 3IDMA 1DQJA 3ZE0F 4HWBH 2FIRT 3UEZA 3WE6B 4DVRL 3DLQR 4APQA 5ITFA 4XWOC 2IAMB 4GQ9L 5E03A 1BWWA 2H9GB 1KPVB 1HHIA 2QHLA 2F54D 1T7WA 3JTTA 2BVYA 2DQGH 3UYRL 4JM2D 5MHSD 2VR4A 1CVSC 3MLTB 1YMME 3LOWA 2NY3B 3LKQA 5GJTH 3VFUB 1DDHB 5FO8A 1BLNB 4U0RB 1LVEA 1VGKB 4ZODA 1NUDA 1U3HD 1P7KB 3FFCE 5DYOB 5HHMD 2CIKB 4X7EC 4WW1A 3CFKB 5GS3A 1K8IA 4RWYH 5AD0A 4GKSA 2BHZA 3QIUD 4NQDD 5I1AA 3SDCD 5DRWA 1FL6A 5DUBA 5GS0D 2NZ9C 1AFVL 4BZYA 1TCMA 3LN9A 3OAYH 3OX8A 1IKNA 4K8RD 3VFMB 4R8WH 1DBBL 5IW1B 3F62A 1WZMA 3CUPB 5ETUA 1WWBX 4GLRH 2Z9TA 2EYRA 2UWEF 1FNEA 2GI7A 3MFFB 1KGCE 1HSAB 3S5LA 3Q5TA 3V4UL 2JB5L 3GJEA 4M6OH 3HI1B 4Y2DB 1EPFA 1FGNH 3B2VL 2B4CC 4ACPA 4JRXB 5DUPL 3D18B 3R0MA 4KUZH 1UKTA 2OTUA 4O5LL 3CFKA 3CIQA 1SBSH 3I85A 4XPFL 2NNAB 1H5BC 3DYPA 5F71A 4OFYA 5L8JB 2CLZB 1EIBA 4GO6B 2CXKA 3LIZL 1HH9A 3RGVD 5FB8B 5DMYA 1NDGA 3HE6B 3FN0H 2W0KA 5JIKA 1KPVA 2CO6B 3GM0A 4JANB 2YD4A 2EDNA 3BP5B 2HFEB 5JNYA 3L3IA 1Q9OB 5CMAA 3QJFB 5DWUH 2VDLL 3MR9B 3PG2A 3S3JA 1IM9D 4PY8I 3G9AB 3BH9A 2ZCLH 1DANT 5HPMA 3EYFB 4JDVB 3H42L 3PP3H 5C2BH 4YZFF 3I6KA 2YBRA 3MO1A 3OKEA 1Z6JT 4PJAB 1YQVL 4DJMA 1ES0A 1RK0B 4ZXBD 5IHUL 1AE6H 2JB6A 5C0GA 3DMMA 4ZS7H 2WIIA 1OAXH 4DVBB 2VDRH 3SCMC 3QWRA 3OB0H 4HS8L 5EFIA 3U4BH 4PJ5A 3ZDZF 2F5AL 3WO4B 3MRNB 4H8WC 3H0TA 2FHCA 4ODWB 4KJQC 3ZTNH 3T0DA 4UB0H 5IEHA 1UM5H 2WQRA 1H8SA 4YLQT 1GC1C 4RFNC 1JWMB 1RUAH 3RTQB 3O2DA 1MCSA 5SV3A 4HIHA 1IFHL 1IAOA 3PWJA 3ULUF 4YNYB 5E2UL 4L8BB 2BSSA 1AHWC 1URLA 3JV5A 3BH8B 1UM6H 2VUOA 4UILL 3DROB 3JV6A 3U46B 2VSDA 5CHNB 5AZEH 4ELMB 4CRPA 4PJAF 2C26A 2GCYB 1A5FH 1JPTH 5FECA 5BZDA 4ZFOA 5C08D 1YA5A 3NCMA 5D8JH 2AXJA 5EZLA 3MCG1 4HV8B 1IQWH 1CI5A 1I4FA 4LPCA 3V4PL 2V9RA 3HE6D 3MRQB 5KZCD 4FZ8L 5J3HC 1NMAH 5DURB 2UY6A 3QNYB 4RGMC 3MBXH 3TBVA 4C56B 2DKMA 4LU5H 5HI4D 1BQUA 5TDPB 1M7DB 4QEGA 1V5JA 1FE8H 5JPMA 1S5IL 3SGDH 5EOQL 1GZPA 2R39A 4JG1L 4PJEA 4OM1L 4N0FA 2ERJB 1G6RB 4MJ6B 3P4OB 4BUGA 4EVNB 4Q2ZA 1OLZA 5I1KH 4J6RL 2W59A 5DXWA 1KJMA 2D7NA 2NY6D 4JFDB 4MJIA 3V5HB 1LEIB 5JUEH 4XP9L 3B9EA 4JFOA 1KPUB 1ZGLP 4X7SH 1OB1B 3C5ZB 5D5MA 3TZVB 1HXMB 3UP1A 3TCLB 5C3TA 3RWEA 4JFZL 3BP4B 5D2LF 4HUWB 2O61A 1A3LH 2KL6A 3AREB 3KPMB 1LMKA 1AHWA 1G7JA 4OUUA 3U7AA 2DLIA 4NRZB 5L8LB 2HFFB 4JY5L 3DXAB 3AU1A 2R0KH 1YNTB 4NN5B 2V17L 2AEPH 3HPLA 4U6HB 1B3JA 1FFOB 3IKCA 4M7LT 1RJYB 4KRPC 3QXUA 4KI5F 4JPKL 4W6YB 5T5FH 1NC4B 2W0FA 3IS1X 4YK4B 2X4RB 1PBYA 3LB6C 4GFTB 2FNBA 4W6WB 4WV1B 1MHCA 4JQVA 5IVXF 3N1PC 2ICES 5HHVL 3HLAB 1DE4A 3P77B 1AD0B 3WBDA 3VDAA 5BRZE 1A9EA 1INDH 1QSEB 4OLUL 3MJGX 3RGVA 2ZOKB 4U1GB 4OD2B 3OKLB 1FNGB 1UJTA 3CCHB 2X6MA 1A4JB 3BZFA 4MQXC 1CT8A 3FQUA 3I3EA 3DXAE 3F7PC 1VPOH 3T8XA 3QFJE 2DIBA 4I3SH 4J7RA 5IVZB 1GGBH 4XC1L 2UWEE 2X1WL 4Q6IC 3UTQB 4A6YA 4ZSOB 5JW4N 1P53A 4XNXH 1RURL 3ILQC 3FQRB 5DA0B 1BFOA 4KK9C 3ZMRA 2XOTA 2JF1A 3I6GB 4XVSL 5DMGC 1DSFH 4W81A 2H32B 1KB5A 3QO0A 5A40E 3LKRB 3IETB 1U3ZA 1HKFA 3K2UL 1UM6L 1NMBL 4OGAD 4ZFOL 3EOBB 4I2XE 3QCUL 5EU3A 3HE7B 5IHZA 1MFDH 2FLBT 4YHZH 5DD0H 4ODVL 5EN2A 4QF1A 4XP5H 4X7FC 3MRLA 5DK0B 4NKIH 2FGWH 5ADPL 4ZO9A 1T2XA 4RGMB 1D9KA 3D25B 5HDQH 5GS2H 1JNHA 4HJ0D 1RZKC 1ZLUH 3DXAA 3T3ME 3HZVA 3SJVB 4P2OB 2XWTA 1IC7L 3GEWB 4LSTH 1N6QH 2R2CA 1U41A 4MD0A 5E2UH 1J5OH 4LCYB 4OZIA 1Z3GH 2ZCHL 2WANA 4MLIA 4Z0XB 5F1IB 3VFNA 3ULVH 3N1MC 2J4WH 5IVOA 3WFBH 2HMIC 2HT4D 1YEFL 2EXYC 1QFWM 1IM3A 2VC2L 4LKCA 1MCPL 4OLZL 1UB5B 1X5GA 4BH8B 5J56B 5GRZA 3MYJB 2JE8A 3B9DA 1JZ8A 4XC3H 1YEGL 1BM3L 3C9NB 4GBXD 5ALCH 2VJXA 2ZG3A 5KW9L 5GGVY 1KCKA 4P2CG 3D2UD 5HPOA 1PW3A 4F7CB 1P5VA 3VFOA 3VE0A 3O11A 1OGAA 4I2XA 2PXYC 3P73B 1D5IL 2I9TA 4NUJA 1T03H 4RFOL 3SJVE 3MLWL 3HZKA 3LMJH 2GQHA 2CK0L 2EIZB 4ZUWB 1E4XI 4QXGL 4O2FA 3WHE0 4Y2DC 1OCWH 5IJKC 5C2BL 3QNYA 4JZJC 4WI2A 2FR4A 1YMMA 2IANB 3IFPA 4H5SA 1AKJA 4ZAKC 3CMOH 4JAMB 4N68A 3RJQB 4HUKB 3ZLQC 5DJ8B 2ZCKH 1IGJB 3FB8A 4MDJB 1ZLUK 3TJEH 1CU4H 4OD3H 1DCLA 4M48L 3O9WC 1MCOH 5EOCH 1INDL 4DGVL 4N5UA 5DUMH 1OL0A 1BVZA 1ZOXA 4K23L 1NGYA 3V5KA 2E5EA 4M8QA 4X7SL 1UZ8A 2F5AH 2H1PL 1ONQB 4GT7A 5DK2A 4D9LH 3QHZL 3V2AR 4ZNEA 1S7QB 4MWFB 4YXKH 2QADB 2VN4A 5BVPL 1R3HA 1YDPB 1I8MB 4IDJL 3LKOB 2A6KB 2A2QT 2BSSB 4NT6A 2P5EA 4P9ML 1FSKB 5IFJB 1I85C 1DEEA 3TFKC 4HGWA 4KAQL 4G6KL 4XGZA 2NY7L 4LRIC 4HSQA 4ZDHA 5CIPH 2W65B 1MLBB 3H3PH 1NKRA 4G7VH 1R0AH 1YMHA 2GJJA 2VLLB 3ME0A 1T66D 3MTRA 3WFDL 2MMXA 2CQVA 5HBBA 5AAWA 1GGTA 2V2XB 4FQJH 4Y8AA 1GGIL 1T21A 4RGOL 3MACL 5F21B 5I1CH 4XRCB 3HAEG 3QIBD 3V6OC 2B8OT 4QRPA 1LK3H 1QBLH 4K94L 4X99A 4WFFD 3QUYB 2WIIB 1AP2B 4MZ3A 4N8PA 3ZSTA 5E2VL 2JELL 3VXTA 3HE7C 4HKJB 4NFBA 2AEWA 2LU4A 4WFEE 3FT3A 3NCYS 3DI2B 1ULVA 4YZFE 1PEZA 3I2CH 1EEZB 4PD4J 4N1HB 3KPQB 1J8KA 2A74B 2K7PA 3I6KB 4RMTA 4NQXA 2VXUH 5CUSH 4HMEA 1VKXA 5FAAA 2E9JA 4MNGB 5BV7L 1E4WH 3BZEA 5IF0B 4OFDA 1H0DA 4U1JA 4KQ3H 3L7EA 4N5EC 1J0HA 2VLKB 4R2GB 2LTQC 4KPHH 4PG9B 4QXTA 3QT2A 1BD2A 5ICZB 2R9HD 4OLZH 2VAAA 3TA3C 4PJIA 3GI9L 1UXSA 1J1OH 1GJIA 1C16A 3BRFA 4PY7B 1QKZH 1T5XA 3FO2A 4TPRL 4XCCL 4JKWA 4Q58C 5E2TH 3QDMD 4PYHA 3DUUB 4JDTL 3WCYA 4FG6D 1CXEA 5A16A 3GHBH 3CVHB 3E6FA 3OKKB 4U6XB 7CGTA 5SWQB 4PJ5E 4R4NC 4MAYA 4GAFB 4RDQG 4X0KA 3WHXA 2NY3C 4H1LG 2JTDA 4UT6L 2NW2A 1J0JA 5IROA 3SGEI 3MMEA 3FQNA 5J8OA 2D3VA 1T0MA 1WZ1H 3GJEB 3O3DA 4HAGA 5CSBA 4IRSC 4X0KB 1CFSB 5D7LA 1FVCB 3Q48A 3E2HB 1NLBL 4BQ8A 4KK6C 3HZYB 3MA7B 4P9HC 4WFHE 1CFNB 2HRLA 4IRSD 1CU4L 3HR6A 3MLPA 1JGDA 5JZ7C 2P44B 4TOYH 4LNVA 1NJ9A 4LPXA 5F8RC 3AC0A 3N9GL 4NZJA 3KPLB 5HHME 2DBJA 3VRJB 4RA0C 1MFEH 1Q9LA 3M1BA 3VI4F 4D0DB 1KV3A 2DWEA 5FHBH 2WBKA 4BH7A 5KSAB 3B9KD 4OGXH 1QSFA 2EDWA 4DQOH 3LD8B 3LV3A 5CILL 3OGOE 1HHKB 1IGFH 5JQHC 2EDQA 1W0YT 1E0OB 1J0YA 3PNWA 3WEXA 1GGIH 2VIRA 4Y19E 3NN8A 4ZQKB 4Q9CA 4IOIB 2D2OA 1FFPA 2DL9A 5AWNH 5DDHA 3GSUA 3K8MA 2K7QA 3PDOB 5JMOC 1FIEA 4OCMC 3GSWA 1LD9B 5JHLL 3QUYA 3I2CL 1KJ2B 5HGAB 4JLRB 2VL5A 3O41B 1SYVA 2NYYD 5F93C 3OHXB 1DL7L 1ND0A 3P4NB 2WK2A 4HK3N 3IFOA 4R0LA 5E8NB 5EWIH 3K4AA 1KUMA 2FLRT 3LQMA 1V3LA 4MNHB 4XVJL 4ZUSB 4QTHB 4U6TA 4RGOH 1G7PA 4P46D 3UBXA 3FRPG 3U0WL 1MREL 2D4FA 3GJFB 4N9OB 4O4YL 3NIGE 4OGYL 3U0PB 3D0LB 4URTB 1JK8B 3MBEC 4JPVL 4NWUH 4KI5E 4P2YA 5C09D 4WHDA 3FFDA 3SDAD 3ARBA 4IDLA 1N8ZB 1YUHB 2BX5A 3B2VH 4X9HA 4G6KH 1FCGA 4HZAA 4FQ2H 2CDFB 4P2OC 1ZSDB 3L3JA 1CF8L 1KT2A 4IRJC 1C08A 3IDXL 4NNPH 4M1DH 5EIIB 2FB4L 5E6ZA 4U6YA 4ZFFB 2HN7B 4OV6F 3UC0L 3MJ9L 3MRHA 2HKHL 2VLRD 3KR3L 5FGBA 4YBQD 2P8MA 3QQ9C 2OZ4L 1YN7B 3MXWL 4XC3L 5ICYB 1JI1A 5ECJE 1TVHA 4PRIB 4XMPH 2BMKA 2DD8H 3UX9B 3KPRD 3DUSB 4X8XA 1JGUH 4NJAH 2F53E 2YUZA 1BJ1J 5JIPA 4RIRA 3LZFH 4C55A 2FJGB 4QRRA 5E8DL 4NUJB 3GO1H 1B0RA 3JUYA 3BW9A 4R7NB 3VFVB 3VE0B 5DD5H 3RWGA 1RPQA 5IW6B 1K5NB 5F44A 2D7OA 2ZUTA 4HFWB 4NQSA 3QUZB 5I75B 1MJ7H 3MYJA 3TH2T 5IQ7L 1K85A 1A3RL 5DI8B 3WNLA 2VDKH 2VLJB 1GH7A 5ERWA 2GSGB 3BGMA 5T1KD 2A6DA 1PZUB 1JCKA 3MRMA 4CN6A 4G8GE 2XYCA 4NDMA 1I9IL 2I60H 2R1XB 4KK5C 2CKBB 3S8WA 3RL2A 4LCYA 4OZIB 4IRJD 3PXHA 5C6TH 4MD0B 3N1FC 4LPWA 1RUQH 4WV1C 5C8JB 3SQBA 3HZVB 3SJVA 4OCWH 2AJ3B 4HJJH 1RZ8A 3BAEL 4ENED 1CGSL 4LEOB 3E6HA 4PV9B 1D9KB 3FL7A 3D25A 1YPZF 1U92A 1PLGL 2E6PA 2J3SA 1T1XA 4FQCH 5FDWB 4PJBF 3BWUC 5DF0A 1BPVA 2RAMA 1IGFL 1KCRH 4HUXB 3Q5OA 4YHIA 5EU3B 1E6OL 3QDGB 2C3GA 1V3KA 1FLTX 3MV7D 5JO5B 1XZ0A 1CD9B 4ZAKD 2FO4B 5IMKA 3MCLL 4N0CD 3OJMB 5J9PA 1YEEL 5DHYA 4YPGA 1S5HB 5IKCB 2YD7A 5E6YA 4NGHH 4GXVH 4ZNEE 5C0NC 3RZCD 1CK0H 1Q1JL 1HSBA 1JGEA 4HDIA 2V2WA 2VH5H 5DO2C 5HI5D 3FO0L 4XVSH 3VRIA 2BNRE 3BQUB 4YJZL 3TBWB 2E6QA 4ZOCA 2UUDK 4OZGA 5FCSH 1P9MC 2G2RA 3DX7A 4GAYB 2EC8A 2YWYA 2EDEA 2ERJC 4WO4A 4M93B 4LSRH 2VXVH 3MRIA 1A4JA 3BZFB 2VXSH 4QT5B 1KB9K 1GZQB 2YRLA 4PR5A 1VPOL 3OB8A 1SJEA 5GHWH 5D1ZC 5DEZA 3B9KC 3MOAL 5FO9A 4S1QL 5DJ2B 1L9MA 4KJPC 4O00A 3PL6B 3HUJA 2Q6WA 3OR6A 2GTWA 2A38A 3WSQH 4U2YA 2FATH 3ZSSA 2ENSA 3C8HA 1G7HB 2ESVD 3BUYB 1U8KA 3DURB 3QUYD 4B5EA 5T1KB 3T0EC 4JHAH 25C8H 4WNQA 1T6WA 3ARQA 3T1FA 4Y5XB 4JFEE 2AABH 2DLFH 5E8DH 4G6JH 3BESR 3NIDF 5EO0B 4KZDH 1OP9A 3KXFA 4P2RE 3JWOL 1MI5B 5K9JH 4YO0A 4NRZA 1F3RB 1FJ1A 4HUUA 1U8PB 2IFFH 5E56A 2ICEA 1Z9SA 1MCEA 1MI5D 5ACZB 3ISWA 5FYKE 1KG0A 5FYKH 1OAUL 3HTLX 4Y4FC 1F3JB 4RZCA 1FV1B 4PJFE 1NCAH 1MVUB 3HMXH 5IBLD 2VQTA 5F96H 3VXSE 1QSFD 3AUVA 1KTLA 3SGJC 4K71B 1PD6A 5D7KE 2YPVL 3ARSA 3QAZC 3FONB 4F58L 4Z7NF 3ARGA 4U4BA 2YMXL 1RUQL 1QLRB 3QFJA 3S37H 3SDXF 1ZHKB 4H26A 3K8KA 1MFBL 2VTFA 1RZ7H 4RNRB 5FYJE 5DJAA 4PJEB 2X05A 4QY8A 2OX5A 2I25N 3MLZL 4X6CA 4X6CB 4L9DA 3ZTJG 1EUTA 4HCRH 1BQHA 3V4UH 4I5BB 2NY6C 4NKDB 3HPJA 4LLMA 1MAJA 2P5ED 4NZTH 2BXYA 5FYKL 1KIUA 4PGDB 4I0PC 3MNZB 3IXTB 1MFCL 5T3XD 2BP3A 1UCBL 3T2OA 3UYPA 4HF5L 2AJYL 5K59E 3ZKNC 4NO0A 5FM5M 3QG6A 1K6QL 4KH2A 4P49A 4RWHA 5JOFA 4J8RB 3G6JE 4PJDA 5HJ3A 4OD3L 5CINL 2NY1C 4XZUB 3GIZH 4G7VL 1VACB 4HHAB 3ALPA 5C86A 4F7PA 3SY0B 1QR1A 1YEKH 4NQEA 5KVEH 4LNRB 4NQCE 3OMZA 2NY2B 3FN9A 4HJGA 2HG5B 4LLQB 5HHOD 4L8BA 3GMQA 4KI5C 5F9WB 3MOAH 1WLHA 2Y06H 5FOJA 3G6AA 1QRKA 3T0AA 4DKEH 2W91A 1ORSA 1XMWA 5T33H 3AS1A 1WBXB 2DL2A 4GKOA 2VDQL 4QHLA 4U1SB 1B88A 4FQCL 2COQA 3TESA 5FO9B 2BHYA 1J05B 2HLFD 5JLZA 4AIZB 1CLCA 3SDCC 3ZT7A 2YUXA 2CR3A 2AEIT 4KKAD 1F5WA 4NWTL 1U91A 4Q9RH 4WO4B 4HS8H 4MB3A 4HIIB 4YFDB 1AGCB 4FQLL 3LRSB 4LCWB 3VMPA 4YHYC 4TNWF 3BN9C 1IGCH 2I5YH 3VWKA 1KFAH 2MHAA 3HAEA 1BIIA 3QUMA 3C5SA 5ESAB 1IQDA 3NPSB 5IFHH 4HMCA 4P5TA 1JGEB 1T03L 3LEYH 2DQJL 4U3XA 3QYCA 4HX1A 3IJYA 4BFBD 5LWYH 4NRYA 1K2DB 4M61B 1IGYB 2ZNXA 3BPLB 1AGFB 5E99H 2YMXH 4L4VE 3VWJC 5KVGH 4FQHA 2FH6A 5E9DE 2BVEA 4YDVB 3VXSA 3BP5A 5TPWH 5I9QB 4LVNC 4LSUL 4M4RA 1FZJA 1PJ9A 1EAPA 2N1KA 1MIEL 2DQUH 5I8KH 5I1LA 2GHWB 4YPJA 4BFIA 3S34L 2I24N 2P8LA 1EXUA 1WITA 4XVUD 2WWKO 1PZ5A 1D5ZA 5TFSL 3GBNH 1TVDA 4XXCA 3V4PH 4PGEB 4NJ9H 5E24E 1RZ8B 3HC4L 1NAMH 1P7QB 4LLDB 5T1LD 3CX5J 5BXFA 2P24A 1G6RL 1UJ3B 4ISVB 2V5TA 3IDYB 2XRAH 2R1XA 5ADOL 2DDQL 4NDMB 3IDJB 1FNEB 2GSGA 1FNFA 1EHNA 3GMOA 4L3EE 3BEVA 4QHNA 5DFTA 2B39A 4OKDA 4P23B 5DVMA 4I48B 3P30L 5LVEA 4LU5L 1UH4A 2X40A 2NPLX 1BX2A 5BOPA 5FV2A 2HLAB 2DQTL 1VSCA 1EA9C 1WIPA 3H9SE 5EBGA 5BVJA 5SWSB 4IIQA 3BQUC 3PWVB 3ZTNL 3GSVA 3L6FB 3RWCA 1BP3B 3SE4C 3C5ZC 15C8H 3L3GB 4WO4D 8FABB 1BVLB 2OS7A 2C7UB 1G7IB 2DJUA 4LLUA 1A14L 4YGAB 4JY5H 3B3IA 2BJML 4XVTH 4YFEA 1NEUA 4GG8B 5F7UA 2H9GA 2X4QB 1DN0B 1MELA 3O2VL 3CSBA 3FHAA 1WC7A 4AH2A 4Z7VA 3BXNB 4TULH 4GQPH 4DGVH 3DIFB 3EO1B 5DJDA 7FABL 4UQ3A 2W9LA 4S10A 1KLUA 4POZD 2NXZB 1YN6A 5L2KE 4O9HH 3QNXA 1XT5A 3MLRL 2X4SA 1GYAA 4YGVB 4XPHL 3B5GA 1MUJB 4PJ9A 1CGWA 3KVQA 1R5VA 2XXMB 3EW3B 3QQ3B 3D0LA 2PR4L 4X6FA 4MDIB 1CFVL 1LQSR 1ZS8A 4MA7L 4LFHG 4G6FB 2HKFL 5FF6B 2FO1A 3EHBD 3HAEH 3SDXE 4O2CB 3S36L 4OQTL 2YUVA 1XF2A 2AV7A 2I07A 4LAQH 3ARTA 4P3DB 3QUML 1WK0A 2X4SB 3G04B 3JWOH 5M7QA 3ILPB 1OWRM 3MLUH 2IPUG 4XPFH 1DBML 1NC2A 4RGND 4BK5A 3C60C 4KFZC 1NMCC 4RRPG 1VGEH 2IADB 4JLRA 3SE8L 5IWLA 3VWJD 5AAMA 2R4RH 3BXNA 2A6IA 2NR6C 3RDTD 1WCQA 4RFOH 5FYLH 1U8JA 1DQQA 2X4QA 5E8PA 4RFNB 1D6EB 5LGHL 5DJ0B 3GIVA 4QWWD 5I8CB 1TMCB 3OKOA 2FEEL 2W9DL 5JXEA 4B41A 1J86A 3OPZH 4RSVA 3WFEH 3FTGB 4YIQB 3MRGA 1AFVH 3L3GA 2KZWA 1XGRA 4K71C 4OGAC 3VGGA 3OAUH 4TSAH 1M71A 1ZANL 4P4KA 4QHLB 2N7BA 1B90A 4U2ZA 3LSOB 3UJIH 3RA7H 1A3QA 2X4PA 1P9MA 2HP4A 2ZSVB 3C60B 4ALAL 1CXHA 4GW1A 4RMVA 4TRPL 5EBWB 1WIOA 4P9MH 5ELIA 4I4WA 4NQEB 2HJLA 2CDGB 5SWZD 2ICWJ 2GT9B 4YXKL 1S7SB 5T3XE 3O3DB 4MQ7A 1NCWL 4RAUA 3MRFB 2OJEA 4S1RL 2JCCB 3ORJA 3CVIL 4XBPA 5FCUH 2M2DA 4J8RA 2P5EE 3ULSB 1I7TA 2W60A 1NKOA 5JOFB 3D69A 5LCVH 4L3ED 4MQTB 1C5DB 1F42A 3RIAF 3VFSA 3VXPA 2VLKE 2NLJA 4GAGH 3MV8E 4ZO8A 1CE1H 1HI6B 5DEFB 4PJFF 3CVHA 4LP4A 4S1DC 2NY5C 1MJ8H 1IKFH 2AW2A 3WXVH 3S96A 1ZT7A 1A9BA 5C92A 2V5MA 2Y4SA 5C2UB 4JPWH 5TDOB 1KLGB 3T77B 5ID0B 3QH3A 4YWGH 4E42B 1HH6A 3BWAB 4QRPE 4HXBL 3WKML 3GHEL 1OGTB 3QHFL 5J11B 1Q9WB 2EDXA 2E9WA 1JWUB 2NY0D 5D2NC 3TBSA 4FQIL 1HYSD 4N8CL 5IMLA 25C8L 2Q8AH 5FYKD 3EJYD 3WUWG 3FONA 1CR9L 4CVZA 4U1JB 4ZFZB 1U58A 4PGCA 5GGVL 3MUHL 4DK3A 1JIBA 4MXVF 3SDXA 4X6DA 3LD8C 4EI5D 1IGCL 2HJKB 2SEBB 4OLWL 4XPBH 4OZIE 5DD1H 5D7IF 3NAAH 2BXZA 4JRWA 4ERSL 4Y1AD 4LCWA 1AGCA 1W0WB 2NCMA 3C5JA 5JORA 3VXTB 3A67L 1V7NL 4IEFB 2DM4A 4K55A 5CEXB 2RBLA 4PBWD 4YHKH 2YHGA 1OF2A 1AGEA 4QRPB 2ESVE 3G6JF 5F7KC 1HOCB 3CVHH 4DW2H 4ODHL 4XPAH 1N4XL 3TIDA 2EE6A 4Z7VE 2VZ1A 4X98A 1OAKH 4I3RH 4XBEH 1F2QA 1YEIL 3RWIB 3LDBC 1ACZA 5FGBC 4M9PA 3T4AB 1JHLH 2AGJH 4P2OD 4RISH 2VLLA 1RHHB 3KPNB 2HT3D 1NLBH 4FXGB 4IBLT 1KJ2H 4IOFC 4LOUD 2BVPB 5EU7C 4KROD 3R0NA 5GGSA 5C0EA 4YDJB 1T7VA 3EFFA 4QLRA 1NFDA 2FJHB 4F7PB 1H3UA 1G84A 1B4JL 4ODTH 2VDNL 3KJ6L 1UZ8B 1U93A 4QT5A 1AJ7L 3MV9D 4XZUA 2DDQH 5T5FL 1U3HB 1ZLSL 4PJHF 4JG1H 4YHPB 1WZLA 1UXWA 3PL6D 4NQCD 3QUKA 4HK0A 5FCUL 1OSPH 3GSRB 3QEQA 4R2GC 3MJ8B 4N90E 4AT6B 3QDGD 5T1DL 2J2ZA 2XTJD 3W81A 2R0LL 4KJYB 2D7TH 3EO9L 4PB0H 4CW1A 5IB5A 4BZ1H 3W0WB 4L3EB 1KNOA 1QSEE 2CJUH 1UVQB 4G6ML 1MQ8A 2FJFA 2R8SL 4WTZA 3WL9B 4NCDA 2YZ8A 2F19H 2I9TB 3TEUA 4LSSL 1T7YA 2M8XA 4WHYH 3TT1H 1NFIB 3NGBC 4OTXH 3VI3E 2BSTB 3QFJB 4OCNC 1I1AB 5KTEL 3P9MA 4DVRH 3S96B 5GRWA 4JM2C 1BFSA 4DOHE 4JFQB 4G8GD 1S7RA 2GK0A 1JYVA 1VCAA 1I3GH 3NCBB 1FYHB 5DMKA 3REWA 3CDYA 4PGBA 2W60B 1F3JA 3I50H 3NFSH 3NPZB 3WLWC 3OKMB 4WW2B 3RL2B 1I3RA 3SGKC 5M95B 3KXFE 4R3SB 1QSFE 4JO3L 2WQ8A 3O6FC 4G9FE 3PQYE 4QCIA 3RWFA 4AG4H 3KG5A 4WNQB 4U05A 4JKPL 3QDJD 5GISL 1GC1H 2ZSVA 1CFQA 4OCLC 2F53D 3QIBC 2HTKC 4MCYA 1B9ZA 2NXYB 3HE7A 5I19H 1N0XH 2DBLL 3IDXH 4NNPL 5GS2D 2O5XL 1RMFH 2IALB 4QHMA 1EHLH 3WLBB 5JQ6H 2FJGA 5J6GA 2H32A 3QO0B 4X7DC 1GGBL 1MCWM 4U0QB 2EYTB 3MCKB 1MFNA 3RRQA 1KC5H 1HHGB 5F7EH 1MPAH 1XF4B 5C0CD 4HQQL 3ULVD 4UNVA 1K8DB 3T4YA 4FQXA 2CDEA 4K7FA 5F3BA 5F6HI 3GSQA 3G9VA 5SX5K 4J3XA 3BZ4A 3TYFA 2X4OA 4G9DA 3BEWB 3DETC 4MA3A 4HKXB 1B2WH 5E5RB 4RFEA 2ADJA 3FQUB 3O6FB 4PJ7E 3X13B 3PV7A 3I9GL 1PY4A 2DJ4A 2YPKB 4YUEL 4EBQL 3JTSA 1LO3L 1D5BB 5IFHL 1EK3A 2YD5A 2CDFA 4PTTB 2EE3A 4GRWH 1AD0A 1JPGA 2Q7YB 4WW2C 3G6JA 4UTAH 3DVGA 3L5WB 4M6NL 4Z8FH 5DC9B 2XY2A 2X4RA 1ZAGA 3P4MA 2W0FB 4Y2DD 3BVNB 2QQQA 4JQVC 2BOCA 4PP2A 3ZYOA 3UPCA 1TJIL 1RJYA 4HUXA 1F90H 4QRQA 3DO7A 5DS8A 5B8CC 3W2DL 3KLDA 5DMIL 3NABL 3ZKQD 1LO5A 5MP6L 1NCCL 1T2QH 4RWYL 4OCWL 4MYWB 1KF9B 4P99A 1ADQL 1CQKA 4DKAA 1IVLA 4XAKE 3AU1B 4R7DB 3GK8H 3ZE2F 2VDRL 2MJWA 4Z7VB 4AH2B 3BP4A 1IAIL 5IV2A 1UC6A 1X5XA 3AAZB 1UFUA 1HXMA 3PDOA 4X7TB 4XMKH 5ERWB 2QR0A 3B9KB 5I8EA 3G5YB 4WI6A 3ARDA 4J3VA 3P0YL 1IRAY 4PJHA 1FLRL 2YRZA 3FZUD 4U1MA 5KN5A 7FABH 3PGCA 5KVDH 4JFDA 2PTVA 1KJVA 4JM4L 4M93C 5C0IB 4P4KD 2CD0A 3O9WA 5A2FA 3DX6A 5C07D 3L6FA 3RWCB 4MJ6A 3TT3L 1AQDA 5DJZA 1GGYA 5B38A 4XVTL 3FT2A 1NL0H 4LPUA 1GIGL 1QNZH 2M26A 3PXJA 4MVBD 3T65A 4BQ6A 4IOFD 4LOUC 5SWZB 1FN4B 3O3EB 1ITBB 5DR5L 5IB2A 1ZHLB 4Y89A 3O2WH 1S7UA 2HA1A 4H1LB 35C8H 5CSGA 5IMMA 1I7UA 1L7IH 3U48A 2W0LA 2YK1H 4JFXB 5I8OH 4LSPL 1FP5A 4MCZB 3VGEA 2WBJA 1BGXH 1H9VA 1U6AL 4KRLB 4ZUVB 5TDNA 4EZMA 3LVEA 4C59B 3L3KB 5I30H 4JZOA 3AM8C 4KRPB 1GAFL 3FQTB 4XP1L 4X8JB 3SDCA 3KPRE 4JKPH 4UT7H 3OKNA 1C08B 4X6BA 1AXTL 2NTFA 4WI5A 5AUMB 2R2EA 5BV7H 3JVGA 4K3JL 2F5BL 4N9GB 5BV7B 3G5ZB 3W39B 4HC1A 3DUUA 1FNSH 2AJVH 1J10A 3FT4A 4YNYA 2GJ6E 4JN1L 2DD8L 1EAPB 1FO0H 5E6IC 3QIWB 4P5TC 2FH8A 2NYYC 5GGTH 5MEOB 4YDVA 3VXSB 1T1WB 1MCNA 1XGUB 2B20A 3ES6A 1X5KA 2IH3A 1ZA3B 4HH9B 1AGFA 4WFED 3OHXA 5ILTH 1SJHB 3QUZC 3L3OB 1JRHL 1BZ7B 1RD6A 2PKDA 1KJ2A 4JZJB 2ATPA 3GMMA 2E9IA 3QUMB 5I71B 3QQNA 1YEJL 3S7GA 2MHAB 3HAEB 2H3NB 5C0GB 3HB3D 3HKFA 1XR8B 1YEDA 4OZ4B 2PCPA 2EH8L 1U8LA 2R1WB 2DJSA 5DDHB 2AXFB 5INCB 2APVA 4HIIA 4AMKH 4OZIF 1T89C 3AY4C 1EUUA 4Z76A 5J7CC 1BBJB 1DUZA 5HHXL 2W0PA 2ZNWA 4PRID 3N0PB 4CVXB 5F3HB 2Y6SD 1ACYL 1T0NA 2O93L 4D0CB 3DRTA 3BAEH 1XR9A 2OP4L 1A21A 2YKLH 4JHZA 4G7YH 5KSAA 2HVJA 4LGPB 5ENWB 1I1FB 3WS6A 5FYJL 4KDWA 1QRND 4PJXF 4EN3A 2F8XC 4K9EC 4F9LC 4GH7B 1RUKL 2MFNA 4L9LC 3QQ9D 1NJ9B 4G43B 1MF2L 5C7XL 4OLUH 4K9EH 4YBLC 1QFWI 4YX2H 4OZFA 3DVNB 3JWDL 1YEEH 4HHAA 5FHAL 1RVFH 2PO6A 3OKNB 2QKIA 4K3EH 2D0GA 1LO2H 3H9HB 5AZ2L 3CXDH 3RZCC 5D1ZA 3B43A 3HI1A 3QG6B 4M6MH 1DVFC 4M03A 5DVLA 3FB8B 1NBVH 4OZFG 3KGRA 5D96B 4EQ3A 3ARFD 1ZTXL 5IVNA 2VLRA 3TO2A 5E9DB 3V0WL 4CKVX 4QTIH 1PKQE 4PLJD 5KG9A 1YNLH 2J5LB 2EEDA 1S9XA 4EUPA 3HPJB 4LLMB 4LKXB 3RAJH 4HJ0C 3DPBA 1JE6A 3S4SA 4F8QA 1RU9H 3HZKB 3MRPA 3LEVL 5SWZA 4PJ5D 1EHLL 4XT1C 4FTVA 5I1AB 1IC4H 4LFHD 1LE9A 1T20B 4FFYH 4OLWH 5K9KA 4AENB 3O2DH 5JZ7D 4PG9A 4QXTB 4IS6A 3EHBC 4M7ZC 5FHAH 1YY8B 4KHTH 1ZHKA 2B5IC 4W70A 9CGTA 3ARGB 5K93A 3T04D 1H0DB 1KIPA 3KYMB 3WKMH 2FX7H 4PJHB 1YEKL 5HHQA 2CXGA 5ANMB 4GS7B 1MCPH 1MVUA 2XTLA 5BZWB 1GOFA 1J8HB 1F3DJ 4G8IA 3MV7A 5CINH 4KKLC 1GHFL 3IT8D 2J4WL 1TNMA 4X4MA 4ORGA 1IZKA 3WFHB 2IC2A 3CFCH 1FFNB 1U8PA 2Y72A 1A6UH 4IM8A 1SJXA 1IAKB 2EIBA 1MI5A 1N2RB 5C0DB 1MFAL 5ISZD 1KCUL 1JNHB 3CDGA 2QTEA 4LAJH 1UACH 4WEUD 1PDKA 2VZVA 1L4IA 2YXFA 3HFML 4ZTPL 1OP5H 3DO7B 1F11B 4HUNB 4QRQB 2VDPL 5JXEC 3OBAA 2AXHA 1T1YA 3U9UA 3BUYA 3TM6A 1OPGL 4ZDHB 3MGTA 4M1DL 4R97B 5IFJA 1OW0A 4FRWA 2VKXA 3HR5B 5D2LA 4PJCE 5ALBL 1S8DB 1R3HB 1F45A 5C0FB 3ZYJA 4M6OL 4GKNB 2HYMA 2OL3A 4S0TD 5IOPA 3D6GA 5I73C 1R5IA 4GW5A 4HPOH 5TF0A 4JFDD 4WIQA 4OCRH 1QFHA 4HKBA 2DLTA 4GXUN 1QBML 3VG0L 2C5DC 5SWSE 2PN5A 3QISA 4YHNA 3MV11 1PSKL 4MX7B 4MHHI 2XZQL 4YXHH 5CP3H 3T2QA 5DHVA 2A73B 3SKJH 1AKJB 4C83A 1AJ7H 1TNNA 1EO8L 1FNGA 3OPZL 3QEGH 3RWJA 4CVUA 4O2FB 3ARXA 1U95A 5HYJA 1OTTC 2EO1A 1D5XA 4FZEH 2QLVB 1NFKA 2EYTA 2WIMA 5E0QA 2DYPD 3BMVA 4Z77A 3VGFA 5KANG 1UJ3C 4PRPB 4TULL 4H25A 4RMWA 4V1DA 1P4IL 3DGCR 2AK1H 4Z7UA 4OFKA 4JCLA 2R56L 4FN0A 2Z91B 4ODSH 4Z5RB 5JHDD 3C9NA 4M43L 4OZHF 4R90L 2QHRL 3C87A 5E8EA 3PGFH 4X4ZA 5A43C 4S1QH 1JF5A 1JHKH 2R29L 4GMSH 1JBJA 4KV5F 5I1JL 4PV9A 3O9WD 3PHOA 3SKJL 4CBPA 1C8PA 1N5AA 4MA7H 2EC9U 1NSNH 4S1SH 1I3GL 4MAUH 1C12A 1C12B 4WW2A 1F6AB 3QEHA 3ARVA 1UWGH 3TCLA 5I19L 4TN9A 5TE7L 4G8GA 3REWB 5DMKB 3WJLC 3NMEA 1XAUA 3ZZ1A 5CD5D 1VGEL 3NPSC 5DK0A 4YHOH 3NFPB 5DFVC 4MJIB 1KIQB 3RVUC 3FOMA 4HFWA 4NQSB 1EJOH 4X6CE 3MA9H 5CJQH 5IW6A 3VJ6B 5IB4B 3EOBA 3BKMH 2VB5A 4FQ1H 2DMCA 2DQCH 5CIPA 1WUNT 3IETA 5TDPA 3DWTA 1DQMH 4IDJH 5D7IB 3QQ4B 2AERT 1NEZB 1B0WA 1NCUA 1U95B 5KJRH 1U8HB 1UA6H 4CW1B 5MP6H 1BFOB 4MXQD 5FKAB 3WNOA 5DJXA 1TVHB 1KYOK 4PRIA 1I8LC 2A73A 1I9RH 3IU4L 2MCPH 4ZSOA 3F12B 1G9EA 3LY6A 2ED7A 3SKNA 1MY7A 3QP3A 4K3DH 4OLXH 2GK2A 2Q7NA 4NZUL 1UXWB 3DSFL 1HKLL 1NGZB 4OM0L 3X3FL 5HDLA 2HN7A 1U3HA 4NKMA 5FECB 1E6JL 2H6PB 4NNYA 1M7IA 1FL3B 2C3WA 3OAZH 3SQOH 5A2IH 3RVVD 4JR9H 2FX7L 4OD2A 1IBGL 2K1MA 3VG9C 1FO0B 2H41A 3TC9A 3WFCL 2IQAA 1E4WL 4QXGH 3EBAA 4NQCB 3U46A 4FABH 3P77A 5TGBB 1QOKA 3OKYA 2V7NB 5IVXE 3BH8A 3LN4A 3EFFB 1B2WL 2B2XL 2HLFC 4IRSB 4NP4H 4LDLB 5FK9B 1QG3A 3NVQA 4HLZG 5BRZD 4ZUSA 1RZKL 1ZVHA 2FDBP 1F11A 4KZEL 4UQ2A 3CSPA 2YXMA 5E2TL 3IFOB 3RWIA 2FX9H 3V4VH 3S36X 3GBMH 2OMBA 3E3QC 1PKQB 3WV0A 5C0DA 4X5WB 1Q1JH 2HFFA 2NQCA 1CD1A 1CLOL 4U49A 2Z92B 3I75A 4KJQD 2UYLB 3TPKA 4Q7DA 2OTPA 4PY8J 2V5RA 2AQ3A 1ZHNA 2NY0C 1S7XA 2ED9A 4GQ9H 4N0UA 4F7TB 1VFBB 2JJWA 4H0HB 3NN8B 1BF8A 1LEIA 2R23B 3QHFH 5C0RH 3NCCB 4L4VA 4ZXBC 1UB6B 2C1OB 2CR6A 2VZSA 5C08A 1YPZA 3MRCA 2XFXA 1PKOA 4Z7WE 1G6RA 1DN2A 4UIMB 4TUOB 3NCFB 3GSXA 3P2TA 5A3IC 4XVUC 1RV6X 1X5ZA 2JCCF 4WI4A 5FO7B 4D8PA 2YA0A 1JYWA 4FTVB 3BKCL 4MJ5B 3PDGA 4YR6A 5JW3H 4KDTA 4LKXA 3VRJA 1I3UA 1KLGA 2X1QA 3BKJH 1KPRA 1ZT7B 2CRMA 2W9EL 5GRVL 5H35A 3H9SB 3BIKA 2H8PA 3ESUF 5DRXB 5HHPB 3VXUE 1T22A 4YHLH 3L5HA 3D69B 3ZKSD 4TUJB 3FO9B 4WJ5B 5I1KL 5BZDB 3S5LG 3MFGB 3VXNA 2OJEB 4EIZC 5KW9H 2X4TB 4CN4A 4ELMA 1U8MB 1QYGH 4NHCH 4OZFB 3D39D 1JV5B 1NANI 5JHDE 1E4KA 1IKFL 5EBWA 4I8DA 5F7WC 4GRMA 4GRLB 3MJ6A 4LCUB 1G6RH 4EXPX 4KTDL 4OFYD 3R06A 5JXAL 3FFCD 3OR7B 4IRJA 1ZEAL 1F4WL 4Y5YC 4HMDA 5DUBB 4HS3A 2FIKA 5F1SA 1MIMH 1K9TA 1DL7H 4G6FD 3ELAT 4JG0L 4GKSB 3G5XB 4PJ5B 1S9VB 1BJMA 3HNVH 3L7EB 2BVTA 1OTUC 4PJBB 1TQBB 2PW1A 3QCTL 3T1WA 3BZEB 1BLNA 4OZHE 4HWZA 3HZMA 5FYLE 3MOBL 4ALAH 4GUPB 4F7MA 1HHIB 4JM4H 1U8LB 4GRLD 1MH5A 2JKXA 3KPRB 5DJ0A 5I8CA 4QRTB 4JFFB 2AJUL 4X80L 2OL3H 4PJ8B 1BREA 1QR4A 2EDYA 1A4KB 2ZCLL 4ZD3H 3FKUS 4WU7B 1FYTB 4PRNB 5EU5B 5JHDA 4P2RA 5HVWA 3RP1A 2OSLA 5HDBE 3EYUL 3U9PH 4IHOB 5HHXH 1ZA3A 4JPIA 3AROA 4IRZH 1H3GA 4C4KT 4WTXA 1MH5B 3KPRA 5CZVL 3NZHH 3DRQB 4U3CA 4AYFA 4F7MB 4ZFGH 4R90H 5GGUB 1VEMA 4MDIA 1JGUL 4NJAL 3FT4B 3VGAC 1TLKA 1I8MA 3QWRD 2AJUH 5E4EC 1RHFA 2VR9A 4U1NB 4NP4L 4FTVD 2OTUB 3SDYH 1KEGH 1ONQA 2OR8A 5IMOB 2R2EB 4BZ2H 3D18A 4LBEB 4F15B 5F70A 4JJ5B 1JTOA 3DIFA 5DJDB 4L8DA 3RIFF 3TNNA 1BECA 1X5LA 1F6LL 4PREA 2IG2L 3CLEH 2VDLH 1GOGA 4YBQC 1CG9A 1YZZA 4AEHL 4XNMA 3IJSB 1VADA 2L7UA 3OGCA 1IGJA 4MDJA 1P6AB 3HRZB 1FO0L 1CL7I 2FSEB 1CLOH 1UH2A 2XPGB 3OL2A 2ADIB 4UI2A 4LLUB 3MLRH 3K81A 3KYAA 1MAKA 4EEEA 8FABA 3MRDB 2IGFH 5TQ2H 1FN4A 5DRWB 3TWCL 5H2BA 1IGIH 5D6DA 4L5FH 3FT2B 4X9FA 5F7MC 4NKQB 5GSRA 1GXEA 5HYSA 1H5BA 3EDDA 5DRXA 1HQ4A 1RIUL 4GLRI 5IG7B 5C0IA 3D48R 2DKSA 5BV7C 3IGAA 5GS0H 2B1HL 1ZVSA 4AMKL 4AEHH 3UTZB 5BCAA 3ZT6A 2KKQA 4MMZC 1MIML 4YEEA 3JZ7A 3FB7B 1RULL 4MXQC 3MCLH 1L0YA 4N1CA 3ZKXC 5C9JB 2AP2A 1IFHH 4XCCH 5F6IC 3D39B 4APQB 3MRCB 4C4KO 5DMIH 1CBVL 1WISA 1EFQA 2XICA 3VI4E 1W72H 2VH5L 2XKUA 4X4XB 1Z9LA 4ONGL 5GGRY 3LHPL 3QFDA 3VFTA 5IK3B 4NQUA 4HLJA 4BFIB 1F6FB 2E7LA 3GSNB 3QPXH 5C0CB 2F8OA 1FZJB 3P0GB 4POZC 3SCMA 4HPYL 2EH7L 2ICWI 5D9SB 1SEBB 4XP9H 3S35X 3P3YA 2JCCE 1GPOH 1KN4L 1PKQA 1QFWL 5HI3D 3H2WA 1DBKL 4GKZB 3SDDB 3G5VA 1BFTA 3JTSB 4F58H 4ELKB 2YPKA 3SO3B 3VH8G 2E9BA 2EDDA 4Q97A 4HX1B 1XF1A 2GTZB 4Q6YA 4U31A 1T2QL 1JZ6A 1S5IH 1EMTL 3FQRA 2Y1VA 2EDOA 2ZKHH 3GZKA 4G5ZL 3EGSA 4ZS6C 2GUOA 3F7YB 1ZGLB 4QTIL 3UTQA 4NNXA 1T0PB 2N4IA 2ARJB 2Z8VC 3O81A 3QR2A 4PGJA 3V6FB 3RKPA 3T8XB 5IB1B 4AEIH 2BSRB 2HT2D 2W1NA 4RMRA 5F7DB 3U2SA 5GJSH 3CH1A 3GSQB 1S9YA 2YS4A 3QJHB 5LXGH 3EDJA 3QO1B 1K8DA 4EI5A 1J0KA 4K3GA 5EO9A 5LQBL 2X1XR 3NIGF 1QSEA 2OK0H 2CIIA 2UV3A 5JLZB 4NKMB 3HLAA 5J6GB 3MRBA 4M1GH 3U7WH 5IFAH 2YPLB 5EZIL 2IALA 3MA9L 5CJQL 2OCFD 2WLYA 1T04B 3BKYL 1XGQA 4RMSA 4DFIA 2OBGA 4NWTH 3S35H 3QEQD 1JP5A 3PJSA 4P4RB 4MD4A 4Z9KB 1N3NA 2X4UA 1P5UA 4GAGL 1JHLL 2AGJL 1QSVA 1MREH 2CUHA 4LVNB 2PUQT 4TVPD 2PTTB 2ZOLB 4YE4H 2LAGB 1XGYL 4I77H 4ZXBB 4WU5B 4OFPA 3RWEB 4PGBB 1JHKL 5B39A 1E28B 1WBYA 5JW5B 3IJHA 1ZMYA 4LQFL 4JFYA 4PJGA 4QHUA 4APQD 3V5HA 5T1LA 3Q5YA 3FJTA 2XWBA 2PF6A 5GJTL 2BSTA 1TJHL 2Z8SA 4NWUL 4N0FB 2BVQB 2FBJL 1KTKE 2ZOLA 2CGRH 4ZO7A 4Z7WF 4I18C 2QQKL 4R4FL 1SM3L 3HC4H 3VWKC 1CDBA 3SEPA 2AJSL 2E27H 4FP8L 5EIQA 4MD4B 4YC2C 4JGUA 3O2WL 4JFHD 2JJUA 5TFSH 1HQRA 4BSWB 1ZLWK 3WIHL 1H15B 3QDAA 4JFYB 4JRYE 4PJGB 1MJJB 3MUGA 2BNUA 2H2PD 4Z95L 1MSPA 4DTGL 2DQCL 1AKJD 1KTLB 1YPZE 4HJJL 2X9WA 5IP4A 1WBYB 1U8QB 5JHLH 5ITBH 5EZLB 3OKDB 1FHGA 1TQCB 2DF3A 3L3HA 3PWPA 3TLRA 3M07A 4U1LA 4OI7A 3O6ML 4ZFOB 1KG0B 1FNAA 4N90D 3V8OA 1RZKH 1KJ2L 4GRWE 3DROA 4G8EB 1LK2B 2Z31B 3SN6N 1MHPH 1NGXA 5EDXA 4OZHA 3V6FA 1V8HA 3B9VA 5F9JB 4YDIH 2VDPH 1RUPH 2R0WL 3C09B 3F7YA 2Q3ZA 2NZIA 5D7JA 4YXLH 4O2EB 4Z95H 5I18H 4HWBA 2BDNL 1WFUA 3OR6B 4LSTL 4BSVB 5I0DA 2C1PB 5D96C 4TUKL 5EU4A 2FYYB 3S34H 1EBAA 3TIDB 5L0QC 2DQHH 2R4SH 4CMMA 3JV4B 2P49B 4OUOA 2IBGA 4M62L 4P5KA 1AGEB 3HR5A 1GZQA 3MV8B 3CZFA 4XBGA 3ZYZA 5JOPE 3GSNH 3TCXA 4PJAE 2AJXL 4RDQF 2WW8A 3U9UB 4NZRH 2JB6B 4GAYA 3W9EB 4DKEL 4I18A 2CJUL 4OZGB 4KY1H 4Y4KC 1EGJL 1V7MH 2WUCL 5KSBE 4PG2C 5E6IA 4PGCB 1I8KA 2BOBB 1HSBB 4KDVA 2X7LB 2GTZA 1FZOB 5AYQA 3NTCL 2LVCA 3C8KB 1OARL 1FFNA 5DD0L 1AC0A 1MF2H 2NY5L 1JWUA 3TBSB 4L5FL 4NN7B 5F1NA 1AIFA 3F65A 5C9KA 2V5YA 1NMBH 3L3IB 5J9PB 3QWOA 4LRNL 4Q9RL 5D70H 5FYJH 5ESQB 5HHOA 3ARUA 1D3CA 1ZEAH 4JEGB 5IMKB 4LQFH 1XZ0B 3WO3B 2P5WD 2IAMC 5H37G 3QDJE 4UOJA 5MEQA 1QEWA 3T77A 4K7PY 4HUVB 1CGXA 1AGBA 3STLA 3PQYD 4XNZC 1QQDB 1CZ8H 1I1AC 3FO0H 5CSZB 1FRGH 2Z93B 5EA0H 1MPAL 5FKPB 4CVWA 1T1XB 1J12A 3U79A 3KXFD 3KJ4B 4OT1H 2NY7H 3VFSB 3VXPB 3ARFB 4LEXL 2V7HA 2IMNA 4NO2A 2BVUA 1A7NL 1A1NA 2X10A 4JQXA 1BVKB 2CKBA 3OSKA 5IJKA 3GMPB 2Y36L 5J06A 4WEBL 1WQVT 1Q0YL 1RZFH 3RTQD 4YEFA 2VLJA 3PWLA 1DBAH 3V52H 3WS6C 2G60L 1G0DA 5IW1A 4GW1B 1LE5B 2BNRB 2GJZB 3EOTL 3IJSA 2QQLL 3C2AH 4L9LA 3SKMA 1BQLH 4IMLB 1CWVA 2KUTA 3HCVA 4HQQH 4IRZL 1IL1A 3BPOB 4RGNB 1K3IA 3WDHA 3W9DB 2QKIB 5J6HA 2FL5B 3ULUD 4OB5H 4R7NA 5K59F 5AD0B 5I18L 4OF3A 5LAXA 2WMPA 1ZHBA 1MHHB 4PRHA 4PD4K 4G43A 4PJEF 2ADIA 4EDWL 4JO2L 5I1GL 3V0VA 4FQQA 3U36B 2R4RL 3DRQA 5ENWA 1DBAL 3V52L 2ZUQB 1DQDH 4J12A 4DGYL 3MV9E 4CMHC 1RIVH 3QCTH 4JY4A 4PBXA 4U6YB 4JFFD 3SOBH 1XIWA 4CDHA 5JUEL 4JJ5A 5IBTH 4CVXA 3F7QA 3RVXC 3MLSH 3DGGA 1NDMB 1K6QH 3UTPD 4LLVB 1XF3B 5B3JE 3FCTA 1X7QB 1T7XA 4PJ8A 1OQOA 3KYNA 2AKRB 3GK8L 3RVXD 4Z7QF 2I07B 4D9QD 2PCPB 1EFXD 3U0PA 3INUH 4UUJB 5C71A 3TV3H 4QHKJ 4NOFA 4KROC 5KANI 2I9LB 3GMMB 1G7PB 5KSUB 2JJVA 3BO8A 5E2WH 4PJFA 3RWDB 4MB4A 5KSAD 3TJHC 3RX7A 5J1AA 1FDLH 4LSDA 2AKRA 2F58L 2O5ZH 2EXWC 1HE7A 4LRNH 3DHMA 2PW2B 4IHOA 2G5BA 1I8IB 1G9NH 1QYGL 3IDIB 5EUOA 2EICA 1ETZA 3EO1A 2YA2A 4E41E 1NGPH 1RULH 3T3MF 4MQSB 4OBSA 3BSZL 1A7NH 3ARED 2PXYB 3HI6H 1FZKA 4J4PD 1P69B 1O0VA 2NR6D 3RDTC 3LS5L 3ABZA 3KDMA 4WWID 3I6LE 3TA3D 3G5ZA 2NY4B 1ED3A 3IDUA 1BVLA 2NTFB 3MBEB 3O3AA 1JPFB 3W0WE 3KHOA 3V7AG 1OD7A 2LU3A 1OTSD 2JJTC 2GY7B 5F72S 1KCSL 2FL5A 4JFXA 5LBSH 3WNNA 4JHWH 5FV1L 5DQ9B 4E41B 5EPMA 1P4BL 4HWUA 2BY0A 1JWSB 3T0XA 4P23A 4GRWB 4XP1H 2BNRA 3CH8A 3CPLA 2A9NH 4TSCH 1UKSA 3GGWB 4OZGE 1ZHLA 5DURD 2ZPKL 5GGSY 3L1OH 3UYOD 1HDMB 4X4ME 5ALCL 3RVWD 4LVHC 1YPZB 1RUKH 5C08B 1ZK9A 3O6LH 2VXTH 3KAAA 4NO2B 1JMZA 4K8RL 1KJVB 4MAYB 2DI8A 3RL1B 3CFDB 3IDGB 4TOYL 5DZLA 3WFBL 3ARWA 3C8DA 4Y4HC 2P8LB 2W07A 1YNKL 3G5YA 4DGYH 4NPYA 3QIBB 5HD8C 4L4TB 1J5OL 1R6VA 1HYSC 3KR3H 2OQJB 2AK4D 1FVDA 2Y07H 1C16B 2VDQH 5EZIH 3MLVH 3C6LA 2BNQB 4JDZA 2DWDA 3AY4A 3BPNC 2BNQE 4UT9L 4HS6B 4HPYH 4DCQB 4LIQH 2IG2H 3GSXB 4Y4FA 1W0VB 2X41A 5C7XH 1R5WB 1C5CH 3HG1E 4NRYB 3I02A 3P0VL 1PG7W 2W38A 2MKWA 1MLCA 3I6LD 4L4VB 5FGCE 4P5TB 4JR9L 4K94C 4HH8A 4PJIF 2XWJA 4G6MH 2XN9E 3NCJL 4OIAA 1G9ML 1I1AD 2DYPB 1T83A 2A83A 4K94H 1S7XB 3HE6C 2IF7A 5TH2A 5JDSB 1L0XA 3R8BB 1CN4A 2V7NA 1RZGB 3VH8A 1JMXA 2HVKA 3MRRB 2AV1A 4M8VA 4BFEA 5F7LB 3P30H 3FN3A 4NQCA 1A0QL 4RGNE 2AVGA 2NX5E 4R9HA 3D5OF 2VMFA 3CK0H 5FFLA 1MHEA 3D3VA 1ZLSH 2VXUL 5CUSL 3BRGC 1EEUA 1E4JA 2RQ8A 2OI9C 3IF1A 1FNSL 3VXUB 3V7AE 1C5CL 4GRWF 5H8DA 2H26B 4MB5A 1T1ZB 3IS0X 4X5LA 3KWWB 1ZA6A 1G9NL 4LMQE 5I1IL 1EJOL 1MNUH 4FQXD 4OZHB 3GMQB 4NT6B 1U8HA 4NOBA 4LLQA 1U2HA 2WM0A 2B7DT 1M05A 4ZPVA 5HHNA 2X70A 3B6SB 3C6SB 5D6DC 2NY0B 3OV6A 4GAJH 1NCDL 5GXBB 4JFFE 5IM7A 4XNUL 5L88H 3VXOB 4WEMB 5BS0D 4XCNB 1YEHL 2QBWA 2FRGP 2OYPA 1X5JA 1NAMA 3BIBX 2APTA 1INEH 2HWZL 3FOMB 5EUOE 3ET9F 5GSVA 2EYSA 4NC0B 3ROLB 1FIGL 4P9HL 1MQKL 4LCWD 1JGVH 3A6BL 2BC4A 5EB9A 2QQLH 5IT2H 4A6YH 4PGDA 4UTBH 3OJDA 1LEKB 2F74A 1UZ6E 1MHPL 4MHHG 5D2NE 3H9SD 1A1MA 1T3FA 4PRPE 1OAQL 2KBGA 5B3JF 1CK0L 4KC3B 5FUZH 4KRMB 1UQSB 3EAKA 3TWCH 2X44D 2RB8A 1IEAB 2NZ9D 3X17A 4BQCA 2BVQA 4U6VH 2C3VB 4TYUA 1EO8H 3KPOB 3WLWD 2GY5A 1F58H 4H8WL 4QHUB 2Z91A 1IAIH 5E1AA 3O6LL 3GMLA 1JYNA 4LKCB 2O5XH 3O4LA 4LCIH 4OCYL 1IM3B 2Z31D 3EDEA 4MSWB 4OCRL 1E28A 1TIUA 5DTFB 5I66B 3VD9A 1UQSA 1PLGH 4Z0XA 2FJFB 1HEZA 1P2CB 2R2BB 5JW4Q 1CVRA 4XNQB 2G75B 5D7KD 1JNLH 3VA6A 2XNAA 4L3EA 3FOLA 4P3CL 5L7XL 3TBYA 4N8VA 1CDGA 4M7ZB 2ZUWA 3OJDB 1DLHA 1N5AB 3T3PE 4OF0A 3VXSD 2X4UB 1PAMA 4JB9H 3ROLA 3GSRA 3QEQB 3MRLB 1MI5E 4QF1B 4Y4HB 4Z5RA 4UTAL 1WBZB 4WO4C 2XTJC 3AB0C 4NBZB 5D7SH 2YN3A 2ATKA 3QPXL 1CGVA 4KJWC 4K07A 4L4VD 3UTSA 1KIRA 4EBQH 5KVMC 4H25B 5D7IE 3ROOA 4YAQB 4Z77B 2ZZUT 2F53A 3QZWG 4OGXL 3NABH 1TVBA 1M05B 3V5DA 3RIAK 5HYJB 4P48A 4XI5C 3BRDA 4PR5B 3O4LE 3QO1A 5F7FA 2BVPA 4GAJL 1Q8MA 3MRIB 5E5MA 3BKML 2QEJA 3IB4A 3P9LA 3G6DH 4A6YB 5CEZE 2IPTL 5FDYA 4PJEE 2VITB 4OBRA 2VWEE 5JTWA 3TIEA 3T2NH 1RMFL 3EGSB 4YC2B 5EU6E 1CT8B 4ZOAA 3T0WA 4XP4L 4HCRL 1HYRC 4ELKA 2DMBA 1I9JH 4Z7WA 1RIUH 4A6YL 1A9EB 4GMTL 1HILA 3KNBB 5IR1B 1DTUA 4ZTPH 1D7FA 5C07B 3LKPA 3RA7L 3O0RL 4AEFA 2FO4A 5HYJE 4AM0B 4G42B 3DVIA 3WIIH 2KQMA 4ODHH 4XPAL 2IANE 5CGMA 4QWWC 4Z7QE 5GZOD 1A02N 4OB5L 1T1YB 2IPKB 5L2JB 1I75A 2F54B 4KZDL 3TNMB 5IK3A 2PYEA 4Z7OE 5IESH 3HC0B 5F6HJ 3X3GL 3QFDB 3VFTB 3LRHA 1YNTA 5GGQH 4DCQA 1OGTA 4AENA 3CVIH 1T20A 3BD5A 3UYRH 5K9KB 2XT1B 3K7UA 5GGRA 3BWAA 2VDKL 5IVXB 5IBLC 3SKOA 2R69H 4PJ9C 5TE6L 4UTBL 4IMKC 3RIFK 5ID0A 4CU8A 5MEPA 1GPOL 1KN4H 4R0LC 2VDOL 5FA4A 3UC0H 5C9JA 35C8L 2C4XA 3WFCH 2VLRB 1GOHA 1KELH 4I0KA 4NO3B 1NAKH 3RL1A 3CSYA 4LSSH 1MFDL 2LQRA 2VUYA 3NIFF 5E00A 3PV6A 3IVKA 5HI4C 3RGHA 1CQYA 1MRDH 3P11L 1K5NA 4Q2ZB 4M48H 1TZIA 5DA4A 1YY8A 5HYSB 5T3ZL 1BQLL 3CFJB 5FYJD 1L7TH 1S7SA 4HWEL 5F8QC 2GAZB 5IBUG 5C09B 5GS1C 2R2HA 1FQ9C 3MRPB 5DD6B 3FO1A 2WP3O 3T0EB 2ZUQC 1D9KC 4MGXA 4KHXL 3KHQA 1VEPA 5T3XH 3ZDYF 4Q9QH 3CLFH 5ISZB 2XPGA 3MGAA 4ENEC 3NACH 3IAPA 1VADB 2GYSA 4P4KB 1A1OA 1XR9B 1CCZA 2NY1D 3GM8A 5C6PB 3SGJA 3O4OB 4PREB 4UOW0 3WJLA 4ZFFA 4J3UA 4GBXA 3MBEA 3V79C 2Q8BH 4OJFL 3X14B 1MAML 4Q0XH 2DQIL 3BPNB 2P8PB 4LLWB 5B3NA 5BMFL 1N6VA 1MCFA 1WSST 4M7JL 4XNXL 1P84K 2LVEA 4ZOBA 4GG6B 5T33L 3TZVC 3CD4A 2ATPB 4D94A 1RZJH 1UWEH 1K4CA 1UZ6F 5FUCC 4HT1L 3MLSL 5AYUH 3H7LA 1I1FA 4ZOEA 3CVHL 4DW2L 2YPLD 4MNHA 4O9HL 3D0VA 3VXMB 1NC4D 4UV4H 3HI6L 5JOPD 2APFA 1KEML 1X3DA 4ZAKB 1QA9B 1BAFH 4JREB 1QA9A 1TJGH 4HH9A 1HHJA 3S35L 3PHSA 3TN0B 1VHPA 4K3JH 3NIDE 4JN2A 1U8IA 4WWKC 5CFHA 3ARFC 1CDYA 4P3DA 4MXWL 5MEOA 5C0JA 4WU7A 3LEVH 2I9LA 3L5IA 5INCA 1CIUA 1FAIH 5IESL 5EUKA 2BNRD 1Y18A 2D7QA 1TZGL 3LZFL 1VFAA 4XXCC 1X7QA 4GG6E 4F57H 1Y6MR 2VLME 2UUDH 1VDGA 5KZCB 1HK6A 1KLUB 5HPMB 2ORBL 4O51B 1I9EA 2QQNH 5DT1H 4Z7NE 1PQZB 1XIWD 4NN6B 4NZDA 3G5XA 1Y6KR 4WI3A 4XAWL 4OLEA 1XGUA 1OP5K 1XCTA 5L9DH 3D0VB 3NH7L 1NCCH 4ONFL 4AJ0A 4D0DA 5KTEH 1RZ7L 1CD0A 5JXED 5LGJA 2P1YA 1EEYA 4JRYD 2NNAA 1JGDB 5IB2B 2R8SH 5IW3A 4AQ1B 5HHMB 4YHYB 2VISB 1MHHA 4PRHB 4JFHE 5DD6A 3GSVB 1RZIB 4N9GA 4QRUB 2AEQL 2ZUYA 2X4TA 4TVPL 5DC0A 4NFDA 3MGOB 3W9DA 2NTSP 2HLAA 5EOQH 3FQTA 3I9GH 3SDCB 3Q6FA 4IMLA 1EFXA 4NBYB 5K9QI 1QACA 1A22B 3RVUD 3MUJA 5IMMB 1CDCA 5EUOF 3DYMA 5ETUB 1SM3H 5HSFA 3MROA 1MCOL 4Q0XL 5D7SL 5EC2A 4ZUTB 4HPOL 1FORL 1KPRB 4B53A 1GHFH 3QIWC 3DO3A 5MEPB 5MENE 2EKSA 2X4NB 5IB3A 4GXVL 1TTUA 5BXFB 4H1LH 4HEME 3WFEL 1KB9J 4MA8L 1U2CA 4TVPH 4TVPE 4UT6H 2NW3A 3U6RB 4N0RA 3RY4A 1A7BA 3HI5L 3MLYL 1LO5B 4RX4A 3X12A 3U7YL 4Z0BL 4M1CD 5IF0A 3GHBL 1WEJH 3MSPA 1AGBB 2IPKA 2VXVL 3RY6A 4Z7UF 1U42A 3P4MB 1G7QA 4HWBL 4WWKB 5ESQA 5HHOB 2AEPL 3LKPB 4BUHA 3G6JB 2E7BA 5BMFH 1U8OA 4XCEB 4D0BB 4NSKA 4UZGA 4JPVH 3SKOB 4NM4H 3WE6A 4PTTA 3NZHL 5GGRB 1A6PA 1G9MH 3UTTE 5MERA 2JLLA 3GJFK 4KI5D 2YC1B 2FECL 4HKXA 3CGTA 3PHQB 4NHUA 5MENA 2R0ZH 4BK4A 5D1QD 2BFVH 4PB9L 4WFFE 2HKHH 3LRSA 1C5BH 1Z2KA 2BOCB 4PP2B 5FK9A 4HK3J 3BVNA 4XGZB 1NUGA 3BN3B 4HIEB 3LEXB 4Y1AB 1DQTA 2P5EB 3THMH 5E08L 3WJJA 1J8HD 1OAKL 2A6KA 4MZ2A 2NXYD 5D93C 3MCKA 2I5YL 5CD3B 1IILE 4TNVF 5DLML 5KSBA 1HKLH 3WLBA 5IGXL 1F2XK 3UROR 3HMWH 2J6EA 5IT2L 1WBXA 2YD1A 2VSCA 1NCDH 1UWXK 3IYLW 3VDBA 4DEPB 2W92A 4KQ4L 5EZOH 2UZIH 1WBZA 5J13B 5FYLD 1KELL 5JA8B 3PQYA 3FMGH 5EWIL 2EDRA 4W4OA 4XWGH 3RWFB 2CMRL 4QCIB 5HD8D 2D31B 5H37H 4R4BB 3P9LB 4DUXA 1LK2A 3QUXC 3EOAB 3RPIB 2DAVA 1BF2A 1J87A 1FAIL 1VACA 1B4RA 2XNAB 2HFGL 5FUOL 1J0ZA 3H7BA 1I8LA 3NFNB 1JF1B 4U1LB 4KI1A 3MREB 3L3HB 3IU3B 5F9OH 3AMKA 4MSWA 4P5TD 3GUTA 1KIRB 1CLZH 1NBYA 4Y7MA 2R9HC 3HN3A 1S7RB 4BKLB 4MCYB 3O6KL 5L2KA 1R3LA 1KOAA 1KIQA 1NCNA 5J1SC 4WFHD 4FOMA 1CBVH 4R8WL 5A1AA 4Y16D 3Q6GH 3HA0A 2J6EH 4KKAC 1I9RL 3P9WB 4XPGH 1I1YB 5CZKA 4EI6B 4NJ9L 4R96B 3MRJB 3MRJA 2G75A 3VXUD 5CCKL 1QLRA 2XQBL 3OJVC 2XWTB 4LL9A 1RQ5A 4Z18A 4Y19B 1I1YA 5IB5B 4FQJL 2Q86B 3QG7L 1RJZA 2B1AL 3K46A 4ODVH 3MUZ1 2GSIA 4XMLH 1R3KB 2Z8RA 4CUCA 1CGYA 1EMTH 3C09C 4LASL 2Q1EA 5E8EB 5B4MC 4M5ZH 3VFPA 2V5SA 2X89A 5F89A 4P3CH 4BKLA 4DK6A 2CK2A 2OP4H 3JWOC 3NIFE 4AK1A 3GUTB 1Z3GL 1FJ1B 1YY9D 2YR3A 2VZTA 1IC5L 5GGTA 3NFNA 4ZYKB 4U33A 1I7ZB 3OQ3B 3U0TA 2HWZH 4FFWD 1FNHA 1D5XB 1F13A 4OF8A 4RAVB 1LEKA 5F97E 1WF5A 3CX2A 3PJSB 2RCSH 4P4RA 3VFGL 1KJ3H 1ZA6B 1U8KB 3L3DB 2BC4B 1TZHA 1HINL 4FXKA 4NUGL 2EYSB 1JHTA 5ID1A 1I9IH 2I60L 5IVZA 3R4DA 3O0RH 4YHPA 5I75C 1AGDA 1S3KL 2ZSWA 4JHAL 1MCBA 1JRHH 3WDIA 1MHEB 3HS0A 4BSJA 3LMJL 5J1TC 3MX0A 2LFGA 3PIQB 5CJ8A 3RGVB 4KJPD 1RY7B 3BDXA 3QJHA 5C0FA 2VQ1B 1MCCA 2ID5A 3RHWK 5F7DA 5TE4L 3RKDC 4POYA 4YDJA 3DX7B 4ZMAT 2WINA 3QDJA 1PG7H 1NC4A 2SEBA 5HDOA 1BD2E 3PP3K 3TVMA 1IC7H 1N6QL 2YWZA 2GUOB 1EEQA 4J1UA 3CFIC 3LQZA 1Q72L 1FFOA 4PFEA 2H26A 2HRPL 5CJOL 2B4CL 1X6NA 4WI8A 1WT5C 5ICXA 5C0AE 4G3YH 3NA9L 1S5HA 2EKJA 5I16B 2XZCL 2WLZA 4PP1C 5HVHC 1N2RA 2OL3L 4NN6C 5MI0C 3Q1SH 1L9NA 2DM7A 5E4EB 5D9SA 1OWWA 3LKNB 4JE4B 1FFRA 4GW4B 3EYOA 4KQ3L 3MV7B 2IBZY 1J8HA 4QXUL 5JDSA 2NMSA 3EYQD 1LP9E 5ANMA 4EI5C 1CE6B 2C3XA 5DGQA 3TZVA 4X6EB 2ARWA 3PDDA 3CFDA 3IDGA 1H8OA 5K9QG 1U58B 1SY6A 4ZFZA 4TTGA 4L1HA 2JK5B 4R26L 3SJVD 3LKSA 1X5AA 1DBJH 3CAFA 5D1QC 2YSSB 4F7EA 1CYGA 3N06B 3EYSH 1QFOA 3G08A 1YJDL 2VZUA 1LE9B 2AJYH 3UJTL 4I4WB 3HB3C 2AI0L 3ARZA 5CILH 2OQJA 1S9XB 3INUL 5TDOA 4EUPB 5ALBH 4HIJA 1FL5B 1B6UA 1WV7T 5ESVA 2DLHA 5GZNC 2LAAA 4MJ4A 3OWEA 4ZUTA 2IQ9H 1JWSA 1WZKA 2X09A 3QUZD 1LO4H 1OAYL 4HULB 4E41A 1HI6A 1I4FB 4Y2OA 5I1EH 3PWNB 4ODSL 1KB5H 1EFXB 5D1XD 3TVMC 4L4TD 3ULSA 2VN7A 4KMTH 1OY3B 3H9HA 2RJMA 1GC1L 3VCLB 1GSMA 2JCCA 4X9BA 3H8NA 5DHXB 1MCRA 1QBAA 3QXTA 2GT9A 4JFPB 4KKBC 4PJ7A 3S36H 3O45A 3GGWA 3VW3H 1EJ6A 1EEYB 4HCRA 3GIVB 2VOTA 5IWLC 5IEKB 2GIYA 3QDHA 3B9AA 4XNMB 3VXRA 4I3RL 4XBEL 2X4PB 5HYEA 4OSUH 4UDTA 5EPMB 4CU6A 1PG7L 1RSFA 1ETZB 1NBZB 2O5YL 2R29H 1QSZA 4MNQA 4CMHB 1M71B 1NGQH 3E2HC 2OZ4H 3MXWH 1JYXA 4ODWA 1BZQK 4LGSB 5TE6H 4D0CA 2OR7A 2LU7A 5EFIB 1WFTA 43C9A 1HNFA 2KH2B 4ELMF 2FEDD 3F6IA 4DZBA 5F6IB 3U4AA 4HKZB 1X9QA 1Y6NR 3BO8B 3RWDA 4LVEA 4HXBH 1ZE3C 5D1QA 1MEXL 1UEMA 3Q1SL 5DUPH 3UBXB 4N1EA 5KVEL 2GFBA 5GS1B 4YHML 3NA9H 1XR8A 1YEDB 2QSQA 3DXAD 3O6MH 4FQIH 5IHLB 1MRCL 3B83A 4R0LB 1GCFA 2DTMH 2VXQL 3O8XB 1JZ4A 1KJ3L 1H3XA 3UBXG 5IHBA 4XX1E 2ZUXA 1D6VL 2FHFA 4JN2B 5CJXA 1NGQL 1RIHH 5CWSB 3C6LD 2ORBH 4JKKA 1HWHB 1UH3A 1LHZA 4KHXH 5DRZB 4KVNH 4Y4KD 1FVEA 2YRPA 1AC6A 1OOAA 3VXMA 1T1WA 4JFFA 3GBNL 2AV7B 1FC1A 2HT3C 4GUPA 2J7LA 1FFPB 4WGVB 1JNNL 4O5LH 3HZMB 4ZQKA 4X6FB 2H2PC 1A3LL 4KMLB 1R24A 3HNSL 4FFWC 4KWUA 2E6JA 3FCTB 1JGLH 1YY9C 4JO4L 3QRFM 4LVOC 2X1OA 5SWSA 4OD1L 5AUMA 3LQAC 5FA3B 2R0LH 3F6LA 3IFLH 4XNZB 1Q0XL 5GRJH 4QGTA 3VMNA 4JY4B 4UDTB 4IRJB 4NC2B 15C8L 3VGAB 4GG8A 4GRLA 4QHNB 1FGVH 1TFHA 3JWNC 5KOVC 5GRYA 1OQXA 3CUPA 4MQXD 5DD5L 1E27B 1QTYT 2C7UA 1WICA 3A67H 3VWJA 3BYYA 3OX8B 5DJ6B 3GMPA 3FO1B 2PO6D 4FQ1L 1BVKA 5LJYH 4LF3B 4U1KB 1FL6B 5KVGL 2AJZA 2GJ6A 4KK6D 5E8OA 2AK4B 3S4SG 1QP1A 1IMHC 4B50A 4X9IA 2MPAL 1N64H 5T1MB 2EE9A 4R26H 4NYLB 1IL1B 4RMQA 4WW1B 5HHPA 1D5ZB 3DX6B 2IBBA 3BIKB 4PJ8C 2XRAL 4A2MA 1HXYB 5ESVB 5HVHB 1A5FL 3BE1L 3PGCB 1AE6L 4FFYL 4NQDE 4XP4H 3UCRA 5BRZA 4LHQB 3ARDB 2X5PA 5C08E 3TP4A 1S3KH 3BDYL 1BD2B 4X5XB 1RZJC 2EDLA 5FGCB 5EZOL 4S11A 4TSBH 1A1NB 3QA3A 2P24B 4R7DA 5JXAH 3D3VE 3ECBA 2XTJB 4TQEH 2BOBA 2ZUSA 1H3TA 1LP9F 2G60H 4RX4D 3H9YA 1UWXH 1SEQH 5JQ6L 1BIIB 2A74A 3UPAA 5JOEA 4X6EA 1X44A 3AXLA 5AZ2H 3TNMA 3PP4H 5CSZA 4GMTH 2BVOB 1AXSA 2BHUA 2E27L 4FP8H 3F5WB 5C0AD 4DAGH 2DQJH 2HT4C 5SWSD 2W9DH 4FNLH 4AM0A 3PWUA 4W4NA 1CD1B 1BD2D 5C07A 4HBQA 2Q7YA 4X5WA 4AIZA 3KLAB 4JFDE 3OXSB 3LCYA 2Y9RT 3FMGL 4PRIE 1YEGH 1DBBH 2ZUUA 3JXAA 1IGYA 4HXAL 1D5BA 4EUPH 4Z7WB 4OCSL 4F37K 4PUBL 3FB5B 1IQDB 1ADQH 4RFEB 1BOGA 1IZJA 1DUYA 3QUXB 5HDBF 5JR1L 1FORH 2Y25A 4JM2B 1DEEB 2L4OA 1H3WM 3VWKB 1XIWC 4G9DB 3LN5A 5BW7C 2Z31A 2XZZA 4G8EA 4MWFA 4HLZH 4M7LH 4DEPC 32C2A 4XBGB 5DK2B 1Q0XH 4YXLL 2CK0H 5GZOC 1XCQA 4RGNC 5CKAA 4N0YL 3UTTD 3V5DB 5ISZE 1U3YA 1FL3A 3NACL 3V5KB 3LIZH 5A2JH 2CSPA 2RFXA 1KXVC 2C1PA 1U8QA 4XP6L 5F9OL 2GJ6D 3K2MC 2H1PH 1Z5LA 4ETYA 1EERB 1H15A 3RVTD 4XPTH 1CFQB 3BDBA 2ED8A 5FUOH 3OG6B 2HFTA 2E7CA 3MLUL 1TJIH 2HG5A 1NCAL 4ZFGL 3NCJH 2EDTA 2FD6H 5I73B 1A14H 1QR1B 4F3FB 4R3SA 2RCSL 5FOBA 1DLHB 3P73A 5HGHA 1OGAB 5D8JL 1I3VA 1S9WB 1KC5L 2RR3A 5F7EL 4UV7H 1QHOA 3WIFB 3PWPB 5I66A 4R97C 4ZS7L 5GRUL 3FQXA 3Q6GL 2MQ3A 4XNYH 5DSCB 3QEUB 3Q2CA 3GMLB 4OAWB 1P7QD 1RJZB 2C4FT 1UGNA 4BSWA 3P9MB 4XPTL 4LLYB 1F4YL 4KK8C 3WIFA 4EDXA 3KPOA 3QEHB 2Y23A 4KU1A 4F9LA 4TSAL 3VU2A 2BSED 2PTTA 2EXYD 1DZBA 4ZUUB 4NN5C 4P2OA 1N5YL 1LDPH 4QY8B 3WL9A 4O4YH 5DJAB 4TUKH 4M1CC 3HMXL 5DJCB 4Y5XA 1VB9A 1YMMD 2PR4H 2GEEA 4M00A 3JWDC 5T1KA 4KJYA 5KOMC 1RUPL 3DURA 3M8OH 2DOCA 4AT6A 5D93B 3IJHB 1KCUH 2V9QA 1W72L 3HUJB 1QRNE 2YPLA 4GXUM 3ZHLA 4LHUB 1YECL 3LKRA 1JF1A 3VXQA 3H7BB 4M5YL 4OQ1A 4JRYA 5ACZA 5IQ9A 2CIIB 4YDKL 1J0IA 3K80A 2ICEB 5EO1A 4DN4L 4WRLA 5EO9B 5L8KB 4JFEB 3V6OE 3SE9H 3C6SA 3NTCH 4C83B 1FCCA 5AWNL 1SMOA 4FNLL 4XH2B 4N0YH 3GRWH 2BY3A 3C6LC 1IGMH 4YHNB 5DT1L 2BFVL 3QUXA 3QI9D 4HKBB 2XA8L 1RHHA 3KPNA 3MV01 3FB5A 1F4AA 2OJZH 4PJXE 1SEQL 1DFBL 3OKLA 1GGCL 3WXWL 5IOPB 3VG0H 4GKZA 3SDDA 5IKCA 3VXUA 1CICA 4QRSA 5CD3A 4G6AD 4H20H 3UZVB 1NH6A 1LEGA 3SPVA 1J9CT 2DKUA 2WSKA 3BMWA 3DBXB 2XV6B 2CUMA 5IBTL 3SE3C 4PGZA 1K3ZA 3VXRE 2D03L 3WNMA 2YOCA 4BZ1L 3K0WA 1DSFL 3UTTB 2MKLC 3KPPB 4KMTL 1OCWL 5HHVH 4WFGE 2IFGA 4XWOD 1CICD 1I7RA 2NXZD 4XHJD 1CXKA 3E6HB 1RI8A 3NGBB 4HDIB 2XZAH 5INDA 1TENA 5C8JA 1JF6A 1VEOA 2FB4H 4DKFH 2P43B 3QA3B 1R5WA 4ORGB 3WFHA 5HYQA 1W0VA 3AREA 3GDBA 5DJYA 3S88L 4HFUH 4I3SL 3D39A 1EBPA 5I1HL 2MPAH 5M94B 1JI2A 1QLFB 5BZWA 3IDNB 5I1JH 1EAJA 4WWKA 3GO1L 1B4JH