1KNOB

Crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
b'DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT CNJ206
publication title Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 47
structure length 220
sequence length 220
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1995-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB01
3BPOC 2XKNB 2VLJB 4JY4A 4LHUA 3TBVA 5J13C 5JHLH 2B0SH 5CWSA 5DVKA 5JW5B 4FQCH 5A1AA 1CGSL 1NMAH 5D1QC 2CGRL 1G7MA 5T5NF 1O5DT 3RAJL 2VXVH 4PREA 4PGCA 4FFVC 3SGJC 4OD2A 3OG6B 5HI5C 1P4IH 3GSUB 3LS5L 3LCYA 2VQ1B 5IB4B 3ABZA 1R24A 4PFEA 1MCBA 3MLTA 4HK0B 3HR5B 3PP4L 4UZGA 4ZD3H 4KJPD 5D1XB 5I76B 4BFIA 4LQFH 4ZUVB 1XGYH 1H3VA 2IH3B 1OT1A 3N1PC 3NFNA 1DBML 5CEXA 4NZTH 5KSBA 4I2XE 2YXFA 5EU5A 2JF1A 2G5BA 3CFCL 1LP9F 1J0KA 1K5NA 2VDKH 4YHPA 2Q6WB 5GIRA 5DD0L 1EEYB 3PQYD 4RMSA 5KSAD 3QEQE 4GG6F 2XWJA 1S9WB 4FZ8H 1FZKA 4Y4FA 5FEBA 2J8UB 3LKNB 4KVCH 3PL6D 4NNPL 1CICC 4OAWA 3BZFB 1J0HA 4PJ5E 4U3CA 1KIQB 4A6YH 2OXGA 5HJ3A 1N2RB 2XKUA 1MI5A 5DRNA 4UTAH 4IRJA 1CT8B 4FFWD 4MD0A 4MXVF 2XOTA 5FUZH 3MLYH 4XBGA 5LCVH 5IWLA 2WBJB 1X5IA 4ZNCD 1JGEB 4N1HB 5CSZA 3VG9B 1JWMA 1N5YL 4XGZA 4AEHL 5ID0A 4ZO6A 1A3QA 1OTTD 5GGUB 2UY6A 3EO1A 1CD1B 3VRIA 5DUPL 2X44D 4FXKA 3FQTA 3ZKSD 1MCCA 3G6DH 3AY4A 4OLXH 1FNAA 2GT9A 3N06B 1F58H 1EO8H 4MQTB 1EH9A 1QHPA 4HUXA 2DTML 3BJ91 1RAMA 1EJ6A 4NQEE 5AG9A 3LN5A 4GW5A 5A2FA 1E27A 4KI5E 3SDCC 4JPKH 4R90L 3HZYA 4X9BA 5ITBH 4CAGA 1A1OB 1KCUH 5SWSD 1MH5A 3BH9B 1NEZB 3W5MA 3DXAD 5F7EL 5ETUA 3IDNB 1JNLH 2P46B 1T4KA 4RFNC 3ECBA 1V8HA 1D6VH 3WIFA 1AXTL 2VDNH 4QT5B 2J2ZA 3U0WL 4M48L 1BVKB 3KPQA 2NY4D 2KQNA 4BZ1L 2A73B 4WDIB 2N56A 1JHKH 3VE0B 2F54B 2Z91A 1TJHL 4R8WL 3QXTA 2YXMA 3BP6A 2Y72A 5GXBB 1T2QH 4GW4B 5AD0A 1OLZA 4OF6A 1F13A 4LNRA 3O4OC 3MCKA 1INDL 3OJDB 1PG7X 1YMHA 1RHHA 5J6HA 1X5KA 3KYMB 3O8XA 4LK4A 3SO5A 3ETBF 4X80H 2XG5A 4R97B 3VXMD 3OR6B 2XA8H 2GJ6E 4MA7L 1N8ZB 3H7LA 4D9LL 3EOAA 3QUXC 4Y89A 2DKMA 1ZLWH 3VXSA 5A43C 1MFBL 3D0LB 1UH2A 3IU4H 2BMKA 3UZQA 4Z5RB 4MA8L 1UKTA 1LHZA 2MHAA 5IESH 3I3BA 4RRPA 1DE4A 4LARH 4HF5L 4NO3A 5KOMC 3NIGE 3QIWB 1U8NA 1IAOB 5TQ2H 1I7RA 1LO3H 4LLYB 4MD4B 5TPWH 4PLKC 3W0WB 1YEFH 4JN1H 2HFGH 5FCUL 2DQFA 4U1GB 4MCYA 1GJIA 2P1YA 5CD3A 2ZPKL 4HUWA 4KRLB 5HPOA 4G9DA 2VSCA 5BRZA 2BJML 2VLJD 2WMPA 4HIXL 5GRVL 2O61B 4QRQB 2VLMD 3VG0H 2DQGL 1ZGLB 1IGJA 1U8PB 4PGBB 3MRMA 4FQIH 3TVMA 4HXAH 5L2KE 4EEEA 3DECA 3ARDC 1UJ3C 3IFPA 3DMMB 5D7KE 1G7HA 3BP4A 4LPVA 1VEPA 2WNGA 4P57B 4NKOB 2UWEE 4LKCB 3R0MA 2HMID 1FCGA 4L3EA 3KAAA 1MPAL 1NGZB 1BZ7A 5LGJA 5L2JA 2EKSB 5D1XD 2Q3AA 3TCLA 4MMXC 5I1JH 5DUBA 3VXUB 1QSFB 4ACPA 3V4PL 1G6RB 4HK3J 1I8KB 1FC1A 1JIBA 5H2BB 4KTEH 3RI5K 5DGQA 1AHWC 1D5MA 5LGKA 1YNTA 3NCYP 3FHQA 3GI9L 5T3ZD 5I16A 4P2OC 4G6JL 4NIKB 3IS1X 4Y7MA 1N6QH 2ADGA 4LLWA 4WY7L 4GSDH 2APFA 1AO7E 2MTPA 1JBJA 1S7VB 4ZPTB 3FT3B 4MSWB 3MSPA 4XWOC 4X5WB 5ITFB 4MNHB 4WTXA 1YJDL 1FNFA 4NUJA 4CVZA 2AJUL 5C0EB 5F9WB 1NFIA 1YDPA 3FZUC 1K6QL 1FYTA 2I27N 2AGJL 3WJLA 1FJ1A 4K23L 4EI5A 3D87B 4WCYL 1KSRA 4Z77B 2WWMD 3IU3A 4JRYA 4MCZA 5JW3L 4M43L 3R4DA 2VNCA 1GOGA 2QSVA 2B7DT 1XR9B 5HVFB 4HGWB 1HH9B 4YHZL 5CGTA 5IT2L 4OF0A 1G7QA 2WBJD 2HJFB 4L3CB 3UPCA 1RJLB 5BQ7A 4WI4A 1XZ0A 2EO1A 2X41A 3MLPA 4HUUB 3IETB 4PRNA 3P0GB 1JV5A 1DLHA 1Y0LA 2B1HL 1TTUA 3UPRB 3TFKC 4X8JA 4XWGL 3CK0H 1B4JL 1W72B 4QNPE 1FO0H 1ULVA 1J8HE 1I1FA 5KVDL 3MJ8A 4XC3H 1I3GL 1IBGH 2NY5L 5I1AB 1S3KH 4BZ2H 2OQJA 4GXVL 2X09A 4LSTL 4POZC 4ZS7L 1G9ML 4W6WB 3BKML 4UAOB 2G2RB 4UB0L 3D39E 3HFMH 4GQ9H 4N5EC 4QHLA 4TUKH 2ADFL 5F7MC 1TETL 3CVHL 4IS6B 2P43B 2AS5M 4Z7WE 3CPLA 1QVOA 2MWCA 2PW1A 3QNYA 4J2XA 3DROB 2JK5A 3RWGA 1FIGL 1S7QB 1Z5LB 2X6MA 1X5GA 4LBEB 5IBUB 4GKZA 2F54D 5J11B 4DN4H 3IYLW 4NQCA 2E7MA 3V6FB 4M4PA 2O93L 4OZFB 3UC0L 5A2JH 3ULUD 1GL4B 4F57L 5JDSB 3QBTB 3MO1A 1JF1B 2EYTA 3FONB 5GS2H 3BUYA 3GBLA 4KGLA 4DCQA 2WBWB 1I8LC 2Z31D 1FZMB 4H8WH 3OMZA 3WFDL 4R4NC 5HPMA 2VDML 4YFDB 1QEWB 4LCCB 1SBBA 2W60A 3OKNB 2DWEA 5ERWA 2XQBH 1HXMA 5T1MB 5L8KB 3MTRA 3VFMB 3MRGB 2FEEI 4RFEB 1YYML 4UIKH 3MV9E 3IFNH 5JMRA 1KN4L 5C6TH 2X42A 3CLFH 3I2CH 2C1PA 2LVEA 5F7FA 2NTFA 1MAMH 3NAAL 5AUMA 3CSPA 5E00B 3FN3A 2QHRH 3TYFB 1A9BB 4I48A 3L7FA 2RB8A 3QXWA 3QFJE 5BS0A 1W0VA 5ICYA 3W0WD 4CW1B 5D1ZA 3KR3L 1QYGH 3MBEA 3ALWA 5F3BB 5FO8A 3SDYL 2IQ9L 3KLHC 4TYUA 4K7PX 1I8MB 5M95B 3ARSA 5F7DA 3CMOH 4QRPB 4FG6C 2Z4QA 3B2VH 3GSNL 3UJIH 5IROC 2YKLH 2ZJSH 2E9BA 4ZXBC 3DMMD 1UCBL 2XQYG 5LQBH 2HFTA 5CJQH 4OZGF 1WAAE 5IHZB 1Q9WB 2GKIA 4PRAB 4U1MB 1NLBH 2FX9L 4KPHH 5FUOL 2XN9A 4JDVA 3VXUD 5IR1A 1F3DH 1QSFD 1JYNA 3PABB 1NCBL 3ARTA 7FABL 4LKXA 5DLML 3IJSA 4PJDA 2DQEL 1H9VA 2WP3T 4XZUA 1QBAA 1FNSL 3LY6A 2HJLB 1UFUA 1TIUA 2ERJB 4X7SH 1OW0A 1G1CA 4KQ3L 3ZHKA 4XCYA 1ZV5A 2J6EH 4LCYB 2BVEA 1U8IA 3FQXA 3FQUA 4PP1C 3GGWA 1BAFL 4QO1A 4M9OA 3QHFL 2R2BA 3QFJD 1I7UB 4JO2L 3QCUH 4NO2B 5T33L 3KJ6L 3H9ZA 4CADB 4F58L 4JFOA 3FTGB 2G60H 3KYKH 5F8RC 4JM4L 4Y4HC 1G7LA 3ZO0A 1QLEL 5INCB 1N64L 4YO0A 5FKPA 5JR1L 4FZEH 5I6XB 4NWUL 1BD2B 1TCRB 3FO2B 1XCQB 1JGVH 3DV6A 2AJXH 4NC1C 4U1HA 1UACH 3UTZA 1FVEB 1A1MB 4FQJH 3MNVA 3MX0A 2F5BL 3OKDB 1QKZL 1UB5B 2X4NB 3O6FA 4IMLB 5SWZA 1KPUA 4NUGL 3BPNC 1RZ7L 1FZJB 4WI6A 4XNZC 4OM1H 4QXGH 1RZKH 1T20A 4MAYC 1N59B 1EEQA 5K93A 4ZFOB 4EI6A 4JG1H 2XICA 1MVUB 5KG9A 1JGLL 3GM8A 5D7IE 5HHOA 1AI1H 1P1ZA 4YR6A 5I8CA 3ZE0F 3IXAB 5FO7A 4UINL 2WQ8A 4QF1B 2HFEA 3ARED 4YBQC 4ODSL 3LN4B 5IWLC 2A9NH 4XPAL 1U8LB 3FOLA 4OCWL 3RX8A 3QDMB 3MV7B 2NY7H 1RFDL 1RUPL 5B39B 1ZKAA 4UQ2A 1DEEA 4CMHC 4L8DA 5TF1H 4PJEF 4Q2ZB 5IG7B 1LEKB 1IEBB 1F6AA 1EMTH 5FFLA 1ZA6B 1NGWA 3GSVB 3BDBA 5H94A 1NCNA 4CVXA 3IAPA 1G0YR 3U4EA 1KYOK 4HIIA 5TE7H 4G9FB 3L6FA 5J6GB 4NFDA 3F7RA 1N6VA 2YBRA 4KWUA 4O4YH 2QQKH 4N9OB 5I2IB 1KJVA 1T1XA 3RTQB 2BNRA 3PV6A 4PJFF 1Q9KB 5DD0H 5F93C 1HHHB 4PJBB 3FN9A 5E2WL 5EORL 3JTTB 4YHIA 3EJYC 5GS3A 1F90H 4JPIA 4PTUA 2I26N 3P4LA 3OXRA 1U8QA 3OKEB 3BUTA 5DYOB 1XGPB 4XBEH 2OTUB 2QLVB 5JZ7C 3GMPB 4M1GL 5FKAA 3T08A 3WNKA 4PV9A 1WUNT 3CDYA 2EH8H 3S88H 1BP3B 2FO4A 3PG2A 1T04A 1B4RA 3CU1A 4UTBH 3WN5B 3TO4A 1KTLB 3EJJX 3NCBB 2I25N 3HAEG 4XBPB 4YXLL 1GC1L 4HT1L 4K3JH 4ODVL 3KDMA 3PHOA 4R3SA 4ZUSB 3F5WA 4HWBA 3QG6A 4K71C 1N5YH 4JJ5A 5I17B 2FLBT 3TZVB 4JN2B 4MVBD 4QTIH 3RNQB 1JI2A 2OI9B 2XZQL 2YPKA 4P2QB 2DL9A 1JWUA 1UB6B 3IDYB 1BEYL 5ACLA 5MHSD 2LTQC 4L9LB 4LDOB 4LLVA 1IC1A 4X4YB 4JFDA 3RUGA 3GMOA 1JYVA 4F2MB 2AK1L 1ZT7B 2BNQA 4H0HB 5D5ME 5BXFA 2GW5A 1A0QL 4QRPD 2YSSB 4JO3H 3AS2A 1Q8MA 4GXUM 4J3WA 3REVB 2P24A 3BPLC 1Z9SA 4X98B 1HQ4A 4OCYL 3RY6C 1B6UA 4JVWA 2WLZA 1F3JB 3OV6A 3KPNA 5F7EH 2CLZA 4L4TA 4ODUA 3TF7C 5I8OL 2MQ0A 1AGDA 4ZDHA 3L9RB 4UU9A 4JR9H 4O2EB 5TFSL 1YZZA 1VEMA 1B2WL 4MD5B 4O51B 5JORA 4JCMA 3U0WH 5FYJH 1J1XL 4M48H 4ZFFB 3RWCA 1A1NA 3GSRB 4HULB 5HVHC 1S8DB 2VITA 4BZ1H 5KSVB 5K9OB 3UTSA 3G9AB 4OTXL 4RFOH 1GSMA 1GGYA 5JXED 2YUVA 3QP3A 1TJHH 4R8WH 2ZUSA 3HG1A 4ZTOH 3UBXB 3MREA 3W9DB 5J0BA 1M4KA 4GRWF 2HP4A 4WU7B 1OP5K 1TVHB 5ICZB 3CC5B 1D7FA 4O9HL 4PJIF 5CFHA 4PYGA 3SBWC 1T7WA 5M7QA 5LGHH 3RDTC 1YEKL 3MLSH 4MA7H 2L7JA 4UT6L 5MEQB 4D9LH 2EC9U 4ALAL 4F7CB 1T5XB 1KJ2L 2DYPA 2VDOL 4XCEB 3A6BH 1UXWA 2YZ8A 4NHCL 4ONGL 3PWLB 5C0AB 1T6VN 5JIPA 4JKWA 3T09A 5LBSL 2YZ1A 2FJFA 4J4PA 2DI9A 3CVHB 3BQUA 4NKMB 3HTLX 4K3EL 3GUTB 4G8IB 4D0BA 3AAZB 4GBXA 2AEQL 1J86A 3EFFB 4HF5H 3RIFF 3SOBL 5D2LA 4S1DC 5E6IB 1F3DJ 5DJ8B 2FSEA 1BQHG 3AXLB 5KTEL 3QIBA 2ORBH 2D2OA 2OR8A 2C3WA 4JZNB 2BJMH 4OZ4A 4W4OA 5HGDA 2YA1A 2QL1A 2ID5A 3CFKB 4PJGB 4W70A 3ZMRA 2VRAA 2NR6D 4E42A 3TBSA 3BGFC 3QDMD 1IAKB 1U3ZA 3GMMB 3MV7D 2JELH 2JCCE 5DQJA 5L88H 4E5XB 3G6JA 3QZWA 3CAFA 4MJIB 1AD0A 5FGCE 4JFQB 4O58L 5IVXF 3T2QA 3BKYL 3DUSB 2GQHA 4X9FA 1I3VA 1MPAH 4D0DB 1WEJL 2PYFB 5BZWA 4UDTB 3V4PH 4DUWA 4G8GB 2IF7A 3MUHL 4YEFA 2IBZX 3M8OL 4G9FD 2ED7A 2FD6L 1OGTA 2B8OT 3U36B 3VXTB 3ZKXB 2P5WA 4HKXA 1KIPB 5SWQA 4G6JH 5D4QA 3RTQD 3MLRL 4ZSOA 1OVZA 3MRRB 4WI8A 2VLKA 2BNUB 3U0PA 4HKJA 2CKBA 3P40A 1WT5C 4OF3A 1KXVC 3MGOA 5D7LB 2NCMA 5EDXA 2VN7A 2FBOJ 1ZHLA 4K94H 4G8EA 2R9HC 1ORQA 1L7TL 3DUHA 1GGTA 4HMCA 2BSSA 3GSNB 4LLMB 2YA0A 4NYLB 4U1IB 5I66B 4E41B 3SCMA 4G3YL 4RA3A 4WCYH 1MJ7L 5HGAA 2DLFH 1KN2L 4F9LA 3RX7A 2HTLD 3CFEB 1WGOA 2FEDD 4N68A 3L7EB 3MRKB 2ZUUA 3D85A 5GS1A 1EHLH 3ULSA 4HCRA 4HFUH 3OHXB 5GGTL 4DOHB 3G9VA 1T1WA 2NNAB 4YXHL 5C71A 2HTKD 2YD7A 4QRRA 1TNNA 1MHCA 1V3LA 3QWOB 4Z7UF 5MI0C 3TZVD 5IFHL 4P2QD 2CR6A 4XWGH 4NSKB 3VW3L 4EUPB 5CMAA 4YGVA 4ELKB 2FIKB 1J05B 1E28A 1I9RL 5FOBB 2X1QA 3NGBB 4M1CC 1MFAL 3VFSB 4L8BA 1OGAB 4OIIL 5TQ0H 1H8NA 5FCSH 4HQQH 3CDGB 1O0VA 2BVPB 1I3GH 1U8MA 4DN3L 2NY5H 1ORSB 1CLOL 1JGUL 4GXVH 5EUOB 3V6ZA 3N9GH 4LSTH 2HLFC 5KJRL 4PRIA 4XH2B 1G9MH 5H35B 1JUFA 4UB0H 1KXTB 4OB5L 4LGRB 5KN5B 2ADFH 4X7DC 4AT6B 3HB3C 3SDDB 4APQA 1A3LL 5TDNA 2AQ3A 2BVOA 3O2WL 2HT2C 4B5EA 1MEXL 2NLJA 2PO6C 4Y5YA 2H26B 1N0XL 1FIGH 5IIEB 1YUHA 2I5YL 4DQOH 3U4BH 2EIZA 3DUUB 3I6KB 4RAVB 1OTUC 2CUMA 4DGVL 1LEGA 5IKCA 4NN7C 4PJHA 4F57H 4ISVA 3MRHA 4WFGD 1CG9A 2NXYB 5DK0B 3O45A 5H37H 4DGIH 1EAPA 4LOUC 4O5LL 3JWNC 4YNYB 43CAA 4LP5A 4WI7A 4ENED 4ZOBA 4NCC2 3WFDH 3IGAB 3QWRA 5EU7C 2FL5A 4GS7B 1A6WL 1U42A 4OCSL 3ULVH 2VAAA 2X05A 3OX8A 4ZOEA 4H8WC 4HJ0D 5EO9B 1N5AB 2BX5A 1N3NA 3BXNB 4ODHH 5CLWA 5C0AD 3NCMA 1BZQK 5CIPB 4WO4C 3KPOB 4HC1H 5J13B 1RV6X 3VRLE 4OFDA 4PIRF 4OD1H 5KOVC 1L9MA 4LVNB 4RAHA 3VFNB 2D3VA 3GIVB 4JKPH 1S9VB 2MCPH 4G8FB 3VJ6A 1WV7T 3QCVH 4EN3B 1XF3A 5DJ2A 5E6ID 2BVQB 4Y1AA 1PBYA 2X1OA 4FXLA 4LEXL 4PV8A 1XIWA 3RZCA 2OSLA 3QJFB 1ZHBB 3BHBA 4GLRI 2IQ9H 1L0QA 3QHZH 3MA9L 4F7EB 3ZHDA 4IRZL 1U95B 3C6LD 2NY6B 4P3CL 5FHAH 3HS0A 4Z7VE 5CHNB 1E4WL 1SJXA 1C1EL 2C7UB 5IEKB 5F9JA 1G7IA 4AQOA 4V2CB 4JO4H 1NFDE 3FL7A 5IW1A 1O7SA 4PY7B 4RCAA 1H3TA 3WFCL 1ZHKB 1UCBH 1BIIA 3SY0A 4MJID 2DIAA 1RQ5A 4LCWB 1EVUA 3RU8L 1OAXL 2CMRH 2AKRA 4GAYB 1AQDA 1T83C 4WGVB 1P7HL 2D31B 2FX9H 2EYSA 3HE7B 4LSPL 1UWEH 1BIHA 1TPXB 3EYQC 1A21A 4X0KB 4XNYH 4ZUUB 5DLMH 1KJMB 2AW2A 3HCVB 3MA7B 4G8GD 3KYOB 2DI8A 1TZIA 3U1SH 3ARBA 3FT2B 4F8QA 3L3HA 1JNJA 3S34L 3VDBA 2AK4E 3HZVB 2A0LC 1KLUB 1T21B 2WINA 5D7LD 3OKOA 2UUDH 3WE6A 3VGEA 1M7XA 3BN3B 1AJ7L 5F70A 3U7WH 3QR2A 5T33H 3MJ9H 4C4KO 3ZHLA 2WUCH 3RVTC 4WFED 2AV7B 4E41D 1NBVL 4JM4H 1NL0H 5DRZB 3PNWB 2GYSA 5JR1H 4JPVH 1U92B 5DC4B 3QXAA 3ZKQD 5D9SB 1MRFH 4P3DA 4GKNB 5HDBF 1WC7B 2BFVL 1AGFA 1LP9E 2F5BH 1QKZH 3S36X 4OLZL 2EZ0D 3BH8A 4OLEA 4LFHG 3W39A 4Q97A 4YDLC 1S5HB 3GMNA 2X10A 2CH8A 2OTWB 4GG6E 2APXA 1QRNE 2FJHA 4Z0XB 4X6CF 3VGFA 2ED9A 1CDJA 3PIQB 1EEUA 2AEPL 4HH9A 1F11A 4WJ5A 1T80A 1K4CA 4X8XA 5GGSA 3VRJB 3RVXD 4HK3N 1PYWA 4QCIB 4JY6B 3MJ7B 1JPGB 4UINH 5ESQB 1SEQL 4NNXA 4ODSH 4JZJB 3P4NB 2OX5A 2GUOB 1OGAD 3DBXA 3G5YB 1PD6A 4WV1C 1QLRB 3H9HA 3P77B 1J87A 3U6RB 3P4OA 4MXVE 1DQLL 1VESA 2VZVA 5DJCB 1T7ZA 4BH7A 5C0BE 4OUUA 1AGBB 3ARZA 2ARJQ 5EO1B 1KC5L 4BSVB 4EKXA 2ESVB 3PDGA 1H8OA 2AAVA 3SDDD 3GSWA 1LD9A 1MQKL 4FQXC 2EIDA 5IF0A 2MOVA 4LVEA 1F4AA 3EDFA 2Z8SA 5F1KC 3V9FA 4UBDC 5GPRA 4UOW1 1C08A 4XB7A 4PY8J 3G04A 5EORH 3QUXB 5GGVL 3QNZB 4F7TB 4WUUB 4ZODA 4X9IA 4LVHC 4RQQA 3EYUL 2NXYD 1ZA3A 2A1WH 5IMMA 4GAFB 4XVUD 2XWBB 4LEOA 2P8MB 1KTDA 5H8DA 4M1GH 1CL7L 3ES6A 2C9AA 3WUWG 1MWAL 4HPYH 1OQOA 4XCNA 4PJXA 1LILA 3DX6B 3Q6FB 4WEBH 3L3IB 5H37G 4CNIA 4D8PB 3TBYB 4FFYL 3JSSA 1J1OH 4J12A 1MCEA 5F3HB 3L1OL 3TCXA 1QFWL 3ILQC 4YUEL 4YX2L 5HYEA 4WFHD 1ZE3C 3JV4B 4OGAC 2OZ4L 1CLZL 3C8DA 2WW8A 4NBYB 3QO0A 1JF5A 4RIRB 1EDQA 3BPCA 5EOQH 1S9KC 4EN3D 4AMKL 4JFPB 5E8NB 2CDGA 1OSPL 1U6AH 1WVZA 4HFWA 1UJ3B 4Q7DA 4OV5A 1CK0H 4G5ZL 4TRPH 4PBXA 3VH8G 4ORGA 5DC0A 3LKSB 3M17A 1A5FL 3KXFB 1T5WA 3H0TB 2FYYB 1WBZB 4WHYH 4HX1A 1QUNA 4QOKE 2NY6D 4NQVA 1Z9OA 5D96C 2VABA 2IANB 4JM2C 1X5HA 1ZLVK 4G80B 3T0WA 4MA1B 3B9KA 2HFFB 3AS0A 1JZ3A 5I8OH 5T5FH 3IXTB 4I2XA 4OQTA 2X4UB 1B2WH 3S7GA 3MZTA 4XI5C 4PJ7B 1J1XH 1U3YA 3NFSH 3IT8D 4D94A 1LVEA 4OKVB 3FO0L 3C5ZB 3HE7D 4NN5B 4XPGL 1BF2A 1RJCA 4LCIL 3U79A 2ICWI 2RHEA 1RPQA 3OWEA 3V8OA 3QEQA 3MUJA 5CD5C 2XACC 4KV5F 1EERB 1WIOA 5B38B 2VR9A 2D7NA 1B0RB 4U1NA 1GH7A 1QD0A 2Y5EA 5J1TC 1MRDH 2OMNA 4P48A 1TMCB 5E5RB 2A6JA 2DDQL 1UJTA 4O9HH 1S7TA 5DHVB 4PJ5A 5C07B 3FB7B 1X44A 1PX3A 4C56E 1IRAY 3M45A 4NRYB 3RGVC 1K8IB 5D7JB 4H1LA 4LLAA 4PPTA 1P5VA 3MUGA 2VDOH 4ELMF 1U3HA 2CXGA 3ROLB 1PKQE 2YPLE 5IHUH 1AKJA 2ZUQB 2APTA 4UQ3B 2X4OA 5CLTA 5JQHC 2A9MH 5DQDL 5I19H 1GZQB 1I4FA 2D7OA 5LBSH 1VHPA 4D3CL 2W0FA 1X5FA 3FAWA 5T5NG 3RL1A 4E0RB 1HQRA 4GOSA 1UVQB 3FFDB 4L4VB 4FRWA 3SOBH 2ZUVA 5T3ZH 5E24E 1I7TA 1AY1H 3FFCE 3ILPB 1BM3L 5CJXA 3E3QC 4K2UL 4FMFA 4NQEA 2A6IB 1JRHL 2PKDA 2Y06H 4Y2DB 2D7QA 4YDKL 1OPGH 5E4EC 1U91B 5E4IA 4F9LC 1ZXQA 1A3RL 2DD8L 4KC3B 1T0MA 4YDJB 2X4PA 4X5LA 3MGTB 3BEVA 4OZIB 4DJMA 5L6YH 3DRQB 4LQ1A 3EYVA 3F7YB 4HV8A 3F8UB 5B8CC 5C1MB 1P9MA 4KDTA 3RVUC 4O58H 3GSOA 1NGPL 1K3ZA 4L29A 3QUMB 3BKYH 1A6AB 2RR3A 5EZIH 5J8OA 1FL3A 3DGGA 2PF6A 4LSUH 4C56D 1XGTB 5K9JH 1OAQH 3VWKB 3LPWA 3UPAA 25C8H 1M6OB 4LSSH 3O3BB 2NTSP 5MEOA 5F88A 4LMQE 3ARGB 3D5OF 1PGRB 5KS9B 1BFOA 4PJCF 2BC4A 4IRSD 1QOKA 1B88A 2A83B 3O6KL 1CVRA 1IKNA 2ZSWA 2QADC 4XNQB 2EDLA 3B6SB 1IL1B 4HIJA 1M05B 3MLRH 4XCCL 5EN2A 3ZYZA 4POYA 1NLDH 1H5BA 1HXYB 2GJ6A 2JIXA 3BVNA 4P2RB 5D70L 4PTTB 1WWAX 3V4UL 4WUUD 1YEEL 4QTHA 5HHMB 4CBPA 1IM9B 4APQC 5ID1B 1X4ZA 2IAMA 4M6NL 1HEZA 1L7TH 1MCJA 4GFTB 3W11D 3OAUL 1X6LA 4WWKC 1L6ZA 4K94C 2VB5A 4LPYA 4PRHE 4XVSL 4OQ1A 4YWGH 3E2HC 2FWOB 1EJOL 3V5HB 1MCPL 4I0PA 1KN2H 4V1DB 1LO4L 1TNMA 1WWCA 2OK0H 3BJLA 4WTZA 1I1AB 1OAKH 1TXKA 1T03H 3PV7A 3D1MC 4K3GA 3JWDL 4XMPL 4LP4A 3QULB 5DSCB 2VOTA 3PWVA 4LPWA 3KPPA 3VA2C 4H25A 4ZTPL 2OL3B 4BK4A 2DJ4A 2VE6A 4RNRA 4XP1H 3QIUB 2CDFB 2QR0B 3ULUH 2R2EB 4YXKL 4YIQB 2DQHL 2RJMA 5IFHH 2H2PC 3RJQB 1D9KA 3MACL 2VXQL 5L2KA 4M4RA 2P8LA 4KK9D 3H9SB 4L8SC 3OJ2C 1NGXB 1JWSB 2E8YA 5A2IH 4GXUN 4HGKC 5IVZA 3FO1A 2R4RL 4LHUB 3KXFD 4JY4B 3TBVB 5CWSB 2UWEA 4OGXL 5FM4A 3WXVL 4UI2A 1JGUH 2BY0A 3QPQC 3T77A 3OXSA 5IFJA 2B4CL 5F96H 1G7MB 3O6LL 5J3HD 4PREB 5FV1L 4PGCB 3B83A 4LRIC 2YN3A 1C12A 2X1PA 3BN9C 4FP8L 1QPXA 2K7QA 1PVHA 3R1GL 4OD2B 4P46C 1DL7H 3O2WH 3V79C 4NKIL 1R24B 4YHLL 3MLTB 3H3PL 1JNNH 2ZUYA 3C5ZD 4RX4D 4BFIB 1UKQA 4Q9BA 1AO7A 2ARWA 4MZ3A 3NFNB 4DGVH 5CEXB 3C2SA 5KSBB 5C8JA 5EU5B 2EO9A 2G5BB 1K5NB 1CGVA 4YFEA 4YHPB 2NX5E 5GIRB 4N0CD 5A3ID 5A40E 1NAKH 5C07D 3L5HA 3VFGL 1UH3A 4FS0A 4ZO9A 3V0VA 4NGHH 2XWJB 5D6DC 1S5IH 4NOBA 1FZKB 4RZCA 3CD4A 5D7JD 4Y4FB 4OZGE 4Y16D 3BPNB 2ARJA 4Z95H 1OARH 4XNZB 4HS3A 5D2NC 3TT3H 1A14H 3STZA 1IC5L 3ZT6A 1T0NA 4J7RA 4OAWB 4KJWD 4YDVA 3D6GA 3H3KA 1FO0A 1AR1D 4OCNC 5I18H 3WS6A 1G6RH 5F9OL 5HJ3B 4FHBD 2Z31A 1MI5B 5DRNB 4IRJB 4MD0B 4L4VD 4XBGB 2XA3A 3EYOA 2IPTL 3OPZH 1DVFA 2F5AL 2XNAA 1J8HA 3MCG1 3NMEA 3ARYA 1MHPH 4N8CL 5CSZB 4DZBA 1JWMB 2DF3A 4XGZB 1G6VK 4Y2DD 4F7MA 5ID0B 3VRIB 3EO1B 4BQCA 4EIGB 4FXKB 3FQTB 5ENWA 2Q8AL 1A6UL 4X9HA 1YNLL 1DBBL 4ZFGH 2GT9B 2ATKA 3D39A 1TJIL 3C60C 4HUXB 1RK1A 3B9VA 3LN5B 4GW5B 4RGNE 1S7UA 2E9WA 4Z7WA 4I8DA 1E27B 1SQ2N 3HZYB 1RZJC 2B20A 4MHHI 2EXWC 5FYKE 3WHXA 4LVOB 1MH5B 4PJAF 1OAXH 1S7WA 5HHQA 4OFYD 4BH8A 2IH1A 2IFFL 1F4XH 4UNUA 3QXUA 4C58B 1ACYH 5KVEL 5ETUB 4UT7L 3VWKD 2NY3C 4DEPC 1H8SA 4U05A 1T4KB 5FYKH 3ECBB 5E03A 3GHEH 5C3TA 3WIFB 4RMRA 2R1YA 3ARGD 4X6DF 4FABL 3O0RL 3WJJC 3KPQB 1CR9L 4S10A 5GS0H 3ZE0E 4IM8A 3MXWL 2R1WA 1C5CL 3HHRB 2Z91B 3S34H 4MB5A 1IM3A 3OF6D 3HZMA 4PRBA 4P2RD 1UQSA 1CFBA 3BP6B 5CINH 3BW9A 1SM3L 5AD0B 5HHMD 1AJ7H 4YHNA 2CJUL 4HS8L 5CCKH 1IM9D 4LNRB 2CR3A 4M6OH 3MCKB 4LMQI 3GJEA 4PJEE 1YMHB 3MV9A 1RHHB 5J6HB 4P4KA 3O8XB 2AP2A 1NBVH 1FLRL 3SPVA 4KQ4H 1I1AD 3EOAB 1LO0H 5F6IC 4KJPC 3VXSB 2BFVH 1AH1A 3QFJA 1NEZG 3B9DA 2DLEA 5BJTA 1S7XA 4P9HL 5GRXG 1CZ8H 3P9MA 1ZHNA 2BMKB 2V5YA 4K8RH 4PJFE 3RP1A 2MHAB 5I71C 3QIUD 5DA4A 4OZFH 1CFNA 2P7TA 2OTPA 1DE4B 1WCQA 3IKCA 5SV4A 4NO3B 1BJMA 4UMGA 1U8NB 3UJTH 5KSAC 1I7RB 1E4KC 4N0FA 3H9SD 3RVWD 2DQFB 4MCYB 4HZLA 5CD3B 4HUWB 1BJ1H 5GGQL 3VGBA 4G9DB 3PL6C 3S4SA 5BRZB 4LHUD 1C16A 4L1DA 1WAAA 3BKCL 4TSCH 5AAWA 1IGJB 3MRMB 3OKMA 2XKSA 3TVMB 4XXDA 2R0LL 3N85H 4HXBL 5MP6H 1V3JA 3QUZA 1KC5H 5JXAL 4FFWC 4Z9KB 1JTPA 1FRGL 3IFPB 3BIKA 4LNVA 3AREA 1G7HB 1OCWL 3BP4B 4WRLA 4K9EH 4MS8D 3GK8H 4U0RB 3KGRA 1PX4A 4U2YA 1ROWA 4L3EB 4WIQA 5LGJB 1BZ7B 1S7RA 5L2JB 4RWYH 1OTTC 1RMFL 3TCLB 2JJTA 5DUBB 6FABH 2KKQA 3FOMA 5GGVH 3ZT7A 1D5MB 1IE5A 1YNTB 3EYUH 2C4FT 5I16B 5KANG 1SMAA 4GW1A 2PYEE 3REWA 5CEZD 1EHNA 3IS0X 2R69L 3NCJH 2ZOLA 2ADGB 2FGZA 4LLWB 1MFEL 4M61A 1MWAH 1YA5A 4LIQH 3H42L 3RWJA 3IB4A 4Y4FD 3CFJA 4NUJB 4CVZB 5AZEH 1NFIB 3QDGE 1OTSD 4NOFA 1YDPB 3HI6L 1FYTB 5KBNC 4JZOA 1FJ1B 4EI5B 4JO1H 3FRPA 4OCRH 3L1OH 1QFWH 4YUEH 4YX2H 3IU3B 2NY4C 4JRYB 4MCZB 4IDJL 5C9KA 3QEUA 1MI5D 5D7IA 3MRDA 4GRWE 4IRJD 3LQAC 1FZOA 5JOPE 3A67H 1G7QB 5JIIA 3OGCA 5BQ7B 1IGFL 1MHHA 4PJIE 1DN2A 1XZ0B 3SQBA 1UWXH 1FPTL 1ZVSA 1W0WA 1D5XA 4PRNB 4GRWH 1JV5B 4TUOA 1DLHB 1Y0LB 2CUIA 4G5ZH 5BVPH 5F7WC 3RHWF 1A6VL 1KJ3L 4FXGA 4X8JB 3V5DA 1A5FH 3O4LE 3SE3C 2DQTL 1CFQA 4XB8A 3F62A 4OT1L 2ITCA 4OLYH 3WEXA 1I1FB 5JA8B 2VLRE 2R8SL 4MGXA 5D7SH 3MJ8B 4NO5A 4LSVL 4TNWK 2OQJB 1N7ML 3VD5A 4AEIL 2WK2A 3G6AA 4EOWH 4AZ8A 1KLGA 1MJJA 2R0KL 5HYJE 4QHLB 3FO0H 4LSQL 1C7SA 1YEHL 1EFXA 2NXZB 3PWUA 3CPLB 4KKCD 1FGVH 1QVOB 2PW1B 3QNYB 2Z8WC 2JK5B 3RWGB 4Y5VA 3BMVA 1RURH 1PZ5A 3RNKA 1Q0XL 2ADJA 4NZJA 4GKZB 1GOFA 4NQCB 5DWUH 3TJHD 3U2SA 2LAAA 3DHJA 5JOPD 3ZYJA 2FIRT 3MO1B 5IVXE 2EYTB 1FG2A 2OM5A 3BUYB 1TJGL 5KSUA 3K7UA 4HDIA 4DCQB 3O8XD 3MXVH 1EVTC 1KYOJ 1NEUA 2HMIC 4FTVE 5HPMB 2C4XA 2W60B 1FL5A 4D3CH 3SDXF 1WBXA 1GIGL 2DWEB 5D1XC 3VXSD 5ERWB 3L5IA 1HXMB 4XNXL 4F15B 1D6EA 2C1PB 4XAKD 2NTFB 5EC2A 3TYGL 1PAMA 5AUMB 1HINH 1UM6L 4YDKH 7CGTA 4JQVC 1VENA 5D5MA 4I0PC 4I48B 3L7FB 5BS0B 1JZ8A 5IBUG 1W0VB 5ICYB 5GRJH 2HKHL 5FV2A 1RIUH 1KCLA 5D1ZB 3MBEB 3ZTNL 2BERA 4OZFG 5FO8B 5HDQH 1IAIL 2DQIL 5BRZD 1QBBA 3U7AA 3FRUA 2X4TA 5F7DB 2WWMC 2ED8A 2IWGA 2Z4QB 4HS6A 3TVMD 3JWOC 4GRLA 5TE6L 4XXCA 1IEAA 1TITA 1TVDA 5DDHA 1HYRC 2ZG1A 4L3AA 3VFPA 1VKXA 4M62H 3EO9H 2ZCHH 3RFZC 1DBJH 4U1SA 1NANH 4Z7UE 1MSPA 2WBJC 1W8OA 3AS3A 4N8VA 1GXEA 5DEFA 3VG9C 3QQ3A 4JVPA 3BT2L 1AP2A 3O6KH 3TP4A 1MHEA 1RULL 3KWWA 4PP2A 3GFUA 2XN9B 4JDVB 5IR1B 3RX5A 2ZCLH 4AG4L 4OFKA 1YEGL 5D72H 4LKXB 4Q9CA 5E2TH 3IJSB 4PJDB 5D70H 1IT9L 1YEEH 2D0HA 3U46A 1LO2L 4XZUB 4IJ3B 4NT6A 1DSFH 4EBQH 1FG9C 3RQ3A 1BJ1J 4XCYB 3FQXB 1U8IB 3FQUB 5MEPA 1BF8A 3GGWB 2A6DA 3D9AH 2N4IA 3RL2A 1MF2L 2R2BB 5I9QB 1NC2A 3BZDA 1LO4H 1GZPA 3KYAA 1Q38A 4JFOB 3ZKND 5M94B 4ONFL 1CL7I 1FYTD 1G7LB 4EI5D 4YO0B 5EU3A 5FKPB 2R39A 4PG9A 3S6CA 4JRYD 4C83A 3DV6B 4U1HB 3UTZB 3MNVB 4YXKH 1QFWI 3O6FB 5SWZB 1KPUB 4RSVA 3SN6N 5C0CE 3G5ZA 1FN4A 2VXQH 1XGRA 1BFVL 3ULUC 1B3JA 1T20B 4EI6B 1ZOXA 5KG9B 2FCBA 3C6SA 2JCCA 5HHNA 4J3TA 5HHOB 4YDIH 1KNOA 1XF5A 3QYCA 4R97C 1P1ZB 4YR6B 2Z31C 5I8CB 5FO7B 1ND0A 2B4CH 2HFEB 1F02I 1OD9A 1VGEH 1EZVX 3K74B 5BMFH 2NYYD 3FOLB 4NRZA 2ZUTA 5D8JL 2C3VA 4M3KB 4FP8H 4N0YL 3R1GH 4UQ2B 2YMXL 1DEEB 3SE4A 3QISA 4L8DB 3RWIA 3LZFL 5FF6A 3PDOA 1MLCA 3PXHA 1F6AB 4YE4H 3WFZA 4UNVA 4IOSD 3H3PH 1NGWB 2NXZD 3HUJF 1ES0A 5H94B 5LJYH 4CVXB 5HSFA 1ZMYA 3NABH 3OGOE 4LDLB 1P6FA 4R4BA 2YK1L 3U4EB 4YHYB 3P9LA 4HIIB 3TM6A 2HT3D 4U1GC 3RZWA 2NW2A 3L6FB 1KCRL 3K8KA 3U0TA 4JQXA 2YBRB 1E6OH 2P8PA 3TESA 2QQNH 4JQIL 1KJVB 1T1XB 2BNRB 3PV6B 2WV3A 3BWUC 1MCNA 4NQCD 1L9NA 3MRPA 4YHIB 5CKGA 5GSRA 1RZIA 5K9QG 1G9NH 2I60L 3T0BA 4JPIB 4PTUB 5C0GA 5E5MA 3OXRB 4BELD 1U8QB 3DMMC 5I30H 2HG5A 2HT4D 4S2SA 1XF2A 2R0ZL 3LRSA 5FKAB 4PV9B 1NKRA 5KVMC 1MJ8H 2FO4B 5B39G 1T04B 2VDLH 3TO4B 5E70A 4HKZA 3OQ3B 4S1SL 4DKEH 4EVNA 2F5AH 4WW2A 3KDMB 5F1NA 3PHOB 4R3SB 2APVA 3F5WB 3QG6B 4JY5L 4JJ5B 3MODH 1ZEAL 4XVTH 2YPKB 2E27L 4N90E 1JWUB 5J1SC 5BS0D 1MLBA 1HE7A 1QFWM 8FABA 4LLVB 1JRHI 5I1KH 3CGTA 2QJDA 2D4DA 1A7OL 4JFDB 5D1ZD 3MBED 1TJIH 3RUGB 5I15H 3CDCA 5F9WC 5HDBE 2AEWA 3GMOB 4OCXL 2E7LA 3I75A 1Q9OA 2BNQB 2R0WH 5BXFB 2BOBA 3WUWA 1T0PB 1EHXA 1OAZL 4YQXL 3MUY1 2P24B 3C6LA 1HQ4B 1IGML 2IFFH 3KPNB 4YC2B 1QZ1A 2CLZB 4L4TB 4ODUB 2V7NA 4PBWD 1AGDB 4ZDHB 4UU9B 3K4DA 3BIBX 4X6CE 3I3DA 2HVKA 1BREA 1MCFA 5HGGS 1WK0A 5JORB 4FABH 3PUCA 2ZKHH 1UH4A 3RWCB 1A1NB 4EUPH 2W38A 1FNGA 2VITB 2HA1A 1C5CH 3GMQA 4XMLH 2XN9D 3UTSB 3MLVH 4OKDA 5GRZA 1R0AL 4NQXA 4KRMB 2OR9L 3HG1B 4NJAL 1WZ1H 3MREB 5DURB 3EYFA 5CZVH 4HC1A 1YPZF 3AREC 2VZSA 4HS8H 3FKUS 5JW4N 5DD3L 3AROA 4OZHF 3GBML 4X9GA 5I1IL 2F53E 3OAYH 1MFNA 3U82B 2JJTC 4NBXB 5KVFH 4OI9A 3TT1L 4UAOC 1OAYL 5FUCC 3GSQA 4X6FA 3SGEI 2DKUA 2DYPB 1NCCL 5B22A 1DQJA 5JOFA 1UXWB 5ILTH 4P9HH 4YFLF 2DN7A 3SO3B 4OJFH 1TQBB 1Z0MA 2FJFB 5C6WH 2Q3ZA 3BQUB 4TSBH 4ZS6D 2VZOA 4D0BB 1FH5L 2UYLA 4GBXB 5JNYA 3O6FD 4W6XB 2ZG3A 5D2LB 5SWZD 4NM8H 3QI9A 4H20L 2ICWA 3V4VL 3SE8L 4QHMA 2FSEB 5EU6E 3UBXG 1NFDA 1UGNA 2Z9TA 3QIBB 1JHTA 1MRCL 5HHOD 4MB3A 3SGKA 3LDBC 4OZ4B 5FIEA 5HGDB 4P59L 3LMJL 2DKSA 2R1XA 4EDWL 1A7NL 4MDIA 5T3XE 4LCCC 3LEVL 2WQRA 4E42B 3TBSB 2R0LH 4HXBH 3UDWC 4E9LA 4Y8DC 1FRGH 1V7MH 3AS1A 1S9XA 3IRZA 5DQJB 4YH6A 5DRWA 4S1QH 3G6JB 1L6XA 3QZWB 3MFFA 1AD0B 5T3XH 4IOIA 1BGXL 3VFOA 2FDBP 1AC6A 2B0SL 5ANME 5DC9B 3TBWA 1WIUA 2FR4A 2AK4A 4HBCH 1A7RH 4MVBC 3Q5TA 3JV6A 5BZWB 3VFWA 2VXVL 4QGYA 1EXUA 4M5ZH 3F12A 2WM0A 3ARFA 3R06A 5IB1A 1OGTB 2P5WB 4HKXB 3SEPA 5SWQB 1X5ZA 2BNRD 4ZSOB 1QO3A 3WLWD 3U0PB 2VLKB 4HKJB 2CKBB 1WZKA 3MGOB 4LQFL 4JLRA 1W0YT 1ZHLB 1Y18A 5F9AC 4B7LA 4G8EB 3OAZK 1ORQB 1RU9H 1A7PH 1LP9A 4NBZB 4NZTL 1HNGA 4XHJD 3TN0A 1YQVL 2BSSB 3HI6H 4Y5VC 3SCMB 2GFBA 1WJ3A 1OF2A 5HGAB 1I85A 1MFDH 1P53A 3BGMA 4GG6A 4KV5E 1QRNA 4H0GA 4IDJH 3HC3H 3TO4D 3D85B 2QSQA 5GS1B 3ULSB 2DBJA 3WNPA 3LEYL 4FZ8L 4RISL 5JXEC 1H3PH 3ME0A 1T1WB 1OAUH 2AV1A 4MZ2A 4KVCL 2BY1A 5I1HL 4OSUH 1IGFH 4QRRB 1MHCB 4XAWL 2DM4A 2ERJC 5HYSA 1QLFA 2Y07L 4L5FH 2H3NA 1A6ZA 3T0EE 2XTJB 3JTSA 4A6YL 1UT9A 3GDBA 2UZIL 4KJQD 5C7XH 4UTAL 3CSYA 5CMAB 4YGVB 4QXUH 2DQTH 4ELME 5FUZL 1E28B 5C0BA 1A4JA 3MLYL 2IALA 5BV7B 4JFDD 1R5IA 2R8SH 2YEZA 4L8BB 1RY7B 1M7DA 1NC4A 1KB5H 3O2DH 1U8MB 5B4MD 5F7HA 2BNQD 5DEZA 4I9WE 4WHDA 5I6XC 1N7MH 3V6ZB 4PRIB 4NP4H 3L3GA 3G6DL 1JUFB 1CLCA 2VXUH 5ISZE 2R0KH 1KIUA 4L4TD 1EO8L 1SVZA 1YEHH 2D7MA 5DFWH 4APQB 3GMRA 5TDNB 2BVOB 1PKOA 3C5SA 2NLJB 4I18A 4Y5YB 5ITBL 2AJSH 1YUHB 1RUMH 1Q0XH 3E2HB 3UTSD 1MJUH 3U9PH 4DWHA 2EIZB 3UCRA 4F7PA 1RUAH 3HG1D 5DJZA 1D5IL 1TVBA 1LEGB 5DURD 5IKCB 1JNLL 4PJHB 4ISVB 1A4KA 3CVIH 3MRHB 2KZ1B 2NR6C 4EUPG 5FHBL 1D6VL 3H6JA 1CG9B 2VDNL 3O45B 1EAPB 3HA0A 3JV0A 1F6LL 3E8UH 1WSST 43CAB 1NAML 1TZHA 3T0ED 2HKFH 1JHKL 5T1KA 3ROOA 3TNNA 2FL5B 5BW7A 1ITCA 1TZGH 2VAAB 3OX8B 4B7IA 1BWWA 1KGCD 1J5OL 2DYPD 4PJCE 1T2QL 4R0LA 1N3NB 4JFFE 1FP5A 3LEXA 4MXWL 1S7SA 2IG2L 5IVOA 3GBNL 5TE4L 3UX9B 4JM2F 5FM5O 1WWWX 3AUVA 4J4PD 1IGIH 1RSFA 3CUPA 2XA8L 3BQUD 5HGHA 3ARVA 4TVPE 5C08E 1I1CA 4GBXD 3RTQC 4QOKA 3VJ6B 1D5BA 1XF3B 5DJ2B 3EDDA 3T0XA 4Y1AB 5LKNA 1KTRL 3VXNA 2E7BA 4PV8B 1XIWB 5HVWA 3RZCB 3BHBB 4TVPH 3ZTNH 3IU4L 3QIBD 5F6HI 2GTWA 4QRSA 5GISL 4PLOB 1IAIH 2DQIH 3ARWA 1KEGH 5IESL 4MNQE 3P30L 2D03H 3HS0B 3UTTE 4LARL 1CLYH 4AIOA 4EIZC 2HTLC 3WN5C 5F9JB 1G7IB 2FEDC 5TQ2L 5TPWL 1KB9K 3MRBA 1YEFL 4JN1L 5IW1B 1FC2D 3BESR 3T4YA 1XH3A 2R23A 1BIIB 3SY0B 5IFAH 5JHDE 2HTKC 3T1FA 4BYHA 5IV2A 5EWIL 4WHTA 2IPUK 2AKRB 5J1AA 3VG0L 1AQDB 1R5WA 4POUB 1YQ2A 2EYSB 4FQIL 1KJ2A 3TZVC 1RULH 4HXAL 2OI9C 1PQZA 3X3GL 3IDYC 5F89A 4C56A 4BZYA 1SYVA 2IANE 1N4XH 2CXKA 4L9LC 3FMGL 4JFHD 3Q2CA 4NKQB 1TZIB 3O2VL 3ARBB 1DLFH 2P5WD 3L3HB 2Q7NA 1PKQA 2YPLA 3E6HA 4IRSA 5FGBA 1EPFA 2BCKA 2BVTA 2VLKD 2BK8A 2WINB 3OKOB 3WE6B 5L9DH 1BBDL 1SMOA 1U93A 5I1JL 2EICA 5I1DA 1LDPH 5JLZA 4CU7A 1JMZA 5GZND 1YC7A 1UG9A 4KVNL 3SKOA 3SCMD 3FFCA 3HI5H 1GRWA 3QXAB 4DKDC 4P3DB 4KMTH 1R3JA 1EUTA 1YNKH 1Q94A 2V9TA 3D85D 4GSDL 4RMQA 3GO1L 1AGFB 3WO3B 5JDJA 4GG8A 3BH8B 4GAGH 1UM4L 2C3XA 4JFEE 2YUXA 3W39B 4QRRD 1DP0A 4XNMA 5DHVH 2LE9A 3GMNB 3Q1SH 2FJHB 2XTJD 4HUNB 4WJ5B 4HH9B 3FN0H 1F11B 2HWZL 3DWTA 1K4CB 5GGSB 4F37F 4OI7A 3MRQA 1PYWB 4C4KT 3HRPA 4HUKB 1XR8A 2G9HA 3MBXL 3BD3A 4BJLA 4NNXB 3MNZA 4JGUA 4HJ0C 3DBXB 3L95A 3S5LA 3H9HB 1V5JA 5I8KH 4LSDA 3P4OB 3QUYA 3NH7L 2KPNA 4D0CA 1JPSH 1NBZA 3DI2B 4PRID 4BH7B 5EIIA 4OUUB 3CK0L 1F4YH 1UYWH 3BKJH 3NIDF 4WW1A 4X7EC 2Z93A 3O3DA 1U8KA 1NUDA 5I0ZA 1ETZA 5IHLB 4JEGB 4APQD 3GSWB 5E6IC 1LD9B 1DQDH 1KFAH 4MLSA 4FQLL 2EEDA 4XC3L 2YK1H 3CX2A 5IF0B 2JJUA 4BZ2L 1NSNL 3G5VA 3DV4A 1C08B 5IBLD 4PRHA 5J7CC 3C6LC 3G04B 4GQ9L 4L9DA 3LIZH 2HH0H 3PWPE 4Y19E 3QDAA 4UILH 2CRZA 4RQQB 1ZA3B 3LRGA 5IMMB 1ZANH 4PJAE 4LEOB 1OSZA 1G9NC 4QWWD 1ZLSL 1KTDB 1OHQA 5I71B 3WHE0 1K2DA 3ES6B 4KRNA 3UAJD 3QWRD 4XCNB 4DN4L 4PJXB 5C0FA 1DQQA 4X6DE 4CNIB 1F6FB 2AXJA 2MNUA 4MQ7A 2AXFA 3TIEA 4Y16A 4PRDA 1RZGA 2W9LA 2BSRA 2X4SA 4G7VL 2NY0B 3QHTC 5IB2A 3QO0B 1REIA 4H8WL 3ZKXC 5EU4A 2YPVL 4FA8A 1CQYA 3RPIA 4JE4B 3BPCB 5HVGB 2PXYA 5C0IA 2CDGB 4HFWB 4Y1AD 2XQBL 3P9WB 4OV5B 1XIWD 3M1BA 3T2NH 3RZCD 3SDAA 3MRLA 4NQDE 3SJVE 5C6TL 3CLFL 3I2CL 4G6KL 3DI3B 3EAKA 4ORGB 3HC4L 1MAML 3M17B 4J23A 1T5WB 4HX1B 1AQKH 1GHFH 4F9PC 5C0RH 4NQVB 3SKMA 2QHRL 3QDJE 5CGMA 2VABB 1OAZH 3OBAA 1IAII 1EX0A 1P7KA 4OD3L 3PWPD 3W9EA 4M1DH 2OL3H 3B9KB 1QYGL 1VADA 3H3BC 2EZ0C 3LSOA 3MV8E 4I2XB 5I75B 4MQSB 3UYPA 3H7BA 2YUWA 2NX5A 3B9AA 4NFBA 3B2VL 4PB9L 3UJIL 1DDHA 1FVCA 3QEQB 3RVXC 1QPPA 4NJAH 1MVFA 3NGBC 4O2CA 4OZGA 5LQBL 4U1NB 4JHWH 3ARBD 2F58H 5FYLD 2A6JB 3BISA 3FHAA 1S7TB 1NLBL 3RGHA 4KPHL 1J0JA 4PJ5B 2FX8L 1VCAA 5ALCL 5I1IH 2GTZA 3FB8A 4IMKA 5L0QC 4XVJL 2DLGA 3ZZ1A 3QRFM 4H1LB 3TA3A 1U2HA 3MUGB 1NCCH 1U3HB 4HEME 4JPWL 4Z6AT 2FBJH 3SDDC 4PJ9A 2GK0A 2GSIA 1AKJB 4X7SL 1YEIL 2X4OB 2J6EL 4Y8AA 1I4FB 1LWRA 2W0FB 4NC1E 3RL1B 4DKFL 1HQRB 5J57B 5EULV 4NHUA 5EC1A 1HYSD 3QCUL 3EUUA 1WCBA 3LKOA 2DMKA 5DA0B 1B9ZA 1I7TB 4GAJH 1YMME 2NPLX 5CEZH 2G60L 3KYKL 1HOCA 2A74A 5ACZA 5FM8A 3S37H 4GRMA 4NQEB 2NXYC 1HHJA 4FZEL 4XVUC 1JN6A 1JHLH 2AJXL 1UACL 4FQJL 1T0MB 1CFVL 4GS7C 2X4PB 2YD5A 4YEEA 1A7NH 4K7PY 3BEVB 1Y6MR 5E2UH 1LO5A 3EYVB 4OM1L 4QXGL 4HV8B 1KG0A 4JG1L 4F3FA 2D7TL 2DWDA 3VA6A 3MR9A 1RJZA 3HR6A 3GSOB 4XMKH 1BGXH 4L29B 1AI1L 4Q6IA 3T4AA 5DVOA 4LVNC 4QEGA 1FL3B 3DGGB 3KPRE 1FORH 1IAIM 1AXSA 2YRZA 2A9NL 1YN7A 4EN3C 1XMWA 1OY3B 5EOCH 5MEOB 5F88B 1OM3H 3MJGX 1BFOB 2NY7L 1MCIA 2VDPL 2BC4B 4HGMA 4PJEA 4NJ9H 2ZSWB 1J8KA 5T1DL 5TF1L 4HIJB 2B2XH 5F9DC 3WFBH 1EMTL 5EN2B 2ZCKH 4M9PA 1H5BB 2GJ6B 1KOAA 2JIXB 2NY6C 3BVNB 4QTHB 4IIQA 1J10A 3DHMA 1DBKL 4WVRA 3K46A 3K4ZA 3BDYL 2IAMB 1HEZB 2R2HA 5MENE 2XPGA 4EQ2A 5TE7L 1YQVH 1GYAA 4PJFA 4O4YL 2QQKL 3D48R 1HN1A 3N1MC 4OM0L 5C3LD 4I0PB 4IOFD 2DQUH 1CI5A 3HE7C 1TENA 1CDGA 1F90L 3LEYH 4MMZC 1C5BL 4RISH 3WBDA 1TPXC 4PG2C 3PWVB 3NBNA 3KPPB 4XBEL 5IQ9A 2RGSA 3B3IA 5IJKA 5I1HH 4H25B 1QFPA 3MROA 2C26A 2NY0D 3I6LE 3TC9A 1QBLH 4XAWH 5DRXA 2VE6B 3DURA 4RNRB 5IOPA 2EH8L 3S88L 3MV11 2PR4L 2Y07H 5DZOA 2Y25A 1IEHA 4UTBL 1FAIL 1D9KB 2UZIH 5SX5H 1ADQL 4AL8L 3LH2H 5L2KB 2CO7B 2B5IB 2P8LB 4X5XA 4X4XA 4K3JL 3VI4E 1WZLA 5IVZB 3FO1B 3WNNA 3SDXE 1VFUA 3MCLL 1MFCH 2A77H 2UWEB 5DJ0A 3D3VE 5I1EH 4RMVA 3OXSB 4QTIL 3T77B 2Q76A 5IFJB 1RI8A 5ELIA 4YBLB 2H8PA 4QHNA 3CXHK 4P4RA 3B9KD 5E8PA 5HDOA 1C12B 4KGJA 5DVNA 4C57C 1MWAA 5JPNA 1M71A 3CDFA 1MCWW 1PG7L 2PYEA 4JO3L 1SBSL 3KPLA 4OGYH 1A7QL 4NDMA 3QEQD 4XPBL 1AO7B 2XZZA 1D5IH 4P5TA 1XF1A 5C8JB 4JR9L 2OZ4A 4QGTA 4JZJC 4ZUTA 3QDGA 5FHBH 1F4WH 2DOCA 4TUJA 1CTOA 2BP3A 5FYJL 3VXPA 4LAQL 4PJ5D 1NAMH 2Q7YA 1HK6A 4LHUG 4ZUWA 1WICA 4RFOL 3V0VB 2OR7A 4H5SA 3LKQA 4AENA 1GGCH 4RZCB 4ZTOL 5K33A 1J5OH 4P5MA 2ARJB 3BP7A 2FGWH 1X5XA 3WHE1 4HS3B 1U3HD 3FJTA 3P0YH 3STZB 3MC0A 1AKJD 4LLDA 1T0NB 4MJ6A 4PJIA 4U7MA 4MXWH 4YDVB 2XZAL 2IG2H 1MCWM 3GBNH 5TE4H 1FO0B 4IRSC 5C0ND 2VWEC 4Z8FL 2Z31B 5LGHL 3O4LA 3MLSL 1DANT 1NDGA 1LMKA 2O5YH 3EYOB 1DVFB 3SKJH 1QBMH 1KIRA 3RI5F 2XNAB 1J8HB 4MB4A 5F7YC 3A6BL 1MCLA 2VLRA 1TQCC 2X4RA 2Y36H 4DZBB 1VFMA 1T1YA 4I0CC 1QSEE 4NQED 1KBGH 4F7MB 1HHKA 1BVLA 1RUQH 1N0LA 4PR5A 5GISH 4LPCA 4AK1A 1FQ9C 3W11C 4KI5D 4U7SA 2ZSVA 5CUSH 2AJYH 5ENWB 1YEJH 3P30H 3RWHA 4OGZA 5E1AA 1YY8A 2ATKB 3D39B 1AGEA 5HYJA 3S96A 1RK1B 1DCLA 3RJDA 1S7UB 4Z7WB 2ORBL 1VB9A 4YK4B 3U4AA 3WHXB 5FB8A 5EWIH 2GJZA 1S7WB 1Q72H 5HHQB 4UUJA 4BH8B 2IH1B 4LASL 2E6QA 3WL9A 4MNGE 4KK5D 5I1LA 3LQMA 1KCSH 3X3GH 1JPST 3EDJA 2R1YB 3JV5A 3C08H 2JELL 3FMGH 5L88L 4KK9C 5IVXA 5E1HB 4PJ8A 2WZPD 3O2VH 2R1WB 3QWQB 1IZJA 3MQIA 1GOHA 1IM3B 5HI4D 4FTVA 3HZMB 4P5KA 4PRBB 2GJ6D 1UQSB 2JIXD 3BW9B 1BBDH 3WFEH 4YHNB 4CDGC 1C5DA 5J3HC 2IAMD 4M8VA 3C8KA 1CDIA 5AZ2L 3GJEB 2GCYA 3QRGH 4MA1C 3MV9B 4KVNH 5IHBA 1AR2A 1X7QA 4P4KB 1SJHA 4M93B 3HUJE 2X7LA 2GAZA 4I0PD 2J8UF 3SPVB 3C5ZC 4NN5C 2EH7H 3UO1L 3GO1H 4PLNC 3QFJB 2CDEA 4K94L 3RPKA 1B0GA 3RWFA 2PETA 5BJTB 1S7XB 1IQWL 1DR9A 3P9MB 1UM4H 1ZHNB 2AJZA 2W1NA 4J1UA 5EOCJ 3OB0K 2VERN 1P4BL 3K4AA 2QHLA 5EZLA 2W9DH 1CFNB 2P7TB 2DLFL 1QSVA 3I50H 4N0CC 3V0WH 1T89A 3IKCB 5A3IC 1D9KD 2HWZH 4JDZA 1EHLL 15C8L 5L2KD 3PHQA 4HFUL 1FBIL 2Q86A 3MBXH 3HNTH 4N0FB 4KZEH 2OS7A 5D7JC 3AB0B 4HZLB 4I3SH 3I3EA 4Y16C 5EB9A 4EDXA 5D7KD 4Z7UA 3S4SB 4Z7NF 2IPKA 1J11A 1C16B 3C9NA 2XFXA 2ZUQC 3EDEA 4KJWC 3NH7H 1VSCA 4W4NA 3OKMB 1AR1C 4XXDB 2OCFD 2ZOKA 3QUZB 2YD6A 1BX2A 1BVZA 5D6CA 4A2MA 3BIKB 3AREB 2P5EE 4GO6B 3T1WA 1PFCA 3EO0A 5TQ0L 4HQQL 4P0DA 4FQLH 4F8TA 3DVNA 3VFRA 3HE6A 4Y2DC 1S7RB 3S35H 3N9GL 3DVFA 1NSNH 4F80A 2IBZY 3EFDL 1WIPA 3HC0A 3NCFB 4AY0A 2PTTA 2FJGA 1AO7D 3FOMB 3CLEL 5IW6A 4ODWA 4DW2L 3OKKA 2Y9RT 5E8EA 3AGVA 2CPCA 3EW3B 2AJVH 4OLUL 2VISA 1H3XA 2LU4A 4GW1B 4QHKJ 3REWB 2ZP0T 1X5AA 3TPUA 3VGHA 4R2GB 1ZLSH 2ZOLB 3ULUF 4M61B 1A22B 1E4JA 2IC2A 1NGYA 3CCHA 3U4BL 4DQOL 3NFPA 5EU7E 3RWJB 2W92A 3S9DB 1NBYA 4OIAA 2HLAA 3VFVA 3CFJB 3WD5H 5IB3A 3VWKC 5A16A 5C0CA 4JZOB 2KL6A 2FLRT 4DGIL 3ARGC 1AD9A 3QQ4A 3LDBB 4G7VH 3HAEH 1YECH 3QEUB 4WFFE 5D7IB 3MRDB 1YPZE 2YPVH 3KLAA 2H32A 3ULVL 4XNUH 1DUYA 1FZOB 2M1KA 2P45B 1DVFD 3OGCB 5DD5H 3O3AA 2VC2H 1J8HD 4GUPA 4AIZA 1MHHB 4OLVL 4OZHE 1ZVSB 1W0WB 1D5XB 4ODHL 3B5TA 4TUOB 4CRPA 4G6KH 4HC1L 4ONOA 4FXGB 3HC4H 3STLA 3HNVH 3V5DB 4OD1L 4U4BA 8CGTA 3P11L 1T7YA 3WDIA 1CFQB 4JKPL 4TSAH 2MCPL 3WEXB 2ITCB 2M8XA 1BQLH 3QCVL 3D39D 4H88H 1I1AC 2CLVA 4OD3H 2V7HA 3M07A 1HIMH 2IMNA 2JJSA 1F4HA 4NO5B 1FFPA 5HYFA 4X6BA 3QHZL 3WKML 4RGNC 3G6AB 4ZOAA 3AM8C 1XGUA 3UXFA 3QIUC 1R3IH 5FHAL 5GS2D 1KLGB 5GSVA 1MJJB 4PGDA 1EFXB 4PB9H 1CFTA 5IJVA 3T8XA 3PWUB 1RZJL 1F3RB 4JO4L 2WWKO 3OAZH 1RZ8A 2IEPA 3RVWC 4Y5VB 4LAJH 1PZ5B 3RNKB 2ADJB 2DQJH 2J5LB 1QHOA 2XT1B 2CMRL 3UZEA 4ZFZA 4HD9A 1NFKA 3U2SB 2VYRE 2FX8H 5ALCH 2RQ8A 5DEGA 3J8F7 1UWEL 4XNYL 3JXAA 3DRTA 4U1JA 5EUKA 4XVJH 4KUZH 1FG2B 1CQKA 5KSUB 3MV9D 4GMTL 4HDIB 1D3CA 3P2TA 4JPWH 4P4KD 3U1SL 4MS8C 1SVCP 1YEIH 2MQCA 4PRPE 3OB8A 4R9HA 1FL5B 1WBXB 3LQZA 4JKLA 2WIMA 4DKFH 3F7VA 3U7WL 3GHBH 4P23A 3MOBL 1AFVH 2VKWA 3MJ9L 2BZDA 2WUCL 1D6EB 3JVGA 5BZDA 4QLRA 5EC2B 3KJ4B 1NL0L 4JPVL 1MRFL 3AMLA 5D5MB 4UV7L 1M7IA 5JMOC 5EBLA 3K1DA 3LS4L 2IBBA 4Q9QH 1CFVH 3NPSB 3QDHA 1NBQA 4RDQG 5BOPA 4Y4FC 3FAXA 3RBSA 4Y5XA 5SX4H 1OTSC 5E7FA 4X6CA 1WFNA 3FRUB 2X4TB 2D7TH 1JL8A 2CUHA 1OP9A 1OQXA 2BXYA 4HS6B 1L0XA 3DSFL 1HSBA 4GRLB 5IM7A 1IEAB 4FQ2L 5DDHB 3QUZD 3VFPB 1VKXB 2C5DC 4IRJC 2ENSA 4HWBH 3MGAA 4JG0H 4U1SB 2W07A 3VXRE 4NPYA 4KDWA 4N8VB 4UOJA 4KZDH 3GJFH 5FYJU 1CDHA 5DEFB 2VDPH 3QQ3B 3NN8A 1AE6L 1AP2B 1HHIA 1MHEB 3KWWB 4FFZL 4PP2B 4KKBD 5T1DH 3C09B 1Q9LA 2F53A 1F5WA 5HHXH 3AY4C 4JANA 5E9DE 3U46B 2ZNWA 1DBKH 4NT6B 3VCLA 1IC7L 3BDYH 4KH2A 5CBEA 4X7TA 4Y4KA 5DJXA 4KUCD 3EGSA 4R2GD 5MEPB 2A6DB 3RL2B 4BFBD 4LVOC 2X2YA 4ZAKA 4OM0H 1NC2B 1GZPB 3O9WA 4OBSA 3L3DA 3EOYG 5B21A 1C5BH 2A1WL 1UXSA 3MOAL 5EU3B 1KACB 4KKCC 5EU6A 4PG9B 1OOAA 3DPBA 3MPCA 4U1LA 5J06A 4C83B 2YD1A 2XRAL 1T7XA 4MXQD 3D69A 1CE1H 4HPYL 4ERSH 1MREL 1CGTA 2PR4H 5JUEH 4WEBL 3TJHC 3VMOA 1FAIH 1RJYA 4L1HA 4AL8H 1ADQH 3G5ZB 1FN4B 5D1QA 1XGRB 5A2KH 2FHCA 1FV1A 5AWNH 1J1OL 4KXZH 5EFIA 4I77H 3C6SB 5HHNB 1BJ8A 2JCCB 1P7QA 3O8XC 3SGJA 3MCLH 1KNOB 5FGCB 1XF5B 5F8QC 4BA8A 3SE9L 1X4YA 2VN4A 5ANMA 1ND0B 2BHUA 5EOQL 4U3HA 1UM5H 1U6AL 4YZFF 3INUH 4NRZB 2KQMA 1CK0L 1DTUA 2C3VB 2O5ZL 1IARB 2DB8A 4TRPL 1KCKA 4NRXA 1ITBB 2R15A 3ARPA 4WTWA 5FF6B 5F7LB 3RWIB 3V7AG 4U6VH 4LRNH 3PDOB 1MLCB 3VFUA 2I9TA 2AQ1A 3RIAK 1PG7H 1HNFA 1SBSH 1ZTXH 1FGNH 1EFXD 5GRUH 1FIEA 1ES0B 4YFLI 1RIVH 5FYJE 5MERA 1A7QH 3IDGA 4ESKA 4XPBH 3H9YA 4R4BB 4Y88A 3UMTA 3LRHA 2X4QA 3P9LB 5T5FL 2NW2B 3TIDA 3BD5A 3U0TB 4BQ6A 2P8PB 1NJ9A 2PW2A 3NFSL 4LAQH 3PHSA 4JKKA 1CICA 3MYZA 3MRPB 1P2CA 5GSRB 2MKWA 3BYTA 3TVMC 1RZIB 3THMH 2FRGP 5C0GB 3CSBA 3WIHL 5T1LA 5E5MB 2B1AL 5C0DA 2DM3A 2FX7L 1H15A 2HG5B 4HWZA 1MRDL 4S2SB 4U0RC 1XF2B 3LRSB 3H2WA 1WQVT 2XZAH 4ZPVA 5C09E 2Z0BA 2AQ2A 3WMSA 3T0EA 4Z8FH 2C3HA 2FEEL 4HKZB 3BZEA 3ZKMD 3ZDZF 1KB5A 3O2DA 3B43A 4ELMA 4EVNB 4WW2B 3ALXA 1BZ9A 3SQOL 5F1NB 2SEBA 1NH6A 5IHUL 5J4MA 1CDUA 3V5KA 3E3QE 4Z76A 2A9ML 5HTSA 5I19L 1VFBA 3SDCA 1MLBB 8FABB 3MRNA 1VGKA 5FYJD 1EA9C 5ISZA 5T3ZL 5HXMA 5KZCB 3LKRA 5FDWA 3BRGC 3IRPX 1AY1L 4LCUA 3U30B 2MSPA 3ZKNC 3I75B 2Y06L 2XY1A 1Q9OB 3WJLC 4EI5C 1OPGL 4R7DA 2BOBB 3WUWB 4GRLD 2VUYA 5DR5L 3C6LB 2Z35A 4LASH 1ZS8A 2V7NB 3T65A 2YN5A 5L6YL 1OL0A 2HVKB 5KW9L 3ZSTA 3FT4A 1MNUH 2J3SA 1CN4A 1FNGB 3L3OA 3CZJA 2KZWA 2NY2B 3GMQB 5BV7H 5EZIL 4LSUL 1G0XA 4NQXB 2V5TA 3BIAX 5K9JL 1ZK9A 1OAQL 2D0GA 3EYFB 2V2TA 1BFTA 25C8L 1DN0A 4LSSL 4NO0A 4ODTL 5CZKA 2OJEA 4PJCA 1H3UA 4UOW0 2W0KA 2NYYC 4JFFA 5AZ2H 4PJBF 4HJJL 3NIDE 1JZ2A 2J4WH 1CXEA 3JWDC 1NC2D 1F8TH 4TQEL 5EZJA 4ZNEE 1NLDL 3GSQB 4X6FB 5CJ5A 5C08A 3GM0A 4XRCA 4KY1H 1F2QA 5IMLA 1DQJB 2NXZC 3UO1H 5JPMA 5JOFB 3TH3T 1IQWH 1EEZA 4QYOA 4B0MM 1CDCA 2A2QT 1OLLA 2HT3C 1P4BH 4LSRH 4JRXE 3R8QA 5GJTH 4YWGL 5GZOD 3U7YH 5D93B 5AEAA 2UYLB 2GK2A 4MNQA 2OK0L 5JNYB 1PLGL 4Z7VB 1OAKL 3UTTA 3QI9B 1T03L 3VGDA 15C8H 2ICWB 1FBIH 1BMGA 4QHMB 3KG5A 5BO1H 1NFDB 4PD4J 1YY9D 3ARDA 1JHTB 3DETD 4KROB 5DFTA 3QXDA 4WENB 4XP1L 3ZYOA 4OF8A 2HT4C 2FHBA 4BKLA 5JHDA 3ULUL 2VXSH 1N26A 2R1XB 1N6UA 4MDIB 5F97E 4JHBA 5AG8A 2FATH 3NACL 1S9XB 2IPUG 5DRWB 3QA3A 2YHGA 4UDUA 4F15C 3UYRH 3MFFB 4IOIB 5DK3A 3BSZH 3VFOB 1AHWA 2ICEA 5HD8D 2A6KA 1KTKE 4OI8A 3TBWB 1NCUA 2FR4B 4P2OA 4NZRL 3X11A 5I73B 2O26U 2AK4B 5F96L 1UA6H 2CIIA 3MYJA 3VFWB 3JV6B 3EFDH 5L0QB 5GRVK 4XCFL 3F7QA 4HG4K 1EXUB 1WZMA 3CLEH 3F12B 2R2CA 3ARFB 3R06B 5D1ZC 4DW2H 1KB9J 3MBEC 5IB1B 4EJ1C 1DL7L 4OLUH 2EDQA 2PCPA 3P73A 1RUKH 2L7UA 5FOJA 4KHTL 3ZTJH 5DJ6A 4OFIA 2LQRA 1T66D 1QO3B 2JJVA 1JNNL 4NN6B 4EQ3A 2I24N 2ATPA 4JLRB 1Y18B 3LAFA 3QPXL 1LP9B 2BXZA 1EK3A 3TN0B 3PGDA 3EOTH 4JFEA 5D2NE 1JZ4A 3ULVE 2Y7QA 2GFBB 1OF2B 2J1KA 3T2OA 1IFHL 1NAKL 3BGMB 4GG6B 3QZWG 1QRNB 3QUKA 1SYSA 1SHMA 2MPAH 3VDAA 4NGHL 4D9RE 1S5IL 1O7VA 3N1FC 2AV1B 4MYWB 4Z95L 1OARL 5FYLH 1MOEA 1GGUA 2CIKA 5C2BH 3TT3L 1A14L 1BECA 4OLVH 4IJ3C 3K2UH 5DMGD 4HMDA 4R7NA 5HYSB 1OW0C 1QLFB 2H3NB 1A6ZB 1QA9A 4QRTA 5I18L 1G6RL 3JTSB 4RGMB 2V5MA 2LAGB 2OJZH 3CSYB 3QQNA 3P11H 2HAZA 4M3JA 5C0BB 1A4JB 4J3OC 5FA4A 1HH6A 2IALB 5I9QC 3OPZL 3WNMA 1R5IB 2D7PA 1TTFA 1VFAA 2FNBA 4LLQA 5JOEA 5KZCD 2YEZB 5CP3A 2VL5A 1UZ6F 3KPSE 1MHPL 4ORZC 1M7DB 1NC4B 3BFOA 1X3DA 1Q0YH 1PG7W 4PJGF 4G6FB 3TH2T 3F58H 1OWRM 3WKMH 4LF3A 4D9QE 4NM4H 2Q20A 1MUJA 1VACA 3L3GB 3OKLA 5I1GH 3V2AR 1RZFL 4ZFGL 4ZS6C 4FQQA 5HI3C 5FM5M 3EJZD 3O6FC 4CDHA 3DO7A 1RZJH 3PWPA 3ISWA 4RMWA 3GMRB 4Y19A 3C5SB 1JPFA 3PXJA 5C70A 3ULVD 4I18B 1J0ZA 4OBRA 4PJAA 4N0RA 1HWHB 2NY2D 4N9GA 3O11A 4YHMH 1J9CT 1I8LA 1KXQE 4F7PB 1F4XL 3MRCA 2COQA 1ACYL 5DJZB 1TVBB 2APWA 4KKNA 2CO6B 4X6DA 1A4KB 2NZIA 5FYKL 3GHEL 3VWJD 4TULH 3IJHA 2AEIT 3S36L 2ILLA 3HMXL 4GMTH 5GS0L 1NCWH 4MX7A 4CL7A 5L8LB 1TZHB 5EPMA 2EDHA 2H6PA 5DJAA 5T1KB 3ROOB 3TNNB 5L8JB 2MMXA 5CINL 5A2LH 4KHXH 4DZ8A 4R0LB 2YD4A 5E99H 1NDMA 4DKAA 5DGRA 5CCKL 3IDIA 3LEXB 3MOBH 4M6OL 3CFDA 2NQCA 2YWYA 1S7SB 4YHYC 4NQDA 3SJVA 3KPMA 1FE8L 3NZ8A 2DMCA 3CUPB 3MMEA 5HGHB 1A6TA 5ESVA 4QOKB 4UV7H 4KQ4L 3WLWC 1D5BB 3W2DH 1LO0L 1VDGA 3QDJA 3QI9D 3LS4H 1EV2E 3PQYE 4X7CC 4TNVK 3VXNB 4AM0A 4O02H 5IROA 1CZ8L 3CZFA 1BLNA 4K8RL 2GTWB 4KROD 2QEJA 4QRSB 4BQ9A 4XHJC 4ZXBA 3MV8A 1K8DA 2ZNXA 1GAFH 2QSTA 4X6EA 2XXMB 4W68A 4K07A 4HKBA 3DSFH 2R29H 2B39A 4FQ2H 3TO4C 3UJTL 3ZDXF 3NIFF 5EO0A 1KENH 5CKAA 3MRBB 1JPTH 3VD9A 3T4YB 1XH3B 4PY8I 4WU5A 2R23B 5EUOF 4BUHA 3IFLH 2EDRA 1FHGA 4PLJD 1IQDA 3HNSL 3T1FB 5IV2B 4WHTB 1FFNA 5B3JF 5J1AB 1R5WB 4TSCL 1AE6H 2EXYD 5E8OA 1KJ2B 2HJKA 2AK4D 4FFZH 2C4FU 3CSGA 1PQZB 3N85L 4KJQC 4KK6D 5MP6L 5F89B 4C56B 4NCC1 2CK2A 1SYVB 1QRKA 1J18A 3GMLA 4YAQA 4M5YH 3RKPA 3ARFD 2IFGA 1G7PA 4K9EL 3GK8L 2VDRH 1IC7H 3NPZB 4JHAH 1PKQB 2YPLB 3E6HB 4IRSB 2VH5L 4Y4HA 5B4MC 2BCKB 1K9TA 3CH1A 5IBTL 4RWYL 1U93B 2AXGA 2CLRA 1SJEA 2D4FA 2YR3A 5SWSE 6FABL 5I1DB 5FO9A 5EBWA 1EGJH 5JLZB 4C54A 4OQTH 3PE9A 1OB1A 4YC2C 3ZTJG 1YN6A 3DXAE 1TQCB 3TN0D 5DK2A 4M7JH 3SKOB 5E5UB 1KCVL 1YMMA 3V0AC 5TDOA 1ZAGA 3FFCB 3MOAH 2JE8A 2YA2A 4MAYA 3NCJL 4I4WA 1R3JB 3B4NA 1Q94B 1QRND 2XRAH 2BHZA 4DAGH 1WFOA 1MREH 4LIQL 1GPOH 1KPVA 4GG8B 3T3PF 1CXLA 2UUDK 5FDYA 5AZEL 5CILL 2EYRA 5DHYA 4XNMB 3A6CL 2BRRH 4JO1L 2D9CA 4OCRL 2NY1B 5E6YA 3LQAH 2EKJA 3GKWH 2GSGA 4H1LH 3MRQB 3T0EC 1FNEA 1II4E 3SE9H 5TDPA 3VXME 5C0BD 4JB9H 1UEMA 1XR8B 2G9HB 2Z92A 3A67L 3KPRA 3RKDD 3MNZB 4M7LH 1WLHA 1IGCH 2HN7A 3L95B 3S5LB 2WLYA 1NC4D 2XZCH 1MIEH 1XGQA 2O5ZH 5BVPL 4G6FD 4BUGA 3QUYB 3S3JA 1SY6L 3SO3C 4D0CB 5LWYH 4XPTL 1TQBC 1NBZB 4J4PC 5EIIB 3BQUC 4WW1B 2Z93B 4OLYL 4N0UE 1A9EA 1U8KB 3O3DB 4G6AD 2GEEA 2FH6A 4GBXC 4OLWH 1ETZB 5D7SL 3RY4A 4WUKL 1PY4A 5J89A 3LOWA 1GCFA 4OUOA 4DVRH 3WKNA 1MQ8A 1V7NH 5MENA 4MQXD 3QIBC 4JFYA 1FLTX 4B50A 1DJSA 3G5VB 1JVKA 3DV4B 4NNYA 4EOWL 5KAQG 3MLXH 4W4OC 2VLJE 4PRHB 2XY2A 2VLME 4PGEA 2WAHA 2XG4A 4ZFOL 2RCSH 1Y6KR 2E3VA 4L4JA 4PUBL 2W65A 3WIHH 4CVWA 1FGVL 1FFOA 2B1AH 1OSZB 3OB0H 1NGQH 4A6YA 1NQBA 2FX7H 1RURL 5FA3A 3FQWA 5EBMA 1K2DB 1SEBA 5T1KD 5C0FB 5EOTA 5DWUL 1DQQB 3ELAT 12E8L 1I9IH 4BFGA 2HYMA 5J56B 2BHYA 3WNLA 4MQ7B 4ZMAT 2AXFB 3TIEB 1BOYA 4JDTL 4Y16B 1G0DA 4PRDB 1RZGB 2BSRB 2X4SB 4S1RL 3SQOH 3C5JA 3CXDH 3MXVL 5IB2B 2DIBA 2IBGA 2W9EH 3P4MA 3SDXA 5EU4B 5T3ZE 5JQ6L 5EZOH 3RPIB 3D3VA 4QOKD 4CMMA 4WNQA 2K9UA 1M1SA 2PXYB 5C0IB 2F19H 1EBAA 3M1BB 1MIML 1AC0A 3RY6A 3SDAB 4D2NA 3EHBD 3MRLB 3GNMH 5GZNC 2J8UE 2XIDA 3QG7L 2DJUA 5DJDA 5DF0A 1HINL 3SCMC 3IDJA 4TOYL 3WDJA 3GI8H 3SKMB 1R3LA 2V2WA 3QCTH 4Z0BH 4NKDA 3GZKA 1KELH 5JW4R 5DR5H 5DQ9A 4EZMA 1P7KB 5GS1C 3W9EB 3DTXA 5GRJL 1I9EA 1RIUL 1K4DA 3IVKA 1VADB 2VXTH 4JHZA 3CNKA 4Z78A 3LSOB 1NAMA 5HDQL 2AERT 4ETQA 1J1PH 4U6YA 2E9IA 3QB7C 1CTNA 5KW9H 3JWOH 1EO5A 4RGOL 3H7BB 3UTOA 2NX5B 2N7AA 4JFZL 3RY5A 3NA9L 2XTJC 3SBWA 1DDHB 1FVCB 4M62L 1KEMH 3EO9L 4DGYH 2ZCHL 4Z7NE 3IDXL 3RDTA 1DBJL 5BV7C 4O2CB 4OZGB 4ODTH 3CXHJ 2CQVA 4HJJH 5LAXA 2YPLD 1GVIA 4XP9H 2VQTA 5IGXH 2GTZB 2ZCLL 3FB8B 3DO3A 5D72L 4TQEH 5E2TL 3TA3B 2CRYA 1DSFL 4PJ9B 2GK0B 2GSIB 3NOIA 4EBQL 3FFCD 5F71A 2BOCA 1QSEA 4Y5YC 1IGYA 1J12A 1CE6A 4LGPB 3D9AL 4XP5H 5JW4M 1U9KA 3B8YA 4CU8A 4NHUB 5EC1B 5IBLC 2F54E 1CGYA 2LVCA 1WCBB 1PLGH 3LKOB 2PN5A 3TNMA 4U6XA 1HOCB 2A74B 5ACZB 3ULUE 4MWFA 1BOGA 3UP1A 4GRMB 4NZUL 3V52H 2NY1D 1HHJB 4RGNB 1JN6B 3IDUA 3RWDA 5EA0H 3WSQH 4QWWC 3ESVF 1K85A 3UAJC 3MV01 1LO5B 4MNGA 3DIFA 1J88A 1KG0B 3NACH 4Q6YA 2EDDA 4WWID 4H1LG 2EE9A 4JFXA 4F3FB 3QUYD 1EBPA 2DWDB 3MR9B 1RJZB 2V2XA 4Q6IB 4YDIL 3T4AB 43C9A 1JGDA 1VERA 1AXSB 4NZRH 2PNDA 4QXTA 1IKFH 2JJWA 4X4ME 1WBYA 1VGEL 1YN7B 4OF5A 1IGTA 1WT5A 4PJ7F 4XCFH 5FYKU 5I8EA 5BMFL 3IDMA 4YHKL 1F97A 3W0WE 5IMOA 1XIWC 3RZCC 1WFTA 3MLZH 3TJEL 4PJEB 2VIRA 4YPGA 2QQLH 4KHTH 5FGSA 4PRHD 4YE4L 3HUJA 5HHVH 5BOZG 4FNLL 3RWEA 2C1OA 4IIQB 1AGCA 3V6OE 3NABL 1RHFA 3QPXH 4K3DH 3WCYA 3B9EA 2R2HB 4S11A 2XPGB 3WUZA 3U48A 3DJ9A 2EDNA 4PJFB 1E6OL 3STBA 4KRPB 2QQNL 3HI1A 1I1YA 1ZT1A 3IKKA 3Q6GL 4MAUH 1IFHH 5DMJB 3WO4B 2DBLL 2DRUA 1G9NL 3EDKA 4N1CA 3VXUE 1QSFE 1GGIH 3P0VH 1CXFA 3QQ9D 5IQ9B 3B3IB 3MROB 5I30L 4XPHL 5DRXB 4J8RA 3X17A 3DURB 5IOPB 3ARBC 1ACZA 4P2YA 1MJ8L 3ZE1F 3LPFA 2VDLL 3IF1A 3O3EA 2PXYD 1CFSA 4DKEL 4X5XB 3T04D 4X4XB 3SDAD 3QIWD 2P5EA 3BRDA 3MODL 1INEH 1EZVY 5DJ0B 4XVTL 5ADOL 4OZIF 2Q76B 4RBPK 2PO6A 2Y6SD 4H26A 4R4FL 2H8PB 4QHNB 3EOBA 1X5YA 2P49B 4KKLD 1RZFH 5I1KL 4P4RB 1HYSC 3P3YA 4WTZG 5E8PB 5I15L 4GKSA 1DFBH 4GKOA 3JUZA 4HAGA 1MWAB 5C92A 3F65A 5JPNB 2R0WL 1M71B 2VO5A 2NX5D 2PYEB 5ALBL 3KPLB 3QO1A 2VL4A 1XCTA 1IC4L 4NDMB 1BWMA 5KS9F 1IMHC 1MAJA 4P5TB 3HAEA 1JTOA 4ZUTB 3QDGB 3HPLA 4TUJB 3EBAA 1I75A 2ZKHL 4J3XA 3S36H 1CGWA 2H1PH 3VXPB 5INDA 3HMXH 1W72H 1XT5A 2X9WA 5IUSA 2Q7YB 2L4OA 4PB0H 4WO4A 4XMLL 1P4LA 3MLVL 4ZUWB 4H5SB 3LKQB 4R26H 4AENB 2G5RA </