1KNOB

Crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT CNJ206
publication title Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 47
structure length 220
sequence length 220
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1995-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB01
1KGCD 4N8VA 3NCJH 5C09B 3K8KA 2CDEB 4OQTA 3QEUA 3L5HA 2I24N 1GVIA 2I9TB 1OF2A 4OUOA 3HR5A 2W9EL 4FOMA 2UVEA 1IQDB 2DBLL 3HLAA 5JW4R 4UINL 3TZVA 2DQCL 5F7FA 1L0QA 1IARB 1OSZB 3ARBD 4HIIB 3SDXA 1CI5A 1AO7A 1A9BA 4UI2A 4D9RD 5J57B 5CIPB 4YDLC 3P9MB 1X5HA 3QA3B 1CLZL 3BVNA 3WKNA 3WHE1 1BOGB 4A6YH 2YKLL 2H9GA 3CDGA 3P77A 3QG7L 3O41B 1A9EA 4WWKA 5C2UB 2VB5A 4I3SH 3SDDA 3WHXB 2X1OA 1J05B 2HN7B 1UKTA 5L88H 5IFAH 1FVCB 5HYSA 3IJHA 4G3YL 3PIQB 5IB4A 1CGXA 3CXDH 4Z78B 2H3NB 1S7RA 4JFDA 4JFXB 3WIHA 2Q7YA 2VAAB 4GRLB 4WI8A 1X9QA 3HNSL 2Y9RT 1YN6B 4M6OH 3QCVH 4IJ3B 4F7CB 4LLQA 2G60H 1KB5H 1N6QL 5HGAB 1R5VB 3MOBH 5EBWB 1AY1L 4F8TA 4MSWB 5F97E 3CU7A 4NSKB 3T0EB 1NBQA 1I7UA 2HFTA 3O6FA 2ICWB 2R39A 3UYPA 4N90D 3VFPB 4ZXBD 3D3VB 4NC1C 4ZNCD 3GK8H 3GMOB 5J3HC 1R0AH 3NFNA 4X8JB 4P2OD 4NUJB 5A3IC 2W65B 4JO2L 4XRCA 2N7AA 3QXUA 5ACZB 3WNNA 4PRHA 3BESR 1QSFA 2GTWA 5BVPL 5J06A 4WI2A 2E7LA 4LLYA 5IVOA 3PGDA 2APFA 1JUFB 5CEXB 5AAMA 4F8QA 4XPTH 3NIGE 3EFFA 3R8BB 3BUYA 2R1YB 5E6ZA 5E4IA 3CPLB 5C7XL 1XEDA 4X9FA 4P46B 3DGCR 4OIAA 5KS9E 3OB0K 3O11B 3IDNB 3P0VH 3DYMA 1K85A 3CFDA 4U3XA 3EYVA 3P2TA 2OJZL 3LEXA 3VDCA 2VR4A 3MBXL 4KAQH 1SVCP 1KIRA 4MB3A 5KTEH 1BMGA 3DXAD 4JPVL 5MEQA 4HPYH 3W5NA 1R3IL 3SGKC 1PG7L 4JZJC 3QB7C 2V7NB 2QQNH 4GAJL 1FGNL 2F54B 1YMHB 5CP3A 1FZMB 3CU1A 3HC4H 3PP4H 4K8RH 3B6SA 3QQ3B 3VXNB 1C5BL 3HUJF 4ZTPL 5EB9A 5KJRH 4GXUM 5D7SH 3GMMA 3TO4A 3DO7B 3UJIH 4U1IA 1M7IA 1B0RB 4OLEA 2WUCL 4KFZC 3DYPA 4RQQB 2WIMA 1T5XA 4O9HH 4QO1A 4JFFD 2DMBA 3T3PE 3CSPA 3MLTA 5E8OB 3FT3B 4KMTH 4JQIL 4U6YB 3VGFA 4HAGA 4NQCA 2BY0A 1I1FA 1A6ZA 3L3OB 4QYOB 4XX1E 4MCYB 1NLBL 3HG1B 5D5MF 2BVPB 3DSFL 4CVZA 4GQPH 4X6CE 1CDHA 1LK3H 4NZRH 4B7LA 1OQXA 1T20B 4F9PA 2YEZA 1YEFL 4QOKD 1WWAX 3EKCA 3QXTA 4LIQE 4TNWK 4QY8B 1F13A 2G75B 2DMCA 3V95A 2B7DT 4ELMB 1WBYA 2O61B 1F5WA 2N4IA 3ARYA 5FOJA 2AQ3A 2ZCHL 2I07A 5I1EH 3MNVB 5BRZE 3WEXB 1J8HE 2J8OA 4P59H 2V5TA 3T1FA 1JE6A 1GIGH 3DV4A 4JRYB 4LVNB 4PRIB 3RWFA 4WFHE 2NY0B 1KPVA 2EDOA 1T1WB 1GGIL 2MTPA 2ZZUT 4XP6L 4ZDHA 3ZKXC 3EO1B 3N0PB 2VDLL 1WZLA 2H41A 5JUEL 3UC0L 1I3GL 4XH2B 3WIIL 4MVBD 1WV7T 4CVXB 5J9PB 3QBTB 3U0WH 3KPOB 1NCDH 5ETUA 4J3WA 3T8XA 1H8OA 4UQ2B 1YMME 5F9DC 2WWKO 4HZLB 3MV7D 4GBXA 3RL2A 4AL8L 4Z76A 1N26A 5I75C 4UQ3B 3BX7C 3O2WL 5GGRY 3NIDF 2PETA 4Z0BH 2YRLA 3H9YA 4F37F 4KMQA 1IGCL 4RAUA 3PGFH 2VUYA 1MQKL 1EK3A 5IEKA 1JWUB 1OLLA 3GIZL 4ZFOL 1PYWB 2BRRL 5KVEL 1F4AA 4BH8A 2CXGA 2NCMA 1XF5A 4LLVA 3LN5B 4HKXB 1IGMH 2QKIB 4DN4L 5IV2B 5T33H 1RV6X 5GGSA 1UJTA 3I02B 4HUWA 4X6CB 3CVIH 1GZPA 5IHUH 4LSQH 1G6VK 3QRGL 3VWJC 4BKLB 4L8CA 2H26A 2VXTH 1WSST 3MODL 1O7VA 5BRZB 4OQTH 3HB3D 3OGOE 5DJXA 2FH8A 2R56L 4M5ZL 3TNNA 2FECL 4KVNL 4PJCB 1TDQA 3RUGB 3PQYB 1RZJH 4CU6A 3HS0A 3G9AB 2R1WA 1XIWB 3IJSA 4B0MM 3EO9H 4WUUD 3VXMD 1WTLA 3MJ7B 5HHQA 1OW0C 3MXWH 2WWKT 3SCMD 5DHYB 2DYPA 3EOTH 3KVQA 1RHFA 3ULUC 5SWZB 3D25A 1U36A 4RBPK 2C1OB 1MJUH 1KLUA 3CK0L 4FNLL 4JN1L 32C2B 1FG9C 1H3XA 5TQ2H 1DL7H 4P23D 4L9DA 1DQMH 1YMMB 1A7PH 1CF8L 4YE4H 2GSGA 1JPFA 3ZKMC 5HSFA 5I9QC 4NM4L 1U8MA 1UM4H 3PWVA 1KYOK 4L4TA 1TJIL 4XXDB 1WTGT 2PKDA 3AREC 3MLXH 3MNZA 4KROC 4LPXA 4RA3A 3PWUB 4ZUVB 2NYYC 4TOYH 5C92A 3K74B 1F2XK 2YSSA 3BKCH 4EI6A 4LNVA 1DQLH 4OLUL 4JE4B 3HR6A 4W4OC 2FBJL 1T0NB 3WIHH 1CU4H 3I75B 5K59F 2F5BH 1I8LC 3U9UB 4G9FE 2X41A 4NQVA 5F89B 5ALBH 3VA6A 1LEGA 4JG0H 1GSMA 1ZVSA 1ED3B 4OCSL 5E2UL 4PIRF 4R4ND 3GKWL 4KQ3L 4IDLA 3VI4F 5K33A 3KPTA 5TQ0H 3FJTA 1NAMA 2QJDA 3EGSA 3P0YH 1KIQB 1RUMH 1AKJB 3LMJH 2CLZA 4CJ1A 3MROA 1A3RH 4PJ7E 1CS6A 4A6YB 3OXSB 2YZ1A 4PG2C 2EDNA 3S5LA 3KYOB 2XZCL 3FQTB 1UACH 3KNBA 4AENA 2O5ZH 2LTQC 3NOIA 4ZD3H 2QLVB 2CUHA 4LBEB 4D0DA 1Q9OA 3C5ZA 4QCIA 1JNJA 3TBSB 1F6FB 2A2QT 1KACB 4LSUH 3TT3H 5C0AD 4Y5YC 2UWEE 1MCCA 4YDKL 4GXVL 5JW4M 1MCOL 1KB5B 1ZOXA 2CIIA 2LV4A 4YDJB 1U91A 3O2DA 2PYED 1T4KB 3VGEA 3WO4B 1QFUH 1JYVA 5LGHH 1F4WL 5D1ZC 1RURH 3OJDA 4HH8A 4BK4A 2UZIL 2EIDA 1WFUA 4HS6B 5HGHB 1OHQA 3MRPB 3T0BA 3V5HA 2CGRH 1LEKB 3QI9C 4NRZA 3NPSC 1I8MA 4R90L 3O4LE 3KS0J 1I7TA 4EUPG 3DTXA 4PJXB 3KYKL 3FFCB 2YPKB 1BAFH 3LZFH 3SDCB 4L8BA 4MNQB 1DBML 1E27A 1TNMA 4EQ2A 4WY7H 3NABH 4RISH 4ODSL 4F2MA 1F3DJ 4NQEE 3L5IA 4OUUA 1LO5B 2B2XL 3TJHD 4JFYB 3PV7A 3O6MH 1KC5L 5KG9B 5T1KA 4Z6AT 5FO7B 4QTHB 3OF6D 5CSBA 2XG4A 2FATH 5FDWB 4PB0H 4PRDB 2DJSA 1DBBL 3DECA 1J8KA 4ZUSB 1WFOA 5JOPE 2CK0L 5BJTB 5F7MC 1YDPB 1KG0A 2X4PB 2ZJSH 3FQRB 3HAEG 4AM0A 2EH8L 1CGUA 5L2KD 2CKBL 3RGVA 1I1YA 1IEBB 2IWGA 3PL6C 3GO1L 3ZDZF 4OT1L 1RZ7L 5EZLB 4JY6A 3QYCA 3GMRA 3BD5A 1OTTD 3QEQE 2HG5B 5DQDH 1HHHB 2VXQH 4XWOD 2VLLA 1FG2A 1KCVL 5FYLE 5ESAB 2GAZB 2P1YA 2XOTA 4NCC1 4HWEL 1MLBA 1M6OA 1CE1L 3LOWA 2OR9L 3C60B 3OKLA 2XXMB 1G0DA 2IH1A 1U6AL 3QPXH 2NY2D 4EN3A 1A6TA 1HCFX 3IDXH 4HBCH 4YHNB 4YHLL 5J56B 4XBPB 3O4LB 4RGMC 4TVPE 3LQZA 5GS0H 3MRBA 1CGSL 1XGTB 2YA2A 3HMXL 3L3GA 2EXWC 4P2QD 3L5XL 3U7YL 2GK0A 4AIXA 4IJ3C 43CAB 4LF3B 1JGLL 3HI5L 4G8IB 3U83A 1AGBB 1RQ5A 4NBZB 1IAOA 1KPRB 3GJFA 1SJHA 4WW1A 4NO0B 3P4LA 1D5IH 2VJXA 3P73B 4YXHH 2XZZA 3U4BH 3M17B 3PWLA 2VLKA 1E4WL 4XCNB 3QO0B 3ROLB 4IRJB 3CH1B 4PRNB 3OR6A 4OIIL 4YWGL 4Q7DA 3EUUA 1B3JA 1NPUA 3JTSA 4R97B 3HI1B 2GJ6B 1G7IB 3TA3C 3V7AG 3RWDA 5DUPH 1R24A 1YNTA 5DEZA 2CLRB 3ZKND 3FTGB 1K9TA 4HWZA 2OS7A 3FB8A 2OR8A 2BNQB 2FIKA 4JFOA 2IFGA 5ANMA 3UAJC 1LO4L 4F7TA 1NDGA 1X7QB 2FEEL 4KPHL 4OSUH 1P4IL 4P46C 3CSGA 4MJIE 3B2UC 2YXFA 4NOFA 3QIUC 3CXHK 1GC1H 4OZGE 1RK0B 2P24B 2BCKA 4PYGA 1T22B 5FGCB 3ULSA 2DQIL 4KK6D 5MERB 1U3HA 2PYFB 2HFGH 3CMOL 4POZD 3MXVL 1I8IB 3FAWA 5EUOA 1QFWI 2GT9A 5L0QC 4Y0GA 2E6JA 3H3PH 3FOMA 4UIKL 1BBDL 2X4TB 1F42A 4JJHA 3VWKA 5EU6B 4NWTL 5HI3C 3VXUA 1CK0L 3BKML 4DKFL 5ESVA 5K9JL 1RVFL 1F4HA 4X6EB 3A0OA 4PJCF 1U8PA 3RUGF 3BWUC 4XI5C 5FB8B 1Q0YL 1WCQA 1IAMA 1K4DB 2I25N 2V17L 4H8WH 2APWA 1OF2B 4KI5F 4XC3L 3C6LC 4YR6A 5HI5C 1JNLL 4YHZL 2IG2H 5H94B 2IPTL 3MRMB 4X99B 1NKOA 4GKNA 4L3ED 1IFHH 2BSTB 3B2VL 4HMCA 3NN8B 1NGXA 1OAQH 1CGWA 1GHFL 3EO0B 1N7ML 3WXWL 5HYJD 3MBEB 3UO1H 3UBXB 2HVKB 1CFTB 2QV2A 4LVEA 1KIPA 1MWAB 4JO3H 1ZHKB 1NAMH 5JPMA 1A0QL 3BGFB 2X1PA 2H2SD 2A73B 3JV5A 4WTZG 1T04B 1IZJA 3MOAH 4TUJB 3EJZC 4F57L 4N1HB 3L3KA 4CRPA 4QRRD 4UT6H 4OLVL 1L0XA 1UXSB 2E9JA 2J88H 4FTVD 5J13C 2WBJD 3PABA 1D5XB 4UDTB 1CTOA 5DRNA 2J1KA 3HPJB 4OZGB 5T3XE 4NNYA 5I1GL 3BUTA 4G80B 3VXOB 4UTAL 1UWEH 2PO6B 1I3RB 4OGYL 4WRLA 1RK1A 2BY1A 2X4NB 2P7TB 3Q5YA 3VXRE 3X14A 4DGIL 1JRHI 1ES0A 1T21A 5FXCH 2GJZA 4NO3A 2FLBT 3RDTD 5DWUH 3O2DH 4I48A 5GRUH 4K71B 5JHDE 2DLIA 5C6PB 1KPUA 3S98A 4M8VA 3NCYP 1NGWB 1UXWB 1GAFH 5D1QB 4U1MA 5CD5C 3U36B 5F71A 1OCWH 4GRMA 2VZTA 1ZT7A 2QHRL 3VMPA 2YN5A 4LCWD 5F7HA 1IBGH 1RAMA 4YPGA 1MNUH 1INQA 2EDQA 3TCLA 1J7VR 1QZ1A 4LQFL 5LWYH 1FVDB 1MF2H 1UT9A 2VABA 4KK9C 4TSAL 5BV7H 4PBWD 1ACZA 1XGQA 5HPOA 3RKPA 4Y8AA 4Q9RH 4NZTL 5CEZH 3T2OA 1I7RB 4QRPD 1UCBH 2D03L 3FONA 4PR5B 4TQEH 5E8NB 1PQZB 3K4DA 1XIWC 2ZCLL 3VRIA 1BVZA 4MYWB 5E2WL 3RWCB 3P40A 1RHHB 1WCBB 5ITFB 4NRXB 4DN3H 2PXYB 3ZMRA 1W0VA 2HT3D 4PJXF 4Y4KD 2VISB 3HZYA 1RMFH 2XPGA 2F58H 1OGAD 4X5WA 2FIRT 1DEEB 5K93A 3JV0A 3VXRB 3KWWA 4CW1A 2J2ZA 2G2RA 4PP2A 4LCIL 5D7JB 1T3FB 3CC5B 4ACPA 1YPZA 2A0LD 4AIZB 1BOYA 5C0CB 3U9PH 3WFHB 3EYUH 3QDGA 5I6XB 4RFOH 43C9B 4BH7A 2XICA 3L3HA 3ZE0E 1K4CB 1FNAA 1CDIA 2FZ3A 4QRSB 4K7FA 3MRQB 3FQNA 1TCMA 4PV9A 3ZHKA 3KJ6L 4N0UE 3QIBB 3LEVH 1LNUB 2BNUA 2IAMC 4G8GD 2FX7H 2NY3B 3QWOA 1T66C 3N06B 3C87A 4YFLF 5JDJA 5I1DB 3MRNA 3TBTA 3GJFH 2IFFL 4LCUB 4ETQB 3FB6A 2UUDK 2IJ0C 3D5OF 3QISA 3RX8A 3W39A 3WKMH 1M4KA 3X13B 2UZYB 2MFNA 3T4AB 3VRLF 3EJJX 5T1LD 1A14L 3O3UN 5D2NB 5GGSY 3CX2A 2C1PB 5ENWB 3RPKA 1BPVA 4KC3B 3O3BA 3GKZA 1A4JA 5GGUB 2YPLB 5A16B 4MJ6A 5IMLB 4HJ0C 1DQJA 4AMKL 3R1GL 4L9LB 1KCSH 1MVUB 2NXYC 5HXMA 4LIQL 1M05B 3ZTJG 3VE0A 4RDQF 3CDFA 1DBJL 5DFVC 3TN0D 3QUZC 4ZG1A 4MXVE 2BFVH 2GSIB 2COQA 2J12B 4M7LH 1SBSH 4HAFA 1TVHB 2F15A 3C9NA 5FHAH 3HRZB 5L8LB 4P9ML 1J86A 1NFDB 1NL0L 2BK8A 4CDHA 5C0IA 1TZIB 1T0MB 4NGHL 3QULB 2AGJH 3BT2L 5AWNH 4EVNB 3T0VA 3V5DB 1DJSA 3HZKA 3DBXB 1ZHBA 1IC4H 1UG9A 4U6HB 3SGDI 1FV1B 4MB5A 4P4KB 3TCXA 4HXBH 4ZPVB 4PD4K 5J89A 4XCCH 4AH2A 4N0UB 3KPLA 2ADJB 5C9JB 5SX5H 2PUQT 1O7SA 3SDCC 4KGJA 3IYLW 5I1KH 4YDIH 5F8QC 1NMBH 4L3AA 4ZUTA 1BF8A 4GW4A 2IPKA 3QNXA 4JY4B 3BJ91 3X3FH 1PZUB 3O8XD 4GW1B 3QCUL 4BYHA 4K3DH 4R7DA 3IDYB 1FE8L 4PTTB 2R1WB 1BD2A 3LKPB 1FYTD 3RWJA 4ERSH 4F9LC 1HH6B 4JM2D 4K7PH 3MJ9A 4OZIA 4U1GB 3U2SA 5DEGA 5HVHB 1JGEA 2A77H 3LDBB 3FRPG 4JO4H 1LO3H 3RP1A 1TJHH 2V6HA 1KNOB 3IT8D 5DMKB 2AEPL 5FGSA 4FFWD 1LO2L 3LY6A 4EIZC 4X6DB 5C6WH 3L5WB 2D0GA 3HE6B 4KJQD 3JVGA 4PUBL 5JIIA 5DZOA 1NSNL 5CSZA 4G7YL 5EU4A 4Z8FL 3BPCA 1UM5H 4N68A 5B21A 3I6KA 4Y1AE 5KW9L 3JSSA 2A1WL 5I30L 2FCBA 1NC4A 1YY8B 2H1PH 5GRXG 5TH2A 1QR4A 2X4QB 2Z8WC 3FT4A 4GMSL 1JZ5A 3RHWF 4GFTB 4A2LA 3ESVF 1MI5B 3SGEI 5IWLA 3V7MA 5SWSA 1U8LB 4KDTC 3MFFA 4ZYKA 5I8CB 3CFKA 1XR9A 3C60C 4G6AC 4YUEL 4DAGH 2X4OA 2BDNH 1X5IA 1EAPB 5HY9A 5DJCA 3QXVA 4Z7NE 2N7BA 2D7TH 1ERNA 2UV3A 3EYSH 3J8F7 1HHKA 5ABDE 4DKEL 3Q6FA 4C55A 2EYRA 1RIUH 4IHOB 3WS3A 2WWMD 1S3KH 5LAXA 5C0GB 5C0EA 1G6RB 2X4RA 5C2BH 4WUKH 1G7JA 4JCLA 1FZKB 1NQBA 1OQOA 2OP4L 5AUMB 2PCPA 1TNNA 4AENB 3QDJB 3MV7A 4LSPH 4JZOA 3D18A 4XBGB 5BMFL 5IG7B 4S1DD 5I1JH 4IRJC 4WHTB 1JV5A 2QBWA 5CMAB 5MP6H 3QIWD 5EWIL 2IC2A 4R97C 3S4SG 1P5VA 4BSVA 3MO1A 3IDGB 1VACB 2M1KA 2W59A 5E9DB 5FYKE 4P2RA 5LBSL 3AS2A 2F5AH 3PWJA 5C07A 1IQWH 4OCNC 4O02L 3EW3B 1MCEA 4IRZH 1RUPH 5H37H 3WHE0 1WZ1H 3F7RA 3S96B 5J7CC 4RIRB 2OK0H 4JDVA 4NM8L 1UJ3A 3SGJA 1OPGH 4XP9H 1T03H 5JNYB 3PDOA 5DD1L 4MAYB 4X9IA 4NKIL 5CCKH 3VXPA 2WQ8A 5TGBA 1TVBB 2DRUA 3EOAB 3QQ9C 4ZAKC 5MEPB 1ACYL 4L29B 3MGTA 2SEBA 2A9ML 1RI8A 1ZLWH 4OUUB 2ARJQ 5E5RB 2JTDA 4ODTL 1KJMA 4HGWA 2VQ1A 1R5WB 4G9DB 4F80A 5EO0A 3PNWA 3Q6GL 2FGWL 2J8UE 3SDAA 4LSSH 5JORA 3BP4B 4IIQB 2MPAL 5HGGS 1Z3GL 4GLRH 2IANB 2GY5A 4KK8D 2M2DA 4E41E 4R26H 4C4KO 4LLDB 1BFVH 4HHAA 3AXLA 3B9KD 5D93B 1NBVH 4OGXH 3MBEC 3OKOA 4WFEE 3Q3GA 4MX7B 4XCFH 5CHNB 2ITCB 1IGYA 1NBYA 1T0PB 3BGFC 4HUXA 4NQXB 5HPMB 3V4VH 1F4XH 3BZFB 5CJXC 1Q72L 5EO1B 5FK9A 5TDPB 3S8WA 4XCEB 2R0WL 1HHGA 3WSQH 4JLRA 2IBZX 2IH1B 2LFGA 3MRDA 1FFNB 1QBLL 1A6TB 1HKLL 3L3IB 4O5LL 4DZ8A 4RAVA 4OFYA 1L7IH 5J3HD 1ZWIB 2DM4A 4XZUA 1T1XB 3C5JB 4ISVA 1LEIA 5A3ID 3U48A 4YJZL 2GK0B 2FO1A 4Y4FB 1MUJA 4M7JH 5EU5B 1FVEB 3L7FB 2R0KL 1CD1A 4P0DA 1G9EA 1S7TA 3V6FA 5B39A 4M43H 1PKQB 4OD3H 5FYLL 5DS8B 5HI4C 1NFIA 5B4MC 5D1QC 1G84A 2IGFH 3W2DH 3HNVH 1AXSA 3QUYD 1S7SB 1BQLH 5B3JF 5JDSB 5KAQF 4GG6A 1CD0A 3NGBB 1ONQA 3TESA 2W0LA 1ETZA 3H42H 12E8L 5ISZB 2UY6A 1VFUA 5EA0L 4N5EC 2FHFA 3S35L 5TF1H 1RZGB 4LGPB 4U7KA 3JTTA 5I1LB 3T04D 1FFPB 1KJ2L 4FQPA 5DUBA 3V6ZA 1QRND 2OYPA 2HYMA 3BQUC 3ARGC 4YK4B 2DJUA 5JW3H 5D2LA 1NFDF 5IMOA 4I2XE 1CFQB 1HZHH 4XVSL 4K7PY 3JWDH 4I0CC 4PJAB 3MJ9H 5EOQH 1RZFL 1XH3A 1UB5A 3W0WA 3OV6A 4LSTH 1RZKC 2XWJA 3BDYL 4JPIA 3LEYH 4QF1B 1QEWA 1ZT4A 4QRUA 1GCFA 2VH5H 4M62H 5TFSH 4F37K 3IU4L 3ZE1E 2NMSA 1G9NC 2B39A 5EO9A 5KSAB 2V5YA 1DFBH 5E6IC 5C0DA 2HVJB 5I1CH 3RVWD 5DD0L 3INUH 1AJ7L 1BHGA 5IUSA 4UV4H 1A3LH 1INDH 1DVFD 1S7VB 5D7JC 3QCTH 2J5LB 2CRYA 4R96A 3FQWA 1X5JA 3C6SA 5DK0B 5ICZB 3FB5B 2D4DA 5F1SA 2I9LA 5HVGB 3UROR 5DJ8B 1ZKAA 3P4OB 2NNAA 4WJ5A 1MHHA 1W8OA 4WW2A 4X8XA 5D6CB 2QEJA 1S5IL 3H9SA 5AD0A 5B38A 2HWZL 5JMRA 4KKNA 4N9GA 5JXAH 2HLAB 2AJVL 2NY3C 5BO1L 3S34H 4XMLL 3WDJA 4K3JL 1N4XL 5EBLB 2APVA 1I4FA 4LKCB 5I8EA 3L3KB 1JCKA 3FL7A 3IFLL 1F6AB 4FQIH 1A7OH 3VFOB 1BFTA 3CFCH 4MA8L 3MRKA 1N8ZB 1JGUH 4FXLA 3U82B 4ZQKA 5D2NC 1EFXA 1P7QA 4TTDD 4IRSA 1AHWB 1IAKA 3EFDL 4TPRH 2ZSWA 1TQCB 3ULVE 5D7LB 3CCHB 4MZ3A 4LGSB 4YHIA 4XVJL 3UTQB 1MRCH 1N0XL 25C8H 4OZHA 4YHKH 5E8DL 3FO9A 3MR9A 4H25A 4L9LC 2EO1A 2FWOA 3LPGA 3SJVE 4Z5RB 5LG1A 3UYRH 1NJ9B 4X83A 5F93C 1MHCB 2PN5A 1LD9A 4LU5L 4DVRL 3GB7A 1EXUA 1RZKL 1Q9KA 4YBLC 5E1AA 4LVHC 4HFWA 3MCG1 3VWJD 1VFOA 4D9RE 4PJDB 4K9EH 1OM3H 1HSBB 1JPTL 2UYLB 1C7TA 4F3FA 5T3XL 5MI0B 3U30B 1BZ7A 4JQVC 4ZMAT 4Z77B 4CMHB 1WC7B 4HW6A 3MZGB 5IKCB 1BFOB 2DDQH 3I2CL 4V1DD 2X05A 4APQC 4P9HH 1UH2A 4UAOC 3NAAL 3RL1A 4M8QB 3PV6A 3LS4L 1Z9MA 1RJLB 4QXWA 3BRGC 2VIRA 3MACH 2Y6SC 3QDAA 2XN9E 1QFOA 3CGTA 1TENA 2IQ9H 3AU1B 1LP9A 4BELD 4QNPE 1K8DB 2XFXB 5CGYD 3MRFA 1OD9A 2C26A 3ES6A 3IDYC 4Y8DC 1FN4A 1ORSB 4Y16C 1IGJA 3ZKMD 5I71B 4WCYL 2CDGB 4NBYB 1MRFL 3LHPL 3PWPD 4OAWB 1IGIL 1NGZB 1HEZB 2VLJA 5HVHC 5IFJA 3VFWA 5H2BA 5AG9A 2BVQA 2X7LB 1DBKL 3VJ6A 3OB0H 2NYYD 4LVOB 3MV01 5DDHB 1IAIH 4U1KB 3VFVB 2HLFC 2VDNH 1HYSC 3LAFA 3L9RA 4I0KA 1L7TL 4XGZA 1MFBL 5DEFB 1FC2D 5J0BA 4WEUD 4HIXL 2BY3A 3EYFA 1XCTB 4P2YA 2FJFA 3WFDL 2WBWB 3ARBB 3B4NA 2QHLA 2JELH 3MLVH 5DQ9A 1G9MH 4DKDC 2W91A 1AC0A 1Q94B 3GSUB 4UDUA 4EUPA 1WBZA 4WU7B 5AYUL 3DX6B 2ITDB 4N0YH 5ID0A 2I60H 4K94H 1RIVL 3VG0H 4PGEA 2WIIA 4KXZH 4WTXA 1NGPL 4N8CH 1G7QB 4FA8A 3W39B 3DYOA 1BREA 4FN0A 2B5IB 4ODVL 3ROOB 3F7YA 3MA9H 1JMZA 1MPAH 5FKPA 1XF1A 3QNZA 3HAEA 5FOBB 3QFJD 1UVQA 3V0VB 4JFFE 1SEBB 5D1ZD 4RWYH 2FX9H 4C56A 5C0FA 2EKJA 2ATKA 4ZXBB 5IBTL 4XNMB 1MCPL 5J12B 4L4JA 4XP1L 2BOCA 4X4ZA 3GNMH 2ICWI 4XHJD 2VYRE 4P2OB 1BQHB 5DT1H 3KLHC 3MLRH 4GMTH 1WIPA 2OL3B 4QOKE 5DI8A 1Q38A 2RR3A 1PG7X 4WGWB 5T3ZD 4PRPD 1JF1A 2BOBB 2QQKL 4JR9L 3UJTL 1AR2A 3X11A 2WUBL 1BVLB 3HZKB 1NBZA 2P5ED 4WO4A 5DD3H 1KTLA 3DMMD 1GGCH 5C08A 2DKUA 3WLBB 1RUQL 3GBLA 4RFEA 1CTNA 4MAYC 2XQBH 2X4UA 1YECL 4DGYL 2DMKA 5DD6A 2EYTB 3TM6A 5KVGL 4C57C 3AS3A 3TJEH 3V0AC 4I5BA 1QSED 4MB4A 4N0CC 1KCUH 5MHSE 4WVRA 3DXAB 2Q3AA 3D69A 1JYNA 2DLTA 1CL7H 1IL1A 4PJAF 4GAGH 3PL6D 2Z91B 2GFBB 5CZVH 1UB6B 5F9WB 4PREA 3VCLA 1EEZA 1XCQB 3E8UH 2YBRB 3QXAA 5HJ3B 4TULL 1FGVL 4NDMB 3NH7L 3O6LH 1HHIA 5INCB 4ONFH 5EUOF 4NZUH 4L8SC 4XMPL 1MY7A 4KUZL 1AH1A 3K2UH 3EZJB 5IOPB 4JFFB 5IW6A 4GW5A 4F7PA 1ZV5A 3B83A 1OAYH 5GZOC 1N64L 4Z0XA 1K6QH 1GZQB 5F3HA 3QXDA 2EDWA 5C0RH 3UTPE 4U6VL 3DETC 2X9XA 4QOKB 4D9LL 1T5WA 4MNGA 3MJ8A 5J6HA 2EXWD 3KPNB 4D0BB 1JZ4A 4RBPH 4P4RB 2DQTL 3MV9E 4LPVA 1FL6B 3SPVA 3CFKB 1NUFA 5DO2D 1UM6L 4G8FA 1J0HA 3AROA 2QL1A 4NKDB 5D7IA 5IVZB 3RTQA 1KENH 1KN4H 3KPQA 3OHXA 4X7DC 4NNXA 5EFIA 4DOHE 3KPSD 1YJDH 2ERJB 1VSCA 3FQUA 3VXME 2X1QA 4NCC2 3PHSA 4YHYB 3G6DL 2XTLA 3MUJA 3TA3D 5C71A 4R0LB 4Y4FC 2C3XA 1HSAA 2DWEA 1WBXA 1DUZA 3RWIA 3QHTC 3ZDYF 4PV8A 3AS0A 3DNKA 4PJFA 3Q1SL 1MREH 3D2UA 4ZFGL 4WV1A 2MQ3A 3TVMC 4Z7WA 4QRQB 4PLKC 3UAJD 3NTCH 4LSRL 2OTUB 3CNKA 1F11A 2ATPB 1KJ3H 3ARFA 4MDJB 4NN6B 4JVUA 3MV7B 3LKSA 3GSNA 2NLJA 4IMLB 5DMGC 3DX7B 1WZKA 2IALA 5C0ND 1UQSB 3NGBC 4WDIA 4K3HA 4W6YB 1A1OA 3QIUD 5IW1B 1DSFH 4XP5L 1DLHB 4DTGH 1FPTH 2DQEH 4MD5A 1VB9A 3DX9B 4WTZA 5LVEA 1FNLA 3T09A 4JHZA 3LV3B 5FO9A 5E94A 1C8PA 4PJ8D 1F58L 2HJFA 3IDJA 3P4NA 4HF5L 4PJDF 4ENEC 2OJEB 1XZ0A 1MOEA 1QLRB 1TTGA 5K9KB 3IDIA 1A7NH 4EXKA 5HI3D 1CT8A 1JGDA 2VDRH 2VXVH 2V5SA 1OAXL 1U92A 1HDMB 2VOTA 4GSDH 4XI5D 1OAZH 2EIZB 2ESVD 1XGPB 3DUUA 1JFQL 2D4FA 5JQ6H 5IFHL 3C6LD 5HI5D 5D72H 1ZXQA 1MIEL 3CVHL 2AXJA 3ZYJA 5JO5A 3LB6C 2E27H 2HTLD 3CD4A 5FYKL 2OCFD 4PJGA 4WUUB 3VXMB 3T2NH 3H8NA 1IC1A 2VL5A 1WEJH 5GRJH 3BH8B 3GUTB 4X4YA 3HE7A 4JEGB 2Q86A 4YEEA 3RA7L 3SCMB 5D1XA 3TIDA 3PNWB 2VE6A 3SDXE 3S37L 3PGCB 2YC1A 5EBMB 2ZCKH 8FABB 2J5LC 3DO3A 2XQYK 4U6TA 4EUPH 4P23B 4M3JA 3GMPB 4Y5VA 1AXTH 2JCCB 2PYEE 4OLXH 2IQAB 1IT9L 4X7CC 1LO0L 3LRSA 5BXFB 1CN4A 1B0WA 1S7XB 2H2PD 5MENA 1AE6H 1MAJA 4R6UA 4AT6B 4MNHA 2QQLL 1I9IH 3EIFA 3TP4A 4PJEA 1BEYL 3A67H 1CZ8L 4D2NA 3IXAA 3M1BB 1Q9WB 2AI0H 3K80A 4L8DA 1ZSDB 3IFNL 4FQXC 3UPRB 1X5XA 1FZOB 2JIXA 3I9GL 3GBML 3IKCA 5E8PA 1KEML 5HGBA 5IEHB 3A6BL 1P9MC 4AEHH 4F7MA 4E5XA 5JR1H 5DD5L 3IDMB 3QH3B 1BLNB 3S88H 4G43B 3TWCL 4NQSB 1CQKA 1NGYA 4JGJA 5CD5D 2O26U 5F9JA 4DKAA 1BGXL 3QUXC 3VMNA 4PRAB 3VW3L 1ZVYA 3V52H 3X12A 3NFSH 1JHKL 2PF6A 4G6KH 4OM1H 5DHVB 3WDHA 3DROB 4OF3A 5LXGL 4CL7A 1FO0A 1QFWH 2P8LB 4PRHE 1EVUA 2Z9TA 5D6DC 1QSFE 3MV8A 4TSBH 5B39B 5L2KE 1B2WL 5CWSA 5DFTA 3KXFA 4WWID 3TYGH 2FO4B 5J1AB 3TBVA 4KDVA 3BGMB 2A6DA 4KK9D 5IB5A 1XGUB 1XF2B 5C0AB 4JM4H 4PBXA 2DI9A 1J8HD 4YGVA 3QHZH 4ELKA 2PYEB 1RFDH 3U30C 4QWWD 4QXUL 1JZ2A 2A83A 2CJUL 1T83C 2DLFL 5GS1C 3VFRA 2MKLC 4WFHD 3PP3H 4I18A 5LJYH 3KPRA 4P49A 1OARL 3VXQA 4OIBA 2GUOA 4YIQB 1JWMA 1KEGH 4Q9QL 2Y07L 3FQXB 3NACH 4QTIL 5I8KH 4PGJA 4BQ9A 1AGDA 2GYSA 5GRZA 4PJBA 1PX3A 4NN5B 4P2QE 2VAJA 3RNQA 1RUAL 4PJ9A 4HPOH 5IF0B 3P4MB 1KT2A 2P8PB 4HKZA 1HNGA 2CH8A 3ARDD 4S1RH 5I71C 2EXYC 2VLRE 1R3KB 2RCSL 3RWGA 1TETH 3KDMB 2MCPL 2YN3A 3MLUL 2BRQA 5BS0D 1B0GA 5F3BB 2WINB 4JVWA 3T4YB 4HK3N 4TUKL 2D7NA 3SE9H 3VFNB 4CKVX 4ONOA 3ULVC 4LVOC 1JRHH 1VGKB 4NQUA 2DM7A 3NCMA 1BZ9B 3GIVB 2IAMD 4RGOL 1RZIA 1D5ZA 4DVBB 1T66D 2FEDD 1VPOL 1TZHB 2EDEA 5L2KB 4ZPTB 2NW3A 5CJ5A 4OZIF 2F19H 4NHCL 1C5CH 1MJJB 3VGAB 2JJVA 2X44D 3ARBC 1KBGL 1MELA 1CFBA 5CBAA 3UX9B 1FRGH 4QHKI 5L7XH 1ZVHA 3LH2L 1BF2A 3WUWB 1OT1A 3QDMA 4YFLI 5DUMH 1OGTA 2NY4C 1A6WH 4Y2DC 2BNRD 3L6FA 4JRXD 5A2LH 1PKOA 5E8EB 4O2EA 4EOWH 4YAQB 3KPPB 4XBEL 4HJ0D 1EZVY 1KFAH 1KJVA 2NXYD 2NY2B 5DFVD 2WLYA 3ARUA 3QUZD 4FQCH 4NO5B 5JXEA 3GSNH 2B5IC 2BSED 1AQKL 1J1XL 3HN3A 1EEQA 3SE4C 2WNGA 4P2QB 3OWEA 3FRPA 3WXVL 1ZHLA 3O9WD 1WFTA 4OD2A 1W72L 4TUOB 5IHBA 5HVFB 4O00A 1HINL 3NCFB 2P44B 2KQNA 3GGWB 1A5FL 1EH9A 1BJMA 3BD4A 3RHWK 4X7TA 4M6NL 2FWOB 4KTDL 2Z8RA 3GSVB 3TC9A 5J12C 1ZEAL 3UBXG 5I73B 1AIFB 3U46B 4P2OC 3D39A 5HYJE 1OY3B 4UMGA 2H32A 1QO3A 1U93A 4G9FD 5EIIA 4Z7VB 4Q9BA 2D7OA 5GIRB 2DQDL 1JWSB 3MCKA 1FAIL 5IR1A 5T5NG 3S7GA 4HIHA 5ICXA 4PGBA 1IM9A 1FNSL 2E7CA 3BP7B 4UBDC 3SE3C 1ZGLA 3ULVL 4JZJA 3O3AA 1YEHL 4HV8A 4PJIB 3T65B 5B8CA 2HJLA 3P11H 4JFQB 2F53D 1QLEH 1FL5A 1HXMA 2MHAA 3QWQB 1TCRB 4U1LB 3ZT5A 1JVKA 5HDBE 3KYAA 3OXRA 1JGVH 1AD9A 4OB5H 1C1EH 1C5DA 2GIYA 1CBVL 3UTZB 3IKKA 5E99L 2PW1B 3TBYB 4ALAL 2XIDA 3FFDA 1HHJA 4RZCB 3ES6B 1MAMH 5F1NA 15C8L 3STZB 4JFPB 1U8OA 1A1MA 1YNLL 5F9WC 3EJYC 3P3YA 5JW4Q 4MQSB 1IKFL 1C08B 1I1AC 3DRQB 1X5FA 2DQUL 2DBLH 4LKXB 3WS6A 5I17A 1B6DA 3S4SA 3BISA 4EI5A 4LEOA 4Q2ZB 4HJGA 2JE8A 1H0DB 1JYXA 4HIEA 1HI6A 5C6TL 5IGXH 3QWRD 4NHUA 2JB6B 2YD1A 1NC2A 3BMVA 4LCWE 4PJ5A 3MRCB 4YO0A 2J4WL 4QXTA 4L1DA 1YEGL 4Y19A 1XFPA 4LHUD 2XNAB 1JK8B 2EDJA 4G6AD 5EPMA 1MJ7H 3SOBL 1BVKB 5ADOL 5F7LB 4U3CA 3H3BC 3UTSA 2D0HA 1F02I 4HS8L 4U0QB 4L3EB 2X89D 1UKQA 1EHLH 4OCXL 3F12A 3JBG7 4OCWL 3QG7H 5HYJB 4JHAH 1ZS8B 3FT2A 3B43A 1SJEB 2VDKH 4H5SB 2AXGB 2JCCF 2FL5B 2V9QA 1CXHA 2I27N 5IMKA 4R2GC 1S9XA 3QJFB 4Y5XB 1DP0A 4QRPE 3UBXI 3AMLA 3LN4B 4NQED 3SGDH 4J1UA 3NCJL 4U05A 4GG8B 5F7DA 1PBYA 3TBWA 4X98B 1FO0H 2IBZY 3HNSH 4DUVA 3HRPA 4QRRB 3TYFA 1VDGA 2ERJC 4FTVB 3ME0A 2XI9A 3IB4A 1N6QH 1DEDA 1G1CA 2WBJB 1T1ZA 1X4YA 3I3EA 4YZFE 4YHYC 2L4OA 3E2HB 1MLCA 5JOPD 3UYOD 2ENYA 3OR7B 1TPXB 2DIJA 1MCSA 1Z0NA 3K0WA 2HKHH 3FB7A 1IKNC 3RDTB 2VZOA 5GS2D 4I0PC 4QGYA 4TTGA 4DFIA 3ESUF 3QEQD 4RFNC 2BERA 1H15B 2R0LH 2DTSA 4I3SL 4ODWA 1X6LA 1PZ5B 4YQXH 1GGBL 5IB2A 5L88L 4XNYH 5IFAL 2EDBA 4G42A 3O0RH 1NAKL 4YC2C 1HXYA 3HUJA 4LCWB 2Y36L 4IS6A 2CMRL 1OSPH 1ZLUH 3VXTA 2XZAL 3QQ9D 3SE8H 4JPKL 4ZAKD 1RJYB 3QUMA 3C08H 4KDWA 4M6OL 3DVFA 4GG6F 3NFPA 4LSVH 5F88A 2G60L 3MBXH 1RZ8A 1A4KA 1OW0A 2JB5H 3GMLA 3MOBL 4CNIB 1WAAF 3MRJB 2V2XB 4PGCB 5C9KA 5EIVA 1PG7H 1H3VA 4QRPB 5KAQG 3PJSB 2XWTA 1EO8H 5FCUH 1GPOL 1WIUA 4KV5E 1V3JA 1R0AL 2XACC 1C5BH 4ZTPH 3F5WA 5D2LF 1A7RH 1WWCA 4PJHB 1T7YA 5FECB 1YC8A 2C7UB 3V5KB 2HRPH 2W9DH 5INDB 2XG5A 4JPWH 3O45B 3RWHA 4Y4KB 3AREA 2PTTA 3OGCB 3CSYA 3GSWA 1OGAB 5EORH 4FMFA 4KUCD 4XPTL 5IHLB 3DI3B 4X5XB 1DE4B 2W60A 4W4OA 4LOUC 2BVEA 5GJTH 3NPZB 4KRNA 3FN3A 2B8OT 4P23C 1E4XI 2NQCA 1NLBH 1MVFA 1PAMA 3T3ME 3ZL4H 3P0VL 3WFEH 4TRPH 4P57A 1EGJA 4QHUA 5C86A 2ZCHH 5GSVA 4MJID 5KTEL 3GDBA 3FOLA 5KSBA 4ZO6A 2KPNA 3SKOA 4HPYL 4LARH 1SMAA 3WL9B 2CD0A 2QQNL 1CICC 1SJXA 5HYQA 3GSOA 4G8GB 3PP4L 3HC4L 2RAMA 3IAPA 3OKDA 3HPLB 4PLJC 4NKOA 5E5MA 5DGRA 4WW2F 5HI4D 5B4MD 3STBA 3UC0H 3MJGX 5T1LB 2IPUG 4U2ZA 4IOFD 3IF1A 4R4FH 5HTSA 4KMTL 5C0BA 3WIFA 5DTFB 3C8KB 4U1SB 1A6AA 2H32H 3THMH 4AL8H 3KYMA 2FBOJ 2Q3ZA 4PJFB 4R7NB 3L7EA 3O2WH 1P4LA 1LK3L 3DURB 4JANB 4ZFFB 1OB1B 5FKAA 5ANME 4M03A 3TN0B 3BQUD 3ARGD 3GIZH 5I1EL 2YD9A 3QI9A 5E2JA 2DS4A 3GMNB 1P1ZA 4P59L 1RJZA 5L2JB 1GIGL 4NJ9L 4HUUA 1QNZH 5TE6H 4DN4H 1NGQH 4D0CB 4OZ4A 1PG7W 4MJ2A 1I9RH 3CFIC 2P43B 1XT5A 4D9QE 1U42A 3SDDC 3K81A 5MEOA 3UTOA 5L8JB 4HUMB 1Y18B 1FNEB 5E6ID 4LCCB 4Z7VF 3A6CH 4D8PB 5M94B 5T3XD 5C09A 3TV3H 1CDGA 3U0WL 4KVNH 4UOJA 2VR5A 2CDEA 4KZDH 2EE9A 5FUCE 4GKZB 4KKAD 3VXUE 1T80A 2I9TA 4YBQD 2AK4D 3PWNB 5IESL 1IQDA 5FUZH 2AJ3B 2YRZA 3F6LA 2Z93B 3ARPA 3O8XB 4Z0BL 5JHDD 3TJHC 1J87A 4WI5A 2E5EA 1YY9C 2ZOKB 3O6FC 4QLRA 5FUOH 1A64A 1FYTB 4NYLB 4HIIA 4L1HA 4JM2B 4POYA 4LFHD 2YMXH 1CF8H 3E6HB 4GRWH 3BI9X 5CIPA 3TFKD 3ILPB 3P9MA 2E9IA 2Q1EA 5T33L 3QA3A 4LMQI 4DWHA 2ZUSA 4MHHG 1BOGA 1ADQL 3CVIL 5IHUL 2F74B 3O41A 1UEYA 2E7LC 4LSQL 3WHXA 1J05A 5E5UB 4Y5VB 4ODHL 4X9HA 1FVCA 2VXTL 1QOKA 4UILH 2FBJH 5K9OB 3PIQA 1U3ZA 4OQTL 4Z78A 2H3NA 4JKPH 4JFXA 3MLPA 4Q97A 2VAAA 4GRLA 4XWOC 3CLEH 5I74B 1YN6A 1SHMA 4X0KA 3EO9L 4F7CA 4M48H 5HGAA 4IDJL 1ORQB 1R5VA 5EBWA 1U8QB 4ZSOB 4MSWA 4NSKA 1L6XA 3T0EA 4RMWA 3ALWA 2ICWA 3N1FC 5HGBB 4CADA 3EOTL 1CXKA 3VFPA 3GMOA 1MJUL 5F1OB 1FHGA 3WNKA 4F58L 3R0MA 1J9CT 4X8JA 4FQQB 4NUJA 1T6VN 1A7PL 2W65A 2IADB 3LSOB 4ZUUB 4YE4L 3GSQB 3TO4C 1S7UB 1MCLA 5KZCD 2FNBA 1NUNB 2AJSH 2P49B 1JUFA 1FP5A 5CEXA 3FRUB 4TOYL 2ICEB 1MAKA 1V5JA 1DQLL 1T89C 2R1YA 3VGGA 1MFEH 1CU4L 2OZ4A 3CPLA 3RY6A 2F5BL 2QTEA 2X6MA 4P46A 5I73C 4NP4H 3QUMH 3UZEA 1QKZH 2FRGP 4M5YH 4APQD 5ALBL 3QIWB 2NZIA 4JG0L 4G6MH 3O11A 3IDNA 3LKRB 4F9PC 4G6FD 5BQ7B 1HILB 1J88A 1CDBA 2Y6SD 3K1DA 4GS7B 3UTTD 3ULUH 4R90H 3P0YL 2OSLB 2V7NA 2PR4H 1ZE3C 2F54A 1YMHA 3LMJL 1FZMA 2XZQH 3KYKH 5TE7L 4MHHI 4Y16D 1A3RL 1DBMH 3QQ3A 3VXNA 1S9YB 2NW2B 1V7NH 1PFCA 3VD7A 1UACL 3D0LB 4L3CB 3HFMH 4N8PA 3DO7A 2WQRA 2VZSA 1IE5A 1B0RA 1YEIH 4RQQA 1AP2B 4KK6C 2H8PB 2HLFD 4JFED 2R2EB 4MA3B 4LSUL 3TT3L 5E8OA 4Q9CA 3FT3A 3BFOA 4Z7UB 1J0IA 2Y23A 4U6YA 1W8NA 1UWGH 1YPZE 3GJFK 3MCLL 2IMNA 3L3OA 1X6NA 4QYOA 4GBXC 4MCYA 3HG1A 3ZSTA 2BVPA 3QDGE 4I4WB 5I1HH 1QFUL 1T20A 2EZ0C 3I6GB 5LGHL 1EGJH 1JPSL 2DI7A 4OFIA 5CEYB 4QY8A 2G75A 2DL2A 4ELMA 1CLCA 2O61A 3SKUD 2M8XA 4PJHF 3MNVA 1BX2B 1RZ7H 2CGRL 2DQGL 3WEXA 1I9JH 4MDIB 4JRYA 4PRIA 1S9WB 2NW3B 1BAFL 3LZFL 5CFHA 5H35B 3OG4B 1T1WA 3B9KB 1LE9B 1MCWM 3EO1A 4WTWA 4NFCA 4WY7L 3NABL 1CIDA 3WN5B 1JL8A 4RWHA 5FV2A 1U6AH 2OTWA 3BHBB 3BN9D 3PHOB 4MD4B 5DJ6B 3VH8B 4XH2A 4CVXA 2AJXL 4M4PA 4YHLH 5J9PA 2FATL 2VSDA 3LQAH 3KPOA 4H0GA 4PB0L 4UQ2A 4LLAA 1CGSH 1JNHB 4HZLA 2VITB 2AJUH 5DC4B 4MQ7B 1JGLH 4UQ3A 1BFSA 3IAQA 2ZJSL 1R5IB 3E2HC 4M1GH 3OAYH 3S35X 3B9EA 3BP5B 2GKIA 3QUKB 1TPXC 1JWUA 5E4EB 1PYWA 4OGAC 4UT9H 1E4WH 3ORJA 2Q6WB 4TSCL 5D7IF 4YWGH 4U6XB 4W81A 3LN5A 5DQDL 4HKXA 2QKIA 2VXQL 3AVEA 1FJ1B 4P2CG 5IV2A 4Y1AD 3GM8A 3I02A 2C3HA 4X6CA 3OX8B 2E8YA 2ZOLB 3QUYB 1L9MA 2BVYA 1KN2H 5I18L 4BKLA 5GGTA 4DK6A 4PJFF 4DZBB 3QPXL 4H8WC 5BRZA 3J7HA 1FIEA 3G08B 3KLSA 3IDXL 4HBCL 4W4NA 4PJCA 3RUGA 3PQYA 5CJOH 3DARA 3WNPA 1XIWA 4KGLA 1QRNB 1SBBA 1V3KA 2AAVA 3OBAA 3MJ7A 4ZFOB 4RRPG 5TPWH 1K3ZA 3U6RB 1UZ8B 1CLOL 4E9LA 3ZDXF 2DQIH 4NO2B 4CJ0A 2A6IB 3LKOB 2GI7A 2BVUA 5DHYA 3UPCA 2WLZA 3HCVB 3CMOH 3MXVH 4OF7A 4OZIE 3BKJH 3RIAF 1NCUA 3OKNA 3L3DB 4OCMC 5SWZA 4FFYH 1D5IL 3RVVC 2C1OA 4LAQL 3GRWL 2VZVA 32C2A 4YXHL 3U4BL 5CIPH 3ARVA 3IU3B 1YMMA 1ZTXL 3OTTA 2DI8A 2VN7A 1FIGL 5C3TA 5FGBA 5DUPL 1WWWX 4OZFB 2HT3C 4XXDA 3C5ZC 4Y4KC 2V2TB 5HGDB 1U8OB 2YK1H 2V17H 3PWUA 1PDKA 3KG5A 5E00B 3AAZB 4ZUVA 3V4PH 3JZ7A 4FZEL 4YHZH 4HH9B 2AJYH 1A1NB 4UOW1 5FYKD 3DETD 1T0NA 4OSUL 3I75A 1DVFB 3U9UA 4HJGB 4ODUB 4PB9H 5F89A 1FZJB 1Q9LB 2E9WA 3H6JA 5DVMA 5FYJD 5SWSE 3WXWH 4MLIA 1N7MH 4JM2F 4PJGF 1ED3A 3QEGH 1GC1L 1A0QH 5DFWH 5EZJB 4AQ1B 1D7FA 1GOGA 1JTPA 3CFJB 1KIQA 1HNFA 2HFGL 4F57H 4GRWB 1AKJA 2JF1A 2OX5A 3OMZA 3ZKXB 1BP3B 4P5TD 5CZXD 2ZWLT 3FZUC 4A6YA 3OXSA 3KYOA 2UVFA 3FQTA 1LK2B 2I26N 1OTSD 3TVMD 4PLKD 4LBEA 1DUYB 4UTAH 4YX2L 4UTBL 4PJEF 5T5FL 3TBSA 4HK0B 1KCRH 4OGYH 4FFVC 2CSPA 4H8WL 2OZ4H 2IG2L 5TE4H 2VKXA 3MUZ1 5I8OH 1KB5A 4OCYH 4YDJA 4CN6A 4Q6IB 1T4KA 2EC9T 1J5OH 3DPBA 1A21A 4P2RE 1C12B 4E41D 2KZ1B 2X70B 3BZ4B 3L5JA 1OAKH 4K3EH 5C07E 3QNYB 1ZLWK 4HS6A 1F45A 2JKXA 5HGHA 3AFLA 2CO6B 3MRPA 2K7PA 3VXSD 1LEKA 4WFED 1VENA 4PJXA 3VWJB 3FFCA 3QQNA 2YPKA 4UT6L 3SDCA 4MNQA 3LRGA 1ITCA 2J88L 1F8TH 4RX4D 3WE6B 5DJDB 3MLSL 4HFUH 1LO5A 4JFYA 2EYSB 5F7NC 3CLFL 5KG9A 2WP3T 1FL3B 1UWEL 4NZTH 5FO7A 4QTHA 5JMOC 4EN3C 4LCCC 5CJQH 4V1DB 3D3VD 3A6OA 4Z7OF 5FDWA 1J11A 4PRDA 5DWUL 1DQQB 3O2DL 5GRUL 2Q8BH 1CE6B 2ZCLH 4NQTA 4ZUSA 5BJTA 5E2WH 1YDPA 1FBIH 2ARJB 1GAFL 2X4PA 2VC2L 3FQRA 1LE5B 1AFVH 2Y7QB 4UIMB 3BZEB 3O8XC 3QR2A 2Q7NA 3NIFF 5GISL 2GCYB 4FZ8H 1IEBA 3CZJA 1WGOA 5IBUB 1OCWL 5A2JH 3QFJE 2EKSB 5DRZB 1I3VA 4L4VD 4KVCH 3SKJH 5EZLA 2DF3A 3PWPB 4RMQA 1IBGL 4PJBF 2HG5A 1MNUL 1BQHG 1CFNB 2YUWA 4QRTB 1HHHA 2ZG2A 4HQQH 5HDQH 1XF4B 5ESAA 5LWYL 2GAZA 4H20H 1NEZB 3JUYA 1MF2L 4NKMB 4FQXD 3C60A 4OQ1A 1CG9A 5BV7L 2CRMA 3C5SB 5T3ZE 4PRPE 4Q9RL 1X4XA 1PX4A 5CEZL 5DA4A 4YHNA 4XTRD 1U3YA 4XBPA 1UCBL 3O4LA 4TQEL 2HFFB 5I74C 1XGTA 2CKBB 1Z2KA 5D96C 3QUXD 3LS5H 4LSDA 4IOSD 43CAA 4LF3A 4P3DB 2IFFH 4G8IA 1AGBA 2BVOB 1H3TA 4DN3L 2NY1C 5DJ0B 2NR6D 1KPRA 4JKWA 1QSEE 6FABH 3Q48A 2FJGB 4NO0A 4GXUN 2W38A 2VUOA 3P73A 1R3HB 3M17A 2Q76B 4XCNA 3ROLA 3QO0A 1NFKA 4KHXH 4IRJA 1U2HA 3CH1A 4PRNA 4U1JB 3CMGA 5FUCC 1TVDA 3HI1A 2GJ6A 1G7IA 2OR7A 3FAXA 2PTUA 5DK2B 4AMKH 3EYUL 3GJEB 1DCLA 4LIQH 2CLRA 2FSEB 3FTGA 4Y5YB 2WWMC 1DBJH 4GG6E 2BNQA 3ARWA 1FFRA 1S5HA 1X7QA 3KYMB 4FQ1H 3QFJB 2LAGB 2YXMA 5DJAB 3BO8B 1G1YA 1ZAGA 2Z92B 5D1ZB 3BIBX 3LEVL 3VU2A 1X4ZA 4P9MH 4S1DC 1NL0H 5JOEA 2FX7L 4NGHH 2DOCA 3G5XB 3C2AL 1S78C 3NPSB 4KRMB 5D2LE 5A2IH 1RK0A 2P24A 3SKNB 1QFWM 2BHZA 1T22A 2VDQH 2ZUQB 1IM3B 5MERA 1P7KB 3WKML 2PYFA 5HHOD 3HC0B 1Q8MA 4PRPB 1I8IA 5IVXB 2EIBA 3C09B 2P5EB 1FORH 3IGAB 2EXYD 2DAVA 3DMMB 2X4TA 3RZCD 1IGFH 5GJSL 5EU6A 5ICYB 2FJHB 3DWTA 3KLDA 4HS3B 3BDXA 3KPSE 4H26B 5BZWB 3QCUH 4X6EA 3ULVD 4XNXL 2R69L 1KCSL 3OKEB 4Z95H 1DN0B 3QO1B 3H7BB 5FB8A 1FE8H 3D85D 1K4DA 4N1EA 2BFVL 1QSEB 4M7LL 1TTFA 1QG3A 2VQUA 4X7FC 4NJAL 5H94A 3W5MA 2P5WD 3MRMA 1MH5B 3SJVD 4X99A 2FR4B 3E0GA 4HKBB 4UB0H 4ZO8A 4ZOEA 1DQDH 2BSTA 3PL6B 3NN8A 3EO0A 2AGJL 1LO2H 1O0VA 1K2DB 3MBEA 5CJBA 5IK3B 1U8NB 4JN2B 5AWNL 3UBXA 3U7WH 2XWBB 2HVKA 1CFTA 3LVEA 1MWAA 1ZHKA 1SEQH 1NSNH 1VERA 4G7YH 1MCBA 4O4YL 4Z8FH 4CVWA 2NY4D 4FQ2H 4Y2DD 2A73A 2HKFL 1T04A 3W11D 3CX5J 1QACA 4TUJA 3RFZC 4NPYB 4XCCL 4KK8C 2XKNB 4FP8L 1UXSA 3B9KC 5I1KL 1MCDA 4UDTA 1D5XA 4M93B 3ZE2E 3NMEA 3HPJA 5I16B 4OZGA 3WN5C 3X3FL 2XN9D 1LHZA 4RGMB 4G80A 3VXOA 4GKSB 1VFBB 2PO6A 1I3RA 5ACMA 4KH2A 2X4NA 2P7TA 2LABA 4X0KB 2R4RH 1QBMH 5HHNA 3U4EB 1PJ9A 4K7PL 1CVRA 4MD0B 2ESVE 2WK2A 3JXAA 3F7VB 5KVMC 1P6AB 4OZHE 4GRWF 1LO3L 1NGWA 3NCEB 1TJHL 1UXWA 4CADB 5FM4A 5D1QA 5EH1A 2VZ3A 3U36A 3Q2CA 3KPSB 4URTB 1FFOB 5JIKA 2YA0A 1EPFA 1EIBA 3N85L 5E4EC 4BM7A 3TA3B 2V9TA 1UM5L 2HFEB 4Y4HC 5ADPH 5BMFH 5FCSH 2R2BB 2CLVB 4PY7B 3E1F1 5F7YC 2ZNXA 4UBDD 1FVDA 1Z0MA 4JDTH 3QUYC 5A1AA 2BSSB 4NQDD 4Q58C 4DAGL 1XGYH 1VEOA 2BDNL 2QR0B 4JGMA 3HKFA 1I7RA 3QIUB 3MNWB 3BD3A 1F6LL 4O02H 4MS8D 2R15A 1CWVA 4PR5A 1G7LB 4M6ML 3ETBF 2D7TL 2B4CC 5E8NA 1PQZA 1LP9E 3EYSL 2J3SA 4BSJA 4GH7B 3RWCA 3TNMB 1RHHA 1WCBA 5ITFA 4NRXA 2PXYA 1IRAY 1UYWL 4NKIH 2RQ8A 4PJ8B 4HJJH 1RIUL 3IFOB 4YHPB 1S3KL 5L0QB 5IQ9B 2VISA 3S37X 2D0FA 3EJYD 1DEEA 1I1AD 5C2BL 4LASH 3N1GC 1S8DB 5I19H 3VXRA 2A9MH 4LSPL 1NDMB 3BEWB 5D7JA 4V2CB 1T3FA 2ESVB 3CC5A 1PEWA 1PGRB 5CKGA 4YH6A 5MP6L 4AIZA 5FM5M 5C0CA 2NX5D 3WFHA 5B39G 4LEXH 4RGNE 3C6LB 2Z8SA 43C9A 3U1SL 3Q6GH 5F72S 3WD5L 3TT1H 2FGWH 2BC4B 1IEAB 5DMIH 5JW4N 1K4CA 4MJ5B 3JV4B 3RVWC 1BBJB 3TH4T 4QRSA 35C8H 3SHSA 3MRQA 1IQWL 3ULUF 2NZ9D 4BZ1H 3PG2A 1Z3GH 3QIBA 3N1MC 1MFNA 1LNUA 1DVFC 4OI7A 1T7XA 1XF3B 4IRZL 4OKVB 3F8UB 4R2GD 3F62A 1H8NA 2F8XC 2OK0L 3WJLC 5I1DA 4XP9L 3WCYA 1QLFB 4LCUA 4UNUA 4ETQA 3OAZK 5CCKL 3X13A 1C7SA 2HTKC 4QHLB 4YDVB 3T4AA 2DB8A 1HQRB 5J13B 4LGRB 5C8JB 2E9BA 4O58L 5KS9B 2ADGB 1Q72H 5D2NA 3RWEB 5JA9A 2C1PA 5ENWA 4JFZH 4NN7C 3G6JE 3MMEB 3BW9B 2OTWB 5GGUA 2YPLA 5A16A 2FH6A 5F21B 5MHSD 5IMLA 1IAII 4L9LA 1MVUA 5LCVH 1M05A 3NA9L 4JVPA 4I0PD 3BRFA 2N1KA 4WIQA 5KSBF 1F90L 1KUMA 1D9KD 2GSIA 4LSSL 1CFVH 5CINH 3JWDC 1TVHA 2Z31D 4C56E 4TTDC 5BS0E 2B4CL 5I0ZA 5CUSH 3P9LB 3HRZA 1NFDA 1TZIA 1T0MA 1G7PB 3KYNB 5FYLH 3QULA 4Q6IC 5C1MB 4J3XA 5F9OH 1OP5H 2FDBP 1NBVL 4OGXL 5SX4I 4EVNA 3V5DA 4O2FB 2VLME 3VG9C 3P30H 3DBXA 3W9EB 1MFAH 4XCFL 3JVGC 4U6HA 2H6PB 3VFSB 3BE1H 1FV1A 3RGHA 4P4KA 1MHPH 4NRYB 1SM3L 4ZPVA 5EA0H 1A7QH 3WUWG 3S35H 1KTKE 3UTPD 1F4XL 4N0UA 4TVPH 4KXZI 2ADJA 4HCRA 4ZFZB 1M7XA 5C08E 3RIFF 5C9JA 5B38G 2DWDB 4NZJA 1KLFA 2YUVA 5IWLC 3CFBB 3MV9D 4J4PA 1J8HB 4P5MB 4JY4A 2BNRE 4J12A 2ICWJ 4GW1A 4W6WB 4R4BB 5DVLA 5KSUB 4JRXE 4DEPC 4NNPH 8CGTA 3T0DA 2G5RA 4H88L 4PTTA 4AZ8A 3LKPA 2R9HC 3HC3H 1HH6A 3DRTB 3BDYH 2J6EA 4M7JL 1U8HB 1RPQA 1HOCB 3LPFA 5E2VH 1H3PL 3G6JB 1KNOA 5DMKA 3MRIB 4KY1H 4OD3L 1MWAH 5FHBH 2K9UA 2IGFL 5CGYC 3OKNB 2HH0H 4X6DA 3HNVL 4LOUD 3DVIA 3L5WA 1U8IB 3HE6A 1BQLL 1E4KA 1UWXK 4OF0A 3V7AE 2R8SH 1AJ7H 4WHYG 1G0YR 4FXGB 3ARDB 4X9GA 3H42L 1YY8A 5TF1L 2X4QA 5BS0B 2OM5A 3WBDA 4QKXB 5FA3B 1N6UA 4F7EB 1MI5A 3PXJA 1U8LA 4HT1L 2WSKA 3QHFH 5CLTA 5I8CA 2MMXA 1CICD 5JW3L 2IAMB 3G5ZA 4QHMB 3FN0H 3WUZA 3MJ6A 1HZHL 3JWDL 4PLJD 1EAPA 1EEYB 1KXQE 4LSTL 1F4YH 3LEYL 4ZOCA 2DM2A 1CL7I 3RVUD 3KAAA 2ADIB 2VH5L 4JDZB 5D7IE 4KKCC 4K9EC 5JIPA 2F53E 1M7DB 1ZA3A 1BM3L 3UPAA 2AERT 5DMYA 4IHOA 1DFBL 3VFMB 2BNRB 1R3LB 5C0GA 4BQBA 3DGGB 1G6RA 2EDKA 5I1CL 4JRXB 4E42B 1FZKA 3INUL 5AUMA 3CUPB 1NANH 3FO1B 2KBGA 3CJJA 3QDJA 1Z6JT 1A3LL 1INDL 3TZVD 4XBGA 3MPCA 5IG7A 2NXYB 4Z7WE 3PDGA 4WHTA 1I75A 2X10A 5CMAA 3QUZB 1A02N 2M26A 4XXCA 3QCTL 1SQ2N 3QQ4B 5E8DH 1AO7D 3GBNH 5FO8B 3IDGA 1VACA 4JAMB 1B6UA 5E9DA 5IMMB 3ZSSA 5SWQB 1K5NB 4U1HB 1NLDH 3SDAC 3O9WB 4DK3A 3ZDXE 3BH9B 1RZKH 1J0ZA 2QADC 5EZIL 1RUKH 1I7ZB 3VFUB 4WWKD 2EDYA 3SQOH 4KZEH 1T7ZA 3SDDD 1XR8B 4NWUH 1TMCB 3S96A 4RIRA 5ACLA 1YEDB 1G9NH 3S34L 3F7QA 5AZEL 2ZPKH 4XHJC 5JNYA 2HJKB 4JFDD 4MAYA 4OFPA 1E4XH 3OKKB 2ZUQC 4FQIL 1A7OL 4G9FB 3CFCL 1R3JB 1TVBA 2EDHA 3BPNC 1JGUL 3EOAA 3I2CH 4O51B 4M1CD 4L29A 5MEPA 1YYMH 4CN4A 1ZGLM 3WMSA 4J8RB 3NAAH 2DICA 3C09C 3G04B 3LS4H 3H7LA 1DANT 1SYVB 3DMMC 4KI1A 1YY9D 3O6FD 1MRCL 1CGTA 3DV6B 1G9MC 4M1DH 1R5WA 4G9DA 2F53B 4YHKL 4PJGE 4DQOH 1JMXA 2P42B 4KK5D 5I66B 4MA7H 4POUB 4PJ7B 5HYEA 4KHTH 3BP4A 4IIQA 2FYYA 1W2KT 4PRHD 2V7HB 3FO2B 4I1NB 1WITA 1QSFD 2ED8A 2IANA 2X4SB 1DBKH 4LLDA 4K9EL 2E7BA 1QQDB 1II4E 1JPGB 2BXZA 4MX7A 5CHNA 2ITCA 2UWEB 3H9HB 5MENE 4C58B 2AEQH 5DQJB 3H0TB 3OL2A 4NQXA 2DDQL 1HN1A 5HPMA 1QSZA 3BZFA 5EO1A 5TDPA 4XCEA 5I76B 1MCNA 5GS3A 1CG9B 5HHPB 2X40A 4LHUB 2HP4A 2A6JB 1QSVA 1FFNA 4M93C 2CRZA 3L3IA 4ELMF 3K1KC 3MZTA 2CR3A 1ZWIA 4CN1A 2WANA 2GTZB 1T1XA 3C5JA 2MNUA 2EH7L 1A22B 3NIGF 3OZ9H 1ZMYA 3E3QE 1XGRB 4Y4FA 3TO4D 5GGVH 5EU5A 1FVEA 3L7FA 5DO2C 2ILLA 4QHNB 4NQEB 4U4BA 2V9RA 1PKQA 4EDWH 2VLRD 4ODVH 3EBAA 3PP3K 5DS8A 4XAWH 4GQ9H 4XAKE 5F9AC 1S7SA 4FABH 2VDNL 4NQCD 5JDSA 3KXFE 4WHDA 4OTXL 5T3ZL 3GSXB 5ISZA 4HCRH 3VFTB 2ZSVB 2VXUL 3FMGH 1RZGA 1M1SA 1N59B 2AV7B 5I1LA 3QJHB 1FFPA 5IBTH 4XP1H 2UY7A 3MLVL 4MWFB 1G9ML 2MWCA 3MRGB 5ELIA 1I85C 1S5HB 3SY0B 4PGDB 1P84J 4DUXA 3QEQB 1CFQA 2VO5A 5C0NC 3KPRE 1U95A 2QQKH 4N0YL 4PJAA 2J6EH 3T3PF 2I60L 4K23H 4K94L 4EXPX 4FG6D 4FQHB 3VG0L 2HT4C 2EO9A 4QF1A 3SO3C 1KIUA 3IJYB 3WFZA 1BIIB 4N9OB 5EG6C 1J0YA 4X6CF 1RUQH 4ZAKB 5KSAA 1BQSA 4PJ8C 3MA9L 4WNQB 1MFCL 2HVJA 1DN2A 4RMUA 4GBXD 1KJ2B 2R29L 5GS0D 4HUVB 2EC9U 2EZ0D 1A2YB 4IRSC 4X7SL 3FO0H 1N6VA 1S7VA 2FX9L 5EOTB 1CFSB 4MCZB 5C0JB 3X17A 3GNML 4HKJB 4FQJL 3BSZH 5DK0A 5DT1L 3FB5A 4XPGH 2HTLC 5ICZA 2GHWB 3MLRL 2J7LA 4MA1C 3HNTH 4IEFB 5DJ8A 3P4OA 4YHML 2CUIA 5D6CA 2LU3A 4GAYB 5F96H 2HLAA 2AW2A 5DD3L 5DSCB 4Y7MA 1OAUH 4FQXA 4LRIA 5EBLA 4LKCA 4G6JH 1G6RH 1MEXH 1ZLSH 2XQBL 3ZT7A 1F6AA 3RIAK 3BOVA 3VFOA 2H2PC 1N8ZA 3TJEL 3AM8A 4RRPA 3VI3E 3VRJB 4MJIB 4Q0XH 1AHWA 5DRXB 2B1AH 3GMQB 5D7LA 3CCHA 4FRWA 2YPVH 4GAGL 3UTQA 2DYPD 2JJUA 3V2AR 2QSCH 3TH3T 5CZVL 4QHKJ 1VADB 2AK4E 5HHNB 4OGAD 2BP3A 4QXGH 3REWB 3QG6B 4Z5RA 5D6DA 3RVTC 1NJ9A 2IBGA 1MHCA 4JKLA 2MKWA 3O6LL 2A74B 4L4TD 4O2CB 4ONFL 3HA0A 3BIAX 4WI3A 4NZUL 4HC1L 3Q1SH 3K2UL 3V4UH 3QZWB 2OI9C 5BW7C 1WT5A 5GXBB 4PJDA 4KTEH 2G9HB 1HSBA 4JREC 4MMZC 3D39E 1TJGH 2UYLA 4GT7A 4RGNC 1K6QL 2ID5A 5C0RL 1GYAA 4UOW0 4Z77A 1WC7A 5GGQL 5IKCA 1BFOA 1S9VB 3F6IA 3BKYL 4WFFE 3BQUB 3ARGB 2O5XH 3MRRB 4HG4J 4M8QA 5LGJB 1RJLA 1N0LA 3GHBL 3AU1A 1K8DA 2XFXA 5D9SB 2VKWA 1F58H 1KENL 1KN4L 4HF5H 3RVVD 1YJDL 4QWWC 3JWOH 5TDOB 1ORSA 4KQ4H 1UH4A 2BMKB 2I5YL 1JTOA 2CDGA 4OAWA 4OD1H 1NGZA 1HEZA 5E6IB 3C5ZD 3NBNA 4G7VH 2X7LA 3OKYA 3UP1A 2DBJA 3NTCL 1MIEH 1UA6L 5DDHA 4RMTA 5T1MB 7FABH 1KJ3L 4U1KA 1N3NB 3HZVB 3VFVA 3ECBB 2AK4B 1JN6B 5CD3B 1QBAA 5DEFA 5BVJB 3KHOA 1LWRA 5JHDB 3ARDC 5DLMH 4OJFL 1XCTA 4PJ5E 1DSFL 3S37H 3KGRA 4DTGL 1D5MB 4WU5B 4Y19E 1FPTL 1J1PH 3ARBA 4PJ7F 2WMPA 2ZG3A 5IQ7H 1HH9B 1QFHA 1Q94A 3GSUA 5CJ8A 3BYYA 1CLYH 3ZTNH 4KJPD 4S0SD 4M00A 4J6RL 4U31A 3FZUD 4WU7A 5IVNA 4XNQB 3DX6A 1D6EB 2ITDA 2FEDC 5GGVY 1AD0B 1A7NL 2VDRL 5ERWB 4HUKB 1EBPA 3UTTE 1CZ8H 4LLMB 2VERN 4WO4C 4DGVH 4I3GA 1G7QA 1ZANH 4GSDL 5T1KD 1OAZL 2O5YH 5DJ2B 4U1NB 4FFVD 3B3IB 5CILH 5JQ6L 3ROOA 5D72L 5CEZD 4D94A 1NCWL 5DD5H 1BECA 1NCTA 4G8EB 5FOBA 1ZLUK 5GRJL 4LDLB 1KXTB 3V0VA 4JFEE 1S7WB 1SEBA 3D9AL 2NY5H 2ICCA 5E95B 3RGVD 4ZXBA 4XNMA 1EV2E 1WISA 1WJ3A 2ADFH 3RPIB 5IM7B 4ORGB 4DFHA 4P2OA 1AXTL 1BQHA 4YBLB 4LVHB 4OLXL 4RMSA 2OL3A 2XKUA 3O9WC 1PW3A 2D31B 4N0FB 3WFCL 1L9NA 3IDUA 5I1AB 5KZCB 1AE6L 5D70H 2BOBA 1JZ3A 1AGCB 4HSQA 1BVLA 1I9IL 3HUJE 1UC6A 5SV4A 3A67L 3SE3A 1QA9B 4MAUL 1PLGH 3MLWL 2Z4QB 1OLZA 4FFZL 4TN9A 4BFIB 4EN3D 3WLBA 2P8MB 4KKBC 3OJVC 4OV6F 3G6AB 4APQB 3AMKA 1IC5H 2DLFH 1QYGL 3R06B 4UAOB 3VH8G 4G6FB 4AEHL 2EYTA 5JR1L 1JPST 4KTYA 2XT1B 3S88L 3W9DB 1U3JA 1P4BL 3DVNB 5D5ME 3UTTB 3DXAA 3ULUE 2Y07H 3V52L 2AQ1A 2Z91A 2GFBA 4P3CH 2GITB 3NFSL 4FXKB 4Y16B 4G6KL 4OM1L 1UB6A 5EU3B 1XCQA 3VD4A 4E0RB 2YBRA 2ED7A 1RUAH 3FCTB 2NXZD 1DQTA 5HJ3A 2VLKD 4M61B 1QFWL 5A2FA 1U8JB 1HIMH 4NDMA 5INCA 3RI5F 3LKNB 2DQHH 4MXWH 5IOPA 6CGTA 4JFFA 4JFEB 3L95B 2BZDA 4WV1C 2JJSA 5EN2B 5FYKU 3OAUH 4JM4L 1ND0B 1JNNL 3N1PC 1EMTL 4XWGH 1GZQA 2E8ZA 1B4JH 1RFDL 1VGEL 3PE9A 4R9HA 4HMDA 4LPWA 3VDAA 4QOKA 2AVGA 3LRHA 2IBBA 5JHLH 4HWBA 3KPNA 4D0BA 4JG1H 1U8KB 4FQLH 5IIEB 4P4RA 4D9QD 1FL6A 2NY1D 1KEGL 3G5ZB 1U3HD 3NIDE 3NACL 5I8KL 3F7PC 5F6IB 1A6VH 4NKDA 5IVZA 4F15C 2Q8AH 4AJ0A 3SDYL 3S3PA 2R2HB 5M95B 2VZ1A 4OM0L 4OF6A 3VWKD 4BJLA 3VXUD 2B0SL 4R0LA 1ZA3B 4S1RL 3QEHB 3EDFA 5T5NF 1TETL 4ZS7H 4FHBD 5D5MB 1DBAL 1IKNA 5C0BE 4QRQA 3M8OH 4AIOA 1BWWA 4GOSA 5HD8C 1RU9L 2OTUA 3BXNB 2ATPA 3OSKA 4MDJA 1AQKH 3O6KH 4OZFG 1JRHL 5H8DA 4OZGF 2YD5A 4IMLA 3WXVH 3WJJC 3BGAA 3DX7A 3K8MA 5IBLC 1UQSA 4AYFA 2C3VB 4HD9A 1S78D 2BJMH 5IW1A 2F19L 1DLHA 4GUPB 1C5CL 2QSQA 4NUGL 4H1LH 5JZ7D 4XC1H 5HHME 2EEDA 3DX9A 3MGOB 4Z7QF 4AG4H 3LV3A 2HMIC 5FA4B 5FYJE 5DUML 2VDPH 4Y1AB 3B9AA 1RSFA 3U0TB 1VFAB 2OJEA 5HHXL 3MREB 1QLRA 2DQDH 5K9KA 4LHJB 3GZKA 1FSKB 4S2SB 4EOWL 1UFUA 1QRKA 3BP6B 1HDMA 1KFAL 5C09E 3ULVH 1YEHH 2LVCA 2EIZA 1YUHB 1B90A 3V79C 1XGPA 4FQCL 3REVB 3IVKB 2VNCA 1JJUA 1Q0XH 4JZNB 3C8HA 1CCZA 1KXVC 3MA7B 4XPFL 3LQMA 3LIZH 4WUUA 4XNZB 3VXMA 2YA1A 3D0VB 5K59E 3BH8A 3GUTA 3SCMA 5E99H 3E3QC 2X09A 1EJOL 4ALAH 3PGCA 1BJ8A 5EBMA 3ZHDA 15C8H 2Z35B 8FABA 3VI4E 5EZOL 1YNLH 2VDMH 4P23A 4ZNEA 3GMPA 2FYYB 2C3GA 1JP5A 4MJ4A 2JCCA 2IQAA 4L8SB 3GFUA 1OVZA 2K1MA 3RZWA 5BXFA 3SO5A 1S7XA 1E6OL 3DVGB 2DQFB 4U7SA 1IGTB 5C6TH 4AT6A 3VXSE 4M4RA 5ALCH 1HWHB 4PGZA 2J4WH 5DYOB 3CVHB 3M1BA 1Q9WA 4YEFA 3SOBH 3V8OA 1ZSDA 2FECI 4YFEA 3UPRA 3P11L 1FZOA 3NCYS 1QLEL 5IEHA 4NC2B 1EDQA 4NT6B 1Y6MR 2OBGA 2APXA 3G5VB 3IDMA 3QH3A 1BLNA 1ADQA 4G43A 4NQSA 3CX5K 1EAJA 4Y88A 3T0EE 1JGVL 4OB5L 1JZ8A 1C1EL 1WQVT 1WFNA 3D3VE 4PRAA 4R3SB 4P5TB 3GHEH 4PTUB 1MAML 3NZHH 4UU9B 2CIKB 2EECA 5DHVA 4Y4HD 2OL3H 1QR1B 3DROA 4PJ9C 2P8LA 2OTPA 4HX1B 2C4FT 5IBUG 3KR3L 3TVMB 5KVDH 1WICA 3QDGD 4K07A 2FO4A 4L4VE 4X6FB 5J1AA 5IGXL 5L6YH 1JHTB 1P53A 3BGMA 5L9DL 2CK2A 1XGUA 1XF2A 5C0AA 4IOFC 4C4KT 1NEZG 1YEKL 5F6HJ 4I77H 1MJ7L 2J8UB 1D5BB 1WAAA 4BSWB 4I9WE 1EHLL 2PYEA 4WENB 4JHAL 1B4RA 2NTFB 4XCYB 4E41B 4KRPD 1GGBH 2VDKL 2YUXA 1CDYA 1NAKH 3VXSB 4YIQA 5JPNB 1DTUA 2Y36H 2F54E 2R23B 1J1OH 2CMRH 3FQXA 2XZAH 4NFBA 4JPKH 1U95B 1AR1D 5EUKB 5D71H 1FO0L 3MC0A 4UNTA 1KV3A 3DLQR 1ZLVK 3ZDZE 4LRNH 1NMAH 5IF0A 5ITBH 3ZE0F 3P4MA 1FQ9C 2P8PA 4YXKL 5BOPA 1KLGB 1NEUA 3DIFB 3CZFB 3LKQB 1R3KA 1SY6A 3KDMA 5BOZG 5DJZB 1MCFA 2CDFB 3OF6A 4HWUA 5F3BA 2WINA 3STLB 2HKHL 3T4YA 2NPLX 3RKDC 3VFNA 4JQXA 1GPOH 5JXEC 2V2WB 3HG1E 1VGKA 4KKAC 3NZ8B 4K3GA 4LLUB 4YBQC 1X5ZA 1BZ9A 3GIVA 4HEPG 2Y06H 2A6KB 4HWBH 1X3DA 4ELME 4DVBA 3DX8B 3HI6H 4K55A 5FF6B 3DJ9A 4BQ6A 1TZHA 2R0LL 5L2KA 5ID1B 4ZPTA 4EBQH 1L4IA 3RIFK 1EHXA 4YQXL 5BZDB 1MJJA 4XNYL 5IHZB 5E24E 3O0RL 4L4VB 2OQJB 3EYQD 3Q5OA 4JRYE 4PRIE 5CP7B 1OSPL 2HTKD 4M7KH 3WUWA 3SE8L 5KSVB 3OAYK 4X6DF 4XPAH 3TFKC 2XA8H 1T1YB 1ZK9A 3C08L 4LSVL 1MHEB 4MXVF 1K8IB 1DANU 5E8EA 2RFXB 4FQXB 2JB5L 4YAQA 5HHOE 3KPPA 5FDYA 4M7ZB 1P7HL 3BMWA 2NY7H 3RJQB 1GGYA 5B8CC 1BD2D 1EO8L 4I2XB 4NO5A 5FCUL 4ONGL 3MUGA 3EDJA 4AK1A 4XP4H 4XPBH 1A7RL 1INEL 3K4ZA 4P2QA 5DRWB 4ODXB 3QUXB 1S7QB 4TUOA 2HRPL 2W9DL 4JPWL 5K9QG 3GGWA 2VLRA 5EORL 1D6VH 2P5WE 3GSVA 2FHBA 1T89A 5HHVL 5J6GB 5GJTL 1AIFA 3U46A 3SN6N 4Q74A 1M71B 4XMKH 1NC4D 3CIQA 3WS6C 2YD7A 5IROC 1N5YH 3ZL4L 5EC2B 3N9GH 2DTML 3QFDB 3WFEL 5J11C 4EI5C 4Z7VA 2VXSH 4TRPL 5GIRA 1JWSA 5DC9B 3O2VH 5SWSD 5EOCH 2AV1B 3BP7A 3S3JA 4HIJB 4M7LT 4LARL 3DUSB 3DOSA 4NJ9H 2D7MA 4PJCE 4PJIA 3RUGE 3PQYE 3T65A 5GS1B 2BXYA 1W72B 2R9HD 4JFQA 4HXAL 2YS4A 5AZ2H 1TCRA 4KI5E 5KVFH 4U1LA 5HYIA 1T7VA 3B8SA 4S1SL 4H1LB 4X4MA 3WLWC 4EDXB 1RULH 1HQ4B 3UTZA 4JJ5B 3V0WH 2P45B 5GSRB 5TDNB 5HHOB 2PW1A 5SWZE 3TBYA 3T2PA 3UJJL 4RZCA 4OBRA 1LGVA 4R4FL 5DR5H 3STZA 1N5AB 4JFPA 4U49A 3SBWA 1FNGB 2GQHA 3RZCB 3DRQA 1C08A 4HLZG 1URLA 3THML 5IESH 4LKXA 1P2CB 1YEJH 2JJTC 1MCJA 4Q2ZA 1I1RA 3MRHB 1H0DA 3D85B 4Z7NF 2JB6A 2FEEI 1AGEB 3MRCA 4P2RD 2W0FB 3MYJB 3TO2B 2P5WB 3OKMB 2XNAA 1JK8A 3SJVB 5C07D 4MXQC 3S97C 1BVKA 3GRWA 3TPUB 2C9AA 1NKRA 1QNZL 4L3EA 5TE6L 1NGQL 1ZA6B 2CXKA 1I9RL 3KPMB 4I3RH 4OF5A 4TNVF 5K9QI 4LLWB 5HYJA 1ADQH 1ZS8A 4ETYA 1SJEA 4NQDE 4K7PX 4H5SA 2AXGA 4KKCD 2FX8L 2FL5A 2ZUXA 4XNUH 4ODHH 5SX4H 3CDYA 3QJFA 4Y5XA 2NY4B 4RNRB 4Y2DB 4F33B 2KH2B 3LN4A 3A6CL 3TEUA 4GG8A 3TV3L 5DHVH 5F6IC 4X98A 2R2CA 4KZDL 5I15H 4QRRA 3CH8A 2V5MA 1I3UA 4R8WL 4IMKA 2E6QA 5GGRB 2APBA 4FTVA 1WWBX 2FD6L 1I8KB 2WBJA 5FUZL 4IDJH 2W92A 2JK5B 2XN9B 4OLZH 5GHWH 1FAKT 5DF0A 3BZDA 1W0WB 3OR7A 4PS4H 3BN9C 5FUOL 1KELH 3RDTA 3SDAD 4F58H 3VFGH 2BSRB 1SMOA 2DD8L 2QADD 2YMXL 3T77B 4ODBD 2NX5E 2IMMA 3L3JA 3EOBB 2HA1A 3OAZH 3E6FB 3OJMB 1H15A 4LCYB 3QT2A 1SVZA 5I1IH 2R1XB 1FC1A 3SKMB 1PZ5A 3BEVB 4UV7H 3RNKB 3WO3B 3GSRB 1YNKH 1P69B 5D8JH 3MLZH 5I2IB 4B53A 4LCWA 1AQDB 4UILL 5JQHC 5EC1B 4PJXE 3FFCE 4JKPL 3HHRB 4MNQE 1N2RB 4DCQB 4BQCA 2GW5A 1RJYA 3CLEL 3B8YA 2J8UF 1G7MB 1YYLL 3KHQA 2QSTA 4M48L 3ILQC 2VMFA 1SY6H 4CNIA 4NQDB 1PSKL 1FSKC 3MRJA 1O5DT 2PW2B 1MJ8H 2V2XA 5IB1B 4PGCA 1JF6A 4OFYD 2KZWA 4QRPA 2AABL 3O4OB 3PJSA 5TE7H 4ZUWB 3DUHA 3EHBC 4YHOH 2NY6C 1RIHL 3V6OA 1NCCL 1KTDB 3KJ4C 3PHQB 4PJHA 1NCAL 5FECA 1WUNT 2C7UA 2IH3B 1FNHA 4G5ZH 3V5KA 4XNZC 5INDA 3JUZA 3O45A 2BVTA 4Y4KA 3OGCA 2HAZA 4P5KB 1OGAA 2AJSL 3G5YB 2AKRB 1I1AB 1U58B 2EDRA 4X5XA 1DE4A 1ZGLP 5KN5B 2BHYA 4XVUC 3TIEB 3MCLH 1MFEL 3LQAC 3ARXA 2ORBH 2Y72A 3ARZA 3QUML 1QKZL 4NP4L 4M5YL 3VRLE 5ESQB 1YN7B 2NX5B 4ZODA 4G6ML 1JPSH 4XX1G 3T0AA 4WFGE 5JLZB 2DQGH 3O3DB 1DLFH 5E08L 3ULUL 1AI1L 5CP3H 4BZ2H 5GZNC 3WL9A 5F1IB 2PR4L 1F3RB 4G8GA 5J1TC 2XZQL 1D3CA 5KOMC 3W0WD 4UUJB 4R2GB 2AP2A 3HPLA 2R0ZL 2XTJD 1UWXH 1V7NL 3IFPB 2RB8A 1E28B 4QT5B 3HFML 3HZMB 3B9DA 1MRDH 1CXFA 3MRLB 4OLWH 4Q6YA 5IJVB 1ZT1B 5LQBL 1YEIL 4OV5B 4C83A 1ZHNB 2AJXH 4WHYH 5T1LA 4HDIB 3ISWA 4BK5A 4P5TC