1KNOB

Crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
DVKLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGDYYGSRGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT CNJ206
publication title Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
pubmed doi rcsb
total genus 47
structure length 220
sequence length 220
chains with identical sequence D, F
ec nomenclature
pdb deposition date 1995-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1knoB01
3QG7H 5C3TA 4JQVC 4LASL 4M8VA 2PCPB 3H9HA 4ONHB 4YR6B 4CW1A 4PJ8C 3WN5C 1KXTB 1QTYT 1CGSL 4QO1A 1KBGH 5EA0H 1J87A 4F7MA 1IGTA 2R1YB 1FG9C 5E4EB 3UROR 4CVWA 5CZXC 5DRWA 5DD5L 3SJVE 2DBLL 1YEGH 3MRBA 1OARL 4PRDB 5H2BB 4RFOL 2PETA 5F6HJ 1QPPA 1A6UH 3EJYC 4H8WC 5FYLE 5F96L 1EXUB 2HFFA 1WCBB 3VGEA 4EUPH 4WIQA 2WWMD 1UJ3A 5TFSH 2EDRA 4GRWE 3NFSH 4NN6B 3FTGA 5JDSB 1OP5K 3ECBA 3W0WB 3NN8A 1LHZA 4U7MA 5D93B 3D1MC 2PTUA 1NCCH 3QIBC 2AKRA 1BOGA 2R23B 4L8DB 4FQIH 3CH1A 4ZTOL 2DDQL 4Q7DA 4MQTB 4OZ4A 4ERSL 4TSBL 3MYJA 3FB6A 5DMGC 5EORL 3DX8B 1KLGA 5J1AA 1U93B 2XTJB 3KLHD 1BMGA 3HI5L 2H2SD 3KWWB 5DQDL 5SV4A 4ZS7L 1JYXA 3SE9H 2NY3B 3EZ8A 2FLBT 3BP6A 3MFGB 5EBGA 1HXYA 3JWDC 2HKHL 1MRDL 3O4OC 5CBEB 5HYSB 2B5IB 3FO9A 4X9BA 4OFPA 1WVZA 2YMXH 1N64H 5DR5H 2HJKB 3PHSA 3VXMB 3ULVF 1BBJB 1MFCH 3PABA 5HDBF 3OAYH 2R29L 3SGJC 1M71B 1JTPA 4DN4H 2NY1B 5BZDB 1JNNL 3UJIH 3V4UH 5F7HA 1JMZA 1XGQB 4JM2B 3BAEL 1CG9A 1F4YL 5F8QC 3RVUC 3WS6A 1EX0A 2R39A 1CR9L 4HS3A 5D1ZA 1DVFA 3X13B 3RWIA 3MUGA 2NY7L 2EKSA 1OOAA 3SDXB 3U48A 3CLFL 3SDCD 1CLCA 1RUPL 1PGRB 4K3GA 1YJDH 3B5TA 1N6VA 2YEZB 2FWOA 1SJHB 5JLZB 1NLBH 4YH6A 5ALCH 4MSWB 2WLYA 4LNVA 2DLHA 2YSSA 5J6HB 3GIZH 3MJ9H 4K3JH 4NKDB 4HUXB 3VG0H 3BXNA 4GXVH 4Y16D 4F37F 5J1TC 1FNGB 5E5MB 1PFCA 2DWEB 3U36A 3MMEB 3RY5A 2FJFB 3GMMB 3U1SH 1BFTA 2MSPA 4EI5C 1IZJA 3M07A 1Q38A 1SEBB 3CZFB 4U3HA 3MLUL 1VGEH 5IVXF 4WI6A 3MNVB 2NR6C 3DIFB 1NGQH 4G6KL 3F7YB 4PJ5A 5D4QA 3O8XC 3MRHA 1CBVH 3EFFB 5L2JA 3DGGA 3ARPA 2P44B 4ETQA 3ARFD 4YK4C 3CDGB 4WDIA 2VZ3A 2VDPL 5J3HC 4K3DH 1G7PA 1RZGB 4IBLT 1YECL 1B0RB 1JWUB 4PV9A 2AK4A 3GMRB 4ZO7A 5EBMB 2OCFD 4G43A 3EAKA 4PJBE 1J7VR 2Z35B 2Z31D 1DQQA 2YD7A 2K3TA 5F72S 4NWTL 5DVOA 5DQJB 2F74A 4G6JH 4J1UA 5A1AA 2E3VA 3SN6N 1JGUL 1GGBH 5I74B 5E08H 5HHOD 2OMNA 4GMTH 3CUPA 2I24N 1FORL 1AQDA 4PRAB 1L7TH 3IDJA 1ZHNA 3I3EA 3BIBX 4G8EB 2DL9A 4EUPB 3S37H 4S1DC 1FLRH 3D3VE 5JDJA 3W2DL 3OKOA 2EE9A 1XF2A 3AREC 1MVUA 1U6AL 2CR3A 5DMKA 1SQ2N 3FQXA 4OGAD 1MCPH 1FFOB 2ADGB 3IKCB 3VXQB 1ZHLA 5GS0H 3WIFB 5I1JH 5IESL 3VG9B 3HC0B 4JZJA 3SO5A 3PWLA 1D5XA 1C12A 1KB5L 1B4JL 5DO2D 1KGCE 1N8ZA 3MV8A 5C0EB 4EDWL 1NMCC 1U42A 5HYJA 2DI8A 1OAQL 4LVHB 2VDLH 4DKDC 3OAUH 5DRXA 3GJFK 2A83B 2P1YA 2NX5D 3GSXA 1DUZA 2EIEA 1RSFA 3HZMA 5CJQH 4O51A 5LBSL 3U4EB 3ZT7A 2W9DH 4X5WA 5C7XL 4LGRB 2Y7QA 2Y36L 3WYRA 1P7QA 1HXMB 1GYAA 5I1DA 4NNYA 4QRSA 2GAZB 5FDYA 2MCPL 4BSVA 5ISZD 3LMJH 5C0AA 4UT6L 1PKOA 1MCFA 4WEUD 1B88A 4M7JL 2KL6A 3HRZA 1A4JB 3ARTA 2YWZA 2V9RA 2GFBA 4NM4H 5DFVC 4UV4H 1E4XL 1R5WA 1R0AL 1EMTL 4N9OB 1RVFL 4M48L 3OKNB 4F7CB 5IJKA 5DK2A 1ACZA 2CDEB 3AC0A 4R7DA 3EDFA 3EGSB 2DWDA 1DP0A 3TV3L 3KLSA 4ZDHA 2NXZC 1LO4H 1AR2A 2FBJH 3HE6B 3IAPA 3L5WB 4RA3A 3VGBA 3GJEB 1ZLVK 4P4KA 1LK3L 5IMLA 3WLBB 1SJXA 4PP2A 3ULSA 3DJ9A 3V5KA 2ZKHH 2X41A 5T3ZH 3UDWC 4TSCH 2FL5B 4NN5C 1GC1C 1H3WM 4JB9L 4TVPD 1XGUB 3WJJC 5CLWA 3CMGA 3SDCB 4P2QA 1CL7L 1VHPA 4MNQB 4CVZA 5GRZA 1I1FB 4FQJH 4ZSOE 1ZEAL 5F7WC 4JVPA 4W6YB 4XVUD 1J9CT 4R0LC 4TVPH 4Q2ZA 1S9XB 5I2IB 1FFNB 5LGHL 2HVJB 4MJ5B 1GOGA 4FFWC 1QSFD 1S8DA 1QLFA 3UTQA 3VFOB 1FFRA 2ZUTA 2X89D 1IGML 1J0ZA 2EEBA 4DAGH 3A0OA 3BDYH 5F7UA 2WUBH 1YMMB 5I8KL 2M26A 4OBRA 3RIAF 3V0VB 4IHOB 4HWZA 4YQXH 1OPGL 4LCWE 2P43B 1V7NL 4JHBA 1BQLH 5KSUA 5I1GL 1NMAL 2CUIA 4JFEB 1FFQA 3WUZA 2IBGA 5TPWL 4ODVH 4JDTH 1P5VA 3NOIA 4XPHL 3JV6A 2GJ6B 3SE4A 2D2OA 1XCTB 3L1OH 1OCWH 1OQXA 3RJQB 3OV6A 5E00A 1A6ZB 4GRLD 5T33L 2IPUK 4ZQKA 4P3CH 2VKWA 5FOJA 4Z7QE 3NGBB 4N0UB 4XHQA 1LO2H 4X6DB 5EU7E 1INDL 3OKKB 1EV2E 2EYRB 5BXFA 3STZA 1VGKA 2YD4A 3VFPA 5KBNC 1UXWB 2DI9A 4UT7L 4HJJH 2R0ZL 3B2UD 2GTWA 3VMNA 3QRGL 3QPXL 2ILLA 2PO6C 4PLKD 4Q74A 3JV5A 3TWCH 4RAVB 5DJ8B 1YQVH 2A6KB 3TBYB 4XP4H 4KV5E 5FM8A 1HKFA 1CD9B 2Z93A 4PJIB 2PYEA 2R2EA 5E70A 3EZJB 1YYML 2H6PB 1WEJL 3GSWA 5JXEC 4JFPB 4DW2H 2NY1C 4OLEA 3Q6GL 4ZAKA 2YD2A 1WWWX 1KBGL 5DZLA 1I7RB 5LWYH 2RHEA 4XMKL 5I8EA 1RJYB 3PWUA 2MQCA 4HJGA 3P9MA 4HWBA 1B9ZA 1SJVA 1YEGL 3VXUE 4TTGA 4IRSD 2E9IA 3O4LD 1RZ7H 3IAQA 2CKBH 3SDDD 3D85B 1IGJA 1A6UL 4JFFA 5KVGH 1KJMA 3ZDYF 3GSQB 5JUEL 3EYVA 1LDPH 3QDJA 1DL7H 1AI1H 1NFIB 3WJLC 3MA7B 2CIKB 1M4KA 1GZPB 1IAII 4UDUB 4PTTB 3NFSL 4YGVB 5F1NA 3KPSD 1RZ8B 5IB2B 1NCCL 2E8YA 1KNOA 1HSAB 5E2TL 3DO7A 3D69B 5MEOA 1UM6L 1JPFB 2Y5TB 3SKMA 3VGGA 4FQIL 2OL3H 4XBPB 4G8GA 1BIIA 2OJEA 1S7WA 3QHTC 3BO8A 4ELMF 2EDQA 5I15L 3CVHA 5I6XB 4WW2F 2NMSA 1JPGB 4LARL 4NHCH 5FO8A 3SE9L 1CGYA 1CF8H 2IFGA 3FT3B 5DSCA 2R4RH 3H9SA 3N1MC 4U6XA 3U6RA 4GG6A 1FL3B 4NFBA 4JPIB 3D25A 4KK5C 2YZ8A 3NIFE 5E56A 5J13B 3IVKB 2YMXL 1CFNB 1N64L 5DR5L 4YHPB 4LCUA 1WT5C 4XX1E 1J1PH 1HKLH 1GCFA 3P11L 3B3IB 1CU4H 4WUKH 1IKFH 1MFCL 3FMGL 4HD9A 2ZG1A 4JQIH 5EUOE 4GRMA 4UV7H 3G5VB 1Q94A 3P4MB 2EDXA 1ZVHA 4DN4L 3D39A 1T7VA 4LLDB 5F8RC 3LY6A 3IFNH 3V4UL 3UJIL 1OAZH 1Z0MA 2NXYB 3T1FA 3C60A 4MS8C 5ANMA 2AW2A 3F7VB 1RD6A 1RU9L 4OT1H 5K9OB 1F3JA 4KQ3H 4ODXB 3RWFB 3J7HA 1P6FA 2AV7A 3E6FB 3QFJD 3BQUA 1KCRL 1RZJC 5TJWK 1PBYA 1T21B 4R7NB 3QUMH 3MOQA 1W0YT 2DMKA 1NLBL 4N0YH 4N9GB 3HLAA 5ALCL 3DTXB 4R2GD 4MQ7A 3MBXH 4L3EA 5EPMA 3GIZL 4O2EA 4PRBB 3MJ9L 1ORQB 4K3JL 4JKMA 3VG9C 3NCYS 4GXVL 1OTSD 5HHPB 3GM8A 4UUJB 2Z8SA 4XTRC 4NQCB 3SKNB 4LLWB 4LVHC 5DHVA 1X5LA 1HI6A 4X5LA 1YN6B 3QR2A 1LEGA 4F37K 1HEZA 2HT4D 4WO4A 3ZKMD 4J6RH 1ZLUH 4NQEE 2FHBA 4JDVA 1LEIA 4HIHB 4OLVH 3BESR 3TYGL 1VDGA 1VGEL 1I9JH 3JZ7A 5F9JB 3TIDB 1NGQL 3BE1L 3MV01 4NUJB 1R24B 2PYEE 4Y0GA 4B50A 1CBVL 2HG5A 1F00I 1O5DT 1BX2B 3CFBA 3SEPA 4RMVA 4YDVB 2P8PA 5GRJH 4K3DL 2DL2A 3VU2A 5KSAA 1VACA 2BRQA 1M7IA 2WBKA 1EEZB 3BWAB 4MCYB 1KXQE 2ZCKL 1XR8B 2FECI 1ES0A 1FQ9C 3IKKA 1NCAH 1CWVA 5ADOL 3EO9H 1DBKH 1UQSB 5CJBA 2APTA 3HE6C 1BQSA 2XQYK 1GGBL 2EDWA 1PYWA 3AUVA 5E08L 5EUKB 3P0YL 1G1YA 4HC1A 1W72H 2CKBB 4GMTL 4X4XB 3TNNB 2VO5A 1YJDC 2EKJA 1K8DA 1DR9A 3BIKB 2Y07H 5LKNA 3UEZA 5A43C 3U46A 3S37L 1NBZB 1LK2B 4G80B 5E7FA 1BHGA 1FLRL 1FN4B 1YY9C 4I0KA 3FQNB 3VWKD 4ELKA 4NGHH 2CLRA 3VFNB 5IBUB 2CH8A 5DURD 5D7JA 3MFFA 2OTWA 3PWJB 4I0PB 1DBMH 1MCPL 4HCRH 1IVLA 1F2QA 1YC7A 4Y4FB 3WD5H 5I1JL 5CJOH 2OL3B 2OSLB 4N5EC 3WNOA 4DZBA 3T8XB 3QG6B 1D9KD 3X17A 1AKJB 1G9NH 3OAUL 3H9SE 4HLJA 4WU7B 5DK3A 2KZWA 4QKXB 4L4TA 5CJQL 4YGAB 1QPXA 3BSZH 4YXLH 1OT2A 5HPOA 2W9DL 4MXVE 5GS2D 4D0BB 3QCTH 3KYKH 5DTFB 4WUUA 4WWKC 1NQBA 4BFIA 4KDTC 3V6OC 4CDGC 2ESVB 5T1KD 1U3HD 2J5LB 4PGBB 5TH2B 3MREB 4G3YL 5JIPA 4PRPD 5J0BA 4ZUTB 3DUUA 3KGRA 4EBQL 2BSTA 1A6TA 3LH2H 4FG6D 4O9HH 5IIEA 5E8OA 1UEYA 4NM4L 5GGSB 1FL6A 4C58B 1WFNA 3IDMA 3DRTB 1CDBA 4IRZL 4HKJA 4K71B 3DI3B 3FFCA 3UO1L 3V8OA 5SWSA 2K1MA 3REVB 4J4PC 3T3PE 3QNZB 5B8CA 4QRTB 1CFBA 3C8HA 4OAWA 4JREC 1LO4L 3DVGB 4IS6A 2FBJL 3DWTA 3Q6FA 1HH6B 4OF6A 4XCNA 2F53A 4U1NB 4L3EE 2VSDA 2ZKHL 2HT3D 3QUMB 4TSCL 3VXRA 1IRAY 2BFVH 4LVOB 5AEAA 2ID5A 2X4NB 3SCMD 1N5YH 4MA1C 2K9UA 3BUTA 5TDNA 1RZFH 5GS0C 5CGYC 3U9UA 2IH1A 1INQA 1FH5L 3BN9C 5CJXC 4YDLB 3B6SA 5IK3A 3I6GA 4OZFG 5HHOE 4FQJL 1E6JH 1P2CA 4URTB 3UTSA 3V5HA 1F8TH 3L95B 4M9OA 4TVPL 4WHYH 4PJDB 4LFHG 3RIFK 4D94A 3GM0A 3BPLC 4EDXB 5D7IE 4MWFA 1MJJB 2FSEB 1QBAA 4DAGL 1A1NB 3H42L 5BVPH 4P5KA 5IFJB 3PP4L 3UTOA 3BDYL 1CDIA 2BC4A 2WUBL 4N1CA 5ESAB 3K4DA 2P8LA 5AAMA 2Q6WB 3EIFA 4QGTA 3RQ3A 2EDJA 1BQLL 2IEPA 4C55A 3K8MA 5SX4I 5IEHA 3L7EB 1FGNH 1OL0A 3OXRB 4F58H 5C0BD 5KOVC 3I75A 5FUZH 1UENA 4JDTL 3LKPB 4ONOA 1U58A 1YEKH 1G6RL 3QXVA 3MXVL 1ZT4B 3SQOH 1J1XH 2RFXA 4ZPVB 2NX5E 3L1OL 2IQAA 5IG7A 1OCWL 5HJ3B 3TZVD 4OFIA 4L8CB 4LBEA 1CFTA 4PJHE 1HOCA 3LQZA 2AJ3A 1VSCA 3MR9B 1LO5A 2HLFD 4M62H 1YUHB 3U0WH 4Z76A 1UM4H 3TEUA 2EDTA 3VFVB 1LO2L 2VTFA 4YO0A 4K3EL 1IEBA 5AZEH 5GXBB 1J0YA 2GTZB 4QRUB 1W72B 1X7QB 3RDTD 4HJJL 4PJ7E 5CGMA 5FEBA 4HUUB 2A9NH 1U8QA 3G6DL 3F5WA 1PG7L 4JJ5A 1VEMA 3TWCL 4CVXA 3I84A 1EFQA 3ARDC 1BGXL 3Q5YA 4XP4L 4Q9CA 4MGXA 2Q76A 4LLAA 3HMWH 3HC4H 4KI5F 1AGBB 5IVXA 2YPVH 5I71C 2HWZH 3RL2B 4U1IA 1BVLB 2R15A 3B9KD 1HNGA 2OR9H 5HVHC 1AXIB 4DW2L 4W4OA 5ICYB 1K4CB 1QVOA 4LIQE 4CMHB 2JJTA 2DYPB 2NXYC 3PGFL 3KYAA 3X12B 4DZ8B 1SY6A 1MLCA 3P4NA 4CNIB 5LWYL 3QHZH 2UY6A 1H3TA 2CK2A 3LIZH 4EJ1C 1J11A 3WSQL 4ODHH 4ZUUA 4PJ5D 3NCFB 1OSPH 1KG0A 1RZ7L 4ZS6D 2CKBL 4CDHA 4WUUE 4LRNH 4OZGE 1C16A 5KVGL 1R3IH 4J12A 4M1DL 3RL1B 2YS4A 5GGRB 1LDPL 1NCTA 3IDGB 5JOFA 1DL7L 1AI1L 3DUSB 1R3LB 3NCEB 2VDNH 2AK4D 4FQHB 4OLZH 4WW1A 4AEIL 3Q3GB 3RY6A 1VENA 5JPNB 5CD3B 1QSFE 4XWOC 5F1SA 2RQ8A 1K8IB 4KI1A 4WJ5B 3K2UH 4UBDC 3U4AA 2MNUA 3IS1X 1OTUC 3BJLA 2QKIA 4JY5H 1CDUA 4ODSH 1VFBA 3H9HB 2OL3L 4CW1B 3VXOB 4XP6L 3KJ4B 5JHDA 4M1CD 1K3ZA 4F7MB 2VLKA 3AB0B 1IGTB 2NYYC 2F53E 5DRWB 5EIIA 1AGDA 3GMQA 3MRBB 4NHCL 2XA3A 1S7XA 1CF8L 1S78D 4PJGF 1AIFA 1KIPA 1UXSA 4MVBD 4NO5B 3MUY1 4TUOA 5DDHA 4MHHG 4GFTB 2R4RL 1AGEA 4KRPD 1KTLA 2FEDC 1R3KA 2IWGA 2HFFB 2X4TA 5AYUL 4BKLA 5D2LF 5L7XH 1UJ3B 3ARRA 1J1PL 1HKLL 3CH8A 5INDA 1CU4L 4WUKL 5D71H 1IKFL 5IBLD 2P5ED 4JQIL 3RY4A 5ID1A 3FTGB 2L7UA 3ECBB 4OTXH 3NN8B 3MV8D 3CCHA 3C6LA 4LPYA 4UAOC 1LE5A 4W81A 4UDTA 2W60A 1I9IL 2AKRB 1BOGB 1F45A 1OAZL 4I4WA 3CH1B 5JMRA 3ISWA 5CSGA 4OZ4B 1GXEA 1K9TA 3S5LB 5IEKA 3MYJB 3WUWG 1KLGB 5J1AB 4QYOA 1BIHA 3QQ9C 4KRLB 1MCJA 5GJSL 1KUMA 2DQFA 5IR1A 2DICA 4P23A 4KQ3L 4FQXC 2VUYA 5C0AD 1O7VA 3BP6B 1U9KA 1OP3K 1HXYB 3IYLW 1JZ2A 3PL6C 5CWSB 5F7EH 3QUML 4NC2B 4YHIA 4I0PC 4Y1AA 4N0YL 3FO9B 1U91A 2UWEA 1MCOH 3MBXL 5BRZA 4DK3A 1JYNA 4DN3H 5E9DA 2WNGA 1RK1A 4JN1H 3PABB 3UTPD 4FFVD 1EZVX 5KOMC 1Q9OA 4OD2A 4UILH 4RDQF 3VGDA 5IVNA 2ZUQB 2E7BA 4LSUH 2HT2D 2VXSH 4P4KD 1MVFA 4CKVX 1CG9B 1I9JL 1FNAA 2YN5A 2XYCA 4HS3B 5D1ZB 1DVFB 5IVXE 3RWIB 1HHIA 3ARBA 2N56A 3KAAA 3MUGB 1QRND 2EKSB 4UOJA 2FX7H 3EOTH 3IJYB 2DIBA 3RVXC 4P2QD 2FEEI 4Z7VE 3IDXH 4QXWA 1D5ZA 4Y19D 5I18H 5GRJL 2GUOA 4S1SH 2FWOB 3VMOA 3O3DA 4EKXA 4RMWA 1A02N 2KBGA 1UADC 2WINA 2YSSB 1A47A 1VADA 1IL1A 2VZUA 5DRNA 3F62A 4L29A 3WNLA 3BXNB 4KMQA 5F93C 4PJCA 5CBAA 3C2AH 4RISH 3O2WH 1DBKL 3RVVD 3U36B 3Q5TA 3AGVA 2BRRH 2VAAA 1QBLL 5E4IA 2VDRL 3RTQD 5DZNA 3F8UB 1W72L 3FQUA 3KPPA 4D3CL 1FRGH 2OK0H 4IRJD 4H25A 4AMKL 2Y07L 4G7VH 4PJ5B 4YBLB 2BX5A 4KK8C 4HUWA 3ULUE 3MRHB 4P9HL 5L2JB 1SBBA 4F7PA 3DGGB 4NGHL 4ETQB 4MQXC 1QUNA 4ZO8A 5FECA 3DHMA 3EYOA 4WDIB 4C56A 1G7PB 1DBML 3E0GA 4HCRL 5JHDE 4OZFA 3QIWD 5I1LA 4PV9B 2AK4B 5LXGL 3RWDA 3EYSH 3H8NA 5E8PA 1DQQB 1NKRA 3QEQE 3SBWC 2B4CC 3QFJE 5FYKD 1XCQA 2F74B 4J1UB 5KW9H 5JR1H 1Z3GL 4HWEH 4YXLL 2JJSC 3CUPB 4ODWA 4Y89A 4ONGH 2NY5H 1AQDB 3QCTL 5FYKH 4DTGH 4OGYH 3KYKL 3IDJB 5C07A 1ZHNB 3CU7A 4ZAKD 3OKOB 1XF2B 3CSPA 4CADA 5KSBE 3LH2L 3WFBH 4O9HL 1MVUB 5DMKB 3QSKB 5GGSY 2CK0H 3PWPA 5HHVL 3FQXB 1F2XK 1JE6A 1ZHLB 1FVCB 1A7BA 3MRGA 4MHHI 1JNLL 1ZMYA 4JZJB 3PWLB 4TTDC 1D5XB 3NFPA 1C12B 4OUUB 1J5OH 4PP1C 3P30H 4JFFD 1N8ZB 3MV8B 1UACH 2Q7YA 2XKSA 5MEQA 5HYJB 4HWBH 3QDJD 2JJWA 3GSXB 1DUZB 1DQDH 4AEEA 3HZMB 1ADQA 4O51B 15C8H 4Y1AE 3U79A 3VWJD 2Q87A 3L5XL 4X5WB 3ARYA 4ELMA 2GT9A 2UWEE 2Y7QB 2YC1A 3FN0H 1P7QB 4WW2A 2BFVL 4XPBH 4KKLD 2GITB 4MMXC 4NNYB 5E9DE 4IOFC 3V7AG 5I1DB 5JW3H 4QRSB 4JHAH 4BSVB 1N5YL 1OHQA 5C0AB 2FNBA 1FC2D 1RPQA 1RZFL 4P3DA 3VA6A 3VGFA 1U3JA 4LSTL 3DGCR 3HRZB 5DJ6A 5T3XE 1E6JL 5FKPA 2VZ1A 1RUKH 1F8TL 4DEPC 1XGYH 1G9NC 3QCVH 4HEPG 4P99A 1R5WB 3MBEA 5E7BA 2HJLA 4CJ0A 4NRYA 4OCSH 5DK2B 3DSFH 4R7DB 2NTFA 5IJVA 5I1IL 2DWDB 3L3OA 1IKNA 1WIPA 1OAUH 4ZDHB 5CEZD 4JRYA 4U7KA 1W8OA 1Q0YL 1HQRA 4NP4H 3CVHH 2NY2B 4QTHA 2PXYC 4JZOA 4P4KB 1QFWH 1NUFA 1B0GA 3O81A 1JF5A 5IMLB 4PP2B 1X5FA 1CDJA 3AM8A 3B9EA 3ULSB 1FGNL 2FIRT 3EYQD 1A1MA 4C4KO 3F6LA 3V5KB 3G6AA 4F58L 5CEZH 2V9TA 3T65A 3PNWA 4X4ZA 4HPOH 2BSED 2RJMA 3C5SA 2Y6SC 4Q9RL 2XXMB 5E6YA 1KEGH 5BJTA 3U0TA 4PJCE 1FNFA 4P2QB 3SQOL 3L7FA 2DQHH 4CVZB 5HHNA 4Y19B 4XVTL 3AB0C 1EEQA 5SWZD 4QHUA 4PUBH 3U0WL 1I1CA 1I85A 1TQBB 1MJUH 4Q2ZB 1QYGH 3IFPA 3S3JA 4R6UA 3GI9H 4S1RH 4DUWA 1NANI 3UTQB 4GXUM 1QLFB 5E6IA 2IFFL 4NO2A 1HWHB 4PRPE 4XPFH 3PG2A 3UTTA 5HSFA 4Q9QH 1FAKT 5EU3A 1U2CA 2YA2A 2E9BA 3R06A 4QRPA 1UJ3C 4JY6A 4HWZB 4EVNA 3H0TA 1DZBA 1NCBH 4KJPD 2A38A 3HC4L 1EVTC 3EOAB 1ZLVH 5KSUB 2YPVL 3VRIA 1ITBB 2HWZL 1BJ8A 1BEYH 2LV4A 2BVUA 4LHUD 2OR9L 3U30B 4Z0XB 3JV6B 5D7SH 1T20A 4F7TA 5CP3H 5ACLA 1MREH 3QHZL 3BX7C 5E00B 2O5XL 5A40E 2EH8H 3M45A 4PLJD 4ZQKB 3WUWA 1OSPL 3I3DA 5BXFB 5C07E 5CCKH 1VGKB 2KUTA 5AZ2L 4LRNL 4OCYL 1OAYH 4MAYC 3TC9A 2GTWB 4DK6A 1R3IL 2Q1EA 1I7UA 3U2SA 2WUCL 5GGRY 5D1XC 3OKDA 4U05A 5B22A 1FPTH 2I9LA 3HZYA 4F57H 4ZNCD 2QQNH 2VDNL 4OLZL 2BVPA 2Z93B 1FNSH 4AL8H 2PYEB 2R2EB 3K2UL 3GSWB 2ZUQC 3P3YA 4JY5L 1MCSA 4ODSL 3BD4A 1JZ3A 4ZAKB 3ETBF 4NZUH 3KXFA 1IM9A 5I8EB 4YAQA 4LSRH 3GK8H 4HJGB 3WS6C 5DJDA 3MLRH 2VXQL 5C0BE 2YXFA 5L9DH 4RBPK 5CP7A 4MXWH 2Z92A 1FCCA 4AZ8A 1OAKL 3C5ZA 1IGJB 2BNQD 1J0HA 4JFFB 4QXGL 3CAFA 1KJMB 2KH2B 1T89A 1U92A 3EYVB 5E2UH 3QDJB 4P2RD 4Z18A 5EOQH 3KNBA 2HRLA 5L7XL 1CLYH 2V6HA 4MXQD 4WI3A 4I77H 5D71L 1T0NA 1CFVH 4ZOEA 2ZNXA 2LVEA 3MNWA 3O11A 5FYJE 3VD9A 1KNOB 5KSVA 3DO7B 3DO3A 4N8VG 3BPCA 4JRYE 4L4TD 3SKMB 2HKFH 1NBVH 5AWNH 4G8GB 2WIIA 2CIIA 2E7HA 1BIIB 2OJEB 1S7WB 4JGMA 5IF0A 2QQLH 1I1AD 3BO8B 1NL0H 1BBDH 2GK2A 1J8HA 3CVHB 3B9VA 3EYUH 2VLRA 3T2OA 4HKBA 4YBLC 2WBJD 5FO8B 2CJUH 2R4SH 5BW7A 2ICES 2W0LA 3DYOA 5DSCB 4U6XB 3U6RB 3S3SA 4JO2H 5F7EL 4GG6B 4OD1H 5DRZA 3D25B 5TQ2H 3QWOA 4Q0XH 1Q8MA 2VLJA 1CVRA 1JN6A 1MCOL 5HYQB 4LCUB 3FFCD 2H3NA 4DN3L 4QF1A 5SWSD 4JN1L 2AI0H 1QO3A 4EN3A 1YZZA 3TFKC 4GRMB 2FDBP 2BDNH 1CLZL 5FM4A 1Q94B 4LSUL 4X9HA 1HSBA 4HULB 2XACC 4ZXBA 4P46C 3D39B 4KZDH 2VXSL 4W70A 3UTTE 1GGTA 1KJ2A 1VERA 4M61A 4XCFH 3T1FB 3C60B 4DKEH 5ANMB 3W5MA 4QRPE 5EU7C 1FNEA 3HPJA 3OBAA 3I50H 1H15A 3VXRD 2KQNA 3BGMA 3BH8A 4XXCC 3O6KH 1F3JB 3DMMA 2FX7L 1XGRA 3EOTL 1J12A 3EO0A 2AV7B 3IDXL 5ILTH 1RZKH 3BQUB 1D5BA 1DEDA 4S11A 1MFEH 1MHHA 1CFQA 4I2XA 3WO4C 2DQEL 5HYIA 1RK0A 4DQOH 3ORJA 5C6TL 3HLAB 3EOBA 5EPMB 4YHNA 4O2EB 4XP1L 5DC0A 3SDYH 5C2BL 4XPAH 3QFDA 3K1KC 5GGUA 4HKZA 4AEHH 5H94A 1AH1A 3C2AL 3O2WL 1RAMA 1TNMA 4ALAH 3VI3E 5D72H 2BRRL 4TOYH 1VPOH 1HI6B 3ARZA 4FXGA 3ARXA 4NZDA 3T0WA 1LEGB 1HEZB 4XCYA 5F7YC 4WO4B 3ULVH 3X14A 1CXLA 2ICCA 4JDVB 1ZLWH 1LEIB 3QUKA 1FRGL 4X4YA 2OK0L 2GEEA 1E0OB 2HN7B 3BJ91 4JQVA 3NCJH 4G7VL 5CD5D 4PJ8A 3WN5A 3ZL4L 5HPMA 2O61B 1CD8A 2JJVA 2HG5B 4HWUA 1T7YA 4GBXD 3CFBB 2P8PB 4UB0H 1N59A 3VXSA 2BXZA 3VXTA 2BY0A 4KWUA 1J05A 1VACB 4YZFF 4R90H 2QADB 4IEFB 5JW4R 1WK0A 1M7IB 4PLNC 4AIXA 1VFMA 3MZTA 2VDML 3EDEA 3EYSL 4RX4A 1FL5A 4GXUN 3T1WA 1ES0B 4Z7OE 4X6DF 5KW9L 5A3ID 3QI9C 2NY2C 2YKLH 5JR1L 5DUMH 2FCBA 4HWEL 4ONFH 3DX6A 1E4JA 1PYWB 2NY4D 3MC0A 4ONGL 2NY5L 1CDHA 5MHSE 5FYKL 4FMFA 4PREA 1K8DB 4OGYL 1U8HA 3EDDA 5DWUH 4MNHA 4NN7C 5CSZA 3U46B 2V17H 4WFHE 2YA1A 1NPUA 1G1CA 4PJIF 2MWCA 4ELKB 1MFDH 5GISH 1PKQA 5F7FA 2BOCA 2CLRB 4HJ0C 4MB3A 5D7JB 2OLDA 5EG6C 3MFFB 2CK0L 2OTWB 1FE8H 5T5NF 4YHOL 1TQBC 2GJZA 1T66D 1PY9A 2EZ0D 1ZKAA 4R8WH 1QRNE 4NUGH 3QUZD 2VLRE 1SY6H 2X4UA 4DZBB 1J5OL 4MYWB 2ICWI 5ERWA 3P30L 1OGAE 4LCYA 1UACL 4QRRA 1KPRA 2YWYA 3CX5J 4Y4KD 5CIPA 3IAGC 4L4TB 1DQDL 15C8L 2VQ1A 4OBSA 5IOPA 3SGJA 4PJ9D 4LPCA 3WHXA 2VZOA 3TA3A 3PUCA 3FN0L 3NCBB 4XPBL 4MNGA 1N0XL 3FOLA 4WUUB 2K7PA 2EIZA 4BFIB 5F7DA 4JHAL 1C08A 3SE4C 1FJ1A 4PRHD 3DUUB 1M6OA 3T3MF 4S0TD 2BSTB 2R8SH 1A6TB 2MQ3A 5I0ZA 1NGYA 5IIEB 4XMLH 5E8OB 1RUKL 3LRGA 1XGYL 3QCVL 5D2LA 1WFUA 2IGFH 1FL6B 2ZNWA 4KKAD 1RJLA 3IDMB 3RUGF 4WFFD 1KTDA 4X98A 5SX4H 3RGVC 3O3AB 4HKJB 4YEFA 3FFCB 5HD8C 2ADIA 5SWSB 3PJSA 3HB3C 3RNKA 1YEHH 1NAML 3L3JA 5B8CB 1OAUL 2EDOA 2D0GA 6FABH 4OAWB 4NP4L 3CVHL 4UQ2A 3ES6B 5BS0A 4IS6B 2FATH 5LCVH 1AP2A 1F90L 2DTSA 3Q6FB 1QFWL 2D9QB 1H5BA 4XCNB 1HIML 1HHHA 5CEZL 3NZHH 5KJRH 3VXRB 2O5YH 4EI5A 1K5NA 1KEGL 1TJIL 3ABZA 4PV8A 5D5ME 1NCNA 5TDNB 3U9UB 2IH1B 1INQB 4XBEH 3B6SB 1HZHH 5GGTA 3ILQD 5IK3B 3I6GB 2JCCF 2QSVA 1P2CB 3K74B 3O8XA 3UTSB 4PUBL 3V5HB 4X0KA 1MJUL 3C9NA 1QYGL 3HNVH 1J10A 5HGDA 1BD2A 3GI9L 4S1RL 3SOBH 4MWFB 1NGPH 1KCVH 4X5XA 5C09A 3NPSC 2AAVA 3LKQA 3EHBC 4P5KB 4B53A 4Q9QL 2BC4B 3RZCA 1E6OL 3HG1D 1DEEA 1WBZA 2ICWA 2P8LB 2R9HD 3S34H 1FLTX 2X5PA 4QHMA 2XICA 2CMRH 1NGZA 4K8RH 5IEHB 1U8IA 4KI5E 2A1WH 4H0HB 5DVNA 1MF2H 3I75B 1AR1D 1U58B 5K59E 2R1WA 2RFXB 5D7SL 2IQAB 2AJUH 4QY8A 5IG7B 1A22B 4C54A 4LBEB 1CFTB 4N8VA 1HOCB 3LQZB 1V5JA 2AJ3B 4KJQC 2AK1H 5JQHC 1H9VA 1LO5B 2P48B 2EH8L 5FO7A 4L8SC 4Z76B 3MGTB 4XNZB 3AREA 4YO0B 1AJ7H 1IEBB 2VQUA 5CCKL 5HHMD 2F54D 4MMZC 1OAYL 1U36A 1QNZH 2M1KA 1T7ZA 5DMIH 1U8QB 3F5WB 3BKMH 1HDMA 2W1NA 2L0DA 4JJ5B 4LMQE 1FPTL 4CVXB 5F88A 5JO5A 1RUAH 2GYSA 4F57L 5H37G 2QQNL 2ZG2A 4G6AC 1I9EA 4MB5A 2ATPA 4Y16C 4TUKH 1NEUA 4LCIH 2Q76B 5IVXB 3SY0A 4AL8L 4UIKH 4WFED 1HCVA 5DGRA 4JFYA 4HH9A 2KPNA 4FZEH 4KXZI 1UT9A 3GSNA 4U1IB 3DBXA 4P5TD 3K7UA 5TE6H 1QVOB 1GGYA 4LCCA 3NFNA 4NZUL 1MLCB 3C60C 3P4NB 1O0VA 4LSRL 3GK8L 3C5JA 4ZUUB 5L9DL 4O2CA 3KPRA 4MXWL 1KG0B 2YUZA 4MNGE 4Z7WE 3OHXA 4U1SA 4OM0H 2Z4QA 4WY7L 1HWGB 2DKSA 1C16B 3BQUC 3O3UN 4PYGA 2DF3A 1X9QA 2HFEA 5J9PA 5E2UL 3TBSA 2P8MA 3V79C 2NCMA 3W11D 1CLYL 5JOFB 1ZV5A 4XHJD 4I77L 1XAUA 2X9YA 2ADFH 4WW1B 1CXEA 4LFHD 2J6EL 3CFCH 4OF5A 3IJHA 1PSKH 2XZQH 4FNLH 4OZFH 2QKIB 1FZOA 4WO4C 3D18B 2BNRA 1VFBB 3OGCA 4U1MA 1NBVL 1N4XL 5FCUH 5AWNL 3U4BL 4RGNE 2VLKB 4S2SA 2QQLL 3K2MC 1NL0L 3K1DA 1BBDL 5EIIB 3NABH 3ZE0E 3GMQB 3EYUL 1ED3A 4PJXF 3TO2A 5I30L 2CJUL 4FXLA 1KENL 2R4SL 5C0ND 1KIPB 1UXSB 1QQDA 5DDHB 4TUOB 1AGEB 4R0LA 3IDIA 1KTLB 4JO2L 4D8PA 4OD1L 1R3KB 5JOEA 4LF3A 4Q0XL 5I75C 3IJSA 5KSAC 2X4TB 4X7SH 3E2HB 35C8H 3S4SG 2QADC 5IB4A 4BKLB 5MI0B 3T0AA 5INDB 5M94B 3QZWG 4NQDA 5FK9B 1NUNB 2BSRA 5ID1B 1BZ7A 2BDNL 2KQMA 2RR3A 3CCHB 3C6LB 2X9XA 1LE5B 1E4WH 5IHBA 4FOMA 5C09E 1GOHA 2W60B 3HI1A 3K4ZA 4OFYD 4UDTB 4ZO9A 1IC5H 4I4WB 12E8H 3HI6L 4MA8H 2NY6D 5IEKB 2J8HA 4DKEL 1H3UA 4M8QA 3I50L 4MX7A 4QYOB 1J8KA 2FECL 2DQFB 3O6KL 5IR1B 2AJSH 4P23B 1ADQH 5ILTL 1RZKL 4WHTA 1MFEL 4FTVA 4Z78A 3QUXC 2YD6A 4YHIB 3QDHA 4PR5A 4Y1AB 4OGXH 3HG1B 4D0DA 1U91B 1CGTA 3THMH 2OR7A 3DXAE 3O6FA 2UWEB 5BRZB 4XPAL 3CIQA 2PO6A 4XCEA 5E9DB 4AEHL 1RK1B 4XC3L 1ERNA 1T1XA 3N1GC 4GRWF 4XH2A 1HILA 1Q9OB 2B8OT 2BJMH 2W91A 4OD2B 4ALAL 5D72L 2YPLD 4X6CE 2X9WA 1VPOL 5GPRA 3C8KA 1WLHA 4HUNB 3ULVL 5T5NG 4P2RE 5IWLC 5JXEA 3BT2H 3NCJL 3FB8A 3W9EA 3TN0C 1HHIB 3WE6A 5GZOC 4ZFOL 3T2NH 1C5BH 3MJGX 2GJJA 4JPVH 2OQJA 2CRMA 2OM5A 1QOKA 1D5ZB 4UB0L 2EDKA 3WNKA 2GUOB 1OP3H 4XVUC 1Q9LA 5BVJA 4H0IA 4LU5H 3TO4D 3O3DB 2H45A 2IAND 4R90L 3U9PH 5J7CC 1VADB 5DRNB 1NUGA 1QFHA 3O45A 4LAQL 5ESVA 3MRRA 3WJLA 4W6XB 2YKLL 1XIWA 5DUML 2VAAB 4P5TB 4ONFL 1ZVYA 2KZ1B 4L8BA 5D8JH 3FQUB 7CGTA 3SE3A 1LO3H 1MSPA 4JRXE 4P2OA 4UMGA 3NCCB 1F6LL 4H25B 5DWUL 1DFBH 4XVJH 3L6FA 3EDKA 3KHOA 2V17L 4KROC 4HUWB 3R0MA 4CU6A 1LE9A 4XBGA 4F7PB 2R0LH 2FR4A 3RP1A 4GRLC 1YPZE 2E7MA 5D7LD 5FECB 2BNRE 3EYOB 4C56B 1KELL 1FE8L 4OJFH 5D7KD 4OZFB 1A5FL 3GFUA 5I1LB 3AU1A 1XGTA 4R8WL 1IBGL 4TNVF 3RWDB 4NUGL 1X4YA 5E8PB 5T5FH 1GGIH 4PLKC 1ETZA 1XCQB 2AABL 4LLVA 1CXIA 2LFGA 2WSKA 1EJ6A 3OGOE 3V6BR 5HGBA 4LLMA 4LSQH 1Z9LA 1K6QH 2I07A 3P4OA 3B8YA 1D5MA 2CD0A 2FGWL 2VXVH 4OI9A 2QSCL 3R8BB 3WKNA 5LGJA 5C07B 1CD0A 4KK9D 1T6WA 3FN3A 4O2FA 5FDWA 1G7IA 2C4XA 3CXDH 4CADB 2ZCLH 3HUJE 3MOBH 2R8SL 1AGCA 3C6SA 4ZODA 5D1QC 4XMLL 4MCZA 3KXFD 1A3LL 2IGFL 3PWPB 1I3GL 3MLTA 2AJZA 3MRGB 5DJXA 1IEHA 4NZJA 1YEHL 3NFPB 4NKIH 1KB9K 2E5EA 4LSSH 6FABL 3PQYD 1FCGA 5DFTA 4P4RA 4PJBF 2Q7YB 1LGVA 5MEQB 2P49B 4I3SH 2C1OA 3TM6A 4KTEL 3V5DA 1WC7A 2LU7A 2FATL 5DA4A 5LCVL 4AEFA 5HBBA 3PXJA 4OGZA 4JFDE 4U6VH 1L9MA 5HGHA 5EO1A 5EWIH 4ENED 1I8MA 5I1EH 4ELMB 3NZHL 2GT9B 3MV7D 4XC1H 5F7LB 5KJRL 1MWAA 2YC1B 3P0VH 4WW2B 1PQZA 3M1BA 1NANH 5FFLA 2YPKA 5BV7H 1DBBH 4W4OC 4P3DB 2JJTC 2B1AH 1BFVH 1HZHL 3DECA 1BZ9A 5DJ6B 3OZ9H 4R4ND 2YN3A 3BHBA 1X6LA 3KYMA 1J8HD 3MBEB 2J7LA 3HNVL 4U0QB 4O5LH 2HJLB 1I9RH 4NRYB 3SOBL 3ESVF 4LPVA 1QKZL 2OBGA 4J3OC 2A73A 1NGPL 5H8DA 1KCVL 1A1OA 5IJVB 1MCRA 3L3OB 5ECJE 1KF9B 3PV6A 2OI9C 1HQRB 5IMKA 4QTHB 5GZND 2VLJD 3S34L 1NCUA 4U31A 4ORZC 3AFLA 4JZOB 4EZMA 3N1FC 2VWEE 1HYSD 1B0GB 2BMKA 1GOFA 2EDDA 3GSRA 4M6AA 3NH7H 1HHJA 1A1MB 3HPLA 2A1WL 3G6AB 3ULUC 2D0HA 4PRIA 5F7KC 3PNWB 1MF2L 1NGWA 1A6VH 1ZOXA 1ND0A 3U0TB 4K7PH 1S3KH 2HTKD 1YYLH 1MCWW 2AJUL 3L7FB 2AK1L 1URLA 4QHUB 1MAML 1X5AA 2Q3AA 1MCNA 4HT1H 4Z7UF 1JPTL 1AJ7L 3N85H 3IFPB 2OZ4H 3TPUA 1KJ2H 3OR7A 5SWQA 4KKCD 4OLWH 5E6IB 4PRHE 5DMIL 5K9KA 3IRZA 2DTMH 1WTGT 5JOPE 3L3IA 5EU3B 1RUAL 2AEIT 3R06B 5MI0C 1F97A 4QRPB 3QIUA 5J6GA 3B5HA 5GRYA 4JY6B 4TUKL 4XP5H 4EVNB 3H0TB 3S4SA 3E6HA 4HBQA 3VRIB 2VXTL 1IFHH 2Y72A 4FZEL 3C6LC 4QTIH 2N1KA 1VFUA 3GBLA 1F02I 4KVCH 5TE6L 1T2XA 1F42A 5GS1C 5K9QG 4G9DA 1T20B 4F7TB 2XY2A 4WWKA 4R26H 4KDTA 3V6OA 2AP2A 3UCRA 1RIHH 3T0EE 2F8VA 3QO1A 2XTLA 1I3RA 2LABA 2W0FA 2FD6H 4PJ8D 2VR5A 3WUWB 4OM0L 4EOWL 2J8UA 4K8RC 4PJFA 1WJ3A 1I7UB 3U2SB 3IXTA 1IC4H 3WNNA 5E8DH 4TSAH 4J4PA 3OKDB 2I9LB 3HZYB 5AUMB 3WNMA 2ADFL 2BVPB 3V6FA 2CO6B 3C2SA 1OP9A 3MCKA 4YJZL 3ARSA 1PSKL 4UINH 4RMUA 3KG5A 5C71A 3NZ8A 5DJ2A 1RHFA 1WFOA 3MYZA 4HX1A 4H8WH 4PGJA 1V7MH 5GGQH 1A14H 3KXFB 3QIBD 4XP9L 1IM9B 1F58H 4YAQB 3NABL 5DJDB 1RURL 3ARBC 5CJXA 4EIZC 5DMGD 4HLZG 4KHXH 2Z92B 4Z7QF 2XKNA 3QUYA 1YC8A 4GQPH 5L6YH 4M5YH 3HE7D 4XI5C 3C5ZB 5E1AA 2FJGA 3PQYB 2BHZA 3MV9A 2IQ9H 1X5ZA 5IW1A 4J3XA 1U92B 4PRNA 2LE9A 3H9ZA 2EIBA 4X7SL 35C8L 3KNBB 5BV7B 2HAZA 3MACH 5LQBH 2F8XC 4QOKA 2AJVH 5FA3A 5FGCB 4A2MA 1WWBX 4X4MA 2FHCA 4V2BA 4UNUA 2H26A 2APWA 2XN9A 2A9MH 3BW9A 1T0NB 3UJTL 5CZVH 4M02A 4KV5F 2F54E 3MNWB 4GG8B 3O11B 1E4WL 3EFDH 5KSVB 3JWDH 3RHWF 3S96A 3BPCB 3H6JA 12E8L 2DBJA 2R2BA 4L4JA 1BOYA 1V8HA 4AT6A 2WIIB 2CIIB 1KT2A 5KVFH 4AG4L 1WCQA 4HK0A 3RUGA 5IF0B 4M93C 5E24E 1J8HB 1U3HC 3CLEH 3HR5A 5KN5A 1BJ1H 5C9JA 2AJSL 2VLRB 3VFRA 5CIPH 4HKBB 2VLLA 1S7UA 3KR3H 3FQRA 1X44A 5SV3A 1JZ4A 4RBPH 3RVUD 5DQ9A 4IOSD 2E7CA 2QHRH 1J86A 5DRZB 2DAVA 1ZANH 1ZK9A 3ZTNH 3RVTD 3QWOB 1RUQH 3BEVA 4OGXL 2VLJB 1JN6B 3QWQB 4G9FD 2X70A 4GKSA 2H3NB 1G6VK 4QF1B 3WXVH 2X1QA 1QO3B 1HNFA 1XF5A 3ARDA 5HI4C 2BJML 4U0RB 5IHUH 1HSBB 1P5UA 4X7TA 1K4DB 4ZXBB 4NQXA 5BS0D 4NZTL 5E5RB 3CXHK 1KJ2B 2JCCA 4KMLB 4M61B 3SGKC 1SHMA 2HT3C 2IAMD 3EDJA 5SX5K 3PGCA 1FNEB 3HPJB 3SDAD 3SCMC 5F6IB 1H15B 5E2JA 3BGMB 3BH8B 3GMNA 5GRXG 3DMMB 1XGRB 5FYJU 3T2NL 4JPVL 3EO0B 3H7BA 1NH6A 2C7UA 3SE8H 1D5BB 1WZ1L 1MHCA 5EOCJ 1QSEA 4I18B 1MHHB 5I0DA 1CFQB 4LU5L 4I2XB 3O8XD 1RK0B 2NLJA 2V2XA 2WP3O 2XZCH 1FYTD 3U9PL 3SO3B 4MZ3A 1CFSB 2D7TH 3EOBB 1BD2D 3NIFF 4YHNB 3UP1A 1IEAB 5J3HD 3QFDB 5GGUB 4HKZB 5GGTH 3QJHA 5IUSA 3OKLA 5EH1A 1MQKH 1ZLSH 4XCCH 3R1GH 1JP5A 5EUOF 2J8UE 4FQLH 4FXGB 5DEFA 4PJFE 4XCYB 3X14B 3PIQA 3QUKB 4X4YB 5JZ7C 3UTZA 4MJ4A 3ZTJG 2VLMD 1PLGH 5FM5O 1TDQA 4PJ8B 3WN5B 1DFBL 1TZIA 2X09A 4IIQA 4XVJL 5HPMB 5L88H 3QQ3A 4LPTA 2R0LL 5DD0H 1MCHA 2OP4H 2D7PA 2APXA 4UNTA 1YEJL 4YWGL 3VXSB 2HTLC 2HFGH 3VXTB 4S1DD 1J05B 3X3FL 3MBEC 3RKDD 4DOHB 3ARED 1UB6A 2RB8A 4QLRA 5IVZA 4P5MA 3V7MA 3RDTC 3BZEB 1TJHL 3Q0HA 1KIUA 1FL5B 1OM3L 2B1HH 5T5FL 1GGIL 3TVMA 2FLRT 3FQTA 1UZ6E 3ZKNC 4OLUL 4NQVA 3MV9E 3DX6B 4LSQL 1JV5A 1RV6X 1K6QL 5C08D 3QDME 3GSOA 2VL4A 3AM8C 2VXVL 1MFNA 1B6UA 3LQAH 4PREB 2VL5A 2XN9E 1U8HB 1JHKH 4MNHB 2GSGA 5CSZB 2MCG1 4PY8J 4LK4A 4X7CC 3GGWA 1KIQA 3CXDL 2ZCLL 3MOBL 1PKQB 4OLYH 2BOCB 2W9LA 1UH3A 4G6FD 1UB5A 4FQXA 4V1DA 2AJXH 3GSNH 3QDGA 3QCUH 4ZPTB 2VZVA 2YD3A 4WI2A 4G6ML 4U3CA 1JTOA 2GJZB 4HBCH 1T0MA 2E9WA 3MLWH 3PL6A 2A6JA 3O4OB 5DFVD 4JR9H 4N0CC 4NKIL 2X4UB 5E6IC 1A64A 3SGDI 4KFZC 4LSSL 5ERWB 4LCYB 1HHKA 4QRRB 3PDOA 5MENA 4I3SL 1KPRB 1A8JH 4JO3H 5CIPB 5C0CD 4U6VL 3L3GA 2NXZD 2VQ1B 5EWIL 5IOPB 2IC2A 4Z5RA 1UA6L 5I1EL 3WHXB 1OW0A 2UYLA 3P0VL 4OZHE 4MJ6A 4MNGB 4L4VD 3FOLB 4HMDA 4LVNB 2EIZB 5BV7L 2EH7H 1DBBL 4KUCD 1MI5A 4PJGB 4D0CA 1C08B 1Y18A 1KV3A 2UY7A 1FJ1B 4M3KB 2APFA 4OV6F 3ZDXF 4BFBD 3OZ9L 1NGYB 5F1IA 4GW4A 4RNRA 2HFTA 5D2LB 5EZJA 1RJLB 4O5LL 5JQ6H 1I9RL 3VDAA 1S78C 4JVUA 4ZOBA 1S9WA 2ADIB 3PJSB 3ZLQC 1GC1H 5F9WB 3RNKB 4B41A 5D70H 4MJIA 5T1MA 2PW1A 4UQ2B 2MJWA 4FFWD 5BS0B 1MRCL 4FQ1H 4JJHA 5KZCD 2ZG3A 5I73C 1AP2B 4RGNB 3WIHL 2ZUUA 5D7KE 5IBLC 4O4YH 3RA7H 1H5BB 2PTVA 4QHNA 3NH7L 1HHHB 4NQDD 2V5SA 3DROA 5B39G 1RULH 4XAKD 1V3LA 1OAXH 2R0KL 2H32A 1A6VL 3LRSA 3A67H 3MV11 4EI5B 2FX8H 4PV8B 4K7PL 3NIDE 3OWEA 3W0WD 3NPZB 5AYQA 2P4AB 3DHJA 3O8XB 4MDJA 4X0KB 2X4SA 4HT1L 1GIGL 3C9NB 4K9EL 1F4XH 1RIVH 3N85L 2B20A 5HGDB 1M7XA 2OZ4L 4YK4B 1BD2B 2EYSA 3UBXG 5DFWH 2QSQA 3BZ4A 4KXZH 2BVQA 4NJ9H 4OLWL 4X5XB 4Y4HA 5IHZA 2X40A 5C09B 5DVLA 3O2VH 3LKQB 1GAFH 2DTML 1KJVA 5JIIA 3TCXA 1WBZB 1PEWA 4RWYH 4YDKH 5KTEH 4OIAA 1F13A 2ICWB 2GKIA 2BK8A 3O3BA 4XP5L 1SMAA 4NO3A 4QHMB 4RZCA 2PO6D 1NGZB 3J8F7 3G9VA 1W0WA 1U8IB 3GSUA 4NO0A 3JTSA 5EOCL 3VXMD 4QTIL 2JJSA 4KVCL 5DK0A 5F9DC 2R1WB 1T04A 4MD4A 1I7TA 2EE3A 4QY8B 4RGOH 1QFUH 1RIHL 4N8VB 1MCCA 3RPKA 4M00A 1DQLH 2NY1D 5FO7B 5I76A 2FD6L 3MV7E 3LEVH 1P9MA 4PGEA 3AREB 4LLYB 4ZUSA 1CDCA 2W9EL 5E2VL 1KSRA 5BW7C 3QULA 2VSCA 5DUPH 5D7IF 1F3DJ 5JHLL 1IC4L 3WFCL 4Y5YA 1R6VA 5E8DL 4TSAL 1HDMB 2YUVA 3MRFA 1I7ZA 5F88B 5JO5B 4WV1C 2UV3A 4YC2C 5HI3C 2ZOLA 4NZRH 2ATPB 4KH2A 3KS0H 1NC2A 3SY0B 4EN3C 1XGPA 2J12B 2JB6A 5ALBH 4PB9H 4JFYB 4UINL 4HH9B 4FABL 5EO9A 3MGOA 3QO0A 2F19H 3GSNB 1SVCP 3DBXB 3T09A 4AJ0A 3RTQC 5F9OH 1AO7E 2X10A 4H8WL 4NNPH 2LAGB 1V7ML 4HGMA 4LCCB 3NFNB 5GGQL 4IRJC 3IFOA 1C1EL 2PTTA 1A14L 2Q7NA 4E41A 1F58L 5JORA 3MUZ1 2BSSB 5F6IC 1ZA6B 4PJHF 3C5JB 2X2YA 4JFHE 4O2CB 3DMMC 3KPRB 5B3JE 2NZ9C 4JE4B 3OHXB 4U1SB 1MHPH 4M5YL 5L6YL 2Z4QB 2UZIL 4WGWB 5DJ0A 3CSBA 2IQ9L 5IT2H 5J9PB 2HFEB 2VN4A 4K3HA 4PJ7F 4XMPH 2P8MB 5LQBL 1VKXA 3MACL 3SO3C 1KFAH 4G7YH 3Q2CA 2A9ML 3ZDZE 4KK5D 1IGFH 4Y2DC 5I1AA 2P47B 3S35H 4OF3A 3IJHB 2JIXA 4L3CA 3MGAA 5T1DH 1ZE3C 3PGDA 3OTTA 5AG8A 2EDFA 3EFDL 1UWXH 1U2HA 5IB1A 3JWDL 1FZOB 4PG2C 3OGCB 3NACH 1NLDH 4U1MB 5JTWA 1MJ8L 4KY1H 5KVFL 3CC5A 3RHWK 4S2SB 1KCLA 3LDBB 1FZMA 1JHLH 4XVSH 2E6PA 2IPKA 5C0JB 4LL9A 1ED3B 4XX1G 3BGFB 4HQQH 4OD3L 3TO2B 1U8MA 3KR3L 3LAFA 4MS8D 1DTUA 1QQDB 4KRNA 4NQSB 4WNQA 1S9KC 4PJBA 4R0LB 2QHRL 3IDIB 4HS6A 1S7TA 3GDBA 3P77A 3VD5A 1ZANL 3IETA 4D8PB 4OZGF 4LF3B 3ZTNL 1RUQL 3IJSB 2UVFA 5KZCB 5IB4B 1ZXQA 4K7PY 4DCQA 4KI5C 3WXVL 4QHKJ 5BOPA 1MNUH 2EO1A 2Y5EA 3QEUA 4NQDB 5DC4B 2BSRB 1BZ7B 1R3JB 2EE2A 1RMFH 5IHUL 1BECA 2FH6A 4KGJA 1BJMA 2A6IA 2BOBA 1B2WL 1RZJH 3HI1B 2HVKA 1DCLA 4XTRD 3D3VA 4YEEA 1G7JA 1D3CA 3FOMA 2EIDA 1BWMA 4D9QE 4MX7B 1JRHI 2GIYA 2ZPKL 4TQEL 1CS6A 5BQ7A 3SE8L 3GUTA 4Z9KB 5H37H 3BFOA 2D7MA 1MWAH 2YD1A 4FTVB 1ZGLP 4OI8A 4QWWD 4PR5B 1WF5A 2XZCL 3H3KA 4WFGE 4D0DB 4U1LA 4MAYA 3UBXI 2D7TL 3O6FB 5D1XA 4XCEB 2PO6B 5GGTL 4B7IA 5F6HI 1T1XB 4I9WD 3MLXH 1MQKL 3Q5OA 4XCCL 4XH2B 1HILB 3R1GL 3N9GH 4HK3J 4FQLL 3UXFA 3C8KB 2QEJA 1DSFH 1GGCL 5B4MC 4E0RA 1Y0LA 4OI7A 2Y23A 4KAQH 2GY5A 4TNWF 5GRWA 4F3FA 3TA3C 3HE6D 1E4XI 1PLGL 3FB8B 4Z7UA 5L2KA 1TITA 3H2WA 3W9EB 4LVNC 3HS0A 1R5VA 5L88L 1NDMA 1Z2KA 1MEXH 1CVSC 2OQJB 3LSOA 5DD0L 2OP4L 3T04D 1YA5A 3I02A 4PJEA 3ILPA 2OTUA 5DGQA 5BVJB 1Q9LB 5M7QA 1ZHKA 5D9SA 2HFGL 1DQMH 3X11A 1YY9D 4MNQD 5DHXB 1TTUA 3EJZC 4E41E 2P24A 3P40A 5HDLA 3MLSH 3EKCA 3O45B 4TPRH 5F9WC 3WFDH 5ESVB 3MRRB 4UIMA 5F71A 3MX0A 4NNXA 5HDOA 3GBML 4N5ED 2GW5A 1XIWB 5EBLA 1ZTXL 4RGNC 3ZYOA 5BOZG 1H5BC 1YMHA 4G9FE 1JGVH 3WS3A 4NHUA 4Z95H 3T0VA 1YMMD 3BKCH 3TESA 3LQAL 4A6YA 1EHXA 4ZSOA 1AFVH 2C4FU 1T2JA 4S10A 1MUJB 3L6FB 2AVGA 5MERA 4ZFGH 5B39A 3K81A 1DANU 1A4KA 4JFED 3F58H 2BHYA 1LE9B 3MO1A 4XBGB 2FR4B 3QPQC 4OLYL 4WWKD 1A9EA 2PCPA 3LS4H 1P4LA 4Z7VF 1C7TA 5HYEA 2GJ6D 2AJXL 1TENA 3MRDB 3QCUL 3NMEA 1DANT 1KB5A 2CXGA 3AXLA 4K23H 4HEME 1MIML 4HIXH 3AU1B 3MLWL 5D6DA 1XGTB 4XT1C 4JR9L 3HNTH 4LCWA 4PRDA 5BZWA 3UBXA 5BCAA 1MH5A 3IDNA 3ZKXC 3AROA 1ETZB 3E8UH 4OCWH 3CFKA 3RZCC 4LLVB 5HGBB 5HY9A 1RI8A 4JO3L 4I5BA 4LLMB 1TQCB 1FYTE 2I07B 2VE6A 2UZYB 3P4OB 1D5MB 4RMRA 4P46A 2P5WA 1WZLA 5LGJB 2OXHA 2EH7L 1K2DA 1EHLH 4O2FB 2PNDA 5FDWB 5EU6A 1HYRC 4J3WA 4LEXH 1G7IB 1XH3B 3CDYA 3WDJA 4XXCA 5FGSA 5JNYA 3ULUF 1AGCB 1EAJA 3C6SB 4MCZB 5GS0D 5CGYD 2WQ8A 1V3JA 3MLTB 5JQ6L 3QQ4A 4YHYC 3S6CA 1EFXA 3BN9D 1T3FA 3L3DA 5DJXB 5CUSH 1GC1L 4XNXH 1DLFH 5D70L 3OJDA 3OR6A 2ZUSA 4MAUH 2BVEA 4HGWA 4P4RB 3LQAC 3TGXA 1G0DA 2C1OB 3V5DB 1WC7B 1UCBH 1X5IA 4FQ1L 4D9LH 3IB4A 3D85D 5CBEA 4O4YL 3RA7L 5HGHB 5EO1B 5LAXA 1I8MB 1MWAB 1RULL 2DLTA 1Y6MR 1OAXL 2AGJH 3M1BB 1BBJA 1GZQA 2YPKB 2FX8L 3VXUA 2WIMA 4KTYA 5CINH 3H3PL 2X4RB 1I4FA 1QLEH 4LCCC 5HI5D 3TP4A 5C08E 1BZ9B 1H8SA 3GMOA 3LZFL 3BHBB 5KSBF 2CSPA 3KYMB 3WL9B 1TXKA 1F4XL 1RIVL 3MRNA 4Z7UE 5L2KE 3H3BC 2A73B 4LKCA 3F7PC 1A1OB 2BCKB 2V7HB 1FNHA 3O2DA 3O2VL 5KS9E 3ALXA 5IFHL 5E5UB 1FZKA 1MIEH 2R2HA 3PV6B 3DPBA 2DM2A 3MNZA 3D2UA 5EBWA 5BO1H 5IMKB 4RWYL 1S7SA 5KTEL 4PJEE 4HG4K 1IM3A 5F1KC 3WNPA 3NTCH 1SJHA 5T3ZD 2BMKB 3GSRB 3QI9A 1JZ6A 4YHKH 5HHQA 1HHJB 3HPLB 3WKMH 4PRIB 3RX8A 1NGWB 2UWEF 2ENYA 1SMOA 1FSKB 1S9VA 5DYOA 1ND0B 4H20H 2IBBA 1WISA 4IOIA 4RGOL 1RJCA 3GMMA 1QFUL 4G8FA 4HUMB 3BH9A 1DQLL 1UFUA 3LDBC 3DV6B 2K7QA 3LEVL 2NXYD 3BGFC 1EO5A 5ESQA 3OAZK 3MNVA 3DRQA 3TPUB 3OR7B 4K07A 5SWQB 4KTDH 4KQ4H 3CPLA 1T7WA 1CICA 5DUPL 1S5IH 3TLRA 5EUOA 2PR4H 5K9KB 4L1DA 4LEOB 5I1HH 2J2ZA 3L3IB 3QHFL 1XF4A 1U8LA 3QIUB 2BZDA 2VERN 5J6GB 3E6HB 4POUB 4NCDA 5ALBL 2AV1A 4PB9L 3RNQA 2Y1VA 2F8OA 4D9RD 2F19L 4BSWA 1T22A 3QZWB 5F9OL 1IGYA 4NNPL 3QJFA 2V2WA 4G9DB 1L6XA 4UBDD 4NQCD 1UC6A 3GO1L 4PJCF 4WWKB 2HYMA 1DQJA 1JI2A 2IH3A 4Z0BL 5C6WH 1I3RB 3LCYA 1P4BH 2W0FB 4FQCH 5IROC 1NSNL 3HCVB 2P5WE 5CKGA 2HA1A 2P42B 2WWKT 1KCUH 1EIBA 1MHPL 4NCC1 2EEAA 3W0WE 5BMFH 3RGVA 3IXTB 5IT2L 5I8CA 5EU6E 2JTDA 1MCLA 1H8OA 3O6FC 1U3YA 2ED8A 4G7YL 4NQEA 4HF5H 3FAWA 2I60H 1KPUA 2MKWA 4JREB 3V6FB 1IGFL 2XTJE 4FFZH 3MCKB 4GH7B 4WWID 3S35L 3C8DA 5ABDE 4EI6B 4K94H 3H7LA 1A21A 2NY4C 3NZ8B 5DJ2B 4HX1B 4A2LA 1NLDL 4XAWH 4KY1L 43C9A 3QG7L 3S37X 1DJSA 4MA1B 5B38G 2WQRA 2V5YA 4BH7A 4HQQL 4U4BA 1A7OH 5EA0L 1I3VA 2DMCA 2XKNB 3QQ9D 4MDIA 5E1AB 3IF1A 2FJGB 2WBWB 4FQXD 5IW1B 2L4OA 3BPLB 5TDPA 2VWEC 3B9AA 4PRNB 1T66C 2EZ0C 4V1DD 5C86A 3B5GA 4Q58C 4QOKB 4PFEA 3PL6D 2H26B 4OCRH 4ACPA 1MNUL 2XN9B 4I0PD 2YHGA 4Y4FD 5HVGB 5TFSL 5MEND 2DM4A 3TCLA 4MA3A 1XIWC 1RZJL 3S96B 3T4YA 3VI4E 5FF6A 2QR0A 3VFGH 4I1NB 1AKJD 2R2BB 1BFSA 4AT6B 3SE3C 1AXSA 4P2OC 3VRLF 1KT2B 1LP9F 2ITCA 1KB9J 3GHEH 4LP4A 4HK0B 3RUGB 3BRDA 5E8EA 4Z77A 3D0LA 3T2PA 4GSDH 3HR5B 5KN5B 4ODBD 5C9JB 3VFRB 2XPGA 2VLLB 1G9MC 1MI5D 1S7UB 3VD7A 3FQRB 4L8SA 5DQ9B 4DVBA 5TF1H 5IHLB 2VNCA 2IALA 2AQ1A 1MWAL 4K2UH 2ESVD 4P49A 3MJ9A 3S7GA 3SKJH 1E28A 3RVXD 3BEVB 3LPFA 2G60H 2X70B 4GKSB 3SKUD 4NFDA 4F8QA 1Q1JH 2C5DC 5J4MA 2VZSA 1FFNA 1VFAA 4MJID 2HVJA 1XF5B 3MLXL 3E1F1 2DQUH 3ARDB 3N9GL 2NY0B 4Y16A 1CTNA 1LO0H 3IRPX 3BISA 3TBTA 4X7TB 1TQCC 1DSFL 4NQXB 5H35A 3WMSA 3T0EC 5I71B 4KAQL 4F2MA 3C09B 2JCCB 4M3JA 2CDFA 3FT4A 3BKYH 5HVHB 1ZLWK 1UKSA 3PGCB 4KC3B 3WXWH 1MAKA 3HNSH 1RUMH 3GMNB 3SJVD 2BHUA 1M1SA 1F4HA 2G75A 1MEXL 3GIVA 4L1HA 3BGAA 3T77A 1KC5H 3H7BB 1FFPA 2C7UB 4U33A 1MHCB 1CE6A 1QSEB 4KK8D 5FYLD 2NLJB 2V2XB 3ARFA 2CRYA 1CXKA 1YJDL 1EBAA 4I3GA 5IBTH 4BA8A 1A2YA 1WV7T 2OMBA 4N0UA 4TPRL 2WM0A 3WFDL 3QJHB 2H1PH 3OKLB 1KACB 5DD3H 1EEYA 5FYLH 3V4PH 2Z31A 2HMIC 1B0WA 3VG0L 5DEFB 4M4RA 1G7MA 2DQCH 1L4IA 4TUJA 1OVZA 2E7LA 1JGVL 1FYHB 4GRWH 5J56B 3UTZB 1TTFA 4HLZH 5HHOA 3U1SL 4YDJA 4HMEA 1AFVL 4NO0D 5ETUA 4UT9H 5SX5H 3RGHA 3S8WA 4Q6IC 4P0DA 4IIQB 4ZFGL 1IE5A 3L3HA 3SGDH 3QQ3B 4Y5VA 3MJ8A 3RZWA 2B4CH 3F58L 5D7IA 5DF0A 4UOW0 4QEGA 2W0KA 2OS7A 3LS4L 3OB8A 4M7KH 1ROWA 4OZIA 1D7FA 3RU8H 3JUYA 2DJ4A 1UB6B 4HIXL 4JO1H 1RJZA 2ZZUT 1OD9A 5IVZB 4P5MB 1UJTA 1PG7X 5C0RH 3HNTL 3UJJH 3FQTB 4APQC 3E8UL 4OCWL 1RFDH 4YDIH 4KJWC 4KMTH 4NQVB 4TTDD 3VI3F 3HRPA 4ZUWA 1JV5B 4PP1D 3T4AA 4G6JL 4RGMC 5EDXA 4UAOB 1YNLH 2NX5A 4X6FA 2DQDH 5HHXH 3GSOB 1NFIA 2KKQA 4PJHA 4LSVH 3OJ2C 2VL5B 2LQRA 5C3LD 3QXTA 4PTTA 3JWOC 1IC7H 4OCXH 1FSKC 1CTOA 2EXYC 2GSGB 1YDPA 1T5WA 2VKXA 1F4AA 1L7TL 3GGWB 1KIQB 4UU9A 2EE6A 1IJ9A 5ISZA 4IOFD 5J12B 2Y5TA 4PJ7A 1UB5B 3VD4A 4FQXB 3ZDXE 5EIVA 4V1DB 3QDGB 5FGBC 2DYPD 1T1ZB 4WI8A 5ENWA 1T0MB 4X7EC 3PL6B 3QUXA 1H3XA 2A6JB 5DD5H 2DBLH 5CUSL 4XNXL 1Z5LA 1OARH 2OR8A 4MAUL 1HHKB 1HQ4B 5GS0L 3O9WC 3PDOB 4C59B 5MENB 1HINH 1IAKA 4Z7OF 1EEUA 1UCBL 4PB0H 2D3VA 2GQHA 4MNQE 1A0QH 3QIUC 1U3ZA 2YD9A 3L3GB 1F4WH 2VDLL 4WI7A 4Z5RB 4PG9A 4LHQB 1II4E 2UYLB 1QFWM 2YR3A 2PXYD 2AGJL 3B3IA 4PJXB 3HN3A 5IB3A 3ZHKA 5IWLA 1BQHG 4D0CB 1MI5B 5CINL 5JW5A 1Y18B 4YBQC 3P4MA 1QLEL 3TN0A 3U0PA 4QRQA 2Y6SD 4OZGA 4J2XA 4TVSa 5F1IB 3LMJL 4GW4B 2NW3A 4RNRB 1MHEB 5CEXA 2JE8A 2DDQH 5EZJB 4M6NH 4S1QH 4IDJH 1S9WB 3HFMH 3HI5H 4UV4L 4JFEE 4MJIB 5T1MB 4R4BA 2PW1B 1MIEL 1QSFA 4XNMA 1U8KA 5EFIA 3EYFA 5BO1L 3ZTJH 4N1HB 2GJ6E 3ARGC 4QT5A 5INCA 4RMQA 3LB6C 3NTCL 5AAWA 3TYFA 4NWUH 4QHNB 1WSST 5GHWH 4YHKL 1G6RA 2GI7A 1LILA 3DROB 4G5ZH 3WKML 4GKZA 1VEOA 2JJUA 2VDKH 3FO2A 4N0UE 3LRSB 2Q20A 3SJVB 2CLZA 4MZ2A 5HDQH 3OPZH 4H20L 5T3ZL 1BVZA 1U8JB 4I48A 1G9EA 3D3VD 1FG2B 5C0DB 5F9AC 1MFAH 1QHPA 3S36H 4MDJB 1ZWIA 2X4SB 4J3SA 3BAEH 3V52H 2X4QA 3DETC 1SBSH 1F4YH 4GRLA 3MXWH 5B38A 2EYSB 5FAAA 1NJ9A 3CXHJ 4KTDL 1R24A 5JIKA 3QUYC 1FC1A 2BVQB 3FB5A 1S5IL 4Y4HB 5EZLA 5IHZB 4GRWB 1U95A 3CLFH 4RWHA 1RUPH 1KJVB 1KGCD 5I1HL 5I66B 1VA9A 2F58H 4JLRA 1JWSB 1FP5A 4JCLA 3AS3A 1IQWH 3O3BB 4NO3B 4RZCB 4LDEB 5D1XD 4OZIE 1EEZA 1JNHA 1W0WB 3GSUB 4NO0B 3JTSB 3AMKA 4YQXL 4WHYG 4OQTA 3G5ZA 5DK0B 1NDGA 5GSVA 3K80A 1T04B 4MD4B 3RIAK 1I7TB 5D5MF 4ODVL 4HW6A 5DJAA 1P4BL 4FQCL 5I76B 4KJYA 4PGEB 1NBYA 2ZOKA 4F15B 4HXBH 2YA0A 4J3TA 4ZUSB 5D1QA 3IXAA 3WV0A 4LSPH 4HUVA 4G6KH 1O7SA 3QULB 4P3CL 4IRSA 5D1ZD 1DVFD 3O4LA 5HXMA 3NA4A 3SDDA 4F9PC 4CN4A 1X5KA 5ISZE 4U6TA 3C87A 1I7ZB 4WI5A 4KRMB 3G5YA 1SYVA 2ZOLB 1MCDA 2CLVA 4WI4A 1YECH 1QR1A 4NC1E 1XGPB 2F15A 4FFZL 2JB6B 1YQVL 5EO9B 2NY0C 3MGOB 3QO0B 3RWEA 4CL7A 3JV4A 3W9DA 4NWTH 5FA4B 3I3BA 3KPSA 4M5ZH 1OTTC 3ZT5A 3C09C 1A7PH 4XAWL 5E95B 4Z7VA 4I8DA 3IFOB 5HGAA 1U8PA 2OJZH 2EC9U 5K59F 3NCMA 2PTTB 5T3ZE 1DDHA 4DGVH 4XRCA 5JORB 5M95B 4JKKA 1YNKH 1FORH 4JO4H 5F44A 1UZ8B 4CMMA 1A7OL 3ARQA 3BI9X 5DEZA 2EC9T 4DEPB 5I17A 1A6AA 5IVOA 5IW6A 5DJ0B 3JV0A 3LHPH 1NCWH 4A6YH 3W2DH 4TVPE 1VKXB 3REWA 1YNTA 5GGSA 1GGUA 1JRHH 1MCBA 3TBVA 5HYFA 5I1AB 1L6ZA 1H3PH 2PXYB 3ZT6A 3REVA 2JIXB 4L3CB 1H8NA 3PGDB 1KB5H 4MLIA 4FS0A 5TE4H 5IB1B 3TFKD 4J23A 3VFGL 4U1HA 2EYTA 5TGBA 1FO0A 3CC5B 3GHEL 3LKRA 5IQ9A 1FHGA 4P46D 4KK9C 1FZMB 2BY1A 4GSDL 1L0QA 2CRZA 2G9HA 2IPKB 4JHZA 4IIQC 3I2CH 2R69H 2W38A 1U8MB 3QUMA 3HA0A 3BOVA 1K3IA 5TF1L 4PJBB 4Z7WF 4HS6B 1S7TB 4UT6H 3P77B 3QEQA 3IETB 4RMSA 3SKJL 2H8PA 3QFJA 4K94C 3AY4C 4JQXA 2G60L 4RFEA 4JN2A 1NUDA 4BQCA 4DCQB 1E4XH 1EMTH 2B39A 3QEUB 3TT3H 1ODAA 3UX9B 3K8KA 4WHDA 3G08A 3TVMC 4EDXA 2RIKA 1LO0L 2BOBB 2ZUXA 2I26N 3TJHC 2HVKB 4UV7L 1KN2H 1P7HL 5DC9B 3CFJA 3D3VB 5C70A 5HYJD 3BKYL 3HR6A 2XG5A 1G7JB 5KSBA 1AY1H 4ZOCA 5F3BA 5GS1A 1WGOA 5GS3A 3IFNL 3VFTA 1LDSA 3HNSL 1RUML 2MHAA 5DJYA 3FB6B 3VXUD 3ZE0F 1P7QD 1KC5L 2IMMA 5BQ7B 3OJMB 4OUOA 4OT1L 5J12C 3GUTB 1ZT4A 4LOUC 2CR6A 2Z91A 4U1LB 4MAYB 5CLTA 5KG9A 3O0RH 1NFKA 1XMWA 5DD1H 2B7DT 5D1XB 1GHFH 3PF2A 2LTQB 3B9DA 2OYPA 2H1PL 5DD3L 1JYVA 2D0FA 3QISA 5FYLL 3V4PL 2JELH 4X99A 4NPYA 1IGMH 1EPFA 2DJSA 1EO8H 2VITA 4L9LC 3O4LE 4NSKA 4E0RB 2DQCL 1Y0LB 3RPIA 4P57A 1CCZA 3UPCA 3O2DH 2NY2D 1OW0C 1WUNT 4F3FB 1B6DA 4J6RL 5CJ5A 4HXAH 5L8JB 2ADJA 4UT9L 4Z7UB 5L2KB 3HS0B 4OLVL 4PYHA 1R5VB 3PWVA 3MLPA 2B4CL 1TZGH 5CJ8A 3LSOB 1TVDA 1BQHA 4UZGA 3KPSE 3I02B 4PJEB 3VWKA 3ILPB 2OTUB 4M7KL 1ZHKB 5D9SB 3UMTA 2F5BH 3X11B 1HCFX 3RU8L 4JO1L 3PHQA 2P24B 5MP6H 4HJ0D 5C0RL 3MRMA 3UJJL 2O26U 2ATKA 1CD1A 1WTLA 3I85A 1INDH 4UIMB 4NNXB 1RFDL 4YDIL 2ESVE 5EBLB 1MQ8A 2R0ZH 1D9KA 3MRLA 4FQQA 5IFAH 4X6CF 1NCAL 4KKBC 2V5MA 1YMHB 3EO9L 2DQDL 5HHXL 5JMOC 3WS3B 4NHUB 1OQOA 3DVFA 4PD4K 4A6YB 4ZSOB 3QT2A 3BDXA 1FGVH 1IC7L 1X6NA 5JPNA 2V5TA 4K7FA 5MERB 5B39B 1WEJH 1A4KB 1DLHA 5T1KA 3MO1B 1X5JA 1U3HA 3MLZH 1Y6KR 1A9EB 3QEHA 2JK5A 4PRPA 3Q6GH 1P4LB 5T1LA 1YEFH 3VXOA 2VH5H 1OSZA 3RBGA 1KB5B 4CU7A 3AXLB 2CDGA 1IT9H 4XMKH 2ZJSH 4NFCA 3S9DB 1QRKA 2Z8WC 2EECA 4CUCA 4Y4HC 4LCWB 5BZWB 3BIAX 3UBXB 4EQ2A 1MH5B 2ARWA 2E8ZA 3IDNB 4NO5A 3WD5L 3RGVD 3CFKB 5CJOL 4G43B 2VDOH 1HINL 5HD8D 4PB0L 5HY9B 3HB3D 4I5BB 2CPCA 1PZ5A 2MTPA 1A0QL 4H0GA 4OKVA 3VH8G 5JUEH 1F4WL 4NQED 1G9NL 4D2NA 4P2YA 5DA0B 2VE6B 4HAGA 1EHNA 4QXTA 5CS7A 4P46B 4F33A 1I8LC 2P5WB 4Y5XA 3BSZL 1MCQA 4PJDE 4HDIA 2VYRE 5GRUH 3SGKA 1K2DB 1S7VA 2PYED 2Y25A 2FJHA 3SCMA 5EU6B 2XZZA 5DD6A 5JNYB 2H2PC 5E2TH 3TT1H 1UM6H 5EU5A 3Q1SH 3ZHLA 4BQ9A 3S5LA 1YPZF 4M6NL 4S1QL 4DGIH 1P9MC 3NA9H 3QQ4B 2F9BT 2NNAA 4F15C 4IDJL 1EFXB 3FHAA 3WO3B 3HFML 1T3FB 3QAZC 5IKCA 5I15H 3L3DB 3HE7C 3WO4B 1DUYA 1QG3A 4LARH 3OJDB 1MY5A 3OR6B 3RWJA 2HLAA 4KU1A 4HGWB 4GT7A 4Y5YC 3N1QC 4U1GC 1QZ1A 5CZKA 5IW3A 5CWSA 5E99H 4ZFZA 1IAMA 3EHBD 8CGTA 1LP9A 4NWUL 5LAXB 5GHWL 5JA9A 5DRXB 2BVTA 4G5ZL 3D48R 5IM7A 2VDKL 5FV2A 5E94A 3P11H 1UH4A 1GZQB 3FMGH 3KPLA 5C0BA 3VXUB 5HDQL 3OPZL 2EXWC 5DLMH 2UUDK 1I4FB 5A2KH 2W07A 3ZKQD 3BPNC 3GMOB 3A6CH 1MFAL 3S36L 3HUJF 3MCG1 3TZVA 3V52L 3DUHA 1AXTH 1SBSL 2VC2H 4G8GD 2FIKA 3MXWL 4KJQD 3MRNB 2GFBB 1RU9H 4LKCB 3PHOA 1T2QH 4KDVA 3CGTA 3IJYA 3JVGC 2DM7A 3RVTC 4QNPE 2XWTA 3MRKA 1FZKB 3WCYA 2R2HB 5ICXA 3RDTA 3MNZB 1KCRH 3D2UB 5EBWB 2F58L 1S7SB 3H9SD 5BVPL 1IQWL 1IM3B 1MPAH 4X7FC 3QI9B 3VW3H 3UZVB 5HHQB 4G6AD 1EVUA 4POYA 3W82A 3S98A 1S9VB 5DYOB 4KK6C 3WLWD 4U2YA 3B9KA 4WTZG 2IAMC 2M8XA 4IOIB 2A0LC 3SDAC 5FUZL 4NN7B 4G8FB 4HIJA 1YEKL 3BH9B 5FM5M 3D39D 1J1XL 4JG1H 4R3SA 3TYGH 4HXBL 3P9WB 1WBXA 5ESQB 4WHCA 4HFWA 3C60D 4LRIC 4POZD 2YZ1A 3DRQB 4LSPL 4M62L 3BE1H 5JPMA 3CPLB 1UM4L 4NDMA 3V9FA 4CAGA 1CICB 4CN6A 1N0LA 5EUOB 5AZEL 4GKNA 2AXFA 1S8DB 1XT5A 3BQUD 1JZ5A 1XF4B 2A9NL 1U8LB 4R9HA 3M17A 9CGTA 2VAJA 3STBA 1I1YA 1N5AA 1P4IH 3KPNA 4KGLA 1BPVA 2AV1B 3RNQB 2ZCKH 3VFUA 1A6WH 4L3ED 4BSWB 1T22B 1YEIH 3HMWL 4M5ZL 4M7LH 1IGYB 3QJFB 1BM3H 2FZ3A 5ADOH 2EDNA 2V2WB 1A7PL 1WIOA 3MJ7A 2OJZL 1DQJB 2XIDA 2YBRA 4DGVL 2IH3B 4WO4D 3P0YH 1XEDA 3KPQA 1YNKL 4JO4L 1T7XA 3LVEA 3LIZL 5D96B 3D0VA 3OAZH 4ODHL 5DHVH 1IAIH 3LHPL 1NCWL 3RGVB 3RKDC 4A6YL 4AY0A 5I8CB 3STZB 1BF2A 3VFPB 3ARVA 3FN9A 2AS5M 1LVEA 4NQEB 4Z7NE 4GO6B 1JRHL 3A6OA 5C0IA 2ZCHH 1KPUB 2LTQC 5KSAD 3AS0A 1KOAA 1FVCA 5K9JH 2QADD 1H3PL 5L0QB 1ZGLM 1UKQA 1KXVC 1WAAA 4NQUA 4FZ8H 4LHUG 2P5EA 2APVA 3BUYA 4OUUA 5FCSH 3VDBA 5TE4L 1SM3H 1IC1A 1KLUA 1JGDA 1KN4H 1TJGH 3UPAA 43C9B 2LU3A 5FKAA 3VRLE 1LP9E 4BH7B 2XZAH 3I2CL 2IG2H 1JIBA 1JF1A 2R69L 3O6MH 2GITA 3ZSSA 3PWUB 3P9MB 4H26A 4MDIB 4P2CG 3IF1B 4G3YH 5TDPB 3KYOA 4EBQH 4HC1H 1KPVA 4OCNC 3NPSB 1KLFA 4GAYA 5D7JD 3QUXD 4NYLA 3TT3L 2XQBH 3GSVA 4IRZH 2VOTA 1TPXB 3UO1H 2ERJB 4TULH 4YE4H 3TCLB 4YHMH 4MA3B 2IPUG 1CE1H 3T4YB 4Q97A 1KN2L 3SPVA 5FF6B 4OTXL 2QR0B 4TRPH 5F1NB 2DQJH 2VQTA 3ALPA 1AXSB 1AY1L 1P7KA 2ITCB 1KIRA 4JY4A 1H3VA 4ZYKA 5MEOB 3FZUC 5E8EB 4Z77B 3D0LB 3FT2A 2XPGB 3RVWC 4PBXA 4Y2OA 4LIQH 4GJTB 1QRNA 5IB5A 4L8SB 3TN0D 4DVBB 1UG9A 4WUUD 2IALB 5GZOD 3MRIA 4Q9BA 5DT1H 1OGAA 1E28B 4IDLA 1FH5H 4Y19A 3RIFF 3PE9A 3WHE1 3ZO0A 4NJAH 3H9SB 3O0RL 3MZGB 1PAMA 5E4EC 2YD8A 5D6DC 2YK1H 4RA0C 3CVIH 3EBAA 5DD1L 4Y8DC 1FIGH 1GHFL 1EO7A 1FNLA 1VFAB 3B4NA 4WV1A 1T1WA 2JELL 4PJ5E 2PYFA 4Y16B 1EO8L 2G5BA 3H42H 3TBTB 3WFEH 3NIGE 3D6GA 3PP4H 5H35B 4AQOA 2WZPD 4F2MB 4UILL 2CDFB 1J1OH 3O2DL 3BMWA 3FT4B 5FOBA 3RTQA 3ARWA 3VH8A 4HXAL 4CRPA 1CQYA 2DS4A 2KDGA 3EO1A 3EOAA 3AAZA 1JF6A 2F53D 4IRJA 4NN6C 2AK4E 5D93C 2G75B 4HG4J 1BFOA 1TZGL 3GIVB 3T77B 4DWHA 4X9FA 4Z0XA 3ZE1F 1FFPB 4LMQI 1G6RH 3MXVH 1CE6B 3CFDA 3R4DA 2I5YH 3BP4A 4KROD 1ZVSA 2F5BL 3OSKA 5JW4M 1GJIA 1DN2A 3ARFB 3P2TA 4JPWH 5I18L 1QFWI 2XTJC 5MP6L 1B3JA 3MRQA 3BP5A 1A2YB 4S1SL 3UTSD 3QIWA 1S9YA 3LKSA 4K3EH 3TH4T 1JWMA 2NY3C 4MQ7B 3ULVD 1N2RA 4L3EB 1EEYB 2Z31B 3BP7A 4ZD3H 1AC6A 1HN1A 1L9NA 4JZNA 4RAHA 4BZ2H 1EAPA 3RWHA 3G6DH 4Y2DA 3BZFA 5IFAL 1PG7H 1G7MB 4RISL 5D5MA 3QQNA 4WVRA 4TUJB 2B5IC 3UPRA 1MAJA 3QWRA 5DHVB 1BGXH 4ZMAT 5HHOB 4PG2A 4YDJB 5ETUB 1FGVL 2XFXA 1F5WA 1R5IA 4XNQA 3L3HB 4Y5VB 3MJ8B 1WAAE 3CD4A 2P5EE 1FAIH 1UKTA 4YHZH 5D7IB 3MLZL 3OKYA 1QSVA 3MV8E 1Q9KA 4OM1H 1YEFL 5HYJE 3JSSA 4BUHA 3PGFH 4JKPH 2VH5L 4JM2C 2UVEA 4OQTH 4OZIB 3ALWA 3FONA 1IT9L 1RJZB 2D31A 2ZJSL 2NQCA 5D1QD 3WSQH 4YFLI 3CX5K 2X1XR 5I75B 5KSAB