5F6HI

Crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
210
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSGMIWVRQAPGKGLEWVSYISLSGANTYYADSVKGRFTISRDNSQNTLSLQMNSLRVEDTAMYYCAKEGWSYFDFWGQGVLVTVSGASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DH427 Antibody Light Chain
publication title Structural Constraints of Vaccine-Induced Tier-2 Autologous HIV Neutralizing Antibodies Targeting the Receptor-Binding Site.
pubmed doi rcsb
source organism Macaca mulatta
total genus 42
structure length 210
sequence length 217
chains with identical sequence K, M, O
ec nomenclature
pdb deposition date 2015-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f6hI01
1XF3B 4LSRH 5I1EH 1B6DA 4HLJA 3VXNA 3KR3H 5A43C 2G60L 1E28B 1ZS8A 2P45B 4AG4L 1BZQK 4QHKJ 1LEKB 3RWGA 5KAQG 4HULB 2O5YL 1IQWH 3CXHK 3EO9L 5HYQA 5BO1L 2AAVA 3U9PL 5D1ZC 5C7XH 5IHLB 2GTWB 5HI5D 3FN3A 5HVWA 5CBEB 2CMRL 2R23A 3BPCA 2ARJA 1H15B 1WQVT 4JQVA 3WFCL 5E00A 1MREH 4G5ZH 4NO5B 4OGXH 4Q9CA 2GITB 2HLAA 3BPNC 3LKQB 1I4FB 3LSOB 4WW2F 3MCKB 4J1UB 1D5IL 1IM3A 2IFFL 1OY3B 5TF1H 2A6IB 3WFDL 4QWWD 4F3FA 1G9ML 3MUZ1 3MGTB 4R7NA 1RQ5A 3L1OL 3QCUL 2V9QA 5D2LE 2R29L 3X3FH 5MHSD 4QRRB 4WW2A 3S37H 2HJLB 1KJ2L 4PP1D 3DYPA 3LPFA 4MA8H 4U1HB 2MCG1 4HKZB 3V4UL 1AXSA 1DANT 1NCWL 2A9MH 1GPOH 4TUKH 1MRDL 5L2JB 1I8IB 3IXAA 2WQ8A 5GGUB 4MHHG 4M1GH 1QSZA 3C5ZD 1QSEB 3VE0A 1A9EA 4RGOH 1Z0NA 1GXEA 5LXGH 1BZ9B 1FRGH 1G7IA 5CUSL 5IB1B 4PS4L 1KACB 4Y16B 1WFNA 2EH7L 1KCVH 3RPIA 1HZHH 3VXUE 2XN9B 4PJIB 4JM2D 4WWKC 1MCRA 4OZFA 4I1NB 5KW9H 1RULL 1M71A 4WHDA 1AXIB 2E9WA 4G6JH 5TE4H 5SWQB 1I8LA 3TWCH 3HG1D 1AHWB 4RX4D 5DRXA 5D7LA 3TCXA 1BD2A 5B39G 1XR9A 5B21A 2HVKB 2VDNL 1SEQL 2HT3D 1GOHA 2V5MA 1DLHB 1QRNB 2EDBA 3BGFC 2FJGB 4LL9A 4TPRL 1F4HA 4EDWH 2V17H 4PRHB 2W65A 2NLJB 4GS7B 4PRAA 1FYTA 1MFDH 5C0RL 4OIBA 4XCCL 2H2PC 1N5AB 3ZKSD 4DFIA 1W72L 1QA9A 5CD5D 1I3RA 2MCPH 4ERSL 5C8JB 3B2UD 3ALXA 2GY7B 3QXDB 4WY7L 5IBTL 4MJ4A 4RFEB 3O8XD 4DKDC 5E5RB 3EYVA 2HFEA 1A4JB 1DQQB 4M62L 5GGTL 5HYJD 4OGYH 4K9EL 4J4PC 5I1KL 1QYGH 2DQTL 1C5BL 1FBIH 1LQSR 4P2OD 4MCZA 4MS8C 4AEHL 3BMWA 3S97C 1JL8A 4NKMB 2IGFH 3A67H 1HINL 1S8DA 1HEZA 1WEJL 1OGTB 3TZVD 3RZWA 1A7QL 2BOCB 4MMXC 4XP4H 4P46C 4K94C 3GNML 5EN2A 4KH2A 5ALBL 1CFTB 2GSGA 1U8MA 3VI3E 1ADQL 2ERJC 3LN9A 3KPOB 2ICWB 2UYLA 2DOCA 3B6SA 1D5BB 2VLJE 4MAYD 2GK0B 4U4BA 1S5HB 2FBJH 4NFCA 3ARBC 2J8UF 1DTUA 4HCRL 4MVBC 4BK4A 3TCLA 3WUZA 4ZSOE 1X6LA 2WIIA 1QLRB 3EOAA 4MXVE 3UTSB 1UVQA 2AV7B 5CKAA 2VDRH 4M7LT 3H7LA 4IHOB 3NTCH 1FE8L 5TF0A 4HIEB 1FL6B 1LO2L 1UCTA 2Y5EA 4JHWH 1AQDA 4PJAE 3WKNA 3VRLF 1NMCC 3CZFA 1DE4A 5I75B 5JO5B 1C16B 4KHTL 5IMOB 3MLRH 2P43B 3MCLL 4IMLB 2HRLA 3BEVB 2IPUG 1M7XA 4PG9A 1BREA 1KG0A 2AJ3A 3OQ3B 1RU9L 3V0WL 3VXSA 3F62A 1MHCA 3OF6A 4Y4HA 1IKNA 1Q72H 3IJHA 3GMLB 2O5ZH 1I3GH 3X3GH 5I9QC 5FK9A 4ZTOH 4ZUTB 1NGWA 2X4PA 1KJ3H 4E41A 4JJ5B 4YHPA 4EVNA 1YYMH 4YHZL 3QNZB 2PNDA 3BXNA 1JGVH 1GRWA 3PV7A 4OZIF 5FCSH 4HMEA 3DPBA 3PWPB 4L3EA 5KBNC 5D70H 4O51A 3BP5A 3S96B 4G6AC 3CSGA 5CBAA 2EXYC 1I7UB 5C2BH 2P5ED 2W0LA 4XP6H 4XPGH 4X6DE 4OZIA 1TITA 3FRUA 5IR1A 1HK6A 1EFXA 5CHNB 1E6JH 1IM9D 4XTRC 3CGTA 2ENSA 3GKWL 3WHXA 4QWWC 1D5MB 1P4LB 1S7TA 2O61B 4TQEL 4DFHA 2ATPA 1MHEA 3C09B 2B5IB 5HHPB 3X11B 1G9MC 2JB6A 3QZWB 3SJVD 4WEBL 3D0VA 4URTB 5DQJA 5EBLA 4G9FE 4X0KA 5I1CH 5KVFL 4LVNB 1I9IL 3IDNA 5I1EL 4F7TA 3F65A 3O4LB 3TBTB 3TH3T 3UTTB 4MQXD 1JF1B 3G5ZB 5CLTA 2P8PA 4Y4FB 2BXYA 4XBEH 3TGXA 4H20L 4P5MB 2Q8AH 1WTLA 1FNAA 3QHFH 3S8WA 1SYSA 3MMEA 2VB5A 3QDMD 4L8DB 4CVXA 1CICB 4NHUA 4RISH 3TPUB 2GKIA 5C7XL 4X7TA 1PQZB 3KPSA 1ZA3A 5JW3L 3HZMA 4JQXA 4G8FB 3WS6A 4Y2DD 4EOWH 3QXAA 1JUFB 3NGBB 4NP4L 5HHME 4GKZB 3C2AH 1FFPB 2J6EL 1MREL 1SQ2N 5INDA 1QACA 4G5ZL 1MJUL 3PHOB 1LO5A 1T1ZB 3OR6A 4TTDD 3VFOB 2RJMA 2BSTA 1IVLA 1PD6A 4KQ3L 4R3SB 2H9GB 4CUCA 5FM8A 1QFWI 1HHGB 4I2XA 3B5GA 4H1LG 5L2KA 3D9AL 3O6MH 5DJYB 2Q20A 1YNLH 1J86A 3KHQA 5AZEH 4JHZA 4KK8D 1RK0B 4M02A 3LKOB 1RHHA 4XCFL 1LO4L 1MNUH 1F8TH 5HPMB 3D1MC 3MV9E 4YGVB 3IDJB 1CE6B 5HHNB 4Y5VC 2OYPA 4B53A 1J8HD 1I7RA 2KZ1B 4NM8H 2V7NB 1K3ZA 4MNGB 1A7OL 3D0LA 1LDPH 4TUKL 5TE7L 4X6EB 2Z4QA 4O4YH 3W2DH 3WJJA 3WNLA 1IGYA 2VL5B 3H9HB 3VFVA 5BS0A 1JZ7A 5EB9A 1KCUH 5BJTA 1I1AD 5C2UB 1XF1A 3DVGA 5D1XA 4I3RL 1HKFA 3BT2L 4IJ3C 5KJRL 4EJ1C 3VH8B 1KCVL 1HZHL 4WFHE 3FQNA 4K9EC 4M48H 3GSVB 5DWUH 5E9DA 1CDJA 3FTGA 3K4AA 4WI7A 3U0TA 2VR4A 4BK5A 2HVJA 1IGMH 5DD6B 3F5WB 3T0VA 4K07A 3RIFK 1TZIB 1KLUA 4PJXB 5EUOA 3MNWA 1VENA 2Z31A 4YHOH 1KB9J 4L8SB 3UJTL 3T0AA 2PW2A 4KJYB 1IAKA 2PYEE 2D9CA 5TPWL 1FYHB 1F6AA 3QDGB 1BFOB 3KNBB 1RZJL 5T1LD 1WZ1L 2V17L 3HI5L 2Q86A 5I0ZA 4P3DA 4ELKA 5HHOA 3O2VH 3Q0HA 4F7PA 4MB5A 4PV9B 4WV1C 4DVBA 5HHXH 4KK9D 1T03H 4JY4B 3VCLB 4J3UA 2CXGA 5T3ZE 4D0BA 4FQLH 5HY9B 4ZXBB 5C09E 2X05A 3C60C 1EJ6A 3BQUC 1IEBB 4RFNB 5SV4A 1ETZB 1ED3B 4J3TA 1QZ1A 5F7EH 2GHWB 1VACB 4PJDB 3WFZA 3X12B 3ZSSA 4NQVA 5EBWB 3IDXH 5BZDB 3QG6A 1JN6A 1TQCB 3HN3A 3ARQA 3RZCB 3B9KA 2X44D 3LD8B 1Q0YL 1IGJA 1EMTH 3U7WH 7FABH 2CLVB 2F5AL 2R2EA 4N90E 2J4WH 2X2YA 1P9MC 4C54A 2DM3A 4ZO9A 4DUWA 1CXIA 5HI4C 4P0DA 4QXGL 4F9LC 1MLBB 1A6TB 3IVKA 1REIA 4P2QB 2ED9A 4P2RD 1G7JA 4D0DB 3IXTB 4LARL 4M5ZH 3QQ9C 3F7VA 3AMKA 2DQCH 4XP4L 3W82A 5AG8A 3PQYB 4H26A 1A1NA 1NANH 1RUMH 4HS6B 1KPVA 3N0PB 1IGIH 3OKDA 1OP5H 3IAQA 4HLZG 5ENWB 4YNYB 1MI5A 5DEGA 4LNRB 3ARDB 3MLXH 1UB6B 4XAWL 1S7VA 3CX2A 3C5JB 3EO0B 4OI9A 1U3HC 2FL5A 1MFNA 4OZFG 3FT4B 3L7EB 4WO4A 4RAVB 3V8CA 4N0YH 3UDWA 4MNQA 4UUJB 5C0GA 2XWJA 3OJVC 1NGXB 2YRZA 1F3JA 3LQAH 5CJQL 4PV8A 4O5LL 5B3JE 4HXAL 5DDHB 3GMQA 4D2NA 5DXWA 1FORH 3ARXA 3ZDXF 3L3GA 3QHTC 2NXZD 2QSCH 5FF6A 3GMOA 4OM0L 4X6DB 4HH9B 4F7EA 2WUBL 3CU7A 1K2DA 2CPCA 5C9JA 2Q6WA 3PP3H 3A6CH 4U1MA 3MLRL 1N4XH 2YKLH 1AGCB 3AB0C 2XZZA 3N50A 4WHYH 1C08B 1QOKA 1DSFL 3RWHB 2DYPB 1PKOA 5D6DA 4LLYA 3PWNB 4QXWA 2VERN 1EHNA 1NBZB 1S3KH 1FZJA 4ZNEA 3OAYH 2CUHA 3GGWB 1U8HA 3QUXD 5D1ZB 1I7ZB 1Q72L 1DQJA 2O5ZL 3RRQA 1I3GL 5KSAA 5JIHA 3CCHA 3L7FB 4PREB 1SY6H 3ULVL 4ONFL 2QLVB 4BSJA 4NQDA 4MAUH 4ZOAA 1TJGL 3FB6A 3QUYA 3BPNB 2OTUB 1MRCL 3G08B 3P9MB 5JUEH 5DRWB 3PWVA 2X7LA 3DROA 5C6TH 2C1PA 1XGPB 1CFQB 5E2TH 3C2SA 5CINL 4XP6L 3T4AB 4XPGL 5JXEA 4P3WA 2JCCB 4YBQC 1GGBL 3OZ9H 1LK2B 1UQSB 2P8LA 3H9ZA 5HHMB 4OF3A 3GMNB 3LKPA 2MSPA 1IBGH 5J57B 1CGWA 1MAKA 1EO8L 4HGWB 3TT3L 3FT3B 4LHUD 3QQNA 5JR1L 2ADJB 3P11H 3HC0A 5IGXH 4D0CB 1N0XH 2BNQB 5T3XH 3MV9B 2IALB 1NDGB 1EERB 5CILH 3RWJA 3V2AR 3F6LA 3MRJA 4CL7A 4LEOB 3S98A 5EU3A 5C9KA 1SM3H 4WWKB 1UA6L 4JFXB 3ZT6A 1JGUH 1HSAB 1A1OB 4Z9KB 3GRWH 4PFEA 2JELL 1I1AC 3RA7H 1T1WB 3UTQA 2NNAB 3D25A 1S7UA 3QHFL 3P77B 3QIWD 1K5NA 2KQMA 5ISZD 1EAPB 1N3NA 2FIKA 1R5VB 5ANME 1JZ8A 3DX8B 1WWCA 3ZYJA 1OQOA 2F8VA 2GK2A 2BSRA 1F90L 4ODUB 1XR8A 2NYYD 4PRIB 3BGFB 4P49A 5DK2B 1CXFA 1TCMA 4KRMB 4JCLA 1QFHA 4KVNL 2DI8A 4KKAC 1IGCL 1A6PA 3K7UA 3VA6A 3HPLA 2YSSB 4M6MH 1PAMA 3HR5B 4JFEB 3O6ML 2VXTH 4U1JB 2Z35B 4PJCE 1YNLL 5AZEL 5HGBA 1NEUA 4ZOCA 1MJ8L 1MNUL 2PTTB 4KAQL 2X4UB 2YMXL 4J3XA 3UTOA 5MENE 5SWSE 3FKUS 5KVDH 3EDDA 4JKPL 4KRPC 4EI6B 3NCBB 3PDDA 4HLZH 3QO0A 1PKQE 4HUUA 1VHPA 4N0UA 4QHLB 5KZCB 5IWLA 5C0FA 1LDPL 5GJSH 4G80B 4DAGL 2BC4B 1Z3GL 1UC6A 3V6FB 1RZFH 3DVIA 1YEIH 2Y36L 4OZFH 4P9HH 2FYYA 2EXWD 4D9LH 4M7ZC 5FYLH 5C09B 4QRPD 4LSVH 3CLFH 1D9KC 3HZVA 4CKVX 4P46B 2A6DB 2AJZA 5FUOL 4CNIB 4N8CH 1Q1JH 1DDHB 5CAYB 1AFVH 1TQBC 4M48L 4RRPA 3X14B 4I5BA 3QRFM 1EPFA 5H2BA 2ZUVA 2ERJB 3KYKL 3KDMA 4UQ3B 1IGML 1BM3H 5ESVB 5HHQA 3RL1A 5TDNB 5DO2C 5E6YA 2FX7H 2IANE 5C0BB 4AEEA 4YHOL 4GW5B 4Z78B 1M7DA 3FQRA 4Y19E 1LD9B 2IQAA 1KYOK 3ARBB 1OAUH 2B4CL 4NZTH 1MRFL 1A2YA 1QTYT 1WC7A 3DECA 5CMAA 1N7MH 1N5YH 3KLDA 4MSWA 3V5DB 4XC1H 3TA3D 4JO1L 3UPRB 4R0LC 1FH5H 2BK8A 3DUSB 4FQJL 4AENB 5IMLB 1Q9WB 5HHXL 1SJEA 3O6LL 3X13B 3MV7E 3W11C 1NMCB 1FNHA 5IEHB 2CIIB 2CDEA 4IRSA 3WXVH 5B38A 4LVEA 4P23D 2OZ4L 4JM4L 2H8PA 3HNVL 3L3DB 4HK3J 4X4MA 3MOAH 3WLBA 1NAML 2R1YA 3O3BB 3SE9H 5IESH 3UYOD 5BXFB 4UOW1 4GSDL 4PJHB 3JBG7 1BQHA 3IJSA 4N9GB 3RAJL 4HC1L 2Z9TA 5I9QB 4DZBA 5FGCE 4ZFGL 2NTFA 4FQXC 1VKXB 3QNXA 4HWEL 5ETUA 1P2CA 2HJKB 3FQWB 5L6YH 4PJ7A 3BIKB 3MXVH 4DGVH 4XHJC 1K9TA 5DMJB 3CH1B 3WFHA 2VZVA 1YNTA 3IKCB 5GS1A 3GIZL 4LCWB 5IVZB 4LCIH 2JJTA 5F70A 5I1DB 4CJ1A 3ZYIA 4UBDD 5DFTA 4FZEH 1NQBA 5FYJH 4H5SB 4ZUWA 2BVEA 3ULVC 1YDPA 4OQTH 1RZ7L 5GXBB 4NJ9L 1J1OL 1OW0A 4PJ8A 2HWZH 2E7BA 1H3GA 4N0YL 1KN4H 5IFAL 3HB3D 2ED8A 3FT2B 1G7MB 1RZ8A 1UZ8B 1HHJB 4LSQH 3R06B 1AC0A 1KPRA 3BP6B 3Q5OA 4FP8H 2IH1A 3G5YA 3F12A 4KGJA 4NGHL 2PXYC 3T08A 4MCYB 1ZVSB 1FORL 2P24B 3T77B 4UT6H 5B22A 2R56H 4G6MH 3MFFA 5KSVA 3HNTH 2QBWA 1MHHB 3CX5K 3EJYC 3VFWA 2AJYH 5F3HB 3MRIB 5C6WH 2C7UA 2YKLL 1NFIA 3WL9A 1YMHA 2E7HA 4U7MA 3S88H 3ZHDA 3VWJA 3KYNA 4WU7A 1YEDA 3LRHA 5F8RC 4DVRH 3P4LA 3R4DA 1ZHKA 2EO9A 3RVVD 3REVB 2XQBL 1QEWA 4K7PX 3ELAT 5J3HD 3AC0A 5DC0A 1YEKL 1NUDA 3K2UH 3T0EC 5A16B 4ZAKD 1YEJL 4HK0A 4U6VL 3VXMD 4P48A 5JUEL 3QJHB 3DMMA 4F7CB 2DIAA 3QEQA 2DL9A 4HMCA 1GAFL 1YNKH 4BFEA 3WFBH 1CD1A 4OI8A 4GKOA 3D2UB 5LGHL 3GHEL 5E2TL 3O6FD 1UXSB 2GAZA 4Z7VA 1UZ6F 1U2CA 3FOMB 2HRPL 5TQ0H 1NJ9A 3FCTA 3STBA 3B5TA 1A6WL 1CI5A 4Y5VB 1EZVX 5EU4B 1HYRC 1GIGH 3VI4E 5HDOA 2KH2B 4MD4B 1KB5B 4J3WA 2FLBT 2FIRT 2PO6D 4BJLA 3LV3A 2NX5B 2HKHH 3V0VA 4YPGA 3MRBA 4DK6A 5ESQA 1U8NA 4EIZC 1W72B 1MCWM 3O8XB 3P11L 4P2YA 5H35B 3T65B 5DMKA 3QT2A 4HIIA 5HYJB 5T3XL 2ADFL 4KJWD 2XKNA 2VLMD 3U7YH 1HDMB 5SWSB 4P2OB 5F9AC 5EOTB 1F58H 1SM3L 3GMMA 4OCRL 1F4AA 4G8EA 4IBLT 5E2JA 4QF1B 5T1DH 1UXWA 4PRBB 5DK0A 4OZHF 4OFKA 3G6JB 5FDWB 5TFSH 1KGCD 1VB9A 1NMBH 1A7BA 1FNSH 4PJGA 4NRYA 2D31B 1QPPA 3O6KH 3VFPB 3V0AC 1WBYB 1U91A 4Z7UE 4M7LH 5DJ0B 2EDXA 4R4BA 5E4IA 3SDYH 1VPOL 4N0FB 2CO7B 1NEZA 2BNRA 3JV4A 1CDUA 4JFHD 2FWOA 4MAYB 4OB5L 1PX4A 5CKGA 4KK6C 1YN7A 1I3VA 4GBXC 4WV1B 4NQCA 2DBLH 1JRHL 2D7PA 4YDKL 1UWEH 4HKBA 4WHTA 4K3EH 4ZS7H 2APXA 5IM7B 4YAQA 1KJVB 4RQQA 5BW7C 2P8MB 3CK0H 5H8DA 5CJXA 3C60B 4HZAA 2J5LB 2B4CC 5DFVD 3BQUB 1U8LB 3Q6GH 5CZKA 5D4QA 1TIUA 2HTLD 2DLFL 4WDIA 2I07B 1VFUA 3DXAE 3QB7C 4IRJA 2NTSP 3UYRL 4FQ2H 2DL2A 1L0YA 3OHXB 5LAXA 2B0SH 4IMKC 4PUBH 1HOCA 1MCDA 2IADB 2XQYG 2YK1L 3B43A 5DJDA 4P9HL 5DQDH 4UV4H 4AIXA 2IAMC 4D9LL 4I3GA 4XH2B 3F8UB 1IAMA 2OR7A 4BH8B 1OTTD 2FB4H 2PW1B 4GKNB 5CGYC 4LSVL 2X4NA 4KDTC 3RGHA 3PP4L 4MYWB 4YO0B 1Q1JL 4M8QA 5FYLD 5F71A 1QVOA 2BFVH 4I13B 2BRRH 2GSIA 3VRIB 5D7LD 4HDIB 4PD4J 1BM3L 1MFBH 4LCCC 1QBLH 3OAUL 3VW3L 5JDSA 2H32A 4ZUUA 2W0FB 2YZ8A 2A38A 4H0HB 4GXVL 3I02B 1D3CA 1U3HB 1LWRA 3A6BL 4L4VA 3QUZC 2CDGB 4LIQE 4EN3D 4WFFE 3MJ7A 2VE6A 4LVHC 4M1DL 3QJFA 4M4RA 4JPVL 1FC1A 4NRZB 3NCYP 1G9NH 3F7YB 1T1YB 2YD4A 1N5YL 4XWOC 1X7QB 3LRGA 4XC1L 1RUQL 1IM9B 5JPNA 2VITB 1SMAA 2OX5A 3BWAB 3TO4D 2W9EL 4JREB 4KKCD 4XP5H 1C1EH 1WAAF 4NJAL 4XPAH 5MEPB 4DUVA 1P5UA 1S78D 4GAYB 1D6VH 2N7AA 4YHYC 4OLYL 4NQXB 5C0AE 3AB0B 4JO2H 2UZYB 1ZGLM 5GGSY 1JPST 1TCRB 1FFOB 4O2EB 4PJIF 5DA4A 4WI6A 3TN0D 4Z7WB 5IESL 4YDLC 4LKXB 4NSKB 3ESUF 4L4TB 4WUUE 5H37H 4XXDA 5AG9A 4NQED 1PSKH 2JTDA 4K3HA 2ADIB 4C4KO 1PJ9A 1AC6A 4O2FA 5EBMB 4MJID 4U3XA 3HRPA 2UY7A 2APBA 3ZDYE 3HE6A 3QDMB 3QPQD 3VGHA 4LGRB 3RI5K 3HKFA 1DL7L 1T5WB 2DTMH 3MC0A 3TBVB 5FCUH 1DBMH 3BZ4B 3HNSL 3KS0H 3MLWH 1JTOA 4BSWA 4XVSL 5HDBF 1E4WH 3PGCA 4FZEL 1AI1H 5IVXE 5C0JB 3BYYA 2AXGA 4RRPG 5D5MF 1FZKA 5CD3B 4M7KH 4NNPL 1NAKH 4BA8A 5FYJD 4ETQA 3O41B 1JMZA 1RFDH 2OMBA 2QADD 4YDJA 4PG2C 3OMZA 1K6QH 5GS0H 1ZLSL 5JORA 4ZQKA 4UB0H 3ZHKA 4WNQA 2D7MA 3LQZA 4FP8L 4I4WB 4JFQA 3U0PB 3G9AB 5CLWA 1HI6A 1J8HB 3IDGB 3UTPD 2OR9L 4BZ1L 1YEEL 3NIGF 2R56L 4G6ML 4DQOH 4HIXH 4F37K 3K8KA 4HKJB 2AK4E 5INCA 3WS3A 4LSSH 3W0WD 1OPGL 1KBGH 2G75B 5I2IA 2H2SD 4NWUL 1MIEH 3VMOA 3NA4A 3WIIH 4QOKE 3VXSD 2EZ0D 1BFTA 1I1AB 3QNYB 2FJFA 5DK3A 3S34L 3ES6A 4JLRB 3WO3B 1NCUA 4LLDB 1KCRH 2XFXA 4X6CE 3RDTD 1JYNA 1S9YA 2D3VA 2ARJQ 5DYOB 5B38G 4E41D 1EXUB 4KV5E 1PLGH 3MROA 3W81A 1P4IH 3QCVL 5ICZB 4D9RD 3TBSB 2FHBA 2DWEB 1EBAA 2ZP0T 2UWEB 4PR5A 4KJQC 2OBGA 1U8JA 1JV5A 3WEXB 2OM5A 3K2UL 4GOSA 4G6KL 3QHZL 4JQVC 1N64H 1LK3H 1BQHG 3OJMB 2H26A 3KJ6H 4D3CL 3MRCB 1EHXA 4XB8A 1YNKL 5T5FH 4OZ4A 2LAAA 3SY0A 1OARH 2QQKH 4YDIH 2IG2H 1U9KA 1NC4A 1K4DB 2A74B 2AEQH 4OKVA 1G7PA 4KTEH 2HT2D 3DBXA 2DQJL 1GIGL 1ZKAA 3W9DA 5JHDA 4GRWE 3E8UL 4WW2C 3UEZA 2I9TB 4NYLB 1W2KT 3OKLA 4R6UA 2AJXL 5TE6H 4C83B 2VABB 4YZFE 1DQML 3U46B 4TNWF 4X5WA 3O2DA 4QHNA 1A4KA 3VRJA 1EUUA 3CFBA 3WXWL 3QEHB 1MF2L 1FO0H 5C07A 4GW4A 2X41A 1IJ9A 1ZANL 4ELME 2KL6A 4MDIA 2YD2A 1X5GA 5JOFB 4UQ2A 1D9KB 4LFHD 4C56D 5ICYB 4NRXB 4NUGH 5CIPA 2G2RA 1F58L 3LEXB 2C4FT 1KFAH 1B90A 1RIVH 5EWIL 1HILB 4HV8A 1KIPB 4S1QL 1NLBL 5LGJB 4P2RB 3RIAF 3KPSD 3UX9B 4P9HC 3DX6A 1NMBL 1FNSL 4RGND 1I8LC 5ID0B 1AQKH 3WDJA 2DTSA 3O6KL 3HS0A 1UM4H 3LN5A 4P4RA 1NC2B 3QQ3A 1KT2B 3ARZA 4LCYA 4NO3B 4HUWA 4YHMH 1ZSDB 5DA0B 4Z8FH 2YC1B 5SX4H 3AREA 4S1RH 3P4MB 4R0LB 1BLNA 4ONGH 2DBLL 1A64A 5CJOL 4Y1AD 2RHEA 1IFHL 3G6DH 5KSUB 1G7HB 2C1OA 4GLRH 4FA8A 3SDCA 4QRTB 3CK0L 4K23L 3PDGA 4R4FH 3ARVA 5F7UA 3Q48A 3UBXI 2ZCKL 1ZT1B 5D2LF 4KROD 4HD9A 5C0DA 2NXZB 2I60L 3QDJD 4IOFD 5HDQL 4KY1H 3CVHH 5FA3A 2WP3O 4Y2OA 5KSBA 1WSST 5GISH 3ZKNC 1PZ5A 5E2VL 4O00A 1ZLVK 3MRGA 2Q87A 5E6ZA 4G6FD 4FQXB 1KB9K 5DQDL 3CSYB 4UV4L 5IJKA 2XWBA 5FECA 3BAEL 4JEGB 2DBJA 5C0AB 3QUXB 2FR4A 1GGTA 2XTJC 3SDDA 3JWDL 4MD5B 4UAOC 5JDJA 2VDOH 2BFVL 2C3VA 4AQ1B 1FL5A 1FV1A 1F11A 5EPMB 3RVUC 1YZZA 2ATKB 4YXLL 1MFBL 5C0CE 3UAJC 2XZCL 1QBLL 4Q58C 3HUJA 3P2TA 1MVFA 3MRDA 3VXUA 4K7FA 1BFSA 4KDVA 4MNHB 4WU5A 1I9JL 1OTUC 2VLRD 3I2CL 5E8PA 4FQHB 2C5DC 3GSNA 4OD1H 1OLZA 3U0WH 4DTGL 5EU5A 5DJ2A 1G9NL 1M4KA 2X70A 4R4ND 1RUPL 2CSPA 3IS1X 3QO1B 5I1AA 3MLPA 1FC2D 4LSTH 3GMRB 3OKEA 4GMSH 1MCPH 1OGAA 1X5XA 4TUOB 3FO9B 5IVXB 2J2ZA 1NEZG 1C1EL 1U41A 4XPAL 1E0OB 5JXAH 4FFVD 3I85A 4WJ5A 2FH6A 4MA3B 4XB7A 5E2WH 2R39A 2E27L 5C08D 1QSFB 3SDXE 1VEPA 2WAHA 3BH9B 4XBGB 3QWRA 5B39B 5BRZE 4MXWH 1E27B 4MMZC 3WLWC 3GJFH 5KVGL 3AS2A 3RKPA 3MZTA 2C3GA 4DKFH 2BSSB 4FFZH 4Y4HC 1I3UA 1IKNC 2NW3A 4JFOA 4PJXF 4Z18A 5IKCB 5IFHH 3S9DB 3AUVA 5ISZB 3T0EB 4JRXD 1ZAGA 2VLLA 4KXZH 1MCWW 3PJSA 4MQ7B 5ILTH 2DRUA 3OAYK 1CS6A 4WI4A 3RWIB 5SX4I 4XNXH 2F53E 3PABA 2EEDA 3VI3F 4NBXB 1LE5B 3LIZH 3FQUA 3G04A 2VAAB 3MV8E 4A6YA 4NT6B 2L7JA 3U4EB 3ARUA 3QFJE 3T4YA 4PJFB 2FEEI 2EYRB 4JKMA 7CGTA 1G6RA 5I73C 4X9GA 3EAKA 5ADOL 6FABL 3U48A 1CGVA 4AIOA 1K6QL 3ARGD 2DLIA 4NZDA 1O7VA 3FJTA 1T20A 5ICXB 5GRYA 5GS0D 4HX1B 4YIQB 3SEPA 1B88A 3EO1B 1XAUA 3IETA 2P5WE 4FTVB 3KGRA 4LSSL 4PJAF 4ZSOA 5JMOC 5IIEA 3VXRA 3DV6A 1BX2B 3I75A 4ZNCD 4ZUSA 1MIEL 5EFIA 2DJSA 5TDPB 1QR4A 3WIIL 3HHRB 3DYOA 3KLAA 4POYA 2ZUSA 5E99H 4MDJB 1J12A 3VDAA 4PJAA 5DI8B 2BJMH 3SCMA 3CFKB 4HQQL 3SDAD 3OKOA 3LH2H 3ORJA 1PLGL 1TPXC 2KZWA 3RTQA 5EOCH 2A2QT 1PG7L 1TVBB 2DIBA 5DRNB 4OCXL 4JQXC 1HH9A 4MJ5A 4OD3H 3WS6C 2R2BB 2VLKE 3UZEA 3ROLB 1N64L 2ZZUT 1DVFA 5HDLA 4WTXA 5I8CA 2QR0B 5GSRA 4WGVB 3RJDA 3KJ6L 4GBXB 3H9SE 5T5FL 3MBEA 1JK8A 2ITDA 3TYFB 2IG2L 4BKLA 5BMFH 1MCJA 5K59F 5DS8A 1XIWD 1FGVH 3TVMA 5F1IB 2ZCLL 1N59A 3D3VE 4KQ4H 3AU1B 5D7KD 1OSPH 3SO3C 1P7QA 4X6DF 1CGSH 3P30L 4FFYL 4AIZA 4YH6A 4LBEB 5A2FA 3HPJA 4M6AA 2B1HH 1KIQA 1T66D 4UDUA 4OSUL 3WJLA 3WBDA 4NKDB 1J0IA 4OD2A 1S7WB 4JFDD 1HH6B 1RZIB 5IMKB 3L3IA 3X17A 3EYFB 4V2BA 2IAMB 3M1BA 2G9HA 2G5BA 4RFOL 3WJJC 1ORSB 5GS3A 3NCJH 2HFTA 4TVPH 1XH3A 5CSZB 1BD2E 4N8VA 4U1GC 3NCYS 2UUDK 4D9QD 5MP6H 1Y18A 3BKJL 1ACZA 3TIDB 3GSRB 3K4DA 1NAMB 5D1XC 2QHRL 1KFAL 5DJZB 4N5UA 4O02H 1WUNT 4QTHB 2Q7YB 4HJJH 1EA9C 1KCSH 4G9FA 1YMMD 1QKZH 4LCCB 4YX2L 4XPTL 1OD9A 2F74A 1YPZA 1SMOA 1FYTE 5E03A 4U6HA 1XCQA 2EE2A 2A83A 1PY9A 1R6VA 3QUZB 4CRPA 1H8SA 4NNYB 4U49A 1JI1A 3JWDC 1UM4L 2A0LC 1JPGB 1MFEL 1OSZB 2JCCF 2Z31C 5DHYB 4N0CC 1IEAA 2FX9L 1FLRH 1GHFH 4CU7A 43C9B 3JV5A 4M5YH 1KEML 3F58L 4YHML 4Z7OE 3NZ8B 1F3RB 3MRFA 1SJHA 1UKQA 5I1LB 2HFFA 5C0EA 3ZTNL 1SEBA 2OMNA 3ZMRA 4R97C 1HXYA 5JNYA 1NGZA 4HXBL 3JV6A 3KWWA 4JZJC 4R4FL 4U6YA 4RZCA 5JLZB 4YHYB 5MEQA 3NFPA 4OLEA 4V1DB 2XTJE 1CD8A 1EBPA 1LNUB 4O2CB 1G9NC 2MHAA 3RWEA 3UBXA 2VTFA 4FQQA 4KY1L 5J06A 5GISL 4YDLB 5CCKH 3TIEB 2BSED 3MGOB 3B9KC 2WLZA 1L4IA 4E42B 5GHWH 3PWJB 5LGKA 2X89A 1JWMB 4H1LB 2XG4A 1F45A 5CP7B 4ZFZA 3RQ3A 1GOGA 4TNVF 1N0LA 3QUKB 5IFJB 3UTZA 4W6WB 5I6XB 5IQ7L 1KIRA 1IAII 3LKNA 2I5YH 3KLSA 1NBYB 2GJ6D 3OGCB 3B9VA 2NW2B 5CZVL 5F7MC 2XWTB 4YR6B 3MLTB 4LHJB 4ZYKA 4WIQA 1MCSA 3JZ7A 3STLB 3P3YA 2ZUXA 3QG7L 1LVEA 3WHE0 4MD0A 4WO4C 5F3BA 4G8GD 3AROA 3UDWC 1LE9A 3U0WL 5EOQH 3OXSB 1EZVY 4OGAD 1OAXH 4QXUL 4PBWD 2WBJA 2F53B 1FNLA 4M4PA 4PLKD 5DD0H 1H8OA 2Y25A 4JFZL 1B0RA 4K8RH 3L95A 1MCPL 2OSLB 4GMSL 4JDTL 4ODWB 3MR9B 2PYEA 3ALPA 3MV8B 3HG1E 1HQRA 3QSKB 4I3SH 5JXAL 2Y6SD 2I9LB 3IRZA 4NNXB 1OP3K 5ACMA 1F4WH 3WV0A 3GSOA 3T2PA 5EZLA 3FFDA 3MREA 1T0MB 3VXNB 3DSNA 1WBZA 4KI1A 3S5LA 3U30C 3FOLA 3JWNC 3NCFB 3MRHA 1TTFA 3T3PF 4FQPA 5ELIA 1ZS8B 4KHXL 3IDUA 3FFCE 5DD3L 2B7DT 1T2JA 1IQDA 4G7YL 3RWGB 5D6DC 3ZT7A 4L3EE 5FA4A 1RIHH 3WD5H 1IAOA 1MEXH 1CK0H 5HYQB 1MAJA 1RURL 2EYSA 3DI2B 3H9YA 3OV6A 1J9CT 3Q6FA 3V6BR 4XPHH 3BN9C 5KSAC 2R23B 3N1PC 1RSFA 4OLVL 2O93L 2V7HB 4M6NH 3D39D 5IK3A 2HKFL 1TJHL 4GW1A 1C5DA 5AUMA 4AL8H 3OSKA 5DUPH 1OQXA 4YDVA 4G7VL 3ULUL 3QUYC 1RUAH 4XNXL 15C8L 4KZDH 1IM3B 5DZNA 2JK5A 3RHWK 1OAKH 2IPTL 4ZO6A 4F3FB 2EDDA 3RL2A 1YY8A 3M45A 5JXEC 1FZMB 4YFLF 5D7SH 4E5XB 1D5ZA 4WW2B 5EZOL 1IZJA 3QPXL 3O45A 2UVFA 1BAFL 1U8QA 5E8DL 4X5XA 2B20A 4FZ8H 4TSCL 3REWB 5L7XH 1AXSB 3V52H 4UV7H 3QEGL 5B3JF 4R90H 3IXAB 1J1PH 3GIVA 4APQA 4PJHF 2KQNA 1BHGA 2XPGA 3VE0B 2H41A 1CXLA 1A9EB 3VMPA 1G7IB 1I7TA 4PJ5D 3RPIB 1UB5A 4AK1A 2RIKA 3CXDH 2NY6D 4OZFB 5ACZA 1EO7A 1XF4A 4Q9QH 1M71B 5I18H 5L2KE 3GSWA 2H1PH 4YQXL 3JTSA 3S35H 1JI2A 5D72L 1B4RA 5DRXB 5EC1A 5D7LB 5EOCL 1A9BA 4YHIA 1BD2B 3EDEA 1BECA 3LOWA 1XR9B 4JFFD 1G0DA 3BESR 3QEQD 3GM0A 2DJ4A 5DGRA 1OD7A 1VA9A 4EEEA 1UACH 3BSZH 3D85D 2W65B 2GFBA 3P0VL 2YPLD 3KXFD 3N85H 2GQHA 4PRAB 1MQKL 1JPSH 3CXHJ 5L9DH 1RVFL 2R9HC 1Q9KB 1QQDA 5JTWA 3IT8D 3DIFA 4CVZA 3O2DH 5FM4A 3FRPA 4HUNB 4YXHH 1QA9B 1I3RB 1MCNA 2MOVA 2LTQB 4X5LA 3GK8L 5I17A 4ZFFA 2YWYA 4B7IA 4DKEL 2EE6A 1VSCA 2CRZA 2B1HL 3BJLA 3EYVB 5AYQA 2HFEB 3VWKD 5CIPH 1JTTA 1GC1L 1MH5A 2ZUWA 4I0PD 5IWLC 3H0TA 4LPWA 2O5XH 4MCZB 3MJ9H 1V7ML 2EIDA 5BOZG 3O9WA 2HMID 5EUOE 4TVPL 3IFLH 2YUXA 4HG4J 1S8DB 1HEZB 2XTJB 4KKLC 4ZPTB 5FKAA 2LFGA 3QQ4A 4UAOB 3EYSH 1E6OH 2FGZA 2ZSVA 3WN5A 4JKLA 2X9YA 4OZGE 5EN2B 4HJJL 2NY3D 1J1XH 1NBQA 3AAZA 1KCSL 5DRZA 2GSGB 1U8MB 1U8IB 2A73A 3Q1SL 4Q74A 4LPVA 3ULSA 5IUSA 1BEYH 4NC1C 5I1JH 3B6SB 4WUKH 4N1CA 5C1MB 1PVHA 2HTKD 3JUZA 2WSKA 1GHFL 1TZHA 1TJIH 5IT2L 2V5SA 3TCLB 3VXQA 5EORH 4OQ1A 5CEXB 5DJXA 2WIIB 1T2QH 1U8KA 2NY5L 3EOAB 4QNPE 5ANMA 2E6JA 1HNGA 1UVQB 3FB7A 3LKSA 5FDYA 3IU3A 4JB9H 5HVHC 2X10A 4PP2A 4PJCF 3NPSC 4UTBH 5F72S 1AQDB 4TUJA 3CZFB 1DE4B 2V5RA 5TQ2L 3T3ME 1PGRB 4IRSC 4YWGH 4NHCL 4PJCA 2DKSA 1EDQA 2Y6SC 3HI6L 4PG9B 1KG0B 2RBLA 1CG9A 4KK5C 1MI5E 5MENA 3VXSB 3G6JF 5KANI 1F02I 4Y4HB 4FQIL 3IJHB 1MY5A 3BPLC 2ESVA 5GHWL 3RDTB 1PKQA 3UJIH 3KLHC 5FK9B 2AXHA 4RGMC 1NGWB 4JKWA 4LKCA 2CK0L 2X4PB 5F97E 1XF2A 1DUZA 4E41B 4YHPB 4EVNB 3L3JA 4R2GC 3BXNB 2JJUA 4LF3A 2BOBA 1MIMH 2I5YL 5GS1C 4N8VG 2ZPKL 4O51B 1JYWA 4ONOA 1A1MB 2JJTC 5CBAB 4GG8A 4N68A 5EBGA 1AO7A 1SVCP 3HE7A 4OZIB 2CLRA 4KKBD 5IP4A 5I73B 3FRUB 4ODSL 5IR1B 1ZOXA 4XMPL 5EO0A 3ULUC 1OW0C 1CR9H 3DRQA 4LGPB 4PJ8C 3WHXB 5HI3D 5T5NF 1S7TB 1XGQA 2YEZA 4QRRD 1R3IL 1OAXL 3CMOH 3MXWH 1P84J 4JRYA 4MXQC 5JOEA 2IANA 5DD0L 2ATPB 1MHEB 3BH8A 4FG6D 2JB6B 1ZHBA 4Y19A 2V6HA 3D0VB 5DQJB 4AZ8A 4XZUB 5EBLB 1QBAA 4FNLH 4X0KB 4K8RD 1F4WL 3GBNH 3IDNB 3WNPA 2NY4C 5D7JD 4F7TB 1QSED 3O4OB 5F1NA 1NBVL 1H8NA 4NQDE 5EO1A 3BP7A 4C58B 5GZND 5BVJA 5D6CA 2P8PB 4ODVH 3MV7A 2UY6A 5I8KH 3VWJC 2W9LA 2XN9D 1TPXB 35C8H 1SYSB 1M05B 1Z9MA 5E8NB 3WHE1 4CVXB 1CK0L 1KN2H 3KPRD 4NHUB 1UKSA 4Z7NE 4FQCH 3UBXG 4X7TB 3KPSB 1UG9A 2NY6C 1C5CL 2VXQH 3HZMB 1FN4B 3HZYA 3H42L 1WGOA 4H8WL 1U3JA 3OKYA 5CGTA 3QXAB 4M6NL 4RGNB 2CUIA 3IDIA 4I18A 5INDB 1LO5B 2R0ZH 5E94A 3OR6B 1QRND 1HN1A 2BSTB 1DBAH 3LB6C 3DMMC 2X1QA 2VO5A 4I2XB 3VD3A 2AXFA 1NFDE 4PRHD 5GZOC 3NIFE 4HW6A 4LCUA 2WM0A 1RHHB 4P5TA 1Z9LA 1SYVA 4GRLA 5FFLA 5L8JB 5TGBA 1W8NA 5HJ3A 1I7RB 4FZ8L 1IC4L 3VGGA 4OIAA 2FGWH 2VDPH 8CGTA 3D0LB 4DW2L 2DD8H 2Z4QB 4Z7WF 2V2XA 5SWZE 1FVEA 3D48R 4BZ2H 4JZNA 1IGYB 1YYLH 1QFWM 3VFVB 3BDBA 5E95B 5BS0B 4U1GB 3CSBA 5B8CA 1DBBH 3K3QA 4OF8A 4QRQA 5BJTB 2FEDC 1FNGA 2NY7L 2XT1B 1F13A 3DVGB 5D1XB 1CU4L 3MV01 2ZOLA 3SE3A 3RVXC 1GC1C 3QIBA 1F6FB 1JHTA 5DJ8A 5E9DB 3FTGB 3S4SA 4GMTH 3EFFA 3U0TB 2VXVH 1N26A 2HVJB 5I18L 3RWDA 2H1PL 4NO5A 1DQTA 4A2MA 2NR6C 1KLUB 3BZEA 2BDNH 3S5LG 4JZOA 5EUOB 1G7LB 3MNWB 2Z31B 2KBGA 2AI0L 1R3LA 2PW2B 2DQUH 2A6IA 5F93C 1H3VA 5DEZA 1KXTB 3C6SA 2X1PA 3GHBH 1DANU 4KRLB 5I19H 2M8XA 5FYJU 2Q86B 4LMQI 5F7HA 3BP4A 4P3DB 4ELKB 3N85L 2ITCA 5HHOB 1KENL 2QL1A 4ENEC 5L9DL 4DOHE 4Y8AA 4OLZL 5D2NA 5IW1B 4F7PB 1ES0B 4ZOBA 3GBLA 4HKZA 3OPZL 4H88H 3O2DL 4LLAA 3U4BL 4DVBB 4PGCA 2PYFB 3O3UN 3UTSD 2NXYC 4D0BB 5BVPH 1AR2A 5GGUA 5CJXC 3DURA 4DJMA 4BFIB 2P44B 3W5MA 4LDOB 1MFAL 1QNZH 2NY5C 1L7TH 1UT9A 2DLEA 2WUCL 1KC5L 4IRJC 5IB1A 4Y16A 3QG6B 1JN6B 2VN7A 3VGEA 3B9KB 1IGJB 2R2EB 4B7LA 4HBCH 1NKOA 1ORQA 4I0KA 1E6OL 1FDLH 2YD7A 5B4MC 3WNNA 3F7VB 4L4JA 5D7IA 4H26B 4OIIL 2OI9B 2JIXA 4OFYD 1WFOA 4Y4KD 1J8KA 1KPVB 2F9BT 4XCYA 1WK0A 4YXKH 5AZ2L 2J88H 1B4JL 2CGRH 5DEGB 4R26L 1BZ7A 1KTRL 4MZ3A 4Z7QE 1F4XH 3G5XA 2WWMD 3PWPD 4WUKL 3VU2A 3U6RA 4M7JH 5DZLA 2VZUA 5DJ6A 1HCFX 3I50H 1WWBX 2AQ1A 4OCLC 4MA1B 3SGJA 2FL5B 4PJBE 4L3CA 4WO4B 2VIRA 1N5AA 5BQ7A 4K3DH 5EA0H 3BMVA 1TJIL 4MNQB 2NY1D 5C0GB 2XWJB 1MCLA 3IB4A 1F3JB 4GG6E 1DEEA 3WO4B 1T2QL 4X4ME 4L29B 4PV8B 5GQBA 2NY2C 3SE8H 3DO7B 4Z7UA 4RFEA 3ZKXC 3GMQB 4JB9L 3MRRA 3L3GB 1JE6A 4OJFL 4XPFL 3GMOB 4F7EB 5GGVY 1HKLH 4ONHA 3E3QC 1K2DB 3CC5B 1IILE 2VOTA 4KVCL 5AAWA 4O58L 3U30B 4U1MB 1MVUA 4S10A 4XP9H 5F7YC 2FATL 4Z95L 3U36A 3FRPG 1J11A 4LLYB 4NIKB 1GZPA 3UTTD 1XF5A 3PF2A 4Y4FD 1FZJB 1WIUA 5IQ9A 3UJIL 3CCHB 3ZYOA 3BZFA 2YOCA 3VXPA 5A2IH 3ULUE 4UI2A 3BD3A 4MX7A 3HE6C 1ZLWK 1S9WA 1JZ6A 4F7MA 3QUYB 1MLCA 2M1KA 3B4NA 1S5HA 1OM3H 4NC0B 3RVWC 2X7LB 3GSNL 3DROB 2C1PB 3H8NA 4M61B 4S2SA 4HJ0D 5DVKA 4H8WC 1R0AL 3IU4H 2HP4A 3LAFA 2I24N 2Z0BA 4XT1C 4EI5A 2P8LB 1X5LA 4QRPE 4S1DC 3M8OL 1CR9L 2MWCA 1H0DA 3LKPB 4OTXL 1G7QA 4J2XA 1K4CA 4TYUA 4WFEE 5F7DA 5KVEH 3K4ZA 4WI5A 1MUJB 1IT9H 2R0LL 2P7TA 4PRNA 4PRPA 3HC0B 3ZE2E 2DQHH 1DQDH 1LILA 5T3ZH 4JFDB 3FAWA 5E6ID 4UNTA 3GBNL 3RWJB 4POZD 1CL7H 5EU7C 4KPHL 5EU3B 1TTGA 3QAZC 4PB9L 4HZLA 3OJ2C 3FL7A 5JQHC 2F54A 4ODVL 1QFOA 3NFSH 1XT5A 2Y07L 4O9HL 5I8KL 2K7PA 3UTQB 3D25B 1S7UB 1K5NB 1P7KA 1DUYA 1WT5A 2DI9A 3D6GA 1N3NB 4Z7VE 2FIKB 3OB0H 3VGAC 3ULVF 3H6JA 3RKDD 3QXUA 2OJEB 1U8PA 4EBQH 2BSRB 4M03A 3VXOA 3ZDYF 1CT8A 1XR8B 2MQ0A 4HT1L 4OUOA 3FHQA 4A6YL 2I27N 4WUUA 3QI9D 1NCAH 4KFZC 2NY0D 1A7RH 5IROA 5IF0A 5LQBL 2R0ZL 5DC4B 5GGVH 1G6RL 1PEZA 2QHLA 2YRLA 3R0NA 2CKNA 3HPLB 3QDGD 1QFUH 5CP3H 5JQ6H 5KG9B 5HGBB 1ZGLA 3O0RL 5CSBA 1FVDA 2JLLA 3GJEA 5IVXF 5JW4R 2Y06H 2DM7A 3KYMA 4YBHA 2AGJL 3H2WA 5DHXB 4Q2ZA 5JIIA 1NCCH 3DARA 4J3OC 5D96C 3QRGH 5ABDE 2VLJD 5I76A 4HUUB 4N0UB 3P4OA 1CLYH 3QA3A 3O4LA 3BYTA 3SGDI 4UILH 3HC3L 3C6LA 5FYKH 3MLZH 4Y88A 5EH1A 3OXRA 4ZFOA 4U3CA 5I16A 1KF9B 1OT1A 3EJZC 1U8OA 4U6XA 1NFKA 2FYYB 3RZCD 1DBBL 1EEYA 2GT9A 2XA8L 1CD9B 4AG4H 3HZVB 3TPUA 2AJZB 2W9DH 2BNRE 2O5YH 4LLUA 1J0JA 4I5BB 2F5BL 3EO9H 4Q9RL 2VXVL 1RI8A 4M3JA 5H2BB 3RTQD 5T5NG 5BO1H 3U9PH 3KDMB 1EGJA 4X6CF 5FGBA 2AK4A 3RBSA 3KPNA 4PYHA 4XNUH 2CMRH 5HHQB 3RL1B 3ETBF 1N8ZA 4LNVA 2H9GA 4QOKA 2W0KA 1M7DB 2IC2A 2GJ6B 3LS4L 3ZE1E 1RK0A 4PJFF 2P42B 1D5XA 3S3SA 2EIZA 2MQ3A 5K9QG 2AKRA 2G5RA 1TETH 2IFFH 1A2YB 5CMAB 1WC7B 4G9DB 3AREC 3WFDH 5HHNA 4MSWB 4CAGA 3QUML 5HVHB 1A6AA 1MCHA 4BH7A 2P46B 2XACC 3WMSA 3NPSB 3QCUH 2R29H 3DHMA 1SJEB 4NM4L 2FECI 1KJ2H 4ZTPL 3SDCC 1YY9C 5D9SA 3K1DA 4WEUD 4AY0A 4IRSB 3FHAA 1RMFH 5B38B 1NCWH 3WKMH 4HWBA 1HXMA 2H8PB 1OOAA 5DURD 1E4JA 4LSPL 3EJJX 4YZFF 3VXME 3WLBB 4NN5C 5IHUH 2R1YB 5E8EA 1OHQA 3GSVA 4YJZL 1BQHB 2DYPD 3IJSB 3WNKA 2X4SA 3BPLB 3I9GH 5CUSH 4DZBB 4ELMF 3QH3A 4RGMB 3RY4A 2EH7H 5DD6A 3TBYB 3QNXB 1CGXA 3BD4A 5ETUB 5IJKC 1F97A 1P1ZA 5D1ZD 4JFPA 4PJ7B 4WGWB 4HH8A 1FDLL 3GJFB 4R2GB 4B0MM 1RULH 3SDDC 3WFHB 4L8SA 5EC2A 4ELMA 3MJ6A 5GS1B 3CDCA 4GQPH 4YXKL 1BGXL 4FXLA 3PWUA 1GGYA 1P53A 2H6PA 3JTTA 1F4XL 2D0FA 3EZJB 2A1WL 2D7TL 1SEQH 3VG9C 4ZUWB 3HI1A 3GI9L 4QXTA 4M7JL 1MELA 3S4SG 1G9EA 4U0RC 4YFLI 5EA0L 1X9QA 1JJUA 1UH3A 1WZKA 5C0RH 1U93B 3TFKC 4UMGA 4ZXBA 1RZ8B 2QQNL 1N6VA 5HHMD 5E24E 4MQTB 2YA0A 3OAZH 2IH1B 3G5YB 3F12B 1W72H 1BJ8A 1C12A 4BZYA 5GGQH 4I9WD 4ERSH 4PJDA 4U7KA 2OL3A 1KGCE 2PUQT 3U82B 3MFFB 5BZDA 2H45A 4WY7H 1HKLL 1IC7L 5KSVB 5IBTH 1XGTA 1KYOJ 1IZKA 1H3PL 1EVTC 1CVSC 4OFPA 5GGTH 3N1QC 3RY5A 2BNQD 3VFWB 1CIUA 4GRMA 2C7UB 4K9EH 1NFIB 3WL9B 3BISA 3MV9D 1YMHB 5LG1A 5I1KH 5E8OA 4NZRL 2DQTH 1A6TA 1ZK9A 4JFHE 2D4FA 3VWJB 3KYNB 4WU7B 1YEDB 4WWKD 1F3DJ 2QV2A 4LOUC 4PJ5B 1ZHKB 2JE8A 2ZSWA 2XA3A 3OX8B 2FO4A 2NY6B 3P9LA 1QEWB 4JN1L 4X4XA 4RA3A 1T7ZA 1A7QH 4XVJL 2ZUQC 3ARDA 1W0VA 1L7IL 3P9WB 4HC1A 5ALBH 3V7AE 1B9ZA 3UJJL 4CMMA 2VH5H 1RD6A 3VFGL 4JHBA 3I6KA 4HK0B 1ADQH 2Z93A 3ZSTA 4KMTH 3DMMB 4PRID 3QEQB 2IJ0C 4WFHD 1ZT7A 3EYQC 1CD1B 3ILPA 1TZGL 2LVCA 1IKFH 4Z7VB 2GAZB 1QP1A 4BYHA 3D85B 5HHVL 3SKOA 2HN7A 4JFED 1F42A 4HCRH 2H2PD 3MYJA 1NJ9B 5SX5H 4QY8A 5EU7E 2VAJA 1DQLH 4QRUA 3LDBC 1T21A 3LV3B 4KTDL 3T2QA 5FYLE 3V0VB 4YPGB 3MRBB 1I8KA 5KVEL 5ESQB 3W39A 1J05B 3QWQB 1D7FA 4NC2B 5E7BA 5DUMH 4WWID 1KTKE 4NBYB 1T7WA 3OL2A 4J4PD 5DMKB 2DQHL 4HIIB 3L3KA 1NBZA 4MS8D 2XKNB 3FN0H 1T7XA 4P59H 1Y0LB 4Q0XL 5J6GA 1FP5A 5DJAA 5T3ZD 4JQIH 4G8EB 4DUXA 1RU9H 5C09D 1P7HL 2Z8WC 3V0WH 1ZTXL 2FHCA 2FHFA 5DK0B 2ORBH 3HTLX 4Q6IA 3SCMC 3MACH 3G08A 4UDTA 4PJGB 1J10A 2CLZA 3SDXA 3T0BA 3HRZA 4X99A 3CX5J 1EJOL 3RTQC 1XGPA 3MA9H 4R4BB 5IJVA 1QSVA 5C0BD 4ODXB 5JHDE 1NEZB 1NCAL 2BNUA 1UYWH 3JV4B 3R8QA 4X7SL 1A7RL 1T0NA 5D1QA 5IBUG 5L8KB 1UQSA 1DVFC 3ARBD 4MVBD 5KANG 2DWDA 3VGFA 5I8EA 4NQCB 2XY2A 2R8SL 5C07E 4HKBB 3MBEC 2NXYB 4WHTB 4YAQB 4NQEE 4RQQB 4UNVA 3TVMC 2W1NA 4LSUH 4EUPA 3BGMA 4MJIE 5F9WC 2EDTA 2AJSL 4YC2C 1KTDB 2Q8BL 1NDGA 3RGVA 4IRJB 2LVEA 5IB3A 2VL4A 5C0NC 5KVFH 2Z92A 4UILL 3WJLC 5LAXB 3RIFF 3HC4L 3QFJA 1I9IH 5DJDB 3H3BC 4W81A 1FFNA 1BQUA 5FYKD 1AXTL 3ARSA 2XTLA 4H20H 3DETC 4M8QB 4KUZL 2W9DL 3MNZA 1QVOB 1E4XL 1NMAL 3O2WH 2GSIB 3IFNL 1CLZL 2J8UE 2P5WA 5JW3H 2CXKA 1I85A 5JDSB 4XNUL 2H32B 5EUKA 3UTPE 1Q9LA 5CZXC 2AEWA 4LCWD 4G6AD 4NP4H 9CGTA 4LPTA 2J6EH 2EXYD 4L4VB 5J8OA 2F8OA 1MJUH 3HZKA 1JPTH 2IBZY 3W0WE 3MJ7B 2VE6B 1INDH 5E70A 1JHKH 4KQ3H 8FABA 5FHAL 1TETL 5AWNL 3D9AH 4XTRD 2NY2B 2QKIA 2YN5A 5KSBE 1CFVL 3ZKXB 4XCFH 1LO4H 2UZIH 5JPNB 2Q76A 4E0RA 3MRNA 3QCTL 2PN5A 4HG4K 2VLKA 1WIOA 5LBSH 1U58A 4N0RA 4U05A 3SPVA 1FVCA 4G80A 4WRLA 4D9RE 1RMFL 3H9SA 2J8OA 1A7OH 3EIFA 4OLUH 1UEMA 2P1YA 3WKML 5TE7H 5JW5A 3H3PL 4CADA 1YUHA 3D3VA 3H7BA 5D7JB 5IHUL 3KYOA 5DJCA 4XXDB 1WFUA 3QIUA 2AV1A 3I6GA 2OQJA 4NKOB 2XV6B 3HUJE 3I9GL 1I1YA 4I3RH 3WSQL 3BT2H 5D71H 5KJRH 2NQCA 3RY6A 1BOGA 4DCQA 3NVQA 2EC8A 3HE6B 1F4YL 3SGEH 1T1XA 3KPRB 3T0DA 4OCWH 4XAKE 5DQ9A 5EZIL 4I48A 2FJHA 3FQXA 2BHZA 5L0QC 4IDLA 1Z9SA 3LQMA 1H3XA 4BSWB 3UJTH 3NA9H 3PL6A 1OGAE 1L0QA 5TPWH 2AXGB 1FZKB 2NZ9C 3D2UD 1RZJH 1WZ1H 4G43A 4AENA 4ETQB 3HI5H 4C56E 1TVHA 3CDGB 4NO0A 4YDJB 4Z7OF 4NN7C 4ZQKB 4WNQB 3V6OE 1WJ3A 3LQZB 1TXKA 5D5MB 4JFQB 5EU6A 2HLFC 5GGQL 2NX5D 2WBJC 5J6HA 3ECBA 1HQ4A 5J13C 1MWAA 3O3BA 4HAGA 2EIBA 5BXFA 5INCB 2VDQH 2C4XA 1KLFA 1KXQE 3MRKA 5I2IB 1BIHA 4LRNL 4DGIL 1AGBB 5SWSD 1FG9C 5F1KC 1Q0YH 2VNCA 4HKXA 2F5AH 2FJFB 5L8LB 3ES6B 3BIKA 2DQDL 4PLJC 2XFXB 1S9YB 2Y7QA 1HSBA 1CF8L 3T0WA 3GB7A 4QXGH 5HGAB 4GO6B 3MROB 1A6ZA 1J5OL 4LARH 4JR9L 1P5VA 5IVZA 1R5IA 4GFTB 4HPOL 4PR5B 1U8JB 1JV5B 1SJXA 2VH5L 1ODAA 4AQOA 1P84K 3QDJE 2H26B 5GRJH 4KMTL 5JZ7C 1MCBA 3JWOH 4XAWH 4OZ4B 2JJVA 4WFGE 1EV2E 2X5PA 1MCOH 4UIMB 2FD6H 1NC4B 1IKFL 1GGUA 3LRSA 1HHJA 4W4OA 2BVOA 4CDGC 5GSVA 3R06A 1NSNL 2QSTA 3M17B 4OKVB 1G7PB 1ZVSA 1P4BL 3DBXB 5T33L 3VXRE 3W9DB 1DQLL 5CJQH 5D96B 4ISVB 3SE4A 3VMNA 5JHDB 4O5LH 4HXAH 3C60D 2GJZA 3OKNA 5JHLL 1NCTA 3OKLB 3BQUD 4S0SD 2YD8A 4X5WB 1T3FA 4PJEE 1A4KB 4QHNB 3VRJB 3CFBB 4JM2F 3MRIA 4OM0H 3C5ZA 2A6KA 2OP4H 2WUBH 5DUML 3IFPA 5C07B 4GW4B 5IV2A 1PY4A 1UADC 1EO5A 4MDIB 1I75A 4APQC 2V2TA 1Q9OA 3FN0L 1N2RB 4UQ2B 3SKJH 1DSFH 2D03H 4JM2A 4FXGA 4P59L 2G2RB 3DV4A 5CIPB 5HXMA 1A7NL 4IS6A 5HI4D 2VLRE 4JQIL 1RJZA 4XNZB 4F58L 1S9KC 4R7DA 3GFUA 2FBOJ 4QT5A 3EGSB 5DHVA 3QQ9D 1VERA 4HV8B 4J3SA 4OGZA 2R2CA 3GZKA 3HG1A 2ORBL 4N5EC 4RX4A 3NOIA 1Z6JT 4AEIL 1ZHNB 3DX6B 2RFXA 3MACL 4Y4KB 3ULVH 4ONFH 5E1AA 1IGTA 1WIPA 3V9FA 4P57B 3R8BB 3MFGB 3NN8A 1TJGH 1PYWA 1A7PL 3THML 3MA9L 4A2LA 3LN5B 1MRCH 3FFCA 2CRMA 1U3HD 2XNAA 3U83A 3C8KA 3QQ3B 4LCYB 1UYWL 4HUWB 4RA0C 1X5YA 1J0ZA 1J18A 3AREB 4LU5H 4UU9A 4XP1L 4XXCA 5CINH 1EIBA 4AYFA 3SKMA 1BLNB 2GTZA 1KB5A 2NY1B 1GGBH 4RCAA 5TJWK 1DFBL 2C1OB 1PG7X 3SDCB 5F9DC 1H5BB 4LSUL 5L88L 1XMWA 3C5SA 1WWAX 3G5VA 3O8XA 5H35A 2YD9A 5DGQA 1R24A 1EO8H 1B6UA 1DEDA 3PGFH 3TT3H 1PEWA 5HYJA 3MODH 3BKML 5DT1L 4PJ9A 5JR1H 5J89A 4NPYA 5FA3B 4NN5B 4P2OA 2DQGH 3C08H 1G1CA 4U31A 2BVYA 1MSPA 2R4SL 2YZ1A 3LPGA 5D2LB 1YPZE 1GGCL 5F96L 1ZGLP 1GSMA 3TZVA 2XWBB 4L4TD 4Z77A 1UA6H 3O9WC 3WIFA 3PDOA 2DLHA 4L8BB 3D69A 2JELH 4P9ML 2FR4B 3SDDB 3WN5C 1FL5B 3O2WL 2A6JA 1FV1B 1F11B 4J23A 3ZT5A 1X4ZA 4DGYL 5FUZH 3VG9B 3B9EA 4J7RA 3HUJB 1F90H 3ARTA 4MAYA 5DD1L 3SKUD 4QEGA 3MRDB 3VXUB 1XCTA 3I6LD 4U0RB 3T0XA 5T1MB 4K7FB 3V6ZA 1AR1C 4WU5B 3DSFL 1JPTL 4KVNH 1IGCH 4HS3B 1INDL 5E8PB 1JHKL 4YBQD 1LEGA 5EU5B 5DJ2B 2X70B 3BUYA 3GUTA 1T83A 4RMUA 2BY2A 1MJ8H 2UZIL 5I1AB 1MFCH 4KAQH 2YMXH 3OKEB 1OGAB 4K71C 3OHXA 1TNMA 5LBSL 1CDBA 2APTA 1OLLA 4JKPH 4OFDA 4RBPK 1S7RA 1QG3A 4Q9BA 4WJ5B 3ZTJG 4OLUL 4FS0A 1AD9A 1QFPA 4BH8A 4DAGH 1Z3GH 1LP9E 5E6IB 3BX7C 3E6HB 2Y36H 4HEPG 4UIKL 2D7NA 4EUPG 3GSXA 3U79A 3J7HA 4QYOA 5FHBH 5D71L 5KS9A 3ISWA 5FUOH 2NW3B 4JFOB 2JIXD 5EUOF 4G42A 1NUNB 5D7KE 4X9IA 3F7PC 5DD5L 2VLLB 2OK0H 3KYKH 3PJSB 2WBKA 4OCWL 4XWGL 2DMBA 2VZTA 1AP2A 5ACLA 2FZ3A 2P5EA 1RJCA 2GUOA 5J7CC 5EIQA 3PABB 3QI9B 4KKAD 3F7RA 2NY0B 3TO2A 1BQLH 3NA9L 2W07A 3ZKMC 1N6UA 2B4CH 4XGZA 4A6YB 2AVGA 1IM9A 4OZGA 1MRFH 3B83A 3HE7C 4X7DC 1G6RB 5DTFA 2D9QB 2H3NA 2BVPA 4D9QE 5MEPA 4JO1H 2DQIL 3L9RA 4FQJH 4LPYA 4K7PL 2BX5A 2D0HA 4KRPD 3SJVA 4JZJA 1E4KA 1CBVL 3O3DA 2LAGB 3O6LH 1T20B 4QNPF 1TCRA 2VLJB 2DQFB 4O2EA 1RZKH 5CS7A 5HYEA 3UXFA 1X5FA 1JGLH 2OZ4H 4MJ2A 3IETB 5DZOA 2VDQL 4JM4H 4ZSOB 3HNVH 5IIEB 3DV6B 3I75B 2WMPA 4ZUSB 3T3MF 1JYVA 1NAMH 2GW5A 1JP5A 5EFIB 5GGRA 1D9KD 4GSDH 2HH0L 3KLAB 3V4VL 1F5WA 2EEBA 3QDMA 3RAJH 4HC1H 4ORZC 1CLOL 2QEJA 1P6AB 5FOBA 4PJAB 1DBJH 3DXAD 2EDNA 3SCMB 4ZFGH 4HWEH 1JGEA 1WCQA 3OKOB 4Y2DA 1VGEL 1A6VL 2DN7A 3MV11 4OAWA 3RTQB 2E7LA 5DO2D 5FV1L 4KU1A 1WCBA 1BJ1J 4MJ5B 5I1IH 1MCCA 4JDZA 3GIZH 1FIGL 3VG0H 4Z0XA 5CD3A 1M7IA 1DVFB 4I18C 5GRJL 5I8CB 1D6EA 5GSRB 1NC2D 3JWOL 4XNQB 3HLAA 1FAKT 2BVUA 1JWUB 1NGQH 5DC9B 2IH3A 1JK8B 3DI3B 5AYUL 3FMGH 2ITDB 4EI5D 1MCOL 4BKLB 2FD6L 2PR4H 5IB2A 1RZ7H 2HJFA 2R69H 4NJ9H 1J1OH 4FQ1H 2R1XA 1N59B 4I4WA 3U0PA 3VFSA 1SVZA 5F9WB 5IFAH 1P7QB 4LIQL 4P5TC 2CH8A 3N06B 2VDLH 3V5HA 3W11D 4GRLC 5DMIL 4ODTL 1URLA 2K9UA 4AIZB 1KIUA 3MJ8A 4NGHH 3M07A 3HPJB 1MJ7L 4WFFD 1KIQB 4UDUB 1BBDL 4XMLL 2OP4L 2ICEA 3VXTA 4TRPL 2X4RA 3QNYA 3EDFA 5DURB 4PRDA 3M1BB 2G5BB 2NZIA 1JFQH 4B41A 2HT4C 4Z5RB 1XH3B 4N8VB 4H1LH 3SKJL 2D03L 4CU6A 5B8CC 2W0PA 4FQXD 1Y18B 4HAFA 1R5WA 1QRKA 3SE3C 3VD5A 2MKWA 2YA2A 4G8GE 2UWEA 1FZOA 5C0AD 4XHJD 3QIBC 4PIRF 4G9FB 4G3YL 5DVLA 2XQBH 2F74B 3RUGE 4YLQT 4U6HB 5IG7B 4JPIA 1YEKH 4P2CG 1XCQB 5EULV 2Y9RT 4C57C 3ZTJH 2BP3A 1W0YT 1YEJH 4U6VH 4JY5H 3ULVD 5T1LA 4OKDA 1IEAB 1GAFH 5BV7H 1UWGH 2YA1A 1FAIL 4TTGA 5LGHH 2D7QA 3MRFB 3GHEH 4LU5L 3AS0A 5F6IC 4HPYH 2B2XL 2HFFB 5C0EB 4PGZA 4RIRA 2HRPH 1A6WH 1HXYB 5D2NC 1NGZB 2PXYD 3NIFF 3JV6B 3T04D 2VDKL 3KWWB 4U6YB 4RZCB 3Q5TA 2YWZA 1XGUA 5MEQB 3NFPB 3T2OA 4ZFOL 1JF5A 4XC3L 5GIRA 2R0WH 3PGFL 5J11C 2YBRA 2MHAB 3MODL 5E5MB 2C4FU 3RWEB 1NCDL 1A3LH 3EJYD 3L5XH 1NFDA 4FQQB 2VWEE 2VMFA 4NRXA 2DQGL 3C08L 1QSFD 1OAQH 1J0YA 3RWCA 2ADFH 3R1GH 4GKSA 3TT1L 4DZ8A 2WINA 4ZPVA 4Y16C 3DGGA 1B0GA 1EEZA 4P2RA 3DNKA 1EGJL 4OCRH 3VDCA 4GJTB 1SHMA 2DB8A 4Y5XA 3BRFA 1OF2B 3CUPA 4ZFZB 3VFTB 1BVKA 1NANI 4F9PA 3P73A 5M94B 5L0QB 5SWZA 3UTZB 1Q94A 3T0ED 1KIRB 4LQFL 1QR1A 4PY7A 3LKNB 4QOKD 1V3LA 5FUZL 4ZS6C 1I9RL 4GUPA 1VPOH 3P4MA 1YQVL 1A6UH 4ZYKB 1S5IL 3V7MA 2N7BA 5DLML 4GS7C 5K9OA 2BMKA 5KSUA 4QHUB 4OB5H 1I1FB 3SGJC 3MRMA 3ZE0F 4MD0B 4QRTA 5F3BB 3K46A 1JRHH 4YDKH 1LE9B 3LKRA 4PLNC 4OCYL 1H3UA 2HA1A 2JKXA 2DI7A 1S9XA 2WBJB 4HWBL 5ID1A 1MFCL 1IAIM 5J13B 1RZJC 2PYEB 1JNLL 3CDFA 1HQRB 1WBXA 2DLFH 4TVSa 2ESVE 3GO1L 1S7SB 3UYRH 4JFFE 3RI5F 3GSOB 1OB1A 3JSSA 3QULA 3FFDB 5EZLB 3MREB 3S5LB 1WBZB 1JBJA 3FOLB 2VKXA 4FTVD 3MRHB 1FHGA 5JIPA 2BHYA 3TNMA 2YK1H 4JY6A 5FA4B 2YPLE 2MKLC 1JNNH 5E5UB 4L1HA 5FHBL 3IFOA 1IAOB 4JO3L 1YEGL 1YEFH 2EYSB 2CUMA 3PP4H 5ITBH 3Q6FB 2ATKA 1AO7E 3RVTC 4JRWA 1UZ6E 2OK0L 5IK3B 4YHLL 4GW1B 1C5DB 5LCVL 5AUMB 3OAUH 4MNHA 3ZL4L 3VW3H 4YDVB 5HYSA 4OLXL 4U1KA 2DKUA 3U1SH 4LLVB 4GXVH 4CN1A 4JRYE 2E8ZA 2WK2A 3MX0A 3A6BH 4RAHA 1NL0H 2V9TA 1BQLL 1Y6NR 4KK6D 4GBXD 4F37F 2JK5B 4Z7QF 4OUUB 3UZVB 3OG6B 2IFGA 3RL2B 1GZQA 4M1DH 3NCMA 3SGKA 1YY8B 1HHHA 4JPVH 4NUJA 4YUEH 3LZFH 1D5ZB 2YPKA 2OL3L 3KPPA 4TUOA 3QWOA 4EI5C 4PJBF 4NDMA 4LHUA 3O45B 1MWAH 3JWOC 2E7MA 1RUQH 1U8QB 4X5XB 1J87A 3LS5L 4MA3A 4GG6F 4TSBL 2W9EH 5I75C 1OP9A 4NJAH 3BH9A 1UKTA 5IEKB 3GIVB 5ITFA 4M3KB 4PJBA 4APQB 4OF6A 1RZKL 4OLYH 4EZMA 4WCYL 5C71A 2XPGB 2YD1A 4X8XA 1JGLL 2MPAL 4UZGA 4GG6A 1ZEAL 4HUKB 2IAMD 2C3WA 4JG0L 1U3ZA 4PJ7F 1I7TB 5CGYD 25C8L 4X4YA 3QIWA 4CVWA 3BEWB 4F33B 5ISZA 4MGXA 5ACZB 5MERA 2X40A 1XF4B 1DBJL 5HGDA 5FGSA 3SHSA 4LLQA 3GSWB 3JTSB 5HBBA 3AXLA 1A3RL 1WT5C 5EC1B 1KULA 1A9BB 4YHIB 1DL7H 4RMQA 5I1IL 3HNSH 3QUZD 3ULUF 1HYSC 2VAAA 2WLYA 3VG0L 3CPLA 4LSDA 4TN9A 4XVSH 2EYRA 5IROC 3HA0A 1AGEA 4XPBH 2GFBB 2NCMA 1NGQL 1MHPL 2CRIA 3FMGL 1BFVH 2PR4L 4XWOD 2D0GA 4NNPH 3EFDH 2R69L 3DIFB 4FQ1L 4CVZB 3PGDA 5C0CD 2QSQA 1BWWA 3GSUA 2XRAL 1ZLSH 2VDLL 3INUL 4YIQA 5I17B 4ZFFB 2PTVA 2AP2A 1JZ5A 1BIIA 2OR9H 2EE9A 4V1DD 4BZ1H 1YEEH 3BWUC 1MH5B 1IC5L 1QUNA 1KJ2B 3TJEH 1AIFA 3H0TB 3ET9F 4FABL 2B1AH 3D18A 1RZGA 5DHVH 3C6LC 1OPGH 4QRPA 1Q0XH 4HWNA 5DVNA 2EDKA 3ZE2F 3O9WB 4NWUH 1JFQL 5HD8C 3PXHA 3QFDB 4NO2A 1AD0A 3S34H 3QQ4B 5A40E 5J0BA 4AM0A 1CICC 3ILQC 3WN5B 3BIAX 1TVBA 2V9RA 3CMGA 3LN4A 3DX7B 4JDVA 5C92A 1AGDA 3AAZB 5DRZB 5FO8A 1S7QA 12E8H 3QCVH 4L1DA 4YE4H 3ROLA 1BBJA 2A73B 1SBSH 5BRZD 4N1HB 5D2NE 5FGBC 4JGMA 3ULSB 1TENA 4PBVC 4G6KH 3QHZH 4Z7VF 4PGEB 2VC2H 4IDJH 5D1QD 3OKKA 4JY5L 1ZT4A 4D3CH 1WAAE 5BV7L 1QLFA 1TZHB 2ZJSH 1QSEE 1UWGL 2A9NH 3TA3A 3TH2T 3F7QA 2XXCB 1VFAB 5DJXB 1U8KB 4Y5YA 4HPYL 5FAAA 5CEYB 5ANMB 4L3AA 3L6FA 3FB7B 3S35X 3LKSB 3QEUA 3IU3B 2XN9E 3DVFA 4OM1L 3EYUL 2DQJH 4PJIE 4KJPC 4PP2B 1BWMA 2F53D 3PHSA 3TV3L 1T4KB 3E8UH 4FHBD 4TUJB 1A47A 1B2WL 1HH6A 4P23A 2V2WA 2AJXH 5IMKA 2FO1A 1DQMH 2R0WL 3EYFA 3FO0L 3MV8D 1UM5L 3WXWH 1KCLA 1MF2H 4ALAL 3IAGC 3QFJD 1A3LL 5AD0A 3L5XL 4HGMA 5KN5B 1TDQA 4PJCB 5D7IE 1ZANH 5H94B 1FG2A 1OAQL 1CG9B 1NGYB 3I3BA 1F6LL 5FB8A 4OF0A 5JA8B 1QRNE 3R1GL 4X9HA 4LLWA 4C59B 1O5DT 5MENB 4XNYH 3SKNA 4IJ3B 3S36L 4W68A 1I8MB 4PRHE 5T3XD 3AS3A 43CAB 3VJ6B 2BCKA 4PJGF 1MAML 1PKQB 5I66B 4HIJA 2CIKB 1T89A 4HF5H 4LKCB 1CFSA 5EWIH 1XF2B 5GGRY 4S1QH 1NLBH 2XG5A 2R0KL 1B3JA 3L3JB 1KPUA 2LU4A 4KJQD 1T80A 4AEFA 5IW3A 1PBYA 3QP3A 1OSZA 4LF3B 2BOBB 4L8SC 2AXJA 4R96A 3EYOA 4CW1A 3V5KB 4HHAA 4L5FL 4KI5C 3NZHH 4Z76B 1C7SA 2ZG3A 1A6UL 1LDSA 1OVZA 3UC0L 3BRDA 3HE7B 2CLRB 3NIGE 1Z5LB 3I84A 4MJ6A 4U6TA 5EO0B 3TC9A 3ROOA 3DRQB 3ZE1F 1J0HA 3LHPL 5CJOH 1EHLH 1A8JH 1XGQB 1IFHH 2OXGA 4ZXBC 2IANB 3MRLA 3BH8B 5CEZL 5EIIB 4K23H 1ZHBB 2VQ1A 4Y19B 2ZCKH 1UCBL 4AMKL 2I60H 3U2SA 5HDQH 2FNBA 4EQ3A 5I8OL 1HWGB 3LD8C 3BHBA 3AMLA 5F1NB 5FYKU 4E42A 5E2VH 5EO1B 4MB3A 2CKBA 3BP7B 3TJHC 1BJMA 3RJQB 5DF0A 5BVJB 5D6CB 1HIMH 2AJUH 3GSQA 3MV7B 2PETA 5FOJA 1RZKC 3GBML 2EDLA 4PY8J 1JNNL 3BAEH 2EO1A 3PE9A 1YEFL 1BP3B 3L5WA 1GCFA 5ITBL 1R3HA 3JWDH 3UTSE 5GRXG 4YGAB 5IBLC 4ZAKA 1XFPA 3HZYB 5HGHA 1SY6A 3VXMA 2XWTA 3IRPX 2XI9A 1CXHA 3ARDC 2L4OA 3IDIB 4I18B 1BD2D 4YXLH 2XZCH 4XVTL 1HHKA 5E94B 4B50A 3O6FA 3U1SL 5FGCB 5K33A 1NL0L 2JB5H 2AXFB 1I9JH 4PRPE 4LCUB 3HMWL 3CFCL 3WUWB 3I2CH 1RJLA 4U2ZA 1FYTD 4JPWH 1RJYA 2DIJA 1SYVB 3ZKQD 1AJ7L 2AJVH 5ESAA 2PO6A 4YUEL 3LZFL 2HG5B 4DTGH 1OAZL 1RUPH 2HFGH 1MWAL 1OTSC 1TFHA 3OR7A 1JHLH 4QLRA 2F54E 3QYCA 1T0MA 2IPKA 3ZKND 3K1KC 4HFUL 2V2XB 1FVEB 4JZNB 1PZUB 1JIBA 2E27H 1ULVA 3PWPE 5B8CB 3OGOE 3KS0J 4QRQB 1FNGB 4X4ZA 5I71C 1T04A 3RBGA 1AE6L 2ZOLB 2YPVH 5MEOA 1NCNA 3PIQA 2J7LA 3PUCA 3QIBB 4M6OH 5KVGH 1JHTB 5DJ8B 2XTJD 3S4SB 3MSPA 2OTPA 2N4IA 3EFFB 4WI9A 3GRWA 2V7HA 4MA7L 1YQ2A 4LHQB 3RWDB 3RVUD 4Q6IC 3UAJD 3O81A 3BZEB 1MCKA 4JZOB 2W92A 3AFLA 5EO9A 4LEXL 2AS5M 1R3LB 4M43L 2VQUA 4JAMA 1ZHLB 4J12A 2GYSA 1TNNA 3W9EA 3WE6A 1OTUD 2X4TA 3MA7A 3C6SB 4X9FA 1FZMA 4FFWC 5F6IB 4E5XA 3BP4B 4XPBL 3NCEB 4HFWA 5D1QC 4U1LA 2ITCB 3O4LE 3UTTE 1BFVL 3HCVB 5D2NB 3VFNA 4M1CC 3EFDL 3REWA 1VDGA 4PGCB 2QJDA 5ADOH 4JFYA 6FABH 2CJUH 2R4RL 5BV7C 5E7FA 1MCIA 2DDQL 1ZWIA 3BKYH 5I30L 5J11B 2Y72A 5HYSG 3DURB 4PTTA 4S0TD 1L6XA 2F58L 5F1OB 5A3IC 1QLEH 3RGVC 3EHBC 3TJEL 2COQA 5J1AA 1OWWA 2B1AL 4ZUVA 3OG4B 3WLWD 5LWYH 2V5TA 1Q0XL 4LAQH 1G0YR 5C3TA 4LHUG 1ORQB 4ETYA 1L9NA 4F2MA 1NLDH 3E2HC 1XGYH 3OF6D 2EKSA 4Y4HD 3CFDA 4P4KA 4JE4B 5HGGS 3EOTL 5D7IB 4HQQH 2JIXB 3BGAA 3MUGA 4XCYB 12E8L 4YE4L 1SBSL 1BZ7B 1PG7H 4LMQE 3EDKA 3FFCD 1NPUA 3G5XB 1I85C 4OCXH 4EN3A 4L3ED 4MNGE 3PNWA 3U6RB 1KB5L 2VC2L 4X98A 5DJ6B 4IDJL 4PY8I 1Q9KA 2O26U 2D7OA 1KNOA 4L3CB 2VIRB 5BQ7B 4IOIA 2ZJSL 3S7GA 2A9NL 2OS7A 4JHAL 2VR5A 1DEEB 1EAJA 1EFXD 5KOMC 1U6AL 3TO4A 1UM6L 2X4QB 2ZCLH 4Z7UB 4QTIH 3B2VL 3NIDE 3MRRB 3E6FA 3P30H 1F2XK 4KRPB 4FFYH 4MZ2A 4PJ9D 4ONHB 2MQCA 4BSVB 2PCPA 1KOAA 3WCYA 1X4XA 4OSUH 1RAMA 1GYAA 4X8JA 1V05A 1MVUB 3TN0A 4PJXE 3U9UB 2DLGA 1U95A 2EC9T 4KMQA 1G84A 3U36B 2P4AB 4NQEA 4ZPTA 5I74C 1GZPB 3MLUH 4RFOH 3BVNA 3FONA 1XF5B 4KI5E 4M7ZB 5F7NC 5HSFA 3QDGE 4MJIA 4XNYL 5IBUB 5IQ9B 3KHOA 3QIUC 5F9OL 5T1KA 1IEHA 1VFOA 3BKJH 1U8IA 3DO3A 1TQBB 2QHRH 3DXAB 1HHIA 4HF5L 3RY6C 3BZFB 5F6HJ 3VXPB 3DX9A 4PTUA 2IEPA 4MX7B 4W4NA 1H3WM 1YECL 3NFNB 3UO1H 4QHKI 1S9WB 4YX2H 4XPTH 4F7MB 3CFEA 1MLCB 5TDOA 4NFBA 4JVUA 3HAEA 4XMKH 1FFRA 3NZHL 3VD7A 5CEXA 5HVFB 4S2SB 1MFEH 2ENYA 1OCWL 4PJDE 1QFWH 2FX9H 3K74B 4HBQA 3PL6C 4YHKH 2GY5A 3TP4A 5L2KD 1KEMH 2Z91A 3F58H 4UNUA 4OQTA 4EI5B 1JGDA 1GOFA 2AK1L 3H3KA 3RNKB 4JN2A 2J8UA 4XCNA 1H0DB 1EHLL 1G7QB 4JANA 2IPUK 3ZTNH 4XBPA 1K4CB 5FV2A 5F7DB 2ZOKA 5EDXA 4HXBH 4P2QE 5KSBF 4OBSA 3T1FA 2P7TB 4PRNB 3FO1A 2YRPA 4PRPB 3PQYE 3W0WA 1CXKA 3NABL 2WW8A 4JO4H 1INEL 2X09A 2AEPL 5BS0D 1WFTA 3JVGA 3RDTA 4HZLB 2C3XA 1HIML 2F54B 5D1XD 2F15A 3K8LA 2AJUL 3LEYL 3NAAL 4P3CL 3FAXA 4NCDA 3RHWF 1P7KB 5E9DD 4H0GA 2YUWA 1DUYB 3CFIC 5HI5C 1T6WA 3HUJF 3MO1A 4UTAH 1CZ8H 2JJSA 1U8PB 5K59E 1A1MA 5IQ7H 1XGRA 3VXOB 3RNQB 1CT8B 1EH9A 2A0LD 2DAVA 4WUUB 2Z31D 5E2UH 4N0CD 5IF0B 4J8RB 3EUUA 5CZVH 3SQOH 5D8JL 1KJMA 3BRGC 3KVQA 2JB5L 2X4OA 4RAUB 3BO8B 1Z0MA 1WITA 4LAJH 1OP5K 2RCSL 3O3EA 1ZGLB 3QG7H 4ZD3H 5HHOD 4W4OC 1FVDB 3GJEB 3NCCB 3DRTA 4JPWL 4KZEL 2AJVL 3JUYA 1VGKB 1CXEA 1VADB 3VFMA 4PP1C 3KYMB 4UOJA 2HFGL 4Q2ZB 3PV6A 4PLOB 1A5FH 4QXUH 2PXYB 4XZUA 5FO9A 5KTEL 4L8CA 1JHLL 2EDJA 3MPCA 4JFZH 3SE4C 5I76B 3A0OA 3P4OB 4JDTH 3QA3B 4LSRL 1BOYA 1QBMH 3GEWB 3CVIH 3C6LB 2EYTA 1FSKC 3KR3L 3C5ZC 3OXRB 4ZFOB 3DVNB 4C56A 3IDMA 5C0IA 5I16B 1GL4B 3BW9A 3B3IA 1U8OB 4U6XB 3B9KD 1GGIH 2ZNWA 4R9HA 3V6OA 1EEYB 1IQWL 2GT9B 1M05A 5E8NA 2EDRA 4KHXH 2YPVL 5DD3H 4JM2C 1T7VA 4G7YH 1KXVC 3AGVA 4M6OL 1FN4A 2JCCE 3PP3K 4LLUB 1MCFA 1RURH 1T5XA 2AK4B 3KPNB 4G8IB 4OGXL 1Z9OA 2SEBA 4I9WE 3A6OA 4OLVH 4Y89A 1N8ZB 2HKFH 1TJHH 1MI5D 2VISA 4NZUH 4QOKB 2HT3C 4WHYG 2Y23A 4QO1A 3R0MA 4N1EA 5BZWA 3B5HA 4G7VH 3ULUH 5TF1L 3MBXH 4X6CB 2BNQE 15C8H 1D5XB 2EIZB 2AKRB 4Y1AA 5IVNA 3X3FL 4WO4D 3CZJA 4NCC2 5F6HI 3S37L 3P4NA 2IPTH 4JVWA 4MNQD 4XXCC 1A6AB 4BH7B 4MA8L 4GLRI 4H25A 2DQEH 5CD5C 5EZOH 2A9ML 3B2UC 2CJUL 1GPOL 2R1WA 3QPXH 1BAFH 1K8IA 3QDJA 5D9SB 5E8DH 3GDBA 3BKYL 4TSCH 1FLTX 3O8XC 4M1GL 4N9OB 5DR5H 4YK4C 1R3KB 4MXVF 1HXMB 3QEGH 4RGOL 3ZO0A 5EOCJ 3U7AA 4PJ9C 5LXGL 4BQ9A 1FRGL 1QLEL 5DUBA 3TESA 4PJEF 1FQ9C 1JVKA 4P2OC 1UFUA 4PRIE 4HJGA 5E8EB 5LWYL 2M26A 4LAQL 2X4SB 4NOFA 3O3AA 4IIQA 4GRWB 1CD0A 2LABA 5KW9L 1O7SA 3QH3B 2PKDA 4G6JL 5TE4L 1NLDL 3TZVC 4JFEE 3TWCL 1AGFA 4BM7A 1P1ZB 1XGYL 5J56B 4PJEA 4JFPB 1SJVA 3BN9D 3L5JA 5KSAD 3C9NB 1V3KA 1G7LA 5DEFB