4P3CH

Mt1-mmp:fab complex (form i)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy Chain Fab fragment of antibody LEM-2/15
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH01
3GSWB 1N5YL 5I16A 3CH1A 1ND0B 2FSEA 5F96L 4B7LA 1KEGH 1WBZA 2XA3A 5C09E 1T1YB 4L4VD 4PYGA 5EC2B 5DMYA 5K59F 2IGFL 4Z7NE 3WIHA 3QNYA 4UIMA 1BBJA 1QO3A 1ZANL 4G6JL 3LPFA 3VD7A 1W0VB 4UV7H 4F9LC 1ZMYA 1HN1A 2P44B 4K94H 5JDSA 1C12A 1DQQA 2AJUH 3GMLA 3RA7L 4D3CL 1M6OB 5DLMH 3C09C 2Z8VC 5I75C 1KENH 5F9DC 2BDNH 1OD7A 1CFQB 3GSXA 3ILPB 4JLRB 3B5GA 4PS4L 5H35A 2EKJA 1LVEA 3ZYOA 4K8RH 1HHHB 1UKTA 3T77A 2CDFB 2DI7A 4P2RE 1GPOH 5JHDD 1WF5A 2DQJH 2IADA 4QRPE 5IMLA 1H5BB 1MEXH 3KPSE 4DGYH 5D7JC 4XBEH 1TJIH 5HDLA 4NM8H 5F3HB 1LO3L 1VA9A 4NZUH 3M45A 4NRYB 1KFAH 5ENWB 1WBXB 5DRXA 5I1JH 2R1YB 4YDIH 1RZGB 4IRSC 3ULSA 5E9DD 3VXTA 4HC1A 5C9JA 2OZ4L 9CGTA 4G7VL 4WV1C 3MA7A 1MJ8L 5CP7A 1MRFL 3O2WL 5I76A 1VKXB 1EFQA 3HI6H 5CP3H 5AG9A 3IVKA 1U3HB 2V7NA 3CXDL 1UCBL 4L4TD 3VFWB 1FZMB 4O51A 4OD1H 3VRJA 1I4FA 4L8DB 1NAKH 3F5WA 1XF4B 1A2YB 1A8JH 2BJMH 1WEJL 1LK2A 2VZSA 32C2B 4GAYB 4PJ7B 5GRXG 2PW2B 4G42B 1JHLH 4Y89A 4NRXA 3G08B 2Z31B 3D18B 4WO4C 5TE6H 2YPLE 3LRGA 3D5OF 3CSGA 4MNQE 3PL6B 1J9CT 2MWCA 1SMAA 2RJMA 2D31A 1LEKA 3RX7A 3SKMB 1JPST 3RDTB 3P3YA 4WTWA 1C1EL 2YD1A 2ZZUT 4OIBA 4XCNA 3KPRD 5D72L 4M1GL 3OX8B 5KSVB 2HFGH 2DLHA 1IQWL 1X5FA 1BJMA 2F53A 2PYEE 5D7LA 3MLRL 4JPVL 3BDYL 4PJEF 5JORB 1CG9A 5A2KH 5HHNA 3QIWB 1A3LH 4HWBA 1VGKB 3QH3A 1NFDB 1KGCE 2BSTB 3PGCA 1TTUA 4IMKC 1ZHBB 4F7MA 5C7XH 3FB7B 3P40A 3VMOA 2AKRA 1Z3GL 1MQKH 1TPXC 4KUZL 4O9HL 4OB5H 1KJ3H 4G6AD 4JY4B 4PFEA 4YHPA 4R7NA 3QUXD 1CLYL 4HIIA 4HGMA 4CVXB 1BEYL 5JW4N 5L9DH 3CK0H 5SV3A 5F9WB 4WFGD 4IBLT 2VDRH 1QR1A 3HMWH 2EIBA 5IT2H 5E8DL 3SGKC 1AR2A 3PHSA 5ANMB 4LFHD 5DD0L 3DGGA 1I8LC 1PY9A 1L6XA 5FA4A 1J1PH 4FHBD 1LK3H 3U6RA 3D3VE 4N8VG 2HKFH 3N1MC 4Q0XH 3IJSA 2HRLA 4YHOH 5E2JA 5EU5A 3V6FA 4HIEA 5SWZE 2VN7A 4XNMB 2NW2A 4P9HC 1B88A 1MHEA 3F7VA 4YHMH 2AJVL 1I85C 2KUTA 3NCFB 4TVPE 3X14A 1R0AL 5TDPA 2P5WD 3RL2A 1A7NL 4A6YH 4WU7B 2ICEB 3G6JE 4NQSB 4FFWD 3D39A 1HSAB 4NOFA 4W4NA 4KGJA 2PO6D 1N6VA 1TVHB 4N0FA 5TE7L 2FD6L 1FL6A 3V4PL 3O3AA 5KSUA 3WNMA 4NC2B 4Q6IC 2X1QA 4DGVL 2FHFA 2ICWA 1QVOA 2HJFB 5LG1A 3VXMB 5FGCE 4S1DC 2UWEF 4OD3H 4JKKA 1S8DA 4PJBB 1I8IB 1LMKA 2BNRE 1R3LA 1H3PH 4EXPX 1E4WL 4JZJC 4XAKD 2FBJL 4XP4H 35C8H 5KVDH 3O4LE 3STLA 2YSSA 3MOBH 1KTLA 1TTGA 4U6HA 3F7YB 4G8IA 3OJDA 2P7TB 3RQ3A 5GS1B 5GGSB 4F2MA 3C6LC 1CICC 1CFNA 2VLMD 4PUBH 5FOJA 5F8QC 4R3SB 2B2XL 3DRQA 2CLRA 5BQ7A 3N1FC 5GS2D 1UH2A 3H9SB 3EDKA 1KNOA 2F5BL 3F12A 2GK2A 3B8YA 1BJ1J 4FG6D 4NKOA 2A73A 3CFEA 4IIQB 2NTSP 3OKDA 1HDMB 4NNYA 3BWUC 4OQTA 1AHWB 3K0WA 3CD4A 1WT5C 5EOCH 4LQ1A 2V9RA 3FT2B 1PEZA 4NN6B 5E2VL 1B0RB 2F15A 1ACYH 1PKQE 3MYZA 4FQIH 1TJGH 2VRAA 3GMOA 4KPHH 2NY4C 1U58B 5FEBA 3TH3T 4BSJA 3KNBA 2NLJB 3MV8E 3ZKMD 4WFFD 1CFTA 2PYFA 3RVWD 2AW2A 4X4XB 2VDOL 4QGTA 4HFWB 2WW8A 2VZ3A 5AD0A 1FDLH 1K6QL 1MCPL 4NN5B 3DVGB 1DVFD 5MENE 4PRPE 2HVJB 3RNKA 3STZB 2WBJD 3BJ91 4X83A 1DEEA 2LAAA 3UTSD 4TN9A 3I3BA 5DO2D 5EUOA 5FOBB 1EHNA 1ND0A 5IQ7L 3FN0H 1T1YA 4HKBB 5FM5O 3OBAA 1A6TB 1H3XA 5F7DB 1W0VA 3T1FA 4WHDA 1PFCA 5J3HC 1I3GH 4F57H 2XNAA 1M6OA 4ZUTA 4Y16B 5T1MB 1NGWB 1CFQA 3QO0B 2HKHH 3ILPA 2K3TA 3L3JB 1SBSH 1HHHA 3O3UN 5FO9A 5SX5K 3ZLQC 2EH7H 5B3NA 2CDFA 5CJXA 1RZ8B 3RIFK 2JIXD 4RMUA 2BMKB 3KJ4B 2H2PC 1H5BA 3O3EB 3DIFA 5T1KA 4LGSB 2VDQL 5F3HA 1T5WB 4JJ5B 2R1XA 5ENWA 1WBXA 5I8EB 1WBYB 4AMKH 5JMRA 1RZGA 2Y07L 4M6NH 5L6YH 1KLGB 1IGML 3CC5A 3DUHA 2IF7A 4PJHE 3HRZA 4XVUC 1E6JH 4PJGB 2D0GA 4Y5YA 4UAOB 4M7KH 4R7DA 4LSTH 3VRIA 3KVQA 2I07B 5DWUL 5JW5B 3VFWA 3AGVA 1FZMA 5EZIH 1W72H 1YEDB 5KANI 3BN9C 3ALPA 3WKML 1KXTB 4L8DA 4Z7UB 4Y8AA 5D6CB 1XF4A 4PJ5D 1YDPB 2K9UA 4HFUL 3VFSB 1IC4H 2HRPL 2NY2B 4HG4J 4HCRH 1MCOH 4GXUN 4PJ7A 4G42A 4QHKI 3WHE0 4RGNE 2Z31A 1RZFL 3SE9L 1S7TB 4HQQL 4OZHE 3CMGA 3PL6A 3SKMA 5FUCE 4OZIA 1Y6MR 2E7BA 5HD8D 4ZAKD 5E8PB 1JFQL 1RUMH 3I84A 4NQDD 4GG6E 1CQYA 4JO4H 3UTTB 3OX8A 5KSVA 1B4RA 2GCYB 5KANG 2MKLC 4YUEH 2FRGP 2VLRE 3ZTNH 3CXHJ 1UM4H 2FDBP 3TC9A 1X5JA 5IB2A 1YEFL 5GRUL 3SDXA 4KJYA 4IMLB 5HHME 4KKAC 1VGKA 5D7IF 1NFDA 4Z78B 3WXVL 2FGWL 2BSTA 1ZVSB 5F8RC 5MP6L 1F5WA 5I73C 1ZHBA 5FHAL 2WWMD 3FB7A 2G60H 3ULVC 1YYML 3QEQD 3UJTH 3QT2A 2EO1A 1EEQA 3WIFA 3EFDH 1NSNL 1BECA 4PB0H 2E6QA 4ZOBA 4EDXB 3QRFM 1NC4B 4XNQB 3LN5B 1D9KA 2HP4A 4R4FL 4CVXA 3GJFA 2Q6WB 1T6WA 3QDMD 2APWA 3M07A 1YJDC 3ZO0A 5JXEC 4PD4K 1OAXL 3OMZA 1P4LB 3WUWG 3TBTB 2Y25A 3VGAC 5ANMA 1YEHH 3VD4A 1FFRA 3HNTH 3ARDC 2X89D 1Y0LB 1QA9B 4NOBA 2YD8A 5AZEL 4XCEB 4HXBH 4MHHI 3SKUD 2IQAB 4JEGB 2O5XL 3LQAC 4XNMA 1F4AA 4UNVA 2CGRL 3TH4T 1MUJB 3BH9B 4HGWA 4JFOA 4AJ0A 1K5NB 2DMKA 3MRBA 4OIAA 1RZ7H 5H2BA 5J6GB 3RL1B 3QDJB 1PSKH 4WU7A 1AO7E 1D5BB 1ZAGA 2VH5H 3BH8B 3BYYA 3MRLA 4UMGA 1VEOA 2V9QA 3MV9D 1TVHA 3CJJA 2AS5M 3RBGA 3O6FB 5HGBA 4I77L 4XNXL 5F71A 5C0IB 1YPZB 2VMFA 3VMNA 3FCTB 3T8XB 5CKGA 4K71B 4YZFE 3R4DA 3O45B 3C8KB 4MHHG 4LHUG 3VXMA 4NRZB 3BEVB 3OKEB 5IWLC 5SWQA 3UAJC 4Q9BA 4PJBA 1I8IA 4Y19A 1BVLB 1WQVT 5JNYA 5JW4R 4DZ8B 1W0WB 5EBWA 5BMFL 2YC1B 4NN7B 2WV3A 5L88L 5DHVB 1DZBA 2APVA 4H8WC 2DKUA 2A9ML 3MGAA 2J7LA 3F7YA 3FQRB 4KXZH 2P7TA 4XWGH 5FCUL 1U93B 5E7BA 4CN1A 1NDGB 4HLJA 4HWNA 1BX2A 4R2GD 2XKUA 2DDQH 3VI4E 3H9SA 2VDNH 3T04D 1F4HA 2QSTA 4LLDA 2JJWA 2G75B 3QIBA 3QQNA 4ZPVB 1HDMA 5TE4H 3DJ9A 4PGBB 1FZOA 4D0BB 1I7UB 4NJ9L 3BP6B 3KPMB 1T0NA 5C0EA 3MNWB 4PRHD 2JCCF 2H26B 3SQOL 1JNLL 3ARTA 2K7PA 5FYJH 3M8OL 5E8EB 4R4BB 1U58A 4OZFG 5GGTA 1MY7A 4O2FA 1UWEL 1EJOL 1ZT4A 2BCKB 4WW1A 2GSIB 2PTTA 3ZTJH 3GO1L 4XTRC 2IG2L 1PGRB 1XCTB 3P9LA 1JE6A 2DQGH 3DVGA 3LEYH 1N0XL 3X13A 3N9GH 4FABL 4FFZL 3CDGA 4ODTL 1LO4H 1Q1JL 3JWOL 5HVGB 1HOCA 4U0RB 3MLZL 5FOBA 3HE7B 3U1SL 3QUYC 3ULUC 4HKBA 4B53A 1A6TA 5F7DA 4PRBB 5GGRA 4ZNCD 1ZSDB 2M26A 4P2QD 3RWFB 4HIXH 3IFPB 5IFAL 1A6WH 2X4UB 4OJFH 3D85D 3ZKXB 3BP7A 3QUMA 4U05A 5D2NC 3O6MH 3MO1B 1IKFH 4HXAH 4YBHA 5T1MA 1NGWA 4NQED 4Y88A 1H8OA 3L3JA 4Y5XB 4UT9H 3LKNB 3NZ8A 3QUXC 4U6XB 2DM2A 5CILL 2YD7A 2HLFC 4JRYA 3T2NL 5M7QA 2P8MB 3LIZH 2BMKA 2MCPH 3SDDB 4ONHA 4KVCH 3JWDH 2VDPH 2P47B 5C0AD 3WFDH 2D2OA 2VWEE 4C55A 4G9DB 4AY0A 1T5WA 2E7CA 1A9BA 5ID1B 1HH6A 1FORL 5I8EA 1WBYA 1V3MA 3IXTB 3TCLB 2Z93B 1NCWH 1KLGA 3Q6GH 2X4SA 1N59B 2YBRA 5C0JA 2VXTL 5F7HA 4NO3A 5F88B 2ESVE 4C56B 2HFEB 1KIQB 4Y7MA 2QKIB 4GW1B 5DVKA 2I07A 5JW5A 1FFOA 1AJ7H 1IBGH 3AMKA 2R0WH 4RGNC 1YEDA 2ARJA 3SHSA 4Z7UA 1DQMH 4FFWC 1NLDL 1KPVB 5D6CA 5FGSA 3QXWA 1YDPA 2IFFL 2PO6C 4IJ3C 5FUCC 5K9OB 4O2CB 1IGIL 4FQPA 1FO0H 2BHZA 2DIJA 2H2SC 5DT1L 2DQEH 1IAII 1MJUH 5EO0A 1Q94A 1G9MH 1FGNL 3KDMB 5CWSA 3OAYH 5EDXA 1J5OL 5GRYA 4Y2DD 3NACL 3MLUH 1D5ZB 1VESA 1RMFH 3QHFH 2HTLD 3NOIA 4JY5H 1CT8B 3RU8L 4P3WA 2IBGA 2P5ED 3MRFA 2AP2A 4G8GE 1XIWD 5EO9B 4QRRE 3KXFE 4LNRB 2APTA 3TYFB 4PJ8D 5AEAA 4Z78A 3SE4A 4YHIA 1ZVSA 4X6BA 4XXCC 4M3KB 5J9PB 2YEZA 3LEXB 2PF6A 3WYRA 3GUTB 4WW2B 2Z35B 1NCTA 4D0CA 2NQCA 1PLGL 4N0YL 3HUJE 1L4IA 4UV4L 4MJIE 1TFHA 2NY6C 3L5XH 3A67L 4ZOCA 3X11A 2ZUTA 1QACA 4EDXA 2QQLH 1JGEA 3EJZD 4KFZC 4XNQA 3L3IA 2A9NH 4LARH 2YN3A 2Q6WA 3U4EB 5C0NC 3V4UL 7FABL 3RKDD 4TSAL 1OGAE 1P4LA 2CUMA 3AS0A 5CHNA 4YFLF 2OTWB 1FYHB 3QZWA 3TBTA 2XWBB 3H42L 3TPUB 4JRXD 1QA9A 2G5RA 2IQAA 4OBSA 4U0QB 1RUPL 3OR7B 4FP8H 4MXVE 1PZ5B 3BH9A 1AGBB 4PGEB 1BQLL 1UM6L 2KH2B 4HF5H 1UEMA 2WAHA 3CUPB 3RL1A 5J6GA 4DVRL 3QDJA 3RX5A 1D5BA 1XR8B 3BH8A 3L3GB 1WC7B 2CKNA 4P5KA 4I4WB 4KZEL 3VWJD 2AJ3B 3GI8L 3ARBB 4X5LA 2H6PA 1LO5B 4TQEH 4XGZB 5DFWH 2Q7YB 3VD3A 5C0IA 5DEGB 1YPZA 1ZKAA 3SE8L 2Y4SA 3FCTA 3M1BB 1ETZB 5T1LB 2F54A 3T8XA 1N6QL 3O45A 1FIGH 3UBXB 5GSRB 1EIBA 1KTRL 3SJVB 1A47A 3V5KA 1E27B 3BEVA 4K7PH 1BM3H 3CX2A 3IGAB 1F4WL 1A1NA 1P7QB 1W0WA 1OAQH 2OP4L 1JPSL 4BFIB 5E24E 4TOYH 2ZSWA 4TUJB 5KJRH 1DQDL 5DHVA 3MJ8A 5K9JL 2LU4A 3FQRA 2I60H 2VZOA 1N2RA 2BVEA 3U30B 1U93A 1NDGA 4I3RL 43CAB 4Z7VF 5JXAH 3TN0D 4X9IA 1FP5A 1HHKA 2EDDA 5IEKB 2WBKA 4UT6H 3DURB 3V6BR 4NKIL 1KJVB 5I1GH 4HMCA 1JTTA 1EUUA 4KTDL 3U7YL 5KS9E 1V8HA 5BXFB 4PGBA 1MIML 3BP6A 4X7SL 3D2UB 2H26A 3DROB 1OARL 1RJYB 4NFBA 4R4BA 3SCMB 1QP1A 1DSFL 4NM4H 2GSIA 3T1WA 4JFDA 4XB8A 4NWTL 3BAEL 4BQ6A 1D5XB 5JQ6L 1XCTA 4X6CB 5HD8C 1QSEB 5T3XL 1ES0B 2ORBL 4IOSD 4GXVH 1B0GB 4I0PC 4K94C 5DRWB 1MSPA 1G7LB 3BPNC 3WL9A 3L95B 3WNKA 3GMRB 4GKSB 1AQKH 5FHBL 3MFFA 1LP9F 4GRWE 1T03H 3W2DH 1A6VH 2HYMA 2IMMA 3NGBC 4ZUVA 4K8RC 1NEUA 1R24B 4R90L 1WZ1L 1C08A 1S5HA 5CD3A 1U8JA 3MOAL 4JFEE 3AREC 5TQ0H 1REIA 1BJ8A 3RWFA 2JJTA 2UVEA 5ALCH 3HC4L 2X4UA 2IAMC 4KC3B 2FX7H 2WWMC 4LKCB 3D69B 5JA9A 2ZCLH 4KV5F 3MO1A 1KT2B 4Z7WF 5JR1L 4K3GA 1A6ZB 4M9OA 5EC1B 3DLQR 4HPYL 4LPUA 5D6DC 3LKNA 3QHZH 1A0QL 2F53D 5D7LD 2HT3D 5C0GA 1YEIL 4BSWA 5KSAB 1A1OA 3BQUA 1WAAF 1E0OB 2ZP0T 5CEZD 3C2AH 4KMQA 4OLWH 1UC6A 3WDHA 4YXLL 2XA8H 4YDKL 4HIJB 1FCCA 1A6UH 2QSQA 2W65B 3HC0B 5HHPA 4CU7A 2CRYA 1IT9H 1ZVHA 5ID1A 4UTAH 3LQMA 4P46C 4FQ1L 2Z93A 4EVNA 3RAJH 3SOBL 3DETD 3Q6FB 1BAFH 5E2UH 1N59A 5MI0B 4P4KC 2Z8RA 1GGBH 2VISB 3IU3A 2AJXH 3UZVB 1B2WL 2HFEA 5CJOL 4C56A 2QKIA 4GW1A 3ZZ1A 4RFNC 3C5ZC 1F4YH 1S5IH 5DVNA 3S7GA 3MLTB 4AEIH 5F9JB 4UIKH 3ES6B 3HNVH 4MJ2A 3IAGC 2D03L 3DUSB 1EZVX 1G6RL 1KPVA 1M7DB 4HWEL 4ZFFB 1LDPH 5LGHH 5JPMA 2WLZA 3MLSH 5T3ZH 4H20L 5K9OA 3EDDA 3HNSL 4O2CA 1FZJA 3PWPE 3H9YA 1SBBA 1XCQA 4IHOA 2BVOB 3QRGH 3D0LB 4M1DH 5B3JF 2FEEL 2NY0D 4Y4FC 3KDMA 4Z0XA 4KI5D 4JG1L 4OUOA 4W68A 2Q1EA 5L2JB 1KLUB 1NMBL 2QQNL 5JHLL 2GTWB 3EYSL 5ALBL 2VR5A 3V2AR 4MNHB 3P2TA 1CT8A 4JM2C 1NBZB 3O0RH 4LVEA 3D39D 3TFKD 1VEMA 4OF3A 4YHKL 2BNUA 3UEZA 3TCXA 4OTXL 4LPTA 3V7MA 5A2LH 1TZIA 4XMLL 4LNRA 4P9HL 3ZHDA 4MLIA 1QOKA 4OFYA 4XH2B 5J9PA 3B3IB 5IR1B 5DR5L 5DD3L 5I1DB 3ROLA 1EHXA 3GUTA 4WW2A 3LS5H 3LZFL 2OYPA 1HHIA 4TNVF 3KYNB 1IC5L 3P0VL 3MLYH 4MX7B 4HAGA 1T66D 4RMRA 2CH8A 3FN9A 3KWWB 2WLYA 2YUWA 5HYSG 5IB3B 5E0QA 2VLKD 5IOPB 1TLKA 1IGCL 3ARRA 5HI3D 3PNWB 3U4EA 3TV3H 4OIIL 3CSPA 4BM7A 2YK1H 1NGPH 1G1CA 2VXQH 5F72S 3VI3E 3VXOB 5D7KD 3TPUA 4L1DA 5INCB 1DBKH 4RIRB 4TUKL 4H5SA 4XPBL 3FO0L 2E7LC 4RDQF 3WJLA 1F97A 2B7DT 5HDOA 4AQOA 1YEJH 3RWHA 4J4PC 4WUUB 5IBUG 3CVIL 3IKCB 5EA0L 4PGEA 1OW0C 1FRGH 2R4RL 3CVHB 3CUPA 3FRUB 4L3EA 2Y06H 4Z6AT 5F9OH 5DQJA 4ALAH 3MRJB 5FDWB 2C4FU 4ODWB 1WC7A 3QAZC 4Z7QF 3S4SG 4GQPH 1J1XL 2AJ3A 4B5EA 4UT7L 3ARBA 2NNAB 3SDAB 3W0WE 3MA9L 3O3BA 1MPAL 4MSWB 1LO5A 2Y72A 4P23B 4XGZA 1A3RL 2Q7YA 5DEGA 3M1BA 3F7RA 3UBXA 5GSRA 1J0KA 1DLFL 3SJVA 4F7CB 4N8CH 3V6OE 4LRNL 1F11B 2J5LB 3IGAA 3HZMB 2JK5B 1T4KB 1SEBA 3QWRA 4AEHL 1IAKA 5IESH 5DUBB 3ZE0E 4NKDB 4F58L 1RJCA 3O6LH 2O26U 3CDCA 4P59H 3Q48A 4LLVB 4BFIA 2W9DH 4WIQA 4OZ4A 1FLRH 3VGGA 5CSBA 3PGFH 2C4FT 3FT3A 2V5RA 3DYPA 2A77H 4UUJB 43CAA 5F89A 5K59E 5IF0B 4YE4H 1E6OH 1HYSD 2CKBL 3Q5YA 4GAJL 4ZG1A 5J13C 1VENA 5IKCB 3DURA 5K9QG 2YD5A 2MQ3A 1ZEAH 1EAPB 4J3UA 3IT8D 3BGFB 4WTZA 2KBGA 1NJ9A 1OGTB 4BKLA 1VCAA 4OKVB 3D2UA 1I3VA 5T33H 2CO7B 1KTDB 5I74B 4PB9L 5IB1A 4KI5F 4DN3H 5HVHC 4JKPL 3C87A 3NCJH 3EYFB 3G04A 1FNFA 2WWKO 4QTIL 4GRLC 1INDL 1D5XA 4U7SA 3BZ4A 3L1OH 3UXFA 3NIDE 4X6CA 3P4MB 3HCVB 1G0XA 3TM6A 1ES0A 2W59A 1B0GA 1L7TL 2IBBA 3ARZA 5DRWA 2D7TH 3ZYJA 3L95A 2YWYA 3I02B 3GMRA 4FQCH 1G7HA 2X4QA 2RIKA 2PTUA 5E5MB 3MJ6A 4M7ZB 3DMMA 5KTEH 5FUOH 2Z31D 3IETB 4ZFGH 1IARB 4L5FL 1QYGH 5DC9B 1TXKA 4HKZB 3RTQC 5I75B 1MY5A 5ILTL 3PL6D 4X6DA 1T7YA 5C0FB 4POUB 5D9SA 2BY1A 3V8OA 2FL5B 1WSST 3WDJA 1Q0XH 4ZNEE 3NCEB 5F7EH 4DUXA 1KT2A 4XHQA 3SKNA 5D2LB 5EC1A 3INUL 1G9NH 3V5DB 4WJ5A 2IH3B 4AK1A 1U8PB 2VE6A 5KSAA 5D7JB 3DV4A 3MV7E 4LK4A 2LV4A 4HIJA 2W65A 1A7BA 4UDTB 3HC0A 1QHOA 3V52H 1N0LA 1OPGL 4PJEE 1EA9C 4F7EB 3FO9B 3WUWA 2R0KL 1JZ2A 2J1KA 4LOUC 1O5DT 3SGJA 5A1AA 4I3SH 3C9NB 4XVSL 4ZS6C 1QEWA 3EYOA 1CQKA 3LPGA 5ERWB 1JWSA 1JTOA 1L0YA 1D9KD 3IRPX 2N56A 5B8CB 5L7XH 1EXUA 4NKQB 5ADPH 2IC2A 5F9JA 2Y23A 3ES6A 1IEAB 3W11D 4M6MH 1U9KA 3DUSA 3W39B 1DQLL 4N90D 1M7DA 3VWJC 4TNWK 3EYVB 1AP2B 2BNQE 4KDWA 3ULVL 2O5YH 4RMVA 1MWAH 3QG7L 3ECBB 2BRRH 3V95A 4S1RH 1GGCL 4Z77A 5IJKC 2J88L 2BVOA 5KVGH 5KG9B 43C9A 1V3LA 5EUOF 4QOKA 3WCYA 3E3QE 5E03A 5KVEH 2UZYB 1YJDL 1IZKA 3L5WA 5T5FH 4M00A 4M9PA 1J8KA 5L2JA 1KLUA 5DUMH 2XT1B 4U1NB 2GTWA 3DBXA 4OCSL 1KEML 5ID0B 3L7FB 1HE7A 2EDTA 2NXZB 4H0IA 1NBZA 1AGEA 2DTML 4L4VE 5DHYB 1FG9C 2AQ1A 1WTLA 3CLEH 4LIQH 4YPGB 1HK6A 1RQ5A 3RGVC 3LQAL 4AG4L 4NC1E 1FQ9C 4NKMA 3BN3B 1OP9A 5JIKA 1RURH 1G6RB 1IEBB 3TN0C 3VXMD 3BESR 2VQTA 1U91B 1U42A 5ISZB 1DE4B 4EOWL 4MZ3A 4XHJC 4JFFB 4POZC 2AJSH 2YD2A 3ARPA 4Y19D 5L0QB 1NCBH 3KYNA 3PHQA 1JMZA 1FPTL 4MX7A 4QXGL 5I6XC 2XQBH 4OUUA 5IFHL 1J11A 4GKZA 5JHDE 3TBYB 1QBLH 4Z95H 4XB7A 3KLHC 4XP1L 4LFHG 1MAML 5IOPA 1FNSL 3QUZB 4GKNA 2Z4QB 5E7FA 2HFFB 4YBQD 1JIBA 3UC0L 5HGAB 3MLXL 2BY0A 5HI5D 5JZ7C 3VXOA 4S1SL 1KB9J 5E9DE 5INCA 3BW9B 5C9KA 3U0WL 1A7PH 3H9SD 4F3FA 2DIBA 2DBLH 1HQ4B 2ZWLT 1JWMA 3QIBD 4H8WL 5CSZA 4L4TE 5D70H 1J18A 1CFBA 3SDYH 4LCIH 1JNNH 3IKCA 3BPCA 1H15B 4XI5C 1P84J 1CDJA 4PJ7F 3TBWA 3PDOA 2P48B 4FMKA 2PXYC 1HEZB 1BFVH 2J6EH 3E2HC 1B6UA 3RI5K 5FDWA 4ODWA 2X4PB 3KHOA 4Y8DC 4ZUUB 4OZIF 4YEEA 2JELL 2NNAA 3SDAA 4OLUL 4P23A 2COQA 3PABB 4MJ4A 5DJAA 1ONQA 5JA8B 4FRWA 2BY2A 1S9VB 3E8UL 5HY9B 2APBA 4F37F 2VB5A 1KCUH 1P6AB 1J12A 2L7JA 4X4YB 2YUZA 1JHKL 4IRZH 5D96B 5CD5C 4XBGA 1F11A 3SDXF 3KPRE 3HZMA 2JK5A 1T4KA 4WI6A 1KPUB 1NFDF 5DUBA 4CGTA 4NKDA 1MQ8A 4LLVA 1DBJH 5D1ZB 3O2VL 3G5VB 4FQLH 2OL3B 3UYPA 2AV1B 3HTLX 4U31A 1X5IA 1MVUA 1BZQK 2ARJQ 4OF8A 1CICB 5I18L 4HEME 4DOHE 5DMIH 2C4XA 5CJQL 4D8PB 4RAVB 4MNGA 3H2WA 5IW6B 2W0FB 5IF0A 3DETC 2DLGA 2FATL 2FLBT 5IKCA 3ULUL 3VXRB 1F8TL 2E9BA 1R3HB 4JPWH 1NKRA 4JRYD 5DS8B 3DO7A 3GHBH 4XMKL 3SKJL 4EDWH 1OGTA 2Q8BL 4Q2ZA 4X6EA 6FABL 2NY4B 5DXWA 3T0WA 1N64H 1D5IH 1HWHB 1KTDA 4QRQB 1Y18B 3C08H 1QKZH 3X3GL 3QNZA 4XT1C 4YX2L 4EXKA 3MRPB 4L3CB 2EXYD 2NY0C 5C09B 2RQ8A 4ZUSA 2ITDB 1E4KC 1DL7L 4OFPA 3U46B 2FH6A 3P4MA 3ZHLA 3L5IA 2BY3A 3HFML 2H3NB 4DKEL 2H1PH 4RWYL 4ODHH 1CVRA 3PWNA 5D5ME 3WIIH 3EGSA 1ED3B 5TQ2H 4OLVH 4JFQB 3TFKC 3GKWL 1DANU 3B2VH 5EUKA 4FFYH 5E5MA 2NY2D 2DWDA 4X5XB 4PJBF 3TPKA 5JUEH 4F9LA 4FQHB 3IXAB 4P2RB 4G5ZL 3OAYK 5KAQF 1OCWH 1WJ3A 3PJSA 4HKZA 1HXMB 4QRPB 3JWDC 5C0FA 3KPSB 3H3PL 5GZOD 2FL5A 2X1WL 4O4YL 5FYJU 1T66C 1EV2E 5FYLL 3LB6D 4DKAA 1YNKL 1W0YT 5HHQB 4UINL 3JXAA 4XMPH 2WUCL 1FNGA 3H9HB 1E28B 2IH3A 3IDYB 1JYWA 5EB9A 1U8PA 5HI3C 3PE9A 5D7JA 3TIEB 3CMOL 2HLAB 5C6TL 1D3CA 1FSKC 3H0TB 3LS4H 1IRAY 2ZPKH 4UDTA 4BH8B 3L7EB 2BSSB 1FJ1B 4IRSA 2BRQA 4U1KB 5GS0H 3MOQA 1FHGA 2B1AL 3R06B 4WV1A 4O5LH 1BF2A 2A6IA 3MCLH 5C86A 1W2KT 2IANE 3D9AL 3HC3H 3C9NA 3CPLA 3KAAA 2FZ3B 1N3NB 2F19L 5ERWA 1K3ZA 4N0CC 1CYGA 4Y0GA 2AK4E 1G9MC 3OR6B 4KDVA 5JW3H 3ARUA 2YPLB 4HJJL 4G7YH 5T3ZE 4MNQB 1IEAA 3IFNL 1RULH 1OAKL 4K3EH 4YDLB 3W39A 3LEVH 1JZ5A 3VXPB 1N4XH 5DUPL 4WFFE 5E1AA 3ECBA 4KAQH 1G7MA 2V5TA 1NCDH 4JG0H 2PYEB 1XGYL 1DEDA 1YEKL 3WXWH 1V7NH 3V0WH 4KK8C 4QXUH 4G43B 2LU7A 5KBNC 4KVNH 4GBXC 1HZHH 2ZCKL 4U1SA 3UTSE 4U1NA 3FQNA 1HILB 2GJJA 4B50A 3QDJD 1NCAL 3JWNC 1I1FA 1KTKE 4JFZL 5I1AB 3TO2B 4WCYH 5I71B 2XY2A 1P4IH 4I8DA 3LH2L 3DSFL 3OHXB 3I9GL 1XGTB 4PJAE 5IHUH 1U41A 3HI1B 4IMKA 2B39A 1CD0A 4X4ME 1G6RA 2AABH 1IEBA 2W07A 4G3YL 2RAMA 4XP6L 1KN4L 4JRWA 5ISZA 3MREA 2CDEA 4LCYB 4JFFA 2R8SH 1ZA6B 2XTJD 2I5YH 1WK0A 1R5WB 5CJXC 3D3VB 1XGPB 4YWGH 3TBYA 4R8WL 2AJZB 3P30H 1JN6B 4MQXC 4XX1E 3S37X 3GSVB 3OSKA 1DLHB 5SWZB 1H5BC 3QUZA 3SGKA 4MGXA 1X7QB 2HFFA 3LMJH 1BZ7B 1I9IL 3DPBA 4YGAB 2QR0B 5IMKB 1I8LA 3OKOA 5HGAA 2B20A 4ODVH 3VG0H 4R26L 5JO5B 3BW9A 3G6JB 1XZ0B 1J05A 4MAYB 1WTGT 1HQ4A 1RV6X 5DMGD 1YQ2A 3UZEA 3UTOA 2E5EA 4Z7UF 4RGMB 3V4VH 1MFBL 1U3HC 1I85A 1AIFA 2K1MA 2V17L 3TF7C 3MXWH 2MPAH 3N0PB 1OAYL 3PIQB 2HT2C 3RUGB 1Z9MA 1BD2B 2FJGB 3KPNB 1HEZA 5FGCB 3AB0B 4JDZB 2VNCA 3QQ9C 5CZXD 1KELL 1CR9L 4Q6IA 3AU1B 1WLHA 3HHRB 1BVKB 3O4LB 4JFDD 4HKXB 5F9AC 3PABA 1N7ML 3PL6C 2NY7H 2LVEA 3QUKB 1JTPA 1MVFA 4QO1A 1VGEH 3RDTC 1CDCA 4X4YA 1IC1A 3DI2B 4NQDE 2PCPB 4N0UE 3HZYA 2OX5A 4KKBD 3MV01 4FQXC 1S7VB 5A16B 5SWSE 3U4AA 3VXUA 4C83A 1P5UA 3HE7D 3CFIC 1KEGL 5D1ZA 3G5VA 1F3DJ 1DQJB 2AV1A 3D0VB 3QIWC 1KPRB 3C6LA 1CICA 1M7IA 2RCSH 2ZUQB 1C5BH 1HCFX 4KRNA 4YFLI 4UV7L 5F7NC 4K94L 1IE5A 4ZFOL 1HXYA 5CJ5A 4QY8B 5IW6A 2AJUL 5DLML 1BOGA 1KENL 1IM9B 1PKQB 3GSQB 1PD6A 3QEQE 3J8F7 2BDNL 4P5TB 1CXIA 5IP4A 4N0RA 1OP3H 4HH9B 3NN8B 3QB7C 3S35H 1S9XB 3PWUB 1X5GA 3SE3C 4K8RL 3U9PH 1OL0A 5CIPA 3VD5A 1WT5A 3LN4B 3BGMB 1GPOL 2RFXA 2F58H 2GT9B 1R3HA 3BQUD 5B39G 1T2QH 2VSCA 5F9WC 1IQDB 2DQJL 5KVMC 5HBBA 5MENB 1NANH 3CDFA 1MEXL 4PRPB 4YXKH 1MFDH 4DGYL 2FECI 1LILA 4XBEL 1TJIL 2DQTH 4ETQB 4NM8L 4NZUL 1KFAL 1K9TA 2XG4A 2J8UE 5I1JL 1U8KB 1NCUA 4YDIL 3W9DA 4F9PC 3MRPA 4U6VH 4L3CA 2HJKA 4JHAL 4GJTB 5C6PB 2J8OA 4QHNB 1OLZA 3HI6L 3U46A 3ZDZE 3BOVA 4C56D 5DEFB 2CIKB 5DSCA 4OD1L 2H3NA 2CKBA 1KJ2B 3RGHA 3TA3B 1HI6A 1NAKL 1YPZF 1RZKH 4FZEH 4EIZC 2BJML 2Q20A 3ZMRA 4JFQA 3BPLB 3MV9E 4KMTH 1NEZB 4X5XA 1JHLL 1H8SA 3EO0A 2ZSVA 3VFMA 4LASH 5TE6L 3IXAA 3SPVB 3T2PA 1RIVH 3K4ZA 3CVHH 1HXMA 3HR5A 3NA4A 4JCLA 2OM5A 4X8JB 4QNPF 1VSCA 2HFGL 1SYVA 5HHQA 3H9HA 1E28A 1RIUH 4PJHB 1BJ1H 1A3LL 1T89C 3TIEA 1HKFA 2HLAA 2JLLA 5GS1C 4RZCB 5TFSH 2FBOJ 3H0TA 4NO0B 4BH8A 2BSSA 5HI5C 4O58H 2CMRH 4OFYD 1LHZA 4U1KA 4ZTPH 3MACH 1IGJA 1NCNA 3R06A 5C7XL 4WFEE 1KXVC 2EIDA 3SDCB 3TVMC 3AVEA 1MQKL 3LSOB 4OB5L 4IIQC 1KJ3L 4RQQB 2FZ3A 3CX5J 4J8RA 2DL9A 2R23B 1B3JA 2YRLA 1SM3H 4GW4B 2DQCH 1AHWC 2DLFH 4RGNB 2DLTA 4P3DB 1T22B 4XNUH 4NBZB 4PRHE 3ISWA 5L9DL 3CK0L 4RRPG 4NN6C 1Q38A 4MXQD 5IGXH 1FNEB 1BLNA 2VDRL 4OZHB 3HMWL 1F45A 4IJ3B 1I3UA 4X0KB 5IT2L 5IBLD 5AAWA 5GJSH 3TO4B 5DVOA 4GG6B 1J1PL 4X7FC 3S4SA 5IIEA 5CUSH 1LK3L 5B38G 2VLRB 2HKFL 3GSNH 3NCYP 4Q0XL 3RPKA 4YHOL 5HYFA 2DM7A 5DFTA 1S7UB 4G43A 5HHMB 3C5SB 4YHML 5BZWB 3MGTA 1MREH 3O2DH 4FNLH 5GGRY 4RWHA 4I9WD 4A6YL 1HILA 4L3ED 3U0TB 3B43A 5I1AA 1UKQA 2HFTA 1IMHC 4KK5C 3ALWA 1R5IB 5FM4A 5IVZB 5J8OA 4WHYH 3ARBD 4P2QE 5EO1A 2ZG3A 1I3RB 2XZAH 1QFWH 3OHXA 1CFVH 3FFCB 3WFZA 2IQ9H 3HI1A 4PLKC 3T08A 3REVB 3IDJB 4OD3L 3JBG7 3SJVD 4Y16C 3CAFA 4CN4A 4LCYA 4NQEE 1A5FH 1H3PL 3QWRD 5GS0D 1P7QD 1ZA6A 4XP4L 35C8L 1QZ1A 5KVDL 1R5WA 3D3VA 1XGPA 2FECL 1AR1C 3MOBL 4PJXB 1BGXH 5JXEA 2P1YA 4GAGH 3GSVA 1DLHA 5SWZA 1L0QA 1T1ZA 2WIMA 1X7QA 2QR0A 4PUBL 3FO2B 3ARDA 1EFXA 3G5ZA 4LSUH 1AO7B 3B5TA 4JO2H 4ZS7H 5HYEA 1XZ0A 4IOFD 5JIHA 4UAOC 5I1KL 1A7QH 2XYCA 3REWB 1QQDB 1OTSD 5KOMC 3WE6A 2AVGA 5FF6B 1BMGA 3RUGA 4ODUA 3B9AA 4D9QD 1X5LA 5EOCL 4M3JA 3VGDA 4WNQB 1BD2A 3D2UD 3T3MF 2M8XA 3KPNA 3PF2A 4QHLB 1ACYL 3IDIB 4FQIL 1TJGL 1ZTXH 2EYTB 4KPHL 4L9LB 2NY2C 3EOAB 3MLWH 2V5MA 3BIBX 2VKWA 3O8XB 4HK3J 5DK0B 1BVKA 1AFVH 3BKYH 1NGQH 2ZCHH 4HKXA 1FDLL 3LPWA 4M1CD 1JYNA 2CLZB 5IWLA 4BQCA 1R3KA 2C5DC 1QSED 2QADB 2PCPA 4JE4B 1BHGA 3LB6C 1JZ6A 4KK9D 3T0DA 1S7VA 5FK9B 5BS0B 2UWEA 4JGUA 4H88H 1ZVYA 3ZDXF 2F8OA 2P5EE 3FN0L 1DQJA 4M6AA 3DX7B 4WW2F 3D0VA 2P43B 1KPRA 2ADGB 3D87B 3EOYG 1TQBC 5JIPA 1QLRB 3GHEH 1WWWX 1LP9E 5F1NB 1FNHA 1I3GL 4MS8D 3GSOB 1U6AH 4QY8A 4HUKB 4F57L 4LPXA 4I0KA 1PKQA 3PGDB 5A2JH 1WCBA 2HKHL 5MERA 5GISH 1S9XA 1SBSL 2GW5A 3LVEA 2EH7L 2Q76A 2X4TB 5KSAD 1EGJH 4KV5E 2F74A 2X41A 4Z7WE 4PRPA 4RFEB 1YEGH 3TZVC 3BZEB 3WUZA 4ETQA 4KXZI 5AWNL 1DQTA 3QDGE 4JRXE 4QHMA 4AMKL 3HG1E 5INDB 3DX9B 3LKSB 4M6NL 5L6YL 1KLFA 3V0VB 2MQ0A 4PYHA 4KRPB 1OHQA 2V5YA 3W82A 3BXNA 1E6JL 4GG8B 3BWAB 2JE8A 4PBWD 4QHNA 4M7KL 5JLZA 4LSTL 1E4JA 4I0PB 5DD1H 5F97E 3UDWC 4LCWA 2EE6A 1KCSH 4NJAH 5DYOA 5EZIL 1W72L 1K2DB 4HWZA 4NO5B 4N5ED 3I3DA 1IC7H 1NPUA 3QUYA 4HKJB 3UTPD 1JUFB 5F6IC 3NTCH 4V1DE 1IC4L 5I66B 3FZUD 1NEZA 1G9NC 3AREB 4HCRL 1JCKA 1MCOL 3O6FC 3IDXH 3HI5L 1LNUB 4ENED 2XIDA 3SPVA 2IAMB 4EUPB 5D2NA 2CLVA 1ZT1B 5DFVD 5E6ZA 1RUML 1Q9OA 5B3JE 4JO4L 4MMXC 4LEOB 5GJTH 5I1LB 4TPRH 4YUEL 2ILLA 1UM4L 4WDIB 2P4AB 5DZOA 5E6IC 2ESVB 4OI8A 4RZCA 2VXUH 3UROR 4GMSL 2JB5H 4NO0A 3G5XB 3U9UA 5BRZE 4QHUA 4MXWH 4ZD3H 3UTZB 2GK0A 3FT4B 4P46B 2X05A 4LAQH 3WLBB 1XGQB 2PTVA 2GFBB 4PJCE 5J4MA 3GGWB 1JZ3A 4P4KB 2G60L 4MB5A 3T0EC 4LPCA 4CDGC 1MJJB 3WJJC 2OL3H 3UJTL 3LSOA 2YPKB 3EFDL 4PB0L 2IPKB 5CSGA 4GW4A 2HMIC 2P5WA 1LO2H 2P46B 1T22A 2R9HC 4F33B 2D7PA 1AGFA 1ZOXA 1UWGH 2HT4C 2D4FA 4OZHA 4Y4KC 2ICWI 1Z5LA 4X0KA 1NGXB 4X6CF 4XP9H 3RIAF 1YEHL 3I50H 5HYIA 3HNTL 2VAAB 5LQBH 3AC0A 2VLRA 4HXBL 4Y4FB 3VDCA 1CWVA 4ERSL 4OGAC 4ZXBC 2ZOKA 3OKKB 4G8GB 5GSVA 1S7UA 1ITBB 1AGCA 4HUXB 4QRRB 5DRZB 3STBA 3WFEH 4ZUWA 3C5SA 4F8TA 2QQQA 4U7MA 5DMJB 4JQIH 4GT7A 1J8HB 2GY7B 1RZ7L 5GXBB 4Z76B 3DOSA 4OLYH 4JM2B 2AEQH 4U0RC 2QHLA 1PSKL 1XF5B 3U0TA 2VH5L 4K23H 3HE7C 3FN3A 1P1ZB 3HUJB 4X6DF 5HVWA 3IF1B 5IW3A 1R5IA 5IVZA 3RHWF 3CFDB 3TJHD 3SDAD 1PX3A 4AT6A 4M62H 4P23D 4R97C 4XXCA 5I19H 3ALXA 3FFCA 3PQYA 4X9FA 4Z7QE 1OGAB 3T0XA 5AYUH 5DK2B 4AEFA 4Y5XC 2MNUA 4CW1B 4YH6A 3T2OA 2MCG1 5FAAA 3BISA 5D7LE 5ETUB 5IHLB 4JVUA 4MVBC 4PJXA 5CEZE 4KK6C 5HYJA 3RZWA 1P6FA 4X9GA 3SDDC 5A2IH 4XWGL 4U4BA 4DGIH 5IQ9A 3RVUC 4LSVH 1JF1A 4PG9B 3FO2A 4NQTA 4XPAH 4CRPA 2DDQL 3FB6B 5HDBE 1AO7A 1OTTC 2VDNL 4JFXB 5TE4L 2YD3A 4HZLA 4PJDE 2FO1A 4EQ2A 1KIPB 5FF6A 3OKMB 5TH2B 4EN3B 2GJ6A 4WNQA 4PJIB 4QHLA 5FYJL 2XWTA 3ARFB 2EYTA 4GSDH 1M05B 3EOAA 4B41A 2EZ0C 4AQ1B 3KPOA 3NCCB 1IQWH 5E8NB 1CL7H 1EMTH 1P9MC 4JPVH 3BD5A 1FVDA 2YN5A 2G5BB 3LV3B 3RVVC 3VXSA 2DQGL 1GZPB 3LEYL 3N9GL 1JP5A 2CLZA 3GBNH 4YR6A 3KPQA 4DFHA 2C7UA 1B90A 1LO4L 4WVRA 4U1HB 5F7YC 3RX8A 1Q8MA 3FQWB 5BS0A 1X6LA 3D39E 3BZDA 1IGTB 2FJFB 3EJYC 4U1GB 2NXYB 1ZLWH 3MUGB 4H25A 3QCUH 1E4XH 1EEZB 1QLFA 2ADGA 2BSRB 4E0RA 5KS9B 4HIXL 3MLVH 1N5AB 1MCSA 3QXDB 1A6WL 2BVTA 3TESA 1V7MH 2E3VA 3MNVB 4WW2C 4OJFL 4ZDHB 4HLZH 3HLAA 2P24B 1UXWB 3O6ML 1IKFL 4HXAL 4NYLB 3NCBB 3B9EA 1KSRA 3MRKB 5BCAA 5DD0H 1YN7B 1JNHA 4UT9L 4ONOA 1S9WB 3VG9B 1UH4A 1C16A 3T65B 1PX4A 3V7AG 2X4TA 4QRUB 5D7JD 3QFDB 1RHHA 3LIZL 2MCPL 1J0IA 1ZK9A 4KVCL 3QFJE 3JWDL 4RFEA 4ZSOE 5IBLC 2VDPL 3WFDL 4NHUB 3C6SA 4E42B 3V8CA 4IRSD 1ORQA 2JCCA 3QPQC 5D7KE 2FLRT 4MQSB 3QNXB 3DX9A 5INDA 3K8LA 5DK3A 3R8BB 1NCWL 3LKSA 3Q6GL 4GG8A 3BWAA 5DJDA 5D7SH 3DYOA 4I0PA 4OGXH 4ZFOA 4JFEB 1AJ7L 1IBGL 1RVFH 3EDEA 2R0WL 1RJZB 2Z9TA 4NO5A 3MRRA 2YKLH 4KTEH 4TVPH 2V9TA 2AXGB 1DQML 1AY1H 4HUWB 1YA5A 2V7HB 5I66A 1FO0L 3AREA 1VFMA 4Y4HB 1LNUA 4XCYA 2DQEL 4C4KO 1MJUL 1A9EA 1G9ML 2IAMA 4EUPA 5IVOA 1PYWB 5KZCB 4XAWL 1INEH 4F8QA 1RU9H 1H3VA 3WO4B 4N1HB 3MLUL 5GS0C 4NT6A 3RWDB 5EUOE 1RMFL 3QHFL 3I2CH 4JY5L 1I7RB 2NXZD 5TGBB 5CP3A 4LLMA 4WDIA 1RUAL 3Q3GA 2H45A 2AV7B 3ARQA 3LKOB 5FGRA 3K80A 3FO1B 3U30C 4LVOC 1MRCH 1FG2B 2X89A 1AD0A 2WIIA 3FT4A 4P46A 4JZOB 4R9HA 4CUCA 4PGZA 1T5XB 5IHZB 3GGWA 4P4KA 5C0CA 1U95B 1IAOB 5ISZD 4JFFD 5CGYC 2EDKA 3QCTH 3RWEB 3L5XL 2QBWA 5EOTB 3PWPB 4MA8H 3ELAT 1J0JA 2QQLL 2IPKA 3C5ZA 4LARL 2A9NL 4QLRA 4F33A 1CGWA 3DYMA 1A6PA 3TJEH 3LRSB 3QUZD 4DK6A 1NUDA 2VZVA 1NGXA 2A6DB 3OKNB 2BVYA 4ZODA 4I5BB 3SCMC 1ODAA 4OCWH 4OZGE 3O6KH 3RVTC 1QBBA 5IQ7H 3SGDI 4Y4FA 3E6FB 4L8CB 4JDTH 5EBLA 1AXSB 2HWZH 3LKRA 4G8GA 5DJXB 3RJDA 4FP8L 2G9HB 1J8HA 4Z76A 4HF5L 1JV5B 2BVPB 4DKFH 4JM2A 5C2BH 1QLEH 3KHQA 2EC9T 4L4JA 3ZE1F 1G7IA 1EAJA 3FTGB 4MD0B 3HUJA 5I1HH 3RGVB 4IRJB 5EWIH 4FXKA 4PJ7E 3HE6C 1M71B 2HAZA 4XPFH 5FO7B 3KPPA 4JR9H 1JL8A 1FIEA 4TQEL 2A6JA 5D2LF 2HG5A 1PG7H 4S1DD 3ZSTA 3FL7A 1KJ2H 1FIGL 4HT1H 5BOPA 1WISA 5KAQG 4QYOB 4OZIE 4DCQB 1BM3L 5GGVH 2C1PB 2DQIH 5ACZB 4BK4A 2XG5A 1OAQL 4CW1A 5BVPH 3IU4H 4TOYL 1I8KA 5D1ZD 5KJRL 1FGVH 1HKLH 3PWVA 1PJ9A 5TJWK 3SDXE 3C6LD 1CICD 3GM0A 5DQDH 3VFNA 1NFDE 3NIGF 3WO3B 2I60L 5B39A 5DC4B 4A6YA 1YYLH 4Z7OF 5M94B 4LEXH 4PG9A 5DDHA 2YD4A 5JXAL 1CFSB 3ZL4H 2E7LA 4ZPTB 4WHTB 1F6LL 1OP3K 4UT6L 3HKFA 5EU7E 4J4PA 2NMSA 5EZLA 4HSQA 3KPTA 1HHGB 5I1GL 2F8XC 5H37H 1B0WA 1BREA 4JFXA 3O41A 3OB8A 3W0WB 1OW0A 1AKJB 1BQHB 2PXYB 4HDIA 5AUMB 3OKMA 4CBPA 1ZS8B 4PJIA 4LMQE 2NY4D 4P2OB 2FGZA 4N90E 1KB5H 1O7SA 1SJHA 1R3JA 3OXSB 3TH2T 3FZUC 3OGCA 5D8JH 2R1WB 2MMXA 1NAMB 4KQ4H 2BC4B 1RK1A 5J6HB 3OGOE 4NM4L 5E8NA 1UENA 4G9FE 1I75A 5TDNB 4QT5B 2DI8A 2G5BA 3GMQB 3LV3A 5CBEB 3KLAA 4X9HA 5DGQA 2ADJA 4PP1C 1S7WB 1GZPA 5DA4A 4E41E 4S10A 4GXVL 2EO9A 3RWIB 5DJ8B 4U1HA 4LCCB 3FQWA 2YMXL 1AQKL 2MTPA 2VTFA 2FJFA 1T03L 3FAWA 3W2DL 1A6VL 4N68A 4G8EB 1QSVA 2X2YA 3QULA 5IV2A 2BSRA 5TQ0L 4N1EA 2UY6A 5BZDA 3ZE2F 2MQCA 4P2RD 5ALCL 1L6ZA 3VXME 2LU3A 2FX7L 4ZDHA 5ABDE 3TNMA 4Y19E 2GUOA 2ZCLL 2X4OB 1GSMA 3VFTB 3C5JB 3MRKA 4J6RH 2NX5A 1RD6A 3QHZL 4RMWA 3T65A 3GSRB 3AROA 4O02H 2H2PD 4I13B 3C2AL 4OLWL 2XA8L 4S0TD 1A6UL 1CLZH 4WTXA 1T83C 1T6VN 1JGDB 4E42A 1IT9L 2P49B 1GIGH 5HJ3B 3WKNA 4CVUA 1CK0L 4UTAL 3H9SE 1RZKC 1QFHA 4OCXH 2H9GA 4XVUD 3UJJH 3RAJL 4GRLA 3K1DA 2O61B 1BAFL 4UQ2B 5E2UL 1FFPA 1M7XA 1GGBL 2X42A 2AJXL 4HS3B 1F6AB 4YO0A 3VWKB 1MCQA 1OD9A 3BKMH 4JFEA 4JKWA 4BH7B 1F4YL 1S5IL 1C5DB 2CRIA 2BOCB 4J1UA 3KYMA 3MFGB 4AEIL 4UIKL 3HNVL 3PXJA 4L8BA 5FA3B 1LDPL 3TLRA 4HUWA 1K4CB 3MLSL 1JF5A 5T3ZL 3FOMA 3IDNB 3O9WB 1G7JA 2XKNB 5ESVB 4BFGA 3QXTA 3TBVA 2V7HA 2OR8A 2VC2H 3CFBA 4YFDB 3QRGL 3N1GC 1WFNA 3UYRH 4M1DL 3N85H 3RTQA 1YMMB 1YNTA 2O93L 2A9MH 3MV7B 1PYWA 1FV1A 3MROB 3VFOB 1F90H 4LU5H 1I1CA 4MA3B 5EIQA 2J5LC 1KGCD 5ACMA 5FYKH 4PJEB 1EVTC 1ZA3B 1LEGB 5JMOC 3WBDA 3O0RL 1J7VR 5IEHB 5BJTB 1FSKB 1XR9B 4KKAD 1A14H 4PGDB 2WZPD 4JN1H 3WMSA 2I9LB 3HA0A 3LKOA 1W72A 2AV7A 3RFZC 5GRVK 2VIRA 4NJ9H 3F62A 3O3DA 1FG2A 1WAAA 1IGFH 3VFGH 3O81A 2UUDH 2OJEB 2Y1VA 3ULVD 3MXVH 2I27N 1T5XA 2X4RB 3LS5L 5C07A 5IHZA 1FO0B 1U95A 1IAOA 1QFUH 3U7WH 3M8OH 1CBVH 3MLYL 3KS0J 1MJ7H 4U1LB 3RWEA 2BK8A 3QXUA 2KZ1B 4UDUB 4OLZH 3BGFC 3UPAA 3D3VD 4UZGA 4JRYE 1CZ8H 3TEUA 5JXED 4PRIE 5C0RH 1FFNB 2EDWA 4P5MB 5SWZD 3QIUB 2LQRA 3F58H 3TV3L 1KJMB 2YK1L 1NGPL 5I74C 3RVXC 3OKNA 2A6DA 4Z7NF 1MFEL 4I5BA 2VXQL 3ARDD 1EFXD 5I8KH 5IJKA 4TVPD 3FHQA 4XXDB 5EU6A 1DBKL 1FN4B 3NA9H 3CFJB 1PG7W 4FQQB 4MAYD 2XFXB 1MLBB 4W70A 3P73B 4HG4K 3E6FA 1YEJL 1AXSA 3S88H 2DM4A 2ENYA 1UACH 1CDHA 2XI9A 2LTQB 1FRGL 5C0BA 1BD2D 1EK3A 2Y7QB 5CS7A 4Z7UE 1CD9B 3BIKB 4UILH 1K8IA 1U8LB 5F9OL 1MHHA 3S5LB 2DICA 4ALAL 2JJUA 3V0AC 2EDEA 4UB0H 3FTGA 4MD0A 2QV2A 1Z0NA 4M7ZC 3RGVA 1M71A 5MEPA 3CXHK 5JHDB 3O4LD 5CILH 3G6AB 3TN0A 1Z0MA 3J7HA 2B8OT 1X4XA 2AI0H 3HR6A 3UAJD 4DCQA 4N8CL 2C1PA 2VLJA 2YOCA 5ACZA 5C71A 1QBMH 5IESL 1ZGLB 4LLUB 3TNNB 3O6LL 5E9DB 1TQCB 4JN2B 4P59L 2X4NB 1H3UA 4M5ZH 4J2XA 2W9DL 5LVEA 1ZT7B 2AGJH 1OQOA 4XPTH 1FLRL 4OBRA 3UX9B 4EUPH 1VFAB 3NAAH 2GJZB 1DDHA 3PGFL 5I1IH 5K93A 4L4TB 3VFVB 1RZIA 3MUY1 3EOTH 5F1IB 4D0DB 1F02I 1I9JH 2A77L 3FB5B 4K3DH 1I7TA 4YE4L 1E6OL 1CFSA 1NLDH 4YAQB 4ZPTA 4CN6A 4WHTA 3S35X 5A40E 4HULB 1U8NB 1TZHB 3DX6B 4P5TD 1F2XK 5FUZH 1A7RH 3B2UC 3QSKB 1ZEAL 1U8IB 2GTZB 3ME0A 2FNBA 5E2TH 1OY3B 3L3HB 5B8CC 1YECH 2PXYA 1EDQA 5BVJA 4APQB 2OR9H 5AUMA 4HMDA 5IROC 1ZS8A 4PRPD 3RIFF 4OT1H 5T33L 2ZOLB 3OXSA 4DN3L 2XACC 4D9RE 2R1WA 1TNNA 3W9EA 2BC4A 4XTRD 3NCJL 4M93C 4RGOH 5TDNA 1JWUA 1MOEA 4OZFH 3GMQA 4ETYA 3VD9A 5CBEA 3L1OL 1S7WA 1JHTB 2E7HA 4DOHB 1YN6B 1G0DA 2FJHA 2X9YA 4LCWD 4FQXB 4OSUH 2W0LA 2D7TL 4X99A 3D25B 1AD9B 3I6KB 1I9EA 2NXZC 3QUYD 3ULUD 1RUKH 4FQCL 1XH3A 5BOZG 4YGVB 3BO8A 3BIAX 3I6GA 2A6KB 4JFHD 3BUTA 3ULVF 1Q9WB 3G9VA 4GLRH 4UQ3B 1ZHLB 4YFEA 5KTEL 5FB8B 5DHXB 5FUOL 1UT9A 2F54E 1QYGL 1BFSA 1QSFA 3DX8A 3RZCB 4Z5RB 1QFPA 4C58B 4H0HB 4NNPH 4TSAH 5F7FA 1OP5H 1Q0XL 5L0QC 5F7EL 2X4OA 1MHPH 2XTJE 3VFTA 3C5JA 3GKZA 3WS6C 2IPUG 2ZUSA 1G9NL 3Q2CA 5F6HI 2ICWJ 2HLFD 2XTLA 1PQZB 4XNYH 3IJHA 4X7DC 3VXQB 3GSRA 2B0SH 3WFCH 4BELD 4NUGH 4YQXH 3QUZC 2N7AA 4QNPE 2EKSB 5FGBA 5ICXA 4U2ZA 2DMBA 4ZOAA 4NO0D 4PY7B 2V2WA 3V52L 1KYOJ 5HJ3A 3U48A 2XQYG 4X98B 5D5MB 3QCVL 3EZ8A 3RUGF 3L3OB 4I3SL 1E4KA 4UQ2A 3TT3H 4QWWC 4MD5B 1P7HL 1T20B 3VWKA 1KACB 1MCIA 4RGND 5EZOH 1UB6B 5L7XL 3C2SA 5DQ9B 4UNUA 3SE8H 4BH7A 2BOCA 4PGCA 5ADPL 2VABA 2NR6C 5FO8A 3PWLB 5FYLD 1H0DA 1PAMA 3DI3B 1QRNB 1IM3A 3JV4B 4BZ1H 2UYLB 4TTDC 2H2SD 2O5YL 3IDNA 3O9WA 1MWAL 5HHVL 2XKNA 4UOW1 2BRRL 4S1RL 3WHE1 4G6FB 4JFDE 4AENA 2VLRD 3ZKNC 1W8NA 2PKDA 3SBWC 1YMMA 5KSBE 1G7PB 5KVEL 5LWYH 3MV7A 3VFOA 3B83A 5T5FL 5D96C 5TDOA 4MA3A 4HX1B 1ADQH 4ZQKB 5DUML 1UJTA 3S3PA 1T7XA 5EFIA 3VFUA 2VLKA 5D1ZC 5IEHA 1FL3B 1KG0B 2IANB 3CLEL 1WWAX 4LIQL 4PGDA 4HS8L 4BZ2H 3JV0A 2AK4B 4JQVC 4MD4B 3FFCD 4N8PA 3T3PF 1RURL 3PQYD 5E00A 2OJEA 2XZQH 3NABH 3TVMB 1GGIH 1WIOA 2LAGB 3VGBA 4Y5VC 2NY6D 2X4RA 3S96B 1FO0A 2AJSL 1NCBL 3BP5A 4YHZH 2DI9A 4U1LA 1IAIH 2XQBL 2A83B 2ZG2A 4P99A 4C54A 2A74B 1J1OH 1QBLL 4Z95L 4UU9B 5C0ND 3RWGA 5HYJD 1DVFB 1XEDA 2DB8A 2QSCH 2CXKA 4P5MA 3VH8B 4JFPA 4PRDB 3VE0A 1NFIB 2WBJB 1KJMA 5ECJE 5DTFB 2Y5EA 3UBXI 3UTSB 4PLOB 1LEIB 4LSRH 4XXDA 5HDQH 1ZLSH 2EIEA 1A7PL 1AO7D 3CFJA 3QWOB 4NDMB 2DBLL 2VQ1B 1OB1B 1ORSB 1Q9KA 1ZGLP 2AXFB 4KJPC 3DXAE 3ULUF 2R2HA 4R90H 5DZNA 1U3YA 1JZ8A 5CAYB 4GBXA 3MRMB 5D70L 3MRCA 4OAWA 3SDYL 4LCIL 1JNNL 4V2CB 4PJAB 4ELME 3GSWA 2GJ6D 3HC4H 2Y7QA 1BFVL 3BIKA 2J6EL 1U8LA 3BUYB 5EC2A 1ZLVK 4I18C 1JGUH 3S5LA 4M8QB 2DS4A 4HEPG 4HUVB 5JR1H 4GRWH 4HJ0D 1IGYB 3EAKA 3UBXG 4BQBA 1FH5H 3O8XD 5JOEA 2FX9H 2JIXB 3VXSD 2D3VA 4G80B 4RX4A 1KCUL 2IWGA 4JLRA 2R69H 4IRZL 3B5HA 2VOTA 4PLJC 5I17B 4M43H 5I2IB 4K7FB 4IS6B 4LLUA 5BS0D 4Z0BH 1ZLWK 4JN2A 3IDYC 1DBJL 4FQLL 1GL4B 4R0LB 1ZT7A 3EO9H 1BIIB 2QQKH 1Q72L 4RA0C 5JW4M 4KUCD 3I75B 2WQRA 5DMIL 5C08B 4NRYA 4U49A 2R1YA 5F1IA 3VDAA 3ZDXE 2OCFD 1BWMA 2GI7A 4J12A 4PY8I 4HWEH 4YAQA 2EE3A 5CGMA 4PREB 1VKXA 4OZHF 4WTZG 1U3HA 1JI1A 5KW9H 3O4OB 2F5AH 2VZUA 3NPSC 4KDTC 3L3HA 4JPWL 3GHBL 4APQA 4EDWL 1A2YA 4RA3A 5I1CL 1GZQB 1IFHH 4YDLC 1N64L 1D5IL 4ZAKB 3C08L 1VPOH 4NQDB 1QKZL 32C2A 4GAYA 4N0UB 4QF1B 2AK1H 2PW2A 3TYGH 1OM3H 1X5ZA 3G08A 5A3ID 1UCTA 3D18A 5SWSB 4LP4A 1F3JB 4KRPD 4P48A 3RDTA 1CD1B 5GGUB 2QJDA 4XPGH 4XPHH 3BP4B 1JHTA 4I0PD 1DUZB 1YN6A 4FQXA 1XAUA 4I9WE 2H1PL 4A2MA 4ODHL 2HTKC 4L3EE 4XVTH 5FV1L 3WIIL 1LWRA 1AD9A 3DO3A 5TQ2L 5JORA 3OF6A 2XN9E 3V6ZB 2XWJB 4OLVL 2WSKA 3QIWA 1QFWM 4YGVA 3SEPA 3QEQB 4K8RD 3B2VL 3BDXA 2A6KA 4FFYL 5I71C 5IUSA 1Q9WA 1TQBB 1WWCA 3ARED 1ZHLA 5JUEL 1PBYA 1FVCB 4CMMB 4LKXB 1VFUA 3LCYA 1OCWL 2IAMD 3VCLB 2FIKB 1UM5H 4Z5RA 3S3JA 4XCCH 3U83A 4PJXF 1SVCP 4JY4A 3K2UH 1T0MB 2ADFH 3SE3A 5IVXB 2J8UB 4O00A 5T1DH 2C1OB 4XMPL 3GK8H 1H9VA 3VXQA 2EXWC 4KJWD 3TZVB 1CGSH 2EKSA 3LS4L 5HGGS 2ZPKL 2Q3AA 4PY7A 2E6JA 4PBVC 4F9PA 1ZE3C 4P46D 2R4RH 4I48B 5GS0L 1MNUH 4X98A 4JANB 5D5MA 5DF0A 4O5LL 4MAYC 4P4KD 5C0CD 3MCLL 5FFLA 3HC3L 4YZFF 1F6FB 3MV9B 4RGMC 4NUJB 4BSVB 3LD8B 3C5ZD 3IB4A 1GC1H 1MPAH 1Q9LB 4D9QE 5JW3L 2ICEA 3MSPA 5DQ9A 4L29B 4NQSA 4G7YL 3MC0A 1S7RB 1HSAA 2A0LC 4B7IA 4NNXB 4M6OH 5F6IB 4K3EL 1RULL 3AB0C 1IZJA 4TSCH 3LEVL 1QRNA 1NANI 3JV4A 1N4XL 2FIRT 2UYLA 3FMGH 4LAJH 4KAQL 1YZZA 3T4AB 2HJFA 1NCDL 1RAMA 4JG0L 4FXGB 1AXTH 4Y4FD 5DI8B 3WXWL 3THMH 1V7NL 3V0WL 1F3DH 4NQCB 3KGRA 2CJUH 4QXUL 4G8GD 3RPIB 4D2NA 5FYKE 1TZGH 2WP3T 4KVNL 1NDMB 1HZHL 4KUCF 1J8HD 4JHBA 1O0VA 1A3QA 4JM2D 2H32H 1NAMH 3KYKH 4HIHB 1WITA 5TPWH 4FTVE 4P4RB 1YEEH 5IMMB 4RISH 1FL3A 1T89A 2DTSA 4WCYL 5E6IB 2W60B 3G5YB 5GS1A 5GGSA 4MDIB 4MWFB 1P4IL 4JFYB 2ZUQC 2NYYC 4R3SA 6CGTA 2AK4A 1OSPH 4MD4A 5IHUL 3H3BC 4PRHB 3UTQB 2V2TB 4X6DE 2AABL 1JPTH 3F7PC 1I1YB 3T0EB 3TVMA 1MWAB 1NMAH 4IIQA 1SEQH 4P5TC 4PB9H 1U92B 4LF3B 4DJMA 3QISA 2R8SL 3CFKB 4N9GB 1AHWA 4P3CH 2I5YL 4WEUD 2A83A 4YWGL 3FT2A 4UU9A 4OQ1A 1B0RA 3P30L 4Y4KB 4O2EB 3GNMH 1GHFH 5ICZB 5K33A 3LMJL 2NLJA 2VL5B 4BQ8A 4FS0A 5EU3B 1UZ6F 4QXTB 5L8LB 3IAPA 2E9IA 4X4XA 4ODVL 3VG0L 4HFWA 3Q1SH 3QWOA 4NDMA 3QQ4B 5E70A 4GXUM 4ZXBB 4WI9A 4J4PD 2AXFA 2HVJA 3V4VL 5IJVB 3HZKB 3P77B 3STZA 2VKXA 3IKKA 4HV8B 5GIRB 3MXWL 2MPAL 4XRCB 3VJ6B 4PJAA 4MLSA 2B1HH 1DBBH 3TA3C 1CDBA 2EECA 2XXCB 4OKDA 4DTGH 3AFLA 2GITB 2P8LB 3BUYA 3V79C 3CU7A 3BPLC 3FHAA 4M8QA 4JQXC 2CK0H 1J0YA 1CXFA 4M4PA 3H8NA 4MJ5B 1IGYA 4R97B 2BVQB 2GQHA 2LVCA 4P57B 3QI9B 4QOKE 1KF9B 2CRMA 2NY7L 1Z9SA 1F42A 2BX5A 4Y16A 4G80A 1VGEL 3KYOB 2VL4A 3QO0A 3BSZH 4Q9QH 1VFOA 2J2ZA 2XRAH 5D93B 5I2IA 4K7FA 5FECB 4D94A 5CMAB 1RZ8A 4WY7H 2H8PB 2XPGB 3O3EA 1BIIA 3OKLB 4LLYB 5ICYB 5I15H 1OSZB 2RCSL 4JJ5A 4ONGH 5C08A 2DQDH 1C5BL 1OAZH 2EE9A 1FAIH 3RKPA 1YY9C 3WD5H 1QFWI 3UO1H 4D9LH 3AM8C 4PV9B 1EBAA 4PJGA 3SDCC 1DQLH 3D48R 4LVHC 2VDKH 3S35L 3AMLA 3U9PL 3ZT5A 2EEDA 2NX5D 1BBDH 5GQBA 1ERNA 3CFCH 3VGEA 2F58L 1T2QL 1HINH 1T1WB 4M48H 4YXKL 1MFDL 3MRDB 3VFSA 2DQTL 3NFSH 5HVFB 3OZ9H 3TO4C 1IILE 4N0UA 4QF1A 5DJZB 2X6MA 3GFUA 2D7NA 4U6VL 1T1XB 5ESAB 5SWSA 1A6AB 4GRLD 1S7TA 4JM2F 5E4EC 2P5EB 2W9EH 4RMSA 1KIUA 5GGUA 5E8PA 3IDMB 3HUJF 3GMPB 1NH6A 4PJ8B 4JFED 3CZFB 3UTTA 4K2UH 2GCYA 3MYJB 1KN2H 5EIVA 4U3XA 1RZKL 2IALB 4FZEL 3AS3A 2XWJA 1FCGA 3MJ9H 4FMFA 4KMTL 1EZVY 1UKSA 1FPTH 4IMLA 4DZBB 3ARXA 2X70B 3BVNB 4U6YB 1FVCA 3QEUB 4LASL 2ICCA 3RTQD 4F7TB 1P4BH 2VDMH 1RIVL 2VO5A 3CVHL 4WGVB 5KZCD 1I8MB 3FFDB 3EHBC 3QEHB 1T0MA 1NC4A 2Q8AH 5IVXA 5FM8A 3LN5A 1VADB 5DA0B 3QDGB 4JRXB 3QXAB 4MXVF 3HG1B 4AM0B 3NBNA 4M61B 1GOHA 4J7RA 4UTBH 1RIUL 3RRQA 3TZVA 3JSSA 5TFSL 3TT1H 3CH8A 1J0ZA 2ERJC 4Y1AE 4X7TB 4YIQB 2UUDK 4O58L 4MNGE 4DEPC 5F3BB 2CMRL 4QTHB 1Y0LA 2WBWB 1WFOA 4LOUD 4ZTPL 4XCEA 3MACL 4ZS6D 5C07D 2QLVB 4RMTA 5EN2B 5EOQH 4PJIF 4V1DB 2DQHL 1MUJA 3PWPD 4H0GA 1RHFA 1K5NA 3MPCA 1SM3L 3UDWA 2DQCL 2DLFL 1AQDB 3U0PB 1Q9LA 4XNUL 3ZDYE 2B5IB 4JO3H 4HUUB 3DRTB 5IGXL 5IB4B 3H7BB 2AERT 5GJSL 4L9LC 4HJ0C 3O6FA 5EU6D 2YZ1A 5CUSL 3CH1B 4GO6B 3O8XC 3GMNB 2FSEB 4ODSL 3T4AA 1WBZB 1F00I 3C8KA 5DI8A 2FEEI 4NRZA 3TP4A 3OKEA 4MAUH 4NQCA 2DJUA 1QO3B 3RPIA 1BVLA 1TITA 4DZ8A 2QADC 1MREL 3O2DL 4FNLL 5BRZB 1GOGA 3VRLE 2YXMA 3C8DA 2YC1A 4R6UA 5C0BD 1EPFA 4XWOC 1V05A 25C8H 4KROB 4HIHA 4PJCB 4P4RA 4JHWH 5E6IA 3A0OA 3G5YA 3RGVD 5H35B 4EBQL 4RAUB 3H3KA 1O7VA 4LVOB 4MWFA 4J23A 1WVZA 1PG7X 4JFYA 1J86A 5K9KB 1QFWL 3FRPA 1CFVL 3I85A 2UZXB 2IQ9L 3ZE1E 5BV7H 3UTQA 2IADB 5GRVL 2V2TA 4U1IB 3T0VA 4XHJD 4POZD 1GGUA 1I1AC 4ONFH 3T0EA 3WJJA 1MWAA 4FQJH 2VLJD 2G75A 2DRUA 1A5FL 4LF3A 4ZPVA 5DRXB 3CFKA 3ULSB 4D0BA 1I7UA 1CLOH 4LSSH 3KPMA 3KLHD 3MNWA 4WWKB 5CP7B 1BGXL 5T3XE 4Y4KA 4GAGL 3HB3C 5E8EA 5JZ7D 4O51B 5DVMA 1U0QA 3BMWA 3VRJB 3EO1B 2V5SA 5EBMB 4QXTA 5LXGH 3BFOA 2EEAA 5A3IC 2BCKA 4LSUL 5JPNB 2FEDC 3TWCH 3B9KC 4JO2L 1K85A 4ZS7L 4KRPC 5CBAB 3NIGE 4ZXBA 1LK2B 1A7QL 5DVLA 1GJIA 4Z7OE 3HZKA 4CMHB 4XI5D 2APFA 1DBAH 2AEPH 4HV8A 2PXYD 4YC2B 2J12B 1LEKB 3WLWC 3HE7A 4G8FB 3IDUA 2MJWA 5E99H 2HA1A 2GITA 5I8OH 3WNNA 1ZTXL 3HE6B 1DFBH 4PRBA 3MLWL 2YD6A 1ZSDA 4LPWA 4MJ5A 4RSVA 5GHWH 5D1QC 4ZO6A 3IFPA 2Y36H 5D7LB 4NZRH 1AFVL 3BKYL 1NGQL 2ZCHL 5E94B 5HHNB 2ZUYA 1XF3B 4XVJH 4KMLB 2PN5A 2Y6SC 3GBMH 5CD5D 5F6HJ 3N50A 12E8H 3GJEB 2VWEC 1TDQA 4Y5XA 3BX7C 4U6XA 3KJ6H 1JI2A 4F7MB 4NQUA 4KTYA 2J4WH 1MCWW 4H88L 4IEFB 2P8MA 4NQXB 4KJWC 2H8PA 3SDDA 2XPGA 3BPOB 3OKLA 1FC2D 4LLYA 1G6VK 4AIXA 1XFPA 4G9DA 4R7NB 4LQFH 4PJDB 4WEMB 4HIIB 3GHEL 3IXTA 3TCLA 2J6EA 4S2SB 4CDHA 4MA7H 1QSFD 4HPOH 5FYJD 1OP5K 1QR1B 3NH7H 1U6AL 4XC1H 5ISZE 4XP5H 5F88A 3VGFA 3WN5C 5J11B 3ZE2E 1KIQA 1KB9K 5FA4B 3HAEB 2XZZA 5GISL 1EJ6A 1I1RA 4NWUH 3DARA 1YEKH 5EU5B 1C7TA 1EGJL 4HIEB 4IDLA 4JPIB 4AL8H 2JKXA 5CEYB 4I1NB 1T1WA 1MHEB 1YEGL 1P84K 3PXHA 1NBYB 5I0DA 4NCDA 5TDPB 1KIRB 3RL2B 3MRHB 2RGSA 1MCNA 2EH8H 3A6CH 1P9MA 1CU4H 1T1XA 5ESAA 1A6AA 4IDJH 4N0FB 2IPTH 1MFAH 4YHYC 4ZMAT 3SY0B 3VWKD 5DD1L 1D5ZA 4XCFH 3CZFA 1KCSL 4NJAL 1MAKA 3MYJA 1IC7L 4OGYH 1FYTE 2KL6A 2OLDA 2ED9A 1MIEH 1R3LB 3NTCL 5EO9A 3O9WD 2W38A 4PR5B 4CKVX 3SO3B 4TNWF 3TYFA 4KGLA 3IDXL 2X70A 4U6YA 3QEUA 3LEXA 1D6VH 2EDQA 5ELIA 1YMMD 4F7TA 1KTLB 3P9MB 4CJ1A 2Z35A 3OJDB 1RK0B 3MV7D 1I8MA 3FFDA 3QFJB 4ZSOB 3IFOB 4MA1B 4TSBH 3DRQB 2CLRB 3VXUE 1KUMA 3R1GH 3QDGA 3QXAA 2XKSA 4TPRL 4AM0A 2C3VB 2DD8H 3CFEB 2ED8A 2C3XA 3EZJB 2ICES 2OTWA 2VXUL 2XWBA 1UB5B 2JB5L 5CFHA 4PJ9C 2EDJA 4MXWL 1E4XI 4ZD3L 1Y6KR 1BVZA 3GI9H 4G6KH 4X4ZA 4UBDC 4LAQL 3C60C 1JYXA 1DN0B 3GMOB 3BD4A 1EEUA 5EN2A 2OL3L 1OVZA 3KNBB 4GQ9H 3OR7A 4V1DA 1CFTB 2PYFB 4N0CD 1PZ5A 1B4JH 1AGBA 1LO2L 2A38A 2FB4H 3U0PA 3ZE0F 4EN3C 4HUUA 1UWGL 1XR8A 3L3GA 4DVBB 2KKQA 5IB4A 4CU6A 4I4WA 2IEPA 3ARFC 1PKOA 1DEEB 5CZVH 2DLEA 4XP9L 3I50L 2IFGA 3MJGX 4EI5B 5EUOB 3B8SA 5LQBL 5EPMB 3GMNA 5T1LA 1ETZA 1GH7A 2ZNXA 4KK8D 3O11B 1E27A 5K9QI 4GBXD 3WFEL 4HLZG 3WDIA 1P7QA 1GAFL 4JQIL 5BRZA 3T1FB 3VFRB 2X09A 4OLYL 5L2KE 2AEQL 4HD9A 2HH0H 2XNAB 4K23L 4LHQB 4TUJA 4ZUTB 4PJCA 5I0ZA 4U1GC 2NXYC 2R0LH 4H1LB 3QO1B 3RI5F 5E08H 5T5NF 3QWQB 4RAUA 5FO9B 4M62L 5I19L 3X17A 4PY8J 5K9KA 3GIVB 5HPMB 3N06B 4U1IA 1QBAA 4RX4D 3DIFB 4QKXB 4Q74A 5T1KB 5IEKA 3MLPA 1KJVA 3F8UB 5AYUL 2R1XB 3GSNB 3NIDF 5BXFA 2DMCA 4CVZB 2H41A 3VG9C 4OZGB 3SO5A 3GRWH 3CC5B 4JHAH 4MQXD 2DYPB 4NGHH 3HRZB 4WWKA 4N5UA 4Y5YB 4YBLB 4R96B 4R7DB 4QHKJ 1EEYB 3DROA 3VRIB 1AH1A 1RJYA 2R56H 1DCLA 4NFDA 4DGIL 3SCMA 4LSVL 3EO1A 3BI9X 5EBMA 2E8ZA 4XPAL 5JPNA 2NPLX 5HHOB 3KPLB 5CBAA 1NBVH 1U3HD 1SY6A 1QSEA 4YPJA 3V5HB 2HT2D 1OAUH 2BERA 3MBEB 1G7LA 3FB8B 4APQD 4GKSA 4JM4H 2R4SH 3FONB 3QQ9D 2DBJA 4G8FA 3OB0H 4OZIB 1N8ZB 3BKJH 1R24A 3HE6A 1ITCA 4GSDL 4WUKH 1U8OB 1FZKB 4JGMA 1CL7L 4Y4HC 1EMTL 3K81A 5DD6B 3EYQC 5E94A 3QP3A 3VXNB 1LQSR 3RDTD 2VXVH 4LKCA 5IB2B 1XF3A 4ISVB 1HQRB 3D69A 3SDXB 3WNPA 3HZVB 4KJYB 3GBNL 1FE8H 4YEFA 3WO4C 1SMOA 3GJEA 1A6ZA 2N4IA 4KHTH 4FQXD 4OM1H 1ZXQA 3DNKA 1P5VA 1DBMH 3OL2A 4FQ2H 2ITCB 3OF6D 3QIWD 1IKNC 4NQXA 3WIFB 2VZ1A 3QCUL 1E4XL 4LVNB 3P4OB 1D9KB 3MLVL 1UWXH 2CSPA 4PJDA 3GJFB 3K8KA 4S2SA 1CCZA 3RZCD 1V7ML 2QL1A 2E8YA 3ULVE 3Q6FA 4FFVC 4WWID 4NFCA 5E5RB 1PDKA 2VISA 1UFUA 3PWJB 3HAEA 4Q97A 1WV7T 1EHLH 4G9FB 4E5XB 5EIIB 3MLTA 3DTXB 4JPIA 5CEYA 3GIZH 4WU5B 4ZFFA 5C70A 1JRHH 4DUWA 4HGWB 4JFOB 1BFTA 4E41B 3MRBB 3RP1A 1NBYA 5H2BB 4M93B 1KIRA 3D0LA 3MRHA 4ZO7A 3MRLB 1EO5A 2NY3C 4NSKB 2X1OA 3JZ7A 4MCYB 5D7SL 5HGBB 3SY0A 4OGXL 2BSED 4M5YH 3RUGE 2EDLA 2OK0H 3U36B 1RVFL 4MNHA 3ARSA 3BE1H 1BD2E 2YKLL 1NEZG 4KTEL 4TVPL 5DRNB 5HXMA 2KQNA 5SWQB 1AY1L 4F7PB 4Y19B 5CLTA 1QRND 2FHBA 5JNYB 4IRJC 5EBWB 2NZIA 4PR5A 4G6FD 2CK2A 1NGYB 4XH2A 3B3IA 4M7LH 5IR1A 5IB5B 5I1DA 3P9MA 4W6XB 5GZNC 4KZDH 2P45B 1RK0A 1INEL 1RU9L 3MRGB 1GGTA 2NY1B 3QFJA 4ZSOA 3IFOA 3KWWA 1OTUC 5H37G 1TCRB 1BX2B 2UWEE 5IB3A 3I2CL 4KHXH 2CDGB 5IBTH 5DURB 1G1YA 2C3VA 4LLDB 1UH3A 3PNWA 1U3JA 4I2XE 4QRTB 2IAND 5I1KH 3QIBB 3ILQC 5JOFB 1T83A 1GC1C 3JVGC 5I8CB 1FZOB 1MRCL 1UB5A 1T0NB 2AK4D 2FWOB 5C0EB 4RIRA 4GRMB 3U82B 5T3ZD 1EO8H 3TVMD 5E95B 3WSQH 1SVZA 3IJYB 1DN0A 4WUUA 1T7WA 3QCTL 3T3PE 5IHBA 4O2FB 4MA8L 1UJ3C 1ZT4B 4WW1B 2PTTB 1F13A 3CVHA 3HMXA 3FRUA 3P9LB 4MDJB 3TJEL 3X13B 4DVBA 3MRJA 4P2OC 5EORH 3V6OC 3CDGB 4LCUB 4KU1A 1HOCB 1L7IH 5AG8A 4KH2A 4MSWA 4OCWL 4EI5A 4OCYH 3O6KL 5EPMA 1M4KA 3MRIB 4JPKH 3O11A 4JDTL 2HWZL 4F7CA 3CNKA 1MELA 5GGRB 1U2HA 4I0CC 5F21B 1JZ4A 5I1EH 4LCWE 4S11A 3RY4A 2OSLB 3VFRA 4DKFL 4WI5A 5C2BL 4LCCC 1U8QB 1QLEL 3ULUE 2WUBH 3BP7B 3QUMB 4DW2H 4KK5D 4JFHE 1NMCC 4J3WA 5I1HL 2YD9A 3KR3H 4H1LA 3WFBH 4ESKA 3QO1A 1FL5B 5EWIL 4XPFL 5JOPD 5A2FA 3NZ8B 1TCMA 4JR9L 4TYUA 4PLKD 4UUJA 3NPZB 4PJFB 4JRYB 3GIVA 4K07A 1PG7L 5HPMA 5D2NE 4PRIB 1KJ2L 4HT1L 4Y5VB 4Y16D 3L3KB 4ONHB 3LY6A 1MI5B 2OI9B 5GGVL 2DQIL 3HN3A 1HH9B 1GYAA 5AWNH 5FM5M 4Q58C 1EAPA 1A9BB 3MUHL 1HH6B 3GSNA 4W6WB 3AAZB 2JJSC 4CVZA 3G6DH 1AR1D 4WFGE 4OZGA 5BVPL 2X4SB 3IU4L 1VHPA 2YBRB 5C0JB 2DYPA 4OKVA 4NO3B 1FGVL 5D5MF 1D5MB 1HKLL 2ZJSH 4R96A 3CX5K 1RUQH 3O2DA 5FGBC 5DQDL 1EEYA 5C08D 3W81A 1FFOB 1YYLL 5ITFB 4LEXL 1AI1H 3EYFA 2ARJB 1HNGA 5MEQB 1BF8A 5HHOA 2RB8A 3ZL4L 1R6VA 1NGZB 3KPLA 4HBCH 3ABZA 3HCVA 3SGEI 2XV6B 2MKWA 3BD3A 4CAGA 2UVFA 3VWKC 4UOW0 1JGVL 3V5HA 2P5WE 3HI5H 2A1WH 3MBEA 2D0HA 5EO0B 1Q94B 3FB8A 3OPZH 3I02A 5CWSB 5GRJH 2WNGA 3FONA 4I18B 4OF7A 5FYLE 1TJHH 1KB5L 1N8ZA 3GEWB 3NZHH 2LABA 1UYWH 3O9WC 5AYQA 5D8JL 1U8OA 2F8VA 4KQ4L 1FZKA 5E8OB 3IETA 2JJVA 5SWSD 4RFOH 4DAGH 4GH7B 4G6MH 4RCAA 5DD6A 3RJQB 3MRFB 3VXNA 4DQOH 1NCCH 4ISVA 1HQRA 3HZVA 1G84A 3MMEB 4GMSH 2OJZH 5HI4C 5HPOA 4XAKE 2BHYA 4YHIB 5D2LA 3UTTD 4X6BB 2NZ9C 2FCBA 2YEZB 2OXGA 3V5DA 4XNZC 1MAJA 2P8PB 4NBXB 2OTPA 2ITCA 4D0CB 2ZNWA 1X9QA 1KBGH 4JB9H 1CXEA 3ZYZA 1H3GA 1RIHH 1ZLUH 3WIHH 3X11B 1BWWA 2VLME 5IVNA 3P4OA 3KS0H 1JGEB 5I30H 3FFCE 3L3IB 4F7EA 3FO9A 3RWCB 3PQYE 3EJJX 1IAIM 5D7IE 3CU1A 5D1XC 5CHNB 3NFPB 2E27H 3QZWB 1U2CA 1NC4D 2ZUXA 3NPSB 3PWJA 4J6RL 5B8CA 5JIIA 4G9FA 4E5XA 4PJXE 5EIIA 5IROA 4ERSH 5HYJE 4O02L 1YQVH 2RHEA 3DTXA 1AE6H 3E3QC 3TZVD 3QIUC 4WU5A 2Z8WC 3EYVA 1AP2A 1CLZL 1PY4A 4I3GA 4E41A 4PV8B 1GIGL 5LBSH 1T3FB 1JGLH 4OCXL 5KG9A 3S9DB 1LGVA 3UJJL 2AEWA 4HC1H 4PJAF 1CTOA