4P3CH

Mt1-mmp:fab complex (form i)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy Chain Fab fragment of antibody LEM-2/15
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH01
2HRPL 2OJZH 35C8L 4NBXB 1S7RA 4JPVH 3KPSA 1IKFH 4R3SA 2J3SA 4WTXA 1EHLH 1H5BB 4Y5VC 3MRKB 3BH9B 3BP7B 5EU6A 3EZJB 1BBJB 3VRIA 4MA8L 2WZPD 1SYVA 1UFUA 1PDKA 4HD9A 4O9HL 1T7VA 1NFDB 3V4UH 3PL6B 4KI5D 4OCXL 1BZ7A 3CDYA 2Z31A 3TYGL 4CMMA 4JY6B 1FFQA 2VWEE 1Y0LB 2APVA 1MCHA 5TE7H 2B1HH 5CBAA 4GS7B 5IV2A 1A3QA 3VWJB 3SDXF 5IBLD 1CFTB 2VE6A 5IBUB 4WFGD 2YZ1A 1SYSB 2MFNA 3MGTB 4XPGH 1AIFB 1QFHA 3T0VA 2OK0H 3FQTA 2WBJB 4QF1A 3VXMB 3HCVA 4ONOA 4YUEH 4H20H 1OAZH 4RNRB 1G7HB 4LAQH 4WU5A 3HMXA 5DC0A 2E6PA 5IIEB 5IW6B 4H0IA 4F2MA 4LP4A 4UZGA 2V17L 3QXWA 1J05B 4KPHL 4G6FD 3U9PH 3AY4C 5C92A 1A7OL 2BERA 3G6DL 3JUZA 3HI6H 1BD2E 2KQNA 4F7MA 2ZP0T 1S7QB 1UC6A 1GL4B 2X7LA 3MCLL 5CHNB 4WEBH 2X70A 3KS0J 4JO2L 1C5DB 2A6IA 3OX8B 4LF3B 3BIBX 3PWLB 3TH2T 1UWXH 4HV8B 4K7PY 4ODWA 4KK8C 1SJXA 3B9VA 4LU5L 1FL3A 4LGPB 2X9YA 5I1DA 4L8DA 4O5LL 1LP9E 5FUCE 2NLJB 3L3HA 5F71A 2BXZA 1U8JA 4X7DC 3MLRH 3ARGC 1N7MH 4IOIB 5DF0A 2QQNH 3O4OB 4CN6A 1U8LA 3OAUH 3AM8C 4PJ7E 3MRCA 1T5XA 1NCWH 3WNOA 3TZVC 4JO1L 3ARXA 4FABL 1MJJB 2IEPA 1F90L 1IGTA 3AAZA 3D3VD 4K8RD 5EOQL 5ERWA 4ELME 1VGKA 3MLWH 3S97C 5C09E 3KDMB 4Z7VA 2WIIB 3TBYA 1C12A 2NYYD 3GHBH 2XKUA 1NAMH 1Z9OA 2FIKA 3AU1A 3PWPD 1YYMH 5DC9B 4U1NA 3ARFA 3DMMA 5D71L 1T80A 4X6BA 1R5IB 5CEZH 5J12C 2IADB 4QHNB 1J1PH 3CCHB 1B0WA 1LD9B 3A6BL 3P77A 1S9YB 3QEQB 1IARB 5I73C 5K59F 2O5YL 3TA3B 4GW1A 4NQVB 2WWKO 2M2DA 3WJJA 1LQSR 4KRNA 1S9VB 1N5YL 1CFSA 1VEOA 3W2DL 1CN4A 2DDQL 4MD4A 4WI6A 4MWFB 1TIUA 5C07B 2H2SC 5FYJL 2CIKB 2NY1B 1QZ1A 2P4AB 3KYMA 3O8XC 4F15B 2CDGA 3HAEB 4V1DA 1CDHA 1HNGA 4U6VH 1X4ZA 3TIEB 2WK2A 3SE3C 5GQBA 4J6RH 5AYUH 1FVEA 3S5LB 4MA7L 4FQLL 1OL0A 4KTEL 1I7UA 4MJ4A 1SEQH 4F58H 3NIGF 2V7HA 4KK9D 3P4NA 3WKMH 1JZ6A 4EN3C 3BVNB 5FM5O 1IEHA 4FFWD 2BVPB 4JM2F 3OJMB 1HHGA 2CR6A 3RUGF 3ZYZA 3EO0B 4OIBA 3V7AE 3UTTB 3T3PF 1FVCA 4BQBA 1LO5B 5LVEA 1DBBL 2FD6L 2C3XA 1MCOL 5IM7A 4HKJB 3MZGB 1RMFH 1YMHA 2FEDD 1RIHH 3ARYA 3LEXB 5IMOB 2VDLL 4HIJB 3Q3GA 1FQ9C 4RGMC 1YNTB 5FYLL 1MI5E 2IQ9L 1WITA 3SKMA 5C0AA 2GSIA 1HOCB 1OAUH 4PP2A 2HKHH 4FQXB 3W9DA 1IBGL 5I71C 3QIWC 5GS0D 3FONB 2BVQA 3RNKB 4TQEL 1H3PL 4HAGA 3QULA 1JNNH 3GSNA 4Y1AA 4GG6E 5L6YH 1RJZA 2QADD 3FQNB 4MVBD 1RHFA 2FX7L 3WDHA 5DS8B 3X14B 5SV3A 2NX5B 4X8XA 1RIUH 2PKDA 1IZKA 4U1LB 1UVQB 5CEYB 4PBVC 2VZ3A 1U2HA 4Y5YB 1AXSB 3RQ3A 3FO2A 5I19L 4M7ZB 4AT6B 3VFVB 5E7FA 4ZSOE 2LTQC 2DS4A 4AYFA 2GTZB 1OGAA 4OBSA 2BHZA 5EN2A 1EVTC 2VDQH 1JTOA 1N8ZB 2A77L 4MLSA 4OBRA 4NRXB 4OZFG 2FJFB 3ZDZE 3QT2A 1X5LA 1AGBA 1WK0A 1LGVA 4GOSA 2EIZB 4GW4B 3GMLB 4G9FB 3SCMD 4YHYC 1XR9B 3PGCB 4JB9L 2NY2C 2HFTA 2X4RA 4MB3A 1A4JB 4NC1E 4OZHA 1ADQL 1RFDL 1JGUH 3TJHD 4G8GD 1B2WH 4IRSD 1IFHH 1J88A 1GGBH 3QUZD 3NMEA 5JW4N 3IJYA 4HT1L 2KUTA 4JFDA 2ITCB 3VMNA 5KBNC 1QRND 2MPAH 4HWNA 3EHBD 3D9AH 4FXGB 3F7YB 2CMRL 2BNQD 3LHPL 5JO5B 4HUXB 5B3JE 3VH8B 3PABA 3QCUH 5E2WH 2VXQL 1KPVA 4LVNC 4YGVA 3DOSA 3P9LA 4XVTL 4I0PB 3L5IA 3L3DB 4HFWA 4Z7WA 1CICB 1T7WA 3LS5L 4EUPB 1Q9OB 3EFFB 4IS6A 32C2A 3S37X 3HR5B 1OQXA 5IFHL 1Z6JT 2VKWA 5J06A 1WCQA 4LAJH 1GGIL 3STBA 1AQKH 1MFBH 2BRQA 3ZDXE 2MNUA 4X5WB 2GAZB 3O2VH 3GUTA 2KH2B 1JI1A 1BFSA 3MMEB 4D0CA 3KXFD 2YD9A 1OGTB 4LSPL 2VUOA 2E27L 4I18C 1L0QA 2IGFL 3QI9D 5B39B 4WUKL 4YZFF 3B9KD 5J1SC 5DRXB 3RBGA 4HKBB 2Y7QA 4DTGL 1F4YH 4X6EB 1HXYB 3OAZH 3B2UD 4PYHA 1OAXL 1H3TA 4MDJB 1MAKA 1U8NA 1HILB 5F88A 3ZYJA 2JJSC 2NXZC 4PJGF 3SQBA 3MR9A 1NMAH 3V5HB 3PWVB 2GQHA 4MNHB 2NTSP 2CLVB 2ATKB 4GSDL 3VXOB 1ZANH 3BW9B 5FGBA 1GYAA 1N6QH 2XWTB 3LQAH 1HYRC 1IGJA 1DN0A 4Y19A 1CLZL 4MSWB 2AAVA 4ZD3L 1CD8A 2C7UB 2EYSB 3ARZA 2NCMA 1RJCA 4M62H 4K9EH 1BM3H 4WI3A 4Y4HB 2D9QB 2MHAA 4NQDD 5TE6H 3QQ3A 3KNBB 4OZFA 3QPXH 3JV6A 2ILLA 3QUYD 3BPNC 4L8CA 4QRRD 4P4RA 1DQMH 3MGOB 5DD0H 3ULUC 3MLTB 4YC2C 1QFPA 2WNGA 3H9ZA 4AJ0A 3I3EA 5I75B 5I76B 1U8IB 5F9DC 1QSFB 1MRDH 2G75B 3C60A 3O6LH 3SKOA 3FB5A 3IDGA 3CFCL 1VADB 3RGHA 3BIKA 3RZCC 5HJ3A 4G6AD 1UB5A 2VH5L 3AXLB 5GJTL 4ZXBC 1RK0B 4KDWA 3OJ2C 3LB6D 2R1XA 5I8OH 4PGDB 3EOYG 3OKDB 1WIOA 2VQ1A 1I7RB 5C7XH 1FV1B 1H9VA 2JF1A 4P46C 1JYWA 1IKNC 5DMIL 4JFQB 1V3KA 2V9QA 4HZAA 4HS6A 1B0GA 4OLVH 3BXNB 5E6ID 1DUZA 3DUSB 4JLRA 2BY0A 4OQTH 4Z7UF 1AP2A 4JRXD 3UTOA 4NUGL 1KJ2A 1GGUA 5GS3A 4JZOA 4YAQB 3HZMA 4KDVA 1G9MH 1BREA 2XQBL 1IT9H 4XNXH 1F8TL 2J6EA 4I48B 1U41A 2EYTA 3FCTA 4PGZA 4JFXA 1BVLB 1M6OB 2E9BA 5DK2B 2VDKH 3W5NA 2DTMH 3HZVA 4AL8H 3RY6A 2HKFL 4ZOCA 3T2OA 5F9WB 4FQQA 1SM3H 5F1NB 4JHBA 3VFPA 3QDGE 5GIRA 1QR1B 1JPTH 1U0QA 2HRPH 35C8H 2XY2A 4PJDA 5D5MF 4FQPA 1IAIL 2UVFA 4HUWB 3P0VL 4MA8H 3S4SG 3GK8L 3PJSB 3MRMA 3RVXD 4X8JA 2J12B 3IETA 3E2HB 5D2LF 4PJFF 4O9HH 4UDTA 4OCXH 3W39B 4KZEL 3TYGH 4PJXF 5AZ2L 1A7RL 4YHNA 4NQEB 5GGUB 4R0LC 4J3XA 1FNEA 4QHKJ 3WIFA 3IJHB 4TNVK 2VLRD 4LLUB 4ZAKA 5EPMA 2CLZA 1KLFA 2C3GA 5FYJU 2APFA 2DQUL 5DSCB 1ITCA 4P2QE 3LZFL 3QUKA 3Q48A 1F4XL 5IK3A 3SGKC 3V6OC 3FO0L 1Z2KA 3VWKC 1T4KA 3GJEB 1KEGL 2ADGA 4FQIL 3DXAE 1VERA 2Z4QA 2V17H 5DQ9B 3MV8D 4ZFOL 4FMFA 3QH3B 4KPHH 4N90E 4Z7QF 3VXPA 4HWEL 3PHOB 3CXDL 2GW5A 3JV5A 4WI8A 1A7OH 3I75B 4QRQB 3G6DH 1A4KA 5J1TC 4Y5VB 3MCLH 4JG0L 5C9JB 4XBEL 1CXEA 3T08A 1IL1A 3CVIL 3JBG7 4JO2H 5DWUL 4LKXB 4O2EA 2JCCF 4Y16C 2HT3D 3SKNB 4QHMA 4LU5H 1XGRB 2DQCL 4DVRL 4IJ3C 2DICA 1S5IL 4LFHG 3HKFA 3STZB 4FG6C 3VA2C 4RBPK 5I17A 1DEEA 2EDWA 1A7QL 5TDOA 4H1LB 2ITDA 4XNYL 1MCDA 1IC7L 2F74B 3IVKA 3KPSD 5T5FL 2DLIA 4ONGL 4KK5C 4TUJA 4ZUVB 2ZG2A 1TFHA 1FFNA 2ZCHL 4MZ3A 1NGXB 3MV7A 5EU6D 4B0MM 4ZPTA 3RI5F 1CG9B 5I9QC 2OQJB 4PJHA 2VN7A 4U3HA 1F3JA 4JO1H 4FABH 3SOBL 4MXVE 1F90H 3CFDA 2FECI 1HQ4A 1T04A 2Z31D 5EOQH 2Q20A 1NCNA 4Y0GA 1ZT7A 5J3HD 2IANE 2UY6A 2A73A 4YIQB 4GKZB 1G7LA 3JTSB 5IVNA 1E6JH 3MXVL 4MX7A 5D71H 4M1GL 3BUYA 4HQQL 5ETUA 2XYCA 1XZ0A 2LVEA 4KRMB 1AXIB 1EEYB 3RVWC 1K4CA 3A6BH 3CSPA 5D6CA 3MFGB 1YEDB 3RVUD 3TIDB 1OCWH 5DJYB 2JB5L 5DRWA 2O5YH 5H37G 2DLFL 5HYEA 5C86A 3NFNA 1AD0B 5D7IA 4LSVL 3W2DH 1N5YH 1DQQB 5JHLL 2DDQH 1U93A 4QGTA 3HHRB 4RQQA 1CT8B 4LASL 5KS9B 5DUBA 2M8XA 4ZQKA 5DUPL 3OR6A 3MNWB 5F96L 5FO8A 4DGYL 1NDMA 2HTKC 1D5XA 5KSAC 5DK3A 3VFUB 2OP4L 2VDPL 1QSEA 2AK4A 3HLAB 2AKRB 4NQSB 3SDDB 2PCPA 4MA7H 2VDNL 1FIGL 5JTWA 4FQLH 3LKQA 4GKNB 2F58L 3TZVB 3D0VB 3OG6B 3DYMA 3FB7B 4L3CB 1LO3H 2BOCA 3GKWL 2NPLX 4QXTB 3DGCR 2DI8A 1QBLL 3UBXA 1T89C 4MJ2A 2XOTA 1FL5B 3Q6GL 1H5BA 3RJQB 4HULB 1ZSDA 3BH9A 3BP7A 4GG8A 1LNUB 1YEKH 5J12B 3BAEL 4L5FL 4JPWH 3LRHA 1KLGA 5CEXB 2XN9D 1IM9B 1DBBH 1S9XB 4UT6L 3RPIB 5I73B 3ARDA 2FD6H 1KEMH 1MCOH 1T6WA 2WMPA 4WEUD 1Y0LA 3GSVB 1S3KL 5MHSE 4QNPE 2VDLH 4G9DB 3C08L 4KJPD 5EU3B 3BKYL 2IQ9H 3KPRB 3LPFA 5FYLH 3VW3L 4D9QE 5JW5B 4MYWB 1LE5B 5F9AC 5ANME 1IBGH 5ESQA 1SYSA 3VE0B 3O8XB 1AIFA 4Q2ZB 5K33A 3ARFD 2WBJA 3DMMD 5BS0E 3QXUA 2X2YA 2I60L 3B9EA 2NY6D 1H3PH 1HHIA 5GS0H 1G7HA 1K3ZA 3O4LA 1X3DA 4JPIB 4O51B 1RZFL 2FX7H 2ORBL 5FB8B 5IIEA 3IDMB 3MA7A 1J05A 3R0MA 1NUNB 4XP9L 4K3JL 2OZ4A 4PLJC 5I19H 4EN3B 1TPXC 5EU5A 3VXUA 1JWUA 4HZLA 5TQ0L 1H3UA 1S7QA 1CTNA 4GMSL 2A77H 4N1EA 4XAKD 5CHNA 5ACLA 2UZIL 3ME0A 4V1DD 5EUOB 2BVUA 2R9HC 3C5SB 4D9RD 1JMZA 1C5DA 4LLDB 3VA6A 1I9EA 3GBML 3OX8A 2CLRB 3VJ6B 3PWLA 4L1HA 2GJZB 1A3RL 1D6EB 4D9LL 2EYRB 4G80A 2BNUB 5IB2B 4JB9H 4GJTB 5SWZE 5FV1L 4QRTA 1WWAX 3VRJA 1R5WB 2P8MA 1ADQH 1RFDH 4ZTOL 2NLJA 1PY4A 4RGMB 4F8TA 5IBTL 4HC1H 4WO4C 4U7MA 4IOIA 5FFLA 5I71B 4X9FA 1IAOB 2FNBA 3QIWB 4P4KA 2CMRH 3LHPH 3V79C 2VXQH 1SMAA 1MJJA 2E7HA 4U05A 4XVTH 3RY5A 4X6DB 5L8JB 3LS5H 3ILQC 2AXGB 4NZJA 5IVOA 2BOBB 1X5KA 1MLCA 1UXSA 1LP9B 4LLMB 3ZYIA 5FHAL 3KDMA 1ZHNA 2VLLB 2WIIA 5ID1B 3K81A 1A6UL 3QNXB 1L9MA 3CNKA 5HTSA 5C0AD 5IFHH 4U3XA 3MRDA 1FZOA 1R5IA 2LTQB 5K9KA 5EC1A 4XMKL 1GGIH 4HUVB 1I75A 4ERSL 3V9FA 3BOVA 1NFKA 4G6KL 4QHNA 3CCHA 1DQLL 1LD9A 1DFBL 4WI4A 1S9YA 4Y1AD 1UB6A 3QEQA 4M9PA 3TA3A 1P2CB 4HK3J 4LSPH 2E27H 2PTTB 5JIPA 5E8OB 4A2LA 2IGFH 1S9VA 4YHYB 1F11B 4WUKH 1A6PA 4CJ1A 2NY2B 1UWXK 4F7CB 4MWFA 3RX7A 2ZZUT 5C07A 4I2XA 2VZTA 1A5FL 5D7SL 2FX9L 1OAXH 4F37F 2YD1A 1OGAD 2H32H 3TIEA 4CVZB 1G0XA 1OHQA 4QXWA 5E03A 3S5LA 4K71C 4GSDH 4HMEA 5CP3A 4LVNB 1P53A 4QTIL 1PKQA 1HCFX 1GPOH 2HJFB 4XP5L 1CLZH 1ZA6A 4ZD3H 4X9BA 2NZ9D 2X4TB 2VLMD 2ZNWA 1K5NB 3CFEA 3BVNA 4JO3L 4KKNA 4BZ1L 4OF0A 5JIKA 1K2DB 2BVPA 4JFDD 1YPZE 4CDGC 2X4OB 1PAMA 2YD8A 2ZUVA 4PJBF 3UTTA 1C16B 1KJ3H 2PW1B 1JGDB 1LO5A 1SJEB 2VZUA 4PJAB 3CFCH 3LS4L 4Y88A 4P3CL 4HKJA 3CVHB 3EYUL 4I18B 3RKDC 5GGVY 1YNTA 3N1PC 3MACL 4FQXA 2QR0B 5HI4D 5IMLA 2H8PB 3HS0B 3FONA 4U1MA 4XPTL 3L3KB 5HPMB 2NXZB 4FTVE 1U58B 1I1FB 4QWWC 2BSTB 5A1AA 2BNRE 4WFHE 4KRPD 4OZIB 1MQKL 1BJ1H 4DAGL 1G7QB 2NX5A 3U83A 2DI7A 4U1LA 1UVQA 5CEYA 4M3KB 4NUGH 1X5XA 4LCYA 5KVFL 3L6FB 3INUL 3MCKB 1AXSA 2IFFL 3F5WB 4Y5YA 3VMPA 1BQHG 3T1FA 2GSGB 3LPGA 3ARVA 5A2FA 3VFVA 1I9IL 2XQBH 3QJHB 3G6JE 2OMBA 4PJEB 4HUKB 3BPNB 4P2OC 4DK6A 1RHHB 2HTLC 4NRXA 4I9WE 3BIAX 4YC2B 3QRGL 3SBWA 3TO4C 5C6PB 2FJFA 1RURL 5HBBA 5HXMA 1PQZB 4ZOEA 2HKFH 4NP4H 5IEHB 4GW4A 3GMLA 4G9FA 1INDL 4WFEE 3PGCA 3RZCB 2MKLC 3WLWC 4Y19D 1FNSL 1FPTL 4ZXBB 5HVFB 1U3HC 3P11L 1JV5B 3S3SA 2VO5A 3FO9B 1BJMA 2YN3A 3EZ8A 1IAIH 2ID5A 3P0VH 4HKXB 3GK8H 3F7YA 5HVGB 4PJ8C 1EDQA 1DP0A 5JO5A 4PR5B 3WIHL 3VH8A 3SDCA 4P46B 4KZEH 3RDTC 1QLFA 5AZ2H 1P7QA 3H9SA 2DJUA 3L3DA 1A7RH 3C60D 4UAOC 5F7WC 3BRGC 1CICA 2YD3A 3VFSA 1Q9OA 1KGCE 3ARRA 1P7KA 5FHBL 5BV7L 1T1ZB 3DSNA 4RIRA 3HR5A 5IB3B 2Q86B 1NQBA 4U1JB 3LZFH 1EJOL 5EU4A 4GUPB 4JFOB 1F4XH 2W65A 1XF2B 4X5WA 2GAZA 4OCWL 4QHKI 5IBLC 4L4VE 4UTBL 2EDRA 3FO0H 5A16B 4HGKC 1KEGH 4N8VB 4LHJB 1T1XB 4M3JA 1BX2B 4FQIH 5DVLA 3OAYH 4RFEB 2NY4C 5B39A 3EGSB 2YHGA 3MJ9A 4EQ3A 4NWTL 3CXDH 5BRZB 4X6EA 2OXHA 5LBSL 1QRKA 1HXYA 3B5GA 3SE8H 4ZNEA 1U9KA 2ICWB 4MDJA 1HILA 1KNOB 4KKBD 4JG0H 4XBEH 3LKOA 4TVPE 3CVIH 3DHMA 5CSBA 3CGTA 4F9PA 3SY0B 5DWUH 5FYKE 3V5HA 1N64L 3PWVA 4MNHA 5MENE 1G7MA 5F1SA 5FF6B 2CLVA 2ATKA 3TWCL 3UO1L 4JFHD 2OM5A 3BW9A 2XWTA 5DLML 5DVMA 2DQCH 4MSWA 1LEGA 4NZTL 4DVRH 3F62A 4R0LB 1S5IH 2C7UA 3HE6A 1A7QH 1ZHKB 2DTSA 3MSPA 2VISA 4LL9A 3QIUB 4XNYH 1IC7H 4Y4HA 1A6AA 3ZKXC 2NW3A 3KNBA 3SGJC 5T5FH 3F7VA 1HSAA 1RUQL 1VEMA 4ONGH 3OSKA 4PYGA 2DB8A 3CDFA 2ZCHH 3QIBA 3MLTA 1EK3A 2CO6B 5DJXA 5FM5M 2WBKA 1L7TL 4JREC 5D2NE 1U8IA 3SOBH 2IPKB 1EZVX 1ONQB 2G75A 4MD0B 4EZMA 1TZIB 5D7KE 4CUCA 4R4ND 4HDIB 4ZFZB 3N1GC 1RK0A 1KFAL 5DD6B 2CPCA 4ZAKD 3D18A 1DL7L 4PGDA 3WN5A 3I50L 3MXVH 3OKDA 3IDIB 3CFIC 1IVLA 4WTZG 3QDJB 5I1EL 4HQQH 1I7RA 4OI8A 4KFZC 1S7TB 1ORSB 1FV1A 5JNYB 2GJ6E 5EORL 1JGLL 3TBVB 4JFQA 5CZKA 2DOCA 4X83A 2JB5H 3BXNA 4Y16B 2DLFH 5EG6C 3DUSA 3V4PL 1TVBB 4LSVH 1FZMA 5JHLH 1JUFB 3MUJA 4IJ3B 4LASH 4ZUSA 5HHNB 3QCVL 5F7YC 1MIEL 4YAQA 4L29B 5FA3B 3R06B 5DUPH 2DWDB 1S9KC 4NBZB 5F96H 3WFBL 1FFRA 1T20B 4PGCA 1DLHB 3I02B 1IAII 4NN5C 2X10A 5E4EC 1CTOA 1T6VN 2HP4A 1BVLA 2OP4H 2VDPH 5DK2A 4PRDA 4BJLA 4FQ2L 3WDIA 3CU7A 4NSKB 4IHOB 5I9QB 5TE4L 3VXSA 5IB5A 4OAWA 2VDNH 1FIGH 1W0YT 1BLNB 4YHLH 4PLKC 2F58H 4UTAH 3RPKA 4M5YL 5KZCD 3BGAA 3GKWH 4OCSL 3CFJB 4HG4J 1QR1A 1MRFL 1QBLH 2B5IC 2GI7A 1J9CT 3M17B 4D0BB 4AK1A 3VD5A 3F12A 3Q6GH 3RWDB 2VNCA 5I1LB 5BVJB 5GZND 2W1NA 3TP4A 5BVPL 4KK9C 4UDUB 4S2SA 4OV5B 5FO7A 3PJSA 1RZKC 2Q7YB 1ROWA 1FG2B 5DA0B 3BAEH 4L5FH 3ULVE 4Q9BA 1I85C 3ARBA 1T5WB 1CQKA 2UYLA 2ZSVB 4FFVD 1OAQL 4FFWC 5SV4A 3BDYH 3O2WL 3W39A 4UT6H 5HI3D 3DO7A 1EHAA 1WT5C 1U36A 4NQEA 4WW2C 2YEZB 1DUYA 1S3KH 3BN3B 1PG7L 3IJHA 5ICZB 3C08H 4LLUA 3BKYH 1D6VH 1CIUA 3VW3H 3GIVB 5IHBA 3WL9B 2Y06L 5I15H 1GGTA 4LGRB 1MCWW 4DCQA 3WKNA 4RCAA 1WFOA 1S8DB 2I60H 1KPUB 1MOEA 3DVIA 5KSAB 1A6VL 3BJLA 5DJZB 1RZFH 2ORBH 5FKPB 3OJVC 2V5RA 5FV2A 3RWFB 3JWNC 3U30C 2CRYA 5DQ9A 2YD7A 2QADC 1ES0B 3QH3A 4R8WL 3CFKB 4MVBC 3FAWA 1U2CA 4XP9H 4K3JH 5D7LE 1T1WB 2DKMA 1NC2B 1B6DA 5TQ0H 4YBQD 1N5AA 3N1FC 4GMSH 3DETC 2DL9A 2UZIH 1ETZA 1OT1A 3T0BA 2VQTA 1PX4A 5MEOB 1JN6B 1QSED 2AK4D 3GBMH 4YPJA 2D7NA 5IGXL 4NHUB 2BHUA 5GRVK 1OW0C 1A3RH 5E8PB 2R23B 5CJQL 3K46A 1XGRA 4HGWA 1KIRB 3FL7A 4JFPB 5IB1A 5IEKA 3STZA 4ZTOH 5IBTH 3DX6B 2F74A 4XMLL 1MWAB 3LRGA 4X4XB 1KV3A 1XF1A 4ZUVA 3TJHC 1EFXB 3GMMB 5IVXA 1PFCA 4HIEB 1GIGL 4IRSC 4EDXB 3QUZC 4GRWB 1DTUA 2HLAB 5JHDE 2VQUA 3A67L 2OQJA 1KCSL 2ESVB 3WHE0 4K7PL 3QPQC 4JN2B 3ZMRA 5E9DB 2EXYD 4MJ5B 4B7IA 4TOYL 4LK4A 3RVVD 1YMME 3ARDD 3B3IA 4JAMA 2FO4B 3ETBF 1I1CA 3S9DB 3ZE0E 5FHAH 4YIQA 1A6UH 4GKZA 1MJ7L 2F53B 1OPGL 4QEGA 3JTSA 2XQYG 1TPXB 4JANA 3M07A 3MYJA 1KJMB 3F7RA 1XR8B 4CADB 4XMKH 4ERSH 3RI5K 2WBJD 2VZOA 3P0YH 2B20A 1EEYA 1FZJA 4XCEB 4PFEA 1YEDA 3RNQA 3T0EE 3C9NA 3TIDA 3O4LD 2VTFA 5DJCB 2HVKB 5EDXA 4PJIF 1AD0A 2E5EA 2DQDH 1CT8A 4PJCB 4QGYA 1JWMB 4ESKA 4YHIB 4NC0B 3DBXA 5A2LH 4PGEB 1A5FH 5D7SH 4WO4B 1A1NB 3QI9C 2FX9H 3VXUD 4KK6D 3B9KC 2VOTA 1H3WM 4C56E 5CD3A 3VFUA 1DQTA 3HLAA 1WTGT 2HJKA 2XKNA 2AKRA 1Q1JH 3AM8A 4NQSA 3SDDA 2X1OA 1Q0XL 1FGVL 3TZVA 4QTIH 5D1ZC 3FB7A 2FH6A 5C08A 4L3CA 4WUUE 4XP5H 1X5FA 5I0DA 5E4IA 1M7XA 4QXTA 1GOHA 5KW9L 2YPKB 1KCVL 1S7SB 4Z7NE 2RFXA 9CGTA 4JO3H 4R90L 1FL5A 1I8MB 2YWZA 3OWEA 2BSSB 3QCTL 4OF3A 4P4KD 2A2QT 5HDBE 3QUYC 1T83A 3CH8A 1IM9A 1S9XA 3RPIA 1CVSC 3EYQC 3BE1L 4GMTL 3LS4H 2XA3A 1IAKB 4I3GA 4P3CH 4ELKB 3EYUH 4LKCA 1NMBL 3DUUA 4ZODA 3DROA 1HEZB 3UZEA 4P3DA 2BZDA 2ZOLB 4Q6IC 3HR6A 3QG7L 4PLNC 3MACH 1NH6A 4JDVA 1ZVSA 5JW5A 5LQBL 1LE5A 4G6AC 3VE0A 1CDCA 4Q2ZA 4MJIE 4R4BB 1MJUL 1UM5L 4XPTH 3LB6C 4JJHA 4LCIL 3SE3A 1S7WB 2P43B 1AJ7L 4JPIA 3NCBB 4BYHA 2UWEF 3K2MC 1MQKH 5CJXC 4OD1L 3ZTNL 3QEQD 4K71B 4YFLF 2NNAA 2YA2A 4DAGH 3TA3D 5FB8A 4BH7B 4L3EE 3IDMA 4M6NL 2B8OT 1DEDA 4XWOC 5SWSB 3KYOA 5GS2D 4D8PB 5KVFH 3INUH 3FQWB 2I25N 2IFFH 3L9RB 2X1PA 5E6IC 3TVMA 3S3JA 1E4JA 5C07D 1I9IH 2OX5A 4JRWA 5ANMB 1UQSA 3V6FA 1PVHA 2NY1D 5AAWA 4K7FB 3EOAB 5BS0B 1WEJL 4NRYB 1KPRB 4P23A 5EUOA 4DGVL 3QRGH 4AY0A 3C5SA 1RURH 4GBXB 2CLRA 4TSBL 3PDOA 3BRDA 1D6EA 1INDH 5IT2L 3H2WA 3P9MB 2BNUA 4NJ9L 1L4IA 1G1YA 3V5KB 5GSRB 1FPTH 4MHHI 3G04A 1T2QL 3P11H 1CGYA 1HQRB 4NCC2 1JTTA 1QOKA 2BSED 4MQ7A 4U4BA 2BVTA 5F9JB 3WIHH 1MCEA 1OT2A 3NZ8B 1KULA 4N0FA 3FQUB 1INQB 1H0DA 2CDFB 3UTTD 5TPWH 3O6FC 3RVXC 5C9KA 1UXWB 3MRGB 4X6DA 3V7AG 1QA9B 2Z92A 2BOBA 4DOHE 5FHBH 1KBGL 1LP9A 1SJHA 1TDQA 3QFDA 5BV7H 2VLLA 3L3JB 5ID1A 4CJ0A 3QNXA 5B22A 4FQXD 2DI9A 3MV9E 1EGJA 4JHAL 4LDEB 5ACZB 1EJOH 4P2OB 2MCG1 5JDJA 4HUVA 1WFNA 5I0ZA 4Q9RL 4OCWH 4I4WB 3ALWA 4UTBH 3TO4B 1EUTA 1T0PB 1FLRH 3FMGL 3SJVB 4HLZG 3MLUL 5C6TL 4R6UA 1FYHB 5E8OA 2NX5D 5H94B 1F11A 1E0OB 5C09A 1S7XB 3ARWA 3IAPA 4F7CA 4NWTH 1U3HB 1QO3A 5LBSH 2VABA 3RWJB 3Q5YA 4PJ7F 4YXLL 4U1HB 2G2RB 2FHCA 4YFDB 1ZLUH 4LCWE 2ATPA 1FZKA 5ISZB 2C26A 3QAZC 2AW2A 5TH2B 2IG2L 5K59E 4PJ8B 2R39A 4ELMF 3S98A 4CVZA 1J0HA 1N64H 1U95B 3A6OA 4YWGL 4UBDD 3ABZA 4JCLA 2GEEA 4W81A 3TWCH 3UO1H 1WJ3A 3RDTB 2HJFA 3DX8B 4G9FD 5D7JA 4G43B 4NZTH 2X4TA 2FLBT 2HT3C 1K5NA 3GJFB 4HWBA 1X5AA 1UYWL 4F37K 4PV9B 25C8L 1RUQH 1K2DA 4AEFA 4XPHL 3X11B 4KJYB 2X4OA 1U3YA 1UKQA 1B3JA 4X6CE 5T3XL 4PG2A 2W9LA 5CEZE 4WHYG 4NKMB 5KSBB 3SDCD 1C16A 1ZHLB 1BPVA 1JGDA 3EDDA 5AYQA 3NIGE 4WHDA 4I3SH 3I9GL 2SEBA 1G9NL 1P7QD 3H9SD 4I18A 2NY4B 1CBVH 1CICD 2AI0L 4FZ8L 1FYTE 5MEQB 3SO3C 1JJUA 2P1YA 2Z31C 2YSSB 1DL7H 3NA9L 3I50H 3LN4A 3QP3A 1YPZB 1ZS8B 2H8PA 3HS0A 5J3HC 5I1EH 3L3KA 3NCCB 5HPMA 3T3PE 2JJSA 5KJRL 1T22B 4F8QA 1V7ML 4XAWH 1JGLH 1VFAB 2H2PC 1S5HB 4YBLB 1I1FA 5EBWB 4NO5B 4CVWA 1Z5LB 3V4PH 12E8L 2M1KA 4LPWA 3JWOL 1U92B 2WSKA 3MCKA 3QCVH 3F5WA 1MIEH 4OM0H 2GSGA 3BDXA 3O0RL 3QJHA 5HHXL 3WFBH 1ED3A 3ZKXB 5IQ9B 5HHOB 1CVRA 1RHHA 1SY6L 2EDYA 4OZGB 3UAJD 3TEUA 2VDOL 4PRHB 3A6CL 4FQ2H 1B9ZA 1DQJA 1PQZA 4JREB 3CLFL 2JLLA 4M5YH 2P5EE 4OCSH 5J9PA 5CMAB 3GBLA 1MRFH 5ACMA 2XACC 3HE6D 2GTWB 1JV5A 3D3VB 4I0CC 4LEXL 4OGXL 4Y4HD 4ZSOA 4GG6F 2FWOB 1U8QA 2APXA 1N3NB 2ADJB 3MZTA 2HFFB 2NY3B 4HKXA 2NXYD 1YJDL 3T09A 1J86A 4OGAC 4PR5A 3QIBD 5BZDB 2D03L 4WHYH 1OAQH 1IKNA 4NT6B 3O2WH 5IFAL 4RGND 5EBLB 1CLYL 4XPBL 4XH2B 5GHWL 5CIPB 1PG7H 2XICA 1J8HB 3K80A 4JM4L 3R0NA 1T1ZA 5IB3A 5EU7C 2Y06H 2OMNA 2WP3O 4IIQC 3ZDZF 4ZPVA 3RWEB 3BZFB 4WVRA 5HYQA 5IQ7L 2AGJL 4GUPA 1CDYA 4JFOA 1FNGA 1NDGB 4NN5B 2JJWA 2VXSL 5E4EB 1A6VH 1CD0A 1KELL 3ZE2E 4HEME 2F54B 5A16A 2VMFA 3ARFC 1A47A 2APWA 1T1XA 1I7ZB 5C0CB 3RP1A 2KZWA 4NNPL 4X9IA 5DJDA 2FHBA 1BOGB 2WIMA 5JR1L 4R8WH 2QHRL 3IRZA 4XHJC 1Z9MA 1VFBB 2B5IB 5BRZA 4X5LA 5B3JF 3WJJC 1UKSA 2ICWA 1KTDB 2GK0B 5HGBB 1UWGL 1KNOA 1NBQA 3OGCA 1M71B 1IM3A 3KPNB 5IGXH 3VXSD 4YZFE 5E56A 5CJQH 3CK0L 4WW2B 4R0LA 3GBNL 1WCBA 4L1DA 4JM2C 1CXHA 5E94B 3ZDXF 1ZHKA 5DRNB 2KL6A 1HWHB 3QIUA 4NNYB 1FAIL 1A7BA 4XMLH 3DV6A 3BP6B 3QNZB 1Q9LB 1Q9WB 1QFOA 1GIGH 1AI1L 3A67H 1KCSH 1MUJB 1DQDL 4PREB 3TLRA 3ARBD 4Y8AA 5I1HL 4LLAA 4K7PH 2IPKA 4TOYH 4HCRL 4MD0A 4U1GC 4Z95H 2RAMA 1JMXA 5IFJB 3EO9L 3U30B 4HDIA 4NQED 4ZFZA 3EDJA 2QADB 1RZJL 3MNZB 5DD6A 4DGIL 3V6ZA 4DVBB 1MJ7H 1HHHB 1OPGH 4QY8A 1TTUA 2YUWA 3IDIA 1GZPA 3RFZC 3QDJA 3FFCE 4NM4H 4NWUL 1MY5A 5HYJD 2J8UE 1ORSA 5JNYA 5ADPL 3S8WA 4LQFL 4LPTA 3BGMB 4P48A 4PRBB 4Y16A 5BJTA 5SWQA 1U91B 2QSTA 2ZJSL 5A2JH 1CXKA 3QXAB 4KMLB 5IP4A 1NL0L 5HHNA 1IJ9A 3H0TB 4L29A 5CZXD 3BYTA 4WNQB 3QDME 4ZUUB 1OARL 1NFDF 2NR6C 1DLHA 3I02A 4NKDA 3D39B 4IRSB 2GJ6B 2ZUUA 3NCJL 3QUZB 2P5WE 4NSKA 1ZE3C 1Q0XH 1BLNA 3NCFB 2MQ3A 1FO0L 1VHPA 1CD1B 2BNQB 2WUBL 4FQJL 5DD1L 1LEKA 4WTWA 1MVFA 3GSRA 3CFJA 4OF6A 2QQKL 5KW9H 3SE9L 1KCVH 3QNYB 4D0BA 1IQWL 3X12A 4CRPA 2YC1A 4DKDC 4R90H 3KG5A 4NM8H 1WWWX 3RWDA 1LWRA 4UDUA 2A0LD 8FABA 1QPXA 4OV5A 3KYNB 4PRNA 2Q7YA 3IS0X 3QCTH 1FG2A 1OTSD 3TPUB 4XHQA 1KYOJ 1T5WA 3ARUA 2H45A 2HH0L 4GMTH 4NJAL 5GGRA 4YHPB 1KC5L 3GMPB 1I3RB 1NMBH 2YEZA 3H3PH 3QDGA 4D0DB 5ICZA 5FUZL 5EC2B 5L9DL 3DX7B 3QG7H 5LQBH 4QXUL 3QI9B 2VLKE 4XMPL 1MJUH 2XZZA 3B9KB 1UM5H 2Z91B 4PJFE 3QO0A 4YHML 3G5XB 1S8DA 4F7EA 3UTPD 3VI4E 1KPUA 4JKWA 4PJXE 1AJ7H 2X9WA 1V8HA 1X7QB 3DIFB 3E6HA 5TJWK 3VXRE 4PJ9A 2ZG1A 3ZTNH 4OD1H 5FKPA 2RR3A 3EJYD 5D1ZB 4K3GA 5C0EB 1PSKL 1AO7E 1HNFA 1P4BL 4KK8D 4M6NH 2IMNA 3OXSA 1ES0A 1NGQL 2QTEA 2RB8A 2VSDA 1LK3L 5FA4A 4Q0XH 5DK0B 5B38G 2V2TB 4KQ3L 5MEPB 2EDDA 5GS2H 2EO9A 4P2QA 1WEJH 3LKRB 4LSUH 1LO4L 3ZO0A 4PS4L 1JN6A 4CBPA 3QUYB 3HAEH 4TSBH 1AFVL 4ISVA 3MREB 3SDDD 2R23A 3TZVD 5IT2H 2X4NA 1KIRA 4NJ9H 2ICCA 5C08D 5TQ2L 4JFPA 4O4YL 2IH1B 5DYOB 3G5ZB 1T2QH 4UV4L 1QHPA 4KI5E 4FQCL 4M93C 3DX6A 3SKUD 3HUJB 1NLDH 4Q6IB 4AENA 1OSPL 4KH2A 1TXKA 3GMMA 2FGZA 3X13B 1MFDH 4GAYB 4Y5XA 3WUWG 3LCYA 4HIEA 3C2AL 2HLAA 4W4OA 3SHSA 2C1OB 4WFGE 3O9WC 4MJ5A 3U82B 1IM9D 1Q0YL 2IBGA 4U6XB 1XF5B 2PTVA 1HDMB 2FO4A 2OR9L 1KBGH 3E0GA 2AXFB 3DYPA 3S3PA 5E6IB 3I6KB 3M1BA 4JHAH 1MHEB 3V6BR 2OTWB 4P3WA 5IR1B 1MSPA 3ESVF 4XP4L 1OWRM 4XCEA 4D3CL 4Q9RH 3G9VA 1HH6B 3VRLE 1XIWA 3FMGH 2GHWB 2HVKA 3QEUB 3HZKB 3ECBB 1HHJA 4H8WC 4NZUL 4MD5B 2LVCA 1BEYL 1MFCL 4JKPH 4YHIA 4LLQA 3TVMD 1S78D 1OSZB 3EYVB 1A1NA 2ARJB 4YXLH 3GMNB 1KT2B 4N5ED 4EEEA 3GB7B 2VSCA 2DN7A 1YN7B 4GXUN 4MXVF 4JG1L 1A7NH 2JE8A 2IG2H 3FQXA 4JFFE 4P23D 4EIZC 3PP3H 3ZHLA 4NFBA 1X6LA 3QEHB 5E5RB 3O6FB 1X5JA 4WRLA 1FH5L 5B38A 1JHTB 2EKJA 4M7KL 5CCKL 3QYCA 3CX2A 3WYRA 2YPKA 3P9WB 1S7SA 3RY6C 3DURB 3LDBC 5CJ5A 1JIBA 1FFPB 1UYWH 2BC4B 5CJOH 25C8H 3BKJL 1I8MA 1J0YA 4BSWA 4XPHH 1BD2D 4UT7L 4JY4B 3QB7C 4FFZL 2BSSA 1KTRL 5T3XH 3UX9B 3PWPE 2D7TL 1U8MB 5EZLA 4LVHC 4UQ2B 3I9GH 1G9NH 3Q5TA 4ELKA 4FZ8H 5T1DL 4CAGA 3PP4L 2ZOLA 3NA9H 4RAUB 2BCKB 3HMWL 3TJEL 4PRAB 4EUPH 4CGTA 4YE4L 2F5AL 1F3RB 5JXEA 5CFHA 4X4MA 4ZAKC 3ZKQD 5KJRH 1V7MH 4RMVA 1S7WA 5C0GA 4P57B 1EGJL 5FUOL 3QFJB 4J8RA 4PRIB 3S96B 1JPFB 1P4LA 1D5MB 1A1OB 4JRYE 1F6FB 1Z0NA 3B83A 4KZDL 3JWOH 3NN8B 5GGVL 3FQWA 2NY2D 3L9RA 1RZGB 4HMDA 5C09D 3OJDB 5LAXA 1JRHL 5FCUL 5F9OL 4DN4H 1NEZG 5ANMA 3O0RH 1ZLSL 5HHXH 4K7FA 4IMKC 4Q97A 5BS0A 2FATH 4N0UE 2X40A 4NRYA 3NFPA 1KPRA 3KLSA 2VDOH 3A6CH 4HLJA 3VGDA 5EOCJ 4YJZL 2JJVA 1JFQL 2AJZA 3KPSB 1BGXL 1EX0A 4GBXA 1C1EL 1L0XA 4QNPF 3VGGA 1JZ8A 2HT2C 3CLFH 4L3EB 5EU6B 3VRIB 4S1DC 1SYVB 1M7DB 3GSUA 3SDXB 5GSRA 5D7JD 1TQBC 2DKUA 3SO3B 1BZ7B 4LEXH 2Z31B 4OGXH 4WEMB 1N59A 1CXFA 3OKMA 5FYLE 5SX5H 1JNHB 1YJDH 5CBEA 2XQYK 1BOYA 5F9JA 2D03H 8CGTA 5GZNC 3FQUA 1INQA 2WWKT 2R0WL 2CDFA 1CFNB 3FQTB 1RK1B 4O00A 1CLYH 4QF1B 1UXWA 4WJ5B 1QA9A 5HYSB 1Q72H 4FFVC 5GHWH 3OKOB 3V7MA 4JM4H 3BGFC 2ED7A 5HI3C 3L3JA 2FR4B 1UA6L 5FGCB 1VPOL 3CVHL 2AK1L 1JGEB 4AEIH 1WAAE 5DEZA 1ZXQA 4F2MB 5IQ7H 3O2DL 4LSDA 4OQ1A 2AGJH 4PBXA 5ACZA 2GCYA 4RMWA 5KOMC 3L3GA 2VXSH 4I4WA 1WWBX 1KELH 1RV6X 3L5HA 2W9DL 2W38A 5HHMB 1VACA 3SJVA 2W9EL 3K4AA 4OFYA 4U6YB 4E42A 3V52L 4NNPH 4P5KB 1RD6A 3PGDB 4F33A 3HI5L 1UACL 2VLJB 5JR1H 2QHRH 1YEIL 4TUKL 1S7XA 3BD5A 1U3HA 3RX8A 1F42A 1L0YA 1ORQA 2BY1A 3RWJA 4U33A 1S9WA 2G2RA 4IBLT 1FL3B 1RU9L 1UWGH 5DFWH 3QDHA 3QQ9D 5TH2A 1EPFA 2MQCA 4PJ8A 4G8GE 3LOWA 1U8JB 1V3JA 4HX1A 1QRNE 3RDTA 3ULUL 5AWNL 3CK0H 3DX8A 5EO9B 2HWZL 3MQIA 3GBNH 4FHBD 5DEGA 2XN9B 5EZOL 1T5XB 4ETQA 1FAIH 4PV9A 1IGTB 4IIQB 1EH9A 3AB0C 1FDLL 2X4QA 5HHPA 4MGXA 3BEVB 4KJYA 2D9CA 4H1LG 1F00I 1OLLA 1AI1H 1V05A 1H3XA 1C12B 2YRLA 4JGJA 1II4E 1DQDH 1O7VA 3HG1B 3RWIA 5B4MC 4NKMA 4HG4K 1ZHLA 4U1NB 3ARFB 4X6BB 4HCRH 1ZA3B 4FQ1L 3NTCL 3EO9H 4NC2B 1XT5A 2YMXL 1MQ8A 1RZJH 2EDTA 1JNLH 5MEQA 2EXYC 4DGIH 3KXFE 2PR4L 2YSSA 3RVVC 2ZUYA 1N4XL 3ARDC 1XGYH 2DAVA 3PIQA 5F8RC 1YPZA 1ZS8A 1F13A 1NAMB 4NWUH 4MD4B 1T22A 5ADPH 1FE8L 1NBVL 1S5HA 4LQFH 3EAKA 2P48B 4G8EA 2Z8SA 2CDGB 3FB8A 2ZJSH 5DZNA 5C0BE 4U1KA 3MLYL 4DW2L 1NL0H 5EO1B 3C5ZA 4W70A 4XVJL 1OP5H 1MCFA 4JM2B 1KIUA 5JW3L 3F58L 4M4RA 3RUGB 5BRZD 5IQ9A 4KQ4L 4HPYL 3SGJA 1X4XA 1OARH 1Y6KR 5HHOA 1I7UB 5F44A 4FNLL 5A40E 1BFTA 2V7HB 4BKLB 2EDEA 4OZGA 5DHVB 4PRHA 4FTVA 5CLWA 3NCJH 4JPVL 4NQDE 2RGSA 4OCMC 4E5XB 4RMRA 3VGHA 1ND0B 1YNLL 4QRRE 4FQJH 4XB7A 2WUBH 4J3VA 5DD1H 4U1GB 1LO0L 3BZDA 2QQKH 2HJLB 3SE9H 2JIXA 1TJHL 3MLXL 4DUVA 1IQWH 1YEEL 1FVCB 2ZSWA 3GM8A 3QIUD 3RA7L 3RWCA 3G6JA 2QBWA 1AQDB 1ZAGA 4BA8A 3CMGA 5LJYH 2HFFA 1YMHB 4H1LH 3ZYOA 3GRWL 3TYFB 2B1HL 4LSQL 5BZDA 4QT5B 4JO4L 3SKMB 4XBGA 4NT6A 1TTGA 2HH0H 3BP4A 4XNUL 1QFUL 4XPGL 2HYMA 4XB8A 1L7IL 5EBLA 4P4KC 4NJAH 2P5EB 4KVCL 4UB0L 4OCRL 5CIPA 3QULB 3GSNB 1J8HA 1RJZB 5FUZH 2EE2A 4QXUH 3L3OB 3T3ME 3BZFA 1A3LH 4XMPH 4JRXE 1B4JL 4YHMH 3QDJD 5BOZG 3FO2B 2F54A 5J0BA 1LEIB 4R9HA 5EOTB 43C9B 5IROA 3C6LC 4S11A 1RUAL 1OGAB 1I7ZA 5C0CA 4Y16D 1PSKH 3OTTA 1P4BH 2GFBB 1BOGA 1AGEB 4JCMA 1NGQH 3ET9F 1LK3H 1VFBA 1ZT1B 3C8KA 3BD4A 2ZKHL 1JBJA 4JEGB 1KTDA 2GK0A 5HD8C 1UT9A 2G60L 3QHTC 2X4RB 4HAFA 4OZHB 1LO4H 4HEPG 3VXNB 5MP6L 3B4NA 4PS4H 1I85A 3KPNA 2EH7H 3OPZL 3MLRL 1NLBL 1AFVH 5H2BB 4JFDB 4JY5L 2DQEL 2P47B 1KB5B 2QQNL 3CXHJ 1WT5A 3K8KA 5TQ2H 4P2RE 4O4YH 4WW2A 1VFUA 3WEXA 3PABB 5E94A 4UV4H 3V0AC 4FQCH 5DRNA 3H7LA 4NNYA 3P9LB 1OSPH 1HWGB 2QJDA 2NY7L 1Q9WA 2AV1B 1P6AB 2VLRE 4L4TE 3C2AH 1VGEH 1NEUA 2D31A 3GHBL 4PREA 3RVWD 3DVFA 5MENA 3U79A 5KS9F 3WXWH 4M6OL 4KKLD 4P0DA 4RMTA 5CEZL 1Q0YH 1XGPA 3OKEB 5IFJA 2GITA 4N9GA 2AXJA 2OR9H 2IWGA 3QDGD 3TF7C 4D0CB 2IBZX 3KJ4C 3W0WB 1HHHA 4WGVB 3N0PB 4HS3A 1U8KB 1WICA 4PJGB 1IAIM 3MV8E 1QEWA 4XP4H 4D3CH 2JB6B 2Y6SD 2HTKD 4LLYB 1TNMA 4I13B 4TPRH 2IPUG 1RUPL 4PJ9D 3VFTA 4KVNL 1OW0A 4KHXH 4NZUH 3BEWB 1ZGLM 3P2TA 5GGTL 3U9UA 4PTTB 3KPTA 5ICYA 1E27B 3FN0L 2NTFA 4M93B 4GRMA 4WNQA 2AJ3A 4ZUUA 5BXFB 1DN0B 3FFCB 4Y19B 1I9RH 2QV2A 4PD4J 4P2QD 4JG1H 5D9SA 3D39A 4M7ZC 1KCLA 2GJ6A 1FG9C 2ZUXA 2MQ0A 2MHAB 1JF6A 4IMLB 2E7MA 3QQ3B 4OZFB 5LKNA 3DWTA 3JV6B 1BZQK 3O9WB 1WWCA 4L8CB 1CD1A 1FH5H 2XRAL 4M7KH 5CCKH 4X7TB 4UBDC 2BFVL 1I1YB 3RJDA 2PYEE 1DBJL 5CSZB 1HXMB 4P9HC 2XXCB 3BKJH 3MLSL 3IDGB 3KLHD 5IJKA 3R4DA 4UT7H 1CF8L 5HJ3B 3EDFA 5ITFB 3TPUA 1MWAL 2R1XB 3PQYB 4KROD 5F7DB 4LRIC 4BFGA 1ZOXA 2D7TH 4Z7UB 1E6OH 4G7YL 3NCMA 4YHPA 1AGCB 3GMPA 5D93C 5EIIB 3SDCC 1JI2A 4CKVX 1EHXA 2V9RA 4GW5A 1QNZL 4HS6B 4B53A 3DX7A 1F4WL 1ZLWH 4YH6A 3ORJA 3HMWH 3TJEH 4PLJD 3WE6B 2AJUL 2F9BT 4G6JL 2F5AH 4DK3A 3G5XA 1IZJA 4MLIA 1KJ2B 3DIFA 1X7QA 1EGJH 1WIUA 1XIWD 4U6HB 5FUOH 1T0NA 3THMH 5CILL 4M00A 5JW4M 5D1ZA 5C0EA 4JFXB 4KZDH 3QISA 5GGVH 3TT1L 5D5MB 5FDWB 5E2TH 5DK0A 1JRHH 3LDBB 5F9OH 2Z35A 5MEPA 5J11C 4OKDA 5F7EL 1ZLSH 1S7VB 3FFDB 4FQQB 5D2LB 4Y4KA 4QKXB 2NY5C 1JGUL 3FB6A 4KUZH 5IMKB 1JFQH 4B50A 4X80H 1BGXH 3BH8B 4PJ5B 1C1EH 4PJDB 2D7QA 3TN0A 3REWB 3UAJC 4OZ4B 4WW1B 3GIZH 1R3KB 4FFYL 4F9PC 4X8JB 2IH1A 4X6FA 3IETB 5DYOA 4WENB 2Y5TB 3ILQD 4UDTB 5D7LA 5HDOA 1YZZA 2DMCA 4Q6IA 5IHZB 1QUNA 1C8PA 5GISL 4X99B 2AP2A 4O2CA 4YX2L 5ADOL 1U3ZA 3HE6C 3QUMA 2D3VA 3X13A 1FNEB 4GAYA 3WIFB 4RA0C 4ZAKB 4W6XB 4Z7VE 2C1OA 2R0WH 2NXYC 1QPPA 3RY4A 5CJXA 3QIBC 4CU8A 2DQJL 3MRRA 1OAKL 5IK3B 4U6XA 1XF5A 1HDMA 3U4AA 1UGNA 2AXFA 1NCDL 4RGNC 4W6YB 2YA1A 4BUHA 2PN5A 3OZ9L 3HRPA 4TRPL 1UM4L 5ESVB 2ADGB 3I6KA 4P5MB 3CVHH 2AK1H 2Y4SA 2Z4QB 1MHEA 3O2DH 2DD8L 3AMLA 4BFEA 3WFHB 5IR1A 1GHFL 1RUML 2HT4C 2JCCB 4WY7L 5JXED 1HH6A 2EIEA 3G08B 4LCUA 3WN5C 3IS1X 2F5BL 3PDGA 3HZKA 3V52H 4R2GD 3OHXB 3ECBA 4XAKE 3HI5H 1UACH 3PXJA 4V1DE 1A14L 1IL1B 2JJTA 1YEIH 4TUKH 4D9RE 4ZG1A 1TQBB 3RIAF 4Q58C 2NY0C 4O2EB 5IESL 3WIIL 4D9QD 1OSZA 4QHMB 2FB4H 3GMNA 1KT2A 3GB7A 1RU9H 1YN7A 1GOFA 3KR3L 2YA0A 4OF8A 5BS0D 5FEBA 5FO9B 2UUDH 2EKSB 5I17B 4PJAF 3CPLA 3BESR 2ITDB 5E95B 4PJIE 1MPAL 4EI6B 4GBXD 4OM1L 3QEHA 3ULUH 3HC4L 3O6FA 2VERN 1JHTA 4XPAL 2HWZH 3VDBA 5DT1L 4ZPTB 3DVGA 4NQCE 2J5LC 5I6XC 3UYPA 4TVSa 3DURA 3BGFB 5EZOH 5DI8B 3RKDD 3MV11 1FFPA 4JQXC 2BC4A 1HQ4B 1T04B 1FDLH 5J6GA 3EIFA 3TT3L 2J2ZA 5F70A 1CGVA 4C56A 4OZIF 2Q6WA 1XF3A 1I1RA 3NPSB 1G7LB 4OTXL 5C0AE 1U8MA 3UZQA 3UXFA 2A9ML 4QWWD 4FQ1H 1QTYT 1EXUB 3BUYB 4WUUA 5C7XL 3ARBC 2YMXH 1AR2A 3QZWG 4KMQA 4PJEF 5JPMB 3WFDL 5D6CB 4Y1AE 2PR4H 5DRWB 1N4XH 3ULUF 1JRHI 4AIZB 1A21A 5KN5B 4OQTL 4WCYL 5D6DC 1WZKA 5D7IB 3VGAB 1U93B 1Y6NR 3UYOD 4BSVB 2P45B 5F6HJ 1FE8H 2XTJC 4P57A 1NBVH 1X5ZA 4ZQKB 1NC4B 3G6AB 3QFJA 4PRIA 2WW8A 3S96A 3OR6B 3JSSA 5I8KL 3SJVD 4Z7NF 4K3DL 4OFYD 1FC2D 5FO8B 1YECH 3WO3B 1A1OA 1NDMB 3L5XL 4QRPB 2O61B 3MLYH 4XVJH 1QSEB 3O45B 1E4XL 5C3LD 4RZCA 1EV2E 5DO2C 3WLWD 3WS3A 1M7IB 3OJDA 2DYPB 4JHWL 1GC1L 4HH9B 3LKQB 4YDJA 3F58H 5JW3H 1GRWA 1U3HD 5HDBF 4KQ4H 4HPYH 4MJIA 2BOCB 2KKQA 4FNLH 4MNQE 1X6NA 2AEPL 5CZXC 4M48L 4PJ8D 3LEYL 1BAFH 2VAAA 1YNLH 1ZSDB 4L3EA 4GG8B 3RDTD 2AJYL 1M7DA 1LO0H 3SDXA 4JFZL 2B2XH 4EI5C 4BM7A 3MRNB 1KLGB 1TJHH 2QKIB 3MLXH 1CDIA 1IGCL 1YEEH 1TLKA 1XCQB 3RA7H 3MJGX 3ARDB 3SDAD 4MAYC 1B88A 1JNHA 3M45A 4Z7WE 4HBQA 3GRWH 4DN3L 4LSQH 4JO4H 4N0CD 3AUVA 2A0LC 3ULSB 4XNUH 5ESQB 1QFUH 4C83A 4UILH 1L7IH 1CFNA 1OTSC 1RK1A 4XI5C 4MQXC 4R4FL 4YHOL 4HJJL 4WJ5A 4NRZA 5TDNA 3ZHDA 4KVCH 5HYSA 4UB0H 3OKOA 4OCRH 2R2BA 2NY4D 1HHIB 4PG9B 3O4LB 1I8KB 2CJUL 4TYUA 2FR4A 4Q74A 3A0OA 3DNKA 1F2QA 1CE1L 1JGEA 4NOFA 3MA7B 1B4JH 3KPQA 3E3QE 3MLVL 1PG7W 7CGTA 4ENEC 4HHAA 2AEQL 5EU5B 3VXUB 1JWUB 3OB0H 4HZLB 5KVGH 1RUAH 3QZWA 4U6YA 5E5UB 5EZIL 1JWSB 1UADC 4P5KA 3PGDA 2VLJA 4UV7L 3C5ZD 1P69B 3EJYC 2ZKHH 4OSUL 2EDNA 4NOBA 4G80B 4LHUA 2D0HA 2G60H 4QRTB 5HHOD 3VRJB 2P8MB 5JW4R 1A6WL 5MP6H 4PRHD 1FGNL 4FTVD 2CK2A 3OPZH 1NLBH 2CUMA 2YOCA 5JQHC 2BNRD 4WFHD 1OTTD 3DI2B 2DQEH 4JY5H 3BMVA 3WFZA 4P4KB 4BH8A 3G5VA 3HC3H 4HIHB 3O11A 2CKBB 4JQIL 4U3CA 5EO9A 3E8UH 4XTRC 5D72L 3RVTD 4FXKA 3SDDC 2JIXD 2XN9A 5EB9A 2EC8A 4OD2A 4IIQA 1HCVA 3BEVA 4LCWA 1RZ8B 2AABL 2NY7H 5JLZB 2E6QA 1MLCB 2NY3D 1UXSB 2GT9A 4K8RL 5GRJL 3F7QA 3U0PB 1ZHNB 4I9WD 3RKPA 15C8H 3HG1A 4PY7A 3MRDB 1FZOB 1E6JL 4OLZL 2AS5M 5DZLA 4M6OH 3C6LB 1LDPL 1ZA3A 5K9KB 5EC1B 1DCLA 4JFEB 3IJSB 3L5JA 5T1LB 2D7PA 4WFED 3TCLB 5GXBB 1UZ6E 3REVA 1T83C 4ORZC 3BWUC 1J8HD 2CIIB 1UB6B 1OCWL 3BHBA 3WD5L 2F19L 4QRUA 2VDML 5ILTH 1KYOK 3PHSA 1NAMA 2EDBA 1X9QA 3T4AB 4I2XB 1KF9B 2XFXB 2ICWI 2F54D 2DWEB 3OGOE 3T77B 4TNWF 1RUPH 3NAAL 4KVNH 1AKJA 1OP9A 5I18L 4PLKD 5C0CD 3AS3A 1W0VA 1ACYL 5GGTH 3FT3B 5EO1A 2X4SB 4LNRB 3CJJA 1MH5B 3STLB 1VDGA 4JM2A 3FN0H 4X6CF 1G6RL 2E3VA 4JFHE 3RUGA 1MNUL 1PKQB 1DVFA 2VWEC 1LO3L 1ZA6B 1QSVA 2VDRL 3WXVL 4PJBB 4BKLA 2AQ1A 4WI5A 5DHVA 1X5YA 3TVMC 5KSVA 1S78C 3CFEB 4Y8DC 2ZWLT 4L4VD 2V9TA 4N5EC 1P7HL 4E5XA 3MBEB 1NGWB 2R0LH 2YPLE 3B5TA 1ND0A 5HI5D 2BVEA 4BFBD 4HUMB 1RZKL 3HPLB 2C4FT 4P23C 5IW1A 5C0BB 1YEKL 1W72B 2XRAH 1GH7A 3ARQA 5FGSA 4OLXL 2HJLA 4JPWL 2BFVH 1DBJH 1TJIL 3WNLA 5IUSA 3KJ4B 2W91A 3MLSH 1EAPB 4O2FA 1AQDA 1KEML 2BVOB 3CFBA 4H25B 1CF8H 3PWNB 1ZVYA 5C8JB 1KTKE 4UNTA 1WF5A 5ID0A 3TYFA 2M26A 3KHOA 4LIQL 1MWAH 1NGZB 4QT5A 4TVPD 2BRRH 4ORGB 1KENL 5MEND 1NCUA 4G7YH 5IMLB 4Y2OA 4CW1A 1IILE 4GRWH 2P5EA 2P8LB 4U1MB 5I1AA 5C71A 3RX5A 1XF4A 2I07A 1CD9B 2VB5A 5GS0L 1QNZH 1BFOB 1F4WH 4MB5A 1C08B 3FRPG 3L3OA 1OP5K 3LKPB 2AJUH 1RPQA 4G6JH 4XX1E 4HS8L 5JOEA 3MUY1 5FUCC 4LCYB 1QYGL 1MF2L 3DETD 1VA9A 1MCSA 3T1FB 3MXWL 1LEIA 3PV6B 5EOTA 43C9A 2FLRT 4JGMA 4MNGE 2DQIL 3ZKND 5CILH 2C4FU 4R26L 4KUCD 2FJGA 2GFBA 1AGEA 1FNHA 1YEHL 4J3UA 1MCRA 4QTHB 3GNML 2EDQA 3TT1H 1ZT1A 3J7HA 3TNNB 5F7EH 4GRWF 2VXVL 3L3IB 1DDHA 4L8BB 1TMCB 3T0XA 5T3ZD 2B4CC 3WHXB 5JIHA 3VXNA 3KPMB 1A9EB 1UJ3C 3MJ8B 2QSVA 3D39D 3F6IA 1WLHA 2GJ6D 4HC1L 1X44A 4PIRF 3IU3B 5GGSA 5T3ZL 4HMCA 5H2BA 3KLAB 4R7DA 3VCLB 3OF6A 4MJ6A 1KB5A 1IEAB 3QPQD 2HLFD 4FFYH 1YC7A 2EDKA 3MV7E 4PPTA 4PP1D 5D93B 3TV3L 4Z7OE 3SDCB 2GKIA 2KQMA 2R29L 4PJHE 5CUSL 1QLFB 2IAMC 3ZE2F 1P7QB 3H9SB 5GISH 2MJWA 3N50A 5D7JC 4JDZA 4YX2H 3VFSB 4EXKA 1MEXL 2E7CA 3DVNA 5ADOH 4E0RA 1P7KB 3FT2A 2B7DT 2AV1A 4RIRB 4PBWD 3KPLB 3DLQR 4WV1A 3I6GA 4PJCF 4UNUA 3FRUA 3LMJL 3OKEA 5EU4B 2DQJH 1OAKH 2W65B 5GSVA 4PG2C 1HN1A 1YQ2A 5C0IB 1J5OL 1NCDH 4FP8L 3OZ9H 1CGTA 1ZHBB 2AERT 3BZ4B 4TRPH 3W0WA 1UM4H 3NCYS 5DRZB 1U8KA 1TITA 5J11B 3GMQA 4PJGA 2DD8H 4JKLA 4Q9QL 5T1KA 5L2KB 1GHFH 1RUMH 4WY7H 1BWWA 2YR3A 2JB6A 4OF5A 1VCAA 4LBEB 3ULVD 4LLYA 1PYWB 3V5DB 2F5BH 3U4BL 4KKAC 4PRPB 5KTEL 4ODTL 2XIDA 1PY9A 4S1QL 2RHEA 4YK4C 4X9GA 5HYFA 3LKOB 5D1ZD 3BEWA 1KSRA 1A14H 4PTTA 1BFVL 1G7MB 1E27A 4ZFOB 3DPBA 3WIIH 5IESH 2FX8L 3SE4C 2EIDA 1QP1A 1I3GL 1GPOL 3T2PA 5BXFA 3FFCA 3KR3H 1LEGB 3V0WL 1UKTA 3NCEB 3QA3B 5D4QA 3HE6B 4Y4KD 2KBGA 2VISB 4DKAA 1XFPA 1A6AB 2MOVA 4IMLA 2NW3B 1MPAH 4J23A 3F7VB 4L9LB 1HSAB 3O9WA 4OM1H 4DFHA 5LWYL 2NXYB 3QQ9C 3HC4H 3TN0D 2EEAA 2V7NB 4XPAH 3QIBB 1MCCA 3EYQD 5DT1H 4X7TA 5DJXB 4AZ8A 1I1YA 4RGNB 2J8UF 5CSZA 4UOW1 1KJ3L 4X4YB 1NFDE 3P4OB 5D7LD 1HXMA 5DEFB 3QDMA 3TT3H 1DBAL 3LY6A 1A64A 2XPGA 5INDB 4J7RA 1FN4A 5ITFA 1BWMA 4ZFGL 1YDPA 3PQYA 5F7DA 2YXFA 3EO1A 3D18B 4OFPA 4OTXH 3WN5B 3UJIL 4HF5L 4Z7UA 1JZ7A 2A9MH 1ZKAA 3CSYB 4IOSD 4BZ2L 4GRLC 2MMXA 3VXME 1AGCA 3S88L 5EIIA 2VXTL 3WFDH 3HB3C 3KGRA 4XWOD 4S1RL 3NA4A 2NY0B 4YFEA 3WE6A 4YGAB 1K4DB 4WCYH 3NBNA 1FZMB 3ZDYE 3F7PC 4NC1C 1LMKA 4ZUSB 4QOKB 4HXAL 2F15A 1QFWM 4U6HA 4K55A 2CGRL 5I8KH 4K3DH 4QCIB 3QXDA 4PGCB 3ZT5A 2W60B 4MDIB 2LE9A 3W82A 3L5XH 1F3DJ 3BN9D 2F8OA 4RA3A 1E4XH 4KJWD 4PRDB 2DIBA 2J5LB 5F6HI 5I6XB 5D5MA 3VXSB 4GXVL 3CSBA 5IB5B 5FDWA 1MLBB 4JHWH 1GC1H 4OAWB 4NP4L 4TUOB 1S7VA 3FFDA 4HUUB 5D2LA 4PJFA 1OF2A 3T04D 1GXEA 3QUXC 3ZL4L 2XWJA 4PJXA 2AEPH 4ALAL 4M48H 5IMKA 3LEYH 3BH8A 4PJ5A 3F12B 3VXRA 1RZ7H 3T0ED 1IGFH 5F1IA 4ODVH 3REWA 4G7VL 4S2SB 4M1DH 4OZ4A 4XXDB 3UROR 5FAAA 5FO7B 3DARA 4WW1A 3VGEA 2AJYH 3O6FD 5HYIA 1R3KA 1P5VA 4JFZH 2P7TA 3MBXH 4P5TD 3ARBB 2UYLB 2Y5TA 1IGCH 3VI4F 5DHYA 5C0RL 1KTLA 4KTYA 2DQGL 5IHZA 2A6KB 3DO7B 1W0WB 4X99A 3CU1A 4F9LC 2D0FA 3HRZB 1DUYB 3GJFH 1ZLWK 4DN3H 4C56D 2GK2A 2OBGA 1ODAA 3QIUC 3ZT6A 1GVIA 2XTJB 4J3SA 1NGPH 3T2QA 1AR1C 5HYJB 2IQAB 4UI2A 4R4FH 3MUGA 4YHOH 4DCQB 4HJJH 4WUUD 5EFIB 4O58L 3QWQB 3Q2CA 1JK8A 2IPUK 2V5SA 4KAQL 3UTZB 2CJUH 3QEQE 1BHGA 4P5MA 5ESVA 1CE1H 3MLZL 1JTPA 1CGSL 4MZ2A 1I3VA 3QEGH 4IMKA 3PHQA 3WFHA 2L0DA 2OXGA 3MLVH 2JCCA 4TULL 3G08A 3AROA 4N0YL 3SE8L 2AEQH 5IKCA 5IG7B 3QFJD 4PRID 5IB4A 4KI5F 5EZIH 1N5AB 3OHXA 2DBJA 1ETZB 3IFPB 4QHUB 4XNQA 3IXAA 4UV7H 4WU7B 4EI5B 5C2UB 1AC6A 2Z9TA 4P49A 1YUHB 3BKML 2HAZA 3FQRA 4OSUH 5DFVD 2GIYA 2CRIA 4HGWB 5IHUL 4MAYB 4MJID 5KSBF 5IB1B 5IEKB 1U8OB 5HDLA 5FO9A 5FECA 1T0MA 2EKSA 4Q7DA 1A6WH 1FGNH 3HFML 1V7NL 3VFGL 3UPRB 4FN0A 2FBJL 1CWVA 3AS2A 1YEJL 4EI6A 4MXQD 1BJ1J 1H3VA 4JQIH 4L3ED 3WNKA 5IVXB 3ZLQC 5JUEL 3RIAK 5D72H 4L9DA 3V0VA 1FHGA 5DI8A 3IDJA 3UTTE 3NOIA 3VRLF 4AQOA 5CD5D 4DEPC 3B3IB 5F7LB 2AABH 4JAMB 2R15A 1MIML 3VGFA 4JFFA 4K8RH 5GRJH 1K85A 3S4SA 4H0HB 1NFIA 3H7BB 4JANB 4OLZH 2H2PD 3MYJB 4Z9KB 1LDPH 2IPTL 1EXUA 2Q87A 1UENA 4D94A 1RJLA 1FZJB 5IMMA 4M43H 4JVUA 1A9BB 3MRHB 5JPMA 1E4XI 3RNQB 4KKLC 3C9NB 3WD5H 1X5GA 2F19H 1JNJA 5IHLB 2VDMH 2EDFA 3NH7L 4AIZA 1QKZL 5KN5A 5CWSA 2NX5E 5J4MA 1BVKA 5A2IH 3LIZH 4JHZA 4JGUA 4BSVA 3JWDL 3HMXL 3WDJA 2L7JA 3DBXB 1NC4A 3G6AA 1P5UA 5HHMD 3NAAH 2OS7A 1LDSA 5I18H 2Y6SC 4QRPA 5GJSL 2O61A 5CD3B 1ACYH 4FMKA 2VLJD 2HJKB 2XKNB 3O45A 4P2YA 2YD4A 1M7IA 4PJ9C 1EIBA 2DYPA 2EDXA 1CQYA 2FSEB 4HH9A 1G6RH 4YHLL 5DDHB 1EEQA 4ZMAT 4UTAL 1MNUH 3P4MA 5C08B 4G9FE 1QLRA 2VDRH 4LHUD 3WXVH 4F7TB 3RIFF 3FO1B 2RFXB 1K6QL 4OGAD 4ZYKB 3PF2A 1EVUA 5T3XE 4E41B 2YD5A 5JOFB 3B9AA 1RZKH 2DLHA 4EVNB 4JRYA 4OLXH 3IFLL 1KIQB 1OVZA 3MRNA 3MRQA 2QKIA 1XGQB 1TJIH 4OLYL 2FZ3A 3BDYL 4PLOB 1IGYA 1XCQA 1TZGL 3UEZA 1HH9B 1CL7L 1MHHA 4LKCB 4LCWD 3DUUB 1G84A 3DROB 2UWEB 1MAJA 4LIQH 1D6VL 4P3DB 3CXHK 5JQ6L 3KLHC 3OBAA 1KENH 3HG1D 1ZVSB 3JTTA 4JDVB 4POZD 3ULSA 3ZKSD 5AG9A 5I15L 3PWUB 2HFEB 4HXBH 5L8LB 3D69B 3IAQA 5EO0B 4Y5XC 1XH3B 1YY9C 4KROC 2OYPA 5DQDL 4W4OC 2QEJA 1C5BL 4PG9A 1I8KA 3MNVB 4XHJD 2F8VA 4KHTH 2PW2A 4M6ML 2NNAB 2YK1L 5F21B 3VDAA 1JYXA 3KAAA 4HS8H 1F45A 1D5IL 3KYOB 5FIEA 1QYGH 1MF2H 4EIGB 1WISA 3TVMB 3GSWA 3MXWH 2N1KA 3U0WL 1UQSB 3V6FB 2DQIH 5IW3A 4ZNEE 2YD6A 3KVQA 4MCYB 4R26H 1JWSA 1AKJD 3UTQA 4P23B 4YDIL 1YEHH 1XIWC 1XGUB 3TH3T 3D6GA 6FABH 3GNMH 1A6TB 2PUQT 3PDOB 4JM2D 1T7YA 4D2NA 1BBDL 1WAAA 5FM4A 5JW4Q 3O6ML 2VXVH 3BQUA 1DVFD 4WHCA 3R8BB 3BO8B 2O5ZL 3QG6B 3G04B 2DQFA 1B0RA 4QXGL 2D2OA 5FGRA 5T3ZH 1BD2B 1ITBB 1P4IL 5J8OA 1TQCC 1NAKL 4MQ7B 4Z77A 1W8NA 3VD9A 1R3JB 4U6TA 4HIHA 2CKBA 1WAAF 3TV3H 3BMWA 4N0FB 2C5DC 2R29H 4PD4K 1H0DB 5EH1A 5CUSH 2Y23A 4OUOA 1ADQA 1MRCL 1QSFE 2X5PA 4V2BA 1F3DH 1RZ8A 5DJ6B 1IRAY 1MEXH 5JLZA 2Z92B 4A6YB 1SJHB 3GMRB 3QFDB 3U0PA 3BISA 3NIFF 2Y5EA 1KXQE 4LCCB 3C6LA 3LMJH 4JFEA 3IJSA 3P0YL 5D1QD 5T1LA 2K9UA 2P5ED 3TCLA 2QQLL 3K1KC 4KJQC 3OB0K 2D4DA 1J5OH 4AEHL 4RWHA 4FP8H 4PJ7B 1E4KA 2CIIA 1FVDA 4IRJA 2N7AA 2AXHA 3WFEL 3GSNL 4ELMB 4Q9QH 2IF7A 1F02I 3T4AA 4OGYL 2DQDL 2DJ4A 2P42B 5DJ8B 5C09B 1URLA 2NR6D 2Y72A 1UZ8A 1QO3B 1UJ3B 1O7SA 2XFXA 3U4BH 2VABB 1M1SA 5KTEH 2DWEA 4ODTH 3T77A 1AC0A 4KMTL 4S1QH 4MA3B 1ZLVH 5JXEC 2ATPB 1FZKB 3FT3A 2BY2A 2X4SA 3O6KL 1BFVH 4LNRA 1MH5A 3STLA 1Q1JL 3MPCA 4R2GC 2CSPA 1EO5A 2FX8H 1I3GH 2IAMB 4ONFL 4WDIA 4N0RA 4I8DA 5D7JB 1JGVL 3V0WH 4PJBA 5D70L 2PO6C 3UTSE 3OKNB 4TNWK 3M8OL 2WANA 3MBEA 1NGWA 2H1PL 2E9IA 5LWYH 4NO0B 3HPLA 5A3IC 3OF6D 5C0BA 1W72A 3PE9A 4NFDA 1G0YR 1KJVB 3DGGB 3N85L 2WP3T 4GBXC 1KB5L 5C0JA 1RVFH 1EAPA 2SEBB 3BD3A 3PWJA 2BVOA 4H25A 2OR8A 3PWNA 1DBAH 4RFNC 3LN9A 5C8JA 1TETL 4NQEE 4NGHL 1JPGB 1NGZA 1AHWC 4ZFGH 2AEIT 5B3NA 4ORGA 3UJIH 4HF5H 3LN4B 2NZIA 4G6ML 4BZ2H 4YK4B 2P8LA 1OAYL 3S88H 3WFCL 3MOAL 2VXTH 3BDBA 4G8FA 4S1RH 1BFOA 4PB9L 1C08A 3W0WD 5K9QG 3LKPA 4M9OA 5TDPA 1KB9J 2XI9A 1EFQA 5T1KD 4XC3L 5CP7B 1MI5B 4FZEL 4HXAH 3UYRL 2ARWA 1J12A 3PV6A 5J6HB 2CGRH 1MCIA 1KCUL 2DLTA 1ED3B 1PJ9A 1D9KC 1INEH 1ZMYA 3HUJF 1N26A 3I84A 4NUJB 4YQXL 4GG6B 4QTHA 4ODBD 1DQJB 4GXVH 4ETYA 3OR7B 3TNNA 2O26U 5L2JA 2J7LA 3L3IA 4ZO6A 4L8BA 3FAXA 3QBTB 5J9PB 4NDMB 3FFCD 4XNZC 2I5YL 3WHXA 4AH2B 1DLFL 2PXYC 4LLVA 3ZL4H 4ALAH 3KPMA 1A9EA 3MJ8A 4OF7A 1K8DA 5I66A 5DHXB 3IU3A 4LRIA 4ZSOB 3KLAA 1U8QB 4GQPH 4G7VH 3VCLA 3O9WD 1IEAA 4GRLB 3T3MF 4X0KA 1R5VB 2J4WL 4MQTB 4GKSA 2BP3A 3MJ6A 2EE6A 5C0RH 3U4EB 1BMGA 2DQGH 3OXRB 5TPWL 3T65A 3VXQA 1DSFL 2G5BB 3QDMD 3RWGB 3UPAA 3IFNL 4X98A 1F58L 5ALCL 5K9OB 5HVWA 3SDAC 2XXMB 3PQYD 2DQTL 3FT4B 3KPLA 4ZPVB 4O02L 3HE7C 5HYQB 2JKXA 2UY7A 3UTPE 1FNGB 1GOGA 1E28B 3IT8D 4N0CC 4O58H 4P2RA 4YPGA 3CAFA 5C0IA 4KAQH 5I8EB 1ZHBA 1FLRL 3BZ4A 4HK0B 4HWUA 3MO1A 4H8WL 3MLZH 5DRZA 1CGSH 5DJDB 1LO2L 5L2KA 2FH8A 4L4TA 4TULH 5KS9E 3QUXB 4LBEA 1PYWA 4N0YH 3V5DA 1SJVA 4PRPA 4J2XA 2J8OA 2UZXB 2V5MA 1KJ2L 2R1WA 3OGCB 1IM3B 2VL5B 3MRJA 4YBLC 2J6EL 4WWKC 3WCYA 3BKMH 2X89A 4ZFOA 2OL3B 3D1MC 2W0KA 3RTQA 1RZJC 2WQRA 1BQHA 3H6JA 1EO8L 5IHUH 2IBZY 3C5ZC 1U8HA 4OUUB 3QA3A 1WCBB 1FNAA 2R0ZL 5JOPE 3P73A 1RY7B 3HFMH 1V7NH 3VFGH 5T1MA 3VFNB 2FBJH 5I16B 3QR2A 1YEJH 4PJ5D 3VXRD 5JDSB 1BZ9B 4L9LA 3DV6B 4K3HA 4XP1L 3O3AB 2V7NA 1J1OL 1G7JB 2WLZA 5JUEH 3KPOB 1SQ2N 1HSBB 2X1QA 4U2YA 2AV7A 4X4YA 1OTTC 3GKZA 1UCTA 3P4OA 3WNMA 4HFUH 3VGBA 4I3SL 5DEFA 4Z0BL 3RVTC 1CBVL 3UDWA 4XC1L 1ZK9A 5INDA 1MIMH 3T8XA 4L8SA 1I1AA 4U1SA 3V6ZB 3KPRE 1N0LA 1BIIB 1JCKA 3UP1A 4QY8B 3CSYA 1GZPB 2IPTH 2NY3C 5DC4B 2ENYA 3OAZK 5GRVL 4NQXB 4XAWL 2PYEA 1KG0A 3X17A 3AREA 5BJTB 5SWQB 3NH7H 3V4VL 1QKZH 1K4DA 4F3FB 4OIIL 4F57L 3JWDH 1RI8A 3HMXH 4QOKA 1CDBA 1K8IB 4LMQI 4XGZA 4OM0L 1ZWIB 4C54A 4YXKL 5IWLC 1BF8A 1B6UA 1T1YA 4QCIA 2W60A 4AG4L 4MDIA 1GGYA 2HT2D 2OSLB 4NKDB 5GJSH 5EUOE 4S1DD 5D1XC 3ZZ1A 5CAYB 5IROC 1ULVA 5DVKA 1MLBA 2CD0A 5KG9B 2NMSA 3TCXA 1CE6A 1FFOA 4G42B 4JQXA 4TUOA 1F97A 4HUUA 3U36B 1LEKB 4DEPB 3K8MA 2OLDA 3GSRB 1IAMA 3D85B 1J87A 1RIVL 4A2MA 4MMZC 3X12B 1K6QH 2YC1B 3QWRA 4M6AA 4OFKA 5E2JA 4DUWA 8FABB 2IBBA 4XXDA 5DGRA 4PRNB 3IGAA 4HJ0D 3IFLH 2VRAA 3CZFB 3GSXB 3ZSSA 5HI5C 1FCGA 4OLYH 2HG5B 2VC2H 4U0QB 5DJAB 1TZGH 2A6KA 1W0WA 4UQ3B 2CRZA 3R8QA 5GGRB 5K9QI 1CL7H 4X6DE 5D6DA 3QDGB 3HRZA 4MHHG 3NZHL 4K94C 2XTLA 2Z93B 4JFFD 5JQ6H 4PGJA 5F72S 1ZT4B 3LSOA 1MHPL 3KPPB 5HYJA 1AD9B 1F4AA 2IQAA 3CC5B 1PEZA 2L4OA 3QO0B 4MA1C 4RAHA 4F7EB 5EFIA 5DQDH 1P84J 1C5BH 3UTZA 1G7PB 3E6HB 4U49A 4PJ9B 3EDKA 4UU9B 3D2UB 4M6MH 2YK1H 3S36L 3OXSB 3K8LA 1D5IH 4WTZA 1J0ZA 3MRBB 4YDVA 5FA4B 5KVEL 4IRZL 4C4KO 3T4YB 5M95B 3U0WH 1O5DT 2X44D 1NC4D 4KGLA 3U46B 5IG7A 1NCTA 1MVUA 4P2QB 5EIQA 2DJSA 3ILPB 4G3YH 1CDJA 3IFPA 4QHUA 4YDIH 3MOQA 4QRPD 4WU7A 5C0DA 3ZKMD 3ROLB 3WBDA 4EI5A 2CO7B 1Z0MA 3ZKNC 5D2NC 3TBTA 1BIHA 1JZ5A 1YUHA 1EA9C 3I2CL 4ISVB 2DYPD 1BBDH 3O6MH 4Z7VF 1CR9L 3DXAB 3KYAA 5KOVC 2X4NB 1BF2A 4MAYA 4UNVA 4J12A 2O5ZH 2P46B 4FA8A 5EBGA 5FYJD 1U8OA 3B43A 1I8LC 2LFGA 4HUNB 4QXGH 4UIMB 1CK0L 2DLEA 3UPRA 3GI8L 1YY8B 5GGRY 1PGRB 4AENB 5B4MD 1P4IH 3GJFK 3HZYA 5DHVH 1NAKH 4Y5XB 4JRYD 1NBYB 4KROB 2WQ8A 2ADIA 1QFWL 4UOJA 3GEWB 1MRCH 2HLFC 4LFHD 5I74C 4PJAE 4Z95L 4PP1C 1SBBA 3TO2B 3PGFL 4YDKH 1HYSD 2C3WA 1CFBA 1NUFA 4PJIA 3H7BA 2P8PA 3I85A 2C3HA 5FOBB 3M1BB 5IJKC 2XV6B 5CJBA 2PTUA 4NM4L 4JZNB 2QQLH 4KGJA 4NQCA 4AEHH 1A9BA 3MRHA 1XIWB 3PG2A 4M7LL 2CR3A 1AXTL 4GFTB 2HMID 4JVWA 3U7WL 1D5ZB 4OZIE 3WFEH 3P0GB 1HHJB 3GSNH 1IC5L 5FYLD 3PNWB 4RMSA 4OGYH 2H9GB 2IANB 2AJXL 4RFOL 5SX4H 1QBBA 4LLQB 2IC2A 2W92A 5HPOA 4KU1A 4H88L 3H9HA 4KMTH 5E08L 4ZFFB 3MX0A 2R8SL 1AGFB 4PJEE 1TQCB 2OZ4L 3I3DA 3ULVC 1K9TA 1JL8A 3FQXB 3O6KH 3ULUE 5DJ2B 2FSEA 5T5NG 5DDHA 3FOMA 1H8SA 2D7OA 4ONFH 3O3EB 5B38B 1JGVH 1IGMH 5E1AB 2Z8RA 3BQUD 3BRFA 1CL7I 3DYOA 3I6LD 4F7TA 5D70H 3MCG1 1R3LA 3MRPA 3FO1A 2VZSA 3M8OH 4MS8C 4ZYKA 3MROA 3IKCB 4NM8L 2H1PH 4E41A 3T0AA 3U6RA 5JOFA 4BSWB 4Y4KC 4W6WB 2JTDA 4EVNA 4HKZB 2BSRB 4KV5E 1KIQA 3N85H 1XGQA 5DTFB 1KB5H 5EZLB 3TN0C 3BSZL 5DURB 4B7LA 4RX4D 1GAFL 2CKBL 2A6JA 4XPFL 3C87A 1HH9A 2BDNH 2V5TA 1JYVA 3UJTL 1TETH 3RIFK 3H3PL 4NGHH 2UWEA 4MNQA 1CDUA 4XXCA 3WUWB 1A6ZB 4HJGB 4Z76B 1VENA 3PWUA 1QBAA 4G6MH 2HFEA 3D69A 3C6LD 5EO0A 1JPSL 1XH3A 5DMKB 1OAYH 4JFED 3WFCH 1KXVC 1FJ1A 3MOAH 5T1LD 3C09C 5C0GB 2YWYA 3MNVA 5ECJE 4J8RB 2Q1EA 4R2GB 4PB9H 4HBCH 4OZHF 1I7TA 1D5BB 4IRJD 1P4LB 1JF5A 3MUHL 2CXGA 1T3FB 3OKKA 5DMYA 4XC3H 5HD8D 3OKLA 4FZEH 3H9YA 2PO6B 4Q0XL 4OT1L 3UYRH 5LAXB 3F6LA 1NCAL 3O3UN 2R2CA 5BRZE 1J11A 3MRFB 1KCUH 4DZ8B 2CK0H 1W2KT 4MCYA 2XT1B 3NFPB 4LSUL 4YQXH 1XGUA 1JHLL 4Z7WF 2AJZB 1A6TA 1NBZA 3DX9A 1B90A 2ZCLL 3BN9C 2EDOA 3G5YB 2FEEL 3GSUB 4KJWC 3HNVL 1H8NA 2X4PB 3BO8A 2JJTC 4RFNB 2I5YH 1LK2B 5HHQA 1DLFH 3QG6A 1I3UA 1J7VR 3VFOA 1GZQB 4H26B 1OLZA 1AHWB 1NLDL 3VFRA 4OKVB 5HGHA 1BD2A 3MBED 1N59B 3OKMB 1ERNA 5F1KC 2X09A 4YHKH 1R3JA 5CBEB 1MFDL 3GMOA 4QYOA 5E7BA 5C0BD 2J4WH 4OZFH 3T0EC 3V6OE 3HPJB 4HK3N 5CZVH 2R69L 3VXTB 5J89A 4LVOC 1W72L 4RSVA 1TTFA 5CGYD 3RAJL 4Z6AT 1DSFH 4P5TC 5SWZB 5DJ6A 3QWOA 3IFNH 4A6YA 1QSZA 5D96C 3DUHA 1OWWA 4XWGL 1HKLL 3NACH 3GMRA 1F58H 1ZTXL 5ALCH 5T5NF 5SX4I 3MTRA 4EXPX 2DQTH 1CU4L