4P3CH

Mt1-mmp:fab complex (form i)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy Chain Fab fragment of antibody LEM-2/15
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2014-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p3cH01
3I50H 3LAFA 4S10A 4LGPB 3QULB 2X4NB 4Z7QF 5GSVB 1KIRA 2X4RB 5I1KH 4YIQB 4M1DL 12E8H 4HS6A 4DKAA 3G6JB 3O6FA 1VHPA 4D8PA 1TENA 2A0LD 3T3PF 4NWUH 2VZUA 2J6EA 4WV1A 1G6RB 3QG7H 4NQED 4UUJA 3KPSE 3DI2B 3CFCH 4MNQB 3RUGA 1A4KA 4Z78A 2IANA 3OMZA 5IQ9A 4C56E 1K85A 3WIHA 1CGUA 1X5GA 1WFOA 5T1KD 3EOBB 2AXGA 1EX0A 3U7YH 3Q5YA 5HDQH 1AGDB 1KV3A 2X6MA 1INEH 4JB9L 4OFIA 4LP4A 3SCMC 4MZ2A 1T0PB 2M26A 3RDTC 4G6JH 5C3TA 2DLHA 4KY1L 1OAZL 5DMKA 1R3KB 4GW1B 5IFHL 1KCKA 3LEYL 2X1QA 2FGWL 2I5YH 2ZNWA 1NGXB 1KPUB 5JPNA 5JW4M 3WEXB 1QPXA 1WTGT 3A67L 4XWOC 3PF2A 4GKNA 3LCYA 43C9B 2LTQB 4X6FB 3NN8A 4L4VD 4R0LA 1G6RL 3LQZB 1RULH 5E8NA 1HHGB 1FRGH 5IBUB 3SKJH 3VXRE 1CLYL 4I18C 1KIQB 1IFHL 3OKNB 4OV5B 5IVXB 4KQ3H 3LRHA 2VQ1B 4ZXBC 1T5WB 5A43C 3OXRB 1WWAX 1H3PL 3QWQB 3FFCB 2PXYA 1LHZA 4KDTA 2N4IA 5I1AB 2ZOKB 5CEYA 4OLUH 2JJTC 1MNUH 4FQXC 3BP6A 4TUKL 4X4ME 3RIAK 3D0LA 2W65A 1QVOB 5GS3A 4GRWE 4G8GB 3ARGA 1CDYA 3ROLA 1P4LB 1RZJC 4FFWD 5IEHB 3DO7B 4PP1D 1BVKA 5EOCH 4HUVA 4M7LH 4E42B 5J1AA 1DUYB 1YEIL 1JNNL 1ZT4A 1PLGL 3NVQA 1U8KB 5DVNA 5JMRA 4EUPA 3QT2A 2APXA 3IFNL 3SKMA 1JTPA 3EJYC 4H1LA 4J1UB 3WIFB 5HI4C 3WFEH 4PJIF 5D6CA 1T1ZB 2V5YA 2FATH 2VDQL 4OCNC 4YDKL 1RVFH 3FCTA 1I1YA 4WHTB 1UM4L 1HK6A 3MLRL 2XZCH 5JIKA 1U8IB 3QRFM 2X70B 1F4HA 4LLWB 2UZXB 4YXHL 4CU7A 4FQCL 3BJLA 5TE7H 3WJLA 1XF5B 4LFHD 3FRUA 1F8TL 1JGLL 4CVUA 2C7UA 4PV9A 4N5ED 4ZG1A 4HSQA 1AE6H 2R2BB 1IC5L 2NZ9D 4D0CA 4XCNA 3H0TA 4KQ4L 2CK0L 2FBOJ 4JO4H 1UQSA 3VI4E 2A73A 2XZQH 3KYAA 4O5LL 3KPRE 2BP3A 3VFPA 3NTCH 3OJ2C 2YOCA 1MHEA 4KKNA 3UC0L 5EBWA 3EYFB 2YBRB 5C9KA 4J2XA 2R2CA 5EO9A 1DANU 2QTEA 2FJHB 4QRTB 4JLRA 1ZANH 1EZVX 3MRNB 4YHNB 5GISH 4K7PH 2UVEA 2EDJA 4XPGL 4LPTA 3HI6L 1YQVH 2W0KA 3V5KA 3MOAL 2F58L 1T21B 2X9XA 2P49B 5KS9A 1EK3A 3C87A 1XH3B 5HHOD 5M95B 3KPLB 5DRXB 3WE6A 5IMKA 1I1AD 1QBML 1FFRA 4DAGL 1YY8A 1S7TB 4MDIB 2X42A 1S7WB 4FZEH 3ZTNH 5ALBH 1S7VA 3FO1B 4JQVA 3CH1A 4MJID 4RQQA 3BKCL 3LZFH 4HXAL 3MRMB 3GMMA 2B4CL 3O81A 2FSEB 3LKNB 3MRKB 4X9BA 3G9AB 2ZP0T 1R6VA 1EJOH 4PGJA 1DQML 4MA8H 1DBAL 1AO7E 3O2DL 4LGSB 4WUUE 2CJUH 4P99A 4ODUB 3H9SB 4KTDH 4JFYA 5J11B 2Z8RA 2VZ1A 2VXUL 5DD0L 2H9GA 1XR9A 4Y19E 5J6GA 2P47B 3AS3A 1G0XA 1J0IA 3C8HA 1A1MA 2Y06H 2BCKA 4R4FH 5BXFB 3QI9B 4HUWA 1A6AB 2EIZB 2XFXA 2E7LA 4PJHE 1QLFB 3FJTA 2J8OA 4YX2H 4ETQA 4OCLC 2GSGB 1A3LH 3ZTJG 3L1OH 3BXNA 1P5VA 5E8EB 1EUTA 1W72A 3ROOB 1D6VH 4GAJL 4LAQL 4OZHB 1I1FA 5DEZA 3I6KA 4Y4HC 1F3DH 4U0RB 3QIBC 4U05A 5FYJU 3KS0H 5CIPH 2L0DA 3BP7B 1VFBA 2G5BB 1OGAE 3CSBA 1JF1A 5C70A 1T3FB 4KI5C 4OLVH 4X6BA 4XNMB 1C12A 4BQ9A 4PG2A 4TNWK 2CIIB 5AD0A 4PS4H 1C16A 2GSIA 5IGXH 2N7BA 2DLFH 4RNRA 2QQNL 4KUZH 1KULA 4L3CA 1JHTB 2YD3A 2YA2A 2Y5TB 3NACL 2ITDA 3MRLB 3NFNB 4L29B 4NHCL 1H3TA 3NCFB 1G9NC 4UB0H 3U4BH 5IM7A 2JIXA 3UBXI 4MYWB 3SKOA 4I2XE 4PFEA 4R4ND 4ZUUA 2E9WA 1CQKA 1EEYA 3K81A 2XNAA 5H8DA 4IIQA 4X4MA 1IGMH 1WT5A 3NCYP 1RMFL 3MMEA 2Y07H 3GHEL 5DTFA 4FQ1H 3HA0A 2ADIA 2Z91A 1J0ZA 1AHWA 4KTYA 2D7MA 3V6OA 5LBSL 3BZFA 3VCLB 4F9LA 3ARBA 3TIEB 4HBQA 3GUTA 1XR8B 5IF0B 3BDYH 4RZCB 4M1CD 5EU4B 5EUOE 1EA9C 1TDQA 1FORH 5AZ2H 2HWZL 1CD9B 5DD3L 3RA7L 3ULSB 1WGOA 5IVZB 4P23C 3DIFB 5C6TL 1ZHNA 4U1NA 2L4OA 3GMPB 2FDBP 2NLJB 3CSYB 3MACH 3VXUE 2FO1A 3MLWH 3B43A 1NDMA 5DMYA 3UROR 3DHJA 5IT2L 3FQRA 2EO9A 2H32B 3LS4L 3LN4B 2I25N 2R69H 4KAQH 4XCYA 5C08B 1CK0H 3DROA 4P3WA 1IGFL 1A2YB 2X4OA 4Y1AD 5HPMA 1RFDL 4BUHA 4WO4C 3ZKND 1ES0A 4BZ2H 4FQPA 4MD5A 4XNXH 3WYRA 5IWLC 4E9LA 4RWYH 3MYJB 4ZD3H 1J1XH 3K4AA 1NMCC 5JW4R 5L6YH 1HNFA 4R90L 4KK5C 4RGND 1OM3H 1G9ML 3KPRA 4Y89A 3BIKB 1F4YH 1CFTB 2YD5A 5F96L 2YD6A 5A40E 1EDQA 5F9JB 3FHAA 1AC0A 4JO2L 1IMHC 4QHUA 1Z2KA 4I3RL 4LSQL 4V2CB 4GAYA 1AGBA 4KK9C 3ARDA 3BZ4A 1CXKA 2DWEB 3TT3H 3F8UB 4LKXB 3CFDB 3P73B 5J13B 2EDWA 3IETB 4LBEB 3GHBL 4ONGL 1J86A 1OT2A 1FO0A 1NCWL 4PJ5D 3B6SB 4PJDE 4ENED 3T0VA 5KJRH 4GKSA 1U58B 4NGHL 5FYJE 5HHQA 4KRLB 5IEKB 5DRNB 3S37X 4HUNB 4PB9L 2G9HB 1ZS8A 4OD1H 5HYEA 1CS6A 2A9NH 3VXMD 4P9HL 2VXSH 3MA9H 4HS8H 4ZSOB 4RISH 5HYFA 1UJTA 3LQAH 5GJTH 1MCHA 3F7PC 3RGVD 3GBML 1DBJH 1S3KL 2F5BH 3UZQA 4JY5H 4I0PB 4UTAH 1MCDA 4WHYH 3HNSH 1QRNE 2VAAA 1YNKH 3O6FD 3IRPX 3QEUA 1AO7A 3DI3B 5EOTA 2D0FA 2V17L 4PJ8C 1SHMA 2B5IB 5HDLA 3WDJA 4K9EC 2R2HA 1PZUB 2QR0B 4HGKC 4Y19A 3PP3H 4CMHC 5TF1L 3JTTB 4R8WL 3L5JA 2MKLC 4HG4K 4XH2B 3TO2B 2GCYA 5CEZE 2AKRA 5E1HB 1OD9A 1LEGA 5K93A 2ENSA 4RMSA 4ZFFB 2E6PA 1QP1A 1UJ3A 1HYSD 3WIIH 4XI5D 1FQ9C 4FG6C 4LL9A 4IRJC 5GGTH 2Y36L 1EFXA 2HFFB 3ALXA 4HKXA 1I3UA 3SGJA 1IAII 3F7RA 2YUWA 1XF1A 3D5OF 4EN3C 3IDIA 1LK3L 2APWA 4Q2ZB 4Y4KA 1OGAA 2XA8H 1C5CH 1KJ2L 1HWGB 2DQGL 1OAXH 1S7QA 2Z8WC 3EZ8A 4HHAA 5IUSA 5AZEL 1AP2A 4U1JB 1T22A 2ORBL 5E2UH 4F33A 1EVUA 3E3QE 3MCKA 4NQVB 4U6HB 3SBWC 4O2EB 1EVTC 1JGDB 3U79A 2ZUSA 4OCRL 5CJOL 3MRQA 1QFOA 4OZ4B 1UWXH 1RAMA 3OR7B 1CICA 1UM6L 1WICA 3O9WA 1H5BB 1HHHB 4JFXA 4UT6H 2BVOA 4G8IA 3IVKA 1VGEH 1G7LB 1G7PA 5HYSG 3PP3K 3U0PA 3I75A 5DLMH 2IADA 1CXHA 1AXTL 2G60H 5E2WL 5GGRB 1D5BB 1U0QA 3GRWA 1BLNB 4I2XA 1N6QL 4XVUC 3ARPA 5ANMA 2PXYD 2XXMB 2E7BA 4ZUWA 5HHMB 5D1ZC 1Q8MA 3F12A 1J87A 2IQAA 1A47A 4FA8A 2YD8A 1AIFA 3B3IA 2R2EA 4UV4L 4WDIA 4NJ9H 4PRDA 3B9KA 1XGUB 4QHMB 1C7SA 3CC5A 1PW3A 4EOWH 3W2DL 5I0ZA 4K3HA 2IH1A 5HGBA 2GK0B 3VFWA 2DQIL 2PCPA 5H94B 4NNPH 4XNZC 4HX1B 3W82A 3DLQR 2V5SA 1AXIB 4WW2F 2OBGA 4NSKB 5B38B 5GGUA 1NGQL 4LSVL 4QRQA 1UWXK 1FV1B 1JK8B 4HWNA 1SBBA 1NANH 2OSLB 3RNKA 5MI0C 4YUEH 3VXUA 2VDML 2VLRE 3T2NL 2GK2A 3VWJD 5JUEH 1JE6A 2XG5A 4MNQE 1R3LA 2V6HA 3L3KB 5HHPB 3O3DB 3BFOA 1KLUA 2Y6SD 3SDXB 3T3ME 3ARFD 3SPVA 3ULUL 4KJQC 2CLRB 5LQBL 1MFAH 5GQBA 1MJUH 3T0EB 2FRGP 5IR1A 1V7NH 4JZOB 2WUCL 3MOQA 5DHVB 3D25A 3RVUC 3QNXA 4P59L 1RZFH 2CGRL 3MJ7B 4LCUB 4MXWL 4POYA 5FYLH 4YO0B 4CVZA 5JHDA 1BQHB 1NUFA 4MJ6A 5D1XD 3LDBB 4Z5RA 4LRNL 4ZS6D 2L7UA 3KGRA 2ENYA 4IOIA 5IJVB 4MMZC 2CKNA 3VWKB 2X4QB 1NFKA 2E6QA 3QUXA 4I4WA 4PLJC 1AGCA 3SEPA 3MRPB 5C9JB 1DLFH 2BJMH 2EIDA 4PJDA 5EO1B 4C4KT 3VFOB 15C8L 2NX5A 1WWBX 2DD8H 3S3JA 5IOPA 2LU3A 1A22B 3R4DA 4M1GL 4TQEL 1UT9A 3E8UH 3X17A 5ACZB 3GMNB 4DCQB 5GGQL 1NAMB 1J1PH 2GI7A 4Q6IB 2NY2B 4NP4H 1QO3A 1BP3B 2KL6A 2VRAA 1I7TB 1EEUA 2XKNA 2V2TA 5CJQL 3MV9B 1QRNA 1T66D 5BOPA 3PDOB 3F6LA 1EH9A 2NY5L 3B9AA 4Q6YA 4OD3L 1J0JA 2IALB 4APQC 5BS0B 1F2XK 1SY6H 1SYSA 4LIQL 5T5NF 3UTPD 3ZYIA 43CAB 5J56B 5F7DB 4JFDB 5A3ID 1OGTB 2VLMD 3FN3A 4XP1H 5DJ8B 3S34L 3WSQH 5KSUB 1XIWC 4ZO6A 2DQUL 2W9DL 4XPTL 4I3GA 3I02A 4FXLA 5CBAB 4ONOA 2HRPH 2FH6A 1SEQH 4LLMB 2NR6D 5D7SL 3ZDZF 5E70A 3WKMH 1TTUA 1B9ZA 2JCCF 4HCRA 4DQOH 3MGTA 2CKBB 4ZYKB 1NJ9A 3IJYB 3VFTB 1AGFB 4K71B 3T2PA 3WXWL 1A4JB 4ODXB 2BY3A 3VFSA 5I17A 4N0YH 1VDGA 2E9JA 1LE9A 2XPGA 2YPVL 4WEBH 1NAML 4UIKL 2AJSH 3PNWA 3WO4C 2XZAH 1CGSH 1GAFH 1CTOA 1LD9B 1MCNA 3SE4C 4NQXA 1OAYH 1NBYA 1NSNL 3N1QC 3O4LD 5K9JH 2JB5H 3BPCB 1FFQA 4I5BB 4O4YL 1AGEA 4PPTA 3KR3L 4JFPB 1DQLH 4ZFOB 4LPWA 2IC2A 5D4QA 5ADPL 5DYOB 4AMKL 4BUGA 3BJ91 5D2NE 3IXAB 3MO1A 4YR6B 1JHLL 4BK4A 5C0EA 5GS1B 1S9WB 1CIDA 3VI4F 5F7WC 1GSMA 1RK1A 1N2RA 1TZHA 1I3RB 3O3UN 2I9TB 2ZSWB 4LGRB 3BP4B 1K8DB 5IW6A 2J4WL 3QULA 2X4NA 4GMSL 3UZVB 5GSVA 3KXFD 2X4RA 4W6YB 2HFEB 2E7MA 4YIQA 2ZPKL 5E9DB 4CAGA 1RZJH 4WI6A 3G6JA 4F15B 5EBMB 1L0XA 3CPLB 3DSFL 1CBVH 2DYPB 4PLOB 1G6RA 1EGJH 3B5HA 1N59B 4F9PA 3VGAB 4MNQA 1BBDH 1BQLL 5B39B 5JOPE 1EV2E 1QQDB 3UJJH 4TVPH 4YHYC 4ZFOL 5SX4H 4LHUG 4ERSH 4R2GB 4RIRB 4Z95H 4X7CC 3EOBA 5GRUH 1KCSL 2IPKB 1AGDA 4FFWC 4R26H 3L3GB 4PP1C 3MBEB 5F6HI 4PP2B 4QLRA 4WHDA 2FO4B 1L7TH 1D5ZB 1C5BH 5E4EB 3G5VB 4OZHE 3D39E 3MJ9H 1R3KA 1IGCL 4GW1A 3VXOB 5DUPL 1MJ8H 4M4PA 2GAZB 3MXVL 2CUIA 1NGXA 1KPUA 3SE3C 3ARDD 3O45B 1CLOL 4PJHF 3QCUH 4RFOH 4X6DB 3QNZB 3WEXA 4NN7B 4W6XB 3G04B 1TQCC 5GRJH 3MLPA 4X6FA 4W70A 5F6IC 4Z76B 1BF2A 4K3DL 4Z9KB 3LQZA 2EO1A 4RBPH 1KCLA 1HHGA 3O3EB 3AY4A 5F9OH 4CKVX 1U3ZA 1T2JA 1WUNT 4L9DA 1FSKC 2A38A 4HIEB 4O2CB 1KIQA 3OKNA 4O9HH 4OV5A 4FABH 3DRTB 1AFVL 1BEYH 2VQ1A 3OXRA 4GO6B 2VZ3A 3FFCA 2PO6D 4N90D 1OW0C 1ORQB 5I1AA 4N5EC 3RP1A 2ZOKA 4LSSL 2DKUA 4YDVB 1WEJL 4XBPB 1QVOA 1HIMH 4G8GA 1TZGL 3JV5A 4XPHL 1P4LA 4FTVB 1RUMH 3DXAE 3DO7A 3DX7B 5HJ3B 4HKJB 4C59B 1AO7D 2NCMA 1HWHB 3CGTA 2VDOH 4E42A 1N5YL 1CLZL 1DUYA 3LOWA 3FQXB 2VDLH 4F57H 1U8KA 2LFGA 5M94B 1TFHA 2YN5A 3WL9B 4J1UA 3PV6B 3WIFA 4YK4C 3IB4A 4G6KH 4U3XA 1T1ZA 3D85B 3CXHJ 3I6GB 4AEHH 4DKFH 3NIGE 3PQYD 4QCIB 4RBPK 1NAKH 4KV5E 4WFHE 1O0VA 3UYOD 5J12C 4WHTA 1F4XH 1KYOJ 1I1AC 2AJYH 3AUVA 1KELH 4FS0A 1U8IA 5EUOF 3RPIA 1ZEAL 1EFXD 2X70A 4MQ7A 4DGYH 2APFA 4LLWA 1P4BL 4KKAC 4X8XA 3R0NA 5C08E 3F7YB 1BQSA 2XWJB 2GIYA 3TJEL 3FAXA 1XF5A 4Y4KD 2E3VA 4K8RH 5TQ2H 4PJEB 3DTXA 5F88B 3MRFB 2NXYB 4GW4B 1BWMA 3O6ML 2PYED 1LVEA 5KSAB 5C0AB 2R2BA 3GMQA 5EIVA 4YC2C 3DMMC 3O2DA 5I9QB 1KENL 4I48B 1PZ5B 4XVSL 3V4VL 3O9WD 4NO5B 5E7BA 3EYFA 7FABH 1A6UL 2YBRA 3H3PL 2DLGA 1WZKA 3R8QA 3GM8A 5DD5L 2FJHA 4QRTA 1JGUL 4OZGB 4MMXC 5TJWK 3MRNA 3QQ9D 3KWWB 3GSRB 3QFJB 4I9WE 1MCOL 3I2CH 5AUMB 5CGMA 1G9NH 1JWSB 1RUQL 5CSBA 1ZGLB 1U92B 1T21A 4RDQG 5F7EL 5DJCB 1XH3A 3KPLA 2R4RH 5DRXA 5ISZD 2CQVA 3BIBX 3B9KD 4ZSOE 1P84J 3QDHA 4WW1B 2VL4A 1S7TA 4JRWA 4MDIA 1DN0A 4EUPG 1S7WA 3FO1A 3EKCA 1VGKB 2AK4D 2HKFH 4H1LG 4B50A 3BH8B 5FM4A 1IBGL 3MRMA 4OCYL 3MJ8B 1PKOA 1KCRL 2FSEA 3LKNA 2PETA 5FF6B 2OR7A 4ODUA 3H9SA 3VXUD 4CGTA 3GJFH 1CFVL 4ZAKA 3UJTL 5HHXL 4R4NC 3OXSA 3BGMB 1IC7L 5E6IB 2NY1B 5BXFA 3QI9A 3MXWL 1A6AA 4ZOAA 2PTUA 2EIZA 3VG9C 5HTSA 1YEEH 4JPWH 1A6VL 1CZ8H 1QLFA 2BRQA 3SDDA 2J88H 4Y5XB 3UO1L 3TCXA 5A2KH 1X5HA 2GSGA 3V5DB 1X5AA 4GH7B 5E8EA 3TBVB 3CSGA 3ROOA 4LSDA 4OZHA 4AG4H 4CW1B 5JHDD 1HKLL 1MHPL 4Z7VF 3HTLX 5H37G 4M1CC 5I18H 4NCC2 2ZCLH 3BP7A 2G5BA 1JYWA 4G8EB 4XNMA 3GSNL 1FG9C 2CIIA 2XRAH 1TQBC 2B0SL 5CP3H 5FHBH 5GGSB 5CSZB 4PJGE 1TMCB 2ZSVB 1IGIH 4EDXB 1D5XB 5I19L 1VACB 1IQWL 3GJFK 2VJXA 4YDIH 2NX5D 4P4RB 1JHTA 4KXZH 4DTGH 5CUSH 2Y5TA 3SDAC 2XN9E 3MRLA 1QEWB 2D7PA 3NFNA 4L29A 4U1LB 4HK3J 4QT5B 4X7FC 2IQ9L 5BRZB 2W0FB 1TJHL 3VDAA 2YD7A 4RGOH 1N7MH 3ZKNC 4UT9L 4OI7A 1IL1B 2QADD 1OLZA 2GFBB 4NZRH 1CGTA 4HGMA 2O61B 4HXBL 3UCRA 4QKXB 4RGNC 2Q76B 3NFSH 2R56L 3MRGA 1N64H 2VXTL 3UBXB 3T0XA 1FNHA 1P4IH 2E27L 4GXUM 2GYSA 3KLDA 4QXUH 3VCLA 2P5WE 3TIEA 1JTOA 2XTJC 1XR8A 5IF0A 4RZCA 2ZUQC 2ZKHL 5E08H 5EU4A 5B8CC 3KYKH 1T03H 2AVGA 1K4CB 3D87B 4QOKE 2CLZB 4UTBL 4MLIA 2GJ6E 3ULSA 4ENEC 1NCNA 2W9EL 3FQNB 5IVZA 2PYFB 3DIFA 3WS6A 1DCLA 3BD5A 3GMPA 2NLJA 5FUOL 3CSYA 2Q6WB 4N1CA 4PGEB 3O6LH 5C0DB 1NCAL 1NANI 1CXFA 2H32A 2UWEB 3LN4A 3KPNB 4PTTB 4YPGB 5C08A 4CL7A 5CLTA 1BIIB 2A77L 4U6VH 4Y7MA 4JFOB 3OG4B 2IMMA 1A2YA 5JQ6L 4UOW1 4D0BB 1D9KD 1MF2L 3O6FC 1KTRL 1QOKA 2V2WB 3MYJA 3A6BL 1MQKH 1IT9H 4AZ8A 4WV1C 1ZMYA 4KROC 2QJDA 4LIQE 1BJ1H 3H9HA 3BIKA 4JKLA 5LVEA 3IJSB 3T3MF 4JFFB 5F9JA 1JYVA 3D0VB 1Z9MA 2IG2H 1H0DB 2FEDD 3N1MC 4IHOB 3VMOA 3WBDA 2D4DA 2DWEA 1I1CA 1IM3B 4LKXA 3CFDA 3P73A 3S35X 2JELH 3LS5L 2YUXA 3SQOH 1ZSDB 3M1BB 1N4XH 3IETA 4LBEA 2ADFH 4UT7L 4JCMA 1OF2B 3PE9A 1NCDH 1JF6A 3IYLW 4XI5C 2Y25A 2FIRT 2ZWLT 3C6LD 2AXHA 3BI9X 3MRRB 4NZTH 1ZLUH 1U58A 1DZBA 2ZJSH 3GI9L 1U42A 1ZHBB 5CJXA 1BECA 5CGYD 3X3GL 4LSUH 5DRNA 2G9HA 4XPBH 1U2CA 3L3DB 4ZSOA 4XAWH 2CD0A 4KZEL 2Y7QB 4M7ZC 4RAHA 5IMLB 3W5MA 5DD1L 4AL8H 3BWUC 3UTTB 1DEDA 2DF3A 1JI1A 4HJJH 4GG8B 3V4PL 3MV9E 3ZL4L 1W2KT 4I0PA 1EEQA 1IQDB 1VFAA 1P1ZB 3RVXC 5FK9B 4OQ1A 4KKCD 4R0LC 3BKMH 1VCAA 2C1OB 2HLAB 2Q20A 5ESQB 4DKDC 1MHCB 2AEPH 3PGDB 1FFOB 4UZGA 4WCYL 3HC0B 1MRCL 3EO0B 5FV2A 5HI5D 4JFDE 5A1AA 1I7UB 5C1MB 2QR0A 1ADQH 3ARQA 3VG0H 2XKUA 3JTTA 4NQCB 1NGPL 4XH2A 3TO2A 2PXYC 1E4XH 2QHLA 1ZLUK 2EXWD 1MCKA 2WSKA 3G6DL 4XP5H 1NFDB 4ZFFA 2XY1A 3WJJA 4XP4L 1ITCA 1FPTH 3WDIA 3PJSB 4NFCA 3ARGC 4NC1E 3OGCA 2JJUA 4LCCB 4FNLH 1NUGA 2HRLA 1IKNA 1RURH 1W0YT 4MAUL 4JHWH 5C3LD 4U1JA 1QYGL 4BJLA 4OF3A 5HDOA 4NQVA 1TJIH 4U6HA 4IMLA 1JNLH 4JDVB 4O2EA 1JGDA 2VXVH 5E8DL 3LHPL 4NZUL 4OZ4A 5HYJB 3FN0L 3OR7A 3GSQB 5L7XL 4RMUA 1H5BA 5EH1A 1HHHA 3CSPA 3NH7H 4LVHB 2Y6SC 1G7LA 4BELD 2XN9A 4CN6A 1J0YA 4OFYD 2OCFD 4XNUH 5GGRA 2MCPH 3GZKA 1D5BA 2YC1B 5BV7C 5D70L 1BLNA 3WJLC 3PHOB 2BNQB 1I7ZA 3FFCD 1CXLA 4HAFA 4CBPA 2BMKB 3U7AA 2K7QA 4QNPE 5D1XC 4ZS6C 5C0JB 5EIIB 4ZMAT 4JO3H 1SM3H 2HLFD 2XQBH 4G8GD 1XGUA 4QHMA 3TNMB 3KDMB 3QIWB 1J8HD 2OJZH 4BQ8A 2I60H 2GK0A 4H20H 4JPIA 4S1QH 3A6CH 5H94A 1P9MA 2H1PH 3ZSTA 4HX1A 4AY0A 1RZ7H 4NSKA 5B38A 3SE9H 3OX8A 1FV1A 1JK8A 5KOMC 1IAIL 1JPSH 1CFQB 2OSLA 4BZYA 3HPJB 5JR1H 3G5YB 4K2UH 1ZHLB 4LOUD 3MV8B 3L3KA 5I15H 3O3DA 3T08A 3OB0H 4OF7A 4PY8I 3SDXA 1CXIA 1MCLA 1DBKL 5JA8B 2CLRA 4XXCA 4JM4L 4UAOB 2JJWA 5SWQB 3T0EA 2MSPA 3HZMB 4JZOA 1T66C 3LKSB 3ETBF 4JQVC 5SX4I 5DHVA 3HMXL 4DN4L 3CDGB 1F5WA 3S98A 1L9NA 3MJ7A 4LCUA 5EIQA 4YHMH 3QO0B 1BQHA 1MFEL 3JZ7A 3INUL 3SY0B 5I76A 1TPXB 5IJVA 2WBJB 5C86A 3H42H 3WNOA 2VLJE 4KRPB 2ICES 3C2AH 5FDYA 4L3AA 4YJZL 4QGYA 5DO2D 3QEGL 3CVHH 3VWKA 2X4QA 3TVMB 5C9JA 1RUPH 3MRPA 1EO8H 4NUGH 4IDJH 4JVPA 3KNBB 2OI9C 5EO1A 1GGBL 5IFJB 2E7LC 1H3GA 2DBLL 3VFOA 2WQRA 2AJVL 5T33L 5DGRA 3K0WA 5F8RC 4WNQB 1CF8H 5FUCC 3OB0K 2AS5M 4NWTH 5ACZA 1DJSA 3NGBC 5DZLA 4DCQA 4HUKB 5J7CC 5DVOA 3U4AA 2RJMA 4Q6IA 5I1KL 5KSBF 1OCWH 4Z77B 3FQUB 12E8L 2F8VA 1I7TA 4PG2C 4HUXB 3MV9A 4K9EL 2H2PC 2IBBA 2FX8H 1YEKL 3ET9F 3LPGA 4NM4L 2IALA 3CMOH 2RFXB 5BS0A 43CAA 1XCTA 4JFDA 3HC4L 4HG4J 1OGTA 3H9SD 5DJ8A 1Q1JH 4GUPB 5KSUA 3NPSC 1BOYA 1G6VK 4QHNB 5EZIH 2A6JB 5T1MB 5CBAA 2EDLA 3U7YL 3L3JB 4LLMA 3QI9D 2P1YA 4P9MH 5TGBB 3THML 3W11D 1A0QL 2KQNA 5I1LB 1FIGL 5D93B 2CKBA 2ZCKH 1AHWC 1EERB 2FCBA 5F72S 4ZYKA 1YPZB 3IJYA 3RKPA 3VFTA 5FO9B 4Q9QH 3V6OC 5D71L 1AGFA 1A4JA 1MRDH 4ODXA 4F9LC 3ARBC 4GAGH 3OJDB 4L8SB 4CU6A 3FB5B 1N3NB 1ZXQA 4OLXH 5MEND 2ED7A 2J2ZA 5KBNC 3NCBB 1NKOA 1LO3L 5F9WC 3MNVA 3NIGF 4PJEE 2IFFL 4WFFE 3IKCB 4NFBA 5C0AE 3BPCA 1ZAGA 3BP5B 4I5BA 1JYNA 3SKJL 4LSPH 2O5YL 2IGFL 4PJBF 1NH6A 4JFPA 4ZFOA 3K8LA 3BSZL 2DQHL 4KQ3L 1SMOA 5DYOA 5DJYB 1A7NH 3PWPB 4ZTPH 3P11L 1A64A 3IXAA 4XMPH 4EKXA 4KGLA 4F7CB 4YR6A 3V7AE 3MRDB 3IFLL 25C8H 5FECB 1EO5A 1S9WA 1BGXL 4IM8A 3QFJE 1I3RA 2F53B 3Q3GB 2OR8A 4JAMB 2I9TA 4Y0GA 2ZSWA 1CD1B 4GW5B 1LQSR 3IDMB 5EOCL 1XT5A 5T3ZE 1QNZH 5D9SB 4UV7L 3C5JB 2EDKA 2W91A 4HLZG 5FOBB 1J18A 3QUKB 3ARDC 3P4MB 1PDKA 2HFEA 3PGFL 5E9DA 5EBLA 5JDSB 3WFEL 4XCCL 5EBMA 3CPLA 3GO1H 2R0WH 5EU3B 2DYPA 1UA6H 1FVDB 4GT7A 2EE9A 1N59A 1PEWA 1S5HB 3L5HA 1U3HB 1OPGL 3HUJF 4LRIA 5CILH 2CDEB 2XA3A 1QQDA 4JM2F 4L4TB 1RZ8B 2X1WL 2OZ4H 3C8KB 4RIRA 4U2YA 2F15A 1FZMB 4XCEB 3PGCA 2VOTA 3D3VE 1EFQA 3TFKD 2IPKA 1MCPL 4JO4L 3F6IA 3L3GA 1QSEE 3O41B 3BGAA 3ULVE 1OWRM 3MBEA 4PP2A 2FO4A 1D5ZA 5DQ9B 3G5VA 2FYYB 1FL3B 5DQDH 1WAAA 3VXOA 3ZDYF 1YJDC 2GAZA 1HQ4B 3GNMH 1MRFH 1MAML 4PJAF 1FAIL 1PG7L 3O45A 3ZSSA 5T5FH 4X6DA 3QNZA 3T4AB 5J6HB 1IC1A 3G04A 1UYWH 3RWHB 3IAQA 1YQVL 1SJEB 1UJ3C 5D8JL 4Z76A 4LVNB 3EZJB 5C07B 1X3DA 3O3EA 5CIPB 1A8JH 2E9IA 4O2CA 4HIEA 3SGJC 2J1KA 5IHBA 3DRTA 4S1SL 1HHIB 4M7KL 3TPKA 5FYKL 3TZVB 2Q8AH 4KXZI 4Y4KC 4KC3B 2R1XB 3GI8L 1F90H 5ALBL 1BJ8A 4MJ4A 3P0VL 3EYUL 3M8OH 1ORQA 4POZD 4PJGF 2YUZA 3E6FB 4IEFB 4YDVA 2FR4A 2HKHL 2OP4L 4XBPA 3CVIH 4GS7B 3GSUB 3CNKA 4M3JA 5D1QD 2BC4B 1U8MB 2DIBA 1CICC 5CJ5A 4FTVA 3O9WC 4KGJA 1KCUL 2CJUL 4N1HB 3DX7A 3S36L 3WD5H 4KVNH 4UILH 4WFED 5HJ3A 1E6JL 4HKJA 2BFVH 4DFIA 3Q48A 5ALCH 3PDDA 3SE8H 5FCUH 5IB2B 2G75B 3WL9A 1CL7H 1GH7A 3PV6A 3LV3B 2O26U 2CRIA 2R29H 3AS1A 2MNUA 3D85A 4KK8D 4P46B 3I6GA 2OS7A 1JGEB 2M1KA 4QCIA 3QDGB 5D7IF 1GGIH 1NBVH 1J10A 4MD0A 3HAEH 2AI0L 1SYVB 3B9KC 1KT2B 3U30C 2BVPA 5E2JA 3GSWB 3MUGB 2YRLA 3CFEB 4JRYE 3F7YA 3IAPA 1HYRC 3OZ9L 5HYSB 3HR5B 3B2UD 4X99B 2E5EA 3JWDC 1ZVHA 4PJEA 3ZT6A 3BO8B 3LD8B 5F88A 5C2UB 3MRFA 4GW4A 5KSAA 5KVEH 3ARYA 4EVNB 5C0AA 3P30L 4RMWA 2F5AH 3TBYB 3L3OB 2D4FA 3V0VB 1KSRA 4J8RB 3EJZD 5DFTA 4I48A 2ESVD 2N7AA 1PZ5A 4NRZB 5IBUG 1IM9B 3SO3C 1EMTH 4ZS7H 4JFFE 5I8CB 4CU8A 4NO5A 1GXEA 1RU9H 1VKXB 3UTQB 2J3SA 5HVHB 5L2KB 1RPQA 2PW1B 4H88H 3WN5B 3ULUD 2D7TH 4TSBH 2F54B 1TETH 1F3JA 2X4SB 4WY7L 1KJ3H 1REIA 4OZGA 1LDPL 3RL2B 4HBCH 3KWWA 3NZHL 4U4BA 1FJ1B 1IGML 4J3VA 3GSRA 5C6PB 4FXKB 4KHXH 3QFJA 4MB4A 3F7QA 1WFNA 3Q6GL 1JWSA 1YEJH 3GGWB 1ZGLA 3CLEL 1G7IB 1JPST 5HHMD 3TN0B 3BT2H 2R4SH 4NO0D 3BDYL 3QDMD 4WW1A 4X4YB 4K7PX 5AZ2L 3L6FB 3HI5L 2DM7A 1EXUB 4Z0XB 3H7BB 3QUXC 1VGKA 2AV7B 3BH8A 3BE1H 3S4SB 4TN9A 4NKDA 3ZT7A 3MJ8A 3CAFA 1ACYH 1KCVH 3O4OC 3OL2A 5HGHB 1OLLA 3MLWL 4XC3L 5FF6A 1P6FA 1IARB 1ZTXL 3ZKMD 4V2BA 1ZGLP 2FX9H 4KAQL 1W0WB 1X5IA 4P3CH 1A7QL 3NIFF 4OCXH 4CN1A 4KJYA 2Y23A 3BGMA 1S7SB 2QADC 2MKWA 2Z31B 2HMID 3T0ED 1WZMA 4CADB 3S36X 5EWIH 4YFLF 1E4XI 4Y5XA 3V0WL 3O8XB 3QP3A 3V5DA 2JK5B 3TBVA 5CZXD 1ZA3B 4CW1A 1T2QL 3P9WB 2N1KA 4TVSa 2D03H 4PJIB 2J6EH 3RJQB 2VR4A 4D9RE 1OP9A 4FXGA 1Z9SA 2JKXA 1N6UA 1Q9WB 3NCYS 5GGSA 5F1IB 5GZNC 5CSZA 1LO4H 1T89A 2ZSVA 1JI2A 3T77B 4EDXA 1A7RH 1D5XA 1U6AL 5HYJE 4K3EH 1VACA 1ZK9A 4YHOH 3SOBH 3QCTH 1X5KA 3QDJB 3V4UL 5I1GL 5JW4Q 3DETD 4P4RA 2A9NL 4NOBA 4Y5VB 2B2XH 5E00B 4YE4H 2VXSL 1QEWA 4U1LA 1G0YR 4QT5A 4UQ3A 3P0GB 5BRZA 2W0FA 1JVKA 1CXEA 1D9KC 2ILLA 1DBJL 4P49A 1YYML 1IL1A 3DVNB 1EJ6A 3HCVB 2NY2D 3ZKSD 2R0KL 4EBQH 1WQVT 4UTAL 2GFBA 2FD6H 3HNSL 3SGDH 3EOTL 3HS0B 4BSWB 2Q76A 4XT1C 4PJFE 1MH5B 3DGCR 1RQ5A 1HH6B 3UBXA 1FLRH 3WO3B 2FWOB 4OLWH 4CMMB 4TUJB 5J1TC 4WI4A 4OBSA 2CR6A 4PRNA 4U6XB 5BS0D 4RSVA 5TQ0H 2YMXH 2NY7H 2VXQL 4EJ1C 1K4CA 4Q9RH 2CLZA 4AEIH 2IH3B 3GMRB 3FQNA 4OGYH 4PRIB 5TPWH 2PYFA 3E2HB 3MV7B 1NEUA 1YECH 2EZ0D 3OAUH 3IXTB 2OMBA 3IU4H 4M43L 2Q6WA 4NNYB 3ILQD 4OQTH 2CDGB 4PGEA 4QHKI 1V3MA 5C0DA 4QXGL 4GAFB 3GBNH 4J6RL 2K3TA 2UWEA 4L8CA 3KPNA 5FHAH 1C1EL 4PTTA 4YPGA 3CX2A 1OAXL 1TVBB 1SJVA 6FABL 2FB4H 1BIIA 4JFOA 4FFZH 2QSQA 4JVWA 1VFUA 4D0BA 2BDNL 3CDYA 1IKFH 4L5FL 4N8CL 2V2WA 4POUB 5FGCB 1DBBH 4MA7L 3RU8H 3VD7A 1TNNA 4Z7WE 1OAUL 4JE4B 1ZLWK 5D72L 3FT2B 4S0TD 1YEHH 1O7VA 1ZE3C 5IFAH 3HLAB 1HDMB 2UYLB 3IJSA 4P5KB 4JFFA 5GGRY 1RUAH 3VGBA 3D0VA 5EN2B 5GGVH 1H0DA 5E6YA 3T0AA 2X89D 4IHOA 1R5IB 3QPQD 1IM3A 4FMKA 5CD5D 1ZSDA 4CUCA 4R97B 1OF2A 3WFDL 2VLKB 4PLKD 4TRPL 2VWEE 3MRRA 3DECA 4MXQD 1FYTE 2EH7L 3B2VH 5DJ0B 1BM3H 2GJZB 3B8YA 3EUUA 4EOWL 2F74B 5EU7E 4XVJH 2CH8A 1UM5H 3L3DA 1UB6B 1XAUA 1FBIH 3K4DA 2O5ZH 4Y5YB 5F44A 4NNPL 2Y7QA 3UTTA 4EI5D 3HE6D 3U6RB 3NA9H 5E9DD 1S9XB 1IQDA 3TO4B 1GGTA 1ETZB 4I1NB 3VW3L 3QEQE 5FK9A 1F00I 3N9GH 2LTQC 4B0MM 2HLAA 2C1OA 2MQ3A 5ESQA 2DYPD 5JUEL 1MHCA 3PGDA 5ILTL 3RZCB 3O2VH 1QSFE 3AY4C 1A3RH 3EO0A 4IBLT 1I7UA 3TA3A 3RQ3A 4XTRC 2Q8BL 4JEGB 1V7NL 4NQCA 4OLYH 4FHBD 4HMCA 4R2GD 3AS2A 4AT6B 1NFDA 3HNVH 3BESR 3R1GH 1BX2A 4XBGB 5FYLL 4X9HA 4WENB 2HLFC 3PJSA 3RJDA 1FP5A 1A9EB 2HH0H 5JW4N 3U48A 4LCCA 2LAGB 1W0VB 5DA4A 4YHLL 5I74B 2EEDA 5DGQA 2EDFA 5SWSB 4FQ2L 2VL5B 3KPPB 2XOTA 3PL6B 2BJML 3QPXL 4R3SB 5BMFH 3P9MB 4JDVA 3PHQB 5JIHA 4RFEB 3BKJH 3CLFH 5AWNH 1U95B 5HYJA 4XRCB 4HKBA 3GSQA 1K6QL 4MNGB 4LOUC 3NCMA 4D8PB 1BBJB 5I1CH 3P0YL 4GKOA 3D2UB 4FFVD 2DM3A 2ERJB 2ZOLB 1J1PL 4EXKA 4X5XB 4AK1A 4NP4L 3PP4H 3STLB 2YC1A 1T1YA 4K7FB 3PHOA 2IANB 2NW2B 2BNQA 5JOFB 1TZIB 2BMKA 3VGDA 3U0TB 4RMQA 2XYCA 2BK8A 4MSWB 4YQXL 3GJEB 3OQ3B 5C0JA 5EIIA 2AXGB 3GMOB 1P2CB 3TNMA 3KDMA 3KG5A 3QIWA 3QXAA 3BQUB 4FTVD 5DEFB 2DTMH 4XP1L 3WSQL 5DO2C 3CCHB 3MOBL 4WEMB 3V95A 1NKRA 3DYPA 4OZFH 4GSDL 4F8TA 4PB0L 2DQDH 1VPOH 1JHKL 1CGWA 4TSAH 4JFQB 3Q5TA 1CFQA 1DTUA 4UNTA 3HPJA 3D85D 1BREA 3DUHA 2DIJA 3EO9L 3G5YA 1FH5L 1R5WB 1ZHLA 2ZCHL 3MV8A 5IJKA 2YPLB 4GOSA 5FA3B 5C2BH 5DEGB 4WEBL 3JV6B 2AJSL 4M6OL 1JZ4A 4KPHL 5SWQA 4D9LH 4NQDD 3HZMA 2BY2A 3LKSA 4YHKH 2BNRB 2FHCA 2EC9T 5MEPB 3PIQB 5K9JL 2UY6A 1EBPA 3HC3L 2IBZX 2NXYD 3LKPB 1NPUA 1OOAA 3QO0A 3WIHL 5C0AD 1WIOA 2Y4SA 4GG6E 3BP6B 5EORL 4JFEE 3RX8A 3SY0A 1Q72L 2OM5A 3FB8B 2WBJA 3VFUB 5DC0A 5EDXA 5HY9B 5EFIB 4ONHB 1IVLA 5EBGA 5F7LB 1BVKB 1TJGL 3IDNA 4HUVB 3TVMA 1QUNA 3O0RL 5J1AB 3QI9C 4JHAH 1F58H 1MWAB 3EOAB 4MJ2A 5E94B 1QFWH 3KNBA 3C08H 5DS8B 1A5FL 5IFJA 4RMRA 5TE6L 3CUPA 3H2WA 1E4WH 2APVA 3GFUA 4PJ7F 4LLQB 4M6MH 5C07E 4CNIB 4U0RC 1VEPA 4Z77A 5DT1L 1AY1L 3FQUA 1KB5B 2YZ8A 1TCMA 1UXSB 2X4TB 1AR1C 4HUXA 5B38G 1UH2A 1KFAL 1GC1C 2V5MA 4DW2L 3VFGH 1RIVL 1X7QB 1EGJL 4TULH 1FIEA 4A2LA 4ZFGH 1A6TA 1D3CA 2RFXA 4PV9B 4YXKL 4N68A 5DRWA 1CGVA 3UJJL 4OLZH 2DDQL 4GUPA 4JRXE 1GRWA 1R3IH 4WUKL 3VFPB 2B1HL 2A6JA 1OTUD 4LSTL 5GRUL 5T1MA 4XBEH 1UWEL 2NY1D 4YHPB 5E6ID 1MWAL 5TGBA 5SV3A 1UVQA 1CL7I 3B8SA 5F8QC 4Z7QE 5I1LA 2Z8VC 1BQHG 1UFUA 1YPZA 1GPOH 5FO9A 3EJYD 1MI5B 4YPJA 3RTQB 5A16A 4WW2B 4Z7UF 2EDXA 4BFBD 5JW5B 3OJDA 4L8SA 3FB5A 3IDYB 1N3NA 3T3PE 3EYSH 1EAPB 1H3XA 3RX5A 4H0IA 1Y6KR 4HJGB 2AJUL 1KB5L 4BZ1L 2BRRL 4R7NB 3IKCA 5GRJL 5I8KL 3X13B 3WS6C 3C6SB 4U7MA 4ALAL 3B9EA 5BV7L 3BP5A 4GBXB 1SQ2N 2R39A 3CH1B 4PJXE 5CGTA 3DRQB 1N0LA 1URLA 2X9WA 4P9HC 4MDJA 2WLYA 3V79C 2HJKB 4MJ5B 4Z8FH 1INDH 4QRRE 1S9YB 2YRZA 5DJYA 3KLSA 3KPSB 3PWPA 5ID0B 5L2KE 3N85L 4HFUH 5DDHB 5BRZD 3ARSA 3MRDA 1KUMA 3TFKC 5FECA 3J8F7 4OB5H 4C56B 5J6GB 3RWIB 2F53A 3S88L 3Q3GA 4JAMA 4K3JH 1QKZL 1CD1A 4GW5A 4J4PA 3IDMA 1ERNA 4QRSB 5HHNB 5D9SA 3U36B 4JHBA 4F57L 1KJVB 2E7CA 3C5JA 1BZ9B 1MJ7H 2BY1A 4NQTA 4F8QA 5FOBA 3QUKA 1YMHB 3P4MA 1LK2A 3WFHB 1M6OB 4JPVH 5FM5O 5CP7B 4IRZH 1S9VB 3DJ9A 5JDSA 5J13C 3X3FH 4KTEH 3IU3B 5GHWH 5KW9H 4AEHL 5EU3A 1FVDA 1NAKL 2F9BT 4UDUB 2R0ZL 1X9QA 2VITB 5J57B 4FZ8L 5CJXC 1F4XL 1S5HA 3NCCB 5IVXF 4YFDB 1UXWB 3RAJH 2G5RA 2CDEA 4JHZA 1OL0A 2R0LH 4PJCE 4L4TA 4ZUTB 1RZ8A 5DMIH 1CE6B 3C8KA 4POZC 3VXRB 3LY6A 2PUQT 4RAVB 1A9BB 4K8RL 3C5ZB 3GBLA 1FZMA 2GTZB 1YMMB 4XCEA 4XC1H 3MBXH 4XNYL 5I2IB 3DNKA 5DWUH 5C0CE 4I0PC 4U7KA 5GRVL 3TJHD 3QWRD 4P5MB 1PY4A 3O41A 1J5OL 1U41A 4GG6A 4OFDA 4IIQB 5DQ9A 2FYYA 1FL3A 3JWDH 3FB7B 2B5IC 3REWB 5DUML 2DIAA 3PXHA 4JFFD 3OBAA 4PJIE 3NABH 1R0AH 2JCCB 1HQ4A 5JXEA 1UG9A 3MA7B 4M6NH 4UBDD 2PTTB 4JDTH 2HTLD 1V3JA 5J6HA 3T4AA 1OSPH 2A9MH 2H8PB 3WJJC 5J4MA 2EH8L 1SJEA 1BFVL 2VZSA 4KI5D 4P0DA 1CE1L 5C07A 1YEFL 1XF2B 5CIPA 4HZAA 2EXYC 1UZ8B 5B22A 2XI9A 5FIEA 3WNKA 3QXUA 4X80H 1VA9A 2UV3A 3EW3B 1IKNC 2BVUA 3TZVA 3B2UC 1T7WA 1Z9LA 3LMJH 2BOCB 3Q6FB 3G5XB 1V3KA 5ICXB 4N0RA 4TSCL 1KXQE 3F58H 2J12B 3E6FA 1JUFB 3UTTD 3GSUA 4KWUA 4NFDA 2BC4A 1U8MA 4EEEA 3RHWK 1Z0MA 3SGDI 1H5BC 1Q0YH 3U9PL 3QUYB 2X4UB 4ODSL 3TESA 1D6EB 1NUNB 1QFWM 3KPRB 3B83A 4RAUB 4PUBL 4OI9A 2R1WA 5EC1B 1JFQH 4UMGA 5IB2A 2G75A 4JGJA 4NQCD 4PJFF 3LV3A 4JPWL 2MPAL 3I84A 2DQTH 3MV7E 1A7BA 4P46A 2AJZB 1OQXA 3FO0H 1JGEA 4HIHB 3QDGA 1BZ7B 1FO0B 3KYOB 4AG4L 4D9QE 1SYVA 1XZ0A 4KRNA 1KT2A 5JXAL 5I18L 4P23D 2VMFA 4HIIB 3GSWA 1BFOB 3MUGA 3CFEA 1CU4L 2VDKH 5JHLH 1UACL 4DN3H 1MEXL 2ZUXA 5ACMA 2Z0BA 5GGSY 1E4JA 3HR5A 5HYSA 4KZDL 2XRAL 2RB8A 4XVTH 3WNNA 3BO8A 1UCTA 4PTUB 5L8LB 4EVNA 5I1EH 3TBYA 4NQUA 3L3OA 4XAKE 3ZKMC 3V0VA 4J8RA 5D6DA 2RCSL 3W39B 2WZPD 4DTGL 4LASL 5CUSL 4HGWA 4NRZA 4HWZB 3VA6A 1IM9A 5GRYA 5D7LD 5I8CA 4WO4D 1FYHB 1VKXA 1DL7L 2XTLA 3QEUB 5L2KA 2VH5L 3MNWB 3WN5A 4RGOL 5D2LF 4WUUB 2F54A 4XXCC 3WDHA 5CCKH 4KK5D 2X4SA 1OP3K 5I73B 2HMIC 3T0EC 1FE8H 3RL2A 1FJ1A 4Z7WF 3E6HB 4FXKA 5FYLE 4Y19B 2VLKE 2BNQD 3NFSL 3F62A 1N64L 5E6ZA 5F3HB 4OGAD 5CZXC 5EU6E 1G7IA 3KYNB 4X98B 3LDBC 4PJHB 1FO0L 1NCTA 3ALPA 2BVTA 2DS4A 3TN0A 2VN4A 3OKYA 4P2RE 4PBWD 3JSSA 3DURB 3KYKL 4X4YA 2NY6B 3VWKC 1EXUA 1I9JH 2QL1A 3H7BA 1JCKA 2AV7A 4GQPH 4YBQC 4JFHD 4ZODA 3S4SA 3KLAB 1AR2A 3MZGB 3MSPA 4ISVB 1S7QB 4HHAB 3N50A 5E5UB 5HGHA 3KPMB 1MLBB 3DETC 1JMZA 3OAZH 3QRGL 2ZG2A 1W0WA 2PR4L 2X2YA 4HEPG 5IESL 4XGZB 3SDYL 3MV8D 4JB9H 4U6VL 4Q6IC 2MCG1 4WU7B 2NY2C 1S7SA 3SQBA 5C09B 4G42B 3VRIB 4BH7B 4KY1H 1OAZH 3I75B 4PR5B 2Z31A 4PJ8D 5D7JB 5IFHH 1OTTC 4H5SA 4M5YL 4CADA 1FC2D 2FGWH 1YJDL 3O8XA 2KZ1B 2CXGA 5I30L 2C26A 4OFPA 5BO1L 5C0GB 2JK5A 3SGKC 5ICYB 1CD8A 2EDEA 1ZA3A 5E1AB 3UTSE 3A67H 1KIUA 2BX5A 2IG2L 2BXYA 4PJIA 1CDJA 1LP9F 2IQAB 3LB6C 5I1IH 3B3IB 1G6RH 4JJHA 3RL1B 4UI2A 5E99L 1MFCL 4ELMF 3EYQD 3V7AG 1CLYH 4IRJD 1JJUA 2LVEA 1Q9WA 5DMGC 2EZ0C 2O5XL 5GRZA 5F1IA 4OSUL 5EUOB 3OAZK 3ILQC 1FL6B 5GGTA 1H3PH 3T77A 4OT1L 3QDJA 4MNGE 4X5WA 1FVCA 2WIMA 4NJAL 1ND0B 4TUKH 5E00A 4U6TA 4G9FE 4K71C 4XAWL 4DEPB 4DFHA 3UZEA 3FO2B 1KN2H 4M9PA 1I8LA 5CZVH 3RWGB 1KIPB 1RIHH 5FGRA 3DVNA 5KAQG 3HCVA 3AFLA 1YEIH 1JNNH 4BSWA 3HS0A 2HFGL 5C0BB 1QBBA 1A6ZB 1HH6A 2WUBL 4XMKL 5F9AC 2FWOA 4CMMA 3DUSA 4XVUD 4TUJA 2WK2A 3P4NA 1P6AB 3PHSA 1VESA 1BD2D 4U6XA 1F3RB 2VDQH 1ZA6B 2RHEA 4XWGL 2DOCA 4YDKH 5CD5C 4TUOB 5B21A 5GS0C 4KHTL 1XF4B 4NO2B 2IH3A 1UM4H 3WUWG 3GMRA 1M7DB 3AB0B 1T4KB 3MLRH 4PLKC 1P7QD 4PRIA 1SEBB 4RGMB 3BOVA 3MV7A 4YXHH 5GS1C 5DFWH 4HFWB 4FQCH 1FPTL 4DKEL 1UEYA 5T1LB 3IXTA 4NNYA 2CDGA 1QSVA 3PWUB 2I07B 1F8TH 1VERA 3OF6D 4Y4FB 3LIZL 1S78C 2FX7L 4HV8B 1IC5H 4KQ4H 2CK0H 5EOQL 2V9TA 1TVBA 4JHWL 4O5LH 4W4NA 3BDXA 4L9LA 1YUHB 1ZLSL 1JNLL 4X9IA 3QG6B 4F15C 1KC5L 4ZTOL 1E0OB 4AQ1B 4YFLI 4KJQD 3FT2A 5IG7B 4X5LA 3K46A 3ARWA 3HLAA 1HDMA 2UYLA 2YKLH 4WU5B 3VGAC 4TVPE 1IAKB 4FRWA 4P5KA 4XNUL 5F97E 4LRIC 3KPTA 1OTSD 4XPGH 5EN2A 3RWDB 3HI6H 1R5IA 4TNWF 3E1F1 1G1YA 1U91B 2H26B 3PWPD 4KKLD 4R2GC 2DKSA 1O7SA 2VLKA 3BZDA 2B1AH 4DAGH 4FFYL 5L9DH 4PV8B 1RZKH 1U8QB 4U6YA 4I77H 5DJ0A 3UBXG 2F53D 1BF8A 4OZIF 4WTXA 3MBEC 2C3WA 1UH4A 2GJZA 3RVVD 2F74A 3BKCH 4HXAH 1KBGH 5E4EC 4F7MB 3NCJL 1AKJD 1UB6A 2B4CH 4J4PD 4S1QL 3CVHB 5FUZL 2FLBT 3CXHK 2H6PB 5FYJL 2AEQL 1DBAH 4OGXH 1T1WB 3O2DH 4NKOB 3VFSB 5C7XL 3U6RA 3LEXB 2D7QA 1KYOK 1S9XA 5DD0H 4NN7C 4YAQB 3TO4A 4RX4A 1ETZA 3QUZB 4N8PA 2VISB 3ULUF 4LQ1A 4FFVC 3VXPB 4LF3A 1QD0A 1BOGB 1IRAY 4LPXA 4P2QE 2IAMA 1U8LB 4XZUB 2C4FT 1U3HD 3BPNB 2LU4A 4GXVL 2XQYG 1N0XL 1AGEB 5FYKD 1FCGA 4L4TD 3W81A 3EFDL 4LAQH 4GAJH 3HG1E 1T7ZA 4I3SL 4AT6A 4D3CL 1JGVL 4G6ML 4XBGA 4RRPA 3D9AL 1A9EA 3MCG1 4LARH 4AEFA 1BZQK 1HNGA 5CEZL 3UXFA 4L4VB 1N2RB 3V2AR 4HC1H 1W0VA 3SKNB 1N6VA 1UCBL 3FQTB 1LDSA 2XWBB 5CWSB 4HCRL 5DR5L 5SWSA 2QQNH 4CDGC 1NC4A 2VL5A 3VD3A 1MELA 2YWZA 5IW6B 1EO8L 3KPPA 3PL6A 3NACH 4R3SA 5JXED 2NNAB 2X4PB 3P9MA 3PHQA 4NHCH 4RFEA 3JBG7 1U95A 1RD6A 1P84K 2FNBA 4XRCA 2D9QB 4MNGA 5DF0A 3NOIA 1BBJA 5EO0B 3D2UA 3T09A 3JWOC 2ZOLA 5C07D 1WFUA 3GHEH 4JKPH 4NYLB 4X5XA 3TEUA 1HH9B 1OCWL 2ATPB 2OJEB 3RDTA 2VLRB 3STLA 4K7FA 5LBSH 2NW2A 3TZVD 5JOFA 3ARZA 1TZIA 4I0CC 4MGXA 3U0TA 1PSKL 2NXYC 1DR9A 3DVFA 5KSAC 4PJXF 1AJ7L 4MSWA 3GJEA 3J7HA 3OB8A 2HWZH 5E56A 5DD3H 4P2OB 3RA7H 5HGAB 3GMOA 5I9QC 1P2CA 5K9OB 1E28B 3JVGC 1V8HA 3Q2CA 1CIUA 3BQUA 1DBML 3RWCA 4L3ED 5DEFA 1G0DA 3S9DB 1Q1JL 3CCHA 5FCSH 5HHVL 4LKCB 2E7HA 5EZIL 4M5ZL 4JO1L 5IT2H 4X4XB 5L8JB 3LS4H 5AG8A 3VE0B 3VU2A 2QQKL 3TV3L 5DJDB 4LAJH 5ENWB 4JFQA 2WV3A 2DN7A 3DSNA 2V5TA 4LSRL 3RI5K 1RFDH 1R5WA 3MRHB 2F8XC 2GITB 3QDGD 4LCWB 2YPLA 1P53A 5FA3A 5IHUL 4JQXA 1RHHB 4OLXL 5DEGA 4R90H 5ESVB 3QUMH 1G9MH 3JV6A 5F96H 4WHCA 4CDHA 1YMME 4JO2H 4HT1L 2BNRA 5MEPA 3PIQA 1EGJA 4FP8L 1A7PL 3C8DA 5T1DL 5BZWB 3LKPA 1R24B 3GHBH 4ONGH 4PJCF 1NCWH 3HMWH 4ODHL 4C54A 1HHJB 3FB8A 3CDCA 4NGHH 1IM9D 2HT3D 1L0QA 3VFUA 4TOYH 5HY9A 3ZDZE 5BVPL 4XMPL 4XNQB 1HZHH 2JCCE 4LNVA 1OTUC 2XICA 4ONHA 5EFIA 1ZOXA 3TP4A 4LK4A 3T1WA 1N26A 2ICWI 1E4KA 2F54D 2NY1C 4PY8J 4P9HH 5E6IC 1MWAA 2DQJL 3EOAA 5E94A 5DS8A 2H32H 1Z3GL 2BY0A 2DM4A 3HRZB 4OCWL 4Y5XC 3GBMH 3ULVC 1S3KH 1JBJA 4LLQA 1QNZL 5TE4H 1FDLL 4CNIA 5D96B 2C3VB 2QQQA 3K2UL 1KB5A 4OKVB 4S2SB 1UXSA 2X4TA 5DZNA 3RPIB 1U3YA 2R0WL 5IB3B 4MQ7B 4WI9A 4I0KA 5C6WH 4H26B 2EEBA 4N9GB 5TF1H 2SEBB 5I8EB 1X7QA 1T89C 4R8WH 2XIDA 3DTXB 4HUUB 5A2IH 4P2QA 4K94H 3GIZH 3GMQB 4E41E 2NXZB 2CLVB 5JW3L 4YBLB 5BQ7B 3GM0A 1L4IA 4LMQE 4Z7OF 4KU1A 2NMSA 3N1GC 3P9LA 1XF3B 1OAQH 2ARJB 4YHPA 2ZG3A 3EO1B 5D2NB 2Z31D 1KJ2H 2DQGH 5AZEH 2ORBH 4ZFZB 4UOW0 3O8XD 3WFCH 3EJJX 5DQDL 1MI5A 3KHOA 1SVZA 3RTQA 4WW2A 5JW5A 2Y72A 3W9DB 5ECJE 4OCRH 4JN1L 4WWID 1UM6H 1MRFL 1EAPA 2DJ4A 4NC2B 2BSRB 3FO9B 4HJGA 5LGJB 2EDRA 4R7NA 3ZYOA 1CT8B 4N5UA 4BFIA 3BEVB 4PRHD 3WV0A 2ATKA 1AXTH 5E2WH 3X13A 4W81A 3C6SA 1DN0B 2Y5EA 4KKAD 1N6QH 3KLHD 3VA2C 1HINL 4GBXA 3OKMA 3DRQA 5K9KB 2MHAB 2HJKA 1ORSB 3QDJD 4MJ5A 5IV2A 4NN5B 1S9YA 2IMNA 4EDWL 5IMOB 1TIUA 3KPSA 5ID0A 5LG1A 4H8WL 3DMMD 4UV4H 4GXUN 5DDHA 1T0MB 4ZAKB 1YNTB 1I9EA 1U2HA 5SV4A 3TJHC 4C56A 2MJWA 3RWIA 3KJ6H 3OXSB 2DQIH 5SWZE 3WMSA 4UILL 3ILPB 1JWUB 2BFVL 4B41A 4LSVH 4QRSA 3SDDB 5HHNA 3U36A 2BHUA 1KJVA 1BZ9A 3DO3A 1FFNB 4HEME 3DUUA 5MHSD 1YMHA 4UBDC 3WFHA 1F97A 1M6OA 1Z5LB 2VDMH 4JANB 5CP7A 3SE8L 1S9VA 3K7UA 4G6FB 1GCFA 2HTLC 3D39B 3MTRA 1CL7L 2VDRH 3IU3A 3BAEL 2DLEA 3S37L 3MCLL 3ULUH 2P43B 1MAKA 4WI8A 2HT2C 4GMTH 1IGYB 4TPRL 4UDUA 4PRID 2VITA 5JO5B 4M62L 5KSBB 1A14L 2WUCH 4DUXA 1UXWA 4P59H 5T3XH 2CGRH 4MXWH 2WWKO 4ZUTA 2JLLA 1WSST 1CE6A 3VXRA 4LRNH 4RAVA 1A9BA 5C09E 5HYQB 3C5ZA 1KLGB 2GTZA 4Q97A 1YMMA 3SHSA 4JQIL 3KJ4B 3GSOB 5I2IA 1ZLVH 3CFKB 4DK3A 4P5MA 2DICA 3TWCL 3VDBA 4JG1H 3IDXH 5E8PB 4QRPE 3REWA 3FB7A 1RIUH 3MV01 4RFNB 15C8H 3MRGB 4HDIB 1EHLH 5DMJB 3NIDE 2D7TL 3VXMB 3DXAB 2JCCA 1K3IA 2C3XA 1H3UA 1KJ3L 1PVHA 1IEBB 3MA7A 3UMTA 4AENA 2PTTA 3QJHB 1KOAA 2NY0B 5GGQH 3RGVB 2H8PA 2VLKD 5CMAB 4MD4B 4V1DE 5IWLA 1XF2A 1G7QB 3TH3T 2H2SD 4LCCC 3W0WE 1UZ8A 5DHVH 1GC1L 2NY5H 2ID5A 5LXGL 2VN7A 1T04B 3Q6FA 2BOCA 4OD3H 1SBSL 3G5XA 5ICXA 4AEEA 2YXFA 5FO8B 1ZLVK 4NBZB 4URTB 3JUYA 1E6OL 3K80A 3BE1L 5TH2B 2A6IB 4OF6A 3SDAD 2OL3B 1XCQB 1JUFA 3D18B 3MPCA 1HHKB 2W9DH 3V6FB 5C0BE 1MCJA 4XPTH 3PABB 3TO4D 2DQEH 4LHUD 5LJYH 4HMDA 4MZ3A 5D7KD 4LDOB 4MB5A 4YLQT 5EB9A 4P3CL 3QUYA 4LVHC 4FQJL 4O51B 2X4UA 4DZBA 3RZCD 1D6EA 3MLXL 4OCXL 1FNFA 3HNTL 2CO6B 3H9HB 4RAUA 1LO2H 2ZUTA 2KKQA 2XXCB 5EC1A 1CGYA 4LNRB 3T04D 4ZNEE 1YEGL 4JZJB 1N8ZB 3WXWH 4HPOL 3RWFB 5EWIL 4OGAC 2AJZA 2CMRH 2IBGA 2XTJD 1WZ1L 3SJVE 3W5NA 1NAMH 4KMQA 4UIKH 4HIHA 1BZ7A 3KYOA 2A83B 1HCFX 4YGVB 3QIWC 2D03L 4M48L 1NSNH 4HIIA 3QDAA 1LO0H 3HI1A 1BFOA 3OPZH 4O4YH 3LPWA 5H35B 1PY9A 3D69B 3KR3H 4MB3A 5SWSD 5ADPH 1XGRB 2NYYD 3HKFA 3HUJB 4PTUA 4PYGA 4JM2B 1A7RL 2OL3L 3ESVF 3QCTL 3JTSB 1NMBL 1FNSL 3W39A 1F02I 1KEML 4ODTL 4HWZA 4R4BA 1VFAB 2X05A 5IJKC 4CRPA 1JN6B 3D2UD 3MNWA 3B5GA 4WUUA 4OIBA 1JRHI 4KROD 4UAOC 4EBQL 5AYQA 2OK0L 2J4WH 3E6HA 2IAND 4Z7VE 5F3HA 2ZPKH 3KYNA 4PJAB 4X98A 4NQEE 5B3JF 4GQ9L 4PJHA 3DSFH 4DOHB 3VWJB 1OQOA 2AV1B 1TPXC 1JPTL 5TQ0L 2DBJA 2WBJC 4LU5L 4N0CD 3DURA 4DVRL 3EYQC 4KRPC 3OGCB 3ARFB 1BMGA 1KXTB 1BQLH 2CUHA 2FJGB 5HI3C 2J8UF 1W8NA 2PW2B 5TPWL 3TVMC 3KLAA 2EDNA 4ISVA 4QY8B 4Y8AA 1YN7B 3MUJA 2WLZA 3KPMA 1MLBA 4IMLB 1OY3B 4XPAH 1KPVB 1INQB 4PJGB 1KCSH 5D1XB 1MCQA 4U3CA 1KXVC 4XGZA 4EQ3A 5F7HA 2FB4L 1FN4B 1LNUB 3RVXD 5GS2H 2YPLD 3OSKA 4WU7A 5C09A 4G42A 1I9RL 2XN9B 3VRIA 4BH7A 4PR5A 1DVFB 1IGCH 5D7JA 3RX7A 3VXTB 2AXJA 5DUPH 3RU8L 3QCVH 5FA4B 2IBZY 2CUMA 1QFUL 3MXVH 4JVUA 2BNRD 1FC1A 5FGBA 2L7JA 1MUJB 1CLOH 3BRGC 1I7ZB 4I8DA 5C0GA 5ICYA 4L4VE 1RUAL 1ADQA 5E1AA 3AXLB 4K3DH 4LVEA 3RL1A 3ARGD 2P5WB 5D7IB 3AS0A 2GKIA 2WINA 1AFVH 4JPIB 3FN9A 1KPRB 4WFGD 1I8MB 5EUOA 3SO5A 4QOKB 1FL6A 2RR3A 3B2VL 2GJ6B 4HWEL 4V1DA 3M45A 4LQFH 5D93C 4MWFB 3OX8B 1ND0A 1WEJH 2W07A 1I9IH 3FONB 2BSTB 4L8SC 2WIIB 1TZGH 3FO2A 4XPHH 2ARWA 3RWGA 1GOGA 1KIPA 1KTDA 5CHNB 3NAAL 1RJZB 1N5YH 1CLZH 4LEXH 1F4WL 3S4SG 2YRPA 4R9HA 3T8XB 3PUCA 3DX9B 3N9GL 5C0BA 1A6ZA 2M8XA 2H41A 1YDPB 4ZOBA 1OTSC 1K5NB 3BHBB 1CDBA 4JR9L 4J23A 1AC6A 3OHXA 3IT8D 1FZKA 1ZA6A 4PG9B 4KKLC 4MQTB 4TUOA 4NCDA 1XF4A 4NO2A 1K2DB 4OLYL 3QH3B 4WHYG 5E03A 5I76B 1M7DA 1T4KA 3QO1B 1X5YA 3BPOB 4KI5F 1IZKA 1SEBA 1ZEAH 1ZWIB 4X9FA 2IFGA 1P4BH 4HFWA 4PD4J 5T1LA 3RVVC 1FVEB 2P45B 5F7KC 3PWUA 4OIIH 2I07A 2MWCA 4J4PC 4Y4FA 1X5FA 3O6MH 4LCWE 2EKJA 4HV8A 4OZFB 5IBTH 3WLWC 5KVMC 1B0RB 1MI5D 5I16B 1VADB 3GMLB 1KENH 3MLZL 4AM0B 4XVSH 3V4VH 1YUHA 5IROA 2PKDA 3QG6A 4N8VG 3RY6A 3CLFL 1A6UH 4AIXA 1P7HL 3H3PH 3ZHKA 4DGIL 5FXCH 5IG7A 5J89A 1NMAL 1JGUH 2GY5A 4WU5A 1X6NA 4KUCF 1IAKA 3CZFB 1U3HC 4HKZB 5E4IA 4U2ZA 5F7YC 5IB1A 5BW7A 3N0PB 3RWDA 3PP4L 1I3GL 4HQQH 4QHKJ 1TTGA 5CJBA 2AJXH 1U91A 1ULVA 1IGJB 3KPSD 2H26A 1XCTB 4K8RD 1CI5A 2YK1H 4Z7VA 1V7ML 4G80B 4M8QB 1MFBH 4MJIE 4PV8A 1U8QA 4C56D 1M71B 3GSVB 3SKUD 4NRYB 4AYFA 4F7MA 4OCYH 1KCRH 4NKQB 3CVHA 5BJTB 1NLDL 3WHE1 4PRAB 2H6PA 2W0LA 1T1WA 5JXEC 3Q1SL 4NKOA 3C5SB 2DQDL 1OWWA 1S7RB 3LEXA 1CFVH 1QR1B 4X6EA 3GIVB 4NPYB 4TSAL 3UJTH 4YAQA 3QUZA 4KK6C 5DQJB 3CU7A 2VISA 3LN9A 1IC7H 4CVWA 4LVNC 3MNVB 1Q0XL 1Z9OA 3VXPA 4CJ1A 5A2LH 3CDFA 1R5VB 1BOGA 4WEUD 1A6VH 5C2BL 2H2PD 3BDBA 1U8LA 4XZUA 5KN5A 3IGAB 3UO1H 3FOMB 2Q87A 3TZVC 4D9LL 1QR4A 4JJ5A 3OWEA 1ODAA 1YN6B 5ICZB 3VXRD 3C9NB 2UY7A 3C5ZD 4KVCH 4HUMB 1YMMD 4LHQB 2YD4A 4GS7C 4NC0B 3GSNH 2JIXD 2FEEI 4LVOB 4L4VA 3K3QA 2B0SH 3MZTA 5MEQB 3Q5OA 3SKNA 3P40A 5CWSA 3FQTA 5I19H 2XWBA 4HD9A 3L3IB 1DLHB 1LEIB 1MHHB 2CKBL 1KF9B 2OQJB 3RIFK 2NNAA 2PO6B 2X4PA 1B90A 3CK0L 3X12B 2IQ9H 1MIEL 3ARBD 4J3UA 1TJHH 3SDCB 3UPRB 4P46C 5EBLB 4F7EB 3WFZA 3ALWA 1BAFL 5IB4B 3MR9B 2F8OA 1LO5B 5EO0A 4EIGB 2P48B 4NYLA 2R56H 2UZIL 1HH9A 5CKGA 5DFVC 2ATPA 2OJEA 5D5MF 2VLRA 1RY7B 5J8OA 1FGVH 2CO7B 1TVHA 3LD8C 2ZKHH 4NKIL 4TULL 4UTBH 5GS0L 4P2OA 5HGAA 5D6DC 3PQYB 2VDPH 3PGCB 2W9EH 1E28A 4ZDHA 5K9OA 1LILA 4QTIH 4HH8A 2HT3C 1HE7A 4OLZL 1NGYB 1G7MB 5FUOH 3QUYD 1R3IL 3BGFB 5HVHC 4LKCA 4R6UA 4PBVC 3WN5C 2K1MA 3CJJA 2J8HA 1F45A 2NY4B 4BYHA 4X4XA 4XBEL 3KPRD 1FGNH 5MEOB 3VE0A 1U8JB 5DJDA 2VLJB 5ENWA 3AAZB 3QSKB 3R0MA 4RRPG 2A77H 3O6KL 3CX5K 2PYEB 3V0AC 3VRLE 5KSBE 3BISA 4OM1H 3STZB 5HDBF 5HSFA 3MRHA 2GITA 3LRGA 1TVDA 4LCWA 4RGNE 2ED9A 3A6BH 3TN0C 5FB8B 1RHHA 1IC4L 2CRZA 3BKYL 4LCYB 5ESVA 3DV4B 2AJ3B 2R8SL 4F7PB 2AEWA 1FNEB 4KJWD 3BW9B 1GIGL 2Q7YB 3U7WL 3HFML 1JNJA 1MCCA 3NA4A 4PJ5E 1GGYA 5BZWA 5FGSA 3LS5H 1R24A 3DGGB 2BVEA 1X6LA 4ONFH 4UT7H 2FR4B 2ARJQ 4Z8FL 1INDL 1WLHA 1HHJA 4FQLL 2OZ4A 3CU1A 1CTNA 2XV6B 4IOFD 3VXME 5ISZB 4HFUL 4XNQA 3VMNA 4MVBD 1GHFL 2KUTA 4QXTA 1FHGA 3L3HB 4WUUD 35C8L 2MQCA 2Z31C 4OB5L 3VH8B 1OB1B 4ODVL 4ESKA 1WWCA 4KZEH 4U1HB 2FH8A 3HRZA 5DD1H 3O8XC 3QA3B 4Y19D 4BA8A 1AD9B 1NEZB 2ICWB 2IPUK 3V4PH 3NIDF 3ZL4H 4NBXB 4D94A 2C3VA 2YHGA 1UZ6E 4IRZL 1L6ZA 4MD0B 4OKVA 2COQA 3X3FL 4S2SA 1AXSA 1MRCH 3PWVA 5L88L 2BVPB 1DQTA 5IB3A 3DYOA 2NY6D 4PJBE 3EFFB 3FTGB 3KLHC 2QSCL 4H26A 4N9GA 2SEBA 5I8EA 3OKOB 1FFPB 2FL5B 1OGAD 1MSPA 1T6VN 4MA3B 3G6DH 4HUUA 3L5XL 4Y5VC 3RWJB 3ZE2E 2R0LL 4XP4H 1XGQB 2AGJL 3MUZ1 2CLVA 2Q1EA 1Q38A 1LGVA 3I6LE 5DMIL 4C55A 4OCSL 5BQ7A 1U93A 3LEVL 8FABB 2P8MB 1CICD 1NCCL 3MBXL 2Z4QB 1BVLB 1XF3A 5DWUL 2GUOB 2ARJA 3EO1A 5D2NA 3WNLA 2F19L 5D7JD 1F3JB 1QACA 1B0WA 1QYGH 4ZFZA 3G6AB 4K55A 4O00A 2DI7A 1S5IL 3LSOA 4P48A 2A6DB 3TNNB 3LHPH 3NABL 1AI1L 3W9DA 4NZUH 3OV6A 5ABDE 5L7XH 2HJFA 1DUZB 2BSRA 4LEOB 3FO9A 5LGJA 3EDKA 3AVEA 4RMVA 4XP9H 4YZFE 1CT8A 3QXDB 3BEVA 1AQKL 4O02L 3JWOL 2QQLL 3E2HC 3DV6B 3HUJE 2AP2A 3TC9A 3WFBH 5D70H 3V5HB 5TF0A 1A6WL 1T1XB 5K9KA 2AQ1A 2MHAA 4NKDB 5I71B 1ZGLM 1ORSA 3HR6A 1U8HB 5IMOA 2ZNXA 1J1OL 2EYSB 2VDNH 3LMJL 1J9CT 2A74B 4EZMA 5DUBB 2EE6A 2B7DT 1B2WL 2GW5A 2YSSA 3F58L 3F65A 5E2TL 1T0MA 3UAJD 1ONQB 5EZOL 1YNTA 1DP0A 4M02A 4KJYB 1PX4A 3WUWB 3ZDYE 4KKBC 1B4JL 5DJAA 3W9EB 5DHXB 2Q3ZA 3ILPA 4Z7NF 4PJAE 3D3VB 5LGHL 1JWUA 3TBSB 3S35L 2D7OA 4LLAA 4DOHE 3ZE0E 4M93B 1QSEB 1FFNA 3O2WL 2YD1A 5KSVB 5CLWA 1Z5LA 4JANA 1JFQL 3D39A 4PJ7B 3D48R 4HK0B 4R97C 3ZDXE 5T3ZL 4Q58C 1DFBH 2DQTL 2LE9A 2P42B 2MMXA 3VGGA 1Z0NA 3FO0L 5EA0L 2VR9A 1IGYA 4HULB 4JM4H 4MAYB 5JO5A 4HPYL 1EHAA 4FXGB 5KSBA 4Q0XH 1QBLH 2H2SC 3H9ZA 5T1LD 2DJUA 1MFDL 5I1HH 3HMXH 1BPVA 3QUXD 4DN4H 1XEDA 3TPUB 2VDKL 4Y4FD 1Y6MR 4Y5YC 1MFEH 5FYJD 3INUH 2QEJA 1MCEA 5HYQA 4XVTL 1KTLB 1KLGA 1HSBB 1D5IL 3GSOA 4UQ3B 5ITBL 4Z0BL 3CFKA 3VMPA 5B8CA 5DK2B 3TO4C 1NDGB 4U1MB 3QEGH 3MFGB 3C6LB 3EOYG 1PX3A 1VEOA 4XHJC 2E9BA 5E8PA 3K1DA 3RZCC 3HE7B 4F80A 1GGBH 1CN4A 2E6JA 5FKAB 2DBLH 4HDIA 1QRND 2AJVH 3VXMA 3KPOB 3DXAA 4UQ2B 2ZUYA 4HWUA 5CCKL 5KS9E 4G7VL 4UDTB 4YWGH 1FE8L 5FFLA 1IEBA 4PJ9B 3ULVL 3CXDL 5D7IE 4PRNB 1QSZA 3QJHA 2BSSB 3RGVA 4Z7UB 3LKRB 1GZQB 2P7TB 5CMAA 4MD4A 2VABB 3IJHB 5CEZD 1U8PB 2QHRL 4K9EH 1G7QA 2I9LB 3MLYH 1N5AB 3ESUF 5GZND 1YEKH 4Y16B 3UTPE 5LGKA 4LLUB 1T04A 5I74C 4NM4H 5DURB 5FO8A 1I9JL 2VLME 2NYYC 4L8CB 3PL6C 2ZUVA 5TH2A 2A6IA 3ZE1E 4PJBA 2AW2A 2OL3A 2OLDA 3HC4H 4JRYB 1XCQA 3D18A 1HXYB 1MJJB 1PAMA 1HHKA 5ESAA 3V6FA 1FZOB 3PABA 3QUZD 1DQDL 4O51A 4HLJA 1HKFA 1C5DB 3BYYA 4NOFA 2ERJC 3THMH 1A0QH 3UDWA 4BKLB 3FQWB 4NDMB 4WWKB 1A7OH 1FIGH 4OV6F 5FUCE 1J11A 4LNRA 1GJIA 5ITFB 5D71H 4JZJA 1N8ZA 3MLTB 5T5NG 3RWFA 1VB9A 4PYHA 4XPFL 4CVXB 4YHZL 4RMTA 3UYPA 1LO3H 3O4LE 3VD9A 5E2VL 2A83A 2IFFH 1A1OB 4BSVA 4YGVA 5FM5M 4N0CC 4TTDD 3BQUC 3K74B 5I1IL 1DE4B 1CDGA 5H35A 5IBLD 1V05A 3D69A 5E5RB 2O5YH 2HVKB 2IGFH 4MLSA 3BSZH 2DQHH 1XGRA 3HUJA 1HI6A 5DXWA 4OQTA 4JM2A 1JPGB 3EDJA 3P11H 3NIFE 4MQSB 3ZTJH 4ZPTB 3JTSA 4B7LA 4PLNC 4MQXD 3IFLH 1BGXH 4X7SL 3RVTC 1MREL 1JN6A 3FKUS 4JQXC 1J8HB 1KN2L 5CZVL 1MIML 1IGTB 1RIHL 3V6OE 2VLRD 2CDFB 5C0RL 3KXFE 4B53A 4MNQD 3VFMB 4UV7H 3TA3B 2OR9L 4O58L 3PGFH 4KDTC 2OYPA 4AIZB 4PJAA 2JE8A 2VZVA 4XCCH 4QF1B 3MLVL 3OJMB 1BX2B 4P2OD 3VJ6B 1WTLA 1H15B 1PFCA 3VWJA 2AV1A 3UJIL 3OAYH 3GEWB 3MODL 3GKZA 4Y2OA 3QZWG 5JIPA 3ARFA 3FMGH 4A2MA 2FZ3B 3WNPA 3UYRL 1OPGH 2FJGA 1E4KC 2PW2A 2QSTA 1I4FA 1XGTA 4QY8A 2DTSA 3LH2L 4X9GA 1YN7A 4OM0H 4G7YL 2P24B 2KH2B 3TYGL 4G5ZL 1KN4L 4Y8DC 1KPVA 1INQA 4PJGA 5D1XA 5MP6H 1MCPH 3T4YB 3GB7B 5KANI 4HKBB 4S1DD 4X8JB 4LCWD 1T83A 1ZKAA 1FN4A 1LNUA 4WI3A 4AIOA 4TTGA 2JF1A 2Y1VA 2VC2L 3VDCA 1JV5B 1DVFA 2YWYA 3MRBB 3VXTA 4NQSB 5FA4A 4N0UB 2Q7NA 4F58L 1T1YB 5I6XB 4XTRD 1MAMH 1IAIM 1FAIH 1MUJA 1PG7H 2YKLL 3GK8L 3OAYK 4JG0H 3S3SA 3MFFB 2NPLX 4ACPA 1JRHL 3AXLA 4K3GA 4X6CF 4PJFB 4U49A 2C4FU 5D8JH 5GJSH 1XGYH 2P5WA 5D7IA 3QXAB 4N0FB 5INCB 3TYFB 4N90E 4S1SH 2B1AL 1KPRA 1I8MA 4LLYB 2QBWA 4M7KH 5L9DL 1RZKL 5FYKH 2V9QA 2MOVA 4QOKA 4E0RB 4I77L 3GI8H 2GJ6A 2FECI 3P0VH 4AH2B 3EYUH 5DJXA 4XMLH 4HAGA 1VFOA 4MWFA 1KBGL 2HKHH 3RTQC 2OP4H 4WW2C 2I26N 4JPKL 1WZLA 3FONA 1CR9H 2BSTA 2WIIA 3IDYC 3TT1H 4OGXL 1LE5B 1KCUH 4OJFH 5IVNA 1B0GB 3S36H 2BERA 5CHNA 4YDLB 1E6JH 4OBRA 1RJZA 2OTUB 1NL0L 5I1JH 1VEMA 3WS3B 1UWGL 3T8XA 3DX9A 1JPFB 4BSJA 1D5MB 1KG0B 5CINL 5D2LB 1YDPA 1J12A 4GBXC 2E8YA 1YYLL 3PQYE 1K5NA 3BHBA 4Z7WB 1WIUA 4JREB 1U8OB 4PG9A 2GEEA 2HJLB 4K8RC 2H3NB 2NTSP 2NXZD 4L4JA 1K2DA 2AI0H 3QH3A 5MENB 4QHLB 3QO1A 4HWBL 2P44B 4OF5A 1ZWIA 5E0QA 3MJ6A 4XCFH 3OZ9H 1BFSA 5KVGL 3SN6N 4JZNB 4KJPD 3NZ8B 1NCBL 1EZVY 1FVEA 4LARL 1FG2B 3IDNB 3PXJA 2PYEE 4OIAA 2DI9A 3O4LA 3VI3F 5IQ7L 1DSFL 4HC1L 3ELAT 3CUPB 4OZFA 3T0BA 1FYTB 1GGCL 2JJVA 3P30H 1B0RA 5I16A 3BZEB 1VADA 2D0GA 3B4NA 3GMLA 1HSAB 2K7PA 4XB7A 1Y18B 4NM8L 4AM0A 1Q9KB 3I50L 2WQ8A 1ZVSB 1MCWM 3VGHA 4P5TB 3VRLF 2EIBA 1EAJA 1YZZA 4WY7H 5ANME 1LDPH 3HB3D 3NZHH 4NWUL 3CZFA 3QUMB 3QG7L 4HKZA 4QEGA 3QEQB 4JKPL 5EUKA 3Q6GH 4X83A 2EYRB 2EICA 3CFCL 1A6TB 5ISZE 3CLEH 1UKSA 1QSFB 1IGJA 3EYOB 5DRWB 3KYMB 3KXFA 3C5ZC 5GPRA 4MA1B 5JOPD 2V7HB 4G80A 5GZOC 2EYTB 4M8QA 4ZAKD 2AK4E 1YNLH 3HI5H 1LP9B 4RA0C 1M71A 3GSVA 4ELMB 1I85A 4NRYA 5HDQL 4IIQC 4M4RA 3TCLB 1WT5C 2EECA 1INEL 2KZWA 4PGCB 5BJTA 1UVQB 2PNDA 4OTXH 3SDDD 5EC2B 4PRAA 1NFIB 4XC3H 4G6JL 1ZTXH 4BM7A 2QKIB 5A16B 3C5SA 1S7RA 4G6FD 4WGWB 4F37K 1QR1A 3GIVA 1A7QH 2I5YL 3D39D 4NPYA 1JZ2A 3V9FA 2B39A 1CYGA 4H0GA 2AABH 5DQJA 5JLZB 4EXPX 4KH2A 1X4ZA 1R5VA 3MRIB 5J3HD 1AR1D 1UZ6F 3QAZB 3QUML 3IGAA 3RUGF 3V0WH 5JHDE 1RULL 3FOMA 5JA9A 1YA5A 1FRGL 5TDNB 3MQIA 2DKMA 5IP4A 2YA1A 4MDJB 5TFSH 2B20A 1YN6A 1T2QH 5ICZA 1YC8A 3C9NA 3QHZH 1ITBB 1MCIA 3MUHL 5IW1B 5FV1L 2KBGA 4WTZG 1QA9B 1C8PA 1DDHA 4YDJA 3PDGA 2YA0A 4OLUL 3ZE2F 1MNUL 3K2MC 3HMWL 5MEQA 3QUYC 2YPKB 3ISWA 4TOYL 2NX5E 1HZHL 1U6AH 1WFTA 3ZHLA 3FZUD 5JTWA 3L3IA 3V4UH 5C0IB 3ES6B 1BIHA 2DQCH 1DLHA 2J5LB 2BOBB 5I1GH 1LEIA 4M7LL 1MHHA 2A1WH 3QJFB 1SJHB 3BWAB 3DXAD 4JN2B 3ZYJA 2OQJA 1KJ2B 2PO6A 3X12A 3QHTC 4UIMB 1EUUA 1LK2B 3SDCA 4NBYB 3UPRA 2YXMA 3U9UB 2NY0D 4F7EA 2AQ3A 3WUZA 1YYMH 3O3BB 1JP5A 5E7FA 5TE4L 2R0KH 5IB4A 2FATL 3MR9A 5D1QB 1LO5A 1EPFA 1UEMA 4R96B 3EOTH 3TH2T 3EAKA 3O3AB 2G2RB 3TH4T 2R23A 1RVFL 3BPLB 4KJWC 4YZFF 4WFHD 8CGTA 2DQFB 4YH6A 2XZCL 2N56A 3DVGB 3BMVA 3P4OB 5JNYB 5TE7L 4U1KA 1OD7A 2VXQH 5C08D 3G5ZB 3PQYA 3BUYB 1AE6L 5DK0B 4IRSB 4K94L 3GIZL 4RDQF 3BEWB 4IOFC 3BN9D 1NGYA 4MVBC 4O2FB 2XZQL 1G7MA 4M43H 5E5MB 3NTCL 4GG6B 4JFEB 3I6LD 5I73C 4QXGH 4HJ0D 4OZIB 2DWDB 4J6RH 4PJ7E 5MEOA 1OAQL 1U8JA 2FEEL 3QQ3B 2BXZA