4OZIF

S2 protein complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
243
structure length
243
Chain Sequence
MVVSQHPSWVICKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAGVGGQETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziF02
1CGWA 4Z7QE 3WL9A 1RK0A 1HEZA 2NY2C 3O6LH 3U36B 4GQ9L 1QQDA 3LQAC 3OR6A 3SDAB 2E5EA 3QDMA 1JNHA 2QKIB 1PSKL 2NTSP 2DLFH 3CC5A 1O0VA 4NRZA 1OGAE 2P24B 5MP6L 4JG0H 4DKAA 1R3IL 1WIPA 4K3EH 1NGXB 5IHZB 1KB5A 3DXAD 5KW9L 1E4WH 2GEEA 3MO1B 1F45A 3DARA 5C08B 2BNUA 3QUMH 3QXVA 3B8YA 3HCVA 3GSUA 3GMOA 2NX5A 2A6DA 3HZMA 4PJGF 3FCTB 3VMNA 5DUBB 2VXSL 4I3GA 5FGSA 4OLZH 3CNKA 3KPSB 4GXUM 1B0RB 4ZDHA 3R0MA 4F7CA 4P46C 3O4LA 2BNQB 4L8SB 3ARDB 3PWPA 2JJTC 2VQUA 4QHKJ 2FBJL 5EU6D 1V3LA 2UWEA 3FB7B 4HXAL 4A6YA 3RZWA 3UC0H 3MQIA 4LSTH 3C6LA 4OD3H 1PBYA 5DO2C 1TMCB 1OP5H 4WJ5B 4NO3B 1JRHH 2W38A 5DUML 3S34H 5DC4B 4PJHA 1MRDH 5D7IB 4KHXH 4OLWH 9CGTA 4J8RB 4POUB 3MCG1 5F71A 1YNKH 2AXGB 1CIUA 1TQCC 1UH2A 3OWEA 4OZGF 2H8PA 2XN9E 5F44A 3H42H 3TZVB 1T1YA 3D0LA 3QUMB 3QA3A 4QRSA 3RVUD 3BDBA 2BY1A 2LAGB 4KTEH 4WW2F 1BQSA 1D6EB 1D9KC 4NN7C 2ZKHL 1QA9A 4WI7A 3RVVC 5KSUB 1QEWA 5KOMC 1DQMH 5H2BB 1CFTB 2CK0L 1A47A 3AB0C 5EZLA 5H94A 5TE7H 3GMNB 4N0UB 5E9DD 3CMOL 4PREB 1NGZB 1Z2KA 3VJ6A 5FIEA 5F7EH 4L5FH 3TO4B 1R3LA 3A0OA 3D18A 2F8OA 4M5YH 5JOPE 3QZWB 4N0RA 3QDGD 4YLQT 2P42B 1YJDC 4CVWA 5D5MB 4Y5VA 2NY4C 1NGYA 1U91B 2YC1A 5F7YC 2HFGH 1MCLA 3WJJC 25C8L 3MJGX 3G5VB 15C8H 3VDAA 3QEUB 3V5DB 1B9ZA 1N4XH 4NQED 5JORA 1G7QB 4X5WB 2Y36L 1ULVA 4XVUC 3BO8B 4KHTL 1FAIL 1F00I 4YGAB 5CLTA 5HI3C 1KLUB 2E6QA 3FT3B 2ZUTA 4M7LH 5LAXB 3SDAC 4QTHA 4MQXD 3B9KD 5CGMA 3RX8A 5FKPB 3O4LE 3HE7A 3MX0A 5F88A 3T77A 5IMOA 3PWPE 1RFDH 2UWEE 5E94B 4MMXC 3MV7D 4JZOB 4NYLA 4PV8B 3MPCA 4LLWB 1YEKL 4PJHE 5HYSG 2I9TA 3RY6C 3Q5OA 3WUWG 3I84A 3WLWC 5EUOB 1CG9B 1WGOA 5JPNB 1MVUB 1FL3A 5ACZB 4Z7OF 1HYRC 2IANB 3CFKB 5D7SH 4DGYL 2CGRL 3BPLB 4ZS6D 3BMVA 4C59B 1ZOXA 1NLBH 2JELH 2OXHA 4G80B 4H1LH 1BGXL 1D5BB 1PEZA 1TZHB 4X8JB 3C8KB 4OF3A 1CGUA 2IQAA 4GRLD 5E70A 4B0MM 3MRPB 5E8DL 1AP2A 1BVLA 4X7SL 4WENB 1MEXH 3FOLA 1A22B 3KPRE 4H0GA 4JJHA 2EDHA 4LPWA 4XVSH 3WS6C 2O5ZH 3VH8A 3CUPB 4NDMA 4EI6A 2AJXH 3CK0H 3V7AE 1GYAA 3MOBL 5DRWA 3D25B 4PRHD 1BZ9B 2Q20A 1IAOA 1MCPH 2A0LC 4G8GB 3TP4A 3T1FA 2OCFD 4JKPH 5B38A 2JCCA 4R4FH 2A6JA 1RUPH 3HNTL 4HV8A 2CKNA 4GT7A 3RZCB 5TFSL 5DMJB 5AG9A 2MQ3A 2R0ZL 1RUAH 4F7EB 2NXYB 3U9PL 3CCHA 5FKAB 2OQJB 5ESAA 4W4OA 4O02L 3FO0H 1C7SA 4LSQH 1LQSR 4KK6C 1PG7L 3LV3A 1TJGL 3MNVA 1KJ2H 3K8LA 5HD8D 1SM3L 2ID5A 4P4RB 4YXKH 3RWGB 5FUOH 1RZJH 2ZJSL 1CXKA 4UILH 5I8OL 2UZIH 5CSBA 5L2KE 4KTYA 2OM5A 5DK2B 1H8SA 1QLFA 3WNMA 4YPGB 5CJQH 3F5WA 2YPLD 4PLKC 4W70A 5ITBL 4WEBH 4LRIA 3DURB 3QNZB 1PLGL 2VOTA 1A1MB 1VPOL 4KUZH 4IJ3C 3UCRA 4OQTH 1B4RA 2XPGA 3CZJA 4XPAH 1HINL 1D5IL 1NGQL 5KANI 3UZVB 1A14L 5C0EA 4R26H 1KIQB 4S1QH 1INDL 5I17A 5FYKD 4OGYH 5E7FA 1W8NA 4KK9C 4XXDB 3H7BA 4LBEA 1WFTA 3ZTJH 1DBKL 4GBXB 4PP1D 3ME0A 4XGZA 3SY0B 4LARL 2NY3C 1KJ2B 3PQYA 1NAKH 5SX4H 3TFKC 8FABB 5IESL 1VB9A 4PY7A 3VD9A 1RIUL 4Y19B 2R29H 3FFCD 4FQ2H 1QUNA 3FRPA 3VFRA 2DYPB 3LDBB 4NGHL 2AK1L 3GI8L 2BMKB 3PWUB 1WCQA 3WFHA 4MXWH 5FECA 5A1AA 1N2RA 3WO4C 1X5IA 5FO8A 3X3FL 2FEDC 2JCCE 3BGFC 1MJJA 4KROD 4JHAH 3KYOA 2VDNL 2F53A 3I6KA 5GRXG 5BZDA 2X4OA 4OSUH 1U8IB 3QI9A 2YRLA 4R4ND 4TUOB 3L3HA 5D1ZD 3RDTB 2V9TA 4HPOL 3EGSA 3K46A 4Y7MA 1NCUA 1CFVH 2VR9A 4FP8H 3UPRB 3RWHA 3S37H 1T22B 3MRQA 2QHRL 3GDBA 3PDDA 4P9ML 3I9GH 2J8OA 1W72H 5HHNB 4FFZH 3FO2A 5EZJB 2C3VB 4BK5A 5ADOL 2WBWB 2YEZA 4WFFE 2UZYB 1P6AB 4NFDA 5DYOA 4V1DA 1JYWA 3GRWA 2P5ED 2FX8L 3OQ3B 5EZOL 4JJ5A 4U6XA 1EUUA 2QL1A 4WFED 1DEEB 4TVSa 4HC1H 5L7XL 5JIPA 4L9DA 3V52L 2E7MA 4ZXBB 3QO0A 5J57B 4FFYL 4CBPA 3FT2A 2EXYD 3QQNA 5C0RH 4M7ZC 4XZUA 3LPGA 4LLAA 4ODBD 4ZTPL 1OGAD 4HIHB 1KTLB 3T2PA 2R1XB 5ADPL 2XQBL 4KVCH 2R2EA 2VDQH 3PQYE 4P9HL 4HZLA 1G9EA 1ZLVK 1JCKA 1QBBA 4EDWH 1MRCH 3EJZC 2ZSVB 1YY9C 5FYKL 1NCBL 4M8VA 3V4UL 1RV6X 4F8QA 4PJCF 2EE9A 3OKDA 3Q6GL 3KYKH 1YPZA 5LWYL 3TVMB 3HI6L 2ITCB 4DQOL 5IWLA 3VWJD 1RZKL 5I73B 3L3DB 1F8TH 1CXEA 3MGOA 3BISA 3GKWH 5DSCB 3GSOB 4N8PA 2AW2A 3R4DA 1TTFA 1HOCB 2F53E 4ZUSA 1ZLWK 2EZ0C 1WF5A 1MAML 2VDOL 5CJXC 5JOFB 4NQXB 1S8DA 5B4MC 3B3IB 4AQOA 4IEFB 4N8VB 3KHOA 3G9AB 1RZ7H 3C5ZB 1HZHH 3MLZL 5DHYB 4RWYL 3IJYA 1A6WL 1OCWL 1U8JA 1RZJC 1Q9OB 1XF2A 1BD2E 2VKWA 3MRIB 2PNDA 1AXSA 4YHKH 4K8RH 4MJIA 1KCLA 3W11D 1LNUB 4AZ8A 5HY9A 4LSDA 5DT1H 4JFFB 1GSMA 1KYOJ 5LJYH 4MA8L 4M1DH 1CE1L 3QULB 1I8MB 1M7XA 2CDGA 2IBZX 4V1DE 1GGIH 1UACH 4KK5C 3D2UB 1LWRA 5HDOA 1KJMA 3ZDZF 5D7JA 1NBVH 1P1ZA 3N0PB 3RDTC 4ZNEA 1OHQA 5F7FA 1AJ7L 3GMMB 1A3QA 5JOPD 5EU4A 4H26B 4OCXH 3HLAB 1OTSC 1BREA 2YD9A 2ZSWA 3U46B 1MIEL 5IVNA 5KSBF 1NCCL 1CZ8L 5DD1L 2Z93B 4Y2DA 4JKLA 3G04B 5EU7C 3QIUB 4FQXB 1JWMA 2FGWH 3RX5A 3MGTA 5IMMB 4NNYB 4PJ5A 5EC2B 3L3IA 2Y5TA 5B39G 4OCWL 2EO1A 5HVHB 2H2SC 5EUKA 1MHHA 1YPZE 2PTTA 4XCCH 3HS0A 3IKCA 1X4XA 5D72H 4H0HB 1YC8A 5DRNB 3LS5L 3L1OL 1CGXA 4F58L 2MKWA 2W92A 5JXED 5AZ2L 1UXWA 5KSVB 5EORL 4OCNC 2X10A 3SKNA 1YEIL 3Q0HA 5D7LB 3C6LD 5T1LA 3T2OA 4QXGL 4LASL 1XIWC 2LU4A 2PYFA 4MJIE 4NCDA 4DW2H 3KPLA 4Y4KB 1F6AA 1FFOB 4LLYB 4ZUWB 4PFEA 3RGVC 4OLUH 3QSKB 4FQLL 4U7SA 1VCAA 3K80A 4CN6A 4PRIA 1BWWA 2O93L 12E8H 1AGFB 2LFGA 4NO0A 5HBBA 1I8KB 1FNEB 1HI6A 1K8DA 4IDJL 2RHEA 4XCYB 3JSSA 4PJDA 1I3RB 4MX7B 2YK1L 3SKMA 1XCTB 4G7VH 4ZNEE 5D1QA 3WUWA 3MLVL 3TNNB 2HWZH 2DAVA 4X6FA 2FX7H 1PKQA 3LN9A 5DJ2A 4IIQA 1MCEA 4UV7L 4X0KB 2Q6WA 2FH6A 3VXQB 2VC2H 3GHEH 4CKVX 4X5XB 2OTPA 3OMZA 4R2GC 1NEUA 2DLGA 4XB8A 5EPMB 2WNGA 3W0WB 3QWQB 4CRPA 1TJHL 4QRPB 2FGZA 3KPRD 3SDXA 2X4TA 5ANME 2ZP0T 4YXLH 2YSSA 5E2VH 3SKJH 3G5ZB 1DTUA 2BVTA 3GMPB 3S96A 2KH2B 4O2EB 3OGOE 1R24B 4DOHE 3KS0J 2CLZB 5C09B 1ZHKB 1CD1B 4DGVL 2Q76A 4Q0XL 4PPTA 2RCSL 5A2IH 5IBTL 4OV6F 4UTAH 5J13B 3MROA 5C2BL 3SBWC 5L2JA 3HE6C 2XTJD 1ZLSL 5IHBA 1U3HB 4K8RC 5GJSL 1UH3A 2VDPH 5DK0B 4HFWA 5D70H 5C0IB 4LKXB 4G9DA 2P46B 1DL7L 5ECJE 5IP4A 5F1IB 1A7PH 3VRIA 3RWFA 3GHBL 2Y06H 1J8HB 5L2KD 1VGEH 1ZKAA 3ETBF 3N1FC 2QQKH 1B0GA 1RURH 3DSFH 1MH5B 3H6JA 1HQRA 2VDRH 3CFBB 3VXUB 4DFHA 3KAAA 3L3JA 3FZUC 1V3JA 3RHWF 4DGIL 4NC1C 4H25B 4TVPD 4YHLH 5BJTA 4PJDE 1WBYB 2R4RH 3SGEI 5CINH 1KB9J 3MV9D 1JWSA 2HTLC 2LQRA 1JGDA 3EO9L 1MHCB 1Z3GH 4DKFL 1AQKH 1K4CB 4EI5C 3N1MC 4RGND 4JGMA 3V5HA 5BXFB 4KRNA 1IGFH 4LRNH 5F3BB 4X6CA 3RU8L 3C60C 3MMEB 3WNNA 4Z7VA 2XG4A 4UMGA 2HVKB 4MDIB 1A4JA 3Q48A 1U93A 3O8XB 3SDXE 4OF0A 4OTXL 5GGVY 5IB4B 2DIJA 3IU4H 1IQDB 4IOIA 3WFBH 4PTUB 1KENH 4U0RB 2HKFH 2M26A 5EG6C 5ICXA 4C58B 3B2VH 4E42A 5GZNC 4UTBH 4LVOB 1C7TA 3HC4H 1DZBA 3OG6B 5CMAB 1WZ1H 2R2CA 4Q6IB 3RKPA 4OB5L 2P8MA 3GGWA 3VD4A 3F12B 2LVEA 1MFCH 2GITA 4KVNL 2PXYA 5C0BA 1J0YA 2AABH 2Y07L 1S7RB 4HS6A 3HRZA 4EN3B 1EFQA 1UVQB 3GSVB 2C7UB 3ARXA 4Y5YB 3WV0A 2VDML 4FOMA 3WEXB 2VWEE 4ZFOL 2VH5H 4WCYL 4X6DF 1KLFA 2UUDH 5FYLH 4XNMA 1N3NB 4ZFGH 4J2XA 3OAUH 1MSPA 2BVQA 3RTQA 3MRRB 1U9KA 4LQFL 5IQ7L 1OQXA 2V7HB 5E8OA 1S78D 2YPKB 4DEPC 3OKYA 1DQLH 5C0FB 1U3HC 4KUCD 2VZ1A 4UT6L 1J0ZA 5DJ8A 3DYMA 5T5NG 3HI5H 1AO7B 3ZKMD 4YAQA 4HK3N 4RZCB 1HDMA 2B4CH 3MODH 4CNIA 1S7QB 4WRLA 5C0DB 2IJ0C 3RI5K 5E5RB 4X6CE 4ERSH 1CLZH 4JANA 1H3PH 4TVPL 1A3LL 3A6CL 4AL8L 4PJAB 1NBYB 1V7NH 2G2RA 2J8UB 4S10A 1AFVL 1P53A 4HXBL 4ZAKA 5ISZA 4TUJA 2W65B 3K1DA 3BKJL 5BOZG 2VLJB 3ZT7A 3F7YB 2FJGA 1AHWB 1WBXB 5BVPH 1IGCL 1KPVA 5IB1A 2DMKA 4LLMB 1XGTB 1UB5B 1C5DB 1JNLL 3DX9A 4P48A 2DQHL 3SOBL 2NY1D 5F70A 1KIRB 1QFWM 5I15H 1MFAH 3DPBA 5HDBE 1SY6L 2EDFA 3B83A 4ORGB 5SX5K 1M7IB 1QLRB 2CRZA 2HRLA 4P23B 5C0BE 5EOQL 1BD2D 2YA2A 4H88H 4O58L 1A6TA 1MWAA 1RK1A 5CS7A 4WO4C 1UQSB 4W6WB 4RGMB 3ORJA 5I8KL 4O5LH 3H9ZA 5GGQH 4UT7H 4Z76B 5E1AB 1DLHA 2E7HA 2GK0A 2BCKA 3ARFC 4MCZA 4NJ9L 4U3CA 3VD3A 5KAQF 1G7HA 4PBWD 3QQ9D 3DRQA 3SGKA 2G5RA 1IAIH 1IRAY 2ZWLT 3ARQA 3TN0B 3O81A 1R3KA 4ZPVA 4HKXA 2YA0A 3FJTA 5IIEA 4HT1H 3QAZB 1HHIB 4NO2A 1VFBB 2OZ4H 5D6CA 2KZWA 2WANA 1I85A 2VZ3A 3IAGC 4TNWK 1LDPH 5EO9B 1MCCA 2ITDB 3BKCL 3ZE0F 1RMFL 1YEEH 1A5FH 5FOBA 4ZFFB 1BBJA 2YKLH 3UZQA 3VE0A 3BQUA 3GKZA 4L8BA 4OZIF 5IVZB 1R5VA 3WN5A 5ISZE 1UJ3C 1BJ8A 1I1RA 3L7FB 2WBJD 1OAQL 1IC7L 4HIIA 1IGTB 3L7EB 3NCJH 4NQSA 1MF2H 4JKMA 1FZMA 4XMKL 4BUGA 4I3SL 4YDJB 3DBXA 2XFXB 1CK0L 4FZ8H 4LCWB 3JTTA 3QRFM 4AK1A 3RPIA 1QKZH 5JR1H 4H5SB 1J05B 5C86A 1U6AL 1DVFC 4MSWB 1OAZH 1OAKL 2YBRA 3MUJA 5B39A 1PEWA 3S36X 3PDOB 2QJDA 2X70B 2Z9TA 4TUKL 5I1CL 1FVDA 2YUVA 3ECBA 4MJID 2FATL 4LOUC 1BJ1J 3V5KA 5EWIL 3W39A 1QR1B 3RRQA 1TITA 1AHWC 2VDLH 1G7JB 1BAFL 2VKXA 4FQHB 4PJ9A 1A02N 4YO0B 1ROWA 1MCWM 3MXWH 1TQBC 3BPNB 4OIIH 3TH2T 1JMXA 4O2CB 3KPPA 5K59E 4Z7QF 4TPRH 3HAEB 4NNXA 1IGIH 3VXSD 1K3IA 1RJZA 2JK5B 3N85H 4H1LG 5BRZB 2F19L 3GIZH 5HHVH 5GIRB 3QG7H 1LMKA 4M1CC 4XBPA 2W9EL 5L6YL 1HHHA 2FX9H 2VIRA 3AROA 2AKRB 3RPKA 5J12B 4GG6B 3KS0H 2DLTA 2V5YA 1AC6A 3GSXA 3ARED 2F54B 2W0PA 2RJMA 1FSKB 5JZ7D 3MUGB 1U92B 1Z0MA 3U6RA 4Z8FH 4FABL 5I2IA 4TNVK 2CRYA 2GY7B 1FVEA 1NAMA 3B5TA 1OSZA 5A2JH 4L4VE 1KCUL 1NC2D 1WEJL 3O2WL 2Q8BH 3V0VB 4C83A 1KN4H 3H9SB 3QG6A 5JW4M 5LGJB 1FQ9C 6CGTA 1E27A 1YDPA 1KN2H 3MRGA 1YUHB 5IOPA 1L7TL 1MNUL 4IRZL 4HWEH 1DBJH 2K9UA 4L29B 1U8OB 1I9RH 4RDQG 3MRMB 5E6YA 3W5NA 4PGCB 3MLXH 4ZNCD 1ORQB 4UB0L 3BD4A 3BXNA 4F15C 3U4BH 1FP5A 4NZUH 3K2UH 4PD4J 3X3GL 3B6SB 4U1IA 4IRJB 1KLGA 1LK3H 1A9EA 2B7DT 4MQSB 1YEGL 2W1NA 1PAMA 3FAWA 5FV1L 1RULL 1CQYA 2VR5A 4QRQA 1JUFA 2IADA 2R9HD 3HC0B 4HUKB 3QUXC 4QRUB 4XMPL 2A2QT 4D3CL 3UDWA 3WFDH 5HHOD 5CSZB 3SE9H 3MRFA 2MSPA 4K7FA 4Q9QL 4Y16A 1H5BC 3ARGA 1QSFD 1EJOH 3CSGA 4NKDB 1EGJL 4TQEH 1LE9B 5DI8B 1HCVA 2G75B 5HGDB 1IJ9A 3DETD 3N1QC 3VWKB 1YECL 5TE4L 3SGJA 1QBAA 1F3JA 2E9BA 4QHUA 1Q9WB 5T3XE 1FO0L 1F4AA 1EX0A 1DDHB 1LD9B 4LEOA 3LEXA 5D96B 1JI2A 1HSAA 1RZIB 2QADD 5MEQA 3NH7H 4YE4L 4JO1H 1X5ZA 4AIXA 1BOGB 4PG9B 2A1WH 1T0MB 3U9UA 5D7KD 4YBLB 4NPYA 3PWNA 1EEUA 3QP3A 2VISB 4LCCC 4I2XB 4MQTB 2WWMD 4OKVA 2EXWC 4O9HH 4XCEA 3C6SA 1MPAH 3FB5B 6FABL 2GUOA 3QCVL 4Y4FB 2JIXA 3LKOA 1EAPA 2IALB 5D1XA 4ZUUA 3CVIL 3DROA 3ESUF 5HHME 2PO6A 1PY4A 2UWEF 4XWGH 1J1XL 1T2JA 2X89A 2EE6A 1MY5A 4WI6A 3RWDA 3MRNB 3MA9H 4PJHF 4FZEL 4WGVB 1Q1JL 3LB6C 5A16A 5CD3A 3RVTC 3BT2H 1KGCE 2VAAB 3IFOB 1RY7B 4P4KD 1BBDH 5I1IL 4P5TB 3MV01 5E7BA 1SJHB 2QKIA 3KXFB 2IFFL 5T1KB 1UWGH 2JE8A 1WFUA 1GPOL 1GGCL 1HKFA 4HW6A 3ZDXE 1NGXA 5IHZA 3PGCB 1NSNH 2VZTA 3MO1A 1P6FA 5C08A 3O6FC 3VG9B 2VITB 1J18A 4N8VG 4WNQB 4XVTL 4I0PD 5CEZE 4OV5B 5D71H 1JHKL 5I9QB 3FT4B 4ZOBA 3RKDC 3FCTA 3ULVL 5DUBA 1ZWIB 4HF5H 2X4UB 3KPSA 3DRTA 1B0RA 3EDFA 4NQCB 4Z95H 1M6OB 4ZOAA 1FVCA 1S9KC 2BNQA 5J6GB 4L8SA 3ARDA 3MLUL 4G6JH 5GRUL 5EA0H 3RA7H 3FB7A 5LGKA 1T7WA 3TM6A 1A7OH 4NC2B 2BX5A 4WJ5A 4NO3A 3GJFH 1PJ9A 2ESVD 5D7IA 1IT9L 4J8RA 2AXGA 1RUKH 3VDBA 1OSPL 3TBSB 2ZUQB 4GQ9H 3TZVA 3QUMA 4CU6A 1PSKH 1D6EA 5E2WH 4HBQA 3WS6A 5GGRB 4MJ5B 5KSUA 1JPFB 2HKHH 5H2BA 1CFTA 5MP6H 3L95B 5IUSA 1R3IH 3QFJE 2ICEB 1CFQB 3AC0A 4ISVB 4N0UA 4LP5A 1NGZA 4PREA 4CL7A 5KW9H 1QRNE 3LKNB 3TO4A 1CGYA 3VMPA 3QUZB 3QZWA 5GGTL 2V5SA 2D31B 2YWYA 5D5MA 3IDNB 3MV8B 1U91A 2D0HA 5DQ9B 1NL0L 1ZEAL 4W6XB 3RVXD 3G5VA 5C0CB 1D3CA 2WWKO 3BVNB 1VKXB 3QEUA 3V5DA 3SHSA 4JPWL 3ARRA 2FBJH 4BZ2L 1G7QA 2C1OB 4X5WA 1N64L 1Z0NA 1KJVB 3UYOD 3BO8A 3LQMA 5I30L 4WTXA 5DUMH 1KLUA 3FT3A 3KPSE 5LAXA 4DTGL 4KKLC 4FNLL 5E00B 5FKPA 2HTKD 3P11L 5EBLB 1TLKA 1S7SB 5E94A 5FB8B 3V0AC 4JZOA 4PV8A 1WV7T 3NZ8B 2ZKHH 4OZ4B 4LLWA 4XCNB 5IFAL 5GSVB 1BJ1H 5D7IE 2JCCF 4GH7B 2GSGB 3PF2A 2OJEB 4NJAL 5KSBB 3CMOH 5I1GL 3BN9D 4XNZB 3BYTA 4K3GA 5EUOA 1CG9A 1NCTA 3SO3C 1T89A 4IMKC 3VFOB 4QWWD 1ODAA 5JPNA 4Z7WE 5INCB 4YXHH 5ACZA 2WM0A 3W5MA 25C8H 1UADC 4HJ0C 2IANA 3CFKA 4N0UE 4BH7B 3S5LG 5I0DA 4C4KT 4MXQD 4X7DC 4G80A 3CXDH 2E9JA 3DV6B 1J0HA 2Y36H 4MJ4A 5IGXL 5D93B 3U7AA 3ZKXC 3NFNB 4YHYC 1D5BA 4KHTH 2D7QA 3CAFA 1FAIH 2MTPA 5D5ME 2M8XA 1C12B 1TZHA 4X8JA 3C8KA 4O00A 4QEGA 3TH3T 4XT1C 3UTQB 1PZUB 3MRPA 2K1MA 3QQ3B 4HBCL 3MJ9H 1B4JH 5E2UL 1FV1B 4PGBB 3AMKA 3WDJA 1NGWB 3CUPA 1JGLH 1CCZA 3D25A 1BZ9A 4J4PA 3L5XL 1U95B 1YEKH 2IAMD 5IW1B 4G8GA 4JDTH 2WLZA 1DFBL 3IFLL 5BVJB 4Z5RB 5DEGB 3RZCA 5B3JE 3BQUD 5B8CB 4F7EA 4P2OD 5GGSY 5FKAA 2OQJA 4LLQB 3HPJB 5FFLA 4L4VD 4KZDL 1XGRB 2FNBA 4UU9B 1FRGL 4YHZL 2B5IB 3ZTNL 5C0JB 1JFQH 1WBZB 1ZMYA 1YN6B 3RWGA 3SQOH 2CJUL 3BYYA 4YFEA 3SCMC 4KKBC 4DGYH 2Z91B 3OKMB 1G6RL 5EUOE 2CDFB 4M3KB 5DK2A 1E4XL 1BGXH 3UAJD 1UA6L 1QO3B 4YPGA 2BJML 4L3EE 4R7DB 5DMKB 3RI5F 4I48B 1U58B 3GZKA 4TSCL 2Q8AL 3O6KL 3DURA 4R97B 4FFWC 5E8DH 4G7YH 4NN6B 3TF7C 1JYVA 1A1MA 2IANE 3P4MB 1GHFH 3K3QA 4X7SH 4M6ML 2O26U 3REVB 1KIQA 2ENSA 2AJVL 2MPAH 5EU6B 2R23B 2E6JA 1EVTC 4M7KH 3RVWC 2VLRE 4DVBB 4XXDA 4PJ9D 2DQUL 4GBXA 3SY0A 4GRWH 1KJ2A 3ARTA 3TJHD 8FABA 1HXYB 3HNTH 4JRXE 3P9MB 3QIBC 2H41A 4KWUA 4Y19A 3PL6C 1CGSH 5TFSH 2V17L 2R0ZH 5TDNB 4KK8C 4NOFA 2DYPA 3NIFE 4UBDC 3ZO0A 2BMKA 4O02H 3PWUA 4D0DA 1XGYH 4MHHI 4Y0GA 3GSWB 3FQWB 1PG7H 3U7YH 4HHAB 4PUBL 1SM3H 1FE8L 5E9DB 2PYEE 4JLRA 3DMMC 2UZXB 3MCKA 4OQTA 4YC2B 1RIHH 4IRSD 3QIWC 5I8OH 5E6ID 4AENB 3QO1B 1U8IA 2NZ9C 3TT1L 3PP4L 3QDGB 3E8UL 4TUOA 1FGVH 3RDTA 5CP7B 1YPZF 4EBQL 4OLYL 1N6VA 2NY2D 5ITBH 2F9BT 3UPRA 2DQEH 1T22A 1XFPA 1VPOH 3SDDC 3VGGA 4YDIL 4GRWB 1HKLH 1KELL 1HINH 1D5IH 5HHNA 1MY7A 1H15B 4NQEB 5GRJL 5J11C 2HJFB 5EZJA 1INDH 2C3VA 1QYGL 3WJLC 2X1WL 5FCSH 4GKSB 2EIZB 5J06A 3BH9B 2HLAB 4TYUA 4Q58C 4TNWF 2K7QA 4NQUA 1DBKH 1VENA 4LARH 3B9KB 1DEEA 4PR5B 1EEYB 5IESH 1KGCD 4C57C 1EHLH 1RIUH 2DD8H 3R0NA 4ZXBA 4IOFC 4WY7L 4J6RL 1Q72L 3ZHKA 4NGHH 2AK1H 3GI8H 4P46D 3MNZB 4HIHA 1DQJB 1KTLA 2IMNA 4JDVB 5KS9B 1BQHB 2UVFA 4XAKE 2NR6C 3X14B 5DO2D 4LHUG 4Y19E 2VDNH 3V9FA 1F3DH 1FFNB 1RAMA 2ZSVA 3OXRB 3PXHA 1ACYL 1VEPA 4HPOH 5E5UB 3W81A 1H0DA 5IB5B 3T04D 3TVMA 2ITCA 2FJHB 3L3DA 1Q94B 5GRYA 3K7UA 3K2MC 5DSCA 3GSOA 3QCUL 3NTCL 1D9KD 5HGBB 1HOCA 3RVVD 4GMSL 1AGCB 5JOFA 4NQXA 4WWKC 3B3IA 5C0AE 3T0EC 1GGUA 3C5ZA 3EZ8A 1QFUL 5DHYA 2X2YA 3CH8A 3TIDA 1Q9OA 2YUXA 1ZXQA 3E2HB 3MRIA 4GRLB 5HHXH 5IBUG 3VI4E 5EZOH 5DFWH 5DJ6B 1LNUA 2AXFB 5GRWA 5L7XH 2YPVL 4JFFA 2NY4D 3V52H 1SMOA 3CU7A 5JHLH 2X89D 2UY6A 3QULA 2E7LA 4X7TB 1DE4B 3LQAL 4PRHB 4PY8I 4ZTPH 1UZ6E 3RIFK 1KFAL 3D2UA 4XVUD 4GMTL 3QFJD 1JHLL 5DD5H 1QRND 2P8PB 4HS8H 4F9PA 1B90A 3GMMA 5HI3D 3WNOA 5FYKH 3SDAD 4ZS7L 1NCBH 1NDMB 3V4UH 2VXVH 4H26A 3HLAA 3U46A 3Q6GH 4LAJH 1JZ5A 3ZHLA 3IDXL 3TC9A 5KG9A 4DK6A 2WZPD 4PJDF 1FG9C 1Y18B 1RZKH 2Z93A 4UI2A 4LF3B 5I1HL 4J3WA 4GKOA 4UNVA 3G04A 5FA3B 3QIUA 1MCIA 1F58L 4ZYKB 4DVRL 4FQXA 1J0JA 2VDOH 1MAMH 4O2FB 4NNYA 5IMMA 5EC2A 4I3RL 1NUNB 2F58L 1ZS8B 4JVWA 2EH8L 4RWYH 3WLWD 1F97A 1A6WH 1OCWH 2DICA 2YPLB 4Z7NE 1NQBA 5DRNA 4NUJB 4Y5XC 3MYJA 3WMSA 1T66C 2A6IA 2XZZA 1P7QD 3SDXF 1I7ZB 4XNYH 5KSVA 2NY6B 1EPFA 4JQXA 4N0FB 4YHPB 5D7LA 5EU3B 2C3HA 3CVHL 2ADFH 3PHQB 5KJRH 4HGKC 3OKLB 1YQVL 4Y4KA 4ZUWA 4LLYA 3D87B 4M6NL 4JFFE 1AJ7H 3FFCB 4FXLA 2OYPA 3I3EA 4BYHA 3B5HA 1ZGLP 3FN0L 2WIMA 3CFDB 5EOCJ 1TNNA 5C8JB 1AGFA 5FO9B 1MIEH 2I24N 1FNEA 4M5ZL 1NCCH 4XCYA 1CZ8H 1OTUC 5DD1H 3GBNH 1I3RA 1UJTA 4MX7A 1XCTA 5BMFH 3KJ4C 1ZVYA 1BPVA 1XGUB 3KWWB 4KJQC 3LN5B 3E2HC 2A0LD 5K9OB 1TVBB 2VLKB 3HMXL 2DTMH 1FGNL 3ZZ1A 4X0KA 2FECI 3VXQA 4X5XA 3UBXB 5EZIL 2CPCA 3LS5H 4M4PA 1IMHC 1EXUB 4F58H 1A7RL 2NW2B 5GS0C 3W0WA 2J8HA 5AZ2H 1LEIB 4QRPA 3QUYC 5EORH 5FHAL 4KK6D 2C3WA 1A6ZB 2X4RB 1I1YB 1J1PL 1LEKB 1YEIH 1IFHL 2BDNL 3G5ZA 4X6CF 1FIEA 3GMPA 4XP4L 4JFQB 2CK2A 4QXGH 4IOSD 3UYPA 4LASH 4XXCA 4O2EA 2P5EB 3NCYS 4XNXL 3ALWA 3K4DA 1R24A 5DQDL 2CLZA 5C09A 1ZHKA 1CD1A 4PLKD 2ICCA 4NC1E 4N9GB 3S36L 1S7VB 1U3HA 1KJ3L 3DJ9A 4JM4L 4JG1L 2C1PB 1GGTA 3NCBB 4HKZB 5DK0A 1OGAB 5C0IA 4LKXA 5FM5M 1ZANL 4IDJH 3CDGB 1DP0A 2PETA 5F1IA 4A2LA 2YK1H 2AK4B 3WFEL 4KK9D 1J8HA 3MLVH 1N5AB 1ZLVH 5D2LB 2P5WE 5HDBF 2NY3D 4M9OA 1Q0XH 1MH5A 3TFKD 1KSRA 2DLFL 3CFBA 3VXUA 1OB1B 1IEBA 4UV7H 4AEIH 4L3ED 1YZZA 2NY6C 4J12A 4H25A 3VWJB 1WBYA 5EIVA 4JZJB 3HG1D 4D0CB 4Q2ZB 1HH6B 5I1KH 1MHCA 4V2CB 1MJUL 2X4NA 1K4CA 4DFIA 3VXME 3PV6B 2FEDD 5JOEA 5BXFA 2VLRD 3EO1B 5F3BA 1KUMA 4ESKA 1PYWB 1SHMA 4XH2B 2AP2A 4JFXB 4OLZL 3MMEA 4RQQB 2IH1B 1CXLA 2Z4QB 3NCCB 5ESQB 5GSRB 2HVKA 4DGVH 4JRXD 4Q0XH 3STBA 4MDIA 4QRPE 2DIBA 3O8XA 5IBTH 1F4HA 2P47B 5C2BH 5IB4A 2DMBA 1IQDA 2A83A 4PTUA 4OD3L 1T7ZA 4ODSL 2XKNB 5GJSH 5TF0A 1JRHL 3U1SH 4G3YL 4GG8B 1DL7H 5CMAA 5F9WB 5C09E 1U2CA 3GHBH 4I9WD 2PYED 4Q6IA 1YNKL 4RCAA 5I6XB 4P5MB 1FN4B 4E41E 5DFVC 1ZLUK 3F12A 2NXYD 1CLYL 2BXYA 4UQ2B 2OL3L 2OR8A 2VE6B 3MUY1 1S7RA 4DGIH 3PE9A 3W9EB 4LQ1A 4EN3A 1UVQA 1T04B 5TE7L 3GSVA 2C7UA 4X9BA 2EC9U 4PJ8C 3LKRB 4M62L 1J8HE 2QQNL 4Y5YA 5F7EL 2ZOKB 1YMMD 3EO9H 4DKFH 3WEXA 1OWWA 1JK8B 4PB9L 1N3NA 3VXUE 3RU8H 3MRRA 3WIHA 2WMPA 3EJZD 2V7HA 1ZHNB 3QEQD 5DJDB 5C0FA 2BHUA 3TPUB 4X98B 4OJFL 1AD0B 1AO7A 2O5XL 4LCYA 4RZCA 4D8PA 4KKNA 3DV4B 1S7QA 4N90E 5C0DA 1FPTH 2NMSA 2ZCKH 3KHQA 5BW7A 4EDXB 2VO5A 4F33B 1CU4H 2H26B 4PRPD 4PJAA 1NBYA 3C87A 5K59F 2Z92B 2DM2A 1T21B 5B4MD 2J8UA 4OFVA 4XAKD 3ZYJA 3T2QA 1N26A 4OFYA 3JWNC 1ZV5A 1I75A 5EH1A 1SVCP 2YD5A 4Y19D 5C2UB 3GSRB 2W65A 5JDSB 2PW2B 2VLJA 3DHMA 2NY7L 4WFGE 3F7YA 4KVNH 3CJJA 1WBXA 3O3DA 5F7KC 2OMBA 3V7MA 1W8OA 1Y6KR 2Q87A 2AJYL 4LLMA 1XGTA 1BFTA 1UB5A 1C5DA 4ZO6A 2FWOB 3I50L 5BS0E 5I71C 2VDMH 4C56E 1KIRA 1PY9A 4HJJL 2HRPH 2E9WA 3DVIA 4KK5D 4WCYH 4X7CC 5C0AD 3RDTD 4M1GL 4HLZH 1M7IA 1QLRA 4P23A 4PJGA 4RFNB 3TWCH 4LQFH 5IQ7H 1EVUA 4X8XA 4GRMB 1G1YA 1X6LA 4UT6H 3H8NA 5B22A 3P9WB 1OTSD 1UQSA 3KLAB 4PJ7E 5E1AA 3I2CL 2J12B 3WCYA 1T5WB 2A73B 5KZCD 5F9WC 1FL6B 3OX8B 1NANI 3MCLL 4TVPH 3WFCH 1A3LH 2XT1B 3A6CH 4AL8H 3OAZK 3U0WL 2CIIB 5GRZA 4C55A 3TN0A 3D85A 3IU3B 5JHDD 1WIUA 4H20L 1AFVH 1AR2A 5DS8B 5FF6B 2D7TH 3RFZC 4ZXBD 1HHIA 5GPRA 4GW1A 1VFBA 4WI2A 1F90L 2XTJB 3BKJH 4ZFOB 5M94B 4MWFB 4PG2A 5EO9A 4WW2A 4HIJB 3NFSL 2BVUA 4PJAE 1AD9B 2BC4B 4V2BA 2J8UE 1JMZA 4ZFFA 5MI0C 5TF1L 1C5BL 2O5YL 2ZOLB 1JNLH 2DQHH 4PJIE 5L2KB 2J7LA 3SOBH 5IVZA 2YWZA 1XIWD 1EO8L 5D2NC 2VLJE 1EMTL 2Y72A 4BFBD 1IGTA 1YYML 3L7EA 1GH7A 1SY6H 2WLYA 3FO0L 5FYLE 4O4YL 4NN5B 4XC1H 4YDJA 5EOQH 2XFXA 3VU2A 5J56B 4K07A 1CVSC 1ERNA 4LCWA 4N8CL 3VGAB 5HI5C 1MREL 4YXKL 3C09B 5EOCH 1RZJL 3MV9B 3V6OA 4M6AA 4H5SA 2Y7QB 5E5MB 4GFTB 1J05A 3ZHDA 1I8IB 4MSWA 4NJ9H 1P4IH 3O6ML 1IAMA 2OZ4A 3L6FB 3TBTB 4RGNB 3LRHA 4NKOB 3PDOA 4BM7A 2NY5C 2Z31C 3VFWB 4ENEC 1EFXD 3BP5B 4GW5B 4WV1B 3BIAX 1OD9A 4PGDB 1ZSDB 1FYTB 1QR1A 1S5IL 3RNQA 3TT3L 2ILLA 4HH9B 3QRGL 1G7JA 3QEGL 2CLVB 4FQHA 4L9LB 3LD8C 2JTDA 3OZ9L 4YO0A 1BFOB 1RMFH 1REIA 3BIBX 4MAYB 2BSTA 3HAEA 4D94A 2MKLC 2JK5A 1PDKA 4RMVA 2R29L 1JZ8A 4CMHB 4FQ2L 5GIRA 4DUVA 4WGWB 2WIIB 3O4OB 2X42A 2AKRA 1OAQH 2HJLB 4GG6A 1IC7H 2ZUVA 1QLEL 4CN4A 3ZDXF 2F54A 3AXLB 1SEBB 3MUGA 5IROC 1U92A 3HE6D 1CK0H 2V5RA 3ALPA 4K8RD 1TDQA 3RL2A 4JHAL 4QNPE 4FQXD 4OSUL 1U6AH 1QFWI 3FB8B 3O3BB 1OAKH 2YXMA 2R1YB 3V0VA 1K5NB 3F65A 3H9SA 5LGJA 1AKJD 1YUHA 4FP8L 5I1CH 4HWBA 3P30L 4CVUA 3X12B 2EIEA 1U8OA 4L29A 4JE4B 5KN5B 3MRMA 2J3SA 4HK3J 4LNRB 3V6OE 2FATH 1IAIM 2PW1B 4PGCA 1W72L 3FZUD 3JWDH 1ORQA 3VXPB 5I8EB 5EDXA 1B6UA 2DQTH 4FFZL 2EE2A 5HHQB 2BK8A 3B6SA 4IRJA 4B5EA 2HTLD 3FO1B 4X9FA 4RMUA 5I8CB 5GGVL 2GHWB 2HJKB 5HPMA 2ATKB 2IEPA 1OAXH 4Y4KD 2H2PC 4EI5D 1RZGB 3HC0A 3STZB 4QRUA 4HC1L 3GJEB 1YA5A 3ZT5A 2F19H 4NN5C 4XI5C 3BEVB 4JPVL 5L6YH 5CSZA 4U2ZA 2W9EH 4K3JL 2VABB 2P5WD 5DVMA 1MHPL 4R0LC 4NOBA 4U1MB 1I9IH 3C09C 1TZIB 2A74B 4OCMC 3V4PL 7CGTA 2JJWA 3G6JB 4NKDA 1LE9A 5DI8A 1KIPB 3TYFB 1JPGB 3GO1L 5HVGB 2G75A 5HGDA 3VWKA 1E6JL 5BRZE 2JJVA 2NY1B 5GZND 1MRCL 3O3EA 5D9SB 2Y5EA 1KCUH 5TQ2L 1Q9WA 1WEJH 3O2WH 2ZUXA 4GG6E 3VXMD 5EBMB 5TH2B 1GOGA 4XNUH 3ZT6A 2F54E 1DDHA 5TDOB 4I18C 1U3JA 1LD9A 4UAOB 1BD2B 1L7TH 5SX5H 4MB4A 1MNUH 1EDQA 1RZIA 2EDXA 1FZOB 3MJ6A 1F8TL 3UYRL 1TFHA 3GKWL 4L9LC 1BOGA 4PG9A 2KQNA 1T0MA 4G8FB 5CFHA 2CR3A 2VISA 1NFDE 4I2XA 3FB5A 3D48R 2JJSC 4L4TD 3OR7B 4Y4FA 3UP1A 4M7JH 2IALA 3KNBB 1WAAE 3BD5A 4K8RL 3EDJA 1OM3L 3O4OC 3M1BB 5ERWB 5TDPB 1P69B 1MHEB 4XMPH 5L0QB 3M17B 4D3CH 5T5NF 1JV5B 2GJZB 4E41D 3W2DH 4MYWB 2R0LL 3MRNA 1U3HD 4U05A 2VZVA 1WC7A 2H45A 1BQHG 2C9AA 5D7IF 2G5BB 2QSVA 3RWEB 1EGJH 2ED7A 3MSPA 3BFOA 4FQIH 3QQ4B 1TTUA 2VAAA 1KTDB 3IFOA 2I60H 4POYA 1PG7W 1NBVL 1CD0A 4EQ2A 4P5TA 5TE4H 3CXHK 1SJHA 4KGJA 3KXFA 2Z35B 2WBJB 4Z7WF 5T1KA 2VDKH 1FO0H 4IHOB 4OCXL 1IE5A 1EAJA 4AMKL 2Y4SA 3PGCA 3AM8A 5IVOA 1M7DA 3EYQC 4YE4H 5F89B 3H3KA 4M6OH 2VITA 4BQ9A 4WNQA 4OV5A 5D5MF 3FT4A 6FABH 1ZWIA 3BDYL 2X4UA 3QCVH 4NWUL 1IGML 4XCCL 4NQCA 1M6OA 5D4QA 3CVIH 5J6GA 4UV4H 5AYUL 3X13B 4P5KB 1J1XH 2WW8A 4HWZB 1KF9B 1OP3K 3QR2A 4I2XE 4S1RL 4UDTB 2QQLH 3MRDB 4WO4D 1IKNA 1FO0B 4FZEH 1Q1JH 1I1AB 2X05A 4JDZB 2XXCB 3NPSC 3JWDC 3EHBC 4F7TB 3ARFD 3FFDB 1AH1A 4DW2L 3KG5A 3TBSA 3VXSB 5B3JF 4A2MA 1WT5A 4OLUL 5I1IH 2A38A 3MOQA 2X4QB 3RBGA 3VG0L 5BS0D 2W91A 3IFPA 3O11B 4C56D 4UAOC 5C6PB 5DD0H 2IFFH 5GGRA 4MJ5A 1X5FA 5F7DB 1JPFA 1GPOH 4LVEA 3AREB 4PJCA 4NZRL 3BPOC 2W9LA 2ICEA 1CFQA 4ISVA 3T0VA 2CRMA 3LKNA 5EUOF 1MCKA 4K7PH 1QSED 5CHNB 4MB5A 3MGAA 3QUZA 4JY6B 4XVTH 2HWZL 3OF6D 1NC2B 2D31A 2UUDK 3KXFE 5ANMB 5C3LD 2WQRA 3ULVH 2X7LB 3ARYA 4M93B 3MV8A 5C3TA 3CLEL 5DQ9A 1S7UB 2ATPB 5C0CA 3GHEL 3BVNA 1VKXA 3VFNB 4DOHB 2DQCL 3TA3C 3MLUH 2C1OA 5GRUH 1KJVA 2P1YA 5IB3B 2AJZB 4E0RB 5E2VL 1AGDB 2FDBP 4JRWA 4NQCE 3WKNA 4R7NA 1KCRH 1JPST 1DVFD 5E00A 4DZ8B 4HMEA 5D6DC 2HAZA 4LSVH 1OSPH 5SWSD 5EBLA 3NIFF 4LGRB 4APQB 1F4WL 5HHOB 5FB8A 3KYMB 4BZYA 4OZ4A 4XCNA 3RWJA 1NFKA 4LOUD 1QSFB 3JVGC 5GSVA 2VDPL 1J7VR 5D70L 1G9MC 2GSGA 2OJEA 5KSBA 3Q5TA 1MI5E 1CFNB 4PBXA 1A7PL 1JBJA 2BRQA 5HYSB 3UTZB 3VXNB 4LHUD 1VGEL 2DQFB 3VFOA 5GGTH 1J87A 3R1GL 5INCA 1X5LA 2VDRL 3UBXG 1UYWH 3TESA 4X4YB 1ZEAH 3EOBB 3I6LD 4M1CD 4KI1A 4BH7A 3IXTB 2VB5A 5E24E 1RZFH 1KEGL 4JPWH 1WIOA 3TCLB 4BZ2H 5DZLA 1N64H 1MJ8L 3DV6A 1I1AC 1RIVL 3NFNA 2FB4H 4S1DC 2EC8A 3TO2B 1C12A 5F1OB 2XG5A 3RUGE 3UTQA 4LRNL 2XQYG 4DTGH 5DJAB 1WVZA 3QQ3A 5FGBC 5C0CE 4FNLH 2OI9C 2YXFA 2K3TA 4ELKB 3P11H 1FV1A 4Z18A 4PGBA 1NGWA 2DLHA 5DQJB 5FUZL 4P49A 3VW3H 1II4E 1KENL 5IFAH 2OX5A 3UMTA 1U95A 5IW1A 3B2VL 4FXGB 5GS1B 4NJAH 2HLFC 2VUYA 3HC4L 5BVJA 5I1GH 4Z5RA 5DEGA 1DR9A 4P4KB 3MJ8B 5B8CA 3G5YB 2AI0L 3QFDB 1CIDA 1E28B 3HPJA 4LLQA 4NKIL 2ICWJ 1XGRA 4PLJC 4LIQH 1MFCL 4UU9A 3QUXD 5A2LH 5C0JA 4QGTA 1BHGA 1WBZA 1T1WB 1YN6A 2C3XA 1L0YA 2GW5A 3PGFL 2R1WB 1LHZA 2Z91A 1SBBA 2CDFA 5EO1B 1BVKB 3CFJB 1IEAB 4I0PB 2R4SL 2VH5L 3SPVB 5MEPB 1QO3A 2DI7A 3BGAA 4MD4B 3EYFB 5C92A 3RAJL 5K9KB 5DMKA 4I48A 1U58A 5HDLA 1S5HB 3VRLF 3QXUA 3VI4F 5HPOA 2Y6SC 1J1OH 1URLA 3ILPB 4HBCH 4APQC 3P4MA 4BK4A 3NVQA 5E2UH 4XVJH 5EU6A 4X6BB 3WHE0 2R23A 1MAJA 4UNTA 2MNUA 4DVBA 5DFTA 1JJUA 1QBLH 3QDJD 4JREB 1WTLA 1UZ6F 4JN1L 1CLZL 2ESVB 1H3PL 1SMAA 3CSPA 1DFBH 3IFLH 1HXYA 4AM0B 2FIRT 4OD2B 3P9MA 2EXWD 4M9PA 4J3UA 1BIIB 5FUCC 2APVA 5BRZD 1F6LL 4DCQB 3GSWA 1JIBA 3HA0A 1FRGH 4YWGL 3U0PB 4QRRD 2WK2A 2A6KB 3FQWA 3ZTNH 1A1NB 2F54D 4HHAA 4X9HA 1CDYA 2YUWA 5DD6B 2ZG3A 5E9DA 4C4KO 3BZEB 2UYLB 1TJIL 1G6RH 4AENA 3ARUA 3QO1A 3OKNB 3LB6D 1E4XH 3RP1A 1JNNH 3QDGA 5FGCB 3RVTD 1UA6H 2GI7A 1CDJA 5L88L 3IRPX 2BJMH 3BAEL 1HHGB 1MFAL 3P4OB 1CDGA 2Q7YB 4TSCH 4Z7NF 4XCFL 2Q8AH 3O6KH 4EVNB 3EFDH 1U3ZA 3BH8A 3QCTH 4H88L 5EFIB 3SDCC 4M6MH 5BV7C 3BI9X 1H15A 4NQEA 3QPQC 4FTVE 4Y2OA 2AJVH 2HJFA 4RFEB 5I18L 4WVRA 1G6VK 4MLSA 4GKSA 2EIZA 3SDYL 2C26A 3BH9A 2HLAA 4BSVB 3O6FD 2DQUH 4Y1AD 3T3PE 2X44D 3B9KA 4PR5A 1EEYA 3RKDD 3ILQC 4OZHB 1NMBL 3LQZB 2V17H 1OT1A 1G6RB 4OI8A 3P3YA 1LVEA 1FNSH 2XA3A 1NMCB 3MV7A 4WW1A 1CE6B 3MNZA 1T4KB 1DQJA 4JDVA 5FGRA 5KS9A 3PWLA 4EEEA 2N4IA 4PUBH 4ODXB 3X14A 1FE8H 1Z9MA 5GGRY 4G6AC 5SWQB 4RMTA 1FFNA 1HHKB 3VWKD 3OXRA 3TT1H 3PP4H 1Z9LA 3E8UH 4NZTL 3MUHL 5CKAA 4HZAA 1T7XA 5IB5A 4UQ3B 1ZT7B 4LLDA 2FJHA 2X6MA 4K7PY 4BFGA 2QHLA 5C6TH 1Q94A 1N6QL 2HT3C 3KPQB 5E9DE 5KBNC 1FBIH 4YDIH 2IH3B 5HGBA 1KELH 1JWUB 4MLIA 1AGCA 1QKZL 5GRJH 5JR1L 4AJ0A 1QYGH 3REWB 2COQA 5KOVC 4KQ4L 1B2WL 1GIGL 4GRLA 2NXZC 3EO0B 5DJ6A 2AJSL 1WSST 2H1PL 4XPGL 4GRWE 2AXFA 3HNVH 1AI1H 1X7QB 2AJUL 4NQEE 1I1CA 4PJBE 5DD3L 5DTFB 1Q72H 3ARBB 4X7TA 2BHZA 5CWSB 1S9VB 1DE4A 4HLZG 4PRHA 4FMFA 1UXSB 1RVFH 3VGDA 2IAMB 2DB8A 2WINB 3U30C 3QXWA 4TPRL 4ZO9A 3L3GB 1UEMA 2CMRL 2P8PA 3WUZA 2X40A 4KDTA 4P2OB 4U1GC 1JNJA 3N85L 1ACYH 4KKLD 1NDMA 2L7JA 5HHVL 3QG7L 4L4VB 4M03A 5DDHB 1R6VA 4MXVE 1LEGB 4JB9H 1HHJB 1Y18A 1TTGA 4LF3A 5FCUH 3IDYB 2GJ6B 3WO3B 3QCUH 5FA3A 3NTCH 1RJLB 3BD3A 4F80A 4ZYKA 5J6HB 4Z8FL 1K8IB 4O2FA 4R3SB 2DQJH 5C6WH 1IQWL 1ZS8A 5F6HJ 1T6WA 4OUOA 5DMIL 2FLRT 2ED9A 1N6UA 2YPLA 3UEZA 2DKSA 2JB5L 5E4EB 5EBWB 4NUJA 5E0QA 4XPHH 3SO5A 4NQCD 1NMCC 2V2TB 4HWEL 3S35X 2R2BB 2YPVH 1I9RL 5IMKB 5F97E 1I7ZA 3IYLW 1BLNB 2X4PA 2EH7H 1FG2B 4N0FA 4NFCA 4YHPA 5EU3A 1LP9B 3GJFK 3MC0A 1WITA 4J3TA 1A0QH 3LQAH 3PHQA 3O2DL 3OKLA 1KFAH 2VAJA 3VFMB 4GMTH 1T0PB 4GSDL 1JHLH 1JZ2A 1MI5D 3X11B 5K9JL 3FFCA 1M71B 3T0XA 4ZS7H 4S11A 3CFDA 5C8JA 5CKGA 5FO9A 4PRHE 4F37K 1F11B 3IDXH 1EJOL 1NCWL 1VACB 3ROOB 1F58H 4ODWB 2NPLX 1XGUA 2W07A 3KWWA 5E6IB 3LN5A 2XICA 1CICC 3BJ91 1P84K 4I3RH 5K9OA 1TVBA 2VLKA 2F58H 4FQCH 2LE9A 2VZSA 2NY2B 3MZGB 1T7VA 3ARBC 1FFRA 5C0CD 2MJWA 2NW2A 2X1QA 3ARWA 4OIBA 1LEIA 3IJSB 4JO1L 4JQVC 4L1HA 1A6ZA 2X4RA 1I1YA 1LEKA 2HN7B 3LEYL 5T3ZD 1X5JA 2AQ2A 2FHFA 3SCMD 4KKBD 4JFQA 4F7MB 3CVHH 1G9NC 2CH8A 3BWUC 2YPLE 1GGYA 4LCUB 4I0KA 2P5EA 4XTRD 1YQVH 3F6IA 1RI8A 4M6NH 2F74B 4N0CC 4HK0B 1DQQB 3X17A 5E8EB 1CGVA 1OD7A 1XF4B 1F2QA 2EC9T 3QDAA 4N9GA 4XWGL 2GY5A 3ZE1E 2P7TB 1FZKB 4U1SB 4FFWD 1S7VA 2DS4A 4OFKA 2EDQA 5SX4I 3SE8L 4P46B 5FAAA 2C1PA 2E8YA 4KRLB 4HKZA 4OCRH 2XZQL 1OGAA 3MA9L 1Y0LB 5JLZB 1LK2B 4M5ZH 3CDGA 2AK4A 3RVWD 3WS3B 5F7MC 4U1LB 2HFTA 4PP2B 3RX7A 2FIKA 2ICWB 3FFCE 1N5AA 5D2LA 3BKMH 5HYFA 5IBLC 2V2WB 3HMXH 3TBVB 4F3FB 2BOBB 1OB1A 4HQQL 1FGNH 3QIBD 3VA6A 3PL6D 4GJTB 1GGBL 3CVHB 3VGBA 3VWJA 4KK8D 1UM4L 1N7ML 4UBDD 4JZJA 4D0CA 3OKKB 1D9KB 2DWDA 2PKDA 4NN7B 4Q2ZA 5FA4B 3GSNA 1HH6A 2BVPB 4JFPB 1IAKB 1GVIA 3EUUA 3IDGB 2VLKE 3PV6A 1J1PH 5EIQA 5D71L 1IFHH 2BDNH 3DMMD 3EO1A 3MBEC 1PYWA 4XH2A 1KXQE 3PG2A 3QIWD 3WHE1 4JFXA 2NZ9D 3QHFL 3MFGB 4XNXH 1LE5B 4C54A 4RQQA 2Z4QA 5ESQA 5GSRA 4JO2L 3RJDA 2NY4B 4Y8DC 1RZ8B 2RFXB 3TBYB 1HK6A 1ZT1B 5DMYA 3S36H 5EA0L 3RA7L 3AS0A 5F9AC 1KJ3H 3P4LA 3SDDD 4JG1H 4JKWA 4F57L 2XKNA 4GLRH 4PJAF 3U0TB 3GIVB 3IS1X 2J8UF 4GG8A 4WFEE 3N1GC 3TH4T 1VSCA 3WFEH 4P5MA 1RUKL 4PJIF 1QRNB 1FN4A 4QHKI 2DBJA 4ONGH 3VMOA 5T3ZL 1J0IA 1KTRL 3L5IA 4UQ2A 3ZE2E 3BEWB 5E2WL 1T20B 2HKHL 1Y6NR 2MWCA 5E8NB 4IOFD 1KB5H 4OGZA 3W9EA 1T04A 2AK4E 3LKRA 1X5KA 2ZOKA 4QCIB 5D2LE 4FTVD 1MJUH 3TYGL 2NR6D 4KROC 1JK8A 3O9WC 1X5AA 1XGPB 4UUJB 3ES6B 3S8WA 3CDCA 2X5PA 2QEJA 1ZHNA 5D1ZC 5DJDA 4LSSL 3MLSL 4GQPH 3TPUA 1FJ1B 2NQCA 4X98A 1OLZA 1AD0A 1LO2L 1P7QB 5JXEA 1IC5L 4YGVB 1OF2B 3N06B 4POZC 4M8QB 1DN0B 3DV4A 3KLSA 3ZDYE 4ODSH 4NRZB 4MA1C 4EDXA 4F33A 2H26A 3P0VL 4LAQL 4PLNC 1GAFL 2Z92A 1T21A 1EHNA 4G3YH 5KSAC 1JYXA 3T0ED 5HHPB 4MQ7B 4RISH 3D3VE 2I27N 2DKMA 5F9OL 2HVJB 5FDYA 3WHXB 3GSRA 2FEEI 3EZJB 4YJZL 3JV5A 5JDSA 3HZVB 5AWNL 1UH4A 1CLYH 2PW2A 2OL3H 3C8HA 4HUUB 1A2YB 4Z7WB 5ITFB 5JIKA 4F7CB 4TOYH 3F58H 2FWOA 4M62H 1DCLA 2QQNH 4QNPF 4P2QD 2AV7A 3PWJB 4MA3B 5IKCB 5B21A 2XZCL 2CUHA 4ELMB 3WIIL 4PB9H 3DUUB 4YXHL 3IDMB 2PF6A 4DKDC 4GRMA 3W9DB 1X4ZA 5DUPL 3C8DA 1A9BB 4OJFH 4QT5B 3KGRA 3KLAA 3ZMRA 1T83A 2O5XH 3KPRA 1F4YL 1I9EA 4N0YL 3CXDL 1N0LA 2APWA 2A73A 1JPTL 1FL6A 3OX8A 2QBWA 2OL3B 3RBSA 2ZG1A 2CIIA 3IU3A 3EOAB 4JEGB 1H3VA 2W9DL 4XNQB 2OR9L 5DS8A 3MJ9L 1B4JL 4AEFA 1R3LB 4U7MA 3VI3E 4AEHL 1FNGB 2D7PA 5FF6A 2QSQA 1HILB 2ED8A 3W11C 1JF1B 1C08B 4RRPG 4LPYA 3BESR 4ZFOA 1JGLL 5C71A 4IJ3B 3FB6B 4MWFA 2BERA 1T66D 2D03L 2NY7H 1NGYB 4ONHB 4HIJA 5C07E 4RGOL 1AD9A 2BC4A 2HT2D 3VGEA 2AJYH 4JDTL 3KPNB 1OP9A 5L8KB 2ZOLA 1CBVL 2X1PA 3I50H 4TRPL 4HPYL 3NMEA 5L2KA 1OARH 1NC4D 4HJJH 4WTZG 4GG6F 2NY3B 3FTGB 4M1GH 4L3EB 2ENYA 1JFQL 4LKCB 3HE7B 3SQOL 3EDDA 3HG1B 3MV9A 3DX6B 4PTTB 5HGHB 3OHXB 2Y7QA 3WO4B 5I1AB 3I2CH 5HJ3B 1I8IA 1OTUD 1NFDF 3LPWA 3BGFB 3L6FA 1BFSA 5DMGD 5AZEL 4NKOA 5HGAB 3TBTA 2VLRB 1ZVSB 5GRVK 3BPCB 5IQ9B 3MCLH 4KJQD 1DJSA 1WAAF 3VFWA 4B7IA 3BP5A 4GW5A 3U0WH 4KC3B 1GJIA 4WV1A 4G7YL 4H20H 4PGDA 1IGJB 1GHFL 4JRXB 1ZSDA 5CILH 5DJXB 1FYTA 3KLHC 4OCSL 3FQXA 1DUYB 2PN5A 2MPAL 1R5IB 4HH9A 1F90H 5T33L 1MJ7H 4M7KL 4CJ1A 2CLVA 4NZDA 5GS0D 3WKML 3NFSH 4YHOL 5E1HB 1SY6A 1BFOA 2ARJB 4TTDC 3C6LC 4MAYA 3EDKA 5TF1H 3CX5K 1C5BH 2PYEB 2O5YH 1KXTB 1CGSL 1GOHA 1EO8H 5CZXC 4O51B 2XTJE 1ZLUH 5HYJE 2HJLA 1EMTH 4H1LB 4BJLA 1CR9L 1YYMH 1CL7H 3LS4L 1XGYL 4O4YH 3AS2A 4ODTH 3AXLA 1SEBA 3MRJB 3U7YL 4N8CH 1MREH 4M7ZB 3WD5L 3ZKSD 4CVXB 1RIHL 3HMWL 3V4VH 1YMMB 35C8H 2ARWA 4HJGB 3FB8A 3O3BA 4LLVA 3O6MH 4OCLC 2R1YA 1FGVL 1K5NA 5I76B 1FNLA 4TVPE 2DQEL 2W60B 3X12A 3QEQB 4KKAD 5KN5A 1K3ZA 4LNRA 3MV9E 4Y5VC 2VN4A 1HKLL 1BVZA 2PW1A 2DQGL 2BNRB 1DN2A 3VXPA 1S5IH 5I8EA 3TT3H 3NBNA 2NY6D 4M48L 4YHMH 4KMLB 5HHQA 4LSPH 3QRGH 3QEGH 2LVCA 4RGNE 1DANU 1EK3A 3FL7A 3OZ9H 3FO1A 2HYMA 2DTSA 5I8CA 5HVFB 4PRPB 1QFPA 2HJKA 3I6GB 3CXHJ 4RAVB 2ATKA 1RZGA 3STZA 4XPBL 3GJEA 4YK4C 1EHLL 1FYTE 2DD8L 3U2SB 1CXFA 2W59A 4KGLA 2KUTA 3BEVA 1E4KA 3BKYL 2IGFL 4MGXA 2VABA 4K7PX 2OK0L 4HGWB 3HE7C 1QLEH 4U1MA 1S7TB 1TZIA 2A74A 2XQYK 3EYUL 1A6UL 3G6JA 1KIPA 3TYFA 1JPGA 4NZJA 4PGZA 4MNGE 3HFML 5HDQL 5D9SA 4GO6B 5C0AB 2VLKD 5GS0L 5EBMA 1VHPA 4H8WC 5TH2A 1CDCA 2H9GB 4CGTA 5TDOA 4J1UB 5DFVD 1BD2A 4OZFG 4RIRA 2BY2A 1FZOA 3P30H 3HPLB 5HI4C 2HMIC 4LDOB 3HRPA 3MRKB 2AEWA 2FYYB 2OBGA 5GJTL 4G8FA 4J23A 5KZCB 4PJ8D 3OR7A 4CAGA 5GGVH 5GRVL 3U82B 1VFUA 3KNBA 1IKFH 4ODHL 5HHXL 4Y8AA 5JHDB 3M1BA 4P0DA 3OAZH 3IJHB 1QSVA 2X4SB 5TDPA 1MHEA 3M17A 3V0WL 5J0BA 1JV5A 2GJZA 4HIXL 4JPVH 5KVMC 5JHLL 3QNYB 4K3JH 3QISA 1MHPH 1DQDH 5H37H 2G5BA 3V4PH 3RWEA 1DBBL 3SE4A 3ZYIA 3QJHB 3QQ4A 1KTDA 3GO1H 2AVGA 2AK4D 1E6JH 5DD5L 4MJ6B 4HS8L 3S88H 1XIWB 5DGQA 1W72B 1XR9B 1WWCA 5TQ2H 5BQ7B 2Z35A 2WBJA 3RWCB 4J3XA 2VXVL 3SEPA 4IHOA 4OKDA 3RGVB 1CFBA 1EUTA 3G6JE 2EDDA 1UKQA 4XB7A 3GSQB 3LOWA 4W4OC 3UYRH 5DA0B 5F89A 1MCFA 4ORZC 5GQBA 3QO0B 3RIAF 3EKCA 5BO1H 4JFEB 2C4FT 4U3XA 3SJVD 4Y88A 1NCDL 4ZQKB 3WXVL 2BVYA 3U7WH 1A7QH 4P57B 3ZYZA 2P4AB 1EFXB 1EGJA 1OM3H 3D6GA 3PUCA 3X13A 3D3VD 4YX2H 4P5KA 1IAII 4ZOEA 4HWZA 4XNYL 4ZD3L 4ZMAT 1Z5LB 3FQTB 1L9NA 3Q1SH 4R2GB 3CDFA 2R0LH 1T5XB 1BFVL 3DO7B 3MRDA 1R3HB 1FO0A 3ULUH 1I9JL 2ADFL 1I1AA 5KJRL 4JDZA 3DYOA 4F9LC 4F7TA 3FFDA 1YY8B 3THML 1CGTA 4WUKL 3VXSA 1UKTA 4P3CH 2X4QA 5F7DA 3AREA 4AMKH 5DJ0B 4KPHL 5JQ6L 3HE6B 3GBNL 1NEZB 4JGUA 5BMFL 1CD9B 2R69L 1HH9B 2IBGA 4JY6A 4G9FB 4KDWA 5ALCL 4LLUB 1NC2A 5ANMA 2EDRA 2X7LA 2DTML 3BDYH 3OKOB 4NWUH 2VXTL 1IGMH 1S7UA 1F42A 2BRRH 2ATPA 1AKJB 4KRPC 3QI9C 4RX4D 5FOJA 1R5WB 2Y1VA 2YD2A 3VFNA 5F7UA 5AYUH 2M1KA 1YMHB 2D7OA 3V95A 3K8KA 4XP6L 1BM3L 4FN0A 5IB3A 3UXFA 3CGTA 5IJKA 2AJZA 5HI5D 1LO5B 4E0RA 4S1RH 2ZSWB 1AGDA 3T0DA 4NKQB 3RY5A 5C07D 1H3UA 4NIKB 4DZ8A 4EI5B 1XCQA 4MCYB 4JFHE 3C60B 3P77B 3VG0H 4JM2B 1ZA3B 4RAHA 2Z31D 4APQA 1BWMA 3PHOB 5HHOA 4ENED 5KAQG 5M7QA 1H9VA 3KYMA 2P5WB 1ZAGA 4L8DB 2PTTB 1QSFA 3LH2H 4NZRH 4AG4L 3SGDI 3LMJL 2DM7A 1CFNA 2PTVA 3SE3A 3VXSE 5HYSA 4FMKA 3UTZA 3HI1B 1JZ4A 3CSYB 3VXNA 3BJLA 3EJYC 3DI3B 2DQFA 4NQDD 1U8QB 1F4XL 1KOAA 3VXMB 1Q0XL 3CLEH 4AEIL 4X4YA 3EOBA 4JPKH 4PYGA 3IXTA 1V3KA 2DQCH 2R2HB 3A6BL 3TCLA 1F2XK 3S5LB 4QXUL 4WI9A 1F13A 4I77H 5I1KL 5IWLC 4LP4A 3TO2A 1C16B 4L4TB 3T3PF 5F6IC 5DJAA 5K9QG 2APFA 4TSAL 4ZUVB 3ULSB 3G5XB 3BWAB 4ELKA 1CLOL 2EICA 3RNKB 1G7PB 2VXUL 4LCIL 5DQJA 3P40A 3DGGA 2IPTH 4MDJB 4E41B 4IMLB 1F4WH 3MFFB 4DEPB 5GGTA 5HYJD 5SWZE 2O61B 3S35L 3CX2A 1FC1A 2WUBL 3ET9F 4FXGA 3U1SL 2G60H 5GS1A 1ACZA 1I8LA 4P4KA 2F8XC 3MJ8A 1FLRH 3NOIA 4YEFA 1WFNA 3G5YA 2X4TB 2FBOJ 1OLLA 2HH0H 2P45B 3QFDA 1MLBB 1V05A 5HHOE 1E28A 3ULUC 3R1GH 3MLTB 2H2PD 4S1SL 4X6EB 5D7JC 2GT9B 3ULVE 1QSFE 4NHUB 4MD0B 3G6DL 3O2VL 3M07A 1T1WA 2EECA 4XI5D 2BZDA 2Q3ZA 2VR4A 2CR6A 5EO1A 2NY5L 1BVKA 1KEGH 2E7BA 3CFJA 1MJ8H 4I0PA 4LVHC 2CO6B 1RIVH 1AY1L 4Y2DC 3SPVA 5MEPA 4MD4A 3EYFA 3M45A 5K9KA 3IRZA 4PIRF 3GMRB 1S5HA 4JM2C 2V2XB 3ILPA 4GRWF 5FHBH 1HWGB 2V9QA 1A64A 2UVEA 5D7KE 1FYTD 1TPXC 4X6BA 3JWOC 5FUZH 5DVLA 4EQ3A 2I07B 2R0KH 4P2YA 1FPTL 2ZCKL 1OP3H 4WO4B 4ZSOB 3EAKA 1CU4L 2ESVA 1BF8A 5LCVL 3ARFB 4AM0A 1P5UA 2BOCB 4OD2A 4MAYD 4BQ8A 4PJFB 4OBRA 4Z7UE 1BIIA 2AI0H 5BS0B 4C56B 4DCQA 5DGRA 4HKBB 4NKIH 4BFIB 4NBXB 1RQ5A 4HFUH 5IFJB 3C5SB 2X9XA 4KKCC 3T0WA 4MXVF 4U6TA 5KS9F 3U0PA 4AH2B 1A1NA 1B6DA 5DD6A 3PGFH 3BZEA 1WK0A 2UYLA 4HMCA 1QSEB 1F3RB 2ZCHH 3OKNA 1B3JA 2QR0B 4PJ7B 4WFHD 1D5MB 1J5OL 2R4SH 3QJFB 2NTFB 5DR5L 2HRPL 1I7RB 3NA4A 3RAJH 1HHGA 1T03H 5D1QC 3P4OA 4EVNA 1F02I 4KXZI 3TWCL 1LO3L 2E7CA 1UJ3B 5CGTA 2P43B 4LPXA 4BKLB 1VESA 2YN5A 4K94H 5EFIA 4IIQC 3G9VA 2DL2A 2P8MB 4RFEA 4LPCA 2QADC 3QEHB 5TGBB 5ICZB 2ZNWA 4R6UA 5F9DC 1U42A 2XI9A 3EYQD 4BSVA 2GSIB 4FRWA 3E1F1 4JN1H 3WFCL 1QSZA 4K9EC 3UTSB 1DVFB 3UTTD 5KVEL 4XP5H 4OZHA 3S9DB 5SWSB 3ELAT 1Q0YH 3LQZA 1NLDH 4B53A 1G6RA 3VD7A 3RL1B 2D7TL 3EOTH 4PJIB 4WDIB 1MIML 1CE6A 4TULL 3KLDA 3T3ME 1T4KA 1XT5A 3AS3A 4YWGH 4LIQE 2ESVE 1ZGLB 2IG2L 4YDLC 4NQVB 4ODXA 1T1ZB 2EIDA 4ZUTB 5SWQA 4UNUA 4MHHG 1TJIH 3WNKA 3PWVB 1HHKA 2EE3A 4I4WB 5T5FL 3T09A 1KPRB 1A1OB 1TQBB 4LHUB 3EHBD 2EIBA 2AJ3B 1FFPB 5L88H 3OAYK 4OGAC 3BAEH 2HFEB 1JPSL 4UQ3A 1ZT7A 2DLIA 3U79A 4B7LA 1VGKB 2SEBB 2HT4C 4XCFH 4K71B 2YZ1A 2H32H 2VWEC 4XC1L 1NFIB 2V5TA 2ZUUA 5FYJL 3KPQA 1J11A 2IH3A 2BP3A 1JWUA 1KEML 3AY4A 1TVDA 5EOCL 5I1LB 5I18H 5FGCE 2W0FB 3REWA 1P4IL 1GC1C 3SDYH 1KC5L 3HUJB 2VSCA 1HSBA 1UEYA 4QY8B 3EO0A 2E6PA 3T4YB 2HFFB 2OSLB 4BZ1H 4KMTL 1BJMA 2PR4L 2OTUA 5IBUB 1X7QA 1NMBH 4Y89A 3VRJB 5DTFA 3ZE1F 2CSPA 3ARBA 1ONQB 1LO4L 4BQ6A 1KULA 3BN3B 5CWSA 1S9VA 2AERT 5LBSL 4EOWL 1UXSA 3TA3D 2XKSA 1EEZB 2IAMA 2FR4B 2WINA 1S3KL 3D39D 4F15B 1P84J 2H32B 2CKBL 5JTWA 3L3GA 1ND0B 4OZHE 1CXHA 1JTTA 4BH8B 1A7BA 4P2OA 3V7AG 3GUTB 1OW0A 5IR1B 4NZTH 4L4VA 2EEAA 3DI2B 5IHUL 5DDHA 5AEAA 3QUXB 1LEGA 4DK3A 1OVZA 1HHJA 4EXKA 1N6QH 5KTEH 4YQXL 4DKEL 3E3QE 2CIKB 1RJLA 4LVNC 5J6HA 1K8IA 2DDQL 1H5BB 2PXYC 2IPKB 4R3SA 1UM5L 3GK8L 2L0DA 4X9GA 4HULB 4KQ4H 1B2WH 1HE7A 3VXRD 5CZKA 5IV2B 4JRYE 1GIGH 2LTQC 1SBSL 5EBWA 3VFPB 2C5DC 1SJVA 5JW3L 2V2TA 2AJSH 2H1PH 4XPGH 3VE0B 1ZE3C 2R2BA 5IMKA 2A9NL 5DURD 5ID1B 2AJUH 5CBAB 3EFFB 3RTQC 1BLNA 3QWOB 5DD3H 3JWDL 4P59L 1FG2A 2XIDA 4JFHD 2D4DA 3NPZB 3ALXA 2DQTL 3EOYG 1LP9A 5J8OA 3P2TA 5M95B 3QDJB 4NRYB 2EYSB 4K94C 2X09A 3VFMA 1I1AD 4MZ2A 3R8BB 4RSVA 3W82A 4LCCB 5FM4A 4S1DD 2WP3T 3X11A 1OAXL 1ZHLB 2CMRH 4HD9A 1M71A 4K71C 2H3NB 3IT8D 3ZE2F 2HTKC 1SJEB 3E6HB 1F11A 3K4ZA 1I9IL 4QRRB 3S3PA 4Z78B 4ZAKC 3JTSB 5C9JA 1VACA 4QHNB 2FJFB 3ROOA 4K23H 1VEMA 4ODWA 3VH8G 4IRSA 5AAMA 5E6IA 1I1FB 4ODVL 5D2LF 3PP3K 3S7GA 1Q8MA 1IQWH 5DMIH 1NFDB 1ES0B 4MMZC 4FQJL 4MNQD 4XNUL 4EUPH 5B38G 5I66A 2JB5H 2AEQH 4QWWC 4LEXL 3TBWB 2GJ6E 4OM1H 2RIKA 1QVOB 4PLJD 1CWVA 3BZFB 4MA7H 3IJSA 5GISL 1QOKA 1I7TB 2R0WL 2HN7A 1P2CB 3ZDYF 4S0SD 4J3SA 4F7MA 5J7CC 3O6FB 4L3CB 5SWZD 4CUCA 4LCUA 1NKOA 2VQ1B 4Y1AB 3O2DH 1HXMB 2ADIB 2GTZA 4M7JL 2AS5M 2F74A 1IC1A 1J9CT 4HK0A 4GSDH 1DQQA 1MQKL 3V2AR 5E8EA 1FVEB 3QPXL 5K9JH 1XF4A 3SGKC 4NUGL 3V8OA 3MV11 1G9ML 2P7TA 1FZKA 3NGBC 4U1SA 2Y6SD 2R8SL 5I74C 4APQD 4P46A 1LP9E 3VGHA 3W2DL 2BY3A 4K55A 2J5LC 1E27B 2BVEA 2G9HB 2JJTA 1Y0LA 5JLZA 3ULVD 1LK2A 4OD1H 4EUPB 1NCWH 4FQIL 4QF1B 1I85C 2IFGA 3WS3A 5F8QC 4U1LA 4PRAB 4PP2A 2I60L 1KV3A 3NN8B 2ICWA 4RFOL 1EERB 4JZNB 1I3GH 1P4BL 2KL6A 1OOAA 2V2WA 3BP6B 3TBVA 3HZKB 4F3FA 3BUYB 2BOBA 4JVPA 3BQUC 3E6FB 2VDKL 2NY0C 1N59B 3CVHA 3H0TB 2K7PA 3WN5C 4Q97A 4P2RD 1XAUA 3JV4B 1X44A 3MRLB 3I75B 2CLRB 3TCXA 1D9KA 3FRPG 5FA4A 2X9WA 2BVPA 2IBBA 4JFPA 7FABH 5C70A 4M6OL 1A7NL 1IAKA 5E99L 3IDGA 3L5JA 5ACMA 5FK9B 3LEYH 4HEPG 3TNMB 4Y16B 3OG4B 3CD4A 5HSFA 5JA8B 1NGPL 1LE5A 5GGSB 4KI5C 1RHHB 1EV2E 5AAWA 4CVZB 4UV4L 5I19L 1RZ8A 2RFXA 3GBML 3TBYA 1ZT1A 3WJJA 1K4DB 3JUZA 3SE8H 1NBZB 3HMXA 3SN6N 5CGYC 5A40E 3U0TA 1FL5B 2QQLL 2XZQH 3GIVA 3QPQD 4CU8A 5ESVA 2YZ8A 3QFJA 5IB2B 1QR4A 2JF1A 4PGEB 1QRNA 1JTOA 3T8XB 1QPPA 1EBAA 1CD8A 4RMSA 3U36A 3SDAA 2XWTB 1U8KB 4OKVB 4PV9B 5DD0L 1F5WA 3BEWA 4HQQH 3ILQD 1I7UB 1T20A 4HKJB 1GGBH 5E8NA 2P24A 4KJPC 1UM4H 1N7MH 1IC4H 3BZDA 4XBGB 1MCBA 4HWNA 1NH6A 1L6ZA 4K7PL 5DWUL 4U6HB 1J8KA 4QCIA 1T1XB 3RY6A 1FZJB 5AD0B 3NACH 4G6AD 3BX7C 4UUJA 5H37G 4OGXL 1JL8A 3ES6A 4ONOA 1H3XA 2VUOA 3SO3B 3SKUD 3QHFH 3A67H 4FG6C 1YEJH 1OWRM 5IW3A 3B9AA 1FJ1A 1YN7B 4JO2H 5GXBB 1P7QA 2XNAB 4YGVA 1OF2A 3IB4A 4FFVC 4M8QA 4N5EC 5LGHL 1DN0A 1C8PA 2HT3D 5J89A 4F57H 4I5BB 1KNOB 1P9MC 4QKXB 5DK3A 3CH1B 4MS8C 3RQ3A 1F3DJ 5IMLB 1QTYT 1QHPA 3ZKXB 4YHYB 5HHPA 1KCRL 2Q7NA 4GXUN 4MQ7A 5AUMB 3C5JB 2DMCA 1MI5B 4LSVL 1T3FB 1ADQL 2HVJA 2N1KA 3WHXA 1L0XA 4EJ1C 2EYRB 4PB0L 2NXZD 3HZVA 5T3ZH 3H3PL 1NUFA 1TCRB 3LKPB 4CW1B 5A3IC 4HUUA 3RHWK 1A2YA 2A9ML 4Z7WA 3UDWC 3DRTB 5F72S 1NEZG 5DLML 5ITFA 1KIUA 1FVCB 3AGVA 5T1MB 5KVGL 1J12A 3GMNA 4ZTOH 4Y16C 3ARGC 3PWJA 4MA3A 5IKCA 5IEHB 3TYGH 4GAYB 4HS3B 1TZGL 4ELMA 3DUUA 5BV7L 5ILTL 1X5GA 4JPIB 2VYRE 3RUGB 3IDMA 3SGJC 1UYWL 3BP7B 3GJFB 2B1HH 4NHCL 4YFLF 3DWTA 3MBXL 3W9DA 4LSSH 1RJYB 3MLSH 1W0YT 3KYNB 1A9BA 4QT5A 1LO2H 1IC5H 1HNGA 1RZFL 3KPMB 1CYGA 5IVXB 4L8CB 2FB4L 5SV3A 3SCMB 4NRXB 3CX5J 2OL3A 3P0VH 4LAQH 4Z0XB 1GAFH 4NM8L 3P0YL 1BZ7B 5IJVB 2ZG2A 1M4KA 3OBAA 3EOAA 4AQ1B 4XNQA 1ZVHA 1FNGA 5F9OH 4DN3L 3UBXI 1HILA 4GAJL 3QDME 1JF1A 1C08A 2XRAL 3QUKB 5D1XC 5AWNH 1G0YR 2W0LA 3D1MC 2CXGA 4LSRL 3FB6A 3H9HB 4ONHA 2PO6C 3VW3L 3QWRD 5JIHA 2A77L 5EO0B 3G08B 3KPNA 2XV6B 2EKSB 1EBPA 2EDEA 3P73B 3VA2C 2J1KA 2YOCA 2NX5E 1MCRA 2XZCH 3FTGA 5MEND 3WIIH 5CJOH 1JHTB 3QIBB 1MVUA 3PL6B 4L3EA 4LIQL 2FD6L 2E27L 1DANT 4JRYD 4G5ZH 3ZKNC 5CIPH 4B41A 1Y6MR 1PW3A 3WNPA 4LKCA 5DF0A 5DUPH 3HG1A 3DX6A 4PTTA 5HGHA 3OHXA 5I1AA 1F4YH 5HJ3A 4N0YH 2AEPL 2J6EL 3MYZA 1CDBA 4ELME 1JPTH 3K81A 5HGAA 2VLRA 1ZVSA 3DMMB 3BPCA 5IQ9A 2JLLA 3QIWB 5FV2A 2KQMA 1CICD 2DN7A 4JAMB 4DWHA 4KUCF 1J1OL 2W9DH 1IGJA 2OR9H 1IGYB 5IF0B 4JRXA 5DJXA 5I1DB 4AEHH 4ZO7A 4XVJL 3VDCA 2EEBA 1DUYA 1C1EL 1R5IA 3FONB 3ARBD 4KJYB 4FXKB 2OMNA 1E0OB 3SDDB 2AQ1A 2D03H 3QXAB 3TIEB 4L8SC 2EEDA 3ARDC 1QBLL 2F5AH 2ZPKL 1EO5A 3MJ7B 3O41B 2N56A 2ARJA 4RGOH 2BXZA 5TPWL 1U8HB 5J11B 1X6NA 5CIPB 2PYEA 4YFDB 1CBVH 3OTTA 4TRPH 4HPYH 1U8MB 4LGSB 1UZ8B 4JY4B 4O51A 1IEHA 5CLWA 3JZ7A 2VQTA 2FL5B 2D7NA 1N5YH 4H1LA 4N0CD 3G6JF 1BF2A 3TZVC 1GZPB 3MRJA 5DVNA 1FNHA 3O3AB 4P4RA 5KVFH 2GJ6D 1GRWA 1S9YB 3PGDB 4WI3A 4LHJB 5FYJU 4CVXA 1UWXH 1YMMA 3O45B 4FTVB 3C2AL 4HJGA 2JB6B 1JNNL 5AZEH 5GGUB 4K3DH 3TO4C 5I76A 4HCRL 4WUUD 3EYSH 2ZNXA 2W60A 4PJEB 5IBLD 3IKKA 3MR9B 3QNZA 3QEQA 3EFDL 1JF6A 4KU1A 4YHNB 3HG1E 3ARSA 3QCTL 1SQ2N 5CD5C 2BNRA 4OCSH 2N7BA 3VCLB 5T33H 3WXWL 4KJWC 3WKMH 4YHOH 4PRPA 4ZFZB 5CJXA 4WWKB 3I6GA 4KTDL 4RAVA 1FH5L 3T0EB 2RGSA 1MCNA 2FCBA 3MBED 4FQQB 2NYYC 3MZTA 3U2SA 4PRNB 1KCVL 2I9LB 3GI9L 2APBA 1FNSL 1M1SA 1NKRA 3QYCA 4HGWA 1CXIA 5C0GB 1S7TA 1CR9H 3LS4H 4NKMB 4S0TD 3KVQA 2GTWB 5DEFB 1MRFH 1AIFB 4I9WE 3WD5H 4D2NA 4P2QB 3HMWH 3BGMB 2VRAA 1PKOA 4F9LA 4JFOB 2KBGA 5C0AA 1ZTXL 4P3WA 4ACPA 1AC0A 5JDJA 3BRGC 4NBYB 2H9GA 4J1UA 1T89C 5DHXB 3P9LB 3JXAA 2ZUWA 1P4LB 1SJXA 1DUZB 1I4FB 3FRUB 3HPLA 5C6TL 1Z9OA 1FBIL 1G9NL 3MRKA 1JYNA 2DQGH 3HNSH 1YMME 2FYYA 2OXGA 4M48H 4PJBB 2FLBT 4D0DB 4U6VH 4JN2B 2XKUA 3BPLC 4KZEL 4M43L 3B43A 5CBEB 2RQ8A 4YEEA 1K2DB 3QEQE 4JLRB 4JO3L 3STLB 5JHDA 1JZ3A 3IJHA 3MCKB 3O9WD 2X4SA 4JFDD 4XPBH 3HNVL 1S7WB 4L1DA 2BNRE 4DN4L 1AI1L 2R39A 3J7HA 3UTOA 1L7IH 3QNYA 3BKYH 2IGFH 3BRDA 4Y5XB 5EOTB 2OK0H 2MQCA 3LPFA 5F96L 3DTXB 1J86A 3EYUH 1A6UH 4PRPE 1RVFL 4POZD 3BSZL 3S97C 2R1XA 3QJHA 2XZAL 5L8JB 3FMGL 2Z8SA 4J4PC 4MJ6A 2NLJB 3HFMH 1XIWA 5HDQH 1XH3B 3OPZL 1W72A 1NC4B 5KSAD 1XR9A 4JFYB 1YNTB 4KV5E 5BQ7A 4OUUB 3RWCA 2OS7A 5GS0H 4K2UH 3RGVA 3RZCC 4IS6B 2YA1A 2NXYC 4JB9L 5MEOB 4GKNB 5IW6B 3GSQA 5FCUL 5EU5B 1Z9SA 4HC1A 5BZWB 4JFEA 5GJTH 2DQJL 4MNHB 1KTKE 2AGJL 3FQUB 1WZMA 2QSTA 2WUCL 4G6FB 4N8VA 4ZQKA 3KJ4B 5MERB 3CPLB 3T0BA 2EDTA 1PVHA 4P57A 4ODHH 1EFXA 1SYVB 4XPHL 2B2XH 4QTIL 3S98A 5FO7B 1MFNA 2VL5B 2J2ZA 4D9RE 3V0WH 1O7VA 4XRCB 4HIXH 1Z5LA 3FQTA 2EH7L 4YZFE 4YFLI 5CJBA 2XA8H 2MCPH 5BOPA 1H0DB 1T5XA 5EU7E 3DO7A 1I8MA 4R96B 1R3HA 5C0NC 1A0QL 3QUYB 1DBBH 4BSWB 5JHDE 3IDJB 1YY8A 3ZSSA 5HYEA 3Q3GB 2DBLL 4GBXC 4TNVF 1QD0A 2VERN 3F8UB 4UOJA 3ULVF 2WAHA 4CU7A 3TIDB 2VLLB 1NDGB 5DJ0A 4F7PB 2IC2A 3LDBC