1OPGL

Opg2 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
b'DELLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGGGSKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OPG2 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1995-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL01
2G2RA 3IFNH 3T1FB 4HT1H 3D39D 2JB5L 5B3JE 1XF2A 2J1KA 3B3IA 3MZGB 5HTSA 1UACL 1UM5L 2VZ1A 4AYFA 2QL1A 2XPGA 4MYWB 3SDDB 2L0DA 1UA6L 3QA3A 3FO0H 3MV8A 1R3JB 3AU1B 5SWSB 4NO5B 2VLJE 4WTZG 1OCWL 1NFIA 4XZUA 4M48H 5D7LA 3D87B 2FATH 4KJPD 3EO0B 4J4PA 5FKPB 5IB5B 5EBWB 4NQXB 3C2AH 1IM9D 4CNIA 4RWYL 3CCHB 1YNKH 4HUMB 1FH5H 2ADJA 3SE9L 4HPOH 1BX2A 1YN6A 1XFPA 3IU4H 4PJ7F 4YE4H 1MJJA 2C26A 4BSVB 1E4XH 1HIML 5DMGC 4OUUB 1NMBL 4WV1A 2O26U 1A6VH 5HPMA 4MNQD 1I8MA 1XZ0B 1HKLH 4RMRA 3OX8B 3PGCA 4UUJB 3I6GB 2R0WL 1LQSR 1ZA6B 3LEYH 3ZE2E 2G75A 4U49A 4Q9RH 3QUYD 4E41D 3L1OH 1GOGA 4OZFG 3TJHC 1CFSA 3MLUH 1FNSL 2FO1A 2DQIH 2FIRT 4TUKL 5IB3B 2AI0L 3TYGH 3DVGA 3H42L 4LASL 4HIHB 3IXAB 4GRLA 2DBLL 3MV7D 4X0KB 2AJXH 7CGTA 1PG7L 2NY5C 3GZKA 3ESVF 5EBMA 5GRVL 1F5WA 3LEYL 5JHLL 4PP2B 3MBEA 2OTUA 4NO0D 4P5TB 5T1MA 4QTHB 2DLTA 3O2VL 3IFLH 2FHBA 3WLWD 1G7JB 5J89A 3DARA 4HWBL 4Y0GA 3QDJD 1MHPH 2VDLH 4ONFH 1IEAB 2GJ6B 1AO7A 5J12B 5C6PB 1EMTH 4N0FB 4DGIH 4RAVA 1BD2B 4NWTL 1F45A 1KEGH 1K3ZA 2Q76B 3P30H 4D0CA 2FGWL 2H32B 5E8DH 4GRMB 4NPYB 3QDME 1F8TH 2C3WA 4X6CF 1QQDB 2D7QA 4BH7B 3STLB 5DHVH 4RMQA 3OKLA 3PV6A 1I9JL 2ATKA 3WO4C 3E6HA 5I1LB 5LWYH 4RCAA 4U7SA 4RAHA 1AGCB 2IANB 5C09D 4WUUD 1YEHL 3MV9E 4YHIA 1D5IL 3FQNA 1G9NH 3DPBA 1MAML 1CQKA 1Q94A 1N0LA 4K94L 3WSQL 3LKNA 1TZGH 4LHUD 1NGZB 2G9HB 2DMCA 4ZO6A 2EDTA 5DFVD 1OWWA 5GIRA 5H94A 1OGAE 4HDIB 4MQXD 4HIEB 1XGUA 2HYMA 4RWYH 4Z7NE 3TBTA 4X7SL 1R5IB 5L0QB 3BPLB 3JXAA 4K3EL 2EDNA 4MDIB 5D6CB 1GZPB 2DI8A 4BZ2L 5JW4Q 3VI4E 1D5ZB 2IBZX 4PBXA 5TPWH 4ZOCA 1AJ7H 1QLRA 1LO0L 4YBQD 2E7HA 3DROA 2H32H 1QVOA 3IDUA 5F7FA 3SKOA 2WBKA 5B3NA 4J4PC 1S9YA 2V5SA 5AG8A 1CGYA 4D0DA 1IGFL 4M7LL 4KQ3H 5EBGA 3MNWB 3QCVL 1JPFA 3OSKA 4GQ9L 1IAII 5K9JL 5HYSB 2PW2B 4WENB 4YBQC 5HDBF 5F9DC 5A3IC 2BNRA 1MJ7L 3IDXH 4Q74A 1SVCP 5SWSE 4EKXA 5DD1L 3TYFA 1FLRH 3FT4A 4L4TE 4MA3A 4HEPG 1QRNB 4HKJA 2UYLA 3SE9H 4WY7L 5I8EA 1IC1A 2YA2A 3DRQB 3GIVB 1MLCA 1NUGA 4U6YA 1WISA 1EFQA 4IBLT 2E7MA 1D5BA 4R6UA 2IFFH 5EU5B 2VL5B 2HKHH 5HY9B 2LAGB 4Y5YA 3T0WA 5MENB 1RHHB 1HYSC 1CL7L 3KHOA 3MJ7B 5DT1L 3KLAB 3S88L 4K7PY 4P23A 4OLWH 2UY7A 4QO1A 3T4YA 1CLCA 3SCMA 2CKNA 4H20H 2NLJB 3IAPA 5E00B 4YDJB 3ELAT 4PY8J 3WS3B 4KK8D 2D7MA 4H88H 3T1WA 4KGLA 4KH2A 3MUZ1 3SDCB 5JXAH 5CCKL 1SJVA 4HIXL 1UWGH 4CMHC 4MJIA 1KXQE 4ZSOB 3QDMA 3I75B 1NL0H 3QCUH 2EDEA 3SJVB 5F7DA 4XCNB 3PQYD 5J6HB 3LN4A 3MYJA 1W0WA 5IHUL 4ELKB 2C1OA 1LHZA 3VG0H 2EYSA 3ZDZE 2IAND 2W92A 1F2XK 3IJSA 4NQSA 4FN0A 1WIOA 5C0IA 3MRRA 1T1XA 2J5LB 4W81A 2AV7A 3FFDA 3UTZB 5EDXA 1S7VA 3QJFA 4QRSA 3MRQA 1AO7D 2BVOB 4J12A 4KROD 4RMVA 4YHLL 1IGYA 4F9LC 1CFTA 5ADPL 3V6FB 4PY7A 5F7YC 1JGEB 1LP9E 4JM2B 2CJUH 4OGYH 4I3GA 1ZVSB 3ZT5A 1E4XI 2JJSC 1QTYT 5DGQA 5AZEL 2VO5A 2IG2L 3I6KB 4PLOB 3RWEB 4LMQE 3MRLB 1UT9A 1F58H 1LD9B 3UYRH 5DWUH 1JNNH 4WCYL 3TT3H 1SEQL 2DF3A 1OARL 3OB0H 4Z7VE 2ADGA 4HFWB 3LDBB 4XHJC 1SM3L 4IHOB 1JK8B 5E56A 1X4ZA 3NACL 3B9KD 4AEFA 1UWXK 3K2UH 4JO2L 4UOW1 4RIRA 3GI9L 2WNGA 5T3XE 4OB5H 2SEBB 4EN3D 3QEHA 1ORSA 4KRMB 1F90H 4U05A 1L0XA 2DYPA 3FO9A 5IW3A 4PGEB 4KTDL 5D2LE 5FM8A 1NCCH 3KR3L 1J05B 3HC3L 3LQAH 3VXUD 3HG1A 3BPCB 5IGXH 3W5MA 1I7ZA 1KIUA 4P2OA 1JWMB 1FP5A 3JUYA 1OAZH 3BAEL 1LVEA 3I85A 1VPOH 1NCBL 1QSEB 3CH1A 2HTKD 5GGVH 1NAMB 1UJTA 2H9GB 1JNLH 3X12B 1G84A 3L3OB 2RFXB 5F6HI 5DO2C 4JRXA 1OAUL 2EDYA 4XVSH 3QNYA 2XKNB 5JHDA 3WDHA 4NQEA 1WFNA 1DCLA 3TVMD 5J12C 1MAKA 3A67L 3BSZH 2AGJL 5KS9B 2GK2A 3OJDA 4NQCB 4AEEA 4TVPH 5EWIH 1WLHA 3QISA 3D0VB 2C4FU 3VXOA 1WJ3A 2BDNL 4XMLH 5FFLA 1EHAA 5HHOE 4GAYA 1Q9KA 1A47A 3WFBL 4YHML 1EHLL 1HEZB 2F54E 2AEPH 4N1HB 3VXRE 3MRPA 4ZFOA 4F9LA 3H8NA 1MHHB 3I9GL 2KQNA 3GMMB 3DETC 2BVTA 4BA8A 4BQBA 4ODHH 3B9KC 3DMMC 3QDGB 5CEZL 4YBLB 1B0GA 3GNMH 4TNVF 1B4RA 4LKXA 2EIDA 4LBEB 1FVEB 5IWLC 1ND0A 2UZXB 3SO5A 1N4XL 2W0FA 5SX5K 2VLRB 1E27B 1KYOJ 3FKUS 4H8WC 3NGBB 4K55A 4ZDHB 1E27A 2Y9RT 4QRTA 5C07B 5E6IB 1XIWC 2Z31A 3THML 5E8NA 2GUOA 2Z93A 4RQQA 4MCZA 4EXKA 2VOTA 4V1DD 5D7JD 3U36A 1CGXA 4HZLA 2W9DL 1B0GB 4YHYB 1S7SA 1D3CA 4G9FA 3TBWA 2C7UA 1MHCB 3GSOA 3ARSA 4YBHA 1HHHA 1CLZH 4PG9A 4GW4A 3SJVE 5ICYB 1XCTA 1V3MA 4PJHB 4OBSA 1A7QL 1QLEL 3HLAB 3O0RH 4IRZH 5FUOH 3QO1A 2D7NA 1CFNA 4WFFD 4Y19D 2B20A 4TYUA 2OL3A 2W60A 3BDBA 4RMTA 1MJ8L 2OZ4L 4LFHG 5FYJU 3QPXH 1SJXA 4HZAA 1FNGA 3D0VA 4IRSA 3BGAA 4HJGB 2IH3A 3ARBC 4GSDH 3O9WD 4NQDA 5IESL 4P2RB 5KANG 1A02N 4X4ZA 4EEEA 3JWDH 5I1DB 3AC0A 1KGCD 3U0TA 5KSBA 4NQEB 1H3GA 1IGIH 2P4AB 4HKXB 4OCNC 3QUZC 3OZ9L 4U0RC 2XACC 3QNYB 3NIFF 4FFWC 4L4VA 5E2WH 5JLZB 2R2HB 4L9LC 4WGWB 1K4CA 4NNPL 2VNCA 3CLEL 4KK5D 2VUYA 5DS8A 4DK3A 1S7QA 3FAXA 4X4XA 3ZT6A 2H9GA 3F58H 4TRPL 3RJQB 3HMWL 3WEXA 4G8GD 1MWAA 3BZFB 4WO4D 4LIQE 2HT3C 3DO7B 5TQ2L 3Q6GH 4Z8FH 2FLBT 2H26A 5GS0H 2NXZB 1CF8H 1P9MA 2Q7YA 3QIBA 4XNXH 5BZWB 4U33A 3HMXA 4NO2B 2AEWA 3AROA 3SGKC 1BJ1H 3T2QA 5K9JH 5KG9B 3QG6A 3MV11 3MQIA 3AXLB 3EJYD 4LSTL 3KPSB 4XP4L 4DOHE 1X4YA 5IQ9B 4KU1A 4HFWA 2ZUWA 4ELMF 4IMKC 5BW7C 3G5YA 5FKAA 1BMGA 3EJJX 4PBVC 1T5XA 1TVHB 4JKPL 2WLYA 5DEGA 5D93B 1EFXD 3UO1L 3N85L 5C0BD 4UI2A 3MRLA 1U8NA 3EDKA 1VDGA 1Q9LA 4Z7UF 3MNZA 4PRPE 4WI3A 4WHDA 3GRWA 3AS2A 4NOFA 2HT4D 1X44A 1LE5A 2PNDA 4ZYKB 2P5WD 5K9KB 3A6BH 4GBXC 3FO1A 4MXQC 4NN5C 3KWWB 4FXGA 1DN0B 1C12A 3HR5B 5CEXB 1IGYB 4JRYB 4HH9B 2FGZA 1BFOA 3MRIA 3VWJA 5FO9B 3KPOA 4Y2DD 4QWWC 2KH2B 1ETZB 4OLUL 1HSBB 1TNNA 4NHCL 5BZDA 4FQHA 1EAPB 2AXHA 5BQ7A 5IUSA 5E6ZA 1NLDH 4OZHA 3S3PA 3QUYB 1BOYA 4JFFB 5JXAL 4O02L 5AWNH 4NQVB 4P9MH 2AV7B 1BJ8A 1NCAL 1NFDB 5DK0A 2ZUQB 4NZUH 4XC3H 1UYWL 3QNXB 5FYLH 5HHOB 3ORJA 2VQ1A 2XNAB 4LLMB 3UTSE 2X9WA 1CWVA 2FO4A 2XZAH 5CEZH 3LD8C 5C0BB 5ENWA 4PR5A 3BYYA 1W0WB 3K4AA 1H3PH 1QEWB 5F88A 3SJVA 1KTDA 1R3LB 2FJGB 1EPFA 3WE6B 3U1SH 3KPTA 1J5OH 3U2SA 1MRFL 5ACMA 1FYTD 1YEIH 43CAA 3PWPB 2F19L 1NSNL 1G7IB 2GY5A 2NY0B 2ZZUT 4CJ0A 4K7PL 5EPMA 5F3BA 4LCCC 3ULVC 2QHRL 2VE6A 1SY6H 2YC1A 2YD2A 2Z8VC 1I7TA 4BELD 1SMOA 5C3TA 4LVHC 4NWUL 1D6EA 4X7TB 3C8HA 4L5FL 3V6OE 4CU6A 4YX2H 2EDJA 3DVNB 3GSNB 3VDBA 3VGHA 5KBNC 4NFBA 3NMEA 2JELL 4OZGB 3OHXA 3V5KA 3ZKND 5IG7B 1D5BB 1FSKB 2NZIA 1AGFB 1T20B 3DO3A 2CD0A 4JFZH 5DMYA 1KLUB 5HDLA 3QIBD 3DRQA 2XTJB 1QRNA 4CMMA 2GY7B 3LZFH 3TYFB 1LO0H 1B90A 1HI6A 1IAIH 2Q1EA 5HD8C 1U8KA 1MCBA 4P3DA 3P9WB 4LF3A 5E7BA 1NMAL 5DDHB 2FEDD 2HFGL 2CK0H 3BDXA 2ICCA 1GYAA 1JZ4A 1QSED 3H7LA 4P2RE 1AGBB 4UT6L 3SY0A 3QUKA 3MNWA 2QADB 4P5KA 1RZGB 4OLYH 3FN3A 5EFIB 3VA6A 4DK6A 2OSLB 3SGKA 1HN1A 2HTKC 3GSQA 4M93B 5KSUA 4KRPB 1Q9OB 2ZG1A 3R06A 4J3OC 3KDMA 3I02A 5DD1H 2YPLB 3QUMB 4XH2A 3C60C 4CVWA 1FGVL 2G5RA 3H6JA 3DMMB 3FO0L 3ZHDA 3DURB 3L3DB 4MDJB 2DKUA 2OJEA 2A9NH 1RUQH 3WD5H 2CRYA 5FCUH 4HMCA 4PJCB 1UH3A 2ENSA 3B6SB 2ENYA 4I3RH 3MRHB 2P8LA 1BVKB 2X2YA 4HDIA 4Y1AE 5B21A 5GIRB 5H94B 1RZKH 2XQBH 2P8PB 3FFCB 3G5VB 3UZEA 2D7TL 1NGZA 3O6KL 3V5DB 3LKNB 2PTTA 5D7SL 1P1ZA 1EHNA 4FQLL 1KELH 5BS0A 4RRPG 2ICWA 3ROLA 3BPOB 4IJ3C 4ODVH 4E9LA 1QSFD 3WFCH 1ZWIA 3GSXA 1KLFA 1AD9B 3K4ZA 1LO2H 1RZKC 2J3SA 4DKEH 2FHFA 2IANA 3GHBL 3KJ4B 3BE1L 1FNAA 3KYNA 1OTUC 4KJYB 5F44A 2YN5A 3OKLB 3PV6B 4OBRA 3UTSD 4TOYL 1NL0L 2AV1B 3VG9C 2DIJA 2CSPA 1EGJH 1BQUA 1PEWA 2OYPA 2BZDA 1FLTX 3CFJB 1XGTA 3RJDA 3O6FB 5IROA 2ADFL 4D0CB 4PRDA 2XIDA 1O0VA 2V7NA 2O61B 1WBYB 1UWEL 2HFEA 5D2NA 2IPUG 2UWEF 4NO3A 1IEAA 2GJ6A 4WU5B 5KSBF 4R2GD 5FGRA 1U8LB 4MJ6A 1S9KC 1GL4B 2X5PA 6FABL 2XTLA 3H9HA 5DFWH 1JPST 3M45A 3L7FB 1WBZB 4HWZA 2QEJA 5T1MB 1BLNB 3Q6FB 1JIBA 2ICEA 5J13C 3C08L 3MBEB 3GSUB 2YK1L 3H2WA 3LEVH 5DFTA 2KZ1B 5DEFB 1WSST 4PJXE 4P4KB 3BT2H 1DQQA 3T0XA 5I71C 2FB4L 2NYYC 3TF7C 4HIHA 1MUJA 3QP3A 1QYGH 4HGWA 2QV2A 5J1SC 4F7PB 4GXVH 3VFUB 4QGTA 1WIPA 2EH7L 4N8PA 4UOJA 4Z5RB 2IAMA 5DJ0A 3O4LB 1T89A 1FAKT 4KPHH 1N8ZB 4AQ1B 2DWDB 4A6YA 3P2TA 5HPMB 5C0CD 3ZDZF 2HT2D 4WV1B 1EK3A 5KVEH 1IGFH 4YZFF 2VLKE 1F4AA 4L4VE 5MP6H 1EGJA 4RFOL 1F2QA 3DGCR 3S9DB 1B9ZA 4XCFL 5FYJH 1YN6B 4MZ2A 4NRXA 3SKJL 4X7EC 4UTAH 1YEGL 5DGRA 5BMFH 5D2NE 3NFNA 3ZYZA 1A64A 4W4OA 4Y2DC 5HGBA 3TJEH 4DUWA 1HKLL 1HCVA 4LAJH 3MLVH 4M93C 4XWGL 4MVBD 5B8CA 3OR7B 3EFDH 3NA4A 2WUBL 2XTJE 3MA7A 5A3ID 1ZXQA 1FIGH 2RCSH 4MS8C 1K2DA 2IWGA 2B1HH 4NO5A 3VW3H 2VABB 2E6PA 3JWOL 3P0VL 4P99A 3MV8B 4QRQA 1T66D 1XR9A 2HRPH 4L4JA 3S37X 1MCKA 4DEPC 2P47B 1BAFL 1CVRA 5DK2B 2Y07H 4FTVA 4O2EB 4JQIH 2AK4B 2JIXB 3QFJD 4X6DA 3DUSA 4BKLA 1FBIH 5TDOB 1GIGL 3U30B 4A2LA 3HCVB 1YQ2A 2FH6A 5HXMA 4KROC 4YUEH 4YEFA 4HW6A 1C5BH 4JANB 3UO1H 3W9EB 4UOW0 4KKBD 5JXEA 1M4KA 4PJ9D 2XWBB 4KJQD 2BC4B 2YOCA 4HK3J 4MB4A 1PY9A 5J11C 5HDBE 2WBJB 4J1UA 3ZKNC 5BS0D 4KK9D 1EO7A 4LARL 4OJFL 2CUHA 4G8FA 1IGMH 1XF4B 3WCYA 1AXIB 4EI6B 3MRBB 1UXSA 1IKFL 3WFEH 4Y5VC 1JGUH 3N0PB 4HMDA 3VG9B 4Z7OE 4E41A 1BFTA 4I0PC 5E99H 1YN7A 2W9LA 5BRZD 2BSSB 1HQ4B 1X5HA 1CD8A 2DAVA 2OS7A 3T65B 1OAQH 4UIKL 3NCBB 4KXZI 3S96A 3KPQB 3O6FC 3BE1H 1EXUA 4ZUTB 5ALCH 5CJOH 4U6XA 4KI5D 2KBGA 4NYLA 3X3FH 5CWSA 1JGUL 3VE0A 3CK0L 5D1QA 3WN5A 4ZTPH 1Q0YH 3VXPB 3E2HB 3V0VA 3IDJA 3VE0B 2J6EL 1EHXA 3VXMA 2YSSB 1KTLB 2HH0L 1JNJA 4KI5C 4NYLB 4KWUA 3BEWB 5T5FH 4MHHI 2BHUA 1CDUA 4NO0B 4P5TD 6FABH 3HZVA 5CZXC 3S5LA 1EXUB 1MQKL 2E6JA 4JY5L 1QUNA 1YECL 1AO7E 5F9AC 2IPTL 1HQ4A 4ZTPL 5CZKA 4AENA 4Z7WF 4JM2C 5IFJB 4PJEA 3K3QA 4M7ZB 3VDCA 5C7XH 3PL6D 2NY3B 5D2LA 1INDH 4GKZA 4EI6A 1HHGA 1OSZB 1FG2B 3IU3A 5F89B 1FH5L 2AQ3A 1AFVL 3C60B 4QF1A 2BNUA 1ZT1A 1J88A 5C9JA 3P0VH 4QT5A 4YHPA 3ZT7A 2K7QA 4PY8I 4DVRH 5DURD 2GI7A 1NGXA 1CE1L 3HAEA 4NBXB 1YPZB 3RZCA 3B9VA 3RVWD 4B7LA 3ROOA 4LCUA 1A1NA 3OGCA 4RBPH 2B0SL 4O00A 4EQ2A 3IDXL 1Z9MA 3UXFA 4TULH 3CDGB 4LHUG 4GQPH 4PTUA 2HP4A 1WZLA 3QXVA 5DJ6A 4NNYB 3L1OL 1JNLL 5CP7B 4ORZC 5DMGD 5I30H 3S3JA 4FABH 5FAAA 5HHNB 5L8JB 4NJAL 2HRLA 2O5XL 3SDYH 4HXAH 1HKFA 2CDFA 2WSKA 1BPVA 1NCDH 2I60H 1P5VA 2H6PA 4Z7VA 4M1CD 2P45B 3MA7B 3LS4H 1MQ8A 3T0DA 3OR7A 2VDQH 1IKNA 1RVFL 4FG6C 2PYEA 4JKKA 4E5XB 4PRHB 3T3PF 1R5WB 4N8VB 1YQVH 4NT6A 5HPOA 1UCBL 2HN7A 3RNQB 4LCIH 3CFKB 2W65A 1IC5L 4BH8B 4NRXB 3HN3A 2PO6D 2ATPB 1U93A 1JF1A 3IS1X 4JY4A 1ZAGA 2EIZB 3CU1A 3VI3E 1YNTA 3V5HA 3QWQB 4C83A 4G7VH 4OGXL 4EDWH 3DXAB 4CW1A 3LS4L 1UWGL 1YYLH 5DJZB 2HJLA 1YNTB 5EBLB 1T03H 2DWDA 1K8DB 1R24B 4LPWA 1L6ZA 1N8ZA 4K8RC 3ALXA 2W65B 4GS7B 2IAMB 5IK3B 3BQUB 2D7PA 1NMCB 1WFTA 1RIUL 3RNQA 1M6OB 5ISZB 1NBZA 3VFMB 3SDXE 1TMCB 3OV6A 1ZHBA 4N0YL 1MFDL 2X70B 5DMKB 1GXEA 2HJKA 3IT8D 4FNLL 3UTSA 4NZUL 4DFHA 4PRNB 1ZLWK 2HT2C 3BZDA 4FRWA 4YK4B 4U3XA 4X5LA 5B3JF 2BDNH 1HH6A 3EUUA 3SE3C 4G42B 3VRIB 4U0RB 3JUZA 2M1KA 5IV2A 4Y4FD 3VGAC 5DUBB 1R0AH 1CLOH 5JW3H 3CDGA 4NM4H 4KAQH 4LOUC 1BQLL 4KMTH 3N9GL 2HLAA 4XC1L 1I1YA 2FYYA 4ZOAA 5CZVH 4WU5A 3ZKMD 2R2EA 5EH1A 1LE9B 4KDTA 1E28A 5DI8B 4ODSL 1JNNL 1U0QA 3QPQD 3D0LA 4Y4HD 3CXHJ 1CGVA 4M62L 5EO0B 1WBXA 2YXMA 5LGJB 5D72H 4OLZH 1PX3A 5JO5A 1RZJC 1FG2A 4NRZB 4ONOA 4HWBA 4YPGA 4DAGH 5ETUA 4KV5E 1DUZA 3GBNL 3QCTH 1UM4H 5EOCJ 2NW3B 2ARJQ 1A9BA 1T3FA 5BV7L 5HDOA 2CO7B 4HUUA 4KKCD 3J7HA 3SKUD 4P9HH 4Y4FB 3VD5A 1HZHH 5I1CL 3BEWA 1OTTC 4OZFA 1CLYL 1RUKL 3WNLA 5GS0L 5JA9A 4B41A 4JHBA 2YD7A 3TN0D 2P8LB 2WWKO 4HUNB 4P5MB 1F58L 5IWLA 5D1QB 1QBAA 4CADB 1DQTA 4NHUA 1LK3H 4NBZB 2RB8A 3ULVF 3RWHA 3FCTA 4PBWD 4KK8C 3QDGE 1SEBB 1MY5A 4U6XB 4NN5B 4BQCA 5GGRY 1EAJA 1SEBA 5DD3L 1OP3K 5HYJD 1PLGH 3G5ZA 3QFJB 1FFPB 1Q9OA 4N90E 4XT1C 2NX5E 2OSLA 5H35A 4BUGA 1FFQA 3C5JB 4XTRD 4XPFH 3NOIA 2DTMH 1AGEA 2ZUQC 4NUGL 3QHFH 3MV8D 1A6VL 1F4YL 4Z76B 3U7YH 3OKNB 4JPWH 3JTTB 2ZWLT 3FRPA 2DMBA 5I16A 4Q9QH 4PYGA 3A6BL 2VQUA 5F1KC 4WW2A 4XP6L 1DZBA 4JANA 3P0YL 1A9BB 4XVUD 4GJTB 4WFEE 1CXKA 3ARGD 2H2SC 2IF7A 1T20A 4PB9L 3DUSB 1SHMA 3IKCA 5TDPA 2VLJA 4NRZA 5T1KA 4AQOA 1T7XA 3EOTH 2QSTA 2VXUH 1IGML 1OTTD 3ZL4L 3VI4F 3PWUA 3DV4A 4AJ0A 4F15B 3MLXH 4NNXA 2UVEA 4ONHB 4F33B 2HKFH 2R2EB 3QUML 3OL2A 3JV4A 2E7CA 2ZUVA 1UWEH 5B39G 2ADIA 4IRJA 1VESA 2KDGA 4MXVF 4YDIH 5DHYA 3ULSB 5JDSB 4K94C 4KVCH 2V2WA 1G9EA 1U8JA 3ARTA 3NFNB 5E5RB 43CAB 3U2SB 1ZE3C 3L5JA 1KTKE 3J8F7 1JYNA 4JFXB 4X9GA 1HH6B 1OTSD 1D5MA 1QLFA 1VEPA 3BP6B 3CK0H 4X6CA 3QH3B 4OIBA 5IMMA 2ZSWB 4Y16C 5E0QA 1RZFL 1ZVYA 3VXTA 4IDJH 1OARH 3ZTNL 3VFSA 4CN6A 5DF0A 2XNAA 1U2CA 5KOVC 1W72L 3QNXA 4O4YH 3W0WD 1RULL 3WV0A 5F7EL 5TF1H 4WEBH 4CRPA 4JFFA 1CFQB 1DQDH 1V3JA 3B9EA 3BQUA 5IK3A 1PDKA 4FQJH 1P5UA 5FO9A 1FJ1B 3D85A 1R24A 1WCQA 4L4VD 1KPRA 2XFXB 3F62A 3MGTB 5IM7B 5GS2D 4MQ7A 4D0BA 4F7EA 3FO1B 3I2CL 1ZANL 1ULVA 4K3JH 1WT5C 5AZEH 1NFDF 4CUCA 4ZYKA 2EICA 4MA7L 4OT1H 3O9WA 1FSKC 1DLFL 1MJ8H 4JZJB 3C6SA 1BLNA 4ORGB 2EXYD 1OSPH 3IDYB 4PRIE 2XTJC 1Z9SA 3X13B 3QNZB 3SDDD 1A7RH 3G5XB 2PTUA 1ZHKB 3BN3B 1AR1C 4OIAA 3BPNC 3T3PE 4M1DH 3HNSL 4NO3B 2QQNH 5I8OL 2H6PB 4QGYA 4N9GB 4GXUN 1G7QA 5FHBL 5HHNA 3V0WL 3UTTE 4PJDB 3MYZA 4GBXA 5CP7A 1KCSH 4GXUM 4YDLB 5SV4A 3L9RB 5DEZA 3PL6C 1VERA 3HZKA 5CGTA 1P7KA 5C0BE 1E4JA 2D4FA 5B22A 3UJJL 3Q5OA 1GOHA 3KYNB 4HJ0C 5JOPE 3O4OC 4LCUB 5HI4C 3D9AH 3ROOB 1UEYA 1ZWIB 3GSXB 2D7TH 5KSVA 2UY6A 1S9XB 3BZFA 4OKDA 4ODHL 1LO3L 4YHNB 5F97E 1F13A 3VXSD 3WEXB 5DTFB 3U9PH 3BH9B 1OP5H 4IOFC 1S7QB 3MOAL 1JE6A 1FZMB 3E8UL 5IBLD 3FB7A 2B39A 4WHTA 5DS8B 4PTTB 5F89A 3QYCA 4XNMA 3DI3B 1EO5A 1HHGB 3V4PL 3QWOA 3HMXL 1Q72L 3PNWA 4PJCA 1MRDL 4XXCA 3JV0A 4N8CL 4W6XB 4OZIE 5IJKC 2UWEA 4MDJA 3T08A 2XN9B 4NQDB 3V7AG 3BRFA 4XP5L 4DZ8B 3P40A 3MREB 4EVNA 2YPLA 1YEJH 1IL1A 3LKSB 1KTLA 4NFDA 3VXMB 2CUMA 5F3HA 4Q7DA 3ULUD 3IB4A 5JNYB 3QO1B 3QEQD 3HLAA 1CICB 1V7NL 4CN4A 3T0EE 1FNLA 4GW4B 3CSBA 5ICYA 3BKCL 3SY0B 4PG9B 3ULVL 3GSOB 1MHCA 1T66C 1KOAA 3TBWB 3UAJC 3CFDB 1NEUA 1Q1JH 1NKRA 4P3DB 2EE9A 2R4SH 3FB6A 4YNYB 4Z95H 5E8NB 3AS1A 1HI6B 5FB8A 3S96B 4I4WB 3Q48A 5DRNB 4CMMB 3VCLB 4OZIF 2BSSA 1AQDA 2WLZA 3BKJH 1MFAL 5HI4D 4HUXA 1TITA 3H7BA 1PW3A 1TETH 5J13B 3N1FC 3SCMC 3T8XB 3QHZH 2VN4A 1M7IA 1RZFH 2DL9A 3GSRB 5I17B 2VYRE 4PD4J 4G8FB 3HAEG 1D9KB 4ZFOB 3HNSH 2WWMD 4KK6D 3AAZA 4DEPB 1RZJH 3ARGC 1UA6H 5B38B 4JO3L 3BKYL 2YC1B 2VE6B 3FFCE 5CJXA 4TTDC 3T0VA 4GSDL 1J1PL 2X1XR 3SKJH 25C8H 2DRUA 4QRRA 5J9PA 2WIIB 3T04D 2C3HA 3S35X 32C2B 5JR1L 1WC7B 4X6DB 1G7IA 4YPJA 1DQLH 1JHKH 2EO1A 3ARUA 4FTVB 3HHRB 2R2BB 5EUKA 3DHJA 2E3VA 1UJ3C 5F88B 1FIEA 2YUWA 2XKNA 4G8EB 2J8UA 1PQZA 4AEIH 4PR5B 2CLRA 4KV5F 4W70A 4POZD 4QRQB 2GTZA 3DBXB 2DD8L 4XTRC 1U8OA 4LSSL 1EERB 4P4RA 4PG2C 3MRNB 3B9DA 1YJDC 5HDQH 1KCLA 4ODWA 3CVHH 3CFEA 2YN3A 2M8XA 5E4EC 4NQVA 3VD7A 4P9HC 3QAZB 2PXYA 5HGBB 2ICWJ 4QHNB 3ARRA 2J8HA 1QFWL 3KLSA 1MI5B 1BFOB 3KLHD 4JRYA 35C8L 1UCBH 3NZHL 4YDVB 4GRWH 3O8XC 1NDMB 4NKIH 1AIFB 3KWWA 5GS2H 3LB6D 3ARVA 5HDQL 1OAUH 4JDTL 2SEBA 1F4YH 3JWOC 4FQQA 3MJ6A 4RIRB 1CT8B 3L3GB 4HGKC 4LARH 5DUML 1S78C 4Q6IB 4Q2ZA 2DIAA 3EFFA 4PGJA 4GRWF 4U4BA 3T2NL 4H20L 4JFEB 1I3RB 4JVWA 4XGZB 5IJKA 4HGWB 1T5XB 4PJFF 4HKZB 3FRPG 3ARFB 1I3RA 4A2MA 1NMBH 1LD9A 4WI4A 2AEQH 4U1HA 2HMIC 3EFFB 4IMLA 3SDXF 1A6TB 5ALCL 4Q6IA 2C1PB 3GSWA 3O4LE 4U1GB 1U92A 3L3GA 1CT8A 3QG6B 4OFIA 3Q6FA 1T2JA 2V6HA 1BZ9A 3L7FA 1JGEA 5EC2A 3H9HB 3V6FA 3QIBB 4MHHG 2Q7YB 1AD0B 1R3KB 2D9CA 2WMPA 4HC1H 1U8LA 4MJ6B 3PQYE 3DO7A 2R0KL 4N5EC 4YHZH 2HFEB 3LHPL 1G6RH 4WI9A 5D2NB 5JHLH 2X44D 5CEYA 3SHSA 3FHAA 2DQHH 3SE4A 1E4KA 3CFJA 2XZAL 4RX4A 3QUXC 3DBXA 2AV1A 2BY2A 4Y1AD 2CXKA 5TFSL 4KVNL 4KJYA 4G8EA 1IMHC 3L7EB 2XKUA 5F7EH 2R29L 4HCRH 4HLZH 2E27L 15C8L 2OM5A 1AD9A 4NWTH 2BY3A 4DN3L 3QQNA 4P59L 1QFWM 4HJGA 3VGBA 32C2A 3TVMC 5EUOF 3N1QC 4QRRB 1KPVA 5TH2A 1FVDB 1SEQH 4RDQG 4S1QH 4YDJA 4JPKH 5E00A 1D7FA 1X9QA 2W60B 3UPRB 3BD3A 4HCRA 2DM4A 4J23A 3R1GH 1AR2A 2QSCL 1CFNB 4BZ1L 3LAFA 3RP1A 3QRGL 3AB0B 1RUKH 1PSKH 2R29H 2CDGB 2MWCA 2XZQL 1IEHA 3ARZA 1HHHB 4YQXL 3CLFH 3LQMA 5EU5A 4D9RE 1M7IB 3GSRA 4XNYL 3LCYA 4NJAH 2HFFB 1VKXA 2DQCH 1P4LA 1JZ6A 4RQQB 4U6YB 3H7BB 2LTQC 1WZKA 3EYQD 3QUMA 5C07A 3OXSA 5MI0C 1GGBL 3ULVE 1A6PA 4LEXL 1NPUA 3MSPA 5CGYC 4I4WA 3MLWH 4J7RA 2P43B 1QSFA 5E08L 4KHTH 5D6DC 1DL7H 1RZGA 1U36A 3B5GA 1C5BL 5ACLA 2A0LD 3FQUA 4ZFZB 3C5ZD 3UPCA 1BWWA 2H41A 5E03A 3RKDD 4FZ8L 1JPFB 5EUOB 5DZLA 4GW1B 4DKFL 1YY9C 5DDHA 3O6LH 3RAJL 3O2DH 4LF3B 4N1EA 2EYTB 1CICA 1U8KB 1DBAL 4D0DB 1QZ1A 2VTFA 1U42A 5JNYA 1QSFB 3MRKB 5F7NC 5D70L 4TOYH 1INEH 2KL6A 4ZMAT 1IKFH 3WFEL 3QQ3A 4EVNB 1M7XA 1AGFA 1ZMYA 1NKOA 2IQAA 4GQ9H 2XN9A 3MFFA 3DVNA 5SWZD 1MCJA 1ZLUH 5JQ6L 4J3XA 5BW7A 4LQFH 1WAAF 2UVFA 4YXHL 3WNPA 2RFXA 5DR5H 3RFZC 1CK0L 5HHOD 5D5MB 3FB7B 1FZMA 5ISZD 2G9HA 1GC1H 2Q86B 5TH2B 2V5TA 4QRPA 2Z8RA 3OKDA 2YPKA 2ZUXA 5KZCD 3FQTA 1U8MA 4I0CC 4JFEE 3HG1B 3MBED 4IDLA 1MH5A 1R3LA 2FJGA 3WE6A 1MFEL 1J05A 3DUUA 4FHBD 2A73A 2UUDH 4LSQH 5ENWB 3QPQC 1JYVA 3D6GA 3QEHB 4OF6A 3B5HA 2Z9TA 3WSQH 1WFUA 4HFUH 4ZG1A 1NBVH 3SGJA 4IDJL 1RMFL 1WVZA 1A7PH 4M6OL 1IAOA 4MA1C 2AKRB 5HSFA 4ZXBB 5CEYB 4IHOA 1MRFH 1QNZH 5HVWA 1AO7B 2IG2H 4FQHB 5BQ7B 1ETZA 1UM5H 2EEAA 4HH9A 3MGAA 5ILTH 1Z0MA 3QNZA 3MLYL 1NUDA 3HB3D 1ZEAL 5I15H 3TGXA 3W2DH 3VI3F 2F58H 3IAGC 5GZNC 1HOCA 2A6KB 5H8DA 1XEDA 5CEZE 4JZJA 4V1DB 5D7JB 4DKAA 4V1DA 5D7JA 3QEQE 3RU8H 1ZVSA 3SJVD 5EBMB 4OD1H 2JELH 4P2RD 2O93L 1H3XA 5HI3D 4MQ7B 4OB5L 1GAFH 2V5RA 2W9EH 4JQVC 2LU3A 4HV8B 4MA8H 4PY7B 2J6EA 2XFXA 2ZCLL 4GRLB 1U8PB 4JREB 3ARFA 4HKZA 4OLEA 2R15A 2ZCKH 1BHGA 5EA0L 1TVHA 1FJ1A 1TZGL 3DVGB 5BO1H 5C0RL 3O11A 4QRSB 1K6QH 4P5TC 5JIPA 1K9TA 3D2UA 3FFDB 2EH8L 2XZCH 1T1XB 4OD1L 1IAOB 1RU9H 3OX8A 4KHXH 3T0AA 3AXLA 4UINH 4LQ1A 2X9XA 3VD9A 5KG9A 2BJML 1BEYH 3IJSB 1S7XA 3IAQA 4IM8A 2ZSWA 4NO2A 1FFNB 4ELKA 5BZWA 2A73B 5EOQH 4S10A 3QH3A 2F8OA 5F7DB 4D9LH 1MH5B 4JFXA 1T04B 4R8WL 3FQTB 2ADJB 5KVFH 1I3GH 4NKQB 1U8JB 3OKDB 2V2WB 2PXYB 4QRPB 4ZOBA 5FKPA 3VXSA 2Q86A 1ERNA 1CDIA 3PP3K 4X4XB 3NAAL 4XZUB 4P4RB 4HD9A 3B43A 2GJ6E 3Q5YA 2OI9B 4JB9L 4P23B 3VWJD 3U4BL 4F58L 4ONHA 4NNXB 2CLRB 3MJ7A 3O6LL 3RAJH 1PQZB 2FH8A 4J6RL 1KIRB 2R69H 3PWUB 4KY1L 3V8CA 5I1DA 3MFFB 2P5WA 4P2RA 5T1KB 3WMSA 3WS6C 2G2RB 4N8CH 5ID1B 4LRNL 2IQAB 3ABZA 4EI5B 3WUWG 4PS4H 3GIVA 1LEKA 1TQBC 1KBGH 3O6FD 5DUPH 4NUGH 2WK2A 3WNMA 1N4XH 4PUBH 1B88A 2P7TB 5FGCB 4OF0A 1N0XL 3GKWL 3Q1SH 4HG4J 3UTQA 4PJHA 1H3WM 1KCRH 3BRDA 1YEDB 3BP4A 5L88L 3OKNA 3NCYP 1TCRB 5C2BL 1F6LL 1CFVL 4G6FD 1IQDA 2IALB 3FQUB 4XNUL 4G9FB 1N59A 1O5DT 1LK2B 3PHOB 4E0RB 4HWNA 2GUOB 5H35B 3QDAA 3WFBH 4QRTB 3UJIL 3DYPA 1TTUA 3DECA 3EIFA 3NABL 1TJHL 5TF1L 2VLRA 2G5BB 1ND0B 2ILLA 2NY3D 3AUVA 3FB6B 4MLSA 5IHUH 5T5NF 1GAFL 1VKXB 2HFFA 1CVSC 3L3KA 3PV7A 5I9QC 5DWUL 3FCTB 3RWHB 1YNLL 1HHIB 5T3ZL 4P9HL 5L2KB 5ESVB 1WFOA 1X5GA 2LTQB 1MREL 3MNVA 4Q97A 2JKXA 3MRPB 5CLWA 2CDGA 4HF5H 3WFHA 5HHQB 3QI9D 1FGNL 2F5BH 5E2WL 5IMOB 4QXWA 5H37G 5D7JC 1KPVB 3SOBL 4HQQL 5EU7C 2V2TB 5ILTL 4EUPA 2O5XH 5DK3A 5LCVH 4Y4FA 1KXTB 1MLBB 1T3FB 4NZRL 3EW3B 5D9SB 4X7DC 3QEGH 4YBLC 4OQTL 1FGNH 4DQOH 5JHDB 1L7IH 4XCCL 4R96B 1PZUB 3QWOB 1Q8MA 3U0WH 3L3OA 4WY7H 4RMUA 3IJYB 5GRUH 2R23A 1I3UA 5EO0A 1HYRC 3GBMH 3CUPB 4DGVL 3CX5K 4MNQE 3GIZH 1LE9A 1H8SA 3JV5A 3O3DB 1S9XA 1BECA 1JWMA 4JKLA 4OCSH 5F21B 2NX5B 1JTPA 1YNKL 5IHLB 1CG9A 4K8RH 1F02I 1G7JA 4B0MM 1J0JA 4KMQA 1DL7L 3PG2A 4PGEA 1GPOL 3NN8B 2VXSL 4I48B 3FO9B 3WKML 4PJBE 4S1SH 4PP1C 3L9RA 3ARED 5EZIL 4HXAL 1RIUH 4G42A 3VRIA 3U9PL 1IEBB 4PJDA 4ZSOE 1PKOA 4RGNE 2I60L 1LMKA 5JW4M 1G7QB 2C1PA 3GSWB 1EHLH 3MLZL 4N9GA 5FXCH 3RWCB 4IMLB 4TN9A 4U1HB 4JRXD 1WZ1H 5DMKA 2APVA 2X4SB 3IXAA 2MPAL 4XGZA 1ZHBB 5IB3A 3V0WH 1ZHKA 4X83A 5D1XB 4JFEA 1EZVY 3VFMA 1CFSB 5HVFB 4Q0XL 1KC5L 3X13A 5JOEA 4XAKD 4GW5B 4G6FB 3LQAC 5EIIB 2A38A 3I6KA 1DP0A 4DW2L 4FFVD 4GUPB 2NXZD 5EBLA 3NABH 5JTWA 1GJIA 3FN0L 3A67H 5IB4A 2AJSL 2N4IA 4C83B 3AY4C 4JHZA 1N6VA 3QIUC 2PF6A 4U6TA 3OR6B 5FIEA 4YDVA 2X7LA 2OZ4A 3MLRL 1MI5A 1IC7L 3I3EA 5GSVA 2BVOA 4HPYL 4XBEH 4AL8L 4YJZL 1PBYA 3FFCD 1R5WA 4C56A 2AEPL 4DAGL 1X5YA 5FYKE 3MRRB 4LAQL 5JIIA 4WTZA 1OLZA 2NY7L 1DQDL 3P30L 4Z7VB 5SWSA 3LRHA 3VFSB 4OCWH 4F8QA 3VXTB 2BVPA 3VWKD 1KSRA 5IMMB 4YAQB 1NBVL 4KK5C 1IRAY 5ACZB 4XCEB 1D5MB 2BERA 3BP6A 3B3IB 1LDPL 2DQJH 2E7LA 3B8YA 5DJ6B 5IKCA 2VAJA 1G1YA 4G9FE 3OKKA 3BT2L 3N9GH 4JVUA 5TE4L 2YRPA 2C3VA 3ZYJA 1YMHA 5J9PB 4QOKB 2EDOA 1MVUB 5E2UH 1Z9OA 3ZKXC 3QJHA 2MFNA 5L6YH 5B38A 3SCMB 2Y36H 4K7FB 2AXGA 3HMWH 5I66A 2BVYA 1KACB 5DC0A 3KLAA 5EZOL 5HI3C 5D1QD 1OT1A 1YC8A 3U1SL 1J5OL 4M7JH 3RVWC 3UAJD 4QF1B 3REVB 5IB1A 5I17A 4X6BA 3ALPA 1C1EH 1NH6A 4GMSH 4WU7A 3MTRA 1I9IL 2BOCB 2X10A 5FO8B 4I2XB 4XNYH 4HUXB 3AS0A 5C92A 2FBJL 4C56E 1RPQA 1FZKB 2G60L 5DRNA 3IGAA 4MWFB 2VLMD 3HZVB 4NO0A 4YNYA 4LP4A 3BWAA 1IE5A 2AJVH 5INCA 3H9SD 3UTTB 2H1PL 3AVEA 4JPVH 4KJPC 2YSSA 4N8VG 5AZ2H 1ODAA 4OUOA 3EYUH 2P49B 1DANT 1A4JA 3GBML 4Y5XC 2HRPL 2ZOKA 1QBMH 4PJ9A 1RFDL 3U9UB 4GS7C 4XI5C 1JF6A 3KPMA 5DQJA 2EZ0C 4KFZC 1FNHA 5CKAA 1FC1A 4M1DL 1UXWB 1FFPA 2ZJSL 3L5WB 1I3GL 4MX7B 3I3BA 2EDRA 4IS6B 3BGFB 1QLRB 4NKMA 5FYLE 4NCC2 4JFDE 4ZUTA 4MJID 3VMNA 3ARXA 4DZ8A 4JJ5B 2VLRE 4PYHA 1DLHA 1YDPA 4XMKH 3TZVD 2UWEB 1GZPA 3GMRA 1MELA 3S4SG 1KCUL 4WWKC 4LPYA 1S9VA 1URLA 1J1OH 3IJHB 3PNWB 5DMJB 4R0LA 4UV7L 3AM8A 4YHOL 5GGSY 4XNMB 2FRGP 1YYLL 4PTTA 5DT1H 1HHKB 1MNUH 4LLDB 3QBTB 2JJSA 2NR6D 4JFED 3BH9A 5KTEH 1JN6B 2YPVH 5DTFA 4PJIB 1MOEA 5I1AA 2BC4A 5EO9A 5EC1A 4EIGB 1DVFC 1OAQL 4WI5A 3BN9D 1TVDA 3VRLF 1G7MB 2NW3A 3P4NB 4R4NC 1XGYH 2X4UA 1E6JH 4ZAKD 5D71H 5TDOA 2ATKB 3SE4C 3HZKB 2AK4A 2JIXA 1XF5A 3AREA 2J88L 2APXA 1KJ3H 4BH7A 5DK2A 5IBLC 2FX9H 3H9YA 5ESQB 2D31B 2NNAA 5LGJA 1TQCC 3S35L 4NQEE 1BWMA 4OZHE 1S8DB 1FORH 4KVNH 1K2DB 3ZSSA 1QFOA 4R97C 3X17A 4OCRL 2ZKHH 1I1YB 2FYYB 3NTCL 3X11A 5L9DL 3MRCB 5IVZA 3H3KA 4N9OB 2FNBA 4M1CC 3LKPA 4U6VL 2DDQL 3ZE1E 3S7GA 3O41B 3DRTB 2AXFB 5DUBA 3DHMA 5GGRA 5IV2B 4ORGA 2ESVB 2VIRB 2Z8SA 4GLRI 5K59F 5CAYB 2FD6L 2OTUB 4PRPA 4JPKL 3WJLA 1P4IL 4PRNA 5FUZH 1JGVL 3F6LA 4KGJA 2E8YA 4JCLA 4EUPG 4K9EL 5CD5D 3KPSD 3QRGH 4D0BB 4X0KA 1NSNH 3BX7C 2AJVL 5IOPA 2WINB 4X7SH 3GI8H 2GJJA 3N1MC 3D85B 3RL2A 4DOHB 4Z5RA 5LCVL 5MEPA 2ZP0T 2VZ3A 1CFQA 4G6JH 4L3ED 2YK1H 3I6GA 4V2CB 1JRHL 4XP4H 4FQCH 3TJEL 2B4CL 3OZ9H 2FJHA 1YJDH 4P4KA 1QFUL 5E08H 4CW1B 3ILQC 2JJTA 5I30L 4X6CB 3UBXG 5CGYD 1JF1B 4PRPB 2P5ED 2ICEB 4ETYA 1VFAA 1A5FH 4F9PC 1RUQL 4YFLF 1WBZA 4NN6C 2B8OT 2DQTL 4FQIH 2HN7B 4WFFE 5DQDH 2Y07L 1P6AB 2GT9A 1MI5E 3LKPB 2LV4A 5IB5A 4PP1D 4IRJB 5M7QA 5D7LB 4JRYE 1NFIB 1YY9D 4OAWB 2X4RA 3EJYC 1C16B 3MACL 5T5NG 4UT6H 3PGDB 1JYWA 4PRDB 3SBWA 1S3KL 1YMMA 2XPGB 1OM3L 3SDDA 1XGTB 4KKAD 5J7CC 4BK5A 2D31A 2NNAB 1I85C 4NNYA 1XGRA 1XF5B 3AREB 2BXZA 5LAXB 4JPWL 1FC2D 1PGRB 2P8MB 4DKDC 1PYWB 3FMGH 1BJ1J 3RIFF 4XC3L 2X4UB 1H5BB 2R9HD 3FHQA 4TPRL 4WW2B 1DBKH 2VKWA 3CDFA 5KW9L 2WBJD 5DUPL 5BS0B 4ONGH 3WD5L 1JN6A 2X6MA 4LLWA 4OF3A 2BNUB 2VQTA 2OLDA 3C60A 3FFCA 4LLDA 2FX7L 4Z76A 4LSUL 2JK5A 1G0YR 4AZ8A 5C70A 3IU3B 1OSZA 1BVKA 1AH1A 4GKZB 4KTYA 3O3BB 3GJFB 4PJEB 3ZKXB 2OJEB 4F7TB 1A7NH 1QACA 4PV9B 2JJTC 3L3DA 1MRCH 3DURA 5T3XH 1TZHB 3EYOA 2VLJD 2BHZA 1Y18B 5GISH 1JPTH 2YD8A 3AY4A 1VADA 2R8SL 3I02B 2IAMD 5L2KD 4WEUD 1UXWA 4Y2OA 2ICES 1S5IL 4XAWL 3KPMB 1FDLH 3IDJB 3K1DA 5EFIA 4L8BA 1T7YA 4P5MA 4P5KB 1A4JB 3SE8H 3EOBB 2VZSA 5CWSB 3SBWC 2QQLH 2ZKHL 3NTCH 2IPUK 2OR9L 4HT1L 4NCC1 2VB5A 4UILL 1JHLH 1JMXA 5EUOE 5L2JB 1X4XA 3FO2A 4RMSA 1EMTL 2MQ0A 3WFZA 5IROC 2DLFH 4FZEL 5E2VL 4F3FB 2OJZH 1FZKA 3JV6B 1F8TL 3EAKA 4P49A 1KLUA 1DUZB 1J1XH 2YPLE 5ETUB 1FCCA 4YDLC 1KPUA 3SO3C 5FO8A 4WU7B 2GHWB 4OZGA 3V5KB 2JE8A 3RIFK 2ESVE 3GSNA 2QQKL 5FUCE 3FB5A 4FXLA 5GRUL 4X7TA 3JWOH 1D6EB 2XWBA 4K7FA 4Z7NF 5FGBA 5I66B 1ZA3B 5TE6H 4Y1AB 1Y6NR 5EIVA 1I7TB 3MRGB 5D5ME 4U7MA 4DJMA 2D2OA 2YMXH 4P57B 2WQRA 5AG9A 5EPMB 5HGHB 2JB5H 1LWRA 2WUCH 1VPOL 5IKCB 3U6RB 5KS9F 4K2UL 3P73A 4XCYA 4HEME 3WKMH 5ACZA 4TPRH 1QEWA 2CRZA 1SY6A 4PJGF 1KB5H 4TUJB 4KQ4H 5GZND 4QXUH 2IFFL 5C0BA 1DVFB 3N1PC 2CUIA 4PJFE 4YFEA 5E70A 4X6CE 3FONB 2ARWA 3GJFK 1GOFA 1O7SA 3S6CA 4GFTB 1FIGL 5ISZA 2NY3C 2ZCHL 1MCRA 3W82A 1HSBA 5BZDB 2AS5M 1UZ8B 5GSVB 1GC1L 2F9BT 4POZC 1F3DH 3E8UH 4QHKJ 4FXGB 4UIKH 4ZS7H 4DZBB 5DJZA 4R8WH 3H9SE 1MWAH 5K9KA 5LJYH 4DN4L 2VXVH 2EDLA 5IB4B 1LE5B 2Q6WA 3V5HB 4FNLH 3RUGF 2EIZA 3HNTL 2EDQA 3AMKA 3MNZB 4GUPA 2MCPH 5E8OB 2NY4B 1QFHA 4XNUH 1VGEL 3QWRD 4GW5A 3EJZD 3IXTA 3CFKA 1U8NB 3W11D 1TQBB 3HR6A 4J3WA 4NT6B 4R0LC 3LRGA 4N8VA 5D1XA 1IFHL 4NHCH 5FYJE 2VKXA 2PYEB 4E5XA 3GFUA 4TSAH 1UH4A 3O2WH 2X4SA 4HS8H 2AABL 2VXVL 2ZUUA 5E5UB 4PRHD 1A3RH 3ZYOA 5AEAA 5GPRA 1MCQA 3RWCA 2BNQA 3RBGA 3PJSB 2A6IB 2CDEA 2W9DH 4LU5L 5J3HC 4FOMA 4LIQL 1IEBA 1N6UA 1IGJB 2HG5B 3QT2A 2EH7H 1N5YL 2N1KA 1CLZL 3CMOL 4HWZB 4I48A 1KXVC 2D9QB 2WANA 5T1LD 4V2BA 4JM4H 3EO9H 4ZQKA 4HAGA 2DJ4A 1TTGA 5DJ8A 2NX5A 5D7IA 4PIRF 1J8HB 1OTSC 1NGXB 1Z5LA 3RZCB 4GG6E 1YYML 1MWAB 1WBYA 4YHPB 2NY6B 4QT5B 1WGOA 4LSRH 2XICA 4MNGB 3O6FA 1KNOA 3CUPA 3V7AE 4X7FC 5DFVC 2YS4A 2R23B 2ERJC 5D1ZD 5BMFL 3QHTC 3LKRA 1I9JH 4KROB 1GGBH 4P3CH 1T0PB 2R2HA 3EO9L 1I85A 4LEOB 1YYMH 4TQEH 4YHLH 1BEYL 2ED7A 4GXVL 4HJ0D 2BVUA 3BI9X 2IH3B 3VFPB 1QSEE 4EUPB 2ICWB 4WVRA 4R7NA 1FNGB 4OIIL 3GIZL 3PWVB 1OY3B 3WXVH 2EDHA 3MRFB 5DRWB 4XXCC 4XPAL 5TQ2H 1OP5K 4JQIL 2BY0A 1LP9B 4W4OC 4Y2DA 1TENA 4HWEH 4U6HB 1QA9B 2NCMA 3BHBA 1S7WB 1FQ9C 1CXLA 3WN5B 1XCTB 4POUB 3T09A 3NAAH 3MNVB 3RY4A 1L9MA 1WAAE 3F7RA 5IT2H 5L2KA 3ARDD 2X41A 4HZLB 3CVHB 3IF1B 1CU4H 4UAOC 4YGAB 4R3SB 4QRPE 2Z93B 5KSAD 1QO3B 1CL7H 3KPQA 2AQ2A 2J4WH 4ZDHA 1A0QL 1V3LA 4K3DL 3R06B 3D9AL 1H0DA 5KSUB 3KJ6H 3GSQB 4XMKL 1N6QH 3PHOA 3I84A 4KKCC 3F5WA 3TN0A 3KR3H 1M71B 1XF4A 5L2KE 4MAYD 3IYLW 1U3JA 1ZV5A 1YEDA 3BP4B 3CFCH 4N0CC 2WBJA 4J1UB 2GSGA 3UMTA 2D3VA 4AT6B 4JVPA 2IADB 5KTEL 1YQVL 1JCKA 3W9EA 4GAYB 4LIQH 1RIHL 2BVEA 1LEKB 3G08A 5GGVY 5C0JB 2QJDA 3VXOB 3HCVA 3RDTC 5K9QG 2X4PB 3VFNB 4BKLB 3GK8L 1B0RB 4NKDB 1EVTC 5ID1A 3OJDB 4NQCA 1BJMA 2FX7H 4KVCL 1PG7H 2P5WB 1MCEA 1PZ5B 4LL9A 1T2XA 2NY7H 5A43C 1P7QD 5TE7L 4LCWA 1XR9B 4Z77B 3VWKC 4G5ZH 3S8WA 3IFOB 4MAYB 5B8CB 3U83A 2BOBA 1U3HD 1LO4H 1K4DA 5F3BB 1JPTL 3KXFA 2K7PA 2GW5A 2R1WA 3SDAC 4P2OB 4DGIL 4XBGA 2FR4A 5BOZG 1WTLA 1WWWX 2ZCLH 1KFAH 2NY0D 2FJFA 1TETL 1W72A 3ET9F 4NWUH 3QIUD 2ED8A 1AP2B 1JUFB 1YEKH 1P4IH 4A6YB 4M1GH 4EOWL 1JHLL 2X89D 5MI0B 4RGOH 1H8OA 1EJOH 3D2UB 4JHAH 4G3YL 5C6TH 3DSFL 1CD1B 1L9NA 2A6JA 5SWZA 3SCMD 1UJ3A 3KPOB 4F7PA 5T1DH 1MUJB 3LZFL 1IM3B 4OFYD 1DQQB 5C07D 3HC0B 1I9EA 4PLJD 1VFBA 2LU7A 5DEFA 3WHE0 3W5NA 4OLVH 4XPGL 3QDMD 1NEZB 5A16B 1SYSA 1HOCB 2A6KA 4PPTA 3CDCA 5FM5M 5KOMC 5C08D 3DXAE 1IC5H 3Q0HA 4WTWA 5FV1L 1G0XA 4OV5A 3VWKA 4JFHD 4PJ5E 3SE3A 4LLVA 5E7FA 1SM3H 3QEGL 2C5DC 4HSQA 4NC2B 2VLME 4FQ2L 1U3HC 3QJFB 2E9BA 5IQ9A 2RCSL 3C8KB 1FL5A 5AD0B 3DTXB 5FOBA 1ADQL 1MY7A 2FBJH 4OQTA 3T3ME 4QXUL 4XWOC 3MYJB 1T1ZA 5JHDD 4XCNA 5IGXL 1N0XH 3GKWH 4H26B 3DUUB 3P9MB 3S3SA 5JUEH 3I75A 2FCBA 1KCRL 1M7DA 2APBA 2H26B 5F71A 1U8MB 3IRZA 3QIWC 3EYQC 3L5XL 1NANI 4QY8A 1B2WH 1CXHA 2AXJA 1Q38A 2ICWI 1LO5A 1P1ZB 1VENA 3V5DA 1QBML 1DE4B 1MFBH 2E5EA 3DNKA 4L8SC 5D5MA 4PRBB 3U4EB 4Y5XA 3T4YB 3QSKB 5HYEA 1N3NB 1WCBA 1ACYH 4CU7A 2R69L 4X7CC 5D71L 5I1HH 1FFOA 3CFCL 3RVUC 2IGFH 4XC1H 3BDYH 4UQ2A 5MENA 3ILQD 1BVLA 3KPSE 5HVHC 4Y5YB 1U8QA 2MPAH 3OKMB 3MRDB 2IQ9L 3QXWA 3WNOA 5HY9A 2VL5A 4ZS6D 2BFVL 3PWPE 2HFTA 4X6FA 4J3TA 3CSYA 3IFLL 5GHWH 2ZUYA 1GH7A 4H1LG 4I2XE 3WJJA 4N5UA 4XH2B 3QQ3B 4IRSC 1J1OL 2WM0A 3O2WL 4ZPTA 3KDMB 3WO3B 3IETB 2LE9A 3OAYK 3VXMD 3BMWA 3SQOH 4PRIA 1GHFH 2F5BL 3PL6B 3IFPA 5DHXB 3QG7L 1ITCA 1UB6B 3LS5H 2O5YL 4XAWH 5DRXB 4GW1A 5EUOA 3RL1A 2CIIA 4KKLD 2PW2A 4RGMB 1QP1A 5T1DL 4OZGE 2NMSA 1IC7H 3TZVA 3UTOA 1F3JB 3ZKMC 3DV6A 4L5FH 2F53D 3I50H 1HWGB 4WI8A 4IMKA 5DA4A 4TNWK 3N06B 5E6IA 4HS3A 2VH5H 5J56B 2NX5D 3S4SA 3FQRA 5GGUB 3OXSB 4HS6A 2W0FB 1XR8B 3FQWA 2KPNA 5C86A 4JFDB 3V6ZA 2RAMA 3OJVC 4ALAL 4CJ1A 3OGOE 1J1XL 3OHXB 1JV5B 3DX9B 4IOIA 4KKAC 4H0GA 1IGCH 4KI1A 4MDIA 3GMMA 1MHHA 3MV9D 1R5IA 1G7HB 3TBTB 4ACPA 1XGUB 1MIEL 5JXED 4RFEA 1IBGL 3OB8A 2PETA 5JOFB 3UPRA 3O81A 1Q9KB 3T0EC 1T83C 3PXHA 4XPBH 4XPFL 2E6QA 3KXFE 1FVDA 2DQCL 3V4VH 1VFUA 4AG4H 1AJ7L 3BGFC 4WIQA 1I1AD 2OI9C 2VR4A 5FV2A 3R0MA 3LRSA 3QIWA 3EOAA 5IVNA 3BESR 1WAAA 4WW2C 1DBML 3L7EA 1FGVH 1NCWL 3RX5A 1YUHB 3HZYA 4JRXB 5IBTH 4NM8L 4ERSL 1QQDA 4LLMA 1HIMH 1Z2KA 4CVZA 5EG6C 5BJTB 3D5OF 4UDUB 1I3VA 4GRMA 5DK0B 4DKFH 1D5XB 1DBAH 3Q6GL 1CGUA 1XAUA 2VDQL 3QUYA 4OZHB 4Q6YA 4QCIB 4KUCF 2QADD 4TSCL 3ZTJG 1I7ZB 3MRIB 3O6KH 5K9OA 4LCYB 1FG9C 5CEXA 4BSWA 3LIZH 2EKSA 3GHEH 1DN0A 5AYUH 4LASH 1BBDL 1QRND 5EC2B 1QFPA 5DSCA 4X9FA 2HWZH 4O51A 4LSTH 3D39A 3WUWA 4Y16D 5I8KH 2HT4C 3VD3A 1U92B 2LU4A 5GZOD 1Q9LB 1NCAH 5E4IA 3L6FA 3HNTH 4JZNB 1KCVH 2DQDH 3ZZ1A 1I4FB 5I1IH 2ADGB 4QXGL 9CGTA 1A7OH 1F00I 1N26A 1OHQA 3UJTL 4OF7A 3P4MA 1NC4A 5DEGB 4Y5YC 3KPRE 3MXWL 2FSEB 5JIHA 4DW2H 1JI2A 1PVHA 4IRZL 4Q2ZB 3RWEA 5CJOL 1PFCA 1OGAD 4L1HA 3RWIA 1WEJL 3RI5F 2HLFD 3C5SA 3FZUC 3P77B 4FQQB 4C4KT 1CIDA 3RUGE 1TCMA 4PJXB 5ITBL 4OUUA 3RQ3A 1FAIH 4PJ7E 2OXHA 1AIFA 1RK0B 5J0BA 1SBSH 1AKJD 2GJ6D 3B2UC 1HILA 1IGIL 3MLSL 3VFGL 3MRQB 4BFEA 5M94B 3MLTA 1NGPH 1S7VB 2X1QA 1DLFH 2GQHA 5I1JH 5EBWA 3OXRB 3QUYC 1L7TH 3MUGA 3B8SA 3MROA 4ODWB 1JPGA 4Y4KB 4ESKA 2QQQA 4P23C 4LSRL 1K4CB 3TO4D 2IMNA 2GTZB 1EA9C 4PJ8D 1QHPA 2EYSB 3PDOA 4H5SB 1YC7A 2VUOA 2C1OB 1JRHH 2BSED 2F5AH 4KMLB 4Z7WE 1NCTA 1H8NA 4KKBC 2LVCA 4X9BA 1B4JL 3FQXA 5EO1A 1AHWB 4RGOL 2QQNL 2DM7A 2GFBA 4LVNB 4NGHL 3SDCA 12E8L 4OGAC 5FOJA 2FX8H 3UYRL 3K46A 3V79C 1PD6A 4WI7A 4LSDA 1J0ZA 1X5FA 3BQUC 2X1WL 2NLJA 5CBEB 2OL3B 5TFSH 1BFVL 3BEVA 3PHSA 5FUZL 3WIIH 3AAZB 1RSFA 4OQTH 4DQOL 3UX9B 3EFDL 1D9KA 4UQ3A 2C7UB 5LXGH 1KLGA 4L29A 4ZD3L 4PREB 1S7SB 3LIZL 5DURB 3BYTA 3CX5J 5C0AE 2VRAA 3T8XA 1AXTL 2VDPL 4KKLC 3U36B 5T33H 3V4VL 4KTDH 1JRHI 2Z31B 2YEZB 1MLCB 1BFVH 5D7LE 1ORQA 5E9DA 1G9NC 4PLKD 1J7VR 2UYLB 4OCLC 3FT4B 3VCLA 4NFCA 4OCSL 1ZTXL 4CDHA 4PLNC 2F74B 1VACA 3STZA 5FB8B 1KT2B 3KVQA 3RKPA 4AY0A 4LBEA 3OKEB 3GJFH 4L1DA 1IILE 4Z78B 4J3VA 5CUSH 3KLDA 5E9DE 3GMOA 4RZCB 1L0QA 5HYFA 4MNQA 1HEZA 1HSAA 1KEMH 3D48R 1ZT4A 4JGUA 2DJUA 4LSUH 5A2FA 4R2GB 3QDHA 1X5XA 1IL1B 3LKSA 1QVOB 4XVTH 2H45A 1IGTB 3F7VB 4H8WL 4TNVK 4N5ED 2R56L 2F53E 1JI1A 4JKMA 2HVJA 1OL0A 2A9NL 1KCUH 1TVBB 5KS9A 1IFHH 3RTQA 3VFOB 1L4IA 1MCIA 3K0WA 1SBSL 1MFDH 1RIVH 3CFIC 1R5VA 4IRJD 3Q1SL 3NFSL 3PWJB 2DTSA 1JGLH 3PGFH 5D7LD 5ESAA 2VXUL 2JJVA 3UBXB 2AK1H 1GIGH 1JP5A 4RSVA 4BYHA 1P4BH 4OD3H 5SWQA 3X3FL 4FP8H 3MUHL 4WHTB 1X5IA 3X12A 3OBAA 3M17B 1Q94B 4XBPB 4PJEF 3FQNB 3L3IB 1Y0LB 1JGVH 5H2BA 4WRLA 5CHNB 1AQKH 4HCRL 2X40A 4ODXA 1D5IH 3TN0C 1A2YB 4D8PB 2OJZL 2DYPB 4MSWA 2VDRL 3STLA 5B4MC 2GJZA 2VXQH 2I25N 5GGTL 4GBXB 1U3YA 3TO4A 1JGDB 2Y4SA 4NPYA 4R26H 1KTRL 4G6KL 4O5LH 1CBVL 4Y4HB 2R4SL 1JHKL 3KYKH 4RAVB 1H15B 4F7MA 4P0DA 5HD8D 1HYSD 5DD0L 3F12A 2PYFB 3LHPH 1G6RL 1NGPL 2P48B 4PJ7B 1LEIB 4MD0A 4G3YH 4Z7VF 5C6TL 3QPXL 5LXGL 4UDTB 3LPWA 5DJYB 5E8DL 4WUUE 4JDVB 3G5XA 3VGAB 4MNHA 1N7ML 1FZJA 2BRQA 5FYKH 2W91A 4ALAH 3ZKQD 5J8OA 5C09B 4QTHA 5KZCB 1K6QL 2YBRA 1SVZA 3HNVL 1CDJA 3A6OA 3WXWL 3O9WB 5IQ7L 1RI8A 2Z35B 3CFBA 2AK4D 2JIXD 3GDBA 3QRFM 4F7EB 4TVSa 4P59H 2Q8BH 4IIQC 5IM7A 2CKBH 1KPRB 4X98A 3VXUB 5KSBE 1KB5L 1KIPB 3ARQA 4GAFB 3K80A 3BD4A 4GOSA 1MFCH 4ZXBD 2XT1B 1ZA6A 1W0VB 5E6YA 2F8XC 1IVLA 3MOQA 4UUJA 4OM1L 3BAEH 1YZZA 2HFGH 3C09C 3VXSE 5C0IB 3HRZB 3IDGB 3WN5C 5E94A 2V9TA 2VXSH 4NQSB 5MP6L 1A3QA 3O3EA 1FNSH 3H0TB 1GRWA 1MF2H 3ARDB 3V52L 1DBKL 5DHVA 3ILPA 5TE6L 1GZQA 3LN4B 5J6HA 3RX7A 1MJJB 4JJHA 4U1KA 5CFHA 3QDMB 1RJLA 4ZSOA 3UBXI 5EU6A 2FBOJ 4OGXH 3FL7A 3UJJH 4EDWL 5LGHH 4NZTH 3MBXH 2VDNL 1EBPA 1RU9L 2Y1VA 4RMWA 4NQXA 3ULSA 4TVPL 5EWIL 1V5JA 3WS3A 1KN4L 5F9JA 4NKIL 2GYSA 4TTDD 3JV4B 3TV3L 1S3KH 5E99L 3L3HB 4YC2B 5BXFB 3N1GC 4F33A 2FLRT 1AXSB 1CXEA 1I8KB 3QA3B 3O2DL 5BCAA 1MCLA 3KPRA 4URTB 1CD0A 1C7SA 1ES0B 2QADC 3DV4B 3QQ9C 5CCKH 2EDWA 2MHAA 3CVIH 5DVNA 4XXDA 1XF2B 2CMRH 2XQBL 2VLJB 5MHSE 3FZUD 1RZIB 5D7SH 3FOLA 5GS1A 4DTGL 3HE7A 3HB3C 1KJMA 3IDNA 3TH2T 2VJXA 1D6VH 1X5KA 5I8EB 2DI7A 5I8CB 4ONGL 1SJHA 3HS0B 4BFGA 4G6KH 1NLDL 2VDOL 1MWAL 2F53A 2VXTH 1I9RH 2X4QA 1T0NA 3DX7A 2BNRB 2K9UA 2QSQA 1KGCE 1U91B 3H3BC 3U48A 2FZ3B 5CZVL 1V7NH 3Q5TA 5HYSA 4OLXH 3UYOD 3D25A 4NIKB 1A6WL 4NP4H 1A7NL 1F11B 4MAYC 5DD6A 3MV7B 1EX0A 1S9YB 3GO1L 4KJQC 3SKOB 4R4BA 4O4YL 3G5ZB 3GM0A 3RU8L 3S36L 1B0WA 3DROB 1BZQK 1A3RL 5FHAL 1OOAA 3KJ4C 4QXTA 2W9EL 1GGUA 1KN2H 1WUNT 5K33A 1D5ZA 5FYJL 3MV9B 3W39A 5D6CA 4CADA 4UTAL 4DGYH 3HI6L 1PAMA 2EXWD 4RGND 2HH0H 1PKQB 4GKOA 4HIEA 2BNRD 2R1YB 4D3CH 5ECJE 3WNKA 4MA7H 4OT1L 4KK9C 4J3UA 3GRWL 4HUWA 5KJRL 4OZFB 2HJFA 2APWA 4POYA 2XA8H 1RZJL 2P5EE 4UAOB 4BQ8A 5BV7B 4YHYC 4W68A 5ADPH 4PJGE 1NQBA 2MNUA 1J1PH 4HUUB 4YGVB 1AGCA 3MA9H 2HVKB 2XTJD 1BQHB 4WUUB 3E6HB 5I1LA 3WHXB 4R2GC 2X4OB 4FQ2H 4M7ZC 1CF8L 4FFZH 5HHMD 5JO5B 4MAUL 3T0BA 1KN4H 3H9ZA 1QBLH 2MJWA 1WBXB 1JL8A 5GJSH 3IVKB 5HYIA 5ABDE 2H32A 3TV3H 1BM3H 4NZDA 2Q76A 2J2ZA 3U4BH 4F58H 4GG6F 4GT7A 1E28B 4WEMB 5DI8A 3G9AB 1GGIH 3BUYB 3VXNB 1OQOA 2GAZB 4M43L 1HDMA 5HI5D 1ZTXH 4ZFOL 1ZHLA 1H3VA 3SPVA 2HLAB 5IIEB 5B4MD 4OLVL 4XHJD 2YD1A 3TJHD 4NOBA 2BCKB 4ZUSB 1NUFA 4M7LH 2NYYD 4LSPL 4OLWL 2CKBB 4DTGH 4NQTA 4F9PA 1CIUA 4L8SA 4EN3A 1MF2L 1MEXL 1VHPA 4P5TA 2EXYC 4X6EA 5HYQA 5F7KC 2CIKA 4CN1A 3BP7A 5HYSG 3B2VL 2OTWB 1MHPL 2VDLL 2D0HA 4S1RL 2C3XA 1JHTB 3JZ7A 4NN7C 2AJSH 2WV3A 3QR2A 3DIFA 4QEGA 2X70A 5DYOA 3QXAB 4Z0XB 5DRZA 3QUXD 3RX8A 1T4KA 1X5LA 4APQC 5IEHA 4ODVL 1N5YH 2H8PA 1LO2L 5C3LD 4NCDA 4Z7UB 3UJIH 1A4KA 2BX5A 4WHYH 2Y7QA 1XZ0A 1I1AA 5FA3B 2DN7A 2IBZY 3KS0H 3RY5A 2VC2H 3DGGA 1IC4H 1U8HA 1EIBA 3RHWK 1HK6A 1DTUA 4OD3L 3V2AR 4BSVA 5GS0D 4LSVH 4AIXA 1MCOH 5CD3B 4OFYA 4JRYD 4JY4B 1U93B 1HINL 2ATPA 4TSBH 1BX2B 3I6LE 1NC2D 3D39E 1V3KA 4HK0B 2ARJA 4MD4B 4UBDC 3E2HC 3REWB 4I1NB 4OGYL 2JF1A 3CCHA 1ZK9A 3OKOA 4CNIB 4HUVB 3ARBD 2WBWB 3LN5A 5I6XB 3ZLQC 3PDGA 5JZ7D 1IAKA 3BO8B 4F7CA 4BZ2H 4FQ1L 4FQJL 4H1LH 1P7QA 4GKSA 2VXQL 2IBBA 3EDDA 3BXNB 2F8VA 2BNRE 3M1BA 1KIQA 3RWJA 2YD4A 4LPCA 1NGYA 1HZHL 5I1CH 3WLBA 2NTSP 4C54A 1ZGLB 2BMKB 1CLYH 3T1FA 4D9QD 3KG5A 3K1KC 1TJHH 2H3NA 4XCCH 2DMKA 5ID0B 4NGHH 4P46D 3P0GB 2BRRL 3BP5B 1A1NB 3OGCB 5E8PA 5GSRB 4ZFFB 4OCXH 4FQ1H 1XIWD 3IDMB 4JFDD 1AKJB 4HWUA 1MAMH 2FWOB 4PFEA 1YPZA 4XVJL 5BVPL 3HAEB 4TVPE 1N7MH 1BIIA 4YO0A 1II4E 4HULB 1U3HB 3KPLB 5IFAH 3ARFC 4OLZL 2F58L 4H1LB 4ELMB 1MAJA 2B4CH 3FT2A 1K3IA 3EDJA 5ICZB 4LPVA 4B7IA 3CMGA 5EU3A 1YJDL 1R3IH 4FFVC 4LPTA 1ED3B 4PJAA 5KVEL 2ZPKL 2BRRH 5D2LB 3DSFH 4L3EE 5L8LB 5CKGA 5I2IB 4P2QE 5HGAB 4LVHB 4X5WB 1GVIA 1UENA 1HQRB 5FDWB 5C0RH 2VERN 1AGDB 4JLRB 1FYTA 5KVGH 2P5EB 3S5LB 4ZUVB 4Y88A 1GC1C 2XRAH 4NDMB 4PJIF 2AGJH 4S11A 3OF6D 4APQA 1JTTA 5JOPD 4GRWB 1ZOXA 2A77H 3P0YH 3V0VB 4M4RA 2DQUH 1KC5H 2NY4C 3QEQA 5C9KA 2Y6SC 2A6DB 4WHYG 5EORH 2DLEA 4FZ8H 2FEEI 1F6FB 3TA3B 5LGKA 1XF1A 3NIDF 4JQXA 3QUXB 1J0KA 5I8KL 4UIMA 1BGXL 3H3PH 4HIXH 1XF3A 1OTUD 2PW1B 4ZO9A 3IDIB 2I27N 4MD5A 3QZWG 4WUKL 1CDCA 3OAUL 4LCWE 3IS0X 2J8UE 3I9GH 3EYSH 5T1KD 4KJWC 4NUJB 3T65A 4FS0A 3P3YA 2UZIH 5D8JL 1YN7B 4PJHF 4TSBL 1QOKA 3BISA 4E41B 4HPYH 1A3LH 4QRUB 1N2RB 3GSVA 5MERB 3RPKA 4PJDE 3MRBA 4DN4H 1BQLH 4KMTL 4PGCA 1A6UH 1RJCA 4JFQA 1C5DB 3C9NA 4OCMC 1A6AB 2Y5TB 3S36X 1MCSA 4LDLB 2XOTA 2F54A 5EOTA 1E4WL 4U3CA 1T22A 3WIFA 5DLML 4LVNC 1A3LL 5BVJB 2VDOH 4X4ME 2F19H 2MKWA 4FMFA 4O9HH 1UCTA 4J8RB 3LD8B 4GG6A 3BPLC 2NR6C 3QXTA 3GBLA 4O2EA 5GGQL 3RA7L 1WT5A 3BVNA 3GMNB 5TE7H 5I1IL 3TFKD 3SOBH 4R9HA 5JHDE 2EE3A 5IESH 1JZ2A 3L5IA 4C58B 2VABA 5CSZB 1EFXA 1WWAX 4QHUA 1IGCL 4NQDE 1CBVH 3HI1A 5FA4A 2XV6B 4WO4A 3CXDH 5MERA 4P9ML 1UM6H 1OAXH 2R1XA 3K2UL 4JO2H 5K93A 5I19H 1KN2L 4Q58C 4ODSH 5HHXL 3QIBC 2X4NB 2R2CA 1U3ZA 3S5LG 4PJ5A 4EDXB 4UT7H 4MD5B 1JZ3A 5EOCH 2GKIA 1MVFA 5D1XC 1R3HA 4M6NH 5DJCA 1OAXL 3CJJA 4JG0L 4OZIA 1EEQA 4G43B 4RGNB 2A6DA 3VRJB 3SQBA 3FOMA 5HHMB 3O4LA 1FV1A 4C57C 5DJ0B 1BF2A 2DD8H 1AC0A 4RWHA 3K7UA 2VDPH 4MQSB 1A5FL 4ISVB 1QRKA 3MCKB 2R4RH 3M8OH 3VFUA 1YEGH 5D1ZC 2X4TB 3JWDL 1W0YT 5F8QC 4JRWA 4G8IA 2BSRA 4ZUWB 4WUKH 4JY6B 4K71C 4HKBA 4EZMA 3NZHH 3TO4C 1ZT7A 1FHGA 3GSUA 1T80A 4XMLL 2O5ZH 4R7DB 3DX8A 5J6GA 3TESA 5I73B 2Q20A 1RHFA 4P2QB 3HMXH 5DJ2B 5IW6A 5A2KH 3TIDB 3VH8B 2QKIA 3BPNB 4OZHF 2M26A 4YHKH 3W0WA 2V7NB 2O61A 2PCPB 1ZLUK 5KW9H 1O7VA 3HE6C 2NXYC 4I18B 5D96B 5IMLA 5ID0A 2AEQL 2FECL 1S7RA 2H3NB 3MLZH 1N64H 5IW1B 3DX6A 1KIQB 3RWJB 3HKFA 5E1AA 2C4FT 4U1JB 1EUUA 3BXNA 5TQ0L 3PQYB 4WFHE 1TDQA 1WWBX 5KSAC 4PJ8A 4L8CB 1KG0B 3ROLB 4NC0B 1WF5A 1ADQA 2UV3A 4IEFB 3RNKA 5JIKA 5B39B 1IAKB 3BO8A 2PTTB 4PB9H 4F7CB 5GGSA 4QHLA 3G5VA 2P8PA 1S9WB 3V4UL 3RUGB 5EZLA 5D7IF 3FN0H 3WUZA 1K5NA 3REWA 2PYED 5FDYA 3MRHA 3U30C 4HJJH 3B6SA 3QI9B 4LNRB 2IPKB 2V17L 3BKJL 4LMQI 3LSOA 4Y19B 3RKDC 2RGSA 5DC4B 3NIFE 4N0UB 1T2QH 4KZEH 4PJFA 3ARGA 2FD6H 3UDWA 2B2XL 3DGGB 3DMMA 1LILA 4OKVB 4DKEL 4UT9H 5C0AB 2EEBA 3CH8A 5FF6A 3OB0K 4K3JL 1UEMA 1A4KB 3NCEB 5FYJD 5INDB 2E9JA 1C8PA 2BHYA 4HLJA 1QHOA 3KPNB 4QOKD 2V9QA 3GMPA 2IPTH 3LEXB 4EXPX 3RZWA 3MLYH 3L95A 4QTIL 3MR9A 4R90H 3QUKB 3TWCL 4JN2A 4I8DA 1NC4D 1CE6B 3VGFA 1AGBA 4RNRA 4IOFD 1A7QH 1QLEH 4HF5L 2NTFB 3ARYA 2OTWA 1RD6A 2R0KH 3TPKA 2XQYK 2ZOLA 2CIKB 3ZMRA 1G6RB 4X6EB 5DD5L 5HYJA 4WEBL 1FZOB 2EYRA 5F1SA 3Q3GA 3F7YB 4CVUA 4L4TA 1FVCA 3EYUL 4L3CA 1LGVA 3ALWA 3P11H 2NY1D 4ZXBC 5EIQA 3INUH 5IR1A 2A1WH 2OR7A 2VDKL 4FQIL 3KYAA 5IIEA 2V2XB 4I0KA 5IG7A 4K9EH 3MPCA 2VWEC 5JZ7C 3C2AL 1U58B 3QQ9D 1YMMD 1I7RA 2D03L 3DI2B 2GEEA 2DLFL 4FZEH 5CJQL 4X5XB 4GKNA 1QSFE 3DVIA 1AI1H 1CTOA 1QFWI 5FYKL 4LVOB 3AM8C 1M05A 3MOAH 4UNUA 3MMEA 3QQ4B 3MRMB 4NZJA 4M61A 2XXCB 2EC8A 5T3ZE 5F9OH 4I3RL 4M43H 1QSZA 4XVUC 1U95A 1QFUH 1NC2A 3PWPA 4YGVA 1PLGL 3S98A 1PX4A 4XNXL 4P3WA 1I8IB 2A2QT 2XY1A 4RFNB 4TVPD 2YA1A 5CJQH 5FHBH 4EBQH 3QIWD 3QO0B 1KTDB 1JWSA 5F7LB 2JB6A 1F4XL 4RAUA 4HXBL 3BRGC 4JZJC 5KAQG 4JO4H 4HUWB 3IRPX 2FO4B 2YWZA 3TCXA 2VQ1B 2W0KA 3HI5L 3X3GH 4AH2B 5HHOA 3SDAA 3RDTA 1E6JL 3UC0H 1NFDA 2XA3A 4PV8B 5GS1C 2A74A 3MO1A 2WIMA 3MV9A 1FL6A 1EAPA 1XT5A 5EN2B 4YDKH 2FDBP 4P23D 3VWJB 1U8IB 4O2FB 1T0MB 3HR5A 3GMQA 1ACZA 1C12B 5F6IB 1UFUA 3DXAD 3O3AB 5FYKD 1AE6L 3BWUC 3TO2B 1S78D 4Y5VB 3ULUF 3GMLB 2B5IC 3TLRA 4Q9RL 4O2CA 1F11A 4OGAD 1IC4L 1T21A 2Y6SD 4Y4HC 3D25B 3ARBB 2CO6B 5DLMH 1VEOA 2FZ3A 5C6WH 3C5ZA 3NCMA 4R26L 4JFOB 4XHQA 5C8JA 5FKAB 3G5YB 5DZOA 4YX2L 5D6DA 3GGWA 5KAQF 1CDBA 1KB9J 2AVGA 2CR3A 1Q9WA 2P24B 3C6LB 3OG4B 3JVGA 3RY6C 3VFTB 3KPSA 2V17H 1OWRM 2FX8L 1ONQA 4WNQB 3HE7B 1NGQH 2KZWA 1I1CA 4IRJC 1OGAA 3OPZL 3D69A 3W2DL 43C9B 4XXDB 5F96L 4TSAL 1LP9F 2MHAB 3LB6C 3F7QA 5I1GH 1ES0A 3CXDL 4MXWH 3N50A 1N5AB 4AM0B 1HH9B 3T2OA 1J18A 3CZJA 2AK4E 1NJ9A 1TZIA 4GAJL 2DL2A 4RFOH 5D7IE 2R0ZL 1DQJA 5D2NC 3ZKSD 4B5EA 4X6DF 1FNEB 5TPWL 1Q0YL 1I7UB 3ARWA 4M6OH 3NVQA 3MGOA 4G8GB 8FABA 1A1MB 2MOVA 5JLZA 2MCG1 4KUZL 3TM6A 4X4YB 5MEQA 4L4VB 3GB7B 3VXUE 4HKXA 1HXYA 5I9QB 3U0TB 3GI9H 5KSBB 5GGTA 4NQED 5DHVB 3IU4L 2GK0B 3ZDYE 2ITDB 2PO6C 4KC3B 3H0TA 3O3EB 2YZ1A 1J87A 4K94H 1BQHG 2D7OA 2ZNWA 4LGPB 1IZKA 3IDGA 4IRSB 3P11L 3U46A 1A7RL 1KJ2A 4UBDD 4XP1H 3MCG1 3B83A 3BOVA 4P46B 5FECB 1EEUA 1ZLVK 4BUHA 5E4EB 4FG6D 2BVQB 3CSPA 4NRYA 4PB0L 4L8DB 3WL9A 4NJ9L 5FGSA 4G9DB 2GITB 5TDNB 2XA8L 1KIPA 4LSPH 5J1AA 4TQEL 3T2NH 4X98B 3VXUA 5CINH 4S1SL 4JZOA 4MJIE 1UKQA 1P7HL 3UZQA 5T33L 2X9YA 4CMHB 1A1OA 5L7XL 3G04B 3H9SA 5AUMB 1OLLA 1SJEB 5C08A 5ICXA 2PTVA 5JMRA 3DOSA 3X14B 4LEXH 4MCZB 5K59E 1E6OL 4PRAA 4OM1H 1FO0B 2E7BA 1AY1L 3FJTA 3P4LA 5KN5A 1KB5A 1FE8H 1EVUA 2CRMA 2OQJB 4MAUH 2KUTA 3D18B 2ITCA 3V95A 4PS4L 1FVEA 2Y25A 4QLRA 5CUSL 4LKXB 5T3XL 1FYTE 4GG8B 3QDGA 4BFIA 1DUYB 3ECBB 2PYFA 3F12B 1DDHA 4HWBH 3HI5H 3X3GL 4GH7B 1A6ZB 1H15A 4I5BA 3GJEA 1Q72H 2QR0B 2NY2B 4XNQA 3QDGD 4O58L 1Z9LA 1SYVA 4E42B 2DQDL 2DWEB 4PJAE 1OB1A 1V7ML 2GJZB 1MCPL 2B5IB 5C0EA 4D8PA 5GRJH 1A2YA 5I76A 3SE8L 4ODXB 5IF0B 4PJGB 4NQCD 3HE7D 1AE6H 5EU7E 2B1AH 3KYKL 4OJFH 1YPZE 5MEOA 5SV3A 3RVXC 2CMRL 3PWPD 5C0FB 1T03L 2HT3D 4LPUA 3PWLA 1OAKH 5ALBH 3MUJA 5CIPA 5E5MA 2WWMC 3PF2A 1T2QL 1RIHH 2CLZA 4KZEL 5J3HD 1DR9A 4PRID 1OAYL 1NAMA 3O0RL 5FUOL 3D1MC 1QSEA 3CH1B 3MBEC 4J4PD 5E2JA 1PSKL 1JPSH 4K7PH 2Z91A 3AS3A 3BPCA 1I1AC 3O3UN 3T77B 4FA8A 4FTVD 4GO6B 1CL7I 5IVXB 4ETQB 1XGQA 4LVOC 3TBYB 1OCWH 5C0CA 1ORSB 1T83A 3BIKB 3P4OB 4MCYA 3RVVD 2NY1B 1ZT4B 1LO4L 1CR9L 5MHSD 2VR5A 4Y8AA 4DCQA 3MLWL 1JK8A 2I9TB 3EBAA 4NKOA 1I1FB 4KZDH 2HLFC 2JCCA 4I9WD 4Z78A 4WW1A 1E0OB 4GG8A 4WV1C 1OF2B 3BH8B 4PGBA 3KNBA 4WI6A 4G6JL 4XPTL 3M8OL 1ZGLM 2PO6B 3D18A 5TGBB