1OPGL

Opg2 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
DELLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGGGSKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords OPG2 FAB (LIGHT CHAIN)
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1995-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL01
4LSVL 4IIQB 1HE7A 4B53A 4K71B 2UZXB 2QQLH 5L6YL 5JOPD 1U8QB 1QBAA 5D1ZA 1Q8MA 3W2DL 5DURD 1U3YA 1XCTA 2ITDB 5D7LB 3NFSL 3WD5H 4GG6A 1A5FH 4F8TA 5GSVA 2FWOB 2CJUL 4YZFE 5DD0L 1I1YB 1JVKA 2I9LB 3C2AL 1K3IA 2GI7A 1T89A 5D6CA 1M71A 4HC1H 2DM3A 2E7BA 2VABA 4K2UL 4R4BB 1XR8A 4X6DF 1RUQH 1JPFA 4HJ0C 3EYVA 1BD2B 2VLMD 5FYJH 3KAAA 2B20A 3QIBB 4QXGH 5E08L 1IC4H 5FHAL 1U2CA 1VGEL 3ARBD 4AIZB 4L29B 3P3YA 1PQZA 4ZDHA 4ZAKD 2Q1EA 3WIHH 3BAEL 4PP2A 3H0TB 3SQBA 4XBPA 1ZS8B 4GKNA 4WI4A 3OXSB 1RZKC 3O45A 2V2WB 1AGDA 3KPSB 5JOEA 1LE5A 3TIEA 4NUGH 3O2VH 1LO3L 4H8WC 3ECBB 1GXEA 2LAAA 4JPWH 2APXA 4A2LA 4U0RC 1GL4B 5CSBA 1QNZL 1RZFL 1F6AA 2F54B 1KN2L 3IDNA 1ZEAL 3DO3A 5JO5B 4XNZB 5DEGA 1X44A 3BH8B 5DQDL 5IROA 4B7LA 1JHKH 3GBNH 4KY1H 2R0KL 1XGRA 1ZAGA 2OSLB 5T1KA 1KEGH 3NA4A 4OCXL 3DRTB 3MFFB 4KJWC 4S2SA 4BK5A 5D71L 5FGCB 3L7FB 4FFVC 3BHBA 3MJ9H 2OZ4L 1HKLL 4LVEA 1B0GB 4ELKB 1CBVL 2NY2B 3EO0A 1AD9A 5CKAA 5AZEH 4HAGA 1IGML 4WFED 1QYGL 1YNTA 2LVEA 5IB3B 5IMKA 2CGRL 4HIEB 5FECA 2I60H 3K0WA 4QO1A 3WFCL 4X6DB 1F2QA 1T2XA 3EZJB 4L1HA 4KK8D 4NO0B 1H3VA 1YY8B 4XPHH 2IANE 2DQUH 4OZIF 2P24B 4M62L 5E6ID 2H26B 1CI5A 5EZJB 1SEBA 5IFJB 4N0CC 5IKCB 3V5DB 3BT2L 4BK4A 2RR3A 1F3JB 1IZKA 5MI0B 1JIBA 5I6XB 4JFHE 4ZOBA 3P77A 3EYUL 3DURA 5IESH 5LG1A 5T3ZH 2ED7A 4L4TE 1J0HA 1J11A 1MWAL 3MOBL 2Q87A 2BVYA 5J57B 2FX9H 3JBG7 4HBCH 3CFBA 1M7XA 4Z5RA 3QXTA 1YUHA 2R1YA 5DMJB 4M7JH 1OWRM 4E0RB 2EEBA 3OV6A 1Q94A 3QFJB 1GSMA 4BFIA 5D96B 4IJ3C 4XAKE 4OGXH 1A64A 3T0EC 1DBAL 5T33L 4Y4HB 4UQ3B 3HUJA 4PGBA 1CFSB 4HQQH 1R6VA 4Q9CA 2IGFL 3HMWL 1B4RA 5C0JA 2JLLA 1INDH 4MNQD 1FZOB 4PRPA 1LO0L 4HKBA 5IB2A 3MOQA 3QNZB 5F44A 4DK3A 7FABH 1KACB 1MJJA 1A9EA 1NBYB 1ZA3A 4OZIB 1S7TB 4HIIA 4Z8FH 3JTSB 4I0KA 3PWLA 1DFBH 1PKQA 4J3OC 3QFDB 3IDGB 3SE9H 2C4FU 4EDWH 1OGAE 2E9BA 5ICZB 4ZTOL 4XMLH 4XPTH 3S97C 1DTUA 3SY0A 2NYYD 5C92A 1JTTA 3D69A 3BKYL 4MJID 1OTUC 3KPPB 4NRYB 1YNKL 4IRSD 5L2JA 1YECH 1OM3L 3D25B 4D0DA 3D2UB 4Q6IC 1HYSD 1N6UA 2CPCA 3DYMA 2FEDD 3MNZB 4PJIE 2PUQT 3EOTL 1BEYL 1IBGL 5IVZA 5BZDA 1FGVH 3L7EA 3PNWA 4PGCB 3VXRA 1QFPA 3EZ8A 4XNMA 2JB5L 3RNQB 2ZUUA 3CSYA 3QQ9C 4MX7B 4YBHA 1S7RB 1RZJC 2UZIH 1EJOL 1P4BL 4CADA 4QHNB 3VRIA 3QIUB 4PD4J 4ZFFA 5EH1A 3ETBF 1V7NH 5JW4R 1A7PL 2YXFA 1XF2B 2H45A 2OL3A 2VXSH 3TYGL 2X4TA 3IF1B 3MOAH 4QTIL 3VWKD 3RWCB 4ZS6D 2A6DB 2WIIB 5IB4A 4XXDB 4I5BB 5GS0C 4QRUA 5DRWB 1T3FB 1JGDA 2ATKB 2Q6WB 5E24E 1HH9B 3KYNB 4AEHL 1J7VR 5I1CL 2P7TB 1E6JH 1TLKA 5ANME 5E9DD 5DLML 2N7BA 4MA1C 4QXUH 4NRZB 3OXRA 2NY0C 2ZCHL 5J0BA 1QQDA 1T22B 5C9KA 1AXIB 1RVFH 5IJKA 2EO9A 4G6AC 3GSWB 1U3HD 4LPXA 4WWKA 1XZ0A 1YPZE 3M45A 4AEIH 3MRKA 1OD9A 1ZVHA 3C60C 1BBDH 1T1ZB 5JOPE 4RX4D 4RWYL 3QISA 1N0XH 1MCBA 1QO3B 4KU1A 4LSVH 2O93L 3PHQA 4LMQI 5L6YH 4LU5H 3FOMB 5D1ZD 3NFSH 3ZE2F 2NW3B 1QA9B 4YE4L 5HI3C 5BW7A 3CNKA 3VXOA 3VRJA 5DD0H 2CJUH 1MQKL 3VFNA 3ZKNC 4F7TA 3MREB 3ZKMC 3C2AH 4E42A 3VXSA 4ESKA 4N8PA 3QDJA 3BZ4B 2VLME 4K2UH 2DKMA 2VDPL 3QPXH 3WEXB 3EFFA 3PWNA 5HSFA 4PJXF 5C0DB 2J4WH 1TQBC 5F7EL 5E08H 1DVFA 2ZNXA 2XZCL 4NWTL 1VGEH 3MRRB 4KK6C 4V2BA 5I9QB 4Y2OA 2EH7L 3T4YB 5A2LH 4JVWA 4X4XA 2VISA 3BAEH 4OLEA 1U92B 4F7PB 4DKDC 4KJWD 3EOAB 4JHZA 5IP4A 2M26A 1XGUA 4OD1L 5ABDE 4FFVD 1LO3H 1K4CA 1KBGL 2YSSA 5JHDB 1YMHA 3KLAB 1X3DA 1QNZH 1HH6A 4JRXA 1RZFH 4KI5D 4W68A 1KN2H 2YHGA 1ZEAH 1SBBA 3OKOB 2GJJA 3KPOB 5DQDH 4ZUVA 1MIML 1NJ9B 2R0KH 1HXYB 4R7NB 3IDXH 1CFNA 5FIEA 4OCXH 5CEZD 4YZFF 4X0KB 4LLMA 1U0QA 5D71H 4H1LA 4WFEE 5DJ2B 1X5LA 3V52L 2OZ4H 1IT9H 4DK6A 1HKLH 4JVPA 4HFUL 3DO7B 2C7UA 4N0CD 1IGMH 4KKNA 1QYGH 3V0AC 1EBPA 1SYSA 1TZGL 3MUHL 4JY6A 5C0BE 1FFOA 3QO1A 3TBTB 2BNRD 3WFCH 5IIEB 1QR1A 3CFEB 4PJXB 2XG5A 3KPRA 3WUZA 1MJ8L 4OZGE 4QCIA 4M62H 3RZCB 3MBEB 3LB6C 1FZKB 1N59A 1V3MA 3B5GA 3D18A 4L3AA 3C08L 1X5YA 5GGVY 4K8RC 2P8LB 4J3TA 3BT2H 3IFOA 2R9HD 1R5IA 1OB1B 3QO0B 3DVNB 1S7SB 3W39B 1J8HB 2OS7A 1JBJA 2AEWA 4OZFH 2P43B 4QGYA 3T0ED 1OPGL 4D8PA 4TUJB 4OCSL 4XZUA 5LAXB 3UTQA 5B8CB 5D1XC 5E5RB 2NLJA 2OQJA 5ECJE 1MWAH 1BGXL 4K7FA 2X1WL 3MOBH 1Z9MA 4P3DB 4P0DA 4MA8L 1I1AB 4WI7A 5E2JA 5C8JB 5FO9B 3N85L 1WBZB 1RJLA 1FVCA 2X70B 3H7LA 3BKML 4M3KB 5H94A 1UB5B 4DCQA 4J23A 3DMMA 2FO4B 2PXYA 5T33H 3HA0A 4MNQE 4JFPB 4QHUB 3BRGC 2A6KA 1NFIB 5DHVA 2IGFH 3HMWH 1E27B 3UYRL 3HRPA 4R7DB 4G8GA 3B2UC 1NFDE 1CDBA 4HPOL 1LO0H 5FB8B 4PRPD 2BY3A 5EU6A 2X4SA 3O8XB 5DJCA 5FGBC 1OTUD 4WV1C 4PG2C 5K93A 1BQHG 2OYPA 5ESVB 4Z7UE 5CZXD 3SDCC 4X6CF 4NN6C 4ZTOH 3B9KA 5E5MA 1BWWA 4MJIE 4LGPB 5IHLB 2QEJA 4YPGB 3VFRA 4PJ5D 1MFDL 3BKYH 4KXZH 1JUFA 3BGMB 2AK1H 1BQHB 4Z9KB 5H37G 3QQ9D 1YNKH 3DECA 3GSRA 1OP5H 4Z7VE 2HTLD 1OM3H 2GSIA 1A4KA 3VMOA 5IW1A 3O3UN 1K3ZA 3MLWL 2V9RA 4HHAB 3LZFL 2YD1A 5F9JB 3EOTH 3PWJA 1WIUA 1IBGH 1KIRB 1FYHB 1CXIA 4K94L 3VXRD 3CVIL 5T3XD 2JB5H 4UNUA 3VMPA 1GGUA 4GW1A 5HDQL 4P48A 3HLAB 1EJOH 4EVNB 3QH3A 1P4BH 3HKFA 5GS0D 3QUZC 4DGIL 5L8JB 5EORL 1JF1B 1T5WB 3OB8A 5I8CA 4ZS7L 5ACZA 1A7PH 4FS0A 5CSZA 1VERA 1BVKA 1AIFA 1TDQA 3W82A 4G6AD 2AGJL 4TUOA 4NKOA 4X6CB 3TYGH 2D2OA 1FL6A 3MA7B 4QTIH 5DMIH 1KYOJ 4XNQA 1YDPB 1JV5A 2VWEE 5E9DE 3Q0HA 4NQSB 2B5IB 2Z31B 1FN4B 2I9TA 1F58L 3UPAA 4AEHH 4FXKA 1QSVA 2AEQH 5I1CH 4L4TB 5DLMH 4KJYB 1YMMA 4CN4A 5F1NA 2ZCHH 5SV3A 1OAYL 3MROA 3WXWL 5EUOE 4PJIF 3BPCA 4Z95L 5HYSA 1S8DB 3GHBL 2M2DA 4RZCA 1JI1A 3QQ4A 4YLQT 4WU7A 4D0CA 1R3KA 5C70A 5DJ0A 4XTRC 3P30L 3ZKND 2W1NA 3UBXG 4ODUB 3ZKMD 3TO2B 4RWYH 5CBAB 1J1OL 4XXCA 3RVWC 1RK0B 3SPVB 4U1MB 3SKOA 3X14A 1P7KA 3N1QC 2HA1A 3LSOA 3FO1B 5ALCL 4M93C 4Z7OE 4OLXL 4EQ2A 4XHJD 5IR1A 2CLZA 4GG6E 4HUNB 5FUCC 4YE4H 1MVUB 3TBYB 2DRUA 3UBXB 3FN3A 1NANI 5C9JA 1MQKH 4QEGA 3NIDE 4JFDD 3VXSD 1OGAB 3QDJD 2VDPH 4AH2A 5FKAA 5EB9A 3P9MB 3C5ZC 4P23B 5AWNL 2QTEA 2FD6L 3HI5L 3SGKA 2X40A 1KIPB 3OSKA 5F7EH 1ED3B 4S0TD 1T6WA 4PR5A 2XZCH 4NWTH 2DQCL 3LDBC 4GRLB 4P3CL 3DSFL 3VXNB 2EH7H 2X7LA 1FGNL 4R4FL 3FMGL 5EIIA 5I2IA 4M1GL 4PJIB 4Y4FA 3C8KB 4JFQA 1WEJL 3UTSD 3E8UL 4LNRA 1LD9A 3DX8A 3K7UA 4WTZG 4CUCA 3AXLB 1QP1A 4X6BB 4OD1H 4KI5E 1K6QL 1KBGH 3T3ME 3KDMB 3OJVC 4NNXB 3D0LA 1FAKT 2FR4B 2Y36L 3QA3B 2BJML 4JRXD 1C7TA 2DQFA 4NZTL 3UJJL 2YPLB 5CEZE 5FXCH 4QHMA 1MIMH 3QJHA 1KCSL 4Y16A 5D6DC 4U2ZA 3WE6B 4PGEA 3MV8B 4Y4FC 4WW1B 1GOHA 1AHWA 2DYPA 3CXHJ 3LB6D 3FT3A 4XC3L 5BZWB 4OQTA 4NKQB 4P2QA 3V52H 1OSZB 3D48R 1HHGB 4HFUH 1U8IB 2BNRE 1JWMB 1PYWB 4HG4J 1TZGH 1BZ7A 3TGXA 2IALB 1F13A 3OR6B 4PRBB 4JG1L 3TNMB 1MJ8H 5EBGA 3I02B 3RPKA 3LH2L 4NT6A 4OCNC 5ANMB 2ADJA 2W07A 5SWZA 2HLFD 4JFOB 1ZLVK 5HHNB 2NY7L 3L3OB 3C08H 1TPXB 3IXAB 1L4IA 3SOBL 1BWMA 5DHYA 3T0EE 2BFVL 4G8FB 3DJ9A 4MXQC 1U3JA 4C56A 1A1NA 2IWGA 4Y2DA 4G80B 4JDVB 3LN5B 1OPGH 2N1KA 4OCSH 2VKWA 2ILLA 3U9PL 1QFWL 5DURB 4EN3C 2AK4D 1BGXH 1HOCA 3W9DB 3WFHA 2VDNL 1K4DA 4IOSD 1ND0B 4UINL 4MA8H 3FB7A 2EDDA 1KTDB 3N85H 3G5XB 4ZQKB 3HZYB 3B4NA 1JP5A 4NO3B 4QRTB 3HUJE 4Y2DC 3F7PC 3DMMD 2PXYD 3CDYA 4PRPE 3P2TA 3STZB 3UYRH 1AE6L 4K3HA 2DWDA 2CDEB 1WBYA 1MCLA 3RX5A 4G8GD 4N5ED 1UWEL 2XWBA 1CE6A 3IJSA 3ARBB 1IE5A 2DQIL 4OZGF 5EU6D 1MFNA 1IL1B 4P9HL 3P4MB 5DEFB 3QRFM 2HH0L 1CDYA 5CMAB 3WLBA 1CGUA 1T0NA 4J12A 1PKQE 3FO0L 3M07A 3AREA 4LFHD 4ELMF 1R5WB 1FYTA 5I75C 2ZSVA 4ZUTA 1H3UA 3DV6A 4PJ5E 5DVOA 4J1UA 2H3NA 4Z7WA 3B9KD 3HRZB 4MJ6B 5EU7E 4UB0L 1F3RB 4WDIB 1ZT7B 5ETUB 1DQJB 2CIKA 4OCLC 5TF1L 1MFDH 5E03A 4N9GA 1YQVH 5CGYC 3ZKXC 1NCUA 3PUCA 4GMTL 3QJFB 3AFLA 4HLZG 4E5XA 5TFSH 3HAEA 3I6LD 3U4EB 4DAGL 4QRRA 2GIYA 5D9SA 3MV7B 4PJ9A 5MP6L 1XGTA 4GKSA 3QUZD 1C5BL 4RDQF 3JXAA 5EOTB 3LZFH 1KTKE 3QDGA 3S3JA 2ENYA 1WBXB 4ZUUB 3VXRE 5T3XE 2R2EA 3GBML 2CRIA 1IQDB 1UWXH 4YR6B 5LGKA 2EDXA 4UIMB 4AMKH 3SHSA 1OGTA 3CVIH 3K4AA 2XV6B 1FVEA 1JWSB 5HDQH 3B2VL 5EPMA 4DTGL 2V7NA 2HT3C 1HHJB 4BZ2H 1RHFA 1S9VA 3BESR 3NFPA 4JDZB 3SDDB 1I8LC 1T4KA 4M8VA 2EDBA 4PJ9C 3BFOA 3DBXA 3O11A 1J12A 4J3WA 1D6EA 4NOFA 1U9KA 1QPPA 4OZGB 5EORH 1VB9A 3RL1B 4ZS7H 4F33B 4Z7UF 5LGJB 5SWSD 3PWVB 5TE6L 1MPAL 4OQ1A 5FFLA 4ELMB 3O4OB 4G42A 2AGJH 3WIFB 4ZUSA 4GJTB 1FJ1A 4M6ML 1H0DB 3PGDA 1FO0B 1F8TL 3OB0K 1ZHKB 3GK8L 5CD5D 4GW4A 1KTLB 4RDQG 3E6FA 3RWDB 3F6IA 4DKEL 3FHQA 3JWOL 3KPMB 5DA0B 5HPOA 4Z7VF 2JJSA 4WFHD 2PO6A 2ICEA 3SGDI 4HUXA 5IEKA 1MLCA 4HDIB 2WBWB 4FQHA 1YMMD 1G0YR 4WUUB 3WXWH 3FB8A 1ZVSB 1P6AB 3OKLB 1U95B 3QEUB 4Z95H 3CU7A 1QSED 3GHBH 3FN0L 1XR9B 4AT6A 3SCMC 4WO4A 3ARWA 1PAMA 1DEEA 4KKLC 3P30H 3T77A 5TE7L 4RAUA 4P46B 5BV7B 1D9KA 4W70A 3VJ6B 5ALCH 4D0BB 4OLXH 1U8JA 3IKCA 3VGHA 3T0AA 2BY1A 3CGTA 1HEZA 2AEIT 1OTSC 1F2XK 1CDCA 3D39A 1VEMA 4WO4C 3VXSE 2V7HA 3L3GB 3QDJE 2EDLA 2WQ8A 5CWSB 4Z7UB 2QR0A 1WFUA 1I1RA 43CAA 2DKSA 3BDXA 4OBSA 2D0FA 3U4AA 1ORQA 3CIQA 1D9KC 4WU5A 2XQBH 2EZ0C 3VXUA 1JJUA 5AWNH 3HI5H 4IRSB 4P4RA 1EEZA 4JN2A 2FYYA 3ROLB 2VLKA 2DQCH 5MEQA 4P3CH 2GK2A 3DSFH 5I74C 4Z7VB 3VGGA 1JTPA 3I2CL 1FGNH 3UTSE 2CLRB 3FMGH 4R4FH 2FEEI 4YBQC 1XGPB 3LHPL 1JCKA 4ZOEA 4AK1A 3OJMB 4M1GH 3WNKA 5BXFA 1NCCH 3EJZD 1T5XB 1WEJH 4D9LH 3E8UH 4Y4FD 3K8MA 1IGJB 4N0FB 5F89B 5L0QB 1S7WA 4JFXA 5CZKA 1NMBH 1MUJB 1K6QH 2ADGB 4JRXE 4O2EA 4RNRA 3EOBB 2HRLA 3RGVC 4Z7OF 3TP4A 3CVHB 1BZ9A 1ADQA 2Y36H 4NZTH 2BJMH 1MRDL 5CD3B 1BBJB 3QXWA 4I48B 3UJJH 1N4XL 4GG6F 4NO5B 3GJFH 4MCYA 4ZPTA 4BKLB 1KCSH 1P9MA 4QRPA 4JRWA 4Y16D 5I8EB 5C6WH 4XVUD 3GB7B 1P53A 4ODXB 2ID5A 3HPJB 1KUMA 1QHOA 2GK0A 4XC3H 1I8IB 3NIDF 4QRSA 2DYPD 2WWKT 5D7KE 5E6ZA 1QOKA 3GM8A 4HUWA 4P2QD 1MNUL 3V0VB 1JF5A 3PJSA 1VFBB 3IFLL 3KPRE 1CVSC 5AD0B 3PQYA 4W6WB 3QHTC 4MNHA 4PRHB 3BJLA 4JG1H 4JAMB 4X99B 3THML 2V5YA 3LH2H 4MMZC 1FZJB 4JQVC 2YR3A 2C1OA 1M7DB 1U3HB 1KCKA 1B6UA 1TJIL 4F3FB 5SWZD 1UWGL 2NY7H 1HDMB 1U8KA 5KVDL 1CTNA 3C6SA 1XT5A 1RHHB 2FL5B 4PIRF 5F9WC 3SE8L 3SOBH 3IDMA 2BFVH 2Y5TA 1ZLUK 4KI5F 1GGCL 2F9BT 2C3VB 3T3MF 4C83A 4L8SA 4XH2B 4Y2DD 3BD3A 3GMOA 3U9PH 1QFWH 3GMQA 3Q3GB 3FRPA 2VDNH 3IFNH 4X5LA 3HTLX 4GG6B 1VFUA 1BVZA 3QEHA 1VPOL 2IAMA 5GSVB 3QNXB 5GRJL 4QTHA 2IEPA 5AUMA 5D6CB 3KWWB 2OTUA 2VABB 3GMPA 2BCKA 3UMTA 4G8GE 1JPFB 1AE6H 3C6LA 4YIQA 3DUSA 5EU6E 1CFTB 3MJGX 5JW4M 1MFAL 1UWEH 4IBLT 1UC6A 4L8DA 5BCAA 5KSBA 2DQIH 5JA8B 4P9HH 5CGYD 3F6LA 2HH0H 3MLTA 1VACA 3WSQL 4LSSL 3FO0H 2F19L 1PQZB 3H9YA 3ESUF 4PP2B 1JMXA 1FYTD 4XBPB 1M05A 5F7DA 4EIGB 3AM8C 3C6LC 3BH9A 4UB0H 1LE5B 2Y6SC 1G9NL 4LMQE 5TF1H 5ISZD 5D93C 3I6LE 4K7PL 3O6FC 3IDNB 4GMTH 3ULUC 2HT3D 2APFA 1XGRB 4DAGH 2YXMA 4QRRD 3MACL 1C5BH 4PJ9D 2BNUA 4M9OA 4S2SB 1IJ9A 3E6HA 2A1WL 2BOBA 5D7IB 3BHBB 3C5SA 4LAQH 1I3VA 1AD9B 4RGNC 1C08A 1TZHA 2MQCA 2RCSL 2BNRB 2IC2A 2M1KA 4G8EB 3DVIA 1ORSA 1YEKL 4DTGH 3GSNA 1RPQA 2ADIB 2BNQD 4CVWA 4GKZA 3GJEA 1OL0A 4LIQE 1EJ6A 3NN8B 5H37H 4BH8B 3OKNA 1QBLH 2BSTA 2R29L 5SWSE 4IRZL 1EEUA 3AUVA 3O6KL 2BOCA 3QCVL 4H0GA 1QR4A 3UX9B 3STLB 2GJ6D 4KTYA 1S9XA 5TE6H 2EDQA 4HGMA 3ARYA 4M5ZL 5ERWA 1ZLWK 4HUKB 1HQRB 1FV1B 2YPKB 1EAPA 2N56A 4M6MH 3L6FB 3T0EB 3OKDA 1X4YA 3P77B 1F8TH 5I30L 3GK8H 4WFHE 1K5NA 4DKEH 3JWOH 1YMME 3KPNA 3L3IA 4EI6A 3QZWA 1NCDL 2DQTL 7CGTA 3G6JA 5J11C 3S37L 1FO0L 2PO6D 4Z5RB 2WUBH 3E1F1 2APVA 2R1YB 1J1PL 4IEFB 3FN0H 4BFIB 1OTSD 2YD4A 3BOVA 2EDRA 4KK5C 4C59B 4WO4D 4MB5A 4K9EC 4PGBB 3SGEH 5TE7H 1QTYT 2IPKA 2ZCLH 5C0JB 5EC2B 3PV7A 3OPZL 4NSKA 5KZCD 1D9KD 1VHPA 5CAYB 5CIPB 5IB2B 1C5DB 1BZQK 5F1SA 4OLYL 1MJJB 4KVCH 1A9EB 1ZA3B 2HJFA 3GKWH 4Q6IB 2ARJB 4DKAA 3PWLB 1CR9L 3D39D 2DMKA 3KPQA 1A6TA 2EKSA 1M6OA 1E4XH 3MZGB 4PJ5B 3SY0B 1S9YB 3HNTL 1DP0A 4B50A 1FNAA 4HS6A 3D69B 1BIIA 5CILL 1INQB 1NL0L 3VXUD 4CU8A 5F72S 1KYOK 2UZYB 5FO7A 4D0DB 3RGVD 4NBXB 4LPWA 4XMPL 3I2CH 4M61B 3SBWC 2XG4A 3LHPH 1I85C 2GKIA 1NAMA 5EOCL 5EBLA 2SEBA 3PNWB 3DVFA 3TH2T 3TWCL 5F9OL 3OAZK 3VXRB 3TCXA 4XNMB 3RVVC 4P4KA 1A6WH 1OWWA 3WJLC 3BKJH 3CSYB 4TNWK 5J7CC 1RI8A 3WDIA 3U1SH 4CADB 5KN5A 3MR9B 3VRIB 1MRDH 4NO2B 2F58L 3AB0B 4XT1C 3MUGA 3W0WA 1MCRA 4MA1B 4GBXC 2NY0B 1E4KC 15C8L 2C1PB 3HG1B 3CVHL 1T1YB 1G7LA 1M7IB 4P2QE 3ALWA 5I1DB 4P4KC 2X4TB 1CXKA 1MJUL 4IRJA 2FB4L 3B8SA 3LKQA 3IFLH 4QRUB 4Q9QL 3VGAB 1FL3B 3VGEA 3P73A 1FE8H 3QWQB 4G8IB 3F12A 3THMH 5SWZE 1HHIA 1NDGA 4G9FA 1CQKA 4U1LA 1TJIH 5GGRY 3S4SG 1UWGH 3HNSL 2HWZL 5F7LB 5KVDH 3MRNA 3S96A 1S5HA 3SE8H 3SKNB 2VJXA 4C56E 4JQIL 4I77L 2ZP0T 2AW2A 1H5BA 2E6QA 5TDOB 1J0JA 3B6SA 3GM0A 2YEZA 3D3VD 3PHQB 2EEDA 3S4SB 1MI5D 2FSEB 3QDMA 4RQQA 1TQBB 3ARUA 1IC1A 1DN0B 3VXOB 2FH8A 1VPOH 4NM8L 5GRJH 3VXTA 1AJ7L 3O9WC 4JFDB 4E42B 3ARDA 4ETQA 5BRZD 3U7AA 3S3PA 2QADD 1Z9SA 4IHOB 3EFFB 2R1WB 4FNLL 3CXHK 3A67L 3C6LD 4U1SA 3DNKA 1MFAH 3N0PB 2Y6SD 3U0TA 1MFBL 4HG4K 2FZ3B 5IM7A 2AJXL 1A02N 1GZPA 3O6FD 3WSQH 4LQ1A 4LSSH 1FYTE 2F19H 4LSDA 2NZ9C 2VISB 3UTPD 4PGJA 1HYRC 3UTSB 1FFPA 1DN2A 4Z7WE 1NDMA 3VD7A 1T1WA 4KGJA 4Q9BA 1XGUB 3MUY1 1G9NH 5SV4A 5ITFA 3ROOA 2HFEB 4KKBC 4RGND 1DR9A 1HH6B 4JRXB 5AYQA 5D4QA 4KRPC 4K7PH 3OHXA 4QRRE 4ZUVB 1UJTA 4X7TA 1RUAL 3T65B 4ACPA 3QDGE 5I76A 5E56A 3RBGA 4TNVK 2A1WH 3EDFA 5TDNB 3DWTA 5CEZL 5IMOB 2C7UB 1NUNB 3QUXA 3MCKA 3BE1H 4GXVL 2J5LC 2RCSH 3GSQB 1IAKB 3QO1B 4M8QA 2V2XA 1YEKH 1KJ2A 4HS3A 3JV0A 4W81A 4DUXA 5D1XB 4HLZH 4JKKA 1RK1B 4RA0C 2IPTH 2R29H 2GJ6E 4IRZH 4OZ4A 1DQLL 4LF3A 2A74A 3O6KH 3QCVH 1N59B 4XVJL 1VSCA 1IKFL 3D18B 4EOWH 4EQ3A 4U7SA 5HTSA 2YWYA 2VDML 3CFCL 4M5ZH 2ZNWA 3IFOB 5C0AD 2ARWA 2GAZA 3ZDZF 3SGJA 5HGAA 3H9HA 3TN0C 3MRJB 2E7MA 4JHBA 2VTFA 4KK5D 1XIWA 5DGQA 5F3BA 1ZT1A 2AK4B 4E9LA 5C86A 2NLJB 4K7FB 3RP1A 4YHZH 1DCLA 1LK2B 1NCDH 2DQTH 4LCYB 4XPGL 1V5JA 4X5WA 2PCPB 3S37H 1FO0H 4JKMA 1JNHA 1F4HA 2A9NL 3MNVA 5T1LA 1RJLB 4FQXC 3TM6A 2O5ZL 1J1PH 1Q0YH 1FVCB 4CMMA 4J7RA 4NN7B 2YN5A 5H94B 3KJ6L 4MQTB 3DMMB 4LFHG 3BKCL 1UEYA 1IQWL 2A6KB 3U36A 3PIQB 1J1XL 1U58A 1N6VA 3QUYA 3OPZH 4I2XB 4N0YL 4L4VD 2EYSB 2X4SB 4OLYH 3FB6A 3JV4B 1Q0XL 3B9VA 1T7XA 3MYZA 3D39E 4HULB 2BSSA 2HVJB 4ETYA 2A73A 3I50L 5KVGH 2YN3A 4WFGD 4Y8DC 1MCPL 4R3SA 3ZZ1A 1U41A 3VXUE 1OQXA 3HNTH 3QUMB 4NNYA 1VDGA 2XQYG 2ERJC 4HX1A 1KG0A 2A38A 1GGYA 4XB8A 1JUFB 5CILH 1L6XA 3VFOB 1NL0H 4Z7NE 5IVXA 4E41A 3M17A 3IXTA 3GSRB 4PRIB 4RMTA 2P5EA 3TIDA 1MHEA 3OZ9L 3SO3B 2FLRT 4XP1L 5EN2A 3QUZB 3CJJA 1F42A 1ZTXL 1YYML 5IW1B 5HHXL 1BF2A 3IU3A 2DAVA 4XBEH 2IH3B 1RZJL 4GBXD 1NGQL 1J0ZA 4KUZL 5EOCH 4X7SL 1R0AH 2OR9L 2Q7YA 3TWCH 4PJBA 5F9OH 3FO2A 2IG2L 3NCYS 3SQOL 4Y5XA 4R26L 4BQCA 3JVGA 1JPGB 4GW1B 3J7HA 4P4KD 5C0FA 3LKRA 3TZVA 5DJDA 5T3XL 1LVEA 4UTAL 4L9LC 3ARVA 2F58H 3D0VA 4KKCC 3JUZA 1G9ML 3W0WD 5DF0A 5SWSB 15C8H 5H35A 3CVHH 3TA3C 5CSZB 5EFIB 4M5YL 5HHOA 1BVKB 4U6HA 1AIFB 2CK0L 2YRLA 5KVMC 4LPYA 4Y5XC 4TUOB 4NBZB 3JVGC 2JK5A 5DZNA 4WI9A 1MJUH 5HVHC 2BHZA 4JEGB 5C0EA 5F7MC 2FB4H 1JV5B 4IRJD 1GHFL 4X98A 4Q9QH 4HIHB 4F7CA 1WJ3A 2OL3L 3CZFB 1QRKA 4HKXA 4FXKB 3FTGB 1K8IB 3V4VL 3IJYA 1KJVB 1YMMB 2WBJC 5FV2A 4GW5B 3MODL 4PJGF 4OFYA 3MROB 1C1EL 4G9FD 1QSEB 1MY7A 4KDVA 3HNSH 4LLYA 2HWZH 4CDGC 3QQ4B 2VL5B 3WNNA 5I17A 1JYVA 4WU7B 3QEQA 3MLVL 4JQIH 4I77H 5E1AA 5DJ0B 1QFHA 1QKZL 3O3DA 4H26A 4V1DA 4XP6L 1HI6A 3C5ZB 3CLFL 1R5VA 3GSVA 3LOWA 1G9EA 1II4E 3HC0B 5IR1B 3QDMD 3EDKA 3LDBB 1MJ7L 2VKXA 4LP4A 3IJHA 4NM8H 3DI3B 2WK2A 3O4LB 1AJ7H 5KOMC 2XXMB 4HK3N 3REVB 3FT2B 2NZ9D 2PNDA 2D7NA 3ZO0A 1PY4A 2W59A 2FGZA 2D31B 3T1FA 1EFXA 4FNLH 5FKAB 2X1OA 2ED9A 4HWBA 3A67H 5I15L 5KSBE 3MRBA 3CCHA 4GRMB 4EDXB 4Z77A 3F7VA 1MFBH 4QXTA 1ZT4A 2P42B 4KKBD 4U49A 5IF0A 3UTPE 4KRPD 2J8UF 4Q74A 1A14L 3HI1A 3V6ZB 2G5BB 5EIIB 3TJEL 4HZLB 4PJGB 1PX4A 1N6QL 4Y4FB 4JFQB 2R2CA 4NJAL 3Q6FA 3OF6A 5EBMA 1G1CA 3VRLF 5GS1A 3DXAB 4RGNE 1WIPA 1KSRA 3SE4C 5E8NA 4NZUL 3D0LB 1N2RA 4D3CL 2JJTA 3RWEA 1JZ7A 1RUAH 5E94A 5EBWA 3SE3A 5DMKB 4WHCA 1R3HA 3IYLW 4O2FA 3GZKA 4P2QB 5CEZH 2P45B 5IMLA 2YK1H 1VESA 2A0LD 2NX5A 5A2FA 2Z93A 4GXVH 4UAOC 3MRCA 3D87B 5KBNC 4APQA 3QUXD 1DLHA 4OUUB 3IDYC 4JR9L 3RL2A 4NQEB 2JJTC 5ESQB 5LXGL 1HSAA 1KC5L 3OR7A 1A6AB 3Q1SL 3FOLB 4KK9C 2R1XA 4AJ0A 4EUPG 5IOPA 2EC9T 2F53D 1DQLH 1WT5A 2Z0BA 3MRDB 4NIKB 4XVJH 5C0AE 2WSKA 2J8UB 2H9GB 3SDAC 3F62A 3QHFH 4UDUA 1J5OH 2VDMH 3CFCH 3V7MA 1CFQA 4Z7WF 2QQNL 3I6GA 4OV5B 4FQXD 1HHHB 1QBML 2XRAL 4APQC 2BRQA 1VGKA 3VG0L 3VFUB 1A1NB 3BZEA 5KSAA 1WWAX 4EUPB 4Y2DB 1K8DA 4LPVA 1JPTL 5D5MF 1T83A 3G6JE 3MGTB 2NY6C 1HOCB 3VI3F 1S78C 3IS1X 1HWHB 4XPGH 2ED8A 4RFEA 3HZVA 2A9NH 4B7IA 1CYGA 4PJEE 3RWHA 1C5CL 1UKQA 2O5ZH 5T1LD 3MRHA 4NQCA 3KJ6H 4MWFA 2G75A 5I75B 5D7SL 3RWFA 1KJ3L 1IQWH 3S34H 4K3EL 1MRCL 1WBYB 2EDJA 2XWBB 3FKUS 4N0YH 3FFCA 3HPLA 3QUYD 1QVOA 5EOCJ 5A43C 5CCKL 1ZANL 4MS8C 3RTQA 1Q0XH 1OLLA 5EU5B 3WLBB 5MEPB 1T0NB 1IEBA 2YA2A 1IFHL 4WFGE 1FYTB 4JCLA 4FABH 1ZE3C 1MCSA 3I50H 5L7XL 3HAEG 2VITA 1NGXA 1A1OB 4Z7WB 1MCPH 2W0FA 4WHTA 3QIWC 2CIKB 5ISZB 1ERNA 4N9GB 4BUHA 2EDNA 3L9RB 1GIGL 2AJ3B 4M1CC 4UOJA 4QYOB 3OAUL 4UQ2A 4E41D 2ZKHH 5D5MB 2P5ED 3OZ9H 3P0VH 2C9AA 3FQNA 4U6YB 4Z0BL 4XP1H 1V05A 3B5TA 2XTJC 4PJ9B 1ZTXH 5D9SB 1KTRL 2UVEA 1YYMH 4DVBA 2RFXA 5HHXH 1S9KC 1I7TB 1GZQA 1VFOA 4KKCD 4XBGA 1X5ZA 1RZJH 2EIZA 4UT7L 2HTKC 1NGQH 4F9LA 3DETD 2R2EB 2W91A 2CRYA 4KUZH 4X7SH 2OR9H 1XF1A 3EYFA 1IGTB 2IG2H 2V17H 1C12B 1OGTB 3SQOH 4R26H 1BREA 3QPQC 1BECA 2VIRA 1NUDA 2BNQB 4WTWA 5EPMB 4AM0A 3FQWA 2V7NB 4UTBL 3G5VA 3U0PA 5T3XH 3TZVD 3NFPB 2B7DT 3W0WE 4UTAH 4N68A 1T4KB 2LU3A 2OP4L 3O11B 1G9MH 5E00B 1D6EB 4NGHL 5ICXA 5JZ7C 5L2KB 2GJ6B 1Z9LA 4JPKH 2VUOA 4Y4KA 4M5YH 1KT2A 3FT4A 4LIQL 2CK0H 3HHRB 4G42B 1MELA 5HHOD 1KXQE 1P7QA 4PBVC 1KPRA 3SCMB 3VFVB 2PYFB 3G6DL 4NHUA 3C2SA 2EC8A 4JPVL 5IJVA 4S0SD 1IILE 4KQ4L 1GHFH 1O7VA 3AS2A 2JKXA 4EEEA 1AGCA 2BDNL 1YY9C 3GJFK 1OP3H 3W9EB 5CS7A 4G9FE 3V4VH 1E28B 4HUXB 1MLCB 1CWVA 4Z7QE 4MAYC 5B21A 3MODH 1C1EH 4OLZH 4OFYD 4Y8AA 2ZG1A 1J8KA 4U3HA 5F1OB 1T66C 4WO4B 1FQ9C 4Q2ZA 2F15A 1EX0A 3MLVH 2F8XC 4JN1L 3F8UB 3T77B 3EDEA 3QYCA 4RAUB 1IM3A 3WNLA 3PGFL 1MY5A 2IFFL 4FFWD 3BRDA 5KZCB 1EO5A 4XP6H 1D9KB 3U9UB 3QDME 4V1DD 1A2YA 3ESVF 3CLFH 1WK0A 3V0WL 1TZIA 5CUSL 2ZG2A 1Y6KR 5ELIA 4X80H 4IM8A 1CLYH 1HEZB 1OAKL 3DX6B 3TVMA 4JY4B 1MJ7H 5I74B 2X42A 5KTEL 2V7HB 4JZNA 4KRLB 3BYYA 3EJYC 5HGBA 3QXAA 3OQ3B 1QHPA 3V6OA 1EFXD 4LLUA 4QRQA 1C16A 5J13C 4LVNC 5I15H 1FDLL 2L7JA 1AXTL 1EEZB 4F2MB 4JN2B 4RISL 1D5MA 2FYYB 3RGVB 25C8L 3MNWB 4UILL 3WFEL 1BJ1J 1A14H 3RX8A 3TJEH 4D9QD 3UTTB 3BUYA 2BK8A 2ICES 1N6QH 4U1JA 3AS1A 5BXFB 1FLRL 4NJAH 4YX2L 2ZUQC 5E1HB 4I0PA 3OF6D 3LQAC 4JFXB 3QNYA 4XGZB 5DD3L 1FNGA 4O2EB 4RNRB 3ULSB 1ACYL 4NZUH 5HY9B 5HI5C 2KZ1B 1NCWL 4OFPA 1F4XL 1BZ9B 5H2BA 1QLRA 2CDGB 4LSQL 4D3CH 2E9WA 3MLRL 5CJQL 1G0DA 4MA7L 4XNYL 3TPUA 4S1DC 1JHLL 2XWJA 4QRSB 2P1YA 4K94C 3RDTA 3SDAD 4HUWB 1IGCL 5F9WB 1MCWW 3RU8L 4JREB 5ADOL 4ZNCD 3S9DB 3BVNB 4H1LH 4JANB 4APQD 5KSBF 4OQTL 2NNAA 3BP6B 4JR9H 2F53E 4MNHB 5LXGH 3ULUF 1KC5H 4POZC 3Q1SH 2JJWA 5GSRA 3IETA 3NGBB 4M00A 5KVEL 1CD9B 4U31A 5EOQL 5LGHL 2R8SL 4NNPL 3V7AE 3T09A 2J8OA 4N0RA 5KG9A 1XMWA 1S7QB 5BO1L 2QQNH 2CKNA 1YJDL 2NXZC 3STBA 2IQAA 1QBMH 4MXVE 2XRAH 4H5SA 5IW6B 4C54A 3WNPA 4L8SB 3D3VB 3LKPA 2HVKA 1AD0A 5KSAD 2I07A 4LCCA 1MI5B 3ARFA 3GMOB 1JPTH 4OF0A 4L3CA 3GMQB 4PYHA 4TOYL 5DJ8A 3T2QA 3KPTA 4NC1C 5DMGC 1LP9A 1FCGA 1OAUL 2QSCH 1TTGA 4GOSA 1J86A 2EDFA 2GJZB 4PJHF 3ALXA 1C5CH 2Z35A 4RRPG 1RFDL 2DQGL 3QDHA 5DI8B 5BRZB 3LMJL 4HF5L 2X6MA 3A6BH 5D7SH 5EUKA 4Z0XB 2OTUB 1DEDA 4FXGB 5F7YC 1KJ3H 4PJ8A 3I75B 4LCCC 4K3EH 1MRCH 3C6LB 1T2QL 3FONA 4AG4H 3QIWD 3CDGA 5KSBB 5D93B 3O6FB 4LGSB 2ZUVA 1ZANH 5HD8C 4M1CD 4YO0A 1L0QA 4EIZC 1YQ2A 4JFED 4JKWA 3RTQD 1A6PA 4JGUA 5LVEA 1IFHH 2ADFL 4QHLA 1TJHL 5DK0A 4CVZA 2JELL 5L7XH 2YC1B 3PWUA 3Q5YA 1XCQB 3O3AB 5F7DB 1B6DA 3IDJA 2GFBA 2HTKD 4AY0A 4J4PC 4F7MB 1BLNA 3SN6N 4RGNB 5IVXE 2AV7B 4E41E 1SMAA 1CICC 2W65A 4KHTL 4HLJA 2P5EE 3G6JF 1GIGH 3MLYL 2X4RA 4R4ND 4YK4C 3OAUH 4QF1A 1CD1B 3QUMH 4LASH 1G6RA 3P4OB 4Z0BH 3X11B 4PJEF 2BVOA 1FRGH 2VLLA 2DICA 1LEKA 3E6HB 4CJ1A 1N8ZB 1AGEA 1IRAY 3EBAA 4PJHB 4PJBE 4UT7H 5JZ7D 2MNUA 2GTWA 1RZIB 3FAWA 1AI1L 1HHKA 1C08B 1TZHB 3SGEI 1MCIA 2C3HA 2PTUA 5C7XL 1ZGLA 3MXVL 2GT9A 4XCYA 3GSNB 4HUMB 1HNFA 3GJEB 4UTBH 4DN3L 3MCG1 2VR9A 3K8KA 5D1QA 4FA8A 2Q86A 5I1GL 3OKNB 3QWRA 1WC7B 2OJEA 4NWUL 1YY9D 2FH6A 2PW2A 4L3EA 4NQXA 4ZFZA 4NGHH 2BOCB 1JZ3A 1CDIA 5HHOE 5KVFL 4J3SA 3AGVA 4LKXA 5C0AB 3QZWG 5LKNA 1S9XB 4LIQH 1SJHB 1PZUB 4Y4KD 5ERWB 2QSVA 5GISL 2XZZA 5LBSL 3CZJA 2XYCA 1WWBX 1XH3B 1AR1D 2MWCA 1P7QD 4O2CA 3G6DH 1T66D 3OKDB 2PYEA 1ZHNB 4JPVH 3CPLA 4KQ4H 1G0XA 3LPWA 3UEZA 2BDNH 3R8BB 3M8OL 3F58L 1K5NB 2UV3A 1NLBL 3O6LL 3KPNB 3L3IB 4I3GA 1I1FA 4EI6B 1QSFA 1WZ1H 2VDOL 5JDSA 2MPAL 1OTTD 3G6JB 3I3BA 4OZHA 5T5FL 1UXSB 4PJEB 1MAML 4PP1D 1JFQL 3MLUL 4JN1H 1W0YT 2EIDA 3ZL4H 3FQUA 3MRPB 4ZOAA 4V1DE 3S5LG 3PGFH 2D4FA 2IFFH 2IPKB 2CKBA 3CX5J 4L4VB 4U6VL 2MHAA 4TPRL 2VSCA 3TBWA 4IDJL 3WHE0 3CC5B 5MENA 3K81A 2UUDH 2E6PA 3PDGA 1FFNB 5CUSH 3MC0A 5FYLD 5B8CC 1HZHL 3MO1A 1T20B 3BEVB 1OAKH 4HMEA 5C71A 3ZKQD 3S5LB 4G6JL 5KTEH 4WGWB 1F6LL 1I1AC 1DUYA 3MUZ1 1F02I 3AY4C 2DWEB 2KUTA 4JRYA 1TITA 2X44D 1MF2L 4O58L 4A2MA 4ZD3L 3K80A 1N7ML 1BIIB 3PDOB 4YWGL 4JFZL 5KW9L 2KH2B 1FDLH 1AXTH 4P9HC 3OAYK 1CIDA 4RISH 5FO7B 25C8H 1A3LL 4K55A 4D9QE 4HUVA 3WFEH 1XEDA 1T7YA 3QULB 3GIZL 1SYVA 4Z78A 4GBXB 2JIXA 5EU4A 4AZ8A 1FLRH 1NAMB 4Y88A 4YX2H 1U8PA 3OGOE 4S1DD 4I0PD 4P4KB 5K9OA 5DRXA 4HV8B 4RIRA 5DD3H 2Z8RA 4HC1A 4ZXBC 4Y19A 1ACYH 1Q9LB 4PV9A 3G5ZB 2W9EL 4GRWE 1D5BB 1A47A 3VXQB 4LSQH 3G5YA 2C3WA 5DVNA 4LRIC 3MLRH 3CSPA 3W0WB 5CJQH 1DBKL 4MA7H 5HDBE 3IFPA 5BJTA 4PJ7A 3MJ7A 3L3JB 4F9PA 1ADQL 1G7LB 3V6FA 4YFDB 1JHLH 3D85D 3FB5A 1RQ5A 2NX5E 4KJQC 4FQ1L 3O2WH 5IFHL 1IGCH 1JL8A 3RDTD 2MKWA 3RU8H 4R97C 4HMDA 3LKQB 1U93A 2MFNA 4P2YA 2Z8VC 4OQTH 3RWJA 1MFCL 3JWNC 4G7YL 4NHCL 3CMOL 4OT1H 1NDGB 1U36A 1EV2E 4F9PC 3RIAK 5EOQH 2R15A 4U1LB 4CMHB 1KLGB 4YJZL 2R8SH 4NNPH 1QEWA 4WI3A 3MRNB 5D7JC 1FNHA 3R1GL 3N50A 4HJGA 5SWQA 5BO1H 3S96B 2H1PL 3LN4B 1YJDH 4OTXL 3X13A 3O9WB 2BX5A 5AG8A 1KCRL 4PV8B 1S7VB 4N8CL 2XOTA 3B6SB 1BVLA 3EFDL 3JWOC 1KIQB 4M02A 2DM7A 3ARFD 1N3NA 4TOYH 1HIML 5DTFA 4DZBA 3MJ6A 1OAUH 4EUPH 2D9QB 5FUOL 4XMKL 2MSPA 5HD8D 1RFDH 2X4OA 5TGBA 2DQGH 3LMJH 1A6UL 3ARGA 4ETQB 3RVTD 2CMRL 4WHDA 2EYTB 4AENA 5D2NA 4TVSa 2R0WL 4DQOL 2W0LA 3K46A 3FFCE 1T2QH 3NFNA 2YMXL 3NZ8B 4JFEE 4FZEL 1MEXL 4KRPB 4OB5L 4MJ4A 5FDWA 2BC4A 1BOGA 5GJTL 3ZT5A 3ZDYE 3U30C 1AXSA 2ADFH 1TJHH 4DUVA 5BVPL 2JELH 3ARGC 1FFPB 3VA6A 3LV3B 5D2NC 5DJXB 4LNVA 4YHNB 1G7JA 2MKLC 1HWGB 2IBBA 2HJLA 5C08A 1U42A 4TULL 4MZ2A 5JQ6L 3ROOB 2I25N 4KHTH 5IBTL 3MLYH 5K59F 3X17A 1OW0A 2PKDA 3BIKA 5E2TL 1W0WA 1OF2B 1NEUA 2GITB 3WKML 3ZTJG 3LKNA 2X10A 5F3HB 4TTDC 5HHQA 5I76B 5E2VL 2BP3A 4GRLC 1I4FA 1AQDA 4JG0H 5IWLA 3HAEH 1ONQA 4O51A 3HS0A 3Q2CA 1AI1H 3QUXB 3MCKB 5C7XH 3TN0B 4M8QB 4TNWF 1UT9A 3MXVH 3V7AG 2V2XB 1KJ2B 4HS3B 4DN3H 2XNAA 5DR5L 2FGWL 5D1QD 2F53B 1DQDL 4LDLB 5TH2A 4MA3B 2DN7A 2A74B 1Q9OA 4L3ED 1IC7L 4PJFB 3GSNL 5KVFH 2J7LA 1TENA 1E0OB 1TTFA 3P4NB 4FQXB 1OVZA 1IGIL 5GISH 1PEWA 5I8OL 5LBSH 5EO1B 3JV5A 5HGAB 3H9HB 2HG5B 4IOIB 3TC9A 3AAZA 2FJFA 1B3JA 3WJJC 3VWJC 4LLDA 1A7OH 2PYED 2YD9A 5F3BB 1ZT1B 3F58H 1NLBH 2LU4A 3O6LH 3RY6C 1EFQA 3DROA 2UWEE 1KPVA 4X9IA 2VDOH 2MPAH 1WTLA 1QSFD 4S1QL 4K9EL 1JNHB 2H32A 5E8OB 4OD3L 5T5FH 2IQ9L 5LWYL 3MNVB 5T1LB 3GSOA 3OJ2C 2CK2A 4G9DB 2YOCA 4LPUA 4CMMB 4PJBF 5I1LB 1JFQH 2Y7QA 3NMEA 2FNBA 1P1ZA 3MLUH 4XC1H 3TO4C 4JJ5B 3IAQA 4LCIH 4PJCA 1ES0A 1X5KA 1QFUL 4BSWA 4RFNB 1U58B 4YHIA 3FRUA 3H3BC 4U6VH 3QUYB 4TPRH 2ERJB 2FJHA 5FYLE 1YEDA 4IDJH 2VXTL 3FQXA 2BMKA 4U7MA 5MEND 2P49B 3FB6B 2X4PB 4MNGA 3QQNA 1HZHH 3ZT7A 4P5KA 1JGVL 2BSSB 5AG9A 2IMNA 4PJAA 2A73B 1T03L 1ZHLB 4RBPH 4JO4L 2L0DA 1K2DB 4MDIB 4R6UA 3SDXA 4NC0B 2VXUL 3V6OE 1LE9A 4ENEC 1NEZG 5AZ2L 3HMXH 4NNYB 4O58H 1MF2H 4OSUL 4ORGB 4WIQA 4JRYD 4ZD3H 4HX1B 1KG0B 1N7MH 4YWGH 4JFZH 5KW9H 5E99H 1I1CA 2NR6C 4QGTA 2UY7A 4X4MA 3JUYA 4E41B 2GY5A 4ODWA 3F5WA 5B39A 3M17B 3IXTB 1QD0A 4N9OB 2P5EB 4HK0A 4ZXBD 1MHEB 2ZOLA 1A3LH 4L9LB 5EN2B 4BUGA 1V7ML 1NEZB 3GIZH 2K1MA 3RIFK 2X5PA 3IU3B 4YHMH 5FV1L 1JPSL 2EDWA 4P5TA 2J12B 3RPIB 3TA3B 2JIXD 5D8JL 4ZAKC 1GPOL 2ICWA 2Q7YB 4PJBB 1G9NC 4Y5XB 5JXAL 5JPMB 1FIGL 5HVHB 1HILA 4LL9A 3LKRB 1ZLVH 3VFPA 2XT1B 1NAML 5DJDB 2W9EH 1VFAA 1L0XA 1A3QA 3ZYOA 1E4WL 5BS0A 3D0VB 1ZVYA 2KKQA 1DBKH 2Q76A 1QSZA 1FG9C 1SY6H 3PV6B 1WAAE 1KJMA 5C09A 5FUZL 5H35B 1GGIL 3TV3L 1ADQH 4TNVF 2LFGA 5HHOB 4U6HB 3BJ91 5FM5O 4YNYB 1VA9A 2V5SA 4FQ1H 3LEVL 5IFHH 1W0VB 2JK5B 5BVJB 1DSFL 3RX7A 6FABL 3DX9B 2AKRB 1OARL 3CAFA 2R4RL 1T04B 5E8EA 4P2CG 2QHLA 2QSQA 2NTFB 1MWAB 1MFCH 3IJYB 1KLUB 3PDDA 2Q8BL 4NHCH 3CMOH 1NBVH 4U1NB 1MH5A 4KK8C 1MLBA 2E7LC 4P2RA 5FHBL 1JGLL 5E6IC 3GMLA 2XA8L 1RJYA 2FRGP 3R1GH 5I17B 2H1PH 4OTXH 5CHNB 5E1AB 5DWUL 2NQCA 3WYRA 3BGAA 1KCRH 1FLTX 1UG9A 4PS4L 2YWZA 4V1DB 1UZ6E 3EFDH 4JZJA 3UDWA 3OKEA 5DRNB 4GRWF 1ODAA 2DMCA 1R5VB 3VA2C 2FX8L 2C5DC 1HIMH 1G7IA 4XNUH 4S11A 5GGVL 2R23A 1TVBB 3NCJL 5FUOH 4NQVA 3IJHB 4XMKH 4CKVX 4HW6A 1AP2A 1W72A 4X6EB 1P84J 1A6UH 2CMRH 4JY5L 2EKJA 2BVTA 3ARGD 5DJYB 3L5XH 3T1FB 4DQOH 1EFXB 4JZJC 5JW4N 3L95A 2FIKB 4R0LA 4W4NA 3KJ4C 2APWA 3TH4T 1U8LA 2UY6A 2EDOA 2WWMC 2R2BA 1BJ8A 3MRBB 2YMXH 1LO2L 3CCHB 1XF3B 2EO1A 3F7VB 4FZEH 1MEXH 4J3UA 4QXTB 5F7HA 1ZOXA 1G7MA 2XZAL 5JUEL 5GJTH 2V6HA 4YHLL 2YPVH 4YEFA 5ID0A 3EO1B 5HGHA 3HZMA 4PJDE 3KLSA 5EBMB 2ZUYA 5F88B 4R0LC 2X4QA 2MQ3A 4HD9A 4X83A 5SX4I 1BJMA 3B9DA 4HUUA 2H2SD 4TULH 4UAOB 5C08D 5JQ6H 5T1MA 1U91B 1C8PA 3O0RL 5GXBB 2WWKO 5IBTH 3RKDD 5HGGS 4GMSL 3F65A 3IDYB 5E2TH 4GRWB 5BOPA 1FP5A 2LAGB 4BQ6A 3WKMH 4OLWL 3GI8L 1XF4A 3VCLA 3H9SA 1G7QA 1S7UB 5E2VH 2BSRA 3LS5L 3CMGA 4MSWA 3U4BH 3SDAB 3TJHD 5FK9A 3PWPA 1I3RA 1P5UA 3MMEB 1RU9L 3MRCB 3QXVA 4APQB 2DB8A 3DV4A 4GH7B 1DLHB 4OIIL 5JPNA 2VE6A 5ID1B 5L0QC 1U8MB 1NMCC 3VWJD 5DR5H 4L3EE 8FABA 5HHPB 2FGWH 4WWID 4OI7A 3OR7B 1BQUA 1DQDH 5IOPB 2NY6B 3WS3B 3ZDYF 5TDPB 1IC7H 3GSNH 5DUBA 1FCCA 1KJ2L 4FZ8L 5DQ9A 3X12A 3CX2A 3FQRA 4UDUB 2NY3C 5D70L 3MRLB 3I6GB 4PB9L 4FN0A 1IGIH 4EI5A 3MLXL 2ZPKL 5I8OH 2HN7A 2PYEE 3HE7A 2JB6B 3I3DA 4GT7A 2NXYD 1ZHBA 2OXHA 1K8DB 4MB3A 3LRSA 4XCNA 4X6FB 3VWKC 4LSTL 1QSFE 4W4OC 4ZS6C 1D7FA 4N1EA 2Z91A 3RGHA 2O61B 4WEBL 4OZHE 1H8SA 4S1QH 3PL6A 3TBVB 4K9EH 4FXLA 4R9HA 3HZVB 2VWEC 1EUTA 1AC6A 4Y0GA 2IQ9H 5LWYH 1GJIA 3VDBA 1F4AA 3RWHB 4EI5C 3MRHB 5ENWA 5IBUG 1U3HC 4K7PX 2G75B 4MWFB 2ZG3A 3KPLB 3RWFB 4NC2B 2VDQL 2YUVA 4ZYKB 1B0RB 3BO8A 1QFUH 2NY1D 1X5XA 4FTVA 3JSSA 1OP3K 5MENE 2PTTA 3ISWA 4ENED 2E27L 3QIWB 5FOBA 3DUHA 3HPLB 1OAXL 5I16B 2VXTH 1QVOB 2FECL 2H8PA 2OX5A 1V3LA 4JFEB 3NPZB 2NR6D 2WLZA 5IBUB 3RTQB 5B38A 3ZYIA 2O5XL 3DRQA 1IEBB 1JGVH 2ZOKA 1YEHL 5D1ZC 1VKXA 2XTJB 2QQKL 2WUCL 1KCLA 4JO4H 1FH5L 1EHNA 4ZSOB 2FBJH 4JRYE 3ULVD 3CLEH 5DS8A 1I8KA 4NJ9L 4OSUH 4WHTB 2V2TA 3TYFA 1T89C 1T0PB 2D0HA 3OL2A 4WEMB 4YGVA 2P8MA 2GTZA 2UWEF 4UQ2B 4ORZC 3KLDA 3CXDL 2ZCKL 3FQNB 2VN4A 3WFBL 1V7MH 4P5MA 1PG7L 2JCCA 3U7YL 4YFEA 4Z76A 1GZQB 1JPSH 4KROC 1FL5A 4YHKL 3MYJB 5D8JH 1GPOH 3NTCL 1U8QA 4BH7B 4X8JB 5JXAH 3S37X 2ITDA 5D7LA 3TCLB 1FIGH 4AM0B 2EDEA 1KXVC 1NAMH 1RUMH 2DQDL 1GGTA 1I1YA 1I9RL 1E4WH 3WHXB 3CX5K 4KI5C 5BS0D 4PJ7E 8CGTA 1CGTA 3U2SA 4MAYB 4R4BA 1ZLUH 4TVPD 5GZND 5FUZH 1UM5L 2QJDA 1GGIH 5C09D 5IROC 5C0BD 4Y4KB 3TV3H 3IAGC 1Z2KA 3FT4B 5DZOA 1EPFA 1J87A 3C5JB 4GG8A 4TRPL 2AXJA 5TQ2L 3TT3L 3WHE1 2AQ3A 2Z8SA 3LEVH 1KPRB 3QIBA 4M7LL 5JLZB 1CTOA 3IKKA 1U8NB 1LDPL 4AIZA 6FABH 5IJVB 1OARH 4L29A 1EGJA 1AGCB 3FCTB 2CDFB 5IGXL 4LVOC 2Q8BH 1IAOB 1ZS8A 1KNOA 2UWEB 3QQ3A 2V2WA 2K3TA 3KPSA 5FHBH 1JGLH 1WWCA 2AXFB 2XA8H 1CL7L 5C0ND 2XFXA 1CDUA 3VD5A 2EYRB 1WCQA 2F54A 2WW8A 3GBLA 1WF5A 5DXWA 2R9HC 1X5JA 3BH8A 4Q0XH 1IM3B 1ITCA 4D9RD 1IGYA 3S88L 1WIOA 4PS4H 2RQ8A 3H42L 1A2YB 3N06B 3DRTA 5IT2L 3TH3T 5J13B 2FX8H 3MV9B 4LVNB 4QHKJ 5B3JF 2WWMD 3L7FA 2VN7A 3FQTB 1TZIB 2IFGA 5GGVH 1WAAF 3NCJH 4WTXA 1LEIA 5DO2D 5GRUL 5IB3A 3ARQA 4JZNB 2WNGA 5D2NE 4K3DL 4JCMA 1SBSH 2ZUQB 3SKMB 1ZSDB 2P24A 2A2QT 4JO3L 4XI5C 2H26A 1C16B 2X4UA 4YDVB 2Q7NA 1CGXA 2B8OT 5EZJA 1DBJH 1LO2H 1BFOA 5IFJA 1F00I 3QCUL 4IDLA 1D5MB 2J6EH 3P9WB 5IKCA 3JTTB 3WN5A 4HWBL 1HQ4B 2XZAH 5JUEH 4S10A 2NW2B 4YHLH 2QL1A 3IDUA 1LNUA 3EYOB 3X3GH 3VGBA 1WFNA 1GAFL 5CZXC 5C08E 3RUGA 1FNGB 5F1IA 4MJ5B 1A7BA 3O0RH 3KGRA 4E0RA 3HC4L 4GMSH 5EU7C 3QFJA 1ZLWH 1AGBA 4X7CC 1OHQA 4HWZB 3DVGB 5E4IA 4Y4HA 4OLWH 2HTLC 3GI8H 1INEH 4UQ3A 3H9SD 3D85B 3LS5H 4D94A 4FQ2L 5FKPB 2YD6A 1NCTA 2FJGB 4KVNL 5KANI 2NY3D 2VLJA 2NXZB 3QNZA 3PWPD 1T0MB 1RU9H 3BP4A 4NKIL 1WZLA 3NCMA 4HSQA 4OIIH 4LK4A 1NBYA 1S7TA 4AEFA 3JTSA 5GGSB 3BYTA 1WUNT 4LLVB 2E9JA 3PHOB 1UQSA 3QFDA 2HT2D 3IDGA 1G9MC 4UUJB 2KPNA 3VFTA 3ZTJH 3L3HA 4R2GC 3RQ3A 1KJ2H 2Y23A 4FZ8H 3AB0C 1PDKA 4XX1E 1P2CB 3U6RB 5D70H 4PB9H 4ODHL 4PJDF 2J1KA 2XQYK 2IQAB 1BMGA 2B0SL 3MLXH 3KPPA 4NRYA 4EI5D 3HE7D 1F97A 3LKPB 3B5HA 2HVKB 2KL6A 3PE9A 4LCCB 4BZ1L 1MCQA 4M48L 3MNZA 5F7NC 4U1HA 3QEGL 2AEPL 4WEBH 1NKRA 3ELAT 3VGAC 1D5ZB 3C9NA 3PL6D 4PGCA 1EHAA 1NCBL 4X5XA 3RNQA 4MX7A 2X1XR 3W2DH 3CH1A 4OAWB 4ONHA 4CN6A 4OJFL 4PJCE 5IJKC 2BVQA 3PHSA 2VDQH 3QWOB 4WWKC 3QIUA 3G04A 4OF6A 4ISVA 2E27H 4FTVD 5DUML 5I1KL 1U2HA 3MRGB 1OSPL 3CDGB 3C09C 4MNGE 1CICB 5JR1L 2V5RA 1XF2A 3UZVB 4YK4B 4ZFGL 2O5XH 3OAZH 2ATPB 2XKNB 4P9ML 4X7EC 4PJAE 2QQQA 4XHJC 1NMAL 5DHXB 4IMLB 4QHLB 1YEHH 3ULVE 3RWCA 2QQKH 2A6DA 1EO7A 2WIIA 3SDXE 2WUCH 4I5BA 4G6ML 1Y0LB 1FH5H 5DRWA 5FHAH 5CP3A 5HYIA 1T3FA 3PWUB 5BW7C 2Q6WA 1DL7L 1HH9A 4KROD 2P7TA 5HI4C 1JN6B 4PJDB 2LVCA 2DLTA 4NJ9H 1RZGA 4NRZA 1F11B 4X4ME 4WI6A 2P4AB 5DSCA 2UUDK 1T22A 1TVHB 5DFVC 4U7KA 2WZPD 3B3IB 2DTSA 1QLEL 5HHMD 4U1IB 4OZHF 2E7CA 3CXDH 4HEPG 2ZCKH 3GJFB 1HNGA 4ZO8A 2BVOB 5DC0A 3WFBH 4RA3A 5IBLD 1PG7H 3U7YH 2H2PD 1DVFC 4OFVA 2Y06L 4AIOA 1MCKA 1QO3A 1S5IL 2EE3A 4YHKH 5J4MA 2GTWB 3NTCH 3EHBD 3L5WB 3NABL 2VZVA 1GOFA 5T1KD 1ZGLB 3KNBB 4Z6AT 1QA9A 5JIKA 2GT9B 3PXJA 1OP9A 2DQDH 2R56L 4ONFL 5BS0E 1CBVH 2Q86B 2DKUA 5ICYA 1I9RH 4TVPE 3HB3C 2PW2B 3WDJA 4ZFZB 5C09E 1FNLA 4KDTA 2CGRH 5JIPA 5DDHB 1UM5H 4LLQB 4FOMA 4H20L 3QUKB 1F6FB 4KUCD 4WNQB 4LARL 5C0DA 4AL8L 5JQHC 4TRPH 5AAWA 5HYJB 4ODVL 4M7LH 4X9FA 3KHOA 1N5YL 1M1SA 3QIBD 4O2CB 3REWB 1LDPH 2PYEB 4GAJL 1AR2A 3MRRA 3CPLB 4J3XA 2C4XA 4OF3A 4BFBD 4WI2A 5HBBA 5DMYA 1I1FB 2JE8A 2Z92A 2Z8WC 3GMMB 4AYFA 3TLRA 4XPAL 1QFOA 4F7PA 4P2RE 2B1AL 2QKIB 3EYUH 3EOAA 4OZHB 2YS4A 2HT4D 3MGAA 5KOVC 1FVDB 2HLFC 4L9DA 4QT5B 3KLAA 4PLOB 4D9RE 1UM6L 4F7EB 4LSPL 5IG7A 3ME0A 3NIFE 3GIVB 2F54D 4MXWL 2Y07L 1H15A 3MCLL 3S88H 1FFQA 4RMUA 1CCZA 1UCBL 2MHAB 5JDJA 4JLRB 4R7NA 4PY7B 3TBWB 5IT2H 4X0KA 2BVEA 1DBAH 4XI5D 1AO7A 3BPOB 1LILA 2AJZA 1KENL 5DJ2A 5A2IH 3BWAA 4DFHA 1JZ8A 4CDHA 2NY2D 1CF8L 1AGFB 5GRUH 1U3ZA 5FYLL 3S8WA 2I5YL 2OCFD 2AJSL 3HR5A 3CFEA 2WQRA 4GAGL 2BHUA 4K3DH 4MAUL 4PJXA 4JRYB 1WLHA 5FA3A 4NN7C 4OGYL 4XCFL 4H0IA 2G60L 4JO3H 3OG4B 3RZCA 2HJKB 3DMMC 3MBEA 2PXYC 2CLVA 2OMBA 4ZXBB 3QCUH 3OKKB 4WY7L 3ARTA 4N5EC 4I8DA 1CT8A 4HUVB 3LQAL 4HWBH 1OB1A 2APBA 4HKZB 3QO0A 3DVNA 1S7SA 3TNNB 1J8HA 3DYOA 2EECA 4TUJA 5CEYB 5LAXA 4X9HA 2E8ZA 3CDFA 1RJZA 4P3DA 3DX7B 1Y18B 1LEGA 3B9KC 4R97B 2DM4A 1BEYH 4KKAD 2NY5L 5FO9A 1WBZA 1V3KA 3HC4H 5DT1L 2A9ML 3G5YB 1G1YA 3QFJD 3H9SE 4LOUC 4Q7DA 1T7WA 2Z4QA 4Y4HD 4RMRA 4IS6A 4MQ7B 4R7DA 3SO3C 3PWPE 4GRWH 3FB5B 4R2GD 5D7JB 4KVNH 1JK8B 2IANB 2BVPA 4NKIH 5FYJU 4JZOA 2VLJD 1P84K 2JJUA 1N0LA 3RWJB 1CXLA 3DPBA 1FG2B 2YD5A 5MERB 3AROA 2MJWA 4DN4L 1PZ5A 3F7QA 4KV5E 4DOHE 4HJGB 4CBPA 3BGMA 4ODHH 3SEPA 1BQHA 4PRDA 2B0SH 4NDMA 1X5IA 3T0XA 2VNCA 3EW3B 1MCDA 4WUKL 5MEOB 1BVLB 5J9PB 2W0KA 4LSUL 4WWKD 4BZ1H 4JM2A 4HIXL 4O9HL 4M48H 1N3NB 4TN9A 4HHAA 5CD5C 4A6YA 5DK2B 1T1XA 3IT8D 1IZJA 5EWIL 2C3GA 5KAQF 1NCBH 3QAZC 3BN3B 3UZEA 1YEFL 2X4OB 3U30B 4OV6F 3ORJA 3I85A 3IVKB 3ARGB 3HLAA 4OJFH 2VR5A 1LO4L 4AENB 4K3JL 5D2NB 5FM4A 4FTVE 3TF7C 4UOW0 1BQLL 1DANT 2HRPL 3T1WA 3QIUD 1KLFA 1A0QL 1JF1A 5HI4D 3NFNB 4TUKL 2DLIA 3F7RA 5DUMH 5I1KH 1KXTB 1OSPH 1DBBL 5JR1H 4K23L 1TETL 4XXCC 3RWGA 2DJ4A 2N4IA 5C0GB 2BC4B 5DFVD 3BZFA 1BOGB 4JPIA 4ZFGH 5ALBL 4P9MH 4X6CA 3T8XA 1BFTA 1ZA6B 1YDPA 3TBSB 1JNJA 1J0YA 4NQSA 4QXWA 4JHAL 1FN4A 1DVFD 1H3XA 1DL7H 3O3BB 1G7JB 1N64L 1NUGA 2HJLB 2QSTA 3AS0A 4KJYA 3MFGB 5F1KC 2E6JA 5HHME 5KAQG 1NQBA 1YPZF 1NC4A 4MB4A 1S8DA 2GSGB 4ZPVB 4L8BB 1QLEH 4XAWL 3BIKB 1W0WB 4I13B 2R39A 2JCCE 1A21A 3SGKC 4RBPK 4YDKL 3HB3D 3V5KA 4ODUA 3BPNB 3TO2A 5CBAA 1I4FB 2PW1A 2Y06H 1S5IH 1RK0A 4PJCF 4U1MA 2L4OA 4O51B 1MCOL 5C3LD 3EJZC 1J0KA 3KXFA 4Q97A 2QBWA 2HKFL 5IB1B 2D03L 3VWJB 4OM1L 4XX1G 3TBYA 3KS0J 2R56H 4ONFH 3CFKB 5DD5L 1PBYA 5D7KD 4HH9A 4PJAF 1Q9OB 4OKDA 3ULVF 1R3JA 3SDXF 1A7QL 4H20H 4Y16C 1XGQA 3DIFB 3P9MA 4LARH 3KPRD 4U1KB 4XVUC 4AL8H 5CSGA 3H3KA 1JHTB 4ODVH 5I0DA 2NXYB 4OM0L 1KIPA 1T7VA 1N5YH 4PRAB 3TO4B 1AHWC 1ED3A 2FJFB 1VENA 5DJ6B 4GAJH 3VXNA 1A6ZB 5DK3A 2I26N 5F7WC 3DROB 2NTSP 1YPZB 2H41A 2IBGA 4PJIA 1NGWA 3BGFC 4XPAH 2H32B 2B1AH 5E0QA 3AXLA 3RIAF 4WI8A 4HGKC 4FMFA 1YJDC 2F54E 1BFSA 1WCBB 3KDMA 1A3RL 1UM6H 1P1ZB 1NGZB 4LSPH 3QA3A 4PJCB 2YPLA 4MXWH 4BSWB 1CU4L 3MCLH 2XKUA 2X4NB 3BKMH 1UCBH 2FJHB 4PRNB 4F37K 5FGCE 3HCVA 2AJYL 1G7HB 3KHQA 2B1HL 3MV8A 3OG6B 4PTUA 4WW1A 5E7FA 5BZWA 2CKBL 1AO7D 3VFGL 4HPOH 1U8IA 4ZO7A 1PYWA 4FP8L 3VFWB 4PJAB 5B39G 1QLFB 1CF8H 4PLJD 2YBRB 5FYLH 2I5YH 5DQJB 2IALA 2AJSH 4MQXD 4X7FC 3SDXB 4GAGH 1PGRB 4MAUH 1KPUB 4ZAKB 2FHCA 3I02A 4XCFH 2G60H 5ANMA 4PTTA 4LEOB 2APTA 2WLYA 2MQ0A 1YA5A 4JFOA 3RZCD 5HHNA 3L3OA 3S36L 1BIHA 5B39B 4WY7H 3GEWB 1P4LA 3IXAA 3LQAH 2VSDA 1EA9C 1DUZB 4G8FA 1UH3A 1HXMA 2QV2A 4LOUD 4G80A 4JDVA 3LN5A 4RMVA 1DE4B 1A1MB 4HGWB 3NIFF 3AREC 3RUGE 1FZMB 2YA0A 5A16A 3MLWH 4G43B 1HILB 4YXLL 1NGYB 1KTDA 2NY5H 3QFJE 1VFAB 3HZYA 4K94H 2A9MH 5BS0B 4NO3A 2AQ2A 2IBZX 4DFIA 4QRTA 1NFDF 2DBLL 3HFML 5HPMA 2DQHL 2ZSWB 4Y5VA 5C09B 1KJMB 5C0BB 1T21A 4JE4B 5E6IB 5JW5B 2CDEA 2HFTA 1A8JH 2VLJE 4DGIH 3UYPA 1A4JA 3ARBA 4NN5C 3CFJA 2Y1VA 3M1BB 1IL1A 1X9QA 3P4MA 5DEFA 5CMAA 3DHJA 2WINB 4O00A 4C58B 3WL9B 4JHWL 5E8EB 1R5WA 5F9AC 2F74B 3S35L 5LJYH 2AP2A 4WJ5A 4P2OA 3RFZC 3WIIL 1MLBB 3CSBA 4DN4H 1I7ZB 1WICA 3HRZA 1FORL 1F58H 3GMLB 2MCPL 5ETUA 2H6PB 3X3FL 1UB6A 1LO5A 4JPWL 4QHKI 5J6HB 1OAYH 3QJFA 3KLHD 3DGGB 2J3SA 4WUKH 4QLRA 5CLWA 3GBNL 4ZUWB 3U4EA 1NC2A 4JZJB 2K9UA 3QI9A 4LSUH 3MV7A 3KJ4B 4HIXH 4O9HH 3FFDB 4JM2D 3VFMB 4P2OC 1WBXA 4MNQB 2R23B 1J1OH 1IQDA 5EWIH 4YR6A 2VDKL 2JJSC 5AZEL 2PO6C 1NFDB 1YEFH 2FATL 5J1AB 1JWSA 1REIA 4FQCL 1JGUL 2HMIC 1AP2B 2A6JA 2RJMA 1UJ3A 1ZKAA 1LO4H 4K3JH 3SDDA 2DQUL 4R0LB 1U8LB 1BQLH 2YKLL 2HRPH 4N0UA 1A0QH 3W5MA 4F33A 1DBBH 4K23H 4N90D 1TETH 3PWVA 1RIUL 1SM3L 1G7MB 4ELMA 1H3TA 4MJIB 4NYLA 1IAIM 5ALBH 4KV5F 2YRZA 3E3QE 4HK3J 2FD6H 1X4XA 1H0DA 2XACC 1UJ3C 1CD0A 3HZMB 1BX2A 4UU9B 3RWDA 1GH7A 4JHAH 1G7PB 5EUOF 3KPMA 5GIRA 2A6IB 2X4QB 1N64H 2HLAB 5IW3A 4OKVA 4HUUB 4HDIA 4YGAB 3D1MC 4WUUA 2AV1A 1X7QB 3T0WA 3G6AA 3OKLA 2GEEA 3QEUA 1F5WA 1NC4D 1KN4L 4XAWH 1NMCB 4TSAL 4XVTL 4YDKH 1XF4B 3NOIA 3RIFF 5FCSH 1JZ6A 5BQ7A 2BSRB 4YDLC 4P46A 4MSWB 2O5YL 4HAFA 1YEIL 2NY3B 5FK9B 3MRFB 3PWPB 1MCOH 1I3RB 4XVSL 3PF2A 3V4PL 3GSUA 4R96A 7FABL 2HKFH 5L8KB 3KXFD 3DV4B 1MHHB 3VG9B 3HN3A 4JB9L 5JPNB 3MRMA 4Z8FL 2CQVA 4DEPC 3VWKB 2E3VA 3WS6A 5I1IL 3SE9L 3L3GA 1QRNA 2Q3AA 5CWSA 3B43A 1JGEA 1YEEL 1R24B 3ARPA 3IRPX 3X12B 1I3GL 5E9DB 1A7QH 1P9MC 1M4KA 5JOFB 3OX8B 4EI5B 3LQZB 4IRSA 4DOHB 3HE7B 4YAQA 1I7UA 4OM0H 1RSFA 3ROLA 5IHZA 1E6OL 1ZHBB 5EUOB 4UIKL 1SVCP 3K2MC 5INDB 5J8OA 2CLRA 4JREC 2Z91B 2OI9C 4GUPA 2JCCF 4Y5YA 4C56D 1FGVL 4N0FA 5CJ8A 5F89A 2Y25A 1MUJA 5DZLA 3UYOD 2ADGA 5D1ZB 3NGBC 5B38G 4UINH 1A3RH 1XCTB 4KTEL 2OM5A 2NPLX 3LCYA 4I48A 3BO8B 1CU4H 4BKLA 4FTVB 1PY9A 3ZE2E 1MRFL 1M71B 3GB7A 2AJYH 4G3YL 2B1HH 4ODXA 1AO7E 2QLVB 5EZLA 2FO1A 2H8PB 3ZDXE 3MV8D 4L8SC 1XR8B 4J8RA 5B38B 2YUZA 1I8IA 4MJ2A 3EYVB 2CKBH 3VD3A 3DRQB 3VFGH 3GUTA 2ZOKB 1VKXB 4FP8H 2HFFA 1VFBA 4NQTA 4PJXE 4BJLA 4KROB 2RIKA 2X89A 3V8OA 1PEZA 5DS8B 2IAMC 3MLSL 4PRHA 3MJ8A 4KZDL 4ZDHB 4FQPA 4JVUA 1LQSR 1FZJA 3ARED 4IOFD 2QADC 3ULVL 1M7DA 4YGVB 1KB5A 5HHMB 1AKJA 2P8MB 3OKMA 4NCDA 3S36H 4GKNB 1HDMA 3O45B 4CNIA 1AGDB 3S7GA 5M7QA 3TIEB 4AEIL 3KG5A 1J8HE 5IHUL 4Z76B 2JCCB 1BBDL 1F6AB 2C3VA 2M8XA 4XH2A 5DEGB 3WLWC 1Q72L 4LU5L 3Q3GA 4PBWD 5MP6H 5T1KB 1Q9KA 3IDIA 5M94B 1DBML 4AIXA 3BI9X 3MLPA 1CK0L 4NUJA 3HUJF 3H8NA 4YXLH 3QDGD 3GBMH 3N1PC 4KPHL 3QNXA 4YHOL 3CUPA 3EO0B 2VMFA 1YNTB 2DBLH 3HFMH 4LVOB 5F8RC 3KWWA 5FECB 5IMKB 3B2VH 2DQHH 3U2SB 4GKOA 3QPXL 5IV2A 4LBEA 4LHJB 1V8HA 1JYNA 1CFTA 2J4WL 4GG8B 4TVPL 3WO3B 1SEBB 3BN9C 1I9JL 5F71A 1MPAH 4JHWH 5FA4A 4JJHA 4RWHA 1FSKC 1WISA 3S35H 1KNOB 3DURB 3QQ3B 4J6RL 3WIIH 4KRMB 4P2OD 1FORH 3ARZA 2MCPH 3QHZL 4QOKA 2CR6A 2X09A 3T08A 1PJ9A 3X3FH 1I7RA 2KDGA 5I19L 2EICA 3CFBB 1V3JA 2XFXB 3RUGF 3BD4A 2IH1A 2WIMA 1KCVL 3FL7A 2HMID 1YUHB 5TJWK 1IGYB 1Q94B 1B4JL 3IDXL 1NC2D 3QI9D 5AYUL 3MV7D 3S6CA 3HUJB 5D7IA 1IT9L 2DQEL 4DKFL 4PRPB 2X9WA 4OCRL 2VDKH 1IGFL 4WHYG 5I66A 5DRZA 1LEIB 4HKBB 1EEYA 2FATH 2BNRA 4FQCH 1JGUH 4G8EA 1GCFA 2EIBA 2ADIA 4MD0A 1EDQA 1BP3B 1CG9A 3NN8A 3EGSA 4Q58C 4BH8A 4HIIB 4ERSL 1RZ8A 1H8NA 1PKQB 3V8CA 3SDDD 4N90E 2YKLH 1W72L 2UYLA 4YQXL 2X4UB 5A40E 4RMQA 12E8L 1BFOB 3STLA 1K9TA 3MLZL 5GZOD 2W0PA 3O81A 5L8LB 1RIUH 4X6CE 1SM3H 3WN5B 4RMSA 1HQRA 1L7TL 1FV1A 4KGLA 2YPKA 5BOZG 3L6FA 4PB0L 3T0EA 1LNUB 1HSBA 5L2JB 1OT2A 4RGOL 1UKSA 2FX7L 4POUB 2VLKD 3ZTNL 2MOVA 3RUGB 2PR4L 1KGCE 1TJGL 5F1IB 2VZ1A 1RUPL 5C0RL 5IVZB 4WUUD 5BZDB 1BQSA 3L7EB 3Q6GL 1KN4H 3ES6A 4KC3B 1GC1L 1AGBB 4TSAH 4XVTH 4X9GA 5I71B 4RGMC 4R2GB 2O5YH 5EC2A 4P46D 1N4XH 1YEIH 4ZFFB 3KXFE 4HXBL 5CIPA 1C5DA 2VLJB 4QRPD 4XVSH 3BP4B 3V4PH 4L8CA 3EJJX 5IFAL 4JB9H 2OL3B 4Q6IA 4Q6YA 5E4EC 2ARJA 3E0GA 5I1IH 1JWUA 1UQSB 2FECI 1MNUH 5IB4B 1QRND 1ROWA 1YEEH 3EO9L 5SX5K 3VFTB 3L3HB 4UOW1 1JGDB 4PJ5A 1S9YA 1RZ7L 1I3GH 3PQYD 3UP1A 3RA7L 2AK1L 1INQA 5J89A 3OXRB 1TCRA 1QQDB 5HJ3A 1G6VK 2AABL 1E6OH 2FHFA 4WWKB 4UIKH 1XZ0B 4M61A 2OTWA 3MRKB 4IRJC 3OBAA 5F93C 4U1HB 3MGOA 4HMCA 1GGCH 3C09B 2R2HA 3C9NB 2GCYA 2DLEA 4X5XB 4XRCA 3L3KA 4LPCA 5MHSD 1BOYA 3CH1B 4MQSB 4ONHB 1Z0MA 2H32H 4KTEH 5DJZA 4CMHC 2BVQB 2YPLE 3OAYH 2X2YA 3MR9A 4URTB 4M4RA 4Y1AA 4NO2A 3G04B 3VRJB 3VFNB 3MV8E 4F7TB 2IAMD 4ISVB 4M7KL 3VXSB 1MRFH 3QP3A 1H5BC 3QDJB 4G3YH 2C1PA 2WM0A 3HG1A 2ZUTA 1T1YA 1M7IA 1RUKL 3PWNB 1Z6JT 5I1DA 4ZFOA 5DMIL 4B5EA 1BFVL 3C60A 1DVFB 1FL3A 4IMKA 4V2CB 1CVRA 1EUUA 2AEQL 3MLSH 2X89D 4G8IA 4GS7C 1U8OA 1VEPA 4KZDH 2DD8L 4X4XB 1RZGB 4PRHD 3ARDC 3WLWD 5DSCB 3ULVH 2AQ1A 2WMPA 3ZSSA 1AKJD 3GNML 5EIQA 3SKNA 1K4CB 2YSSB 5IHUH 1YMHB 4H1LG 5A2KH 4WRLA 5J12B 2DI7A 5TDOA 3LEXA 1TTUA 1CL7I 4IMKC 4U2YA 4N8VA 3S4SA 4I4WA 1Q72H 4HJ0D 5JMOC 2FSEA 5K9KA 1CFNB 4NKDA 4P57A 3NACL 3MACH 1DBMH 4LLMB 4H1LB 4L5FL 1CK0H 1DN0A 3GKZA 3ZDXF 4KPHH 3BN9D 4YHOH 5ICYB 4JFDA 5J1SC 4O02L 1IEAA 1SYSB 4JY6B 1FFOB 4AEEA 1CGVA 1QR1B 2ZUXA 4JFYA 3OMZA 4IHOA 5I1JL 3KPRB 5IHBA 2R1WA 5I73C 4HH8A 2DJSA 3P11L 4QCIB 4TVPH 1ZGLM 1IAII 5C3TA 2FZ3A 2VZOA 4XHQA 3UJIL 1KOAA 1I9JH 2A0LC 2EXWC 1IKNA 3QUXC 1R5IB 2P46B 3NCFB 5KANG 3UTSA 2Z92B 5FO8A 4Z18A 1EGJL 4D8PB 4J6RH 5I30H 2F5BL 4XZUB 3UTQB 1ULVA 3QHZH 4HWNA 2OQJB 4QOKD 5I19H 3GMRA 1XF5A 1AQKL 2HFEA 5IG7B 2VC2L 3WBDA 3S3SA 1P6FA 1KCVH 2DF3A 2W9LA 4OFDA 1H15B 3MV7E 1IKNC 1MCJA 1NBZA 1B4JH 3SGJC 5F6HJ 3T65A 1E4JA 4O4YL 4DCQB 5AYUH 3LVEA 2PXYB 2ITCA 4EZMA 1KF9B 1XIWC 1AO7B 5DHVB 3LQMA 2AJZB 2RB8A 3NCYP 5TDNA 4G8GB 2DQEH 2WV3A 4LCWA 5IMOA 4DKFH 3BWAB 4OCRH 1IGFH 5ACMA 1ITBB 4KRNA 4NOBA 5EU6B 1U6AL 2AJVL 3GSQA 5DJCB 1IAKA 3HR5B 5EO9A 3EYQC 5FA3B 5GGUA 5D1XA 4ERSH 4N0UE 1NCNA 4H88L 1RK1A 3CFDA 1CR9H 1W72H 4YQXH 2CLVB 12E8H 3B9KB 5EULV 5E5MB 3BPLC 4PY8J 4ELME 4RFNC 3MLZH 3VFRB 1SJVA 3QUYC 1CT8B 2PF6A 5E2WL 1L7TH 3P0YL 4PB0H 3MRJA 2N7AA 2VLKE 4XP4L 1JYXA 5D2LA 1QZ1A 4RGOH 2AK4A 2GSIB 4GXUN 2FX7H 2NZIA 1A4KB 3ZTNH 2VAAA 4XMPH 4JGMA 5HHVL 1LK2A 1RJZB 4LCYA 4WUUE 4JM2F 2PR4H 3UROR 2PCPA 3UZQA 1TJGH 1LEGB 4YHPA 3PWJB 4MZ3A 1I8MA 3LPGA 5FGBA 1RUPH 1S7XA 2VH5L 5C0RH 3VXPA 3VXMA 1LWRA 3Q6GH 4WV1A 4PG2A 1GC1H 3QDAA 3MPCA 1CFBA 1YN7A 5DA4A 3SDCA 5FYKD 2W38A 3I9GL 2KQNA 2Z4QB 4FRWA 1W8NA 1CIUA 3PIQA 3QH3B 4IS6B 2OR7A 4QRPE 1OT1A 5I1EL 2AXHA 4I2XA 1KULA 3LN9A 2CUHA 4HXBH 2AS5M 2EYSA 2BVPB 5I8CB 5ACZB 3DETC 4JZOB 4DZ8A 1VEOA 3JV4A 5IFAH 3LKSA 4X9BA 5EZIL 3LRGA 1QRNE 4EJ1C 3WNOA 2HVJA 4NKOB 3DYPA 1FL6B 4XPFL 2JF1A 5HYSG 3VFSA 4XNQB 3PQYE 3TZVC 3EO9H 2P44B 3OJDA 1PZ5B 2I9TB 3QUMA 1RZ7H 3BP5A 1JNNL 3QAZB 1PX3A 3LKOA 1YQVL 2EXYC 1XAUA 3DHMA 1EXUA 3RA7H 3VFOA 5F1NB 5E95B 4PRDB 3K4ZA