1OPGL

Opg2 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
DELLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGGGSKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords OPG2 FAB (LIGHT CHAIN)
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1995-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL01
1SBBA 4QHUA 3OR6B 4LEOA 2VXSL 4KJPD 2HTKD 2G2RA 3O3DB 4CMHC 5I18H 4RAVB 5C07A 3NVQA 3L95B 3FO9A 2Q8AL 3TBYB 4PUBH 4JG1L 2XKNA 3PNWB 4U1LB 4JFHD 4ONGL 4ZUSB 4I8DA 5E8DL 4E9LA 3LEVL 5GHWL 5D7IE 3UTTA 3DUSB 3VFRA 4YQXL 2VZOA 3ARDC 3MLWL 2CLZB 1N0XL 2IGFH 3MLZL 4KWUA 1YEFH 5MERA 4KVNH 1G6RB 5DJCB 3LDBB 2DLFL 4L9LC 1D5BB 1AXTL 3KYAA 4JO1H 1NAKL 4PJ8B 3QQ3A 2UY6A 1AO7A 1BWWA 5T3ZD 1RUML 4FOMA 5FYJU 4A2MA 3ZO0A 4OKVB 1VFAB 2VQTA 3VRJA 1QBLH 1TCRA 5F9AC 1I4FA 3WFBL 3KPRB 3U36A 1VPOL 5JIKA 5JA9A 3IB4A 1J11A 2NY2C 3LKNA 4ZDHA 2EH8H 3GSRA 3BQUD 1B4JL 3O3BB 1CF8L 5DA0B 1TETL 5DJ8A 5IF0B 3VGHA 4BJLA 4PS4L 4FQXD 2R1WA 2YA2A 1KJ2L 4FG6D 4PJEF 4G9DB 4IRJC 4LMQI 1ZGLM 2VL5B 3HMXL 1JL8A 1SJXA 2N7BA 1EZVX 2OSLA 3H0TB 4PLKD 4OBRA 4V2BA 4XPTH 3KWWA 5ITFB 1LP9F 2DQTL 2AXFA 2DQJH 1UACH 4LEXH 3SEPA 2D0HA 3VXPB 3DMMB 5DZNA 3O4LD 4UNVA 4MLSA 3T3PF 1I8LC 2AV1A 4AEEA 4UQ3B 4GAGL 3QISA 5CEYB 4ALAH 3B43A 3GO1L 4M5ZL 2IBZY 1PSKH 4F9PC 2BNQE 3B3IA 4AMKL 3DVNB 1AGFA 3H8NA 4RFEB 1HXMB 5KTEH 3T1FA 3FN0L 2YPVL 3LPGA 2ICWA 3JTSA 2ICCA 4G6JL 1QLEL 1T7YA 1ZMYA 3O8XB 2HTLC 2GJJA 2EYSB 3PL6D 2FX9H 5D1ZC 4OIIL 1FLTX 3CJJA 1FRGH 1A2YA 1R5VB 1U92A 3MRIA 1A1MA 2DIAA 2YPKB 5IM7A 2AEWA 2X70A 2DLIA 1OAKL 4G9FD 4YXKL 3C2SA 1BBDL 4HGMA 2D2OA 4YAQA 3QIBA 2WMPA 1D6EB 5DMYA 1R24B 2CR6A 3TNMB 4HBQA 4YDVA 3WXWH 4XVSH 4RBPH 3SJVA 4G8EA 1QSEE 5KW9H 3EJZD 2KZWA 1U8OA 1XGPB 2DJ4A 5C0CE 3DSFL 3U2SB 3BKCH 5HGAA 3VGAB 4LVNC 2E7LC 5JHDB 2E27L 1LO2L 1GGIL 3U6RB 1VACA 5D2NB 1MCKA 3AREA 1LE9A 4XCEB 1FV1A 3EOBA 3O3BA 1N26A 4K3EL 3RY6C 3HE6D 2QSTA 1A8JH 3BH8A 4M5YL 1MCNA 1BOYA 3WEXB 4ZSOE 1GC1C 5IMOA 2QQLL 1MLBA 3MLUL 5HVGB 43C9A 2OL3A 1FSKC 1J1OH 4KDWA 5ILTL 4RNRB 2Z92B 4JHZA 2IANE 4Z7UA 1DQDL 4LRIA 3B9AA 4OZFG 5F6IC 1GL4B 3OAYH 1PEZA 3BZFB 1YY9D 3IU3A 2X4TA 5B4MC 1WIPA 4NZTL 4WHCA 1WF5A 5SX5H 2WQRA 1FFRA 2APXA 2PO6D 3OAYK 2ZNXA 1F45A 3QQ4B 1JK8B 3RZWA 2HMIC 4LSUL 4PRBB 3FFCA 4PJDB 1N2RA 3DMMC 4P5TB 2XZAH 5I1EH 4G8GE 4YR6B 4CW1B 5DQDH 1X9QA 4LSVL 4YFEA 3NFSL 2PYFA 1T1ZA 4NRXB 4OCNC 2PCPA 1NGZA 2DMBA 5ID1A 3MUGB 1JHKL 1RZIA 3VG0H 1BMGA 4P4RB 5I8EB 1NAMH 4Q2ZA 4UDTB 4Y1AB 1JI2A 4PJEA 2NY5L 4X6BB 3Q1SH 3KXFD 1B0GB 3AREC 5D7JC 3IDJB 4HKJB 2EXYD 4GRLB 4JDZA 4MMZC 3TA3D 4OZIA 1I3UA 1FQ9C 1BM3L 2DM4A 3ARFB 5D8JL 4EBQH 5JIPA 3SDXB 4M8VA 1XGRA 1VGEL 1KXVC 1P4BL 4ZMAT 5JDJA 5IW1A 4I4WB 1A1OB 1FYTD 2DI9A 1RV6X 3QUXC 5DMJB 2ICWJ 2ID5A 3QA3B 4WI2A 4JDTH 2QKIB 1TCRB 1CL7I 2YRLA 5BZDB 5IMLB 4R90H 5EFIA 4JM2D 5IK3A 5C0AB 3KDMA 4P2CG 1JGDA 4AJ0A 1CLOH 1HKFA 3L7EB 5FKPB 1NFDE 1JWSA 5EWIH 2J88L 4PJEE 1NMAH 3DOSA 1QSFD 2YC1B 4CJ0A 5I71C 2UUDH 5KVDL 3HAEB 3DX9A 1F11A 1URLA 5IEKA 1WT5C 5GRVK 4MQXC 3TBSA 4EDWH 2BY2A 4OZGB 5MENA 2VABB 2Q1EA 4PJHB 1LO4H 3WIHA 3NA9H 3FB5A 1AD9B 4PJGB 3HZMA 4G8GA 2CKBA 4M7LH 3OKOA 3TPUB 4JPWL 3HC3H 4ZTPH 1I9JL 2CJUL 3ARDD 3QHZL 3HFMH 3ISWA 3LPFA 5D7IB 2NY4C 2XOTA 2FD6H 1DE4A 4NZUH 3WJLA 3CX2A 1ZT7A 4UT6L 5I1KH 1N7MH 4H0IA 2FR4A 1QBBA 4XC1L 3VD7A 2B1AL 4ELMA 4CNIA 2V5MA 4JQIL 3CXDH 5J11B 4KTDH 2IANA 4Z7UE 1BVKA 4WY7H 4NZDA 5LCVH 4O4YL 5GGTL 4LLQB 1YPZB 4Z8FL 3KR3L 4U1MA 3V0WH 3VG9B 4OB5H 1N59A 4ZSOA 4XP1H 2W92A 1QFWH 3GMPA 4Y4FA 3VXRD 4TUOB 1F13A 3O6LH 3UXFA 2ICEA 3OMZA 1WBXB 2ICES 3MBXH 4KUCD 4Z7WE 1DFBL 3C8KB 2OYPA 3BMWA 3UJJL 3UYOD 1MCBA 2BMKA 3GSQB 1T1ZB 1HWHB 3IFPA 4ZO6A 5A1AA 5E5MA 4F7TA 1WT5A 5T5FL 43C9B 3L3IA 4GUPB 3BP4B 4KMQA 4KY1H 1BQLL 1UA6H 1S78D 2A9NL 4NJAL 5C0JB 5J1AB 4XPFL 1CFSB 4F3FA 4DWHA 5B38A 3O41A 4TTDC 1IGJB 3T0DA 4XCEA 5TDOA 4NCDA 1J18A 5DHVA 1DLHA 2I9LA 3NIFE 4PJ8C 4PBWD 2XN9D 2EDBA 3GHBH 3WS3A 1PLGH 2ZUQC 5JOFB 1MJUL 1CGVA 3M1BA 3PV7A 5DUBB 3RWHA 4D94A 3S88H 1PVHA 5D7LA 1BQHA 4I3SH 2BDNH 4G8EB 1CICA 4Q9RL 1MCIA 3HS0A 1T83A 1YMMA 3QQ9D 4HULB 3IXTA 5FA3A 3LB6D 5DEFB 6FABH 4H26B 2R0KL 1A7PH 3OR7B 1J1PL 3GJFB 3MUZ1 3DHMA 2BNQA 3AREB 1BQSA 4WI5A 4LCIL 2UY7A 2P24A 3BWAB 3GBML 4KRMB 4QCIB 5KVGH 3LS4L 5KS9F 4OCLC 5HHQB 1H3GA 4MA1C 4OJFH 4XPHH 1FAIH 3O3EB 4M6NL 2GITB 4XBPB 3MOQA 1V05A 4AL8L 4I77L 3BZFA 4XTRD 1I1AB 5C09E 1XCQB 2I24N 1C5BH 2CRZA 3U30B 4IRSC 1J8HD 2F5AL 3DVNA 3QO0A 2BNUB 2OBGA 3EJYC 2MFNA 5E1AA 1ZLSH 3QEGH 5DRZA 1HH9B 4FFYH 4AEHL 4OUUA 3GNML 2G9HB 4Y16B 4HUVA 1EFQA 4H88L 3TN0C 4L3EA 3DROA 2X4NA 5E7FA 3T0EB 4RMRA 3LY6A 1DTUA 3VXTB 2NY1C 2HVKB 5CEZD 2OSLB 3H0TA 1JNLL 4PGEA 1MHHA 1SYSB 1NLDL 3RX7A 1G7HB 1MJ7L 1M4KA 4MHHG 1AQKL 3BN9C 1ES0B 4U3CA 4EIGB 2AXGA 2EC9T 3JWDH 1ZWIB 2OQJB 4I5BB 3WD5H 3F12A 4LASH 5KN5B 1ZA6B 1LEGA 4QHMB 5C2UB 1T0NB 1YY8B 5EOCH 2F19L 3I2CH 1NFDF 2Q76B 1MQKL 2HTKC 3TBWB 3RWIA 3KHOA 1TITA 5I0ZA 3ULUD 3TVMA 1MHEA 2R0ZH 4YE4H 2YK1L 3R4DA 3GJFK 5D7IA 5L2KE 1IE5A 2AEIT 3T8XB 4N5UA 2WBJA 4WI7A 3TO2B 1XGTA 5GZND 2DBLL 1UT9A 4G42A 5DJ6B 2IBBA 2XG5A 2EYSA 3OXSA 3QIWC 2OXHA 3I9GH 2Y7QB 3VFUA 4YHLL 3C6LC 1FFOB 5F21B 1UKSA 1L0YA 1A6WL 1X5FA 2P7TB 4GS7C 1N6VA 5ACMA 1I9RH 1DQLH 2AJ3B 2UV3A 5DC4B 2EDLA 4LLWA 5AZEL 1T7VA 3TJHD 2XTJE 4P3CH 4J3OC 1J8HA 5EU6D 3N50A 1J05B 4LIQL 4RISL 3MRDB 4I2XE 5HHME 5LGJA 4UTBH 4ZTOH 4Y4KC 1S5HA 2FBOJ 2XKSA 3VXOA 4GSDL 5EO1A 4DAGL 3QYCA 3UTSB 4P9MH 4L5FL 1F58L 3O3DA 3MACH 4MJ4A 2DLGA 3SDXE 3L6FA 3TIDA 2R69H 5E00B 4ZUUA 4IS6A 5ADPH 2JB5L 4M93C 2W0FA 5EDXA 3SKMA 4G9FB 3PGFH 4HF5L 3D85D 1YN7B 4NN5C 1A14L 2ENSA 3O9WB 1CT8A 1IC4L 3ZE2E 2LTQB 4MCZA 1LEIA 1N5AB 4V1DE 3NA4A 5FGCE 4WHTB 1OT2A 3LKNB 3PP4H 3TT1H 1L0QA 3SDDA 5CZKA 3EGSB 2AJVL 4NFDA 1QFUL 5A40E 1B0GA 5JZ7D 2VERN 2Y07H 5FUCC 2W9DL 4EI6B 1A7NL 2VYRE 5D2LA 5KW9L 4ONFL 5AG8A 5A2JH 4YDKL 1YEJH 2DMCA 2F15A 4QY8A 1OPGH 2DYPB 2YXFA 4JLRB 3MLXH 2VL4A 1NGZB 3CMOL 2HKHL 3MV9B 5FUOL 4HUWB 4FHBD 1MEXL 5JDSB 5E2UH 4GMTH 3QO1A 5TPWH 3GSWB 5F6HI 4M1DH 4MNHA 3OWEA 4OQTA 3EOTH 3SGKC 1LDPH 1B2WL 1YZZA 5KANI 2CMRL 2VXTL 4XCYA 2H41A 5D1QD 4FABH 4D0BB 1A7BA 4FTVE 4YZFE 2AERT 4OF6A 4IM8A 1J0IA 5DYOA 5HYJD 3EYSL 3UTQB 2BSSB 3L5WB 1FZOA 3H7LA 3ARGA 1ZSDB 2FZ3A 2PO6B 3VXME 3ORJA 1GAFL 5J3HC 3MLSH 1J5OL 4GLRH 4RA3A 2Q20A 4OZIB 4U1NB 3SKMB 3GMNA 2YA0A 4UIKL 1S7UB 4L3CB 5KS9E 5IB2A 1GGCL 3P73B 3HC4H 2J8UE 2DTML 5IMKA 4L8BA 4FA8A 3SOBH 4TRPL 1I85A 2FCBA 1G7QB 4MQ7B 1RJLB 4Y5YB 4X9HA 5GS3A 4L4TE 4JFEE 3PDDA 4HJ0D 4CMHB 4YO0A 3CFEB 1CD8A 4BSWB 4MA8L 5FDWB 1E6JH 3SKNA 1AIFB 5HYIA 3N9GL 1A64A 2PW2B 1RU9H 4HC1H 4KKBD 4CW1A 2DICA 4TNWF 4U1IB 4F37K 3ULVC 1RUMH 4TSCH 1UQSA 3MV8A 1EHAA 4YHKH 2VAAA 1A3RL 1KIUA 2P7TA 4OAWB 4IS6B 3QJFA 4Y5XA 2C7UB 1JWUB 2HLAB 1BM3H 3HZKA 1KPRA 4WTXA 4PBVC 1WWBX 3EOAA 4M7LT 3MRKA 3TYGL 2HH0H 3TJEH 5EO0A 3T2PA 4F2MA 1MLBB 3NABH 3L3KB 4D9RE 4OUOA 5FYLH 2WV3A 4R90L 1YY8A 4X7EC 3B5GA 4HS3B 1OB1A 5E99H 2GJ6E 2RFXA 3K2MC 4ENEC 1UWEL 4HJJL 1LE9B 1S7TA 2QSCH 3DURA 3HAEG 4J6RH 2H2PD 2FHBA 5INCA 1EO8H 4PGZA 5F97E 3LH2L 1DP0A 1V3LA 1FCGA 3JVGA 1YUHA 1I1CA 5B3JE 5C0FB 5J9PB 5F3HB 1SJEB 2OCFD 3WFZA 4XP4L 4M62L 4KZEL 5ICYA 1KTDB 1ZTXH 1IQWH 3U9PL 1JV5A 4FNLL 4YUEH 5DSCB 5FO8A 5ITFA 1NJ9B 5B8CA 4MD5B 3IETA 5F8QC 5GISL 2P5ED 1IEHA 4JPWH 4QF1B 2FX9L 3FO2B 2A74B 3NN8B 1B6UA 3U1SL 4MQTB 3GSUB 3UBXB 1NANI 5KS9B 3L1OL 2XRAH 1ZS8A 5FO9A 5D93B 4IDJH 3OKDA 3VWJD 3C5ZD 4PGBA 4C59B 1IM9D 3D2UA 1N7ML 1QRNA 2DQIH 5HGHA 1FFOA 1G9MH 2D7QA 3CZFB 4IRSB 3REWB 2XACC 1R3JB 4NSKB 3S35H 2X5PA 5K33A 3V6OC 3MBED 2I26N 3PWJA 1AFVH 4HWBH 1Q9WA 2QADD 3C5ZA 2H26B 3FB6A 2AJUH 5K9QG 1CD9B 2ESVD 1KCRH 5ALCL 1K2DB 2C1PA 5I1JH 1I75A 4FS0A 3SGEI 1ZGLP 4PJ7F 4RRPG 1I3VA 3HUJA 5DJZB 1MCPL 2HFEB 4YXHH 5CIPA 4J2XA 1W0VB 1OGAE 4BH7A 5KZCB 3BH9A 4HX1B 2X4UA 2WUCL 4FQ1H 4LK4A 2ADIB 1AGBA 4O2EB 2ED8A 1WUNT 3B5TA 4NUJB 2EDEA 1H5BC 1W0VA 4K8RL 4LL9A 4NM4H 3DROB 2J5LB 4YAQB 5IQ9A 4IJ3C 4NJ9L 5KJRL 3QUXB 1OTTD 3KHQA 4M6AA 3AM8A 3KG5A 4OF7A 3RZCA 1VKXA 5JW4Q 3FB7A 5IB1B 1KJMA 4JZOA 2GTZB 3LMJL 2VLJB 3D9AL 4Y4HD 1MIML 5FK9B 3ZKMD 2WUBH 3K0WA 5AAMA 3QEQA 3KLAA 1IAKA 2FEDD 4FQQA 2Y06H 3MRCA 4ZNEA 1KTRL 3QCVH 4P2QA 3K1DA 4JO3L 4O2CB 4UDUA 3HMWH 4NP4H 3VWKC 5IOPB 3P11L 5FYJH 3UBXA 3TC9A 3QAZC 2FO4A 3QEQD 4YHIB 3G5VA 3IJSA 2FL5A 3RGVB 3G5ZB 3IU4L 3VWJA 2IPKB 1LGVA 1UXSB 3HC0A 4X6DB 3FB8B 1AQDB 3QFJE 4F9PA 5JHDE 4FZ8H 5D6CB 2R9HC 3PWLA 2V5YA 1VGEH 4EI5B 1DLFH 2MKLC 4PY8I 4F7CB 3OB0K 3JV4B 1MFAH 3P4NA 1X5HA 3S36X 2BY1A 2XG4A 5BS0D 3U0TA 3BISA 3PWPB 4ZSOB 5I74C 2UZXB 1S8DA 4GXVH 2D7MA 1U8PA 1S9VA 1PYWA 5D1ZA 3MO1B 3G5YB 2BRRL 4GAFB 2RFXB 3PG2A 4F9LC 4EN3B 3MFFA 3C60D 5IVXA 3EFFB 4PGDA 2VABA 3D0LB 1YJDL 4LLYB 3TJHC 1MJ8L 1PX4A 3TZVC 4LLMA 1EGJH 2LVCA 2V9RA 4F7TB 1LO2H 3FB6B 5F44A 3VI3E 4BFEA 3L7EA 5FKPA 3BESR 2V2XB 2FLBT 5D1QA 5HGDB 1UZ6F 4WCYL 5I71B 5E5UB 2D31A 1D5BA 4UB0H 1DBML 3PQYB 1P4IL 3QULA 4Q6IC 2D7NA 2PXYB 3WIFB 5AG9A 5I73B 1R3HB 2A6JB 1JYVA 3RY6A 1FZMB 3MRMB 3QNXB 1JE6A 2PTTA 3DGGA 1C5CL 1EEUA 4IOSD 4NQXB 5B3JF 1A6VH 3U7YH 4FQXC 3VFTB 4WJ5A 3TCLB 5F1KC 1BVLA 5IVOA 4LLQA 2NPLX 5C0ND 4XPBH 2J5LC 4MXQC 4FXKA 2VZVA 1LNUB 3PWVA 3OX8A 1MRDH 1FZJB 4QRRE 3G6JB 1I8IB 1W0WA 3WSQH 2EO1A 4OM0H 4MAYC 1INDL 4ZOCA 1F6FB 2A6IB 1RIVL 4DEPB 5DJ6A 3K4ZA 3QDAA 4X99B 1OTTC 4B5EA 1G7LA 5FECA 5CCKL 2QEJA 1NKRA 3UBXG 5IVNA 1W0WB 3WNPA 2YPVH 4I48A 3ULVF 1J1XH 3L3DB 3QUMB 3LD8C 4U1GC 1MUJB 3VXRB 3DSNA 3QDGE 2AV7B 3WMSA 3BT2H 1W0YT 3QH3B 5I75B 1NAML 2I07B 4ZO7A 1CDCA 2BHZA 3PL6B 3VMNA 4D8PA 4M1GL 2ZUUA 3EJYD 2FD6L 3E0GA 5CFHA 4GXUM 1ZHKA 4UT6H 5I1KL 1HHHB 1K5NA 3VE0A 2Z31B 2F53D 5DQ9A 3PWPE 4MAYD 4CADA 4NKMA 1DJSA 5GGTH 4PJIE 1TZHA 4UOW1 2BOBA 3VFOA 3GRWL 5EIIA 1GSMA 5T1LB 3LIZL 3RZCB 5C08D 5FO7A 4JDVA 1KC5L 3NZ8A 3KPSA 1YQVL 1MPAL 3CGTA 4YK4C 3SQOH 4F9LA 3P0YL 5E9DB 5J6HA 5IVXB 4IOIA 3JXAA 3UYRH 35C8H 5GGVL 4DCQA 1MCEA 2FECL 1ZT1B 4X4XA 2X09A 4M5YH 2J88H 4AG4L 5HHQA 5F9OH 1CE6B 4G8FA 4HPOL 3R8QA 5JQ6H 1XGPA 4XAKD 4RX4A 3D39B 1AKJD 1NCWL 5FIEA 4CRPA 4HUKB 1RURL 4G8IA 1DQDH 2QSVA 3EOYG 4BFIA 4NQCB 2YXMA 2QV2A 5FGBC 5L0QC 2VXQL 2VDLL 3H9SD 3QI9C 1UZ8B 5DD5L 5DR5L 1CDJA 4OCSL 5CD5C 4UILH 1MFDH 4CU7A 5KSBA 4XVTH 3G9VA 1S78C 25C8H 3VI4E 2H8PA 4M48H 1N2RB 3QDHA 4JFFE 4K7FB 2R29L 5GZOC 3PV6B 1EJOL 1A2YB 4Q9RH 2HJFA 4NN5B 4U1HA 3QQ4A 1NC2A 4HIEA 2CUIA 5K59F 3VJ6A 3REWA 1QKZL 2W9EH 4E41A 1QPPA 1Q0XL 1QSED 4FXLA 3NGBB 3TZVB 4DGIL 4GRWF 5IVZA 5EN2A 1R24A 3ZT7A 2Y25A 5B38B 1CDBA 4NQVA 2P8LA 3HE7C 4KRNA 2A9MH 1GYAA 5JLZB 1FL5B 2OL3H 3JWOC 1UC6A 4MDIA 4LU5H 3RJQB 4KK8C 3EO1A 3TIEB 1AGDB 1MCHA 1OCWL 5C0CB 3FTGB 1OTUC 1A1MB 1FP5A 1SMOA 3JV0A 4P9HH 1JMXA 1NC4D 2ITDA 4PGCA 5D2LF 2D7TH 4JRYD 4PIRF 2GT9B 2V17L 5FUCE 1JJUA 1R3IL 5DMGC 2BHYA 1RUKH 4P2OC 3IJYA 2MQ0A 2OQJA 4I5BA 1JGLL 4QTIL 1CQKA 1DEEB 3STLB 5BVPL 2QR0A 4OLUH 2HH0L 3QIBC 3RL1A 3OPZL 1Z0MA 3UZQA 1CBVL 2J8HA 2OJEB 4NQSB 3K8LA 3V6BR 2HP4A 3CCHA 5DJ8B 5IB5B 4IRJB 3VDBA 3QG6B 3O2WH 2IPTL 4JFZH 4XMLL 4U7MA 3ZE0E 1EMTL 1HE7A 2Y6SC 1AQKH 2QSCL 4OKVA 2BSTA 3AAZA 3D39A 3FTGA 4PJ5A 1UM6L 5ISZE 4DZ8A 1JGUH 4N9GB 3ROOB 4FFZH 1UFUA 3S3PA 4KGJA 1S3KL 1J1PH 3VCLB 3OX8B 1ZTXL 2EE6A 4BH8B 3SY0B 2FIKA 5HSFA 1WK0A 2XTJC 1V3JA 3P4MA 1W72A 4QHLB 3NZ8B 1ZT4A 1F11B 1PG7H 1VFBA 1AHWB 1L7IH 4F33A 1PJ9A 3T2NH 3BP7B 4PB9H 4I77H 4G6AC 5TDPA 2H8PB 4R2GC 5DURB 4JM4H 3GJFA 4Y89A 4WO4D 1H3TA 1LO0L 5I66B 5DTFB 5HYEA 1LEGB 5LGHL 2NTFB 3NCJL 1T21A 3ARTA 3B83A 3TVMD 5M95B 3GMRB 4OZ4B 5CMAB 1GPOL 3ZKSD 4X6DE 4LNRB 4PGEB 4NO2B 3X11B 4PFEA 3IKCB 4OT1H 4PJCA 5DYOB 1JPSH 1U8HA 3DMMD 2R1YB 5EUOE 3RWJB 3OKEB 1B2WH 2E8ZA 2R23B 3PABB 4P59L 2WUCH 2FATL 4FQ1L 4NQEE 2A6IA 3CK0L 2AKRA 4GUPA 1ZGLA 5B4MD 3TT1L 4NRZB 5HJ3A 2XTLA 5I1LB 3T3PE 2PN5A 5D6DA 3X12A 2PO6A 2E9WA 3BPOC 1A5FH 4K9EL 5EU4A 5M94B 2Y5TA 1RSFA 3QXVA 2J8UB 5KJRH 1G7JB 2BNRE 2FJGB 3LQAC 4K7PX 4HIEB 3WHXB 2VR4A 1Z6JT 4O9HH 3QFDA 4MJIA 3QIUC 1U93B 3QDJA 4NO2A 1A7PL 1MAML 2DRUA 4BA8A 4XPGH 4DOHE 4FZEL 4FQCL 4Y2OA 3VXRE 3K2UL 4HDIB 3C60A 1VENA 4RIRA 1VKXB 3VDCA 2YUWA 4LLMB 3W5MA 3P9WB 3TBVA 3TA3A 4JFQB 3HS0B 1KTKE 5IBUG 1CDGA 4TSAL 3VH8A 3BEWB 5EIQA 5EZOH 2YZ8A 4PJHE 4HDIA 2F8XC 4GSDH 2XA3A 3ULVH 2X4RA 3C8DA 3T0EC 5L8JB 2E8YA 3ESUF 4ODHH 1U91A 2XYCA 3C5ZC 1CXIA 2FX8L 1YEEL 3GHEL 3KYNB 4LQFL 1WJ3A 1BX2A 3BUYB 1T03H 1BGXH 4HT1L 1DQML 1PZUB 4H88H 2Y9RT 2EYRB 4MNHB 3RVXD 5F7DA 3BN9D 3DRQA 1QR1B 1FZMA 2LU7A 3MRMA 3QNXA 1X6NA 4I0PD 3K74B 4WFFD 1XF5B 2EDXA 1TVDA 4RRPA 3HE7B 1P2CA 4F15C 5T1KB 4CN6A 5D4QA 4KZDL 4UTAL 5BRZA 4QT5B 3W11C 4OQTL 3D2UD 2YPKA 2R2BB 4XXDA 1OAQL 5IMLA 1EJ6A 1Q9KA 4Q9QL 1C7SA 3SDDD 3IAPA 4DKFL 1K8DB 3LQZA 4NWTL 4TUKL 1RIUH 3P4MB 5IFHH 5JW4N 4NO5A 2NY0B 1P4LB 1U3HC 3F12B 5KN5A 1MREL 5DQJA 4GW4A 1G9MC 5IB4A 1UWGH 4FABL 3F5WB 4JFEB 3KNBB 3HZVA 1OD7A 4MJIE 3MXVL 3K80A 2BNRB 1C5CH 3ROOA 4LHUD 4LSPL 3L3OB 4OI7A 1FZKB 5CEXB 4MD5A 4XNUL 1U3ZA 1OGTA 4OV5A 3TBWA 1FCCA 4AIXA 4IHOA 1J5OH 2VUOA 4OZHA 1MJJA 2DQGH 5DJDA 3QG6A 1YMHB 1U41A 1B9ZA 3NPZB 4I2XB 3MTRA 4P3CL 2ENYA 4KK6C 1JGVH 1LVEA 2VB5A 4FRWA 5DVLA 3S5LG 5KANG 4P2RA 3UMTA 5INCB 4NQEA 1T1WB 3JSSA 5CIPB 1OQXA 1NQBA 3SE3A 3NBNA 5IKCA 2HTLD 4Y19B 1WTGT 4ZUVB 1FFNA 1G6RL 5C0AD 5JOEA 1LK2A 1RFDH 1PAMA 4PJCE 3VXTA 2GY5A 3PDOA 1JZ4A 3AXLA 3KPNB 1MI5B 2O61A 4TNVK 32C2A 2CGRH 5I15L 5I1HH 3VG9C 1MWAH 2EICA 3BIBX 5I30H 4BK5A 3ULUE 4HCRH 5EORL 4N8PA 4LRNL 4NQVB 2YKLH 1GC1L 1KPVA 4WI6A 3X14B 4QYOB 5T1LD 1IFHL 3G5YA 1MCFA 1DQTA 1G9EA 1JUFA 1INQB 1TDQA 3VMPA 4S11A 3GBNH 1XR9B 1KCRL 5ICXB 1X5IA 4X4MA 1YQVH 3S96B 3SGJA 4P4KB 5C1MB 3J7HA 1DLHB 4ONOA 4YNYB 5F1NA 1LK3H 5EU6E 4HIIA 4HD9A 4KDTA 5B39A 4HUVB 2J4WL 5IUSA 2VLJD 3PGDA 4CVUA 5IJKA 4JJ5B 4GRWB 4NKDA 1OTUD 5IOPA 2VDKH 5F7EH 1KIRB 3IFPB 5D7LB 4QEGA 1YEKL 4IMLB 1WZLA 1GOFA 2IH3B 3D39E 1QACA 4HS3A 3SHSA 2NY1D 3ARWA 3HRPA 3AMLA 4WFHD 3P4OA 3E3QC 3IDGA 5E8PB 2Y5EA 2EIZB 1GH7A 5EWIL 3IFOB 3O6FD 4ZXBB 2X9YA 3MMEA 4JQVC 4D0BA 1FNHA 1ZS8B 3A6BH 2K9UA 5FHAL 3PL6A 1X5XA 4HG4J 3OF6D 1CWVA 1S5IH 3FONB 3H9SA 3O6ML 3ARFC 1B0RB 4CL7A 2EH7H 5J57B 1HSBA 1MCSA 2GIYA 4M6OH 1JPTL 5HHOD 1AKJA 3KWWB 3MRGA 3PP3K 3QSKB 3ESVF 2FDBP 3KPQA 2XIDA 3N1MC 1UCBH 5T1DH 1WISA 5D7SH 1G9NC 3NPSC 1A6UL 3V2AR 4RDQG 4N8CL 4AY0A 4PJAA 3WUWG 2HFEA 5DQJB 1CQYA 4DCQB 2BSRA 5HGBA 3B6SB 4WCYH 4AEFA 2EKJA 4WV1A 4F8QA 1FC1A 4OB5L 3ULUH 1PZ5A 1A3QA 1E4XL 5JPNB 4NQDD 2O26U 1EHLH 3HPLB 3V4UH 2PTUA 3OGOE 1OGAB 1IT9H 2PTTB 2UWEE 4NNXB 1O5DT 1RULL 1INEH 5F9WB 4U7KA 4ZQKA 5F7FA 4WUKL 4AQ1B 4J3TA 1T1XB 5FHBH 1F4WH 1KLGB 3NMEA 4JKMA 5TF0A 4JFFA 3SGJC 2MCPH 1I8KA 1CICC 5BXFB 4JFPA 4PPTA 3NCBB 5IGXL 3LEYH 3HE7A 1KIPB 1ZVSA 2JJSC 3H9HB 1GIGH 4M7ZC 1T1WA 4Z7VA 3LQMA 1NPUA 3NCEB 4U1MB 3FT4A 4M62H 2VQUA 1YNTA 2Z91B 5JW4M 3IGAA 1EGJA 3P77A 5CSZA 3AS2A 5C71A 5F9JA 1T89C 4G5ZL 2VN7A 4JE4B 2IAMA 5EZLB 3BP5A 5IK3B 4HFUL 5DO2C 2JJVA 3KLSA 4PRPB 5FYJL 5C0FA 1JF6A 1QBAA 3EO0B 5DURD 3DV4B 3FB8A 4PJCF 1H3WM 4PY8J 3P9MB 1NMCC 5JMRA 4ELMF 3BAEL 4PJIA 3GSRB 4W70A 4JVWA 2MHAB 4D9RD 3UP1A 3DO7A 1KN2L 3PWPA 1RQ5A 3IJYB 1T4KA 4FQXA 2PXYA 1R5IB 1MPAH 4Y1AA 5D96C 5BXFA 4ONHA 2VE6A 1ZLVK 5DK0B 4PTUB 4PTTB 2EC8A 2HT2C 3EYVA 4OSUL 3LV3B 5I1DA 2C7UA 3OJ2C 4YGVA 4QKXB 4DN4L 1JTTA 4XHQA 1RJYB 4HPOH 2W0LA 1IGML 2VKXA 5GIRB 2F54A 5IW1B 4HLZH 3EYFB 3KPLA 4S10A 4O5LL 3BUYA 2H32B 4JFOA 1K3IA 5ESQB 2RGSA 1X4XA 2R1YA 2YWYA 3IFOA 4ZFGH 5JXAH 2DQUH 2XPGA 4L4VB 3ULVE 5C07B 2CIKB 3QAZB 2W0PA 4QRTB 3CSPA 1MCDA 5GQBA 3VFMB 2W91A 1RUPL 3FRUB 5KSAA 3Q5TA 3JWDL 2EZ0C 4X4YB 5HYSG 3E2HB 3G6AB 4EQ3A 4LHQB 1KSRA 1QKZH 5CLWA 2FGZA 5I8CB 1M7DA 2EDNA 1RIVH 3MODL 4QRRB 4F57L 5CWSB 1M71B 4PYGA 1AP2B 4NNPH 3GM8A 4NP4L 3ZTNH 1IGFL 3QFDB 4MJIB 4JCMA 3MRDA 7FABL 3OZ9L 3PWJB 4PLKC 1NH6A 4KKLD 3AGVA 2CDGA 4Y4KA 3I9GL 2GT9A 3I3BA 1D9KA 1J1XL 3L3GB 4BKLA 3DI2B 3JWOH 5IBTL 2AGJL 5I18L 3MA9H 2EO9A 5TE6L 1HSBB 4Y4FC 1JN6A 5IVXE 2UZIL 4M48L 5J6HB 3STZB 1TCMA 4ZYKB 1U3HB 2HN7B 5J1AA 5C0JA 5I76A 4WTZG 5I6XB 3IRPX 5BJTB 5C3TA 5E5MB 2OR9L 5F7NC 3RVUC 2A6DA 2CRIA 2BVUA 5DHYA 5E6IA 1MI5A 1YEFL 1F58H 5FYKL 4ONHB 5I74B 2O5XH 3QEHB 3H2WA 1KB5L 2ZOLA 4Z7WF 3WUWB 1GOHA 3JTSB 5JHDA 2JB5H 5IQ7L 4IIQB 1MWAA 1E4JA 1YYML 1RK1B 5DT1H 3OKDB 2VQ1A 5EC2B 4KQ3H 1WBZB 1U8MB 3BHBB 4JO2H 5D6DC 2GW5A 1YMMD 1BEYL 1UM6H 4JFDD 1X5GA 3WJLC 1T21B 4D3CL 1CGYA 3QXAB 4ENED 1DANT 5I8CA 1MWAB 3D3VB 4Q0XL 3MFGB 4MXQD 1JZ5A 3RVTD 3RHWF 1JMZA 3BEVA 4G8GD 3QEQE 2JJUA 2W60B 4KKLC 2L4OA 1JGLH 4OZGE 3BP7A 5TDPB 5TE4H 3CVIH 4P4KA 1P6FA 4YDKH 4GBXC 3OKMA 3HNVL 3KPNA 3RI5F 4O58L 3WE6A 3BKMH 1Y6MR 3CVHL 4L4VA 3G04B 3GM0A 2OZ4A 2VXSH 3UTSE 4GW4B 1MIEL 5F9JB 1WC7B 1DL7H 1I3GH 1CGWA 1QFHA 3X14A 5ENWB 3IS1X 1HXMA 2X6MA 4BH8A 2F8OA 1GVIA 1LO0H 3BD3A 5DJYB 1Q72H 1RMFH 1QLFA 4XNXL 1MFCH 5EUOF 5L6YH 2P24B 1VGKA 5HI4D 4CUCA 1Q0XH 5TDNA 2DD8H 1RVFH 4PJBA 4QRPB 3EOAB 3QUYB 1X7QA 4YX2L 3BEVB 5BRZD 1WQVT 5KOMC 3CFBB 3QI9D 3IF1B 1F8TH 2LVEA 1G84A 1NGQL 1D9KC 5HHPB 1ZAGA 4AIOA 2BNRA 2QKIA 4X9FA 4R3SB 4L8DA 5DHXB 1NGPH 2NLJB 3IFNL 3D85B 4PB9L 2VLME 3WUZA 1A02N 2DDQL 3HI1A 1LO5A 3TEUA 1MJJB 1IEAB 4ELKA 2XZCH 3LQZB 1DSFL 2BSSA 1PYWB 4P57A 3DV4A 3MCKB 2IBGA 4OLWL 1B4JH 3E6HB 3LIZH 1C08B 2HLFD 3NIDE 1OP3K 3B9EA 4NKIL 1QRNE 2IFFL 3VWKD 2NY6C 1XF2A 5HDBE 2MJWA 4KPHH 4Q2ZB 4HMCA 5A2FA 3QPQD 1N4XH 2BRQA 2FEEI 4NBXB 3P9LA 2JELH 3OAZK 5DFVC 4GMSH 4LLDB 4MSWA 3P0VL 1CD1A 3U0WH 2VXUH 1S7RA 3KPOB 4FZEH 3BMVA 3UTTD 3MOAH 1FZOB 2ORBH 3TJEL 2XY2A 2EDTA 1FDLL 1OSPH 4LCWD 3E3QE 3VGBA 1I9IH 3QDGD 4ZFOL 3NCMA 5CJBA 1QPXA 4J7RA 4G6KH 1CN4A 5DD5H 2YUVA 2F5BH 5HYSB 4P3DA 5FYJD 1BJ8A 5HD8D 4DGYH 3FKUS 4ZS6C 4HK3N 1HEZA 1G7QA 4D0CA 2HYMA 4NZTH 3SE3C 5JIHA 3PWNB 1MOEA 4ELMB 3BEWA 4MA7H 5HDLA 1TPXB 1XGUB 1S9YB 3QUMH 5GS0H 4RAUA 3HR5B 3A6BL 3OHXB 1QSVA 2QQNH 4X99A 2SEBB 4LFHD 3RWJA 2NCMA 4EN3A 3MLWH 4YEFA 3O6MH 1NMBL 4GG6A 2PYEB 3DIFA 3FT3B 5SWSD 3A6OA 4F80A 3MLYL 4FXKB 4OZHF 3T0AA 4XCYB 1FNSH 4O00A 4EI5A 3DX9B 2V5SA 1MSPA 4WEUD 1WV7T 3H9HA 2DQIL 4FTVB 4XAKE 3DWTA 3IAGC 4BQ9A 3B9KB 3QZWB 3GSQA 3N06B 1KYOJ 3BZDA 2C3GA 4WHYG 2F54D 5K9QI 1MRFL 4L4TA 4ZAKA 4JRYB 4PS4H 1S5HB 5M7QA 3GDBA 5GJTH 1A9BA 3RIFK 1ZANL 5K93A 3S3SA 4AZ8A 4XMPH 1U58A 4R97B 1C12B 2GJZB 1LMKA 3FQWA 5C0GB 5I1JL 4MXWH 1ZHLB 1C5DB 3KLAB 3QEQB 1A0QH 4OZFH 3ARRA 4M9PA 2NY6B 1AXTH 3MFFB 4PGBB 3A0OA 5D5MA 1NBZB 1KB5B 1CLOL 4PJ9B 2V7NB 3U0PB 2QJDA 1W8NA 2OM5A 1A7OH 4HZLB 2ZKHH 1ZK9A 1G7HA 2NX5D 1MCOH 1AY1L 1WGOA 2XV6B 2G5BB 1AHWC 2FWOA 4UQ2A 5E1HB 2BSTB 2AEQH 4BUHA 2P45B 3PWLB 5F7UA 1BHGA 4AT6A 3E6HA 2NYYD 1LO4L 1FPTH 4LF3A 4QXWA 1QG3A 1EPFA 3MRQB 3MRNA 2N56A 3CDGB 3U2SA 1XF3A 2Z91A 5BMFL 2NLJA 3LOWA 3DYMA 4R4FL 5B21A 12E8L 1NLBH 3QXTA 3HRZA 2AW2A 4QHLA 3DTXA 4ZOBA 4MNGB 2OR7A 4B7IA 2A6JA 2FEDC 2VZ1A 2YR3A 4PB0L 1IAKB 3MOBH 4NFCA 1VEPA 3IF1A 3G04A 1EDQA 3CXDL 3CC5B 2VITA 2OI9B 4LPYA 4KROD 4L1DA 2YA1A 3LKOB 3LEVH 2JJSA 1I9EA 4JHBA 4OD2A 4V1DA 4RMUA 3GIVA 2Z92A 4EQ2A 4KXZI 5E2WH 3DSFH 5GZNC 1N6QH 2EDOA 2WWKT 3I6GB 3STZA 4JKKA 1U2CA 4R0LB 1NAKH 4U05A 3SDXA 3UJJH 1DLFL 4R2GD 4OIIH 3W9DA 3KPSE 1DBKL 4OSUH 4MAUL 3PF2A 3FHAA 4JDZB 1JHLL 5GGSB 4RMQA 4HKXA 2NXYC 1E6OH 3DETD 3PP3H 4DW2H 4ZUSA 1C1EL 4PJEB 2R2HA 3ILQC 4I0CC 4N8VG 5BZWB 5HPMB 1DANU 3SE9H 4YBHA 3SE4C 5E2JA 5DJ0B 3FMGL 5BCAA 3T0EA 2APWA 4MJ6B 2N7AA 3UJIL 2IPKA 1TVBA 4L8BB 1K2DA 3U7WH 4YR6A 1Q94B 5E1AB 2XWTA 4HMEA 1QQDB 4CVZB 1WBZA 2IAMC 1NBZA 4RGNE 2YEZA 4XNUH 32C2B 1P84J 4XPGL 4NSKA 4XC1H 3BDXA 3KPMB 4C56D 1YECH 3MA7A 4F57H 5A16A 2QHLA 4U1HB 5C0RH 1VFAA 4FQPA 3TO4D 3VRJB 4RFEA 3WHXA 4TSAH 1A3LL 3LS5L 5I8KL 2BP3A 4R4NC 5ILTH 2XNAA 5LWYL 4OZIF 2ZUQB 5E08L 4C56A 2KL6A 4L8SC 4QF1A 4QRRA 4S1SH 3HZKB 3WFCH 3WLWC 4XBEH 3MROA 4CNIB 3QNZA 1QLEH 1XF5A 4OM0L 2FBJL 4ODHL 1AJ7L 1T66D 5K9JH 4WDIA 5DD3H 2B5IB 5ICZA 5IJKC 4DZBB 4ACPA 1RD6A 3GSOA 1N0LA 4RMTA 2H2PC 2YKLL 4M6MH 1H8SA 5DFWH 3ZSSA 5CWSA 4ZD3L 1XMWA 3I3EA 2ATKB 5E9DE 4QOKA 5B39G 3S7GA 4NO5B 3RUGF 4BELD 1KB5H 4NT6B 2F74A 5IHLB 1HCFX 2V6HA 4MQXD 4BFIB 1L6XA 4XBGB 4Y5VC 4P2OB 1IBGH 3S36H 3WIHH 3L9RB 3V5DA 1ADQA 1JRHI 1S7SB 1F90L 3MRIB 1FNEA 5DTFA 4FFVC 3I6KA 3WLBA 3WDHA 1L7TH 4K3EH 1MREH 3ARBA 4AENA 4UV4L 2FYYB 1JWUA 3GMLB 3FQTA 3OJDA 2CUMA 4WEBH 5C92A 2I60H 3ULSA 1A7RH 1X5LA 1GZQA 3WFDL 2GCYA 4WI4A 5GSRA 3NIGF 4G3YL 4C4KT 1U8NB 4JY4A 4JFED 4DUVA 2EXWD 3THML 4I4WA 3QFJA 4PP2B 5EOTA 3RPIA 5DVNA 4O2FB 5DRXA 3T0WA 5D7LE 3N1GC 2IMNA 4MVBC 3RP1A 4GKZA 3SDCA 4DEPC 1OAUL 1T22B 1K8IA 3M07A 3KDMB 4NC0B 1HSAB 43CAA 3CFJB 5E8EA 3S4SG 1U36A 1S7SA 1G7MB 5CIPH 4AM0B 1F5WA 3ME0A 4FQXB 4XNMA 2WW8A 1RI8A 3TBVB 2AK4A 2NZ9C 5T5NF 1UH2A 5H37G 1K8IB 1JCKA 2VXVH 3IKCA 5ESVA 1BD2A 5CJXA 2MHAA 3QI9B 4P5MB 2H2SD 5J7CC 1ORSB 1NCCH 2FZ3B 1BVLB 4LP4A 3VD9A 4KVCH 3WV0A 5I1HL 2ADJB 5KSBF 3MJGX 1SJHB 4UZGA 1P7HL 5CHNB 2ZZUT 3VD4A 5ITBL 1A6UH 4JCLA 3MCLL 3VU2A 1KIPA 2HT2D 4OFYA 3VD5A 2GQHA 3ARBB 4XRCB 1RZIB 4HV8B 1WCBA 1Y6NR 5LVEA 2VLKA 1MY7A 4P23C 1N5YH 2XZCL 3ULUL 2CKNA 1BAFL 3QNZB 1G0DA 2PYFB 1RZFH 2ZCLL 1MNUL 2GEEA 1CR9H 4UIMA 4ZUWA 2V9QA 4L4VD 2KDGA 1IZKA 4PREA 4WVRA 5FM4A 4UOJA 2P5EE 4K2UL 5CJXC 2XWJB 2CRYA 4P2QD 1TJHL 4MZ3A 2ZG3A 1QFOA 4ZO8A 2D7TL 6CGTA 4RGNC 3MJ9H 1HQRA 2C3WA 4HAFA 4KMTH 5CZVL 1H3VA 3Q2CA 5BVPH 5ID0A 5AYQA 4JANA 1FNAA 4KY1L 1ADQH 3QDGB 3B2UD 3O9WA 1IGFH 2XQYG 1IC7L 3IDIB 3MNZA 5DGRA 5GGSY 5A3IC 5MENE 1IM3A 3SE8H 3UROR 4PR5A 4R96A 1J0KA 2J12B 4UTBL 4XPHL 4RIRB 4NT6A 2B2XL 1ZA6A 2ZUTA 2OTWB 3RUGB 4HJGA 4LEXL 3QUZD 4ERSH 3FFCD 3AY4A 1ES0A 4PRHA 4CMMA 3U46B 4A6YH 1ZLSL 3GO1H 1LDSA 4HUNB 2DTMH 3BH9B 3EDKA 4HF5H 1MCLA 1F02I 4IIQA 3SOBL 2B1AH 1FLRH 4C83A 1KCVL 5TF1L 3KPRE 4MD0A 2AXHA 5FOBB 3CLFH 4NFBA 2VC2L 2FGWH 1EAPB 3QHTC 5FCSH 2VLLB 4RFNC 1T1YA 3MGAA 1GGTA 1ZLWK 2ZG2A 4U1KA 2OL3B 4BSVB 1G7IA 1KN4H 2AKRB 2XXCB 2Y07L 4X9GA 1NGWB 15C8L 5I76B 3UO1L 2ITCB 5D1XA 4UINL 4UOW0 5FA4B 2AABL 4IDLA 2VLLA 4NN6C 3QZWG 4XHJD 2YPLB 2Z4QA 4H0HB 2GSGA 3B9KD 3QR2A 3ABZA 1KF9B 2UVEA 2VLRD 1JVKA 1U95A 3BRFA 4RMSA 5IG7B 2WP3T 2A83A 4BQ8A 1HCVA 4YE4L 1G0YR 1D5XB 2OMBA 3MUY1 4DVRL 3EJJX 3BKCL 2DBLH 2XFXA 3GUTB 1EHNA 1XF3B 3C87A 4MXWL 2E27H 1BFVH 2P5EB 4M03A 4ODXA 3O0RL 4L8CA 4NQCA 1IEBB 2ZCKL 4LCCB 1BF2A 2KQMA 1G7LB 5FECB 1UM4H 1OP5K 4U3HA 4D2NA 1REIA 1OVZA 4JN1L 4M4PA 5DVOA 3ROLA 4WW2B 4U31A 2YUXA 3TFKC 5L9DL 3F5WA 4JFEA 1ZT4B 2BVQB 4NC2B 3FN9A 3DURB 5F6IB 2R56H 3MODH 4P46C 2Q86B 4BSJA 1IGJA 4P5KB 2R0ZL 1RJCA 1FPTL 1WC7A 4LCIH 2NMSA 1FBIH 3MACL 4FQIL 5TE4L 3GBMH 3TBSB 5F96L 4GQ9L 4Z7VB 3RVUD 4AQOA 3HNVH 4V2CB 4OLYL 4YXLL 1GCFA 2AV1B 2QADC 4TSBH 5LQBL 4NQUA 3VXMA 1HKLH 4JPKL 4RA0C 3ZT5A 1WFUA 3RWDA 1NMCB 5EOQL 1NEZG 1HINL 3TWCH 3D25A 4NHUB 5E95B 3VMOA 5F7YC 5HGDA 3EKCA 4NIKB 4JRXE 5FUZH 4QTHB 4PJ5D 2OJZL 1ZHBB 4XNYH 3QDMB 3I02B 4LIQH 4RISH 3ZDYF 1J7VR 1IAII 3DO7B 4L8SB 1A7NH 2AJUL 1BOGA 1OY3B 4M8QB 1HDMB 4FQJL 4HJ0C 3WNNA 2PW2A 1SYSA 1S7WB 4EJ1C 4GMSL 1MFNA 1EK3A 5IBLD 3TBYA 4I48B 1AGCA 1DN2A 5FF6A 3EDJA 3DX7A 2ZNWA 3RU8H 4WU5A 1WBYA 2ED7A 1DBKH 1IGMH 3MOAL 1K4DB 1OAXH 1EAJA 4JRYA 5DRZB 4DTGL 2D0GA 3G6JA 1QD0A 4G6KL 3MRHA 4OCRH 3EYSH 2F5BL 3SGDI 2AJVH 3IJSB 2AK1H 2WK2A 1YNLH 1P7QB 3OAUL 4LGPB 3O3EA 2FX7L 2GSIA 1UQSB 3NZHL 1HQ4A 3TFKD 5LKNA 4WIQA 4UIKH 3KYNA 1GGCH 1VFOA 5EZJA 1MFBH 1KXQE 4NBYB 3FQNA 4TRPH 1O7VA 4JQXC 4G6FB 5FUOH 5HDQH 3U0WL 1NUDA 1KT2A 4CKVX 1P7QA 3K4AA 4E41D 5IFJB 3ZKND 3LMJH 1I9RL 4W6XB 3UCRA 2WBJC 2MSPA 5FB8A 1F3RB 1IC5L 1BBJB 2G60L 4JREC 1HN1A 3MV9A 3V4PL 3L3DA 4DUWA 3PWPD 1Q72L 4NN7B 1ZGLB 3Q3GA 3HC3L 4ZTPL 4XC3L 4X7TA 1AFVL 3HMWL 2XTJB 1JRHH 5EUOB 4WENB 4NOFA 2DD8L 1BBJA 1UWXK 3WL9A 1UH4A 4WEMB 1AO7E 3L5WA 4GG8B 3CFEA 1NEZA 5FGRA 4G6AD 5KSAD 1AJ7H 5HYFA 4MX7A 3CUPA 2X4UB 3HC4L 5L2KA 5HYQB 2IAMD 5DD6B 4P4RA 2F54B 4KXZH 3N1FC 3V0AC 4ZNCD 3TT3H 1E27B 4JPVH 4JN2B 2NTFA 2M26A 4LVHB 4EEEA 2UZYB 4DK3A 3W11D 2K7PA 4MA8H 3CVHA 4M43L 2GUOB 2NZIA 2W38A 2X05A 2VE6B 1ORQA 1IGIH 2DQCL 1T80A 5C07E 4P23A 3UTQA 2XNAB 1KJVA 5GS1A 4HCRA 4HWUA 1EO8L 1T5XA 3C9NA 3SDAB 1JYXA 3WO4C 5CKGA 4XPAL 2C5DC 5D7KE 5HY9B 5BQ7A 2BJMH 1AY1H 5CHNA 4JREB 1BBDH 1YDPB 3W81A 3JV6B 3QUZC 3D0LA 1IEAA 1QZ1A 4RGOH 4K3GA 3PUCA 4L3EE 3MV9E 4HK3J 4Z0BH 1TIUA 3QPXL 4MA3A 4XVSL 1I1FB 4K71C 3T0ED 3GMMA 4U4BA 1MF2H 4U6TA 3M17A 1DDHB 3WE6B 3WFDH 5DJ2B 4MS8D 2J8OA 3LKSA 4OTXL 1MH5A 5E00A 5C09A 3GK8L 4OIBA 4Y8AA 2F58H 3BZ4B 3MLRL 4GG6F 3V52L 1MHEB 1TQCB 4ODUA 3GB7A 3RAJH 1FL6A 1I1RA 1GAFH 5JOPD 4XNZC 3ARFD 1LD9A 2X4OB 5ESAB 3K7UA 4OZFA 3BYTA 4MCZB 4JQXA 3QCUL 3OTTA 2B4CL 4G9DA 2W0KA 1EVUA 1BOGB 2P43B 1INQA 3BW9B 2QR0B 4JRYE 3AM8C 4PJ7E 4C58B 2PKDA 3U4EB 4HQQL 1ZVSB 3MRCB 1P5VA 3GMLA 2YMXL 2XXMB 5DLMH 1QP1A 2WIMA 2R15A 4LCYB 4KHTL 5GS1C 1YMME 4JFDE 5E2VH 3BGFB 3QUYA 4D0DA 3HCVB 5C0AA 1Q9KB 1XGTB 1YJDH 5J4MA 1FGNL 4XB7A 3SPVB 2XRAL 3CFCL 4QT5A 1E6OL 3W5NA 3UZVB 3KJ6H 3GKZA 2X44D 4LLVB 4H1LH 1IKNC 5CUSH 1ETZA 1MAJA 2APVA 1SQ2N 3GI9L 3T3ME 2Q3AA 5ISZD 3L5HA 1G7PA 3O11A 4JRXA 4YK4B 1ZLUH 3S35L 2WWMD 2M8XA 4RGMC 1I8LA 4XBPA 4GRWE 4Z0XA 4OD3H 1T2JA 3FQUA 4MWFA 4I18A 2AJXH 3UTSD 5IJVB 1UCBL 2ZCLH 1P1ZB 4S1QH 4Y16C 5SWZA 1RK1A 2WBJB 1KC5H 1U91B 4DZBA 1TNMA 1II4E 4GRMB 2Q7YA 2NXZB 1U6AL 4I3GA 1CGTA 5EBWA 4L3EB 4MVBD 2ADFH 2ADGA 1LP9A 1QNZL 3V4UL 4HEME 4U1JB 3JWNC 3GIZL 2YK1H 3QCVL 1IAIM 5JQ6L 5EULV 2DQHL 5J12C 1ADQL 3RVVD 1A3LH 1F97A 4MA3B 4YUEL 4ELME 4G8FB 5C6TL 3O6KL 1T5WA 2ARJQ 2GITA 1U95B 1DN0B 2APFA 2D3VA 2YD1A 4QRSB 5F6HJ 4KK9D 1TMCB 4G9FE 1K6QH 1N64H 5KVFH 2AJZA 2OR8A 2YPLA 2VLMD 4HKZA 1DQJA 1EFXA 4MGXA 3MRPB 3K4DA 3FAWA 4KK5C 4KUCF 3RTQD 4PYHA 1VADA 2YSSA 4EI5D 5KSUA 3INUH 4KQ4H 5I9QB 5DRNA 2BERA 1QRND 1I8MB 3PGDB 1WFOA 1X5JA 4ZFFB 5IR1A 3H3KA 4PRNA 4DAGH 1U0QA 5DK2A 1KCKA 2Y06L 5DJAB 2GY7B 5EBMA 4JO3H 5AZ2H 4K94L 2HWZL 5I8KH 4C83B 5L7XL 2HT3D 4JHWL 4GBXD 4OQ1A 3GSNL 4YHYC 5F3HA 4ZS7H 4L29B 5JOFA 1IBGL 3S36L 4KH2A 5JHLL 2BXYA 4BSWA 5IEHB 1MFEH 1AP2A 5GGQL 5CILL 1V3MA 4MJ2A 5DMGD 3W9DB 3UTZA 5K9JL 1U2HA 3O11B 4TVSa 2IAND 4QHUB 1TNNA 1GOGA 3BXNB 2AQ2A 4UT9H 1MFAL 1OARH 1SHMA 4OFPA 1QFUH 4LLVA 3QDJD 2YD4A 3KPRA 1GHFH 3U36B 1A7QL 4G3YH 1S7VA 1KG0A 3ARGC 1NCAL 2X4SB 1MHPH 2O93L 2ZUXA 4PTUA 4PRHE 2R4RH 4OFIA 1ITBB 1MEXH 1RHFA 3S3JA 3P77B 1A7OL 4HH8A 4PP2A 3LSOA 1AGFB 1NL0L 1DBJL 5MI0B 3ALWA 3VFTA 4DN3L 4MNQE 3AUVA 4TYUA 5EPMA 5EOCJ 4LCUB 5F93C 4Y8DC 3E6FB 2JJTA 1R3KB 4J4PA 4PLNC 2VXVL 3GMOB 2CXKA 2BOBB 1NGXB 3PL6C 3GHBL 4JKPL 3ZE2F 2DYPA 1HHJA 2P44B 3EYUH 5GSVA 4I0PC 4P2RD 4N90E 4ODBD 3DHJA 3OXRA 3BRDA 4KGLA 5J1TC 1UADC 2BDNL 1QYGL 4KVCL 2OL3L 4G80B 3H7BA 1J9CT 2VL5A 1HSAA 43CAB 1KBGL 1F00I 3GMPB 2GYSA 2KBGA 1S7UA 1DDHA 1NEZB 1KCLA 2R1WB 5J1SC 3O2DL 1PKOA 4G6ML 2FBJH 3D0VA 1YPZA 3NFPB 3NFNA 1OAUH 3ARBC 4JY5L 3OJVC 2ZJSH 2DL9A 4OZ4A 2XA8H 1ZWIA 2H1PH 3QI9A 4MAYB 4HGKC 2H6PA 3RL1B 2EKSB 1S8DB 2NY4D 1MNUH 4U0RC 4APQC 5E2WL 1FVCB 1KFAH 2JF1A 3A6CH 4KV5E 3MRFB 3NTCH 3NIGE 3SQOL 5C08B 5HXMA 1FORH 4JFPB 2R1XB 2JIXA 1ORQB 4RWYL 1A3RH 3AB0B 1GPOH 3WNOA 2YN5A 5ACZA 4MAUH 2Z0BA 3VWJB 4Y5XB 3BO8A 5C0CA 3QB7C 1LNUA 1QSEA 3QXUA 1AHWA 4JN2A 4GRLC 1FL5A 2AK4E 4BZ2L 5CBAB 3X3FH 5EC1A 1U9KA 4EI6A 4U1IA 2QADB 2XICA 4XNQA 5L2JB 1FO0A 2EIZA 2AI0H 3ZTJG 5DR5H 1S9VB 5D1ZB 1EEZA 1I7RA 1T20A 3P9LB 4LPCA 1HWGB 5C0EB 4I13B 3VXUB 3O8XD 2E9IA 1UWEH 4HJJH 3OAUH 2MPAH 4Z7NF 1W2KT 3AAZB 3L9RA 3CX5J 1CFVL 1BFSA 1KPUB 2B1HH 3DXAA 1IL1A 1AGCB 1AXSA 1FC2D 2VDPL 5EB9A 5FF6B 4X80L 3HPJA 5BV7H 1VCAA 1INDH 4IRJA 3F62A 2D4DA 1UGNA 2IQ9L 5F1NB 5E8NA 5IHZA 3RVWC 2G60H 1IZJA 2V9TA 4YC2B 3U6RA 3ARED 4LLUA 1BQUA 3IDJA 3BKYH 1AR1D 3BI9X 4U6YA 1AR1C 5IG7A 4QRUA 3GJEA 4YHLH 4F58H 4X83A 3LCYA 3KS0H 4BK4A 2JTDA 1EUUA 3V4VL 3IXAA 2X4TB 5I1GL 4QYOA 1AE6L 1C16B 1NCCL 2CKBL 4R0LA 4X98B 1NGXA 5E9DA 3VFSB 3Q6FB 2OS7A 2BY3A 3HI5H 4IRZL 4YHPA 4Z18A 1GZPA 4JHAH 5EPMB 4P5TA 1MQ8A 3QO0B 2ZSVA 1FLRL 4K3JL 1JWMB 5HI5D 3RY5A 3RWEB 1Q9WB 2I27N 3ETBF 4X98A 3SDCD 3TT3L 1JK8A 4ZD3H 1J12A 5I73C 4K94C 1Z9SA 2IADB 4FQQB 5DJ0A 3VXSA 4MD0B 2FH6A 5E8OA 2Q76A 2VSCA 4JZJA 4UTAH 1KN4L 2ZCKH 4LNVA 1W72L 3GMRA 4K8RC 4OQTH 2HFTA 1F42A 4QNPE 4TULL 2VDNH 4BFBD 5JW3L 4C56E 2W60A 1UH3A 4AYFA 1HYSC 1TJHH 5L88L 3KLHD 2ADGB 2DL2A 4TUKH 2V17H 4XAWH 5T3ZH 4Z0BL 4L4JA 3UJTH 3C08L 5FGBA 3SBWA 3IDIA 3MNZB 4WTZA 3T77A 1UWGL 1PG7L 1LE5A 5EU3A 5J12B 3MLXL 5LQBH 1CYGA 4NYLA 5HHOE 4YDLC 3VXSB 4WUUD 3DV6B 1HQRB 2BOCA 3ULVL 3V52H 5DD1L 2CD0A 1FO0B 5IKCB 4J3XA 2EECA 1Z0NA 4RWHA 2VH5L 3QDME 5LJYH 5EUKB 5INDA 2FX8H 3GHEH 5SX4H 1XFPA 1CFTA 4H5SB 4XNYL 4WRLA 4ZYKA 4PJ5B 3VFOB 4Q74A 4XP5H 1IKFH 3CU1A 4PLJD 3BD4A 4YQXH 3V8OA 3EYVB 2BMKB 5ACZB 4PTTA 2IBZX 4JZJC 4KVNL 4XRCA 4P2YA 1R0AH 2HRPL 5I16A 3DRTB 2VTFA 4OGAD 1K3ZA 3MRJA 5FV1L 3BN3B 3SCMC 5IB5A 4M7JH 5KAQG 5FA3B 4OLYH 4PJXB 4YXLH 2VAAB 5EZIL 5C0BE 3HZYB 2UYLA 4BQ6A 3BIKB 4JPKH 1S7TB 2EYTB 2OK0H 4CVXA 4P59H 4K9EC 5EC2A 4ZAKC 4Z78A 4XCFL 4XXCA 4OGAC 5L2KD 3BDYH 2DQFA 2PYEA 3DIFB 5FFLA 1U8PB 4G43A 1CF8H 1FE8H 4FFWD 1RUQH 3BPNC 4W4OA 1V3KA 1U58B 2AJSL 4JAMB 1IFHH 3QUKA 2WQ8A 3NZHH 2IALB 3L3OA 1WICA 3I3DA 3MYJA 4FQJH 1ACYL 4KRPB 4K2UH 3T0VA 4RZCB 3GJFH 4PRIE 1CD0A 3HZMB 2A77H 4XPTL 2MTPA 1WVZA 1P4LA 5CZVH 1JHTA 5DWUL 5SWZD 2HG5A 2N4IA 2YZ1A 4ZDHB 5HYSA 4E41B 2FHFA 4ZUWB 1BZ7A 4GAGH 4F2MB 3R1GL 1R3HA 4P4KC 4EDXA 1PSKL 3JUZA 4AK1A 2DOCA 1AO7B 3W82A 3KS0J 2NTSP 2BNQB 4P23D 1BFOA 1N3NA 4Y5YA 5GGRB 5IW3A 4JZOB 3MV7D 1M7DB 5IESH 2H32H 4FQIH 1FBIL 4XWOC 4J12A 3RWFB 3IJHB 3QUZB 1RZ7L 4H1LB 2ZKHL 4LKCB 2CLZA 1IAOB 1SJHA 1MFBL 1CL7H 2C4FU 4GS7B 4U1NA 1KCVH 3BXNA 3FRUA 2HFGH 1M05B 5DI8A 5CSBA 2ATKA 3RWHB 3TWCL 2P5WA 3V5KA 2ARJA 2HJKB 1AIFA 4GKSA 4MJ5B 1SMAA 1VACB 1IGCH 3WIIL 5ESVB 3VI3F 1U93A 2JK5B 4GRLA 3AMKA 2HJLB 4ODUB 2PYED 1UZ6E 3GSOB 4RQQB 3HUJF 3CSBA 5BW7C 2DTSA 5HI5C 4QHKJ 4UI2A 3OJMB 3WJJA 3KPLB 1JRHL 2HWZH 5L7XH 2VR9A 8FABB 5ICZB 2OMNA 2R0WH 1G6VK 5IWLC 1RJYA 4NKQB 4J3VA 4KTEH 4A2LA 1S9XB 3B2VL 5D71L 3JZ7A 4JJHA 3IGAB 4FTVD 4RGOL 5MEND 2LU3A 4HIJA 4GG6E 4C56B 1KT2B 1QA9B 3MRPA 3F6IA 1YDPA 1QVOA 3FFDA 1J8KA 3SGKA 2VDKL 4EOWL 3OBAA 5I17A 3LN4B 4G7YL 1XGYH 5C70A 4LOUC 3DARA 4O51A 2R4RL 1BLNB 3BE1H 1NC4B 3ZDZF 5AYUH 1JTOA 2CR3A 3ECBB 3GKWL 3HMXA 4OCYL 5E2TL 5JTWA 5JNYA 4Q97A 2FEEL 3OKMB 2F74B 3SE9L 1NJ9A 5B8CB 3OG4B 2BSRB 2AXFB 3EYQC 1UENA 1NUNB 5EBLB 3PWVB 4JKPH 1MFDL 3OB0H 1BIHA 4XC3H 5D7JA 4EUPA 5GS2H 1CT8B 1I85C 4OTXH 3T4AB 4DUXA 3AU1B 5I1CH 4QRPE 5E4EB 3IFLL 2X7LB 2Q6WA 2NY5H 1ZLWH 4GAJL 5D7SL 2Q87A 2GTWB 4KROC 5T3ZE 4LSSL 3O45A 2A6KA 1D6EA 1Z9MA 3IJHA 3MBEA 2WUBL 3IDNB 1B0RA 1D5IL 3RUGE 4LGSB 3CIQA 4HUMB 4E5XA 1OM3H 1IJ9A 3FT2B 4DZ8B 2A9ML 1YEGL 1FNEB 4P0DA 2C1OB 1CU4L 5JZ7C 1J05A 3V7MA 3F58L 2GJ6D 3H42H 4LQ1A 2APBA 1DQQA 4C54A 2YMXH 3WKML 4L9LA 5F1IB 5DJCA 1R3LA 4HKBB 4M43H 3B6SA 1KEML 3DX6A 2OI9C 3FHQA 5C6PB 3KLDA 5IT2L 4PJBE 5C0IA 4LCWA 3BHBA 2PUQT 3GIZH 2BJML 3Q6FA 3KJ6L 3ROLB 1Z9LA 1SBSL 1H8NA 3O4LE 4O02H 4QCIA 5DJDB 1K4DA 1TXKA 2GK2A 3B9DA 4EDWL 4LF3B 3ZHDA 5CAYB 3TVMB 4Y2DC 3KYOB 5D1ZD 5DUMH 5DZOA 4GRMA 5JO5B 2A0LC 3SCMB 2YUZA 3EHBD 4NQCD 3QIBB 4OD3L 4ODXB 4KHXH 4Z76A 1QRKA 3P0GB 4HLZG 4JVUA 5CD3A 5IMKB 5LXGL 5KSVB 2BY0A 1I9JH 2J6EL 5CLTA 2BCKA 2WINB 1JUFB 5FHAH 2V7NA 5IROC 3CD4A 4NZUL 1BVZA 3HE6B 1NCNA 3D5OF 3E1F1 1CGXA 1IC5H 1T5WB 3EYOA 1NC2B 2VISB 3BOVA 4YZFF 4P99A 2BX5A 5I1IH 2CQVA 4RAHA 5AZ2L 1KN2H 5DRWA 1IGTB 5H94A 3OZ9H 4XPBL 3VRLF 3NGBC 2LU4A 3FN0H 2BC4A 3O6KH 3QHFH 4LCYA 3ZMRA 3LQAH 2P8LB 5DLML 3IDNA 5C0CD 1AE6H 2LV4A 3V6OA 2VZ3A 1FV1B 1FRGL 1YMMB 2CK2A 4YEEA 5H2BB 1FGNH 2Q7YB 3MV8B 1MI5E 1BJMA 1HH6B 1D9KB 2FHCA 1P6AB 2H45A 1O7SA 5EU3B 4FFVD 2P8PB 1EHLL 4DGVH 2I9TA 4MX7B 5HI3D 3PV6A 1Q8MA 3BFOA 4GRWH 3EGSA 2PO6C 4LVHC 2Q7NA 4LCCA 1OW0C 1U8LB 3C2AH 4RFNB 4X5WA 3TNMA 5C8JB 5DUPL 5CEXA 3P9MA 1TTGA 2AJXL 3I6GA 4PJXE 5CP3H 1VSCA 3ARGD 3KPSB 3WBDA 5J13C 3GUTA 4X4YA 1JF1A 4NRYA 1GIGL 1FNGB 3IAQA 4P2OD 3ARXA 2JE8A 4OFDA 5GGQH 1QR4A 3O4LB 5SV4A 1MVUA 5DFTA 4PJ8A 4Z7OE 4JFXA 4PD4J 4IRSD 3I75A 3W0WA 4K7PH 3HG1A 3VXQA 2VDQL 5CINH 1KIQB 1A5FL 4Y19A 2J8UF 1IT9L 1F6LL 1TQBC 1T5XB 3SDAA 2YHGA 3DTXB 4HS8H 1JPST 1ZLVH 4HFUH 4HSQA 5F7EL 3DGGB 4NQXA 5SWSE 1EO7A 1HHJB 1BVKB 1CDYA 4P46B 4X9IA 5IW6B 3KYKH 1UB5A 3CVHH 4HUWA 4OJFL 4WGVB 4OZFB 3DVFA 2AGJH 1FNFA 1MLCB 2LTQC 3WNMA 1R3KA 1P53A 5BS0E 1C16A 1A6WH 5I0DA 2YD7A 3CFDA 3RFZC 3BJLA 1MCCA 2GAZA 4X6DF 5GGTA 2R1XA 4JR9L 3QCTL 5IWLA 5HHVH 1R5IA 4EXKA 5I1EL 5GRWA 1FVCA 4AIZA 5A43C 1U8HB 1NGYB 2VXQH 3GNMH 2F54E 4DQOH 4ETQA 4LSVH 2VDLH 2NW2B 5JPNA 1Y18B 3BYYA 1SYVB 3I75B 1FZJA 3JV5A 5F89B 5GRZA 3VGFA 3W0WB 4XWGL 2AP2A 1DBAH 1B4RA 3ILQD 2FLRT 3VG0L 5F7HA 1V7NL 1GGBH 4PP1C 1JGEA 2R29H 1JF1B 1OAZL 3L3KA 2PNDA 1BD2D 1YYMH 2GJZA 3RIAK 1XGUA 1FG2B 1AR2A 3P4NB 2AJYL 5ECJE 4PRPA 1WEJH 1A9BB 2DM3A 2VZUA 4TOYH 3QRFM 4TVPD 5MHSD 2QQQA 4JFYA 5J6GA 3D25B 1S9KC 4N0UA 2H1PL 4JVPA 1JZ6A 3VXUE 3FB5B 1P2CB 4N5ED 2JCCE 1QLFB 5MERB 4YDIL 3QFJB 1RULH 3HAEH 5ETUB 4UINH 3HB3D 4GKNA 4FQLL 4MB3A 4RFOL 4HXAH 1P7KB 1BX2B 1OHQA 3J8F7 2MCPL 5ENWA 2DIBA 5GGUA 1IM9B 1PQZA 4BQCA 1MCWM 2RBLA 5F70A 1WAAA 1HIMH 4K23H 3U0TB 2ICWI 1E28B 4NNPL 1FDLH 4NPYB 4HKZB 1XIWA 3LN5A 3RBGA 2H3NB 2FO1A 1XZ0A 3QA3A 3MXVH 1BIIA 4XNXH 2V2TB 3GMNB 4Z7VE 5DMIH 1AQDA 5ALBL 3O0RH 5SWSB 4L8CB 3NH7H 1SEQH 5IBTH 4J8RA 1T7WA 2HFFB 3EYUL 5C6WH 4Z77A 4LHUG 1LO3H 4H1LG 2RR3A 4Z5RB 2AXGB 1Q9OA 1KGCD 3PHQB 4NUJA 2ZUSA 1EERB 1NGQH 2XQBL 1FL3A 5D9SA 4HIHB 3TYFA 1RY7B 2ZP0T 2K1MA 5HBBA 5L9DH 2JCCB 3CFJA 5E8EB 2UWEA 3RGVC 1KCUH 5E70A 4LOUD 3ZE1F 2GAZB 1CLZH 3G6DH 1IGYA 3T2OA 1X7QB 1F6AA 4NQTA 2YRPA 3LRHA 2VWEC 3VFWB 5F96H 5ABDE 4R9HA 3KAAA 2AEPH 2ZSVB 4F7MB 1UWXH 5FGCB 4TUJB 3FONA 4U1GB 4HC1L 2YSSB 1AC6A 1ZLUK 1XCTA 3NOIA 1D5ZA 4HH9B 3O6LL 2XZZA 5FM8A 5BO1H 1FSKB 5CILH 1UJ3C 1HINH 3D3VE 4U6XB 2ZCHL 4NUGL 2B5IC 2YPLD 4LRNH 2BK8A 5JW4R 2BVQA 2CDFA 4NC1E 3QRGL 1N5AA 4Z9KB 5HVFB 3H9SE 5IB1A 4NJAH 1QQDA 5CKAA 4JG0H 4PRHB 4CMMB 1EV2E 3GSXB 5T1MB 3FRPA 4KFZC 3VGAC 1XIWD 4F8TA 1PX3A 2OTWA 2W0FB 1WZ1L 3C60C 4MNGE 4Z76B 5IQ9B 3D3VA 2R39A 5L8LB 1JPSL 3EOBB 3ZKNC 5BVJA 3IXTB 2FJFA 3UTPE 1F2QA 3QIUA 1OAXL 2X70B 4TULH 3L5IA 5DD0L 2FSEB 2VQ1B 5C09D 5HHNB 4NO0B 1H3UA 2Z31D 3MLUH 1U8OB 4OGXH 3T08A 1AGEA 4PG9A 2CH8A 1ZA3A 1H3PH 4C4KO 4LPVA 1QSFA 4K3HA 4WI8A 4X9BA 4ZUVA 5IIEA 3CU7A 4UBDD 3QWOB 4BM7A 2VJXA 4PREB 4EN3C 3VRIB 1E6JL 5GIRA 3N9GH 3HKFA 4MCYA 5KVGL 4M7JL 2WIIB 3MLYH 2FRGP 5KBNC 3L3IB 2DWEA 3MCG1 3RKDC 4O9HL 3FL7A 5GRJL 4OKDA 3T8XA 1BZ9A 1OW0A 1FNSL 1I1FA 5HDQL 2E7LA 2LAGB 4XVUC 1JGDB 4JY5H 5J11C 3SKOB 2O61B 1UB6B 3MRRA 3RL2B 1UG9A 3NPSB 5SWQB 3OF6A 5EU6B 3CPLA 1FO0L 4MB5A 1EUTA 1SJEA 2OTPA 3QXAA 3MGTB 5B38G 1MELA 3V79C 5F8RC 2XFXB 5F7DB 3A6CL 3E8UL 1X4ZA 4MD4B 5E4IA 2HLFC 1XCTB 2H6PB 4I3RH 1Q94A 3KXFA 3P3YA 5KSBB 2CIIB 2N1KA 5C9JB 1CVRA 4U1LA 4WO4C 3MRQA 4E0RA 2WZPD 1F8TL 1JNHA 5TE7L 3RNQA 2VOTA 4KI5C 1A6AB 3ZLQC 2ITDB 3RTQC 2M2DA 2GSGB 5ADOH 1I4FB 3O9WD 3LN5B 5AWNH 2JCCA 1OSPL 1U8KA 1A9EA 2FWOB 3LH2H 3RDTC 3H9YA 1H8OA 4YIQB 2OZ4H 3MLZH 4P2RE 1WTLA 4MNQB 5IJVA 2DQEH 4U1KB 3D87B 3SCMD 4Y19D 3BKJL 5CSZB 4TPRH 4U6XA 4XAWL 5T3ZL 2DMKA 5EOTB 5TJWK 5D1XD 4NC1C 5HHMD 3RVVC 5JUEL 4NJ9H 1ZHLA 4I0KA 5FO7B 3ARYA 1NEUA 1N8ZA 5HY9A 1LQSR 4POZD 2XKNB 3PNWA 1EXUA 2EDHA 3BWAA 1U3JA 4UT7H 3ZYIA 1FYTE 1YEDB 1TETH 3DLQR 2IQ9H 1GRWA 4AEIH 1UVQB 1WSST 1JZ8A 4YGAB 4U33A 1S9XA 1WZKA 4V1DD 3TYFB 4L3CA 1EHXA 3HMXH 4LLYA 3HFML 8FABA 5BS0A 4E42B 3LRSB 4Z7QE 4YBLC 4KUZL 2AV7A 3D18A 4YX2H 4L5FH 1HHIA 4F15B 2CIKA 3CDCA 5SWSA 4GG6B 4FMFA 4PRIB 3B9KC 4KTDL 2NY5C 4NQED 3MUJA 4RZCA 3BAEH 3BDBA 1MCPH 4KDVA 2IPUG 2WWKO 4ORGB 4F3FB 3SDDC 1AKJB 4WHYH 3BP5B 1WBYB 5IB2B 5DJ2A 2QLVB 4HLJA 5I19H 3W0WE 4JB9L 4LAJH 1E4XI 1EFXD 3BDYL 1KENH 5D70H 3SKJH 4RGMB 2WLZA 4NRZA 5HJ3B 1XR8B 4N1EA 5E2VL 3VGDA 1RIHH 2WSKA 4QY8B 3ARGB 3RIFF 1TENA 2FO4B 5DUPH 1P7KA 4GLRI 5MEQA 5ELIA 2VIRA 3W9EB 2VDNL 4AIZB 3Q6GL 1RUAL 3VXMD 4NGHH 2KKQA 2QTEA 1J8HB 5FYKD 4MHHI 2Z93B 3WFEH 2A9NH 3DX8A 4KAQH 3CZJA 5J89A 1F90H 3MJ8A 3KPMA 5GS0C 1U8IB 3F7QA 1W72B 3JBG7 3FQXB 1QEWA 5JDSA 1KJMB 4XHJC 4P5MA 4Y4FD 3VXRA 4LP5A 2EXWC 2X9WA 3MZTA 4Z6AT 4YHOH 5CJOH 3NACH 1QFWI 2I5YL 3S88L 4ZG1A 4LPUA 1PZ5B 5KVMC 3NCFB 3BGMA 4KKBC 4OLZL 3IFLH 1KYOK 3EFFA 4PGDB 4N1CA 4X5WB 1UACL 4R8WH 2DJSA 3GRWA 2I25N 1KEGH 4PJGA 1MRDL 5AD0B 4N8VA 4WHTA 3SE4A 2IH1B 3WSQL 1LHZA 3S35X 4WFFE 3GSNA 4M8QA 4AMKH 1J1OL 3MXWL 4KROB 1SEBB 3T4YB 4GFTB 3L3JA 3U79A 2YC1A 4LAQH 5IBUB 1FGVH 1YJDC 2DAVA 5DK2B 5E4EC 1ZXQA 4OI9A 4A6YB 2FIKB 3MRJB 1KTLA 1RZGA 2H9GB 5FOJA 2CLRB 2GJ6B 1FG9C 4OI8A 3HA0A 2BC4B 1T7ZA 5C9KA 4PJFE 4PJDE 2YD6A 1ZEAH 1OTSD 3MLVH 5BMFH 1KLGA 5I8OH 5EZIH 1VGKB 2YD3A 5LGJB 3C5ZB 3VA2C 3D69B 1TFHA 1JHLH 2R0WL 5D1QC 5KSAC 4R7NA 2ZSWB 1KJ2A 3V6ZB 3DVGB 3WIHL 1C1EH 3SDYH 2YRZA 2EH7L 3ZYOA 3JWDC 1MVUB 2VRAA 3LEXB 3KJ4C 3X3GL 3CLEH 3CSGA 4WUUE 5K9OA 2D0FA 2FECI 1TZIB 4BSVA 1N6QL 2Y72A 1LE5B 3OKKA 4EOWH 1EX0A 4HIIB 1TJGH 3QIUB 3TLRA 4QGTA 3L3HA 4OLVL 1P5UA 3RWCB 1FHGA 2X4NB 5GRUL 4Q0XH 5ICYB 3BQUA 2G5BA 5FKAA 1A7QH 5CZXD 5I1IL 4LARH 3DYOA 2IMMA 1QLRA 2JJTC 2V2WA 3EJZC 4MQSB 2IC2A 4P49A 3I02A 1NCDL 4PJ5E 1W8OA 1NFDB 1M6OB 1A6ZB 3MGTA 1CIDA 5IV2A 4S1SL 4B0MM 3UPCA 4UILL 2C9AA 3EO9H 4LHJB 5JXED 4G7VH 1NL0H 1RZJC 3OKKB 3L1OH 2A2QT 1EJOH 4JDVB 3MV8D 3NFSH 4LSTL 2RJMA 4LVOB 1KCUL 4YFDB 4ZTOL 1QRNB 5GGRY 5DZLA 4KKCD 1XCQA 3ILPB 5DMKB 1YNKL 3O4OB 3IXAB 3QHZH 3HRZB 3TV3L 1LILA 2R69L 2UWEB 1BQHG 4PJHF 4X6CE 4EVNA 1BJ1J 3CDGA 4RSVA 4OZGF 3S37L 5IP4A 4KTEL 4MDJB 3O2DH 4OZHB 4D8PB 2E7MA 4JQIH 5EO9B 3RWCA 4HV8A 4NUGH 1KEMH 4PJGF 3Q48A 1PG7X 5GS0D 4LDLB 1KTLB 1RZGB 4WTWA 5E24E 1G1CA 3HR5A 4HG4K 3NCYP 4E41E 1KPUA 4X6EB 4NQDB 3UDWC 3A67H 4HWZA 4JKWA 1XIWB 4R4BB 3QIWB 1RURH 1U8MA 3THMH 1R5VA 1U92B 3MBXL 1DFBH 4PRDA 2JELL 4HEPG 4HKBA 1R3LB 3NIFF 1CXKA 3BP6A 2VITB 1PKQA 2KQNA 5I17B 3FJTA 2IPTH 5HGHB 3PJSB 1I7ZA 5JIIA 4I9WE 2BVOA 2E7HA 5TPWL 5H35A 4QNPF 3QQ9C 5KVDH 3E2HC 5FA4A 3W9EA 2BVTA 2VAJA 3OXRB 5BOPA 5C2BH 4WO4B 1H15B 2ZOKB 3QO1B 3F65A 3IDXL 4ZOAA 1FVDA 1KPRB 2MMXA 3W39B 3SDCB 3MBEB 5DDHA 4MMXC 1RHHA 4WEBL 4IOFC 4BQBA 2R8SL 2FGWL 4JM2B 2BSED 5C0RL 2GI7A 1WBXA 3KYMB 3RVXC 2D9QB 1CGSH 2HKFH 2B7DT 1CFVH 2B1HL 2JCCF 1S9WA 1BF8A 4TSBL 5HDBF 2CKBB 2EKSA 1UCTA 2QQNL 4FQHB 5IB4B 3SDDB 2VDMH 2NX5B 4TOYL 1I7TB 1KB5A 1LO5B 3TA3C 2JLLA 4HPYH 2EDFA 3MO1A 1I1AC 1KG0B 5D96B 1R3IH 1ZT7B 2DM2A 4JFQA 2O5ZL 1FH5H 3LS4H 4YDIH 4F58L 3AS0A 4B53A 1YQ2A 4I3RL 2FJHB 4C55A 4X8JA 5A2IH 1T89A 3LD8B 4P3WA 2KPNA 2ZUWA 5GJSH 3QNYA 2VDOL 4PY7A 5IEHA 1UXSA 3HC0B 5CGTA 1T04B 4XMLH 3F7VB 5T5FH 4ZFOA 4HGWA 3DVIA 1UB5B 4O2FA 4NN6B 2EZ0D 4Y5XC 4E42A 3MR9B 3O2DA 5JOPE 1QA9A 1NBYA 2Y5TB 2VZSA 5BW7A 2JJWA 4XCCH 5EIVA 4NDMA 4JFHE 3UPAA 4KI5D 4HGWB 1Z3GH 5ALBH 3SKNB 5FDWA 4ZUTB 5FYLL 4HUUB 3LV3A 1DBMH 1A7RL 4N0UB 3X17A 3U7AA 2X2YA 2V7HA 5E03A 1CE1H 5C08A 4CDGC 2IALA 5EU5A 3TN0D 1NBVH 5KVEH 4GQ9H 4F7CA 1AI1L 3LKRA 4RAUB 5BV7B 5EU7E 3MUGA 5IMOB 2LAAA 4DKAA 4MAYA 1YPZF 4FNLH 2E7CA 2XN9A 4P3DB 1YYLL 3BVNA 3V6FB 1FYTB 3BIKA 3V4PH 2DLTA 2CSPA 4I0PB 1T7XA 2GFBA 1AGBB 1WFTA 4L29A 4O2EA 4FQ2H 4U1JA 4XT1C 1PG7W 4X6BA 5FKAB 2P8PA 3IS0X 5FV2A 1BFTA 3SJVB 3DRTA 3CFBA 3ZDZE 5HHOA 3QWRD 1C5BL 4N68A 4YBQD 5E6IB 2YOCA 1DQLL 3BT2L 1I7UA 1CIUA 4E0RB 4EUPH 4NOBA 5SWZB 3WS6C 2CK0H 2IG2L 4CVXB 5MP6L 4LCWB 5GGSA 1T03L 2HN7A 3VI4F 1A4JA 1EFXB 2W59A 2NY3D 3Q5OA 1RVFL 3L7FA 3PQYD 2Q86A 4NNYA 3C2AL 1I7ZB 3PJSA 1N5YL 5HI4C 4HS6B 1DQQB 2BNQD 3MRBB 4ZPTA 4XH2A 4NM8H 1HHGA 3PHOA 1F4YH 2IQAB 2ZSWA 3MYJB 4LFHG 1P69B 2FJHA 3F7PC 1EEYA 2EIDA 4BH7B 1I1YA 2AABH 4HWZB 5JPMB 3MRLB 4UNUA 4PV9B 1CFTB 4JY6A 3WXVH 4QRQB 3VXSE 5BVJB 5IFAL 3FOMB 2EEBA 4JFFD 2DQFB 1O0VA 1DEDA 1RJZB 4NO0D 3IETB 3WHE0 4ZNEE 1YC8A 3DO3A 2XY1A 5EBWB 4KRPC 3KYOA 5DS8B 7CGTA 2CLVA 3DV6A 3UJIH 2P8MA 4QXUL 1VESA 1XH3B 2P46B 4QHNA 3RJDA 1SY6A 5ICXA 2E3VA 5DUBA 2A83B 3QP3A 1SVZA 4OLXL 5DMIL 4HKXB 1WZ1H 3S8WA 2ZG1A 4D9LL 4GW5B 1J0YA 5CBEB 4LRIC 4HUXB 1IAIH 3T1FB 4Q9CA 1T0MA 4ZPVA 2J2ZA 4DK6A 4UV7L 3EYFA 1QBML 2RQ8A 4A6YL 4N0YL 4JN1H 3DGCR 3NCYS 1KCSL 5IB3B 4YHNA 4LQFH 4PV9A 2YBRB 5GHWH 3CFKA 5IM7B 2O5YL 3TBTB 1T0MB 4ZPVB 4XWGH 1B88A 1QEWB 3O3UN 4XWOD 3UBXI 2D4FA 3MRBA 4KKNA 3O4OC 1KTDA 4HBCH 3WNKA 5TE7H 2IADA 2OXGA 2YD9A 2D7PA 1QVOB 3FFDB 3B5HA 2UWEF 1D6VH 1IGIL 1B0WA 4EI5C 15C8H 3U48A 2EDRA 2X7LA 2Q6WB 4DKDC 3GZKA 4ODTL 1OP3H 4LPWA 4NKDB 2EE3A 5E6IC 4W4NA 3LZFL 1UXWB 4DTGH 1VPOH 4GXVL 1SJVA 1VDGA 3ARDA 3CDFA 5EORH 2DKMA 5E94A 2X4OA 4KC3B 3ARUA 3VFWA 4TPRL 3QPXH 5F7KC 2G2RB 4TSCL 1MF2L 2FX7H 4J4PD 1FZKA 4MB4A 3CUPB 3QFJD 4X5XB 5JHDD 3I6LD 3ARVA 4N90D 5C0IB 2VLRA 4KRPD 5FGSA 3IDMB 1U3HA 3O2WL 5E8NB 5IHZB 1T2XA