1OPGL

Opg2 fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
214
structure length
214
Chain Sequence
DELLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFGGGSKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OPG2 FAB (LIGHT CHAIN)
publication title Crystal structure of the OPG2 Fab. An antireceptor antibody that mimics an RGD cell adhesion site.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 46
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1995-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1opgL01
1NBYB 2PO6A 1F6AA 4HUUB 4R90H 5ESAA 1ONQB 3KWWA 2O5XH 3C08L 2ZPKH 3MJ7A 4RMTA 2HTLC 1TMCB 1G1CA 4XWGH 3WO3B 3MJ8B 4U2ZA 4Y19B 1MVUB 1D5IH 3DX8A 2L7UA 3MYJA 2ARJA 3TT3L 3BGMA 5HYJB 4P4KA 5A2LH 2NY1C 3L3KB 2NY2C 5DDHB 2UUDK 3BIKB 1N0LA 3BIAX 1AD9A 1NFIB 4F7MA 3O2VL 4PLKD 5TFSL 3WFHB 3VFUB 4DFHA 3ULUC 1FFOA 5I6XC 2LFGA 4XNMA 1T1YB 5TDPB 5JQHC 4MYWB 3S35H 1BLNA 3HC0B 3TBTA 3UDWC 1FHGA 3LOWA 3ZSSA 1T03L 1NEZG 5DJ0A 1OP3K 3L1OL 5FB8A 2VDOH 1WWAX 5EOTB 3N85H 2FIRT 2UUDH 5IB3B 4BUHA 4R4FL 4WO4A 4X5LA 1DQTA 3UYOD 3MGOB 3QEGL 1VKXB 4JFDB 4LVHB 4P3CL 4DW2L 1PYWB 5EU4A 1BVKA 5H2BA 3UP1A 1T5XB 3AAZA 4J4PC 5SWZA 4Y1AB 1A3LH 4X9BA 3IAGC 4HDIB 5AD0A 4XVTH 1DSFL 4PYGA 2W0FA 5BMFH 2H41A 1UVQA 1U0QA 3LS5L 4ODBD 5TF1H 1LWRA 4HLZH 4XNQA 3MV7D 4NO5A 2GT9B 5GRUL 3DTXA 3KNBB 4JM4L 4FQXB 5C2UB 4TOYH 2C26A 2XI9A 2JTDA 1BQLH 3QCTH 5C08D 1M6OA 3PP4L 1N7ML 1QSZA 3BPNC 3O2DA 1FZKA 4PJFB 5DJ2A 2EDDA 4XBPB 5GGVY 1KCSH 4CVXB 2CLRA 5IG7A 5D1QB 3TCLA 3NPZB 1BP3B 4M1CD 4C4KO 2VLRB 4MDJB 1TCRA 5FDWB 5FCSH 3FB8A 3W0WA 1WC7A 1JF5A 3MUHL 4U31A 2ZWLT 4YHML 1BREA 3EUUA 1TTUA 5I1JL 3O41A 3OAUH 2ADIB 5EU6E 3VFGL 2BOBA 3QFJA 1VFUA 4AEHH 3EOTL 5DGQA 2C3HA 4TNWK 2OL3B 3EOBA 3OSKA 5IF0A 1P84J 1T0MA 1XF3A 5F6IC 5C0BD 4MCZB 4IOFD 1RD6A 3QDME 1TENA 1NANH 2XKNB 4M9OA 2I5YH 3N50A 1FFNA 1X5YA 2X89A 4GAFB 1ZANH 3QUMH 1OQXA 2DI8A 1WBXA 3OKMB 3QHFL 3QUZC 1GCFA 1ZOXA 1VA9A 4WTZG 5CFHA 1CFTA 4GW5B 3JV5A 2HJKA 2FR4A 4PP2A 4UNUA 1DE4A 1LEKA 1QQDA 1PKQA 2CSPA 2EXWD 2XOTA 2VXSL 3BZDA 4KI5D 3CFBA 3AUVA 2ZUSA 2JJUA 3QUXD 2FBJH 1XGUA 4QHLB 3TBYB 2ADGB 1KJ2L 4FXGA 1E4XL 4X8JB 4PGBB 5F9AC 4ZO8A 2YBRB 3V4PL 2Z8VC 5KSVB 5JW3H 1LO3L 2BDNL 4ZDHB 3IU3A 4XPFH 1OY3B 1ZHBA 3QDGB 2Y6SD 3IU4H 4AY0A 3MV7A 2BVTA 5KOMC 1EZVY 5D96B 3MGTA 3HR5A 3BIBX 3RQ3A 3B9EA 4BQ9A 5J13C 2ZUVA 3EOAA 4C4KT 4WCYL 1RZGA 2OLDA 4OB5H 3MRGB 1FNLA 3I84A 1HHJB 2NNAB 1KFAH 2I60H 3DO3A 4HKZA 1YYMH 4OGYH 2N7AA 5EIIB 1YNLL 4QNPF 3QIUA 1HE7A 4NC2B 4N8CL 4U7SA 2F8OA 4IRSD 3VXTB 1VESA 3OMZA 7FABL 3IS0X 1SEQL 1CLOL 3OHXB 3O2WL 3T65B 4V2BA 5C0BA 4R26H 1S7QA 2CH8A 4U6XB 3WN5B 2YD3A 1S7WA 3VRJB 2E7BA 5EFIB 2DTSA 4U1KB 5BW7C 2QR0B 1X5ZA 4LKCB 1JMZA 3WUWA 1RSFA 4I0CC 4X99B 4YC2B 1BWMA 3EJZC 4JRXE 3ARFA 2ARWA 2PW2B 4P46C 2BVYA 4QF1A 3DUHA 1HIMH 2EH7L 3SDCD 4H25A 4TSCL 5K9JL 1DLHA 5LGJB 3VE0B 3BWUC 5CZKA 3DI3B 3ARDD 1Z9MA 4G6MH 3VW3L 5BVJA 2DLEA 2EKSA 4F7TB 3EDFA 1QRND 2XZQH 3GMLB 2A6KA 3B2VH 3KJ6H 4ODSL 1HH9A 3MA7B 1PAMA 4LGPB 5A2KH 1A5FH 3DXAB 4R7NB 1CU4L 2Y25A 1NPUA 4ZSOE 1HYSD 1SJEB 3G04B 5MEPB 1I1YA 1R5WB 4ETQB 5GS2D 4RFOL 5ESVB 4EJ1C 5ITFB 9CGTA 2Y5TA 4Y4FB 4Z7WB 2VXUH 4XXDB 8FABA 2H8PA 1XCTB 4M8QA 4KGJA 1A47A 2JLLA 5DMKA 3H3KA 4MJ6A 5CJXA 3OKKA 1TZGH 3DMMB 3KYNA 4YX2H 4AQOA 5KVFL 1YZZA 2C1OB 1X7QB 4JN1L 1ITBB 2YUWA 4Y0GA 1QNZL 4XPBL 3VXPA 1B4JL 4L4TD 1V8HA 4HJJH 3ZDXF 2CLZB 4FZEH 5H37G 5I18H 1LE5A 2OZ4H 4Y4HA 3G6AA 3OR6A 4E41E 2MTPA 1CLZL 2VZ1A 4J3UA 3IDYB 5L0QB 4PJHF 3FT3B 3Q6FB 4UTBH 4HZLB 4MDIB 3MV01 4MGXA 1N59B 2XFXA 4M1DH 1JNHB 2XPGA 5KAQG 1X3DA 4IRSA 4N0UE 1QO3B 3W81A 5HVHC 3MBXL 4HLJA 2HT4C 5IEKA 3S3JA 4NHUA 5E8EB 2AV7B 2R4SH 2C9AA 2NR6C 5DRNA 4Z7NE 1P6AB 1U3HD 1GOHA 1NBQA 1AQKH 2NY6C 4I48A 1RIUL 4MNHA 4AT6A 4LPYA 4YDLB 3KHOA 1J10A 1T0NA 2D31B 3VG0H 2JK5B 1DVFC 3LQAL 1LO4H 2ICEB 3SBWA 3S9DB 4M7LL 3PWVA 3VFNB 4M7LT 1VSCA 3QG6B 3LEYL 4LLAA 3LHPH 1A1MA 4P5TC 3P0YL 1AP2A 1CGVA 1PBYA 1Q9LA 5DVMA 4A6YH 4H1LG 5I8CA 4DGYH 4M6NH 1KIQA 3CFJB 3MODH 1A0QL 4MHHI 3T4AB 2BVPA 3QRFM 1BVLA 2NTFB 1I85A 4XCCL 2ED7A 4UTAL 1MUJA 4YDVB 3P4MA 3BPOB 3GSNB 5DJ8A 1J1PH 3OB8A 2X40A 3AMLA 4ZUTA 5FM5M 5HI4D 2E7LA 1HNFA 1MJ7L 4TULL 5F9WB 3V2AR 1S3KH 3UTQA 3KLAB 2QHRL 3ARQA 3FN0L 4PJAE 2AGJL 3V7MA 2AKRB 4ZFOL 1B3JA 2DL9A 1X6NA 3CIQA 2EE9A 1RUQL 4WUUB 4E5XA 4OQTL 1HQ4B 3IRZA 5F8RC 3BKJL 2HRPL 2IWGA 5J6HB 1NDGB 2G5RA 3SKJL 1H3TA 2MCPL 1D9KD 1YN6B 4OGXH 1KB5A 3OAYH 4FTVE 2IPUG 3O4LA 2W0PA 1JI2A 1J05B 2K7PA 3QUMA 3F12B 4NKOB 2VLJA 1PSKH 5T1DL 5T1LD 5FK9B 3WIIL 4W4NA 3FFCE 5J9PA 3AXLA 1S7SB 4JQIH 4OAWB 1UQSB 1I4FA 4LPUA 2X4NB 5DD3H 4KK9D 4WW2A 1TETL 1SYSB 32C2B 4K23H 3FTGA 4XPTH 4EXKA 1PX4A 4JFEA 1RJYA 3CLEH 5GRJH 4IHOA 1NAMB 1S9XB 4LLYB 1VFOA 3WHE1 5J3HD 5E08H 1W72A 4JANA 4N8VG 5E2VL 4ZFZA 1ACZA 1RVFL 3BZFA 1SVZA 4H26B 4RQQA 1O5DT 3U1SL 1I8IB 4NZTL 2NZ9D 2X4QA 3WL9A 3V4VL 3DROB 5IBUB 5HYFA 3QIBD 3W39A 4HWBL 3IJYB 5KTEL 8CGTA 3FJTA 2B8OT 1HILB 3KYAA 4KGLA 4FXKA 3NAAL 4MHHG 2VWEE 3NCCB 4TUKL 4LQFL 3BH9A 3HNTL 4KH2A 3GMPA 4AIOA 3ARGC 2SEBA 1S5IH 2DKSA 2YPLE 3TPKA 1NDMB 2UYLB 1ZT4B 4MQTB 3RL1A 1IARB 4ZS7L 3STLA 5J56B 3MNVB 4F7PA 5FUCC 3BKMH 2GTWB 4MA8L 4I13B 1AKJA 1DBBL 1G7LB 1VEPA 3LN5B 1BFOB 1MLBA 1EO8H 1OB1A 3O4LE 2FJFB 2H6PA 4POYA 1F5WA 1NKRA 2VLJE 3V4UH 1A4JA 3FQTA 2PYED 5JPMB 4OCXL 4GAGH 1CTNA 1NSNL 1DBAH 1IAKB 4WJ5A 5FGCE 2O61A 1MNUH 4V1DD 2F58L 3RGVD 3HUJF 2GTZA 1F2XK 1IGFH 4RMVA 5IFAH 1NCDH 1DLFH 3CSBA 4U49A 1FH5H 5T1LA 5E24E 4HX1B 3K80A 4JFFE 5EO0A 5HDLA 1LK2B 2CIIA 4UT7H 2VERN 3TPUA 4W68A 3C6LA 2C4FU 3QIWD 1AHWB 2J7LA 2Q6WA 1MEXL 4OCWL 3ZDZF 5F71A 4E9LA 4M3JA 1UZ6F 3EGSA 1QFWI 1YQVH 1ORSB 1YMMD 3QUXB 3CSGA 2QQKH 2ZSVB 2E9BA 3MV9E 1EDQA 5D1XA 4U6YA 1K3IA 3QPQD 4NQEE 2F53D 5DT1H 3T8XB 1QD0A 1P4IH 1IM3B 3PWPB 4GXVH 4LP5A 4PRHA 5BOZG 3ORJA 1JZ4A 4GO6B 4IDJL 3C5ZD 7CGTA 4QHNA 4MJ2A 4OV5A 1FL6B 4TQEH 4KK5C 2V2XB 1TJHL 1P4BH 3NIDE 2NY3D 3MFGB 3P11L 3D39B 2W9EH 2DMBA 5F96L 4BSJA 1OGAA 3UYPA 3SQOL 3C60C 1R0AH 1J5OL 1YY9D 2YR3A 4G9FE 1MH5A 3VXME 4G5ZH 1FPTH 5E4EB 3UTTE 4ODXB 3GIVA 4Q6IA 4Q9BA 5JUEL 3SGDI 4RISL 3TF7C 4TTDD 3IDMA 4NRZA 3HAEA 5GGSY 4E42A 4P2RB 4RNRB 1S7XB 5I17A 1U3JA 3INUH 1YQ2A 5GJSL 4JRWA 4EDXA 1IC5L 5KSUB 1OSZA 5HI3D 5EZLA 1UB5A 1VADA 4JR9H 4U6HA 4G6FD 1BWWA 2QSCL 1OARL 2OL3H 2Z92A 4PJBE 2H45A 4NCC1 3UX9B 1L0YA 2FB4L 2VE6A 3QIWA 4H8WL 2PR4H 1IL1B 2FLBT 4CU7A 5B8CC 4BQCA 4A6YA 5J6GA 1HHHA 4PJHB 1VHPA 1QSEB 3JWNC 5HHME 3SJVE 1OHQA 4JDVA 1NCCL 1DQJB 4K8RC 4UILL 4UOW1 4YBHA 5IV2A 4P99A 3B2UC 5DHVB 3L6FB 3R06A 3ARDB 4L3EA 1L7TH 5T1KA 4Y5YC 4WEBH 5AZ2H 3BD4A 4M4PA 1U8LB 3SPVA 5DMGC 4PRID 3ALPA 2X4RB 2EEBA 4Y4KC 1CD8A 3HB3C 1QR4A 3RVTC 1JYWA 2IAND 4MNQB 3D3VB 3KPRD 1IGIL 4AK1A 2W1NA 5JORA 4XX1G 3CVHL 5CIPB 1KN4H 1YEFL 4JHAL 4DQOL 2O5ZH 5HPMA 1XGQB 5CP3A 3UTPD 2BSSA 3EJJX 5EUOA 3TN0B 2FHCA 2VDQL 2X05A 1UKQA 1J7VR 1XF2B 5CJBA 1MIML 4HUVA 3LIZL 2BMKB 1NCWH 2V5YA 1HXMA 3MXVL 3H7BA 4KK6D 1DUZA 1CDHA 1ITCA 1H5BA 2BNRD 4L4TB 4MA7H 1UXSB 5DFTA 4B7IA 2DL2A 5EC2B 3HE7D 3IFNH 3QXUA 4OFPA 3C8KA 2VDPL 5IMLB 3QR2A 5CBEA 1CF8H 3H9SD 1KT2A 3ULVH 4EOWL 3PWJA 1WCBA 4JG1H 3KYKH 3MUY1 1MVFA 4XGZA 5FUZL 3VMOA 3WJJA 2XTJC 5IJVA 1AI1L 1JN6B 2V9QA 1OAZL 4G8EB 3RY4A 4MX7B 4LIQH 4HKJA 5BQ7B 5HBBA 3GMMB 3NCEB 3NZHH 3MRQB 4RSVA 2GITB 5C07B 3UTSE 4G43B 4NQDB 2GY7B 3O6FD 1U3HB 3KPSD 1G9MC 5F7HA 3DRQB 4JQXA 1VERA 5KANI 2AEQL 3QXVA 4HC1A 2R29L 3DSFH 3NA4A 4L3EE 5IIEB 6FABL 2J6EH 1KJ3L 3BQUD 4A2MA 3WNOA 5TE4L 1EFXD 4ODWA 1C08A 3NZ8A 5GSRB 2R2HB 1R24A 4Z7VA 4YFDB 1OWWA 5DUML 4PB9H 5DSCB 4PJCE 1D5XA 3BHBA 3LSOA 1UA6L 2QHLA 1DL7L 3GMQB 5F7NC 3SE4A 2BERA 4UIMB 3BD5A 4XC3L 1WFUA 2XQBH 4XHJD 2X41A 4B0MM 4XWOD 1A9EB 1KN2H 1WUNT 1GZQA 1RQ5A 2FIKB 4U0QB 1AJ7L 3O3BA 3KPRA 3FT2B 5CKAA 5KW9H 1HDMB 2AJZA 3NCMA 4AEEA 3SDYH 5FECA 1X5GA 5IVZB 1V3MA 1T66D 1O0VA 4HCRH 3HE6D 2P5ED 3FMGL 1E6JH 3MBED 3BKCL 3WIFB 4J12A 1Z3GL 4YDIH 5BZWB 3RVWD 1TZIB 4ZUUB 1UH3A 3BI9X 2DDQL 5I15L 2AEIT 1AFVH 1K2DB 1NL0L 4IRJB 1J11A 1ONQA 1RU9L 3ULUL 1D7FA 4OIBA 5IB2A 2Z8SA 4QGYA 2Q8BH 5H94A 4FQHB 3D2UB 3CSYA 2Q8AH 2BVUA 3GHEL 4I3RL 1R3HB 2UZYB 1J8HE 3MJ8A 2AJVL 3MJ6A 3KAAA 4LSPL 1MVUA 4P2QE 3RWFB 1F90L 1N26A 1Y18B 1JPSL 1U8PA 2FDBP 1B6DA 4OF0A 2V17H 4UI2A 3QP3A 3UC0H 3FCTB 1WVZA 1FQ9C 2HTLD 3VXRE 1H3WM 1ORQB 4ERSH 2ZUYA 3L3KA 2CJUH 2DKMA 3EYUH 4TVPD 4XTRC 3ROOA 5DDHA 4PGCA 2W91A 4PJ8D 5C8JB 1EMTL 5DJXB 5SX5K 5L88L 1RZIB 1TJIH 1MREL 3WFHA 5KANG 3VFUA 1NGZB 1LEGB 2NY1D 4O5LL 5GHWH 5TDPA 2NY2D 1QLEL 3CCHB 3IT8D 3HC0A 4FQJL 1X5FA 3PF2A 5CSGA 4H20H 3IVKB 1CL7I 2QLVB 3P4OA 5I0DA 1ETZA 1IBGL 4O2CA 1J88A 2QEJA 3ULUD 1EFXA 5EOTA 3HUJB 4XBEH 3BN9C 1PKOA 5SX5H 3W9EB 5ITBH 3QIBB 4X7EC 3C09C 3EFDH 4M5ZL 5CEZL 2NX5B 3RX5A 3Q1SH 1VKXA 1BIIB 1JNLH 4JFDA 1BQHG 3L7EB 4M93B 1T5XA 4D8PB 3X12A 5SWSE 2YOCA 1U95A 1WZ1H 2HFGL 3MLZL 2JCCA 5HYEA 2P46B 3RWIB 5MEOB 4YHZH 1MQ8A 4KU1A 1MFDL 2GT9A 4XB7A 2DD8H 4H0IA 4EVNA 1CD9B 4ZFGH 4J4PD 1MRFL 5E7FA 4FQXA 3LV3B 5I1GL 1J0YA 2EDYA 3KDMA 1U8KA 3A6OA 3HE6A 1GGIH 2MQCA 2VOTA 4KTDH 4YAQB 4R96B 5A40E 1NLBH 1AD0A 4PJFA 2JJTA 5EO9A 4XBPA 2PYEB 3LEVL 4Y19E 4MA3B 4CVXA 1UXWB 3MLUL 2ID5A 3VFTA 1VPOH 1FE8L 2CLVB 4NQCB 4QRTA 1JK8B 3FOLA 4DFIA 4N0YL 4V1DB 5HYJE 2DYPD 1JNNL 4X7SH 4OSUH 2B20A 2H9GA 4ORZC 1RZJH 4Y2DB 5HDBE 3EDKA 3MLWH 3RGVB 5CEZD 1PY9A 1RZ7H 5C0AA 5D5MF 1MCOL 4LDLB 1JGDB 1WIOA 2OL3A 3LRGA 2JB6B 3IKCB 5E2UL 5TJWK 4MCZA 1BBDH 2R15A 4RAHA 4CL7A 1JGVL 3Q5YA 4KROD 2H2PC 1EA9C 4JQVC 2IPKA 3PV6B 4G6JH 1KTDA 5ALCL 5CILL 3HCVA 5I1KH 2CK0L 3OKMA 3RHWF 3P30H 3WDJA 2KPNA 4AIZA 3RTQC 3QXWA 5BV7L 1RV6X 2F53B 2BSTA 4JFDE 5D6CB 2B1AH 1KJVB 4D9QD 4Y1AE 2Z31C 3RWJB 5ADPL 3QUZD 3DURA 4CADB 2OCFD 3Q0HA 1QKZH 4HKXB 2E27L 3PABB 3C5ZB 5I8EA 4QHLA 3TBYA 3E6FA 3MR9B 3FFDB 4PGBA 2XIDA 4R8WL 5FGSA 3CU7A 5KSVA 5FYKH 3WNNA 4ZDHA 3TT3H 3IFPB 4ZYKB 2EDNA 4WNQB 2J4WH 2FJHB 3QDGA 4ODTL 4PJFE 4QEGA 3BP5B 5C0GA 2VITB 4ZS6C 1FFPB 4PJGF 2VLRE 5IOPB 4JO3L 3O2VH 5TFSH 2KQMA 1XH3B 4WRLA 2YMXL 3GIZL 1FP5A 4L3AA 4HK3J 5KVDL 5I73B 3VD5A 4I3SL 2XWJA 1T03H 3LN4B 1WT5C 2IBZY 4IRZH 4JFHE 2FECI 2Y1VA 3SGEI 1QLFB 2GJJA 3M07A 5DEGA 4JGUA 1YEIL 4R4FH 5EIIA 4JY4B 4WI5A 2IBGA 3QEGH 4P3CH 4DW2H 1AIFB 4BK4A 5TF0A 5FKPB 5HHXL 4X7TA 1IGTA 5CUSL 5FAAA 3OHXA 3T65A 1DSFH 4X6DF 1KLGB 4W4OC 2UWEA 3NA9L 2X42A 3MREB 4U6XA 5EFIA 2VTFA 4K3HA 1KLFA 5GRUH 4JM4H 1WBZA 1IAIL 4LVNB 3D1MC 1GPOH 3MCKB 4WI3A 1YN7B 4K7PY 2YPKA 4RX4A 2AXHA 3PP4H 1DQQB 1EFQA 3IDXL 3PGDB 2KKQA 5DD5L 5L7XL 3QI9B 3K0WA 3BKYH 1BGXL 3EJZD 2IANB 1OCWL 5CSZA 5IFHL 2YZ1A 5JOFB 4L9LA 5D6DA 4N9GB 3DUSB 4N0CC 5LGJA 3OKOA 4P46D 5C70A 5D93B 3QDGE 1KEGL 4JREB 4XMKL 5I1JH 3VFGH 4PJXA 5C3LD 4FQQA 3GMLA 4OKVA 1VACA 4U6VH 3EOTH 3QXAB 3ULVE 2R4RL 2J3SA 2P5WE 1NC4A 2LAGB 4Z5RA 5ICZB 3DXAA 3ECBA 4PV9A 3LD8C 3V6ZB 5DS8A 1JTTA 4NNXA 5ERWA 3IXTA 2VISB 5J89A 5E6IB 4LIQE 5IEHB 2FEEL 4ETQA 5ESVA 2BNRB 5GGVL 1I8MA 1ZVSA 4XXDA 5BOPA 5JIIA 4RGMC 3QNZB 1GGBH 4XRCB 2ADJB 3TO4B 2WBKA 1T89C 1LVEA 2C3WA 3H9SB 4JZNA 2HFEB 1X7QA 2IADB 4CRPA 4NUGL 4N1CA 4M7KH 1QLRB 4DZBA 3VWJB 1MCIA 3IYLW 4K94L 4XCFH 5IVNA 3BPCB 3B8SA 3I2CL 2VXSH 4FXLA 3CVHB 5DLML 2BRQA 3T2OA 2ZOKB 3FT3A 5CZXD 4MDIA 4MB4A 3WV0A 5HHOB 4QHKJ 1LQSR 1QG3A 4OZGA 3KXFD 5F89B 1JNHA 3LAFA 5F7MC 4YZFE 1E4XH 1EEYA 5KBNC 4Y5VC 2QQNL 1AQDA 1BIHA 4Z78B 3V4PH 4L8DA 4RFEB 5IVXF 1LO3H 2BDNH 5HHNA 4JM2C 3FQXB 3EZJB 4NO2A 5H35B 5DHXB 2P8PB 3RI5F 3ZHDA 5MERB 4AIXA 1C12A 2RCSH 3BP6A 1A9BB 2OSLB 4PRAA 2HT4D 3HZVA 3CC5B 3PQYD 3VI4F 4FG6D 2K9UA 4HWEL 2NR6D 4WCYH 2JK5A 4XNZC 2GSIB 5EUKA 1D6EB 1CCZA 2F5BL 3D0LA 3MRNB 4YFLI 2NY6D 4QRUA 3VFNA 2V2WA 2ZUQC 1DVFD 3KJ4C 3NN8A 2EDRA 3LDBC 4OLXL 4P46A 3VDBA 1A7NL 3MPCA 3RBSA 1MCLA 1I8LA 5DHVH 2P5EB 4KKLC 4Z7WE 4N8CH 3MBEB 1NANI 3G5YB 1RJLB 4P5TD 3T4AA 3ILQD 3HZYA 4HF5L 4R0LC 1SEQH 1CLOH 3T1FA 4ZUSA 3O2WH 3GSNA 3UTZA 2B5IC 2I9TA 2GHWB 2LU4A 4NO3A 5TQ0L 1UCBH 2F8VA 1PGRB 1RJZB 3DETC 4HFWB 2JB5L 2YUZA 1EX0A 5GS2H 4X9FA 5CIPH 3HG1D 4QT5B 1I3RA 2NXYD 5A2JH 1FVDB 1T22B 5A3IC 4WUUA 1UADC 2FH8A 2QSTA 1HQ4A 3F7RA 2VR9A 1QPXA 3V5HB 5J6HA 4CAGA 2I9LA 3HC3L 4YE4L 5D7LB 1HH6B 1YN6A 2EH7H 4YGVB 2XKUA 4UNTA 5K9JH 1BOGB 4PJ8B 4BQ6A 2CXGA 1X4XA 2CMRL 3C2SA 4NKOA 2XNAB 4C56E 2EDQA 3VW3H 3GSXB 3BGAA 5FK9A 4FZ8H 3VG9C 4ZTOL 4HLZG 3MROA 4NC0B 3SO5A 2NY1B 4MQXC 1KG0B 4ODSH 4G6KL 3ET9F 4NM4L 5DD1L 1SYSA 1HSAB 32C2A 2YD6A 3CFIC 5DD0L 1FIEA 1CU4H 3ARPA 5HGDA 1B0RB 3L5JA 2A6JB 3Q5OA 5D5MB 5BZDB 1NAMA 1YEEL 4LLYA 4I8DA 4YDJA 1N5AB 4TSBL 4OD2B 1A3RL 3QDJD 5KVFH 4FP8L 4JN1H 4LLWA 1UJ3C 5CGYC 3O6ML 1MCBA 4QHUB 2J5LB 1QNZH 4JKMA 3MLPA 3P40A 1S7VB 3QCVL 1PZ5B 3DROA 2DJSA 1DVFA 5C0IB 1CLZH 3V52H 3IJYA 4FNLL 3SCMA 5EG6C 1Q94B 1YJDC 1YDPB 3DPBA 1F3JA 1E6OL 5JXEC 1CFSA 1R5VB 5LG1A 2VXQH 1DEDA 1LO5B 1R3JA 3MBXH 1NDMA 4ZAKB 2UYLA 1ZT4A 4HV8B 2VSDA 1T2QH 3ZKXC 1S9WB 2IFGA 3DIFB 3S7GA 2HVKB 2GTWA 1GXEA 2DYPB 3ARGD 3B5TA 1G7LA 3T1WA 3GSVA 2VR5A 4BQBA 1BFOA 5C7XL 4XXCC 4HEPG 4OKDA 1DZBA 1RIUH 2FJFA 5JHLH 1I1AC 2A9NL 3LRSB 5HY9B 3LQAH 4FQ2L 3ZYIA 1JZ8A 5B3JE 4M7LH 3OB0H 1F11A 3LEYH 4LLQB 1S9YB 4PJGB 3P0YH 2FNBA 3NCBB 4KROB 5EBWB 2UZXB 3TNMB 2FL5A 4EN3C 5HVFB 3LH2L 4OI8A 1FL3B 2APXA 5F6IB 4HX1A 2FEDC 4XP9H 5LXGL 1A0QH 1IZKA 3C8DA 1BBJB 4XCCH 3TJHD 3WDHA 5HGHA 4UTAH 3HRZA 3GBLA 3QPXL 3T3MF 2EDLA 5EOQL 1WJ3A 2HFTA 1MJ7H 4JDZB 4WU5A 3O6LL 1SMOA 2QHRH 1JHTA 2ZSVA 3FO0L 3FN0H 4QYOA 2AGJH 4MLIA 2A38A 2K1MA 2YD2A 3QNYB 1RUQH 2OR9H 2BNQA 3T8XA 3S96B 4ELMF 2HJFB 4X6DB 5F70A 5ANMA 5C08E 1MF2L 3HMWL 3PWPA 3SDXF 3SKJH 1V3KA 3SY0B 3BMWA 1C8PA 1RIHH 1BJ1J 4ODUB 5FYJL 5B38B 4UOJA 1INQA 3A6BH 3EYVA 3BEVB 4JCLA 1G7MB 5E2TL 5F9JB 4EDWL 5T1DH 2V2XA 4YBLC 5FYKU 1J0HA 3WIIH 3R8QA 3D39A 1RIVL 3DGGB 5BV7B 5IHZB 5DQDH 3KPPB 4DKEH 3MV8D 4KK5D 5EU3B 2AJ3B 3VJ6A 4XB8A 4LCIH 4UNVA 3WKML 3L5IA 4X0KB 4IIQB 5C0JB 5FA3A 4PBXA 2EIEA 1A4KB 1ERNA 1ADQL 3WBDA 4HWZA 1KSRA 1ZXQA 3SGKC 5K9OB 3C60D 1Y0LB 4TTGA 1FG9C 1A14L 4FFYL 1DANT 2CQVA 3TO2B 5E2VH 1RVFH 4P2RA 1S7XA 2P8MA 4KVCL 3IFOB 4K8RL 3U1SH 3LKQA 5CINL 3SKMA 4NRXA 4G8IA 4NZTH 4LEOA 5FYJD 5C6TL 1IFHL 1HOCB 1UWXH 1NGQL 4X6FB 1NCBL 5KSUA 4HWBH 3ULSB 5KTEH 1FCCA 2XN9D 4NO0B 3NAAH 1KIRB 4L5FL 2I07A 4QRPD 4TUKH 5GGRA 3TYGH 4LQFH 4MJIB 3SDAB 1MFEH 3VFWB 1AGFB 5F72S 2HH0H 1FV1A 2EE2A 4ZS7H 3WHXB 3U0WL 1EZVX 5C6PB 3MMEA 4PJHA 1QSEA 1DQJA 4HULB 2CD0A 4MA8H 5E7BA 1SHMA 1DBBH 3LB6C 1U8LA 5IVXB 3FO9B 5EOCH 2IALA 3QT2A 1ZAGA 1NMCC 4K8RD 1S7UB 3B2UD 4MNQA 3D3VA 4TPRH 3SGJC 1NSNH 5KG9A 3X11B 1O7SA 3PNWB 1MCRA 3SO3B 5DMGD 3BSZL 2FGWL 2F58H 3OZ9L 1OTUC 4Y4KD 4MD5A 3HB3D 2AXFB 3RVTD 1GHFL 1JHKL 4G6AC 2P1YA 4WI7A 5D7SH 1AY1L 5D2LA 1CBVL 4HGWB 1RUML 5E2WH 3TN0A 1AXTL 4NGHL 2F8XC 1XIWC 3E1F1 1XF2A 4YPJA 4ZXBC 4CN4A 2FO4A 1G9ML 5IW1B 4OCWH 4NRYA 1NC2D 5EOCJ 3U48A 4XBGB 2EYTA 4HG4K 2VLMD 3VXSD 4H88L 2G60L 2CK2A 1ZGLP 1EO5A 5JW4N 2OBGA 1JN6A 2PYFB 1FZMB 4NN7B 3D69B 3CZJA 4YJZL 3ZYJA 3TZVC 3FB5A 3MRQA 1IMHC 2GITA 5C07A 2Y9RT 1A6TA 2XTJD 4G43A 3ZDXE 3V6FB 4OJFL 4CW1B 4IDJH 4HBCL 1RMFH 2G5BB 3RDTC 4TN9A 1MJ8L 1QSEE 2CR6A 2Y36L 3PQYB 1HHGA 4AMKL 1TJHH 2WZPD 2ZOLA 2ERJB 3MRBB 3V5KA 3V7AG 4MS8C 1RUKL 5F96H 4PY7A 3SQOH 5GSRA 1A6AB 2R2HA 4LLUB 4NJ9L 1J5OH 4XZUA 1Y6NR 1GH7A 4QGTA 5K9KA 3RY5A 4PV8B 3PL6B 4F33B 2A74A 1OGTA 1UM6L 4RFNC 5BS0D 2PKDA 4AL8L 4U1JA 5JUEH 3QWOA 2PXYC 5KSBA 4BA8A 4P5TB 5D1ZA 2OJZL 1A9EA 5TE7L 3MRHA 3X3FL 4J6RL 4O58H 4GRMA 2MCG1 3FT2A 1G9EA 4PLJC 5TDOB 5B4MC 3P4NB 1IKFL 1W0WA 2XWTB 1CDCA 5GJSH 3O9WA 4K3JL 4YHLL 3EYSL 3MZTA 3VFVA 4L4TE 4PJDB 1F3DH 3HG1B 2NXYB 2JKXA 3T4YA 4XC1H 4P2OC 3G5VB 3VWKA 2WV3A 1OARH 3VU2A 1FJ1B 1K2DA 2FB4H 3V6OC 3UO1H 5IWLC 4IRJA 1B2WL 3M8OH 1T1ZB 1RULL 5BO1H 1CGYA 1MI5B 5KVEL 1NCCH 4UILH 1U9KA 3D2UA 4CBPA 1EHNA 4S0TD 4NQDE 4KHXL 4HUWB 1Y18A 1YY8B 3FCTA 1QHOA 1ORQA 2BVQA 3IKKA 4GUPA 3U9PL 1BFTA 3T09A 5C2BL 5FFLA 3T0AA 1TZHB 3HS0B 1IGIH 4PLNC 3RY6A 4NJAH 2D9QB 5DJXA 1KGCE 2IAMC 3BDBA 1JIBA 2DQCL 3CVHH 1RZIA 3O3DB 1YEFH 4JHAH 2MJWA 4L1DA 1IC1A 4LAQL 1LEGA 2BRRL 4XTRD 5KSAC 3CCHA 4OZFB 1AC0A 1KCRH 1K5NB 4CVUA 1AR2A 3RIAK 3RZCC 4X4ME 5IMOB 1MIMH 1TCMA 5TPWL 3LIZH 2JIXD 3MXVH 4NM8L 1M71B 5C3TA 1KCVL 3BXNB 5JHDD 3H9ZA 3DVGB 2NX5A 1BIIA 1AXSB 3L7EA 4D8PA 3BN9D 5FUZH 1GGYA 3OKNB 5IK3B 1AI1H 2A6DA 1A6UL 2HKHH 3DHJA 2WWKO 2YUVA 1OAZH 1AGCB 4KDTA 5MEOA 5JXAL 1BZ7B 2FHFA 4LLVA 5EWIL 1OAUL 3LV3A 1TPXC 4ALAL 3ARGB 3QO0B 3PHQB 2HN7B 4M48L 2BY2A 2AEQH 4YAQA 2EIDA 2V2TB 4R96A 1BQSA 4WU7A 2R29H 4ZUWB 3PE9A 5F21B 5DRZA 1OAQL 6FABH 1IQDB 4Y16A 3QJHA 4HUMB 5TE4H 3AROA 4KRMB 3T0WA 1ODAA 4GG6E 3ZL4L 2Y7QA 3TFKC 4Y2DA 4HWNA 1BVZA 1UA6H 4OLVL 4GBXB 3UBXB 3QUYC 3TVMC 4D0CB 1VGKA 2LE9A 3QG7L 4Q0XH 1BD2B 1D5ZB 4XC3H 2JB6A 5MHSE 1CXHA 2XZZA 4OF5A 2CRZA 1JFQH 4APQA 3WE6B 1AJ7H 1BF8A 3BVNA 3G5XB 4X4XB 5LGHL 1GAFL 2CKBL 3PV6A 4GXUM 4R4NC 2D9CA 3HUJE 1T2XA 5DJDA 1NGWB 2HVJA 2YC1A 3FMGH 1Q72L 2EDOA 3BKCH 1JGLL 5C09D 1INDL 1IGJB 1IEAA 5F3BB 2H2PD 4HHAB 5D72L 3PDDA 2AK4D 2DDQH 4UMGA 2YN3A 1T3FA 1U36A 3QNXA 3RWJA 2JIXA 3GJEB 3HI1B 3ULUH 1RU9H 5C0EB 3RTQD 3ZDZE 2FX7L 4UB0L 1WBYA 1I75A 3PABA 4OUUB 3VXUA 2WWKT 5HDQL 4I3RH 3GHEH 3FFDA 1X4YA 2W92A 2Z31D 4LSPH 2AJVH 3RHWK 1D5MB 1F90H 1JPSH 3CFKA 4LRIC 2VJXA 4BKLB 4KJYB 4S1QL 3S4SB 3KPNB 2ZG1A 3MV8B 3MLTA 4EKXA 2FJHA 3CFEB 3JV6A 2NXZC 4KUZL 1HSBB 2PYEE 4DGIH 4S1RL 1JWMA 3TIDB 1EMTH 4NQCE 4HD9A 3QWRD 4F2MA 5ACZB 3RVVC 1MREH 4V1DE 1XH3A 4O5LH 1QLEH 4ZS6D 1F4AA 5FUOL 1H3UA 1JUFA 3GKZA 1IBGH 2E6QA 3ZLQC 3MACH 1FAIL 2XXCB 5BVPH 4BZ2L 4YFEA 4JY4A 1KLUB 1IE5A 1SEBB 1Z5LB 4L3CA 5BRZA 4R3SB 4M5ZH 5CEZH 4ODHL 4QOKD 2XN9B 1AO7D 5FXCH 5J7CC 1YMME 1AIFA 3WSQL 3WFEH 1N2RB 2MPAL 1MHEA 2W0KA 5GGTL 1FLRH 2HFGH 4U1GB 3OG6B 3JVGA 3X17A 2VQ1B 1UB6B 3MREA 4OCYL 2PO6C 2F53E 4C83B 1MFDH 5FA4B 3DBXA 1S7RB 5I1GH 3QFDB 1LDPL 3WCYA 3RAJL 2CGRL 4PP1C 4GOSA 4MJ5B 2VZUA 5B8CB 1FGNL 4ZTPL 4JQVA 4HJ0C 3I3DA 5ENWB 3QI9A 3WFZA 3LEVH 1WLHA 3MLUH 1FE8H 2R0WL 1R3IH 3CDFA 3DUSA 2QBWA 2R9HC 4WDIA 5I71C 3RTQA 4X9IA 5T3XL 4N0YH 3D18B 1JNNH 4LU5L 2JJVA 4Y4KB 1MELA 1MCOH 2FX8L 3NPSC 1JV5A 1MFAL 4UUJA 3QXAA 3IDUA 3E3QE 2OTUB 1RJCA 4N0CD 2CDEA 2ZKHL 1K8IB 5ICZA 2X4OB 3JUYA 4ORGA 5EPMB 3DECA 2OXHA 3WLBB 1YA5A 5E6IA 4KAQL 4PS4L 3WEXB 3MLSL 2J88L 1NC2B 1NUNB 4JFYB 3GSWB 3F5WB 3QWRA 4XRCA 4DZ8B 3TO4A 2E9IA 3VXSB 5ALCH 3TYFB 2HFEA 1FNGA 3CFCL 1CYGA 2IADA 4F8QA 5BV7H 5IBTL 3K4AA 4RRPG 5GS0C 3VWJA 5HJ3B 1N4XL 4G8GD 5ADPH 4XI5C 4UZGA 5T3XD 4JY5L 4WV1A 1DBJH 4KJWC 2GFBB 3U7WH 3WFDL 5J11C 1A1OA 4JRYD 2E27H 3BZ4B 3TA3A 3V0VA 1WT5A 4ETYA 4R8WH 3O3AA 1A3QA 3H2WA 1FDLH 3BUYB 4N5UA 4NN5B 4D94A 1L7IL 3EO0B 1XR8B 5AZEH 2HP4A 1NEZA 2VDLL 3GMRB 4PRIE 2ZP0T 3QEHB 1MPAH 2P8PA 2DIJA 3DVNA 3MRRB 3MUGB 4GAJL 4NT6A 3SE8H 5JMOC 1BECA 2IANE 1A9BA 2OSLA 4WY7L 3WO4B 1OPGL 3CC5A 1UZ8A 4JM2D 4JO3H 1J86A 1CS6A 4W4OA 3Q3GB 2BVOB 2RJMA 5CWSB 2DQGL 3VGAB 3ARSA 2JJSC 5BS0B 2YMXH 3GIZH 3ARZA 2DQIH 1XGYL 3N1FC 5ID1B 4P9ML 5KVDH 1AR1C 1WK0A 1QSFD 2A9MH 4NKIL 5L2KB 43CAB 5IMMB 3SDDA 3UTPE 3FONB 1WZLA 4PG9A 2YA2A 2APFA 2X4UA 4Q2ZA 3VCLB 4OFYA 1UWGL 4P49A 1F58L 3GGWB 2JE8A 2C3VB 1P6FA 2BNRE 4MXVF 1SYVB 1C1EL 2G9HB 5IROC 4MA1C 4PGEA 4KV5F 5CLWA 2GUOB 3H9SE 1CFNB 5E5MA 1VFMA 1UG9A 4AH2B 5DJ6B 3LMJL 1VFBA 2NW2A 4KKLD 4PD4J 3NA9H 4UDUA 1MOEA 1A6VL 3VD3A 1GGUA 4HIIA 1IAIH 4MMXC 1TXKA 4F58L 1T4KA 2IPUK 1PQZB 5IESH 1JP5A 2R1XA 3E0GA 3HPJA 4GSDH 3KPSE 4M62H 2NTSP 5HHOE 3NTCL 5J4MA 3DETD 3NCYP 3IDXH 2E7MA 4X4YB 5DD5H 5D7LA 4M03A 1S5HB 2R69L 4YK4B 4YGVA 4F3FB 1BGXH 1CXIA 1T89A 1G0YR 5A3ID 1OCWH 5IFHH 4YFLF 2EXYD 2JELL 2GJ6B 3P0VH 4FFVC 1CFQA 2BCKB 4LEXL 5GXBB 4KRNA 1LO0L 4YHPB 2P47B 1V7NH 2YPVL 2C5DC 1NCTA 1F4WL 2AQ2A 3CH1A 4QXWA 2Z8RA 4K7PL 4JVUA 3PXHA 1EUTA 1C5DB 1YJDL 1UM4L 4MD0A 3MNWA 1B0RA 4LFHG 4MQXD 5GGSB 1JHLL 1I8KB 3KS0H 4EI5D 5GGVH 5D5MA 5F6HJ 4XP6L 5BZDA 5FO9B 2IG2L 2NY0C 4PJ5D 3F7PC 1P1ZA 1N5AA 2EE6A 3W5MA 3QIUC 3P73B 4OM0L 4BFIB 2P5EE 4NUGH 4QHUA 4QKXB 3C09B 2Q86A 2V5SA 4K94H 4FQIL 3KLHC 3VA6A 2D7MA 5C0IA 1CICA 4LNRB 1Q94A 1VFAB 5DVKA 5L8JB 4Y5XC 1YDPA 1AE6L 3BWAA 2QQNH 1H3PL 3KS0J 3FRUB 1R5VA 4FS0A 3BW9B 2WLYA 3QISA 3RPKA 3ARFC 3SKUD 5MENB 5T5FL 4IMKA 1LO5A 3HLAA 4ZAKA 4F9LA 1KNOB 5TQ2H 2VQUA 3NCJH 1A2YB 4HV8A 1HXYB 3BGFB 5DC0A 2LQRA 5TDNA 2VR4A 3B6SA 2AXGB 4XMPL 2VUYA 3DIFA 3KPOA 3DV4B 5JXED 1P7KA 2N56A 3MCLL 4DK3A 1YPZA 1Q9OB 2LU7A 4JHZA 4RMRA 2D4FA 1X5AA 3R0MA 1GOFA 4CDGC 3LRSA 2NY7L 3LY6A 3K4ZA 1U92B 3K8KA 3MSPA 4NQXA 2F5BH 3QSKB 4LHUD 4OZHE 5FV2A 5IKCA 3RWCB 4D9RD 4LLQA 4UQ3A 1VDGA 1I1AD 1CIUA 5C0NC 4CDHA 3NIDF 2FATL 5JDSB 4GRLB 4TRPL 4OT1H 4OLXH 3ULUE 3B4NA 2AEPL 1A7NH 1FL3A 4U1SA 1JWSB 4YIQA 4QHKI 4FFWC 4NZDA 2QSQA 4ZNEA 1IGYB 3AU1A 3GZKA 4QXUH 5CJXC 3X14A 3M1BB 4X6BA 5I1CL 3FQRB 5DC9B 5IBUG 2EDJA 4EN3D 4HF5H 3OF6D 4HBQA 3WD5H 1BZQK 2DIAA 1EXUA 2VN4A 2YA1A 1YC7A 3ZE0F 4QRRB 2FEDD 3PXJA 4JDZA 5EH1A 2JB5H 4Y4HC 5D2NA 2B0SL 1PDKA 3ISWA 4PJ5A 4ZSOB 4M6OL 1DEEB 3QNYA 2ZCHL 4JZOB 1CXEA 4OLUL 4P4RB 4NZRL 1MWAA 3M45A 2OTWA 5AUMB 5DFVC 2DBLL 3QEQD 2HJFA 2OQJB 4OZFH 1KBGH 1HI6B 4XPAL 5DRXB 1LNUB 2PUQT 3HC3H 4YE4H 5E8OA 3CDCA 4ZG1A 3SY0A 1E4XI 4UINH 4PRPD 5GIRA 5I66B 4BSVB 3RUGB 4PJBF 3BEVA 1G7MA 5CMAA 2CMRH 1UJ3A 4NZJA 5HHPB 2Q7YB 5BCAA 1ZMYA 3DO7A 4ZTOH 2OP4L 4OFKA 3I6KA 4XNUL 5TH2A 5DXWA 5IHZA 5CEZE 3KPPA 4G6KH 4NM4H 5DD1H 3FB7A 1U3YA 5JA8B 1U8QB 3ARBC 5EU3A 3SBWC 2AJ3A 1H0DA 1OLZA 3ARTA 3QA3A 3LS4L 4IIQA 3ROLB 4NZUL 1OT1A 5JXEA 3PWUB 5C6WH 1IAOB 2DLFL 4LCYB 3LEXB 4N0UB 4F7CB 4FQPA 4PJGE 2NQCA 4K2UL 1YEEH 4U6TA 2YSSB 4TSBH 1ZT7B 1Q38A 2EEDA 1EVUA 4GKNA 3WS3A 2IH1B 2YWZA 5INDB 4FP8H 3PIQB 5DUPL 1E27A 1I85C 3O6MH 3EAKA 3IXAB 4NKDB 3N1QC 1I1AA 2HFFB 5HDOA 5I30L 3MJ9L 1HOCA 4X6FA 2UZIL 4MD4B 4D9QE 1P5VA 2Q7NA 5DURD 3ULSA 3S3PA 4FNLH 3QH3A 4L8SB 2IF7A 1MCNA 2DQDH 4P57A 1INEL 4N0FA 5EBLB 1E6OH 3VXNA 2J8UF 5GSVB 3MGAA 4MJIA 3SDAA 3VFRB 3VFWA 3CDYA 1ED3B 4EN3A 1O7VA 3OF6A 3F6IA 2ATKB 1YYLL 1N6VA 1U8MA 4X6DE 3IDIB 4YDKH 4HZAA 1QYGH 4WI8A 2F5AL 4H1LA 5MEQB 4Q6YA 2FCBA 2QADC 4RAUB 4Q97A 1U8HB 2EDWA 3O81A 4O9HH 4XCYB 3FO9A 4HIEA 1L9NA 5E8PA 2IBZX 4HIJA 5CP7B 5B39B 1B9ZA 3ILPB 4NN6C 4DUXA 3QO1B 4JO4L 2H26B 4WW2C 3PNWA 1C5BL 3UPRB 1CVSC 1A8JH 2VLKB 4RMUA 3F58L 5T3ZL 2Y07L 3O4OC 4HGWA 3PDGA 1KPUB 2AS5M 4ZOCA 1CQYA 3EW3B 1FNSH 1OTUD 2X1QA 1FYTA 2APTA 1LD9B 4Z7OF 2AJYL 4RGMB 5IW1A 3AREC 3DVFA 3EBAA 3FFCB 4G6AD 1HZHL 4G8GB 12E8L 4QHMA 3DX9B 3RWGA 1EGJH 4OZIB 1AGBB 5C0CA 4RA0C 5FYLD 3O6LH 3O6KH 1XIWD 3GSRB 3FO0H 4JRYB 4K7PX 4ZXBD 4MMZC 3O8XB 1ND0B 3VRLF 4P23C 2XICA 1W8NA 3M17A 2OJEB 3WS6C 4NHCL 3MRIB 3NFPB 5JO5A 2A6IB 3HMWH 1U3ZA 3ARXA 3GSOA 1R3KA 1G9NH 4G3YL 2VDNL 4Y5VB 2QKIA 3V6FA 4CW1A 2WLZA 2R8SL 3O45A 5FYJH 5C0RL 4CMHC 1C16A 2G5BA 5E2TH 1ZEAL 1HHKB 4JM2B 3TZVD 3WIHL 4EDWH 4WWKA 2R2CA 2ZCLH 1RIVH 2GW5A 4J1UB 3OKLA 1QSFB 2P49B 3FL7A 3S36L 5IVXE 3BESR 3FN9A 1MY7A 2ESVD 1A6AA 3I9GL 4K3DH 4L4VB 3U7YL 4DCQA 5ETUA 5A2FA 3WKMH 1CGTA 4YXKH 4LCUB 4XNZB 1MRDL 4PV8A 4KDWA 4F33A 1ADQH 4F15B 4CMMB 2DB8A 2ICWI 4HXAL 3ZHLA 3IDNB 1KJMB 4JHWL 3VI4E 4FFYH 5GGQL 1M7IB 1YEKL 4M7JH 4PGDB 5IB1A 3T0EA 4XP4L 4KVCH 3CLFL 3S5LB 4K8RH 4NNYA 1GZPA 5F1IA 5CINH 3C6LC 5TDOA 4NDMB 2PXYD 4EEEA 3O3EB 5C6TH 1IFHH 3L3DB 1CLYH 4XPHH 1JRHL 1NGQH 2VIRA 1NCBH 1QFWL 4R0LB 4LDEB 1R3LB 1WZKA 1XZ0B 3QZWB 5FGCB 2VUOA 4PLJD 5B4MD 3G5VA 43C9B 5D1XC 4L5FH 3QUKA 3I6GA 1B4RA 4OFDA 4QY8B 3HA0A 5IR1A 3TBVB 4LSTL 1JF1A 3GM8A 5ISZD 4JFFB 5BXFA 2W9LA 1MI5A 2X4PB 1W0VA 3L5XL 1OAYL 5CD3B 4KRPC 4IS6B 2EIZB 1T83C 1QBMH 1YY8A 3RRQA 4LSSL 1FG2A 3PQYE 1K6QL 3ZE2E 4LKXB 3OJ2C 4MWFB 1ZT1B 3K1DA 4M43L 1TZHA 3HS0A 3LKOA 1KXTB 5KS9B 3BSZH 5I8OL 1FN4B 2IGFL 4AJ0A 2YXMA 4QTHB 3GSUA 4EI5B 3B9KB 3GDBA 2XZAL 4EUPB 2X7LB 1AY1H 4NQSB 4UV4L 2UVFA 1RUMH 4Q6IC 4LBEB 1AXTH 2WIMA 2IAMD 4NGHH 2DWEA 5HDBF 1UT9A 2E3VA 3RDTA 4OLEA 1G9MH 5KSAD 1I1CA 1ZLUH 4UT9H 1M71A 2X1XR 2D7PA 4J3XA 2NY4B 3RZCD 2XA8L 3BXNA 2VAAA 2OK0L 2W65B 3DVGA 4H88H 2G60H 3EYQC 1V7ML 1P7HL 3VXMB 3JUZA 4PJDE 1P53A 5I1DB 3V5DB 1RHHB 3HG1E 4X5WB 3REVB 4P2YA 3UTTB 2UY7A 1AGCA 25C8L 4O4YL 3IDJB 4U05A 3W11C 3U0PB 2B4CL 1FLTX 2YZ8A 4HT1L 3C5JB 4OJFH 4X6EB 4K71C 3RGHA 5DK2A 1IILE 3MNZB 2HN7A 3E6HB 1MI5E 2Y36H 4AMKH 3EO1A 4ELMA 3ZKXB 1BX2A 4ZUWA 5I76B 3QJFB 5F88B 3SDXA 3L7FB 4HFUL 2AW2A 1RUKH 1KEML 5LBSL 4LHUB 4DKAA 1VCAA 3CZFA 1SJVA 5ISZA 1TVBB 4P2OA 4P3DB 1OF2A 3VMNA 4RZCA 4HJGA 3ARRA 1UM6H 3UBXA 4AL8H 1BD2A 1D5ZA 2P43B 4KUCD 4ISVA 3TFKD 5FIEA 2OJZH 3WE6A 4ACPA 3FO2B 5GRXG 2BOCA 4GT7A 3QDJE 3QUYD 3TVMD 3EO9H 4RWYH 1IKFH 3UCRA 1H5BC 1OW0A 3EYSH 1NGWA 3G6DL 1ZA6A 4UAOB 1HHIA 3VXOB 2DM4A 4JB9L 5GJTH 4FABL 3QXDA 2IAMA 1K8DA 3S88L 1CGXA 4GS7C 2EC8A 3WJJC 4U3CA 4PRNB 2HLAB 1FO0L 1NMBL 3GJEA 3P0GB 2F54B 3HI1A 1B2WH 5KSAA 3H3PL 4OCRL 3D87B 3IJSB 4PRPB 5HYQA 3BH8B 3H0TA 5KVEH 4WVRA 1MHHB 3BRFA 4OM1L 1FSKC 5IQ7L 1U8JA 4G9DA 1NUDA 2J8UB 4JQXC 1D5MA 1G6RL 4KHXH 5J57B 4BKLA 4GRWF 5D8JL 1I7RA 3VMPA 1NLDL 2VYRE 3U9PH 1EGJA 1HSBA 2BY0A 5C71A 3LZFH 3R0NA 3TIDA 3VGBA 3NVQA 1U41A 2PNDA 2DQCH 4U1MB 3GRWL 4HPYL 1A64A 3BYYA 4YUEL 2A1WL 2Z0BA 3WFBL 1FVCB 1ZV5A 4PJ9C 4LAQH 2BRRH 2NXZD 2E6JA 2O5YL 2H3NA 1DQLH 4EBQL 4NC1E 1I9JL 3D0VB 4MXQD 3GHBL 3RVVD 4BZ1L 1BD2E 3EFFB 4RAVB 3MRPB 4NM8H 3U46B 1G7PA 3ULVF 3IJHA 4HEME 5ESQB 1RUAL 4YHKL 4QRQB 1KLUA 1S7TB 3LVEA 1UCTA 5DURB 3S36X 5ADOL 5CEXA 1WFTA 1MIEL 3F7VB 1FC2D 1F02I 5I9QC 5I74B 4LCWA 4C54A 1Z9OA 2ADFL 1ZLWH 5E9DD 1V5JA 2Z4QB 4ZFFB 1A6UH 2Y23A 1LE9A 1HQRA 1JTPA 4M7ZB 4C83A 4XCEB 5JXAH 4P9HC 3PGFL 3QUYA 3TVMA 1PD6A 1NGPL 2DM7A 5EWIH 1OAUH 5F44A 3BZEA 5FM4A 5JNYB 5EC1A 5F7FA 2PO6D 4M48H 2R1WA 4UIKL 4MJ5A 1RUPL 3IDGB 4KI1A 1YMHA 5IMKB 4QRSB 2DTML 1BZ9B 3DX7B 1OAQH 5CLTA 4PP1D 2QL1A 1ZGLB 4YZFF 2J8OA 4I77H 1I7UB 3MV8E 2Z9TA 2A73B 5IHBA 4ODVL 3D18A 2O93L 3ZL4H 1NMAL 1GJIA 4K9EL 5FGBA 3BPLC 5GS0L 4OLVH 2OTUA 2FWOA 2BC4B 4N9OB 3O0RH 1DUYA 2R9HD 3QG7H 4P4KD 4ZPTA 2X4OA 5EU6D 4X9GA 5EPMA 3MRMB 3WLBA 5EIVA 4P3WA 3KPMA 2DLHA 3MXWH 3BOVA 2NLJA 4XH2A 5ALBL 1CFVL 4FQLL 5LGHH 1GAFH 1AGEB 4U33A 4YO0B 4DZ8A 3QAZB 2W59A 4ZXBB 5FYJE 3O2DL 1Q72H 1INDH 5IW6B 2DMCA 2Z8WC 4LVHC 5D72H 2YRLA 3QEUA 2XN9E 1A21A 4U1HB 4QRPE 1KB9K 4MNGB 1RK0A 4Z7WF 1KCKA 3REWA 1SBSH 2VNCA 2GFBA 2FX7H 3PWNA 3QB7C 2VO5A 3MJGX 5GS0D 5ICYB 5SWZD 4FQXC 1I3UA 4BH8B 5L6YL 3KVQA 4XI5D 2FD6L 3FT4B 4KJWD 2FX9L 3D5OF 4S1QH 2VABB 1U2HA 2EC9T 2YUXA 2JJTC 3FB6B 3GMRA 4JJ5A 2ESVB 3U0TA 3SKNA 5D1QC 3MUGA 4S1RH 2Z93B 3T0BA 4J3SA 2PW1B 1TITA 1MCJA 4LVEA 1JYXA 1QVOA 4I9WE 1BJ8A 4U3HA 3MOAL 1MHPL 1BQHA 4KMTL 1V3LA 3D85B 1I9RH 5FUOH 5IMMA 4TUOA 3W0WD 1TLKA 1ZS8B 3WLWC 4PTUA 2GCYA 3ZYZA 5LCVH 5TGBB 1X5XA 4E0RB 2EYSB 4LMQI 3VCLA 3QFJD 5EA0L 4NBZB 1DANU 4BZ2H 3P2TA 5IHLB 1KB9J 5EZIL 1SYVA 4MB5A 4ODHH 4OF3A 5DVLA 2VLME 1IC7L 1NAKL 3VXSE 2GUOA 1EAPB 3WSQH 2AI0L 4PG2C 5EU6A 5GGTH 5FCUH 4AH2A 2M1KA 3P77B 4NIKB 2X89D 2FSEA 3MLYH 5DZOA 1T7WA 2R1YA 4NWTL 1L0QA 1MCEA 4Z8FH 4XVJL 1ZSDB 1EHLL 4L8BB 1LDPH 1S8DB 5DA4A 3QDMA 3RAJH 1QBLL 5DJCB 3F62A 1FGNH 3GBNL 3DLQR 3P9MA 2VLLB 4IJ3C 4LLMB 4X5XB 1KV3A 3HHRB 3QQ4B 4MSWA 5INCB 4LSDA 1REIA 4WEUD 4F3FA 2R0WH 4AG4L 5F3HA 1TVHB 2GJ6A 3RZWA 3K1KC 1P84K 4OTXL 5T3XH 3U4BL 4I0PB 1Q0XL 4LU5H 1CVRA 1KYOK 4YHPA 2P8LB 5D96C 3ULVC 5DJYB 2V7NB 3NACL 2FX8H 1IQWL 1DJSA 4I4WB 2EYRA 3I85A 4DAGL 2LAAA 2ZKHH 3HPLA 4FFVD 5BS0E 3LKPA 1XGTB 5F1NA 3NGBB 4KAQH 3HI6L 3JXAA 4PS4H 5L2KE 3CU1A 2ZUTA 3MLSH 2J88H 5FO8A 1H9VA 3VD4A 5B3JF 4RGOL 2Q76A 5EN2B 4I0KA 4QXGL 3CFCH 3GUTA 4BFIA 1DP0A 5DF0A 3MO1A 5I1IL 3QRGH 2NY0D 4Z0BL 3HKFA 5E8NA 1N4XH 4BJLA 4TYUA 2JF1A 2JJSA 3G5ZB 3QIUD 4JY5H 3T77B 2EDTA 4FMKA 3CJJA 5IFJB 1VFAA 4NBXB 2RGSA 4JO2L 1GVIA 4B50A 3G08B 3I02B 3L3JB 3KLHD 3FRUA 3KYOB 3BW9A 4R90L 5DYOB 5MENA 1JWUA 1KYOJ 1J1OH 5EU7C 5F8QC 5CD5C 4XP1L 1L7IH 1E4WL 5E1AB 1AC6A 1HXYA 3GMOB 2VDLH 4H0HB 1UC6A 5AWNH 3K8MA 1SVCP 5DO2D 5IROA 4GAJH 3OJDB 3OJMB 3ARFD 5DD6B 4L9LC 4X7FC 5D6DC 1NFDE 5D7KE 4WY7H 1D5IL 2NY5C 2GJ6E 3X3GL 5LGKA 4GRWB 2DQGH 3RKPA 2NYYC 1XCQA 1U92A 1KTLB 5I16B 1CG9B 3VD9A 1E4JA 4NKIH 5FEBA 4JFOA 1N5YH 4JRXA 4KJQC 4XCNA 4OZ4B 3MRLA 2ZUUA 1UWGH 1F58H 4G42B 4NUJA 3RL2B 1W2KT 1T21A 3I6LD 4GW1B 1C1EH 4WGVB 4LL9A 5C0ND 2VDOL 3M1BA 2WQ8A 1WIPA 5JHDE 2QJDA 4O02L 3DMMC 1B0GA 1UYWL 4P48A 1D5BB 2FRGP 1MLCA 2MWCA 5HHVH 4FFWD 3LMJH 4QRRA 1G7QB 3MV11 1T6VN 1N6UA 35C8L 3VGHA 2FJGB 2P5WB 5FM5O 2F15A 4U3XA 3HNVL 1JGEB 3MOBL 3U30B 4ZSOA 3RWDB 4F58H 3CVIL 1EBAA 4NQTA 3JV4B 4EUPH 3W5NA 5AUMA 5EZOL 3D25B 5GRWA 1HI6A 3U2SA 2ZCKL 5TF1L 3OKDB 4Y4HD 1LMKA 4H0GA 4KI5F 1CD1B 4NKMB 5JDJA 5MENE 4GW4A 4OCNC 4RA3A 1FVEA 1K4CB 2CRYA 3QCTL 2JELH 5F7DA 4M61B 2APBA 3L9RA 4LEXH 5E00B 2VDRL 4FTVD 2V7HA 2AQ3A 5HHPA 4Q9QH 2GJZA 3HMXH 4E41A 3UZQA 2YPVH 4YDLC 3WNLA 4GG8A 1Q1JL 1OD9A 1T7VA 1F4WH 2F74B 1U8QA 1I7TB 4K7PH 4Y5XA 5F1KC 4YEFA 1YJDH 3A6CH 3ROLA 1UM4H 3N06B 4OUOA 3PWUA 4N0UA 2Q20A 2XXMB 3MLXH 4AEHL 4LF3B 2IG2H 1DBKL 4Z7UE 4LSVL 5BJTB 2YSSA 1LEIA 1G6RB 1XFPA 1I8LC 4BSWB 1JZ5A 4WI9A 1IM9B 5DQJA 5T1MA 3W9DA 1KB5L 4GFTB 5C09E 2G2RA 4HIHA 4IMLB 3IXAA 4U1NB 4NKDA 2NW3B 3BPOC 1ZTXL 2AK4E 4FQIH 1ZANL 3LKRA 3QUML 4LSRL 3AB0B 4ONHA 4QRRE 3T0VA 2XWBA 4L8SA 5IHUL 3BO8B 4N90E 5LQBH 3IGAA 5IT2L 4HUXA 3VFRA 2GSGB 2ZNWA 1ED3A 1YNTB 1IAII 5B38G 5T5FH 4JFPB 2EDKA 1FZOB 3FQWA 5EU5B 1X5HA 1YEDB 3KWWB 3MUZ1 3GK8L 4PBWD 1XF5A 4ELKB 1SM3L 3IDIA 1QR1A 1KIPB 2WBJB 5GGRY 4U0RB 1M7DB 3GFUA 2YPLD 5CJQL 3GM0A 5F6HI 1KPRA 5MEQA 5KZCB 4R7DB 3DX8B 5E99L 1N8ZB 1W72L 4RAUA 3RUGE 4KKAC 1KCLA 4PLKC 4XCYA 3BGMB 2NY7H 4MAYA 4P4KB 5I71B 4JDTL 4PJAA 1N0XL 4J8RA 5B39A 2YRZA 2YD5A 3O4LD 1Q0YH 2H26A 4F7MB 2QADD 1NGYB 4JFQA 4I18B 2VLJD 3NPSB 3FN3A 1EHAA 4RBPH 2FATH 4JAMA 2Z91B 4ZOBA 1FFOB 4TRPH 4XNMB 2AEPH 4G7YL 4OB5L 4FTVA 4CVZB 1G7JB 4LSUH 5EB9A 4NPYA 1KPUA 2FEEI 4JKKA 5FHAL 4HS3A 2MFNA 1J8KA 5LAXA 1Q9WA 4WHYH 5I1CH 4HXBH 5A16B 3QCUL 4C56B 1LD9A 1YYML 2GQHA 2PTTB 4QOKE 1AO7E 4JFED 3GO1L 3JWDL 3FFCA 4WO4B 1JYVA 5GRZA 5DJZB 4U1LA 3U9UA 4WENB 1CT8A 1VEMA 5EU4B 1BVKB 1ND0A 3AAZB 3ARBA 4M6OH 3J8F7 3SCMC 3HFML 4R26L 2W0FB 5GS1A 3NFPA 4XPAH 1ROWA 4PREB 4XNQB 1ZA3B 3LKSA 3TGXA 3DTXB 1X4ZA 4P23D 3ZT7A 4NQED 3O11A 4AYFA 2P7TA 5JLZB 3NFSL 3VH8G 4NWUH 5GRYA 1M6OB 2OP4H 3DYPA 2CLRB 5IG7B 3TCLB 1MFBH 4KKNA 3OAYK 2BXZA 3FB8B 3W0WB 1ZHNA 1AKJD 4B53A 5KVGL 1F13A 3LS4H 4NZUH 2DLFH 3QFJB 2YPLA 2WQRA 3B2VL 3KJ6L 1LP9F 3EOBB 4PJ7E 1KJMA 5IF0B 1WIUA 5HGAA 1M7IA 1IT9L 3WFCL 1XF3B 2VLKE 2HKFL 3OG4B 5DUBA 2BNUB 3S5LA 2C7UA 5DUPH 1T7XA 1MCKA 4ZD3L 4EI6A 2YD8A 2V5TA 2UY6A 5I30H 4UU9A 1ULVA 4MA1B 2EH8L 2UZIH 1WBXB 4G8GE 2VXVL 4H5SB 4I1NB 4YX2L 5HGBA 4OZIE 3VGGA 5T3XE 5GZNC 3VFPA 3QUXC 2HJKB 3C6LD 2FR4B 1LK3L 1MCDA 2WW8A 4MXVE 1H3XA 4JRYE 1INEH 1DE4B 4ONGH 1LEKB 3PGCA 4HJJL 1QQDB 1PKQB 4BQ8A 4FZEL 5IW3A 4KV5E 3T04D 4UQ2A 3K2UL 1WWWX 1YYLH 4OD1L 4UTBL 1JYNA 4JFFA 3DUUA 1FGVH 5D1XD 2P24A 4FXGB 2RB8A 3TBSA 1F4HA 4JG0L 2F5AH 3B5GA 4KHTL 2EIZA 4ZUVA 5HD8C 5F93C 3UZVB 3AREA 2Q3AA 4F8TA 2NCMA 3IU3B 4PRHD 5L2JB 1CLCA 2LV4A 3V0WL 3MV9A 4LKXA 4NSKB 4KRPD 1FC1A 3MV7B 3RVUC 2VDKL 1ZT1A 4P23A 4JO4H 1AQKL 4WI2A 3MGTB 4NQEA 1QSFE 1I9IL 1KXQE 1FN4A 3WS6A 5ID0B 4L4VE 4QTHA 3B9KA 1M05A 5C08B 3EOAB 4GKOA 1QP1A 1URLA 5AYUH 5K9QI 5E4EC 1TNNA 3L5HA 5T3ZH 2Y07H 1OGAD 4NQSA 4LBEA 3LHPL 1TJGL 4GG6F 2HAZA 2FBOJ 5EBGA 2AJYH 4LCCA 4OCMC 5EO1B 1DN0A 2IQ9L 1HZHH 4OD3H 5GRVK 4Y8DC 2W65A 3FHAA 4KVNH 3UJJL 3HMXA 1RZ8A 3GI9L 4G9FA 3VXMA 2EEAA 5I1DA 1RHHA 3BEWB 4X5WA 5C0BB 3AY4A 1S7QB 5IGXL 4NHCH 3UTTA 1S7WB 3BX7C 1S3KL 4X9HA 2CRMA 3D6GA 2WIIA 3IDJA 2YHGA 4QCIB 3EYQD 2C1PA 3KLSA 3MRCB 3U0PA 3UBXI 4G3YH 3VFMB 2VDNH 3TIEB 1PFCA 3Q6GL 5E94B 2R8SH 1P7QA 2W07A 1U8NA 3U4EA 5C0RH 3MNZA 3WIHH 1ZEAH 3E6HA 3ARDC 3W11D 4OGXL 2MHAB 1OQOA 5K33A 3L3IB 5F88A 3L7FA 1MCPL 2CPCA 3QHTC 1DLHB 3S36H 3U7YH 3I9GH 5HYSB 4L3ED 5T1KD 1TVBA 5BVJB 4OZFG 4PJBA 3K46A 1JTOA 3FQUA 4J3OC 3RPIB 1MRDH 4JQIL 1SY6H 4LPXA 1K3ZA 2Y72A 5KS9E 4HXAH 1HH9B 1AGDA 4OCSL 3SJVA 4XPTL 1JCKA 5GQBA 1KPVB 3OAZH 3TN0C 1F4XL 1I1YB 4XP4H 3FO2A 3PHSA 3CLFH 1FBIL 2Y5TB 1RZKL 3CLEL 1T83A 4WFHD 8FABB 2H8PB 4HAGA 3I75B 1IC4L 4N5ED 4MJ6B 2CKNA 4GAYB 3L95B 3OKKB 1JRHH 4HC1L 3BD3A 5K9QG 2WINB 3RNKB 3CX5J 3DWTA 4LGSB 4Q58C 1HCVA 1XGPB 2QQLL 2ENYA 2OZ4A 1I9EA 3DX6A 4GMTL 1Y6MR 3NFNA 3G6AB 1HEZA 2AABL 1FYHB 2F54A 4LSTH 1KJ2B 5E8DL 5A1AA 1SJXA 3ZE0E 3G6JF 2AERT 3BH8A 3GI8H 2B1HL 3L5XH 1OAYH 1KC5H 1MHHA 4IRSB 5EBMB 1U3HC 3ZTNL 4S0SD 2H32B 2J8UA 1ZHKB 5CCKL 4JVPA 1TQCB 5IEKB 3F65A 2ENSA 3WYRA 2GK2A 3AGVA 5IUSA 2G75A 4P2QD 5DRNB 2W0LA 4UBDC 4OGAC 1G7HB 4M43H 3UBXG 1QUNA 4I48B 4MNHB 3VXRD 4AT6B 3OQ3B 1T0NB 15C8L 5J1AA 2XZAH 1K4DB 4R4BB 4POZC 3UTSA 4UV4H 3PWVB 2BY1A 3CGTA 4P9HL 4JLRB 3SDCB 1WFOA 3D0VA 1MNUL 1AP2B 5D1ZC 4Z18A 3QULA 3UJIL 4F57L 3EFFA 4Q9RL 3MRPA 5DJAB 2PTVA 3U46A 1FH5L 1KIQB 4KKCC 1ZGLM 1ZHLA 3T3PF 3ES6B 3DARA 2DRUA 5JOPD 2XA8H 1QRNB 3O9WC 3RKDC 2OK0H 1UH4A 2BVPB 5JW4Q 4NFCA 1BVLB 5AEAA 3FRPG 1MUJB 1V7MH 4GRWH 2VAJA 4PYHA 4PJCA 5DJ8B 4YNYB 4ZUTB 3N0PB 1L4IA 4XHQA 3LQAC 1YQVL 4KJPC 4QLRA 3VWKC 3UTQB 25C8H 4O4YH 1MJUL 5C92A 1LHZA 3QEQE 3CXDH 2QQKL 5J12C 4F7EB 1QRKA 5MI0C 4DGVL 3Q2CA 3P9LA 4IRJC 3N1PC 2B4CH 3NCFB 4HT1H 3RU8L 2F54E 3S4SG 4E5XB 2QQQA 1CK0L 4D0BB 4PRPE 4GXVL 1N6QH 1I3VA 3RNQA 1KB5B 4JN2B 4QRSA 2J8UE 1BZ9A 3DX7A 3KPLA 2YKLL 1KEMH 4NYLB 5LBSH 5KOVC 1ZGLA 4GH7B 4Z7VF 1I7UA 5KJRH 4CJ0A 5E6YA 1P4BL 4Y19D 4PRBA 3RY6C 4KXZI 3AXLB 5E56A 3K8LA 1I4FB 3DVIA 4NN6B 4DJMA 3PJSA 4NOFA 4JZJB 2R0KL 5D7JA 3JWOC 4WW2B 5HYJD 5FOJA 3FTGB 1EEQA 2DQFA 4ZOAA 1M1SA 1RK1B 1J8HA 1JPGB 4P2QA 4JFEB 1RURL 1RJYB 3O4OB 4HKBA 2A0LC 1AGEA 3VXRA 1LP9B 2DBJA 4X80H 3G6DH 1W72B 1A7OL 4RQQB 5IW6A 4JB9H 2BZDA 4FABH 4M9PA 3INUL 3GKWL 3ALWA 3STZA 4OF8A 2X4QB 3WL9B 1ZLVH 4U1HA 4PJ9A 4Z7OE 1NMBH 3W39B 3CMOL 4DKDC 4KDTC 5DTFB 3C6SA 2BHZA 2RFXB 1N3NA 2YD9A 3H3PH 4JFDD 3MRFB 1ZLSL 4FXKB 4XAKE 5ICYA 3NH7H 4Y1AD 2OL3L 4OM1H 5IQ7H 3BH9B 3VRLE 4O51A 1XGRB 4G8FA 5JOEA 1G6RH 5GZOC 5JW4M 5T33L 3RL1B 2MKWA 2VABA 3B9VA 5FO7A 2ILLA 4TVPL 4F7PB 3RJDA 3FB6A 4FQXD 1BM3H 1CGSH 2EO9A 2CDGB 3CMGA 2B7DT 5SWSA 1L7TL 4Y16C 2IPTL 4R97B 1DCLA 1DQDL 1OAXL 3HC4L 2PW1A 5DC4B 1EEZA 2H6PB 4HPYH 4YUEH 4LVOC 4Y2DC 3WFBH 1NBYA 1A4JB 2E5EA 5CZVL 1JGUL 4DVRL 1OP5H 4YQXL 2ICWB 4HUUA 3PP3H 4WGWB 5D1QD 1D9KB 3D85A 2VLRD 4KTEL 4WJ5B 4EBQH 5D70L 5DHYB 4Y88A 4BZ1H 3FQNB 3I3BA 2GTZB 1MCHA 5FV1L 1GL4B 4APQC 5C0AD 4DUVA 4KK8C 5T1LB 4Y19A 1RUAH 4R9HA 4YHKH 3DYOA 4M5YH 5ADOH 1JPST 3CPLB 3WLWD 4P2CG 2OS7A 3H8NA 1DQML 4OFIA 3TPUB 5HYJA 4OIIL 4GG6B 2ADFH 1EAPA 1CDIA 3ZO0A 5ELIA 3BIKA 2KDGA 1NFIA 2ZJSH 1KCUL 2ITDB 4ZFOB 1NGPH 4U6YB 1SY6A 1T1YA 1T7ZA 4MNGE 5DVOA 1JF6A 3KPQB 4KZEL 3QWQB 1RUPH 2OR8A 5T3ZE 4PRHB 1PX3A 5IB3A 3KPTA 5DA0B 3LQZB 2DTMH 1II4E 5AG9A 1XF1A 3MGOA 1GC1C 4QHNB 1TVHA 2DQHL 3BP4B 3C8HA 3DJ9A 4OV5B 1PYWA 4I0PA 1NMAH 2ESVE 1EIBA 4K9EH 3GEWB 4Y1AA 2O26U 4HDIA 4NBYB 1X9QA 4I4WA 5GS0H 3QBTB 3QDGD 4FFZL 5I73C 3KNBA 4TVSa 1MH5B 1LGVA 1XGTA 4DWHA 1YNKL 4AQ1B 1QFOA 1F42A 5ALBH 1CFVH 4FQLH 3L5WB 3DGCR 1TFHA 3HNSL 2LTQB 1OSPL 4HMCA 1BEYL 4OZHF 3IDMB 3R1GL 4NRZB 3HAEB 3O2DH 3L3HB 4RWHA 4E42B 1M4KA 5D1QA 5I17B 4L4JA 5KW9L 2VLRA 4MDJA 4NNPL 5FDWA 2RQ8A 3ULUF 4PFEA 5CEYB 3SDYL 1U6AL 2NY5L 4EDXB 2ADIA 2HYMA 3JVGC 3T77A 1OSZB 1UB5B 2W60B 4LVNC 2E6PA 3I02A 3L3JA 2PF6A 2AK1H 2VE6B 3KYOA 3QIWB 2WAHA 2VZOA 2FD6H 5DYOA 3V6OE 1WQVT 2XKNA 3A67L 4K71B 3GMOA 1HHHB 3QI9C 3G6JB 1YMMB 4HWUA 5IV2B 4JE4B 3R06B 4RX4D 5CD5D 4PG2A 4GW5A 1CR9H 4L8CB 4YWGH 4JREC 2HT3C 1FORL 4UV7L 3UTOA 3MOAH 4YHYB 1CG9A 4KMTH 2WMPA 1WTGT 5JORB 3C08H 2D7NA 4RMQA 2ADGA 1VGEL 2NYYD 4X8JA 5E6IC 2HJLB 5EA0H 2X1OA 4G42A 2DF3A 2YBRA 1G0XA 2NY3B 4M1GL 3UXFA 1NC4D 5EUOB 4KJQD 5EZIH 3DXAD 4H20L 3TO4C 4CKVX 1IC7H 4HUVB 1NAKH 5F1OB 2MOVA 2AI0H 2UWEF 3ARYA 2VB5A 1GGCL 5ITBL 1G7QA 3C8KB 3VWJC 5GISL 5CBEB 2FJGA 2P5WA 4NWTH 4XVJH 3RP1A 3DMMD 3PWJB 1WCBB 4WV1C 1EHLH 4XGZB 1JGEA 4GS7B 1UKTA 5IJVB 3MRGA 3JV4A 1QBLH 3TA3C 3RIFF 2V9RA 1EAJA 3L1OH 3D25A 4HKJB 5DK0B 1HHJA 2NNAA 2ICES 3GBNH 3FOMB 3B5HA 1A1NB 2QTEA 1EHXA 1K4CA 4AG4H 1NBZB 5L9DL 3VXTA 3JZ7A 4KTDL 4OTXH 1A02N 3U4BH 4G6FB 1PEWA 2J6EA 2VL5B 2P45B 4Y89A 3NACH 3GSNL 3OBAA 4ODWB 2CDFB 3VRJA 2AJXL 3BT2L 3WN5A 4W6YB 4GRWE 1R24B 3LS5H 4U1KA 1DFBL 1CE1L 2QR0A 1Z6JT 4X7SL 4OSUL 4Z7VB 1GGTA 2P4AB 4IBLT 4LKCA 4RRPA 3N1GC 3OR7B 3SDDC 1D5XB 3WJLC 3BHBB 3HI6H 4X99A 1L6XA 1N7MH 2IEPA 2PW2A 4PRIB 2FHBA 3NCYS 4RGOH 1G6VK 4QXGH 1EEUA 1IM9A 3KPRB 5I1IH 4JJHA 1P9MA 3KG5A 3VE0A 4YHNB 4HCRA 4Z0BH 5FECB 1S9VB 4G6JL 4YHMH 5I9QB 2XZCL 2EKJA 4F7TA 2DMKA 4LFHD 5I1EL 2QV2A 4NFBA 4OZGF 3BO8A 3RWEB 4JO2H 4TSAL 3MA7A 1T0PB 4ZO6A 3EDJA 2B1AL 4R7NA 1SJEA 2GSGA 4P59L 5E6ZA 3G04A 1YNTA 5CGTA 1R5WA 2BP3A 5MEPA 4JFXB 4JFPA 1FZOA 5EU5A 1YEDA 4XP1H 5ITFA 4Y4FA 1E4WH 4Z7WA 5IB2B 1QKZL 4GLRH 5H94B 3HE7B 4ELKA 1XCTA 1KIPA 2WBJA 3CSYB 1M7DA 1NAML 1T6WA 5SWQB 1GIGL 4WUUD 3DMMA 3QHFH 4PJ8C 4G7VL 2C1OA 1U8PB 2Y5EA 4R7DA 4WFFD 5FYKL 1N8ZA 2BVEA 3ABZA 3S3SA 1JZ3A 3X3GH 4K3EL 2J4WL 3ROOB 2CLZA 4PGCB 3BPLB 1NGYA 3TP4A 3O6FB 3Q6FA 4I18A 4HZLA 4D0DB 3KPSB 4XNYL 4KKAD 5FF6B 1N59A 1KJ2H 2Z91A 4NP4L 3DOSA 4OLZL 4D3CL 4S1DC 4CVZA 1QO3A 1G7JA 4X7DC 4Z95L 2H32H 2BSED 5I75B 3P4OB 4IRZL 1ETZB 3BQUB 4O2CB 1EFXB 5E8EA 2AV7A 5A16A 3PUCA 4O02H 4C56A 2PTTA 1UYWH 3AM8A 1X5JA 5E9DE 5DJZA 2J5LC 4PTTB 35C8H 2D31A 4TUJB 4WTXA 5FYKD 5SX4H 3SQBA 1SBBA 5I1HL 1T1WB 3HNVH 4JKWA 4KDVA 3MOBH 3X12B 1CICC 1U95B 2ICEA 3CVIH 1OP3H 2UVEA 2R56L 5JTWA 2JCCB 3QG6A 5EZOH 3AS0A 2ZCKH 4YLQT 5JQ6L 4PREA 1J87A 4M6ML 1QFHA 1ZA3A 4EVNB 4J7RA 4ESKA 4KZDL 4IMKC 4F9LC 4ZAKC 3SCMD 1GPOL 3CFJA 1A7QL 3OTTA 1YNLH 5JLZA 3KDMB 1U8KB 3HE6B 2NTFA 3KHQA 5B39G 1AD0B 2VDRH 7FABH 1NKOA 4YDVA 5EO9B 3EYFB 3BKYL 3CK0L 3VFTB 1RHFA 4QRTB 1CQKA 1DR9A 1JPFB 1Q1JH 3FOLB 3KLAA 3U6RB 2PCPB 2X6MA 4MZ3A 2H9GB 1P69B 1WAAF 2AKRA 4M02A 5C0AB 2D7OA 3MRDB 4U6VL 2I24N 4KROC 3ZE2F 1DBKH 4LSVH 1NDGA 4XP5L 2YRPA 3VA2C 1KB5H 2BNUA 4TSCH 1QA9B 1J05A 2IPKB 4YEEA 3F12A 1GGBL 1KTDB 1ZTXH 3ARUA 3HCVB 1S7SA 4LSRH 4OAWA 4H5SA 4JPKL 5AAMA 1UQSA 2NY2B 4OZHB 5ICXB 3RX7A 2X4NA 5IHUH 4AIZB 5L8LB 5D2NC 2BSTB 4ONFL 4M7KL 4WFED 4JPWL 4XCFL 3BYTA 5SWZE 3UJTL 5IT2H 5I6XB 2WANA 2GAZB 4RFOH 3DURB 5GZND 4CN6A 3GK8H 3GNML 5I8EB 3JSSA 3E6FB 1S9XA 1SM3H 4KQ4L 4O00A 2P48B 4PJDF 5CJQH 2BNQD 4IJ3B 2OMBA 5JIPA 4H26A 5E99H 1W72H 3PWPD 4PY8J 1I8IA 5L2JA 2DQTL 4XPBH 1B4JH 5BV7C 1WTLA 3D9AL 4JDTH 4NSKA 1N0XH 3B83A 5C0GB 2WUCL 2RCSL 5HD8D 2J1KA 1H15B 5ID0A 4UDTB 3I50L 1HILA 3W0WE 4W70A 5C08A 4IIQC 3D39D 4C59B 2I26N 3IS1X 3RVUD 4G7YH 3S5LG 3QFJE 1WEJL 2XWJB 5FHAH 2EDBA 3OB0K 4N68A 3NIGE 3MNVA 3QCUH 3F8UB 5EO1A 1IGCL 5DEGB 1A6ZB 3GO1H 3BPNB 2HLFC 3JWDH 3QZWG 3LN5A 2D03L 4P5MB 5D7IF 3TH3T 5T5NF 5EZJB 1WISA 1XR9B 5JPMA 4X7TB 4P2RD 1EO7A 1IGTB 3H9HB 2KQNA 5F7YC 3HFMH 3BEWA 2UWEB 1IAKA 4MQSB 1G7IB 2IQAB 1UCBL 3SDAC 5I2IB 4QCIA 1WBZB 1XEDA 1PKQE 4FOMA 3MRCA 2BXYA 1IEHA 4KFZC 3VFMA 3TIEA 3ZDYE 5E94A 3NFSH 2YPKB 1LK2A 2ED8A 4MB3A 1U93B 5F7EL 1AHWA 2MHAA 2EC9U 3L3IA 2J12B 4HGMA 5D4QA 4NQUA 5CSZB 4TULH 3QUZB 1QSED 2R39A 4L9LB 1ORSA 2GI7A 5FHBL 2ORBL 3OKOB 1G84A 4EUPG 5HYSA 3QUXA 1D3CA 5KVGH 2ICWJ 4FZ8L 3MV7E 4PJXB 3RPIA 3SO3C 4FQQB 1WGOA 4OKVB 1VACB 4OQTH 1NC4B 3BKJH 1IM3A 2HRPH 4Z5RB 3ECBB 4PV9B 4MNQD 1IT9H 3D3VD 2MCPH 5DS8B 3WFCH 4NNXB 5ERWB 3IXTB 2HKFH 4MCYB 3PWLB 1KPVA 1MCCA 3BP7B 4C55A 1I8MB 1ZVSB 4HUKB 1FL6A 4ZD3H 2HMIC 3I75A 4GAYA 4R6UA 3EKCA 4JZNB 3L95A 2EH8H 3TN0D 2VXVH 2WINA 3RNKA 4PRDB 5DEFB 5CZXC 5CS7A 1CIDA 1XGPA 1LK3H 1TETH 1KF9B 4DZBB 4LASL 2EDEA 1JE6A 1NBVL 5J13B 4BUGA 3X13B 5LVEA 3V52L 2XA3A 3K2UH 5C0BE 4NN7C 1UWXK 1KJ2A 4OD1H 4ODXA 5HVGB 4OZGB 1LO2L 1EEYB 1JI1A 1A6WL 1EK3A 1AQDB 5EBMA 2M8XA 4JG0H 4KHTH 2H32A 2KL6A 2VXQL 4L8DB 4LHUG 1ZHKA 2YK1L 4RNRA 3TT1L 5HHNB 1T80A 3HAEH 4WWKC 1T2QL 4FG6C 4POUB 4NO2B 3KR3L 2ERJC 2IJ0C 5C07D 3V0WH 3OX8B 4NQDD 3WUZA 3V4VH 2AEWA 1C12B 2VDKH 1G7HA 3BP6B 4K94C 4KI5E 4PRAB 3HZVB 1I9IH 5DZLA 3TJEL 5JHLL 4HH9B 1Z0MA 1K4DA 5EUKB 3L3GB 4R4BA 5D2LF 3PL6C 3HNTH 3IRPX 4OGAD 2X1WL 4UBDD 3D0LB 4KWUA 1IL1A 1KGCD 4QRUB 5DI8B 2MKLC 2V2WB 4JLRA 3SDCA 5HYIA 1ZVYA 3I6LE 1TJGH 3MFFB 3ILQC 3NN8B 3T0EC 4P46B 4POZD 3HRPA 5DHVA 5DJAA 3L6FA 2IQ9H 1FAKT 1UM5L 3ARDA 3ES6A 4BZYA 1BAFL 1YUHB 2GYSA 4XP9L 4MZ2A 1QRNA 2L0DA 3VH8B 2X4RA 5D1ZD 3UJJH 3HZYB 4XAWL 3GI9H 4OCXH 1JPTL 4ZUSB 3T1FB 2NXYC 4KKCD 3UTZB 2I9TB 2YD1A 4YNYA 3LCYA 4HQQL 4AEIL 5IGXH 3RKDD 3O9WD 4NO3B 5CIPA 4F7EA 1I3RB 1XGQA 1UGNA 4WHYG 3JWOL 3P9WB 3Q6GH 2OR9L 4QO1A 3RJQB 4KJPD 5CP3H 3VWKD 4D0BA 1T5WB 2I9LB 2BMKA 2AJUL 4IRJD 1QTYT 4JN2A 4WI4A 1MEXH 1MCPH 4L4TA 1UXSA 1RIHL 4NYLA 5EC2A 1RZFL 4M4RA 3D2UD 3A6BL 5DMYA 5IMLA 1UEYA 1TTGA 2X09A 3SOBL 3KXFB 5B3NA 4RIRB 3MROB 2XTLA 5DQDL 4DKEL 5KSBF 4G8EA 4S1SL 2AV1B 1W0YT 4JZJA 4MX7A 5BQ7A 3GMMA 5IM7B 4OCSH 2KZ1B 1I1RA 4LCIL 5HGDB 3MC0A 5D9SB 3THML