1D6EB

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
179
Chain Sequence
TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPALLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide inhibitor
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 179
sequence length 188
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6eB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d6eB01
4LSRL 5D7LA 1D5IH 4YAQA 3VXUB 1DQQA 5I30H 4Z7UA 4JFEB 3KNBA 2Q86A 2VISA 4G42B 4YDLC 1GHFL 2R8SL 4Y19D 1IKNC 3GKWH 1TETH 2E9WA 3WUWA 1WZMA 5HHOA 5BVJB 2DM4A 1ZLUH 4EI6B 4UINL 2NX5E 5CEXB 4UNVA 2NY6D 3UTQA 2VDLL 3MCLL 4X80H 5D9SB 5AYQA 5EU4B 1AGEB 4JFPA 4IHOA 2R1YB 3TCXA 1WICA 1YNTB 1G9MH 2W0FA 4EIGB 1CICB 3ZDYF 4DN4H 3TPUB 3QNXB 1FVCA 3UEZA 4DVBA 4Q6IA 4N68A 2RB8A 1FPTL 4LOUC 1FFOB 3RDTA 5D70H 3MJ9A 1P7KB 1PKQA 3WE6B 3VXMA 5C0EB 2DBJA 1AXSA 4GT7A 5JUEH 1LEIB 4ENED 4LSSL 5BS0A 4HS3A 1MCFA 4U6XA 4NKMA 4O2FA 3MV9A 4Y5XB 4QRRE 1YMMA 3H9ZA 1HEZA 4PRIB 1YY9C 5GISL 5TFSL 2AEQH 2AW2A 3EOBA 3HZYA 5HD8C 2HLFC 1OPGL 3CX5J 1LWRA 1T89C 4YDKH 1RJYA 5LCVL 1X5GA 3EZ8A 5FKPB 5AUMB 4ZUTA 5D96B 1J88A 5DQ9A 1PLGH 3ARWA 4CVUA 1CDBA 4DOHE 5FKAA 3MACH 5E5UB 5E94B 1G84A 5JZ7C 1C16A 2PR4L 5DS8A 4G7VL 5FO8B 1HHGA 1XF2B 2PCPB 1VFBA 3T4YB 1TPXC 3V5HA 4KKAD 5DQDH 2APXA 4TNVF 1A1NA 1GOGA 4MJID 1AD9A 2QSCH 1YQ2A 4HH9B 4YFLF 3VXPA 3I9GL 3VXOA 4NZUH 1B88A 3WN5C 4Y19B 1VGEH 4XI5C 5IB1A 4LBEB 3RL1B 5MEND 4OJFL 5FFLA 4XVSL 3SO5A 3TNNA 3ZKXC 1S78C 3QSKB 2R0KL 5GRUH 3CMOH 3M8OL 4MQXC 4XVTL 2NY6B 1UM4L 3SKOB 4P5TD 1Z6JT 2Y36L 4PJ7A 43CAB 2FJGB 2FDBP 4M48L 2VN4A 1PSKH 2YZ1A 3MA9H 1OQXA 3B5GA 4C56A 4EDWL 4I5BA 1ZVSA 5BQ7B 5ID0A 1I1YA 3DRQB 1NMAH 5EZOL 4KHXL 5MI0C 5GS0C 5DLML 3TCLB 3RZCD 4ZUWA 4XNZC 3C9NA 5C0JA 5DJ8B 1A6WH 2YD7A 3BD4A 3L9RB 3GBNL 3GM8A 5E9DD 2CDGB 1XGPB 1IKFL 3LPGA 3BXNA 1NCBH 4UUJA 1KIQB 4JCLA 4MQTB 5CP7A 4OLWH 4WWID 1AO7E 3ROOA 2BVQA 1HNGA 3UTSA 3MV7D 3QEGL 4YPGA 3V5DB 4ZFGH 1NUNB 1KPUB 2XTJE 3C8DA 1A9EA 2NNAA 4KK9D 2ZKHH 4ZS6C 3P4MB 3RWIB 2X4UA 5C7XL 4ZFFA 2Y07H 4YE4H 5KANG 3BT2L 3EO0A 5IF0B 5DVMA 1RJZB 3VRJA 1BZ9B 4I0PC 2OMNA 1A7NL 2J8UA 1LQSR 2GY5A 5EBGA 3A6BL 3IDXL 4N5EC 4YHOL 2RCSH 1GRWA 3IFOB 5IW1B 3DVNA 4MJIB 3FMGH 3O4LE 4XVJL 5JHLL 4I3GA 1MRCH 4UT9L 4LCIL 2IQAB 3P30L 1J5OH 1TIUA 3SGJC 3IDNA 3NIDE 4GLRH 2OCFD 2K1MA 2DQEH 4HMCA 1IGFH 5IHZB 4GW1A 1DLHB 4NC1E 32C2B 4P2YA 2Q8AH 1DQDL 5HPOA 2MSPA 5MENB 5CGTA 5DR5H 5EWIH 5D5MB 3OXRA 1T5WB 5LWYH 4GAGH 4L1HA 4YR6B 5CIPH 1PG7W 1PD6A 1U8IB 4P5TB 5EORL 2GHWB 2DWDA 2MCG1 1X4ZA 5FM4A 2JIXB 5CAYB 3QDME 3Q5YA 4P46C 2YOCA 5DUMH 1NANH 1R5WB 4X7CC 1QSED 4F9PA 3F7YA 2WIIA 1QO3A 3GB7B 5E00A 3VG9C 4PY8J 3QIBD 4LSVH 5K9JL 3SPVA 1VFAA 2C7UB 4U1IB 1X5LA 1D5MB 3RZCB 3QG6A 5LGJA 2IJ0C 5E9DB 4X9GA 2HWZL 4H5SA 3NN8B 1UB6B 3BPOC 3P11L 1ZA3A 1GL4B 5EIQA 3WDJA 2BDNL 1KTLA 3RIFF 1JF1B 2BVOB 5F96H 3RUGB 4IRZL 3B9KC 5LXGL 2HFFA 1QP1A 3I02A 2IG2L 5FXCH 5D1XD 2Y6SC 3B6SA 3SDDA 2WBWB 4F58L 4NBZB 4K8RH 1UGNA 4XBPA 3AUVA 5IGXL 1BQUA 5DD0H 1BBDL 2QV2A 1ZTXL 2AJVH 2O5ZL 1K2DB 1OSPH 3BHBB 5EU6E 3JV4A 4ZO8A 5AZ2H 1NBYB 1EJOH 1OB1B 4HZAA 4EVNB 5IHUL 1UJ3C 3KPQA 4Y2DA 1D5IL 1M6OA 2E8ZA 5SWSD 3V6OA 1T21B 3ZT7A 1YPZB 2H8PB 3G04B 3RVVD 5I30L 4MNQA 2ZJSH 1DVFC 1OGTB 1WT5A 3IDIA 1DSFH 3LQZB 1YEHH 3BD3A 3GKWL 4GG6E 1P9MA 1LGVA 1B6DA 3HMXH 4HWZB 5CLWA 2RQ8A 4Z7NE 2AJSH 5F70A 6FABH 1NDGA 1G9ML 4PJBA 5F1IB 4U6TA 4DN4L 1NAMB 1LE5A 1NC2D 1UKTA 5J3HC 1U8HB 3HUJB 3GRWH 1QSEB 2BVEA 3DGGA 3NIFE 5D70L 5IBUB 1R3KB 5JUEL 4WJ5A 2DLHA 3QIBB 1ZHBA 3GSNB 4MJ2A 2LU7A 5HYFA 1TFHA 3HRZA 2W9DH 4NUJB 3DSNA 1NBZA 1TZHB 5GJSH 2ZUSA 3D85D 4K3HA 1MQKH 2AEQL 5JMOC 5D7JD 12E8H 5CJQL 3IVKB 5F9OH 5D71H 5I1LA 1ED3B 2FR4B 4X0KA 1G7JA 1Q94A 2N1KA 2GW5A 3FO2A 4QHMA 3M45A 4A2LA 3MRLB 3O11A 1Q0YH 3CZFB 3IKCA 3MRIA 5D1XB 4A6YB 5IOPB 3R8BB 1QZ1A 3MACL 4L8SA 1RZ8A 3PUCA 3LD8C 1N8ZB 4NNXB 3AXLA 2MWCA 3G5YB 3MCG1 3U0PB 43C9A 2D7NA 5IBLD 1OAUH 1RK0A 5CJ5A 1HWHB 5DQDL 5DXWA 5ELIA 4OAWB 5D96C 4JLRB 2AJYH 3EUUA 4LLVA 5SWSB 3BIAX 2BSSB 2QSCL 1KJ2B 1OGAE 4O2EB 3D3VA 1FIGH 2JJWA 1IL1B 2ICEA 4NZUL 1EUTA 1U3HC 1VGEL 2FX7H 4AIXA 5EU5A 4L4VD 1GZPA 1DDHA 1CFVL 1UB5B 3DRTB 2IADA 3NH7H 4ODXB 4TQEH 3FAXA 1FVEB 1NEZB 4B41A 4PJAB 1DE4A 5GRUL 3CMOL 3WFEH 5IMKA 3VW3H 4LLUA 5FF6B 3MLXH 4PJFB 2X41A 2IFFH 4F7EA 3EJYD 1HXYA 2A0LC 3NIDF 1S9YB 3JWOC 4K2UH 2D31A 5B22A 3DX6B 4U6YB 2XY2A 3B9DA 5EH1A 1NC2B 1JGEB 5FAAA 3MA9L 4XNXH 4M8QB 1SY6H 1KYOK 3BMVA 1NMAL 4X98B 1K5NA 4ONOA 1U91A 4CAGA 1VKXB 5J0BA 2NY6C 3RPKA 1KJ3H 3LY6A 4DK6A 4Q6IC 2YD8A 3JBG7 3CVHB 3VXSA 3FB8B 4HIJB 1F6AB 1JN6B 2F58L 4OLWL 1FYTA 4KZDL 3D85B 2ATKA 1E4XI 3RDTC 1F00I 3RZWA 3PHOA 5D7JB 4ZFGL 3MLTB 4TSAH 3UTZB 2AV1A 5CMAB 4RMSA 3NFNA 2ZKHL 3D18B 4P23D 3IFNH 2BFVH 5B3JF 4PLJC 4ZXBD 4MX7B 1EVUA 1A1MB 2Y07L 4I13B 4LGSB 4YE4L 3QNYB 1JWSB 2MKWA 1SQ2N 4D2NA 1Y6NR 2PYFB 3QEHB 5CHNA 2PXYD 3KLHD 2G2RB 4TOYH 4HUXA 3VE0A 1IC4H 2EYTA 4JGMA 5D2LA 4XX1G 1DBBH 3BPNB 2RCSL 3SE4A 2JB6A 2FH8A 4LLMA 4RGNC 4HKBA 3FMGL 1U0QA 1MRCL 4WV1A 1FG2A 5ANMA 1J5OL 3FOLA 3R8QA 1RHHB 3S6CA 4Z77B 2DQEL 1IGFL 4GMSH 4WGVB 5IW3A 1N0LA 3JXAA 5DR5L 4L4VB 4NQCE 5EWIL 2AK1H 3TH2T 4YBLB 5HGHA 5LWYL 4M6OH 4GAGL 3NFPB 3GSOB 5EC1B 5GGRA 1CF8L 4GXUM 4QRQA 1GVIA 3I6GA 1Q0XH 5IWLA 5DUML 1AGCB 4PP2B 4Z7NF 5J1AB 3ARSA 4NGHH 5DRNB 2B2XH 2BY2A 4LSVL 3QJFA 5KTEH 1JGDB 3T65A 4XAKE 3RTQA 1FGVH 5I1EH 3T2OA 5E8EB 2VXQH 3QISA 4LCCA 2CLVA 3VRIA 2CRMA 2HTKC 4BSWA 3PWPE 3F65A 4NJAH 2X5PA 4OCSH 3NIFF 1WGOA 2YEZA 2GUOA 3T1WA 3NA9L 1U8NA 4G80A 5CBEA 5F96L 3NMEA 3RGVA 2EEDA 4HQQH 1KBGH 2ZWLT 4P23B 3HCVA 4FMFA 1RZJC 3PV7A 5D1ZA 5DUBA 1I3UA 2GTZB 1DFBH 4ZXBB 3EHBC 4K8RL 2JCCA 3VFTB 2X9WA 3QEUB 1NAKH 5DD0L 5I1CL 1ZT4B 2V7NA 2AJVL 4Z7WE 4WI7A 1OSPL 1N3NB 5AZ2L 1F42A 2PXYB 2BOBA 5T1MA 2APVA 4N0FA 2YR3A 3EAKA 4QWWC 4U1KA 3UDWC 3RRQA 3I50H 5HXMA 2ZJSL 3DVIA 1LE9B 1DSFL 1FL6B 4Z18A 1YEHL 1BOYA 3BP5B 1EFQA 4AENA 3HG1E 3O3DB 5I8OH 5IFJA 1HQ4B 4AY0A 3HMXL 5INDB 3QEQA 3MODH 5FGCB 1XGQB 1XGUA 4POUB 3VGFA 4CADB 1IGTB 1CD8A 2AJSL 2ZSWA 1BQHB 4G6MH 1P2CA 4P4KD 1A6ZA 5FCSH 1QACA 3H0TA 4MZ2A 4GRLA 4R4FL 4YDJA 6FABL 1ZGLB 3RVTD 3S9DB 2R4SH 3KPNB 1D6VL 2UYLB 3RWEA 3PJSA 1LO4L 4YFEA 4PTTB 2ZUXA 2AJUH 3PGDA 1AXIB 3RWFA 4M7LH 4MCZB 3MBEA 3GRWL 4WEUD 1TCRA 2NPLX 2EC9T 2ZG3A 2IAMB 4D0DB 1E28B 4LNRA 4ZUUA 1IAKB 4OF6A 3RPIB 3HFMH 4NQVB 2QSQA 1BEYH 3QQ9C 2W9DL 5GJSL 3QXUA 3K2UH 3B9EA 1X7QA 4F9PC 1MQKL 2AXHA 2FJHA 1R3JB 3BW9B 5F9OL 4JZNB 4XMKH 1RJLA 4LGPB 1IQDA 5DEGB 3G5XA 4AIZA 4QRRD 2WIMA 2QKIA 1Q0YL 3FQTA 3MV11 1FL5A 1WZ1H 3SHSA 3S37X 4Q58C 2VB5A 2P47B 3QIWD 4KJPD 3TVMD 5BXFA 1IGJB 2H32H 4LIQH 1RIUH 4PJGA 4JREC 4YFLI 2EDHA 5E5MA 3UTPE 1ZHNB 3EW3B 2XICA 2GJ6A 4GW5B 2AJYL 4F7TA 3SDDC 3WLWC 1DN0B 1MJUH 2HMID 1EGJA 3RVWC 2AXJA 2G60H 1FIGL 2ZZUT 4JHAH 4Y88A 3MV8E 1FV1B 1XCTA 3MNWB 4UAOC 2FX7L 2YBRB 5DFVC 4LLYA 3MTRA 5H2BA 3H7LA 4Y5VA 1WFTA 1OW0A 4WTZG 4NRXB 4QXUL 4TQEL 4POYA 3VMOA 4G8IA 5HYJD 2ARWA 5EBMB 3WFEL 5FOBB 3CSGA 3VW3L 4EIZC 2JELH 2XNAA 4P3DA 5E6ZA 4G9FE 4HGMA 3MLXL 1J0HA 2AEWA 4P4KB 2IFFL 3H9HA 4BZ1H 3VXRE 2L7UA 1OT1A 3OF6D 3N9GH 4K2UL 4B7LA 1GOHA 1P9MC 3EZJB 4WW1B 2Y5TA 1H15B 4XNXL 3GMMB 4U1HB 1SY6L 2VABA 4FQHB 3J8F7 4JO2H 1W72A 1VENA 3SEPA 1X5AA 2XPGA 4JCMA 2P5WE 1C5DA 2XXCB 1AD0B 1D5XB 4MJ4A 4RMTA 3DV6B 4JY4B 1XAUA 2V9QA 1KJ3L 1L6XA 5FDWA 5EO9A 3GSUA 4KMQA 3DXAA 3SKNA 4P4RB 3IJYA 3MREA 1Q9LA 3K4AA 1Z5LA 4XH2B 3MROB 1ORQA 2VITA 4GJTB 1MFCH 4TSAL 2VLJA 2V7HA 2XG4A 5DK2B 1IGCH 4H0HB 1W8OA 2PKDA 2BFVL 2PNDA 3D9AH 3KS0J 4LRIC 4LMQI 4OZ4B 5DHVB 4QRRB 5GGTH 5IR1A 1MFBL 1AO7D 5IMLB 2ZOLB 2G75A 1X3DA 1U8MA 1Z3GH 1UVQB 3BDBA 5ICYA 1YEJH 3QIWB 3TVMB 2LTQB 4KRNA 3QAZB 4UTBH 1RZGA 5IB3A 4PREA 4AMKH 5C0GB 4TOYL 3WFZA 4M02A 1N6UA 1IC4L 1DBBL 1RV6X 4Q7DA 4P5MB 4TVSa 2RJMA 4F7PA 3OJDA 3ZKSD 4OT1L 4O9HH 3WFHB 3DUSB 3EFFA 3A0OA 1HQRA 4N1CA 5JHDA 4J4PD 3OX8B 4NRYB 3O4LD 1CDYA 1JPST 3MR9A 2AK1L 4M6OL 5HYJB 1QA9A 2VQUA 2XQYG 4RAVA 4P2RE 2QQNH 4YHIB 5DT1H 3SDXE 3H3KA 3QFDA 4QO1A 3KPSA 1B4JH 3GKZA 3F7QA 5EOCJ 5J6GB 5EZJA 1Q0XL 5DRXA 5I1HH 1G6RH 4J8RA 5HHNB 1URLA 1RZKH 3P73B 2MQ0A 3O3BA 2SEBB 3P77A 3R06A 5DJZA 5I17A 4M6MH 4TNWK 4PGBB 5KTEL 1OTTD 3D25B 5FYJH 2PW1B 3QDMD 5I2IB 4ZPTB 4L8CB 2FEEI 1FGVL 3KYAA 1MH5B 2FEDD 1TTFA 5I1EL 5KS9A 4I4WA 2VXQL 2YKLH 1KIRB 4QT5B 1FSKC 3AY4A 4PLKC 5GPRA 2AGJH 4NJAL 5K9OA 4OCSL 3CIQA 1MHCB 3V6BR 1TITA 1T0NB 1U8QB 4HQQL 1KBGL 4BH8B 3QPQC 4HCRH 1FN4B 2IH3A 3RNQA 1N5AB 4OFIA 4H1LA 1NAKL 3P9MB 4QF1A 5ENWB 1FZMA 1I8LA 3ARPA 3BE1L 1BJ1J 2XKNA 1FZKA 3QDJE 1TVHA 5JIIA 4MDIA 3TV3L 4YHYB 1J11A 5IVOA 5C71A 3THMH 4P23C 5I8CB 2E8YA 4WFGD 4KV5E 3ILPB 3S37H 2YD4A 5M95B 1W8NA 3V6ZB 2FB4H 4ZTOH 4LKCB 5B38B 3PWLB 25C8H 3QFJA 5I8OL 5T3ZH 2PXYC 3KLHC 1KCLA 3MODL 3WD5H 3SE4C 5HGDA 3O4LB 4H26B 1PEZA 2Z31D 5F8QC 3VGEA 5L2KA 1EHAA 3UROR 1O0VA 1U8JB 3DX9B 4IOIB 4OD2A 1I3GH 4WV1C 3PWUB 4KVNH 3ZDZF 1C08A 1CG9A 3LVEA 2B4CC 2AJUL 3I6LE 3EDJA 1UWXH 2IC2A 3C6SB 4PV8B 4M7LL 1LNUB 3CFKB 4FQXA 3BKJH 3QDMB 3HFML 4O2CB 3WLBB 2LFGA 1BEYL 5DHYB 1RUPH 3VD4A 4HUVA 1I4FB 3K2UL 5IJVB 3LEXA 2BSTB 3O3AB 4RRPA 4XMKL 1SMAA 4CNIA 3QWRD 1U58A 2IAMC 2E9BA 1DANT 3SOBH 2AV7B 2HTLC 3T1FA 1WZ1L 2FZ3A 3C2AH 1R5VB 4TYUA 4F2MB 1YEFH 3CU1A 4LIQL 1RIUL 2IBBA 5JXAH 3DMMD 5I66B 5MEQB 4M62H 3RGVC 1FCCA 4R0LA 2HVKA 5FYKH 4U4BA 4PLOB 4XNQA 5C0RH 2XTLA 4Y4FA 1EEYB 1IBGH 5D1ZC 4W4NA 4QRTA 5CGYC 4NKDB 3H42H 3FOMB 5EZIH 5EPMA 4U1NB 3F6LA 4AH2B 5TGBA 2G60L 1K8IA 3OKNA 5JA8B 5HYSG 1TNNA 5J9PA 3L3OB 8FABA 3NBNA 1X5KA 4BELD 4L9LB 1Y18A 4YBQD 4HK3N 1VEOA 4X6DA 3SKJH 3WL9A 1PG7X 3NZ8B 4KRLB 1U9KA 4QRPD 2Z31B 2JELL 4U1MA 1PZ5B 1F4YH 1YC8A 3KXFE 1CQKA 4BZ1L 2XN9E 5DI8B 3S96B 4V2BA 4GG6B 1G7HB 3N9GL 3GJFB 1YEGH 1KT2B 3I3DA 5CGMA 3VFSB 1DR9A 2ZSVB 4KK8D 1BLNA 4LPTA 1U42A 4JO2L 5EOTA 5ACZA 4Y1AA 3ILQC 4K7FB 4GRLC 1RVFH 1JGLH 3HAEB 1FGNH 2X89A 1L0XA 2ZUYA 3SDXF 5FUOH 5CZVH 2EIDA 2ENYA 5F8RC 4ZG1A 3U4EB 3L6FB 5ESQB 4UDTB 3ARDD 1OY3B 3LSOB 2VXUH 2VDML 4P0DA 3FRUB 1A7PH 1IGCL 3P0YH 4FRWA 1E4WH 2FL5A 3D9AL 1RSFA 4S1DC 4GOSA 5DQJA 5GGTL 2E7LC 4NN5B 3STZB 2EE3A 4GKNB 5MP6H 3MXWH 1J8HE 3DIFB 1A5FL 3LV3A 1Z9LA 1BX2A 3IXTB 5HDOA 4K71B 2UWEA 3PWJA 4QKXB 5HSFA 4UTBL 2D0HA 3GSXA 4TNVK 1MWAA 3DMMB 4AMKL 5F89A 4XRCB 1O7VA 1OP5K 1XF4B 3DECA 3GNMH 4YEEA 2CIKA 4G8FA 4IRSA 1ZT1B 4H8WC 3QQ4A 2R29H 4C55A 1FJ1A 1NGXA 1ZA6A 3S88H 4O9HL 1DUZB 3RL2A 2OSLB 3QIWC 3WMSA 1CXFA 5TH2A 1LO5B 3KJ4C 4Y2OA 4ALAL 5JLZA 2X4RB 2DQCH 4GAYA 2GEEA 3TZVD 4LASH 4JRXA 2K9UA 2HT4D 4D3CH 1QFOA 4QRPB 4V1DD 5JIPA 1I7ZB 3FN0H 2QQNL 5TQ0H 3FQXA 1V8HA 3QO0A 2VMFA 5DT1L 5A2JH 5JPMA 3O2VH 1B4JL 2GAZA 3SGEH 4HWBA 2HP4A 2G5RA 4Y5VC 3MFFB 1G6RL 5K33A 3W2DL 1RZKL 3E6FA 4Y0GA 4M6ML 4ZD3H 3TO2A 2WUCH 1HN1A 5FYJL 2BJML 4NNYA 4MD5A 3V8OA 1XCQB 1I9RH 1HK6A 4LSDA 4K3DL 2YKLL 3HB3C 2UVFA 2Y06H 4MDJA 2A83B 1P5VA 4OZIB 1KXVC 1MCKA 5JIHA 3QB7C 4NQXB 1KXTB 4M9OA 1U8OB 2AGJL 2NW2A 1EVTC 3AREA 1FLRL 3ARDB 3MJ7B 1OWWA 2IANA 3HNTL 2F19H 2BMKA 4I18B 4LIQE 5SX4H 4RGMC 3PWPD 3PHQB 3QUXD 5I6XC 1SYVB 2B39A 3QI9A 3ECBB 3ULSB 4X7TA 1A6AB 3E0GA 1MY5A 1MI5A 1QFHA 3NA4A 1I7UB 3ZE2E 4QXWA 1IAIH 3O6KH 3NTCL 5DK0B 3HS0B 3BDYL 3L5IA 5DD3H 1JVKA 2HJKA 3THML 1WSST 2J5LB 3SY0A 4E0RA 4Y16D 4KK5C 1GGIH 5JDSA 5EBWA 5E24E 4GO6B 1IGMH 3RY6A 3S37L 1MUJB 3UX9B 5HI4C 3QQ3B 4JFDA 1HHKB 4PRAA 2FB4L 1FLTX 1E27A 1CGVA 2X70B 3Q6GH 5I74B 4ZTOL 25C8L 4MWFA 5T3ZL 1GAFH 4QCIB 4OFYD 3WD5L 3TZVB 3RJQB 4YHPA 3MRKA 1S7VB 3LKSB 3T0VA 3HZKB 5FO9A 2PTUA 4EQ3A 3MMEB 4HGWA 4RIRB 5MEPB 4V1DB 4YUEH 1N4XH 5E03A 4KVNL 4YXKH 35C8H 5DVKA 1XR8B 4I3RH 5ILTL 3UO1H 3Q2CA 4GUPA 3FT3B 4J4PC 2R15A 4URTB 1WITA 3BKJL 1KPRA 5IFHH 1PG7H 2OL3A 3QHZH 5ESAA 4D94A 3KPRE 3OKDB 3L3HB 1ZMYA 4M93C 3BO8B 3FONA 1BFOA 4JJHA 4Q9QH 2H9GA 2ZOKA 1RUPL 1EHLH 5IW6A 3IU3A 3VI4E 4IIQB 3AAZA 3VXTB 2P8PB 3OSKA 4OV6F 3MSPA 4JRYD 4CVZA 3MGTA 5JW4R 2EKSB 4HHAA 5GGVY 4PG9B 4KKLD 3SOBL 3TO4A 4DKAA 1EV2E 4NWTH 5AAWA 3AMKA 3PWPB 3AY4C 2OXHA 4YGVA 4NWUH 1YEFL 3QUXB 3ROLB 5BJTB 1KB5H 3MV7A 5JXAL 2FATL 3L3JA 3WDHA 4PRHA 1Y6KR 1JPFA 4X6FA 3BH8B 1ONQA 5FYKL 1P53A 1NH6A 1OTSD 2FH6A 5C0RL 2BVUA 3ETBF 1PBYA 4BH7B 1IBGL 1WCBA 3ZKQD 1KCSL 4KZEH 4R3SA 1QVOB 1C5CL 1ZSDB 2QTEA 3CXHK 1UACH 3IS1X 4Y16B 5EZIL 4Z7WB 4ODWA 2AS5M 3V7AE 3UTPD 2XA8H 3WNOA 3KPTA 4OF7A 4AQ1B 3WS3B 3VJ6A 1I3RA 4NN7B 3GIVA 5E7FA 4R4BA 3RBSA 1RJCA 2V2TB 3SKJL 3MRJA 1CL7L 1D5ZB 1JPTH 1F4YL 5E5RB 4JPVH 2D7QA 3TIEA 3DETD 4ZYKA 1WAAF 1YEGL 3SE3C 2NY0C 2E5EA 4XPAH 4OZHE 4LARH 3IRZA 4XHJC 1AQKH 3S5LG 4G9FD 4WHTB 2PN5A 3RNKB 5HHPA 5JQ6H 5FYJE 2AXGA 1P84J 3VGHA 3OAYK 3H2WA 3ME0A 4PJIA 1JNHA 1N5YL 1MREH 1RVFL 3TA3A 1AKJA 1FGNL 1MLBB 4JO4H 1CVSC 4HAFA 2EIEA 2BNUA 4NN6B 5FUOL 5CZVL 3OHXA 3ZYJA 2CH8A 3OL2A 4W6YB 1EDQA 1JNLH 3WFCL 1CFNB 5GJTH 4XWOD 3PP3K 5TE6H 1TVBA 1MFAH 5DJDA 4FQXC 3BPCA 4JRYB 4ZAKA 3ARYA 1JJUA 1A7PL 4NQED 1E4WL 1T7WA 4XVUD 3BEWB 5MP6L 3MXWL 5FA4B 3HNSH 3RAJH 3FFDB 4PRDB 1CIUA 1KCKA 4K8RD 2GSGB 3VFWB 4KUZH 3FCTB 3LRSB 3BP7A 3MJ6A 4Z7VE 1EEUA 2ARJQ 3T0EA 3NCJH 1D7FA 5JW3H 2BNRA 1T1YB 5DMYA 2FLRT 3GNML 2BY0A 1P84K 4NN5C 4ZFOA 3MV01 1HYRC 4D9QD 3CUPA 3S88L 5T3ZE 4K71C 1Z9MA 3ZE2F 3ESVF 4R0LC 3U6RA 1Z9OA 1JZ7A 2DQCL 2YA0A 2AK4A 3DMMC 3LPWA 4Y4FC 3CFEB 4M6NH 4HLZH 3I3EA 4LASL 2NXZD 4HXAH 4OTXL 1OSZB 4G43B 4D3CL 3KYNA 5FGBC 5E6YA 3QCVH 3FN0L 3UAJD 1IMHC 5TQ0L 4L3AA 1NFDE 4LCWE 3FQUB 5CIPB 3HE7D 1YMHA 3CFBA 3L5WA 3DSFH 4QXGH 5TDPA 1FO0A 1J18A 4YXHH 4G9FB 2QHLA 4P2RD 3IJHA 3QDGA 1GXEA 4ZD3L 2WUCL 4OKVA 5GS0H 2EICA 3VG0H 5L88H 1I9RL 2C3HA 4NM4H 2RGSA 3KPPB 4NYLA 2D0FA 2Y06L 3AVEA 4NQSB 1VA9A 2ADGB 4WFHE 5D6DA 5EB9A 2AEIT 4MXQD 2GY7B 5EU3B 4XNMB 1IGIH 4PJHA 1AGBB 4KK8C 4X98A 1UQSA 5L0QB 2AJZA 3EYOB 1S7QA 3DPBA 5F7WC 4NQEB 2D0GA 2F19L 2PO6D 4EUPG 2VAAB 3AU1A 4HJ0D 5F7FA 2D7OA 4JY6A 3RWHA 4PJ8A 3VI4F 3DURB 5FYKE 4XCEB 3OXSB 4XNYL 2FIKA 1N7MH 2CKBH 1Q38A 1RK1A 4BSJA 4PJ5D 1IAIL 3O6KL 4X83A 2LVCA 5DD3L 4AL8H 5D1QA 5FO7B 1GGIL 1VADA 2WSKA 4OLVH 1IGML 4JB9H 3EDEA 3RKPA 4ELME 1JFQH 3C5ZA 3JTSB 2E6PA 4U2ZA 3G6JB 1S9VB 5ICZA 4EZMA 3AMLA 3Q6GL 5KVMC 3X11B 4MAYA 1BD2D 4RSVA 1GAFL 3P3YA 2LV4A 5T1LD 5IG7A 2NXZB 2J5LC 4PPTA 3CVIH 2Y7QB 4J12A 4ZSOB 5ID1A 3VMNA 2HN7B 1DL7H 1I7RB 1F3JB 2P4AB 4YUEL 2O5XH 1N4XL 4JPIB 1Y0LA 4GKZA 3L7FB 4YXKL 1MHHB 1NGYB 2DJUA 35C8L 1NANI 3UO1L 1GZQA 4I3RL 3HE7B 2EIZA 4L4VA 2XWJA 4PRPE 1XF5B 3RI5F 4XP1L 4JJ5A 2A1WL 4NO0D 5EZLB 4AYFA 4P2RB 3TZVC 5IEHB 5K93A 1MPAL 1PG7L 5DJXB 3GSWA 2EYSA 5HI5D 2Z8SA 5DF0A 2EKJA 3J7HA 3R0MA 4UIMA 1H3TA 1JUFA 4OZHF 3MRNB 2CGRH 4Y8AA 1EHLL 2DKSA 3VFPA 3PDOA 5E8DH 5DJCB 3F7RA 3U9UA 1Q1JH 3TESA 3C2SA 3BP6A 1MFDH 3ZE0E 1KELH 1QSVA 3SGDH 2PO6B 4RFNC 2OTUA 1N6VA 3VDBA 1W0VB 5I76A 4MGXA 3B3IB 3WO4C 4JG0H 5HJ3A 2BC4A 2ITDB 5IB5B 4B7IA 4YQXH 2KZWA 3DYPA 4TUOA 3TIDB 2JJUA 3VA2C 4PJ5B 3REVB 5C0BE 5JOFA 4EJ1C 5E2UH 4D0BB 3IB4A 4KZEL 4X8JB 2WK2A 1IM9D 1IEBB 1N59A 1UACL 2GITA 1K4CB 3QI9C 3QWOB 4OF5A 4RZCA 3RHWF 2Z4QB 3W9EA 2XA8L 3STLA 2EH8H 3B9VA 3TEUA 1CFQB 3RBGA 5BZDA 4Z7VF 3VDAA 4PV9A 4OQ1A 4RAUA 3DROB 3VWJA 5FUCC 1BIIA 1BD2B 3TPKA 2X4NB 4Q2ZA 4AIOA 1KCUH 1DEDA 5T1LB 1O7SA 2C4XA 3LN9A 1JPTL 2M8XA 3LHPL 3OKKB 4JPVL 4Y16C 4HX1B 4M7LT 3BUYB 4S10A 2B1HH 3MRMA 4CUCA 3V0WH 3SCMD 4OBRA 4F15B 4LARL 5IVXB 1EFXD 3MRGB 5T5NG 1AQKL 4ONGL 1KTDB 5JQ6L 2Y1VA 3KXFD 4ZOEA 5F6IB 5DVNA 1ZWIA 2YPVH 3GUTB 3CSYA 5F3BB 1MREL 4NFBA 3N1PC 1YUHB 2R9HD 4JM2F 1TQBB 3GMLB 1NFDF 2GK0A 4JO4L 3Q6FB 5J6HA 2VQ1A 3QUKB 1G0YR 1A3QA 1UEMA 1JNLL 4XP6H 4Z7OE 5GJTL 5C0ND 3FTGA 3KYOB 5TE6L 1MFAL 5ICXB 4PRNB 4NRZB 1P1ZB 3GSVA 1UH2A 4JQIH 1KCRH 5K59E 3M1BB 3INUH 3LQMA 2VXVH 5CSZA 5JPNB 3HNSL 4NN6C 3RAJL 1JPGB 2NLJB 1KN4L 4F8QA 4KUZL 3WHXB 2YMXL 4ZUSB 3H9SE 1P6AB 3IFLH 1T3FB 5L6YL 4LK4A 3NCJL 2O61B 4FABL 5JW3L 3TO4C 3TBTA 2ZCHH 3RWDA 1QKZH 4WIQA 3C60A 4MHHI 1IM9B 5CWSB 3SBWC 2IF7A 3K8KA 3TBYB 4ODUA 3IJSA 4JDVB 3MRPB 4X4XA 2RBLA 5EUKA 5IVZA 4M6NL 1ZHKB 4GRMA 1X5IA 1ZLUK 1J10A 4HXAL 1OTSC 1A4KB 1NEUA 3WIIH 2EDNA 1LP9E 4ELMF 3LKRA 3MOBH 4OIBA 4HBQA 2X4TA 5DEZA 4F9LC 4XWGH 3BWAB 5DMKB 4FZ8L 3GBLA 5FB8B 3SCMB 3DSFL 2AKRB 4QXGL 4BFGA 1EFXB 1I8KB 4YXHL 4X5XB 3DX7B 5TF1H 1CGXA 3KXFB 4F3FA 4UT6H 5SWZE 1A6TA 3MRDA 3X3FH 4NSKA 5GS0L 2W38A 2ESVB 4XAWH 2BSED 3VG0L 4YIQA 4NM4L 4PGCB 2GSIA 3MO1B 3DETC 2NX5A 5DMJB 1A2YB 1S8DB 1ND0A 1I1AA 1I7TB 2ZG1A 3B5TA 1X5FA 3W5MA 1IGIL 3VFMB 4KRPC 3TA3C 5JDJA 2FJFB 4R2GD 1WBZB 4OZFG 3ZHDA 1N64H 1ZEAH 3HA0A 5A1AA 5A2FA 7CGTA 2VIRB 1QPPA 3MXVH 5DD5H 3SDCD 5KW9H 3HPLA 2IPUG 4N8PA 1GPOH 1N7ML 1XT5A 2CKBL 4PY7A 5IROC 4XWOC 4TSBH 4B53A 3LN4B 4ZAKC 3TYFA 3BYTA 2UVEA 1FAIH 3ZE0F 1NGPH 4FTVE 4KVCL 3LAFA 1ZAGA 1KV3A 3HKFA 5DEFB 5FA3B 2FGWH 1BZ7B 4AL8L 3W0WB 1P7QA 4OZGB 5C08B 2VERN 2CR6A 2F53D 3DI3B 4XVUC 1NBVH 2VNCA 3GMNA 4KXZH 4OLVL 4JB9L 2DN7A 3P4LA 1JFQL 4AT6A 3G9AB 1T6VN 3SJVD 1FFRA 2R56L 3C8HA 5HPMA 1F4WH 3X3GH 1QNZH 5BRZD 5HGBA 5FK9B 2AI0H 4UI2A 5DC0A 1KTKE 4MJ5B 1DQJA 4G6AD 2EDEA 3SN6N 2QR0B 1SEQL 5E8OB 4UV7H 4OSUH 1KLUB 3T2PA 1TMCB 1IILE 3I6KB 2ENSA 3CVIL 4N8VA 1DL7L 4M00A 1XMWA 5BZWA 2O5XL 4PJDE 3UZQA 3T3ME 1A6PA 4J2XA 4MQ7A 1CN4A 2IPTH 4PJXE 1JYXA 4HKJA 1AP2B 1A8JH 4NPYB 5HGAA 3C09B 3LN5A 1JWMA 3G6AA 1JCKA 3MRBB 3MUY1 2J4WH 1S9XA 3KPMB 4WO4A 2BVPA 1KUMA 4XB7A 5F9WB 4NFCA 5DA4A 5F7UA 1F5WA 5E8DL 1HXMA 3U0TB 1PX4A 4QHLB 4KGLA 3LB6D 4WUKH 1MFDL 4YK4B 4R2GB 1K3ZA 4Z95H 1MJJB 1B0RB 2Q20A 1RZJH 1B2WL 5DRWB 1W2KT 3FQWB 5SV4A 4Z7OF 4UV4H 2VSDA 4JG0L 3TNMB 1J0IA 4NO3B 3L95A 4YHNB 4JANA 4YQXL 4LF3B 3H3PH 1LK2A 2UZIH 3OG6B 2X05A 3PNWA 4IMKA 2MKLC 1WZKA 4LDLB 4ODVH 1DBJH 5E2UL 5K59F 1AO7A 1FZJA 4Y4HD 1C1EH 3R0NA 4PJ8C 3EGSB 4IDLA 2PO6C 1D6EB 2F53B 5C9KA 1F11B 5F9JB 3VXQB 3K8LA 3PGFH 5IKCB 1WC7A 2PETA 2EH8L 2CPCA 4ZPVB 3O4OC 3SJVB 3VGAB 5HDLA 1MVUB 5BRZB 5FECA 2FO4A 5CD3A 4OCWH 2V17H 1KCUL 1R3HA 4LQ1A 1ITCA 2B5IB 4D8PB 1ORSB 4ONHB 1ZOXA 2HJLB 5IQ9A 4HKZA 4JFFA 4WUUD 3C5ZC 2B1HL 4WU7B 3LMJL 2YSSA 3L3GA 3PL6D 2OR9H 2WINB 3T0WA 5C0CA 4ZFZA 3QQNA 5A16B 2Z92A 3O4LA 1RUQH 4DCQB 5C9JA 2YPVL 1LP9F 3LKQA 1S7SB 5HHXH 2K3TA 3ORJA 5FYJD 5C0IA 4K7PX 2CQVA 1I8IA 4F15C 4XP6L 2DDQH 3QJHA 3KS0H 2IWGA 5F7MC 4DQOH 2I07A 1D9KD 2P7TB 1WQVT 2HT2D 3BI9X 4JQIL 3V52H 1KCRL 1G7PB 1TQBC 3INUL 1N2RA 5F21B 3T77B 5HI5C 3TWCH 4HDIA 3KWWA 3CFJB 1HILA 5JR1H 1JBJA 2P8MB 1A02N 1T2QH 5JW4N 2EE6A 4YNYA 4B50A 3IFLL 5DSCB 3VCLA 3VWKA 1XZ0A 3FT2B 3I3BA 1QSFA 2ZCHL 1QKZL 2YPKA 4Y4HB 1NCWH 1AHWB 1U95B 2BOCB 1SJHA 5DVOA 2HT3C 2F9BT 3HHRB 2Y4SA 4OGAC 5D7IE 4OI7A 3E6HB 3JSSA 5JW4M 3E3QC 4QYOA 4NKDA 3RX7A 1HHHA 3WIIL 5DYOA 5EU6A 3MOBL 1S5IH 4Q9RH 1KJ2H 4XWGL 4WUUB 4N9GB 4Z8FH 1A9BA 1MCOH 3JWOL 1DP0A 5EG6C 3PL6B 3D39A 4KTEH 3U36B 3ZZ1A 3O81A 4DJMA 4UQ3B 2GI7A 5TF1L 3D2UD 2DWEA 4G8GD 1FNSH 4HZLA 4OGYL 5C09E 3OAUH 1M05A 2COQA 4LCWD 4UT6L 1KJMA 5DI8A 1JK8A 3X3FL 1NPUA 3O45B 4PJDF 4CW1A 4N1HB 2WBJD 4OCRL 1MEXL 2ZCLH 3T3MF 3LKOB 4FQJH 4L5FH 4JVWA 4LVHC 4PJXF 3REWA 5EU7C 3F5WA 2YZ8A 3OB0H 2D4DA 3PWVA 2A73B 2XY1A 4PB9H 1MAJA 3VFVA 2GTWB 3X14B 1FVDB 1WZLA 2OI9B 3QXDB 1YN7B 3OKEB 1D9KB 4CVXA 3QCUH 1ZT7A 2P45B 1BJ1H 5ISZE 4KKBC 2R9HC 1N64L 1ZEAL 5J4MA 1G7LA 4JZOB 2NTFA 4HAGA 3CVHH 3MXVL 1TJIH 1KG0B 5DD5L 5JNYB 5KW9L 1GPOL 1KPVB 1NJ9A 2D7PA 4QTHB 3IF1B 3O8XD 5C0NC 4TSBL 2V5SA 1Z9SA 1FAIL 3HI6H 1NGPL 2YPLA 4MXWL 3OKLA 2FGWL 3QUZA 2HFEB 5HYSA 2F74A 3S36X 5J7CC 2G9HB 1NBVL 4KI5C 5F9DC 2R0LL 2HVJA 3FB7B 2DMKA 4DTGH 1VGKB 5E56A 5FEBA 1HH6B 2Q3ZA 2B1AH 2PF6A 4BZ2H 1F4WL 2O5YL 1QNZL 3X3GL 3QHFH 1XR9A 1XIWD 3AB0B 4MD4A 1H5BB 4UV7L 4JFEE 1MVFA 5SWQB 1RU9H 5DWUH 1INDH 4OF0A 4XGZA 2A6DA 4TN9A 2OSLA 1V7NH 2F54A 3KPOB 1LO5A 5MERA 4X8XA 1H3WM 4QHNB 2YUZA 2IPTL 3LCYA 1OGAA 5B3NA 5LG1A 3U1SH 4PYGA 5ALCH 1A3RH 3D2UB 4G8GB 4LRNH 4LDEB 4LCWB 3QO1A 3KLAB 1NCTA 5F3HA 3UMTA 2V5RA 2J4WL 4R4ND 2WBJB 1RZIB 5CJXC 4OLYH 4BFIB 4UQ2B 2I27N 3QA3B 5F1NB 5HDBF 1CD9B 1OAXH 4WU5B 4LLQB 1QRNE 5F7YC 4XTRD 1JWUB 1BHGA 1NDMB 1U2CA 2DI7A 4WUKL 4KHTH 3QCTH 4M61A 4U3CA 5ADPH 2MFNA 4K9EC 4MQSB 4YH6A 4Z95L 3F12B 3PIQB 1RZJL 4NQDE 4PRIE 1IAOA 4QY8A 7FABH 1LDSA 2W92A 4UV4L 5F9WC 2ITCB 3OZ9H 4K7PH 1BIHA 3DTXA 3GMPB 4ONFH 2Z8RA 3ZHKA 3S35X 2FYYB 3H3PL 3O8XB 2UZIL 3OTTA 3TN0D 1G7MA 2IEPA 4CU7A 5C70A 4QOKD 4ODVL 1DBJL 4MSWB 4FQ1H 4R2GC 1IC5H 2CIIB 3ZYZA 3GI9H 1A7BA 3BQUA 4O02H 1T1ZB 5C0BD 2NXYD 3U2SB 4DEPC 1M7DA 3OGCA 4UDUB 4J1UA 3DNKA 1M7IB 2FBJL 2R23B 1UENA 1FL3A 5FIEA 3G5VA 4UU9B 1R0AH 1XIWB 3ARGA 4Y5YB 4OCWL 3WV0A 1LK3H 4ELMB 1MHEB 3UPRA 3QPXH 1RIVH 2X1XR 2IPKA 1GH7A 1XGTA 2DQGH 4Y19E 4HUWB 4X7FC 4X7SH 5D7IF 2VUOA 5IIEA 1S3KH 4D9RD 3MNVB 1SHMA 3VGAC 4NO5A 1JHTB 1CE6B 3MGOA 2EXWC 3U7WH 4EKXA 1RUQL 1Q9KB 3L3IB 3F7VA 5TQ2H 3RA7L 4UTAH 2F8XC 4G6AC 2DYPD 5GRJH 2QADD 4MMXC 4JN2A 2B5IC 2WWKT 3IETA 4MCYA 4D9LL 3S3SA 4WNQB 1JMXA 4DZBA 4NQCA 3GZKA 1LEGA 4DN3L 1KJVB 1A4JA 1PKQE 2CSPA 3VXME 3D0LB 3FO9B 4UZGA 3OBAA 5BS0E 2DDQL 4L8DB 1MRFH 4JZJA 4Z76A 5KSUB 4ZUVB 3WXWH 4DQOL 4HKXA 1BOGB 3D69B 1YMME 1PJ9A 3V52L 5EN2A 3PGCB 5KG9B 5I1IL 5E6ID 4N0UA 4X99B 5DD6A 3L7EB 2ID5A 3P0VH 3TWCL 2XFXB 2C3GA 2VJXA 2OTWB 4U49A 3VXTA 5AWNH 5I9QB 5JR1L 3GSRB 1T2QL 4NOBA 4LFHD 4PJCB 3WO3B 4YBHA 4RGNE 1B6UA 1HH9B 3TN0B 4J3TA 2V2XB 3LB6C 4GQ9H 3QXTA 3CPLA 4QOKB 2NZ9C 4MNGA 4GAJH 2H41A 3MYJA 2YN3A 3CC5B 1NCWL 4ZDHA 3MLRH 2DJSA 2A6IA 3O6LL 1HDMB 4IRJA 4M43H 4OCYH 2I24N 3DV4A 4K3JL 5C0BB 2NXYB 4L9DA 5B4MD 1RHFA 2X4QA 3O6FA 1FC2D 2Y5EA 2W60B 2W65B 3W39B 1MCWW 3IGAB 1EEZA 5DRZB 5I16A 3V6FB 4MJIE 5EA0L 4YC2B 2Z0BA 1L0YA 4Y4HC 1S5IL 4MVBD 4YLQT 3S36H 1KJ2L 4Z8FL 1CXLA 3NPSB 2QHRL 5MENE 3WNNA 1T04B 3L3KA 2R1WA 2R2BA 4KTEL 3QUYD 5D5ME 5B8CB 2Q7YB 5FCUH 1OD7A 5M7QA 4DW2H 4JFYA 3DUUA 3MA7A 1T5XA 1FNSL 1KENH 3N1QC 3OAUL 4QRUA 1BFVH 3IDGA 2DOCA 2DYPB 2QADB 3HG1A 2X4PB 3HZVA 3TBSA 1V7MH 2E6JA 5D7SH 4R96B 4J3XA 2ZCLL 1ZLVH 4C56E 3IDYC 1SYSB 4XNUH 3QUMB 1J05B 5GQBA 1H0DB 3UBXG 3TBWA 1S7UB 3N50A 4QNPE 4PB9L 2XZQL 2DQTH 1JRHL 2EDTA 2ARJA 1WK0A 4KFZC 4E5XB 3BIKB 3CH1A 5C07A 5IHBA 2Z35B 3EYFA 1OVZA 3QCUL 2AEPH 4ORGA 1IGYA 1NFIB 3UTSE 3ARFA 5K9QI 5E6IB 4XZUA 3HE6A 4X6BB 3VFNA 3CVHL 4XB8A 1J9CT 1TJIL 1RD6A 1RZFH 4EN3D 2R1XB 4APQA 1CT8B 3S97C 3H7BA 4P59H 2IMNA 1MIMH 2OI9C 4KK6C 1SEBA 1YN6B 1WBYA 3HR6A 4I77H 2HT2C 1G7IB 3ARTA 4POZD 5FA4A 1CE1H 5DHVH 3WNMA 4H8WH 4WHYG 4PGDA 4DTGL 5D72L 1CGWA 2DD8H 3QR2A 4XCFH 2B1AL 4OD3H 1DCLA 1ZHLB 2BSRA 4BZ2L 3ZKMC 1IC7H 3QHFL 5GRZA 3WJLA 4F7CA 1BMGA 4WEBH 4JHZA 3S35H 5GRWA 1YPZE 4L3CB 5L9DH 4KPHH 4LSQH 4I0CC 5IB4A 4R7NA 1RU9L 2DQHH 5DWUL 1S9WB 3UTTA 2XT1B 1INDL 5I8EA 3S5LA 4L8BB 1V7NL 1AGDB 1REIA 5AG9A 1BVKB 4PR5B 4IOSD 2I9TA 1HHIB 1VFUA 2QQKL 2EDFA 1YEDB 3QUYB 1QLEL 3AB0C 1T4KA 1S7RA 1LP9B 2CLRA 3U1SL 5ALCL 1A3RL 4WWKA 4LRNL 3MV8A 2ATPA 4LOUD 3KHOA 3CDGA 4EDXB 2AERT 1RUKH 2LQRA 4JDTH 1S7XA 3CFDA 1G7QA 2H6PA 2FSEB 4JDZA 4ISVB 4IS6A 1HKFA 3F62A 3DVFA 3HUJE 4OLYL 4HFWA 4NHCH 1X9QA 4HIHA 1T1WB 1EHXA 2WLYA 1OAXL 3VXRA 1J8KA 4IJ3C 1DEEA 3BZ4A 4P2CG 4ODSH 5DURD 5HD8D 2HLFD 4KHTL 2G5BB 1QFPA 3QCTL 4BQ9A 1L9MA 3I75B 5ADPL 4Q0XL 3OB8A 4FQCH 3KJ6H 4P5KB 5F7DA 2HLAB 7FABL 3QWQB 2P5WA 3OZ9L 1CVRA 1MCQA 3MUGB 4K7PL 2ZUTA 4EN3B 4RFEA 5TE7H 5JZ7D 3SQOH 1IAII 1T66C 3V7MA 1ACYH 3GGWB 2IALA 3Q0HA 2EECA 3KDMA 2FX8H 2C1PA 4E42A 5GGQH 5C3LD 1IC5L 2EXYC 3Q5TA 3X12A 3OJ2C 5I18H 4JG1H 4O02L 2EZ0D 2WLZA 2BVYA 3UTOA 3WFDH 1WVZA 1NCAH 4ERSH 1BWMA 4RGOH 2CKNA 1AR1C 1CXEA 3PDGA 5IV2B 2X44D 5SWSE 4YDLB 4G6JL 3UBXI 1IM3B 3P4NB 1R0AL 2UZXB 3QUZC 4ZOAA 1LK3L 4P2OA 5DGQA 4FFYH 4U1LB 4WHCA 2BCKA 4X9FA 3QPXL 1RIVL 3TJHC 2JJTC 2XQBH 2DQGL 4PTUB 4WFEE 3RI5K 4X7SL 5KSVA 3GMQA 2BP3A 1Q9WA 1FNGA 1OM3H 2B4CL 4N0CC 3U7WL 5TQ2L 4UTAL 2R8SH 2OK0H 2WW8A 3HMXA 4PJFE 4L3EB 1AY1H 1YDPA 3DHJA 5GRJL 1EO5A 3FFCA 5D2NB 3BP4A 4MA7H 1QPXA 2WMPA 3ISWA 5GS0D 5DJ0A 4C83B 1CLOH 5D5MF 1CQYA 1NLBH 4HV8B 3QP3A 1HSAB 4KJYB 4DAGL 1MRFL 4CJ0A 4FXKB 2VR4A 3TH3T 1FFNB 3O3EA 4LHUD 3WXWL 3SDXA 2OQJA 1LEKA 1JZ8A 4HK3J 5ESVB 5GGSB 4AM0B 2CRZA 5DURB 3EYUH 5GS1A 3ULUD 2CO6B 4ZS6D 4XCYB 3P0VL 1KIPA 4HMDA 3UYPA 3VH8G 4P2QD 4S0SD 4GBXA 5IT2H 2VTFA 5JW5A 2M26A 4I0PD 3T0DA 4HIEA 1S7WB 3RHWK 3S8WA 4GQ9L 1OPGH 4N5ED 1TPXB 5CJ8A 3VGGA 3T8XB 3MLRL 4H1LH 5J12B 5D7KD 5IK3A 5HYQA 2VDNH 4OCYL 4S2SB 3IDJB 4RBPH 4OIAA 2PR4H 3D3VE 5IMOB 3TN0C 3JV0A 4NZRH 5ETUB 3VXNB 1IZJA 2WAHA 3NCMA 4LPXA 3QDJA 4HS6B 3BQUC 3P9LA 1FZOB 1HHJA 2M2DA 3S36L 1CI5A 5C0FB 3BZFA 3BESR 2YC1B 4LL9A 4MXVE 4JVUA 5DJAA 2DS4A 2GFBA 1YPZF 1UWXK 5HY9A 1JHLL 4DW2L 4HK0B 3MUZ1 4P46D 1FIEA 1OD9A 5GRXG 4L29A 4YC2C 1QLRB 4OIIH 3NACH 4G9DA 1QHOA 1V7ML 1NGWB 3G08A 2DI9A 4XNUL 2BHUA 4PJ9D 2CDEB 1SJVA 3NPSC 5C09D 4X4ZA 3GJFH 4EUPB 4Y4KD 1FH5H 2DQTL 3CFIC 4PGJA 5B8CC 5IB2B 3VD3A 1JPSH 2VLLB 4NO0A 4BQ6A 1SY6A 5DTFA 4LHUB 3VXSE 3DX8B 3H3BC 2X7LB 2H26A 4U3HA 1RI8A 2AEPL 1TVDA 5CD5C 3GSQB 4EDWH 1KN2H 3B9KD 2XWBA 3HUJF 3ES6A 5IBTH 4KHXH 1SVZA 2EEAA 2J88H 1QLFB 1RZFL 4JZJC 3TFKC 1B3JA 3MJ8B 1GGCL 4P2QB 3HNVH 5DO2C 2X9YA 4NKOA 2YWZA 1MIML 3OKMA 3U46A 4I0PB 3IAQA 4F33A 4I77L 1UXSA 5DJ2A 1MCPH 1CE1L 1G6VK 5F72S 1ZGLP 1YYLH 4H8WL 5E6IC 4HUUB 2XV6B 1CCZA 3P0GB 2F8VA 3WNPA 4ETQB 2DD8L 3GMRB 5HHQA 3MCKB 5C7XH 3QZWA 4OD3L 4PBXA 1DVFD 4RRPG 1BBJA 4KKCC 1IC7L 4PJEB 4X6EA 4JGUA 2NW3A 1H3PH 2GJZB 4BSVB 3WIFA 4LVNB 4WEBL 3S35L 5L9DL 4L4JA 2PYED 5ANME 4LSQL 1A7NH 1QSZA 1NQBA 1U8LA 2DQHL 5DJ6A 3A6BH 3IFPB 4U6HB 1JNNH 3HPJB 3EYVB 4IRJC 3HI1A 4LU5H 4YHOH 4PY8I 1NGQH 1MQ8A 1HOCB 5I19H 4JFED 4HJGA 4PGEB 1UXWB 3MNZB 4UT9H 1FNHA 4LCIH 4IMLA 1F4XH 3KGRA 5J3HD 5E2VH 4P46B 5EOQH 5D6CA 1ES0B 2F5AH 1RUKL 1QR1B 4TULH 3QDHA 2BRRL 3RWJB 4PJ9B 4S0TD 5C09B 4NHCL 4PJAF 4Y4KB 2X1WL 5EORH 2XN9A 1VACA 4PJFF 3QUYC 4MD0A 4GSDH 4ODSL 3C5JA 1VEPA 1PW3A 2Z93A 3BPOB 3FJTA 4P3CH 4X6CB 2R2HA 3G5ZB 4FQCL 3KJ6L 1KEMH 1H9VA 3EYQD 3B9KB 1YY8B 1PYWA 1QRND 1UEYA 1YEKH 3DO7A 5CEZH 5E08H 4LVOC 3FO1A 3BFOA 5I1DB 5T1KD 5TE7L 3SQOL 3IXAA 2D03H 3BVNB 1ACYL 4NQDD 2ICWB 5K9KA 2FX8L 5GGQL 1V05A 2C1OB 1NC4D 2A9MH 1UJ3B 3HE6C 5I18L 2YXFA 4JE4B 4JG1L 5LAXA 4WI8A 2DLEA 3WFDL 1NCAL 4RGOL 1ETZA 1J8HA 3UPCA 4X4YB 5TDOB 2AQ2A 5CZXC 2F15A 1U3HD 3EDDA 5AD0A 1T7VA 2ED7A 2O5ZH 2PYEB 2W07A 1JYWA 5D7LD 4FFYL 3BGMA 3VDCA 4NC0B 4POZC 4FZEH 4KDTA 4RQQA 2XQBL 5CEYA 4R7DA 1Z0NA 5EO0B 5KJRL 5A2LH 4CMMB 5ABDE 4M6AA 1FNEA 2A0LD 3WJLC 1OM3L 3KPLA 4LKXB 5TF0A 1ZS8A 3ULVC 2EE9A 5HHOD 2OK0L 2DM7A 1AY1L 1WAAA 4FXGB 5DHXB 4AEIH 4N8CH 4MA7L 2BZDA 4YPJA 3O41A 4LPUA 4MXVF 3KYMA 1OLZA 2C3VB 1CLOL 5BW7A 4OZFA 1NLBL 3V5KB 3LH2H 3LKNB 4XMLH 1PQZA 3MC0A 4OV5A 2IQ9H 2JK5B 5GGUA 3FT4A 4MJ6B 1KLGA 2Q76B 2CDFA 3RDTD 4YO0A 3VXMD 5DK3A 5D2NC 3WUZA 3EYUL 5BS0D 5CBAA 2AJ3A 2VZTA 4ZMAT 5EBLB 4PLJD 1C7TA 1QRNB 4GKSA 1YMMD 2GCYB 1XGRB 1AIFB 3QXAA 5IT2L 1R5IB 5T1KB 5ITFB 3LD8B 3GMOA 5E8PA 4NQDB 1RMFH 2W0KA 4U1JB 5CJQH 2AXFB 4PJGE 4JFXB 1NC4B 1CFSB 1UZ8A 5JORB 2EDLA 2C26A 2N7AA 4RGND 3SDCA 2VDNL 4KJWD 2H32A 3ARQA 1ZVYA 4MNHB 3SGKC 5ERWB 1CZ8H 3JWNC 4JFOB 3HLAB 4HC1H 4NZRL 1U3HB 4RDQG 5D7LB 4YAQB 1DQQB 2H3NA 4Z7UB 5J12C 5E1HB 3TJEL 3RWCA 3KNBB 2Q86B 2VISB 3DJ9A 1VSCA 2EZ0C 2ADFH 2D3VA 4ELKA 4NNPH 3L3DA 4Z0XA 1BQLL 3FQRA 5HYJE 2BX5A 4PD4J 4D8PA 3WUWB 2A74A 5HHOB 2JF1A 1DBMH 3ARBA 4PS4L 4OIIL 3NACL 1CFVH 3UTQB 3DVGA 3F7PC 4JFPB 4IHOB 3AGVA 1E4KA 3CX5K 3LQAC 4RMVA 1D5BA 5IFAH 2W0FB 5KSAA 1FH5L 1FVCB 4DVBB 4Q6IB 1CD0A 1K8DA 1JPSL 1CGSH 2HTKD 1WBXA 2JIXD 4C56D 4LPCA 4JFHE 2OL3H 3DXAE 3E2HC 3RDTB 2ERJC 4M8VA 1B0WA 1PKQB 3VXMB 1OF2A 1AXSB 1KN2L 5BS0B 4HS3B 4KTYA 2DAVA 5IBTL 1DBAH 4U6XB 4NKMB 3GHEH 4O2FB 4U1GB 3KR3H 2J88L 1P7HL 1ZE3C 5E8NA 3EHBD 3MV9B 5BV7B 2N56A 3KPRA 1YMMB 4H25A 3HNVL 1HEZB 1L7IH 3QULA 3UTSD 3EOBB 3HZYB 3EOAA 2F58H 1RJYB 5GS1C 4KZDH 1VERA 2F8OA 4ZUTB 1MCPL 2V2WA 2Y25A 1YYLL 3ULUC 5DQ9B 4WEMB 4ZQKA 4QWWD 4JY5H 5FKAB 5FV1L 4RGNB 3BH9A 5DFWH 1C16B 5DS8B 3EO9H 3DYMA 2C5DC 1H3PL 4G6KL 1HHGB 2FHCA 1SJEA 2FBOJ 3BWUC 1VFBB 1S7TA 1A6VH 1A14H 3ET9F 1BREA 4CDHA 3V5HB 4HH8A 1C8PA 1WV7T 2QBWA 1JNNL 4LU5L 3HC0A 1A1NB 4Z5RA 1C12A 1AD9B 4RA0C 4KMTH 2FCBA 1NGQL 5IJKA 2K7QA 1F8TH 3EYSH 5I19L 3VXPB 3VXOB 1F4XL 4LVNC 5IB1B 5C0AA 1CGUA 5JTWA 5E2VL 3KPSE 2VQTA 1AC0A 5EOQL 3SDAA 3TNNB 2VH5L 2F5AL 4OFPA 4NOFA 1HCVA 2VLKA 3CZJA 4TULL 2VL5A 4WHDA 4WW2A 2OX5A 4PJ7B 5C92A 1QFUH 3QQ9D 1CF8H 1K4DA 1G6RA 2X4OA 3N1MC 2YD5A 4GSDL 5MEOA 4QHUA 1UH4A 2IH1A 4C56B 3P2TA 4OZHA 3MRHA 4P3CL 4I5BB 1ZVSB 5ID0B 1I1YB 1GGBH 4DVRH 1KEML 3FQNA 4ZUWB 2R0WL 3C9NB 3WDIA 5C0JB 1YEKL 3BZEA 5CEZL 5E08L 4PJ9C 1XGYH 3CXDH 3BXNB 4Y4KC 4UUJB 5CP7B 3M17A 2D03L 2P8LA 3ROOB 2AJXH 2ZUVA 2BVQB 3PHSA 3UTSB 1RUAH 2EO9A 4YPGB 2YA2A 3PQYA 1A9EB 2NNAB 3OR6A 4KXZI 3NA9H 5EO1A 4ODBD 1FP5A 2A9ML 1WJ3A 3W81A 2XZCH 3SDDD 2X4UB 3WLWD 4HCRA 4HIXH 4ZFFB 5IBUG 3EO0B 1U92A 1U41A 3VRJB 3RVWD 2PTTA 5I1CH 1INQA 1BJ8A 2J8UB 1L0QA 4BUHA 1JIBA 5B39A 5DFVD 4Y2DD 1M4KA 4A2MA 2KPNA 4WFGE 1AE6H 4Z7VA 4FZEL 3QFJE 4FG6D 4OI8A 4MNQD 3DVNB 2WUBL 4LLWA 2DQIL 3W82A 3IDNB 2DQFA 2ZG2A 3U9PH 4GW1B 3EIFA 4WFED 4AEIL 4N8CL 2I9LA 3OXRB 1Q9OA 4NC2B 4JQXA 3R4DA 1JYNA 3UJTH 1I1FA 2OS7A 4K07A 4HUMB 4R4FH 2Q3AA 3HZMA 2DWDB 1D6VH 3LH2L 4XMLL 2IQ9L 4JM2A 3CDYA 3BGAA 5KAQF 1LO4H 1NFDA 3TT1H 4BQBA 3T4AA 4XCNA 4WDIA 3F7YB 2WIIB 3EBAA 1QO3B 2OBGA 5E00B 1F6FB 3CCHA 1I8MA 1HE7A 5AG8A 3SPVB 5JXEA 1VFAB 3QA3A 3PXHA 4OCNC 1LO2L 1R24A 4KROC 4AEFA 5LGJB 4JRWA 4GG8A 5HVHC 4H5SB 5KVEH 5CLTA 4LCUA 1A3LH 1ZA3B 1I85A 4RWYH 1VFMA 3U79A 1RMFL 1KTLB 3L5JA 2BERA 1UM5L 4JREB 4L4TA 2JJSA 3C5SA 4XPBH 2HFFB 3I02B 3O2DH 4CGTA 2OLDA 3UPAA 3B6SB 3EYQC 3SDDB 5F1SA 1KB9J 4KU1A 4XBPB 4FQQA 1CZ8L 4BUGA 1KGCD 1U8KA 4HC1L 4RAHA 3JTTA 4WCYL 3JV4B 4UAOB 3U30B 1ULVA 4LEOA 3KPQB 4Y2DB 3STBA 4EI5A 1M6OB 3GJEA 1PAMA 3PF2A 2N4IA 2ICWJ 5BCAA 1EUUA 3ZE1E 3D3VD 4X6DE 4MNQB 2DKMA 5GSVA 2BNQA 1CLZL 5GSRA 1H8OA 5TDNA 2ADFL 1T20A 4NT6A 2EDXA 3IDIB 3MLZH 4TUJA 4NNPL 1KCVH 3N85H 3QH3A 4DFIA 3VRLE 4NM8H 4QRPE 3ZT5A 4EBQH 4R90H 1CK0H 5I1GH 1TTUA 1MCNA 1DBML 4KDTC 1CDUA 4QXUH 5CS7A 4P57A 3EJZC 1NDGB 2R4RH 1EXUA 3VD7A 4PJBB 5IFAL 3JV5A 4KAQL 1GOFA 2VXSH 1LE5B 1EA9C 4BKLA 1INEH 2H45A 4PLKD 1CGSL 4RNRA 1T7YA 2OL3L 2APFA 1TTGA 3C6LA 2I60L 3DGGB 5CEZE 4PRPA 4WJ5B 4OZIE 4LP5A 1ZHBB 2CUMA 4MYWB 5GIRA 5BW7C 1DBAL 3GHEL 3KR3L 3QPQD 3VXSD 3HRZB 1NBZB 5L2JA 2RR3A 1FYTD 1L7IL 4CU8A 3HR5A 4LCYA 4Z78A 4Y8DC 2UWEE 1JZ2A 3O9WA 5I1LB 4X0KB 1G7JB 1Q94B 1H8NA 2FNBA 3FO2B 4QHMB 2AABH 3L5HA 4WENB 3HRPA 3O11B 2YN5A 3IKCB 3MRIB 4LHJB 4U1GC 4JY5L 1MFBH 4L8SB 5BV7C 2ADIA 1RZ8B 4OUUA 3EO9L 1HI6B 4HFUH 3AXLB 4TVPH 4MAUH 43C9B 1A6VL 1A14L 1RK0B 1P4LA 2E9JA 1HSBA 4XXCA 4LLVB 3BEVA 4R26H 2XRAH 4XPTH 4MA3A 5H94A 5DUPL 3WSQH 2L7JA 4KMTL 4JRXE 1IQWH 3NCCB 5KOVC 3D3VB 1F8TL 3EYSL 2V5YA 4KJWC 4GXUN 4OT1H 5EUOA 2PW2A 2ICEB 1A7OL 3D6GA 5EU5B 1GZPB 4V1DE 1DDHB 4NHUA 5H35A 2IADB 1DE4B 5IMKB 4LLUB 5IEKA 1AQDA 3QIUA 4F7EB 2Q6WA 1HXYB 5E1AA 2DLIA 2HFTA 1QFUL 2D31B 4JKWA 4QXTA 3SDYH 4C58B 1FSKB 3U7AA 4GG6F 5JOEA 2GYSA 1RAMA 3ARBC 1PKOA 3PABA 4CJ1A 3A67H 3RWGA 5E70A 3ARVA 1GGBL 2UV3A 4DVRL 1K5NB 3RTQD 2IAMD 1U91B 2NZIA 2HTLD 2IANE 5KSAC 2VE6A 5SX5H 1XGYL 3CXDL 3VXSB 5F88A 4U2YA 1BQHG 1FYTB 4IOFC 2AJXL 5IMMA 2ATKB 1RUAL 3PHOB 4DZ8A 3RGVD 2AV1B 3NFNB 1BF8A 1MCBA 2XZCL 5D1ZD 5JO5A 5CGYD 4LPYA 4HIXL 4AK1A 2HG5A 1QYGH 1MJ8H 4JPWL 5FUCE 2XWTA 4MS8D 2MJWA 2H2PD 4IBLT 4S1SH 5CHNB 3BE1H 1B0GA 4HUXB 3VE0B 3TV3H 2EYTB 5D2LB 2CLZA 1AE6L 3H8NA 3H9SA 3MRRA 5DDHA 1GGUA 2JB6B 4O51A 4LLMB 4QHKJ 4HKBB 3IYLW 1UC6A 4WV1B 1R3IH 1FG2B 5ANMB 4X7DC 2JE8A 3FOLB 4WI4A 4U1SA 1BJMA 2GT9A 3PV6A 3U9PL 2DL2A 2W9LA 3WEXA 1EO8H 5E0QA 1QEWA 4WI9A 3UBXA 4CL7A 4KTDH 5HGHB 2UUDH 3C87A 4HXBH 5F7EH 3ZE1F 4X6DF 3ILQD 1U8PA 5IJKC 4GRLD 1F2XK 3UJTL 2NMSA 2R39A 3C8KA 1MCWM 5GGRB 1CR9H 1S5HA 3VRLF 4QRQB 1DTUA 3I6GB 3TBVA 4GFTB 3K4DA 4F57H 1J12A 3TT1L 3W11D 1KULA 3SDAC 3MBED 5H8DA 5FUZL 4FP8H 3D0VA 3QJFB 2WV3A 4WW2C 3T65B 3RTQB 4S1DD 3I2CL 5DVLA 1VCAA 1FE8H 4NBXB 5SWZA 3VU2A 5C8JA 4JRYE 2VYRE 4LCCB 4KC3B 2CLVB 3VRIB 5KVEL 4BSWB 1A3LL 4XXDA 4YFDB 2CR3A 1U93A 4RWYL 2YEZB 2GUOB 1U8NB 2P5EA 2HRPL 4G80B 4GW4A 4UILL 5CBEB 5AZEH 4OZIF 3RGVB 2EO1A 4XPBL 4C54A 3VD5A 5EIIA 3O2DL 3HCVB 1OOAA 4JAMA 5D1ZB 5DUBB 4HIIA 2YD9A 2JCCB 1KXQE 1KB5A 1XH3A 2V7NB 3FB6A 4F80A 4I1NB 1O5DT 2BOBB 5T1MB 2GJ6D 1MLCA 3OQ3B 4N0FB 1QFWI 1E6JH 1JV5A 3EO1A 3UP1A 4FTVA 5GZND 4U1KB 4KUCD 4YDVA 1GIGL 3SKMA 3VFRA 1M71A 3DBXA 3MQIA 1AGFA 2FRGP 4HMEA 3MLZL 3B8YA 1KCVL 3N85L 1IKNA 1TXKA 4AENB 4NM8L 4FFVC 5IFJB 2MTPA 1MAKA 4R90L 4EBQL 1CK0L 1G9NC 5I1GL 2BK8A 2DLTA 3QEQB 3U30C 5CP3A 1XGUB 4Y2DC 1MNUL 4NJ9H 2ZSWB 3V6OC 1MCEA 1P2CB 1A6ZB 4FG6C 3H0TB 4YDJB 4GRLB 2MMXA 2R4RL 1VDGA 4P3WA 3R1GH 4M1CC 3VFUA 1UJTA 3UXFA 3RWEB 3PJSB 2VXSL 3V0VA 1WT5C 3HB3D 4X5WA 1INEL 1SJXA 3PGDB 3HMWH 4PJDA 1QD0A 3BDXA 3AM8A 3RWFB 3MBEB 1TCRB 4N8VG 5EFIA 4PJXA 1QQDA 1NGZA 1JNJA 5C2UB 4LNRB 4ZUUB 4FFZL 2FECL 1PY4A 3LIZH 4I2XA 2YHGA 4JFHD 3DXAD 4MA8H 1HKLL 2A6KA 2DMBA 4NQEE 1JF5A 1DUYA 4HGKC 4P49A 1FYHB 1M7XA 1RURH 2FJHB 5KAQG 2VLJD 5D93C 1RJLB 1IQDB 4XC3H 5HVFB 3G5XB 4AIZB 2AABL 2VDMH 2QKIB 3FQTB 5GRVK 1FL5B 1ZLWH 4KK5D 2EYRA 4NKIL 2BNRE 1A5FH 4IM8A 2RFXA 5BXFB 1EAPA 5HI4D 2MHAB 4PJGB 4HFUL 4TVPL 4MAUL 3KJ4B 3BIBX 5E5MB 2FWOA 1OARH 4D9QE 2GJ6B 1XF3A 2I26N 5HHVH 4F7TB 2AK4E 1T2JA 3Q3GA 2XRAL 3G6JE 3O2WL 4R26L 4W70A 4XPTL 3WSQL 4NDMA 1NBQA 1IQWL 4ZS7H 4RFOH 1U3JA 4L8SC 1MF2H 1KACB 1XCTB 5JHDD 3WN5A 2E6QA 4Z7WF 2HJFA 5F6HJ 2R2EA 4ZSOE 2JTDA 4LLYB 4ALAH 4WGWB 5H2BB 3HI5L 3MRCA 1BVLA 4Y5VB 1PDKA 4G8IB 4DKFH 2XNAB 4P3DB 1NMCC 2XZZA 3H9HB 4E41A 4RMUA 4Q9CA 3KPSD 3QNZA 3SDYL 2VWEC 1X4XA 3LDBC 1CD1A 2Y5TB 3FB5A 3WKNA 1KNOA 3A67L 4U31A 2VABB 3NFSL 1W72B 3VH8A 3W2DH 2XPGB 2VN7A 1EMTL 1C5DB 3SO3C 4PJHE 5B38G 3IAPA 1JTOA 4ZNEA 3S4SA 2VZUA 5FDWB 2BJMH 4RGMB 4HLJA 1VHPA 3LRHA 4YHLH 5EO9B 3GSUB 3LRGA 3EKCA 3DXAB 1I9EA 3SKNB 3IJYB 4K3DH 4I48A 1FG9C 1EJ6A 4JVPA 5I6XB 3MREB 1Q9LB 1Z5LB 4WRLA 1ORQB 2VITB 1A1OA 3C6LC 4XBEH 2VLJB 1FLRH 2V7HB 4M1DH 4HEME 4HSQA 5HI3C 1OTUD 5IR1B 3HNTH 3MRQA 1IEAA 1W0WA 4XBGA 4TTDD 2D7MA 3ZO0A 2G75B 4OB5H 3BSZL 1U8MB 1QYGL 4UMGA 1MJ8L 4PJ5E 5ICYB 5C6PB 1MIEH 3F58H 4QRSA 3VFOA 2CKBA 4S1SL 1RZGB 3O9WC 5IB3B 4PREB 3CU7A 2H1PH 4KY1L 2QLVB 4BFBD 2LAGB 5FDYA 4RX4A 3P4OA 1NMBH 2Z91A 4NO2A 3NTCH 5E2WH 5I1AA 3BDYH 3OR7A 5LKNA 4F7PB 1T1XA 4JHBA 3OJDB 5ECJE 3TT3H 4NIKB 4B0MM 3OKOA 3JV6A 1R3IL 1QR4A 1BD2E 1GSMA 3LKPA 1EO7A 2NY0D 2YRZA 3EFFB 4WFFE 2QSVA 1HQRB 3QFJD 5JHDB 5AYUH 4TPRH 4U33A 4XHJD 3PWNA 2VZOA 1EO8L 5D7IA 3MR9B 3O0RL 4J3VA 4E9LA 4KTDL 5L2KD 4HXBL 5F7EL 5IVXE 1QA9B 4PRBA 4RAVB 5KSBE 1CGYA 1CR9L 3OB0K 3QFDB 4M93B 3KPSB 4FOMA 4UT7H 4F57L 5EZJB 5DRXB 5DC9B 3W9DA 4K3GA 2NR6C 4J8RB 5ILTH 1IT9H 3O3BB 5IM7A 2OZ4H 3P77B 3R06B 5DJZB 4FP8L 4FQXD 5I17B 3QIUC 4HW6A 4LLAA 1FE8L 5KS9B 4I4WB 4JFZH 4NCDA 2X4SA 2HRLA 5DD1H 4JFQA 4GH7B 1U36A 2A2QT 1CGTA 4KMLB 3IDMA 4KJQC 2NYYD 5K9OB 5IWLC 1FFPA 3D5OF 1T22A 2ADJA 3MRFA 4XX1E 5AZEL 1UWGL 3X13A 2DBLH 1LD9A 4K7PY 3RTQC 1MCIA 1QOKA 2FEEL 4H0GA 3RNQB 2IH3B 4TVPE 3E3QE 1R3LA 4H1LB 2OJEA 4LCCC 3DARA 4QF1B 5ISZA 1FZMB 2XKNB 1FZKB 3C08H 3GBMH 3HAEG 1TVHB 2QSTA 4MDIB 2FATH 3T2QA 4Y4FD 3FZUC 5C0DA 1PFCA 4FNLH 1E6JL 5E4EB 5KN5A 2WANA 1KCSH 1DVFA 1C5CH 2A6JA 5F93C 4MS8C 1K6QH 4G8EA 2NY0B 2VXTH 2H2PC 3QFJB 2VLRA 4GS7C 3VI3E 5HGDB 1OAQL 3G6JF 3VXUA 4NJ9L 1H3VA 3LS4L 5L2KB 3VGBA 1CL7H 4OD2B 1KOAA 4JFEA 4OBSA 1TCMA 3V4UH 3R1GL 4G42A 3AS1A 1EBAA 1C08B 1CG9B 4R6UA 3TP4A 2A9NL 3CMGA 3HMWL 2ESVE 5GGRY 4F37F 4AZ8A 3B8SA 5BVJA 4Y1AD 4EI6A 5CEXA 4PBWD 4FQXB 1OCWH 4UB0H 5D9SA 5EU4A 1AGEA 2X89D 1V3KA 2R1YA 1YNTA 1N5YH 3LIZL 1WIOA 1CICA 3K8MA 4MA8L 2ED9A 3TPUA 3QNXA 5CEZD 4HUVB 4JN1L 3LEXB 5DMIL 1RURL 3WFCH 4KI5E 3W11C 3MBEC 1FFOA 1P7KA 4XC3L 3WE6A 5C0EA 4CNIB 1LEIA 4PJHF 1U58B 4D0CB 3T1FB 2OXGA 2FZ3B 4OI9A 1WFNA 1BM3H 4LSUH 1YC7A 4Y5XA 4QLRA 4PRIA 2UY7A 3W0WE 4OZGE 5C08E 5I1KL 5FM8A 4AEEA 4R0LB 2NY2C 2HVKB 5FKPA 4XNQB 5AUMA 1OARL 4Y4FB 2X1PA 5HHVL 4HG4J 4IRSD 4QRTB 2J6EH 5EPMB 1UYWL 4ZS7L 3MBXH 4RFOL 5E94A 4ZO6A 5TGBB 1MF2L 1K8IB 3OKNB 5CILH 5FO8A 3OG4B 1U3HA 1T80A 1XF2A 2PCPA 5J9PB 3BRDA 3T4YA 8FABB 2XKSA 4JRXD 1Y18B 4X6DB 3HC4H 5J89A 3NCBB 3WL9B 4DKFL 1ERNA 4U1MB 4FXLA 4OTXH 5GZNC 4HH9A 3ARZA 4KV5F 5CINH 4LSTH 2VDRL 1YZZA 2IBZY 4Y19A 4C59B 4LBEA 3RL1A 2NY5C 1BLNB 2NY4D 1ITBB 1TJHH 4W6WB 5EOTB 1OW0C 5F7NC 5IVXF 2NTSP 4Y1AB 5ACZB 2A38A 4EXPX 1WTLA 2B8OT 4R9HA 5KSBF 3UZEA 3SKOA 2B0SH 2CO7B 5FYKU 3QUMH 43CAA 1MY7A 4HG4K 5GXBB 4YHLL 2FJGA 4DGVH 3AM8C 3ARED 1P5UA 4RMQA 4BYHA 1MAML 2IAND 2YD2A 4RA3A 4XBEL 5BQ7A 4XCCL 3MLYH 3OJVC 4M1DL 1II4E 3DRQA 1RUMH 4P99A 2FL5B 5DQJB 1A21A 3TCLA 3BN3B 5DJ8A 4M1GL 3L9RA 4OB5L 3LV3B 3FRPG 2CDGA 1BX2B 1OP9A 1XGPA 3QI9D 2CK0H 1A7QL 1MIEL 2UWEB 2Y9RT 3F58L 1OL0A 3LS5H 2EIBA 3PWJB 1KIQA 1MI5D 3BMWA 5HHMD 5HVWA 3GSXB 3U4AA 2VDPH 4XNYH 1MWAB 2F53E 2H1PL 5F89B 3V5DA 1L6ZA 3V4VL 1KPUA 2B20A 2HH0H 2EDWA 3P4MA 1NMBL 3BJ91 5E2WL 3RWIA 2CIKB 3SJVE 9CGTA 4G8FB 3IAGC 4IRSB 5BRZE 3QQ4B 3TT3L 2Q87A 1FJ1B 1NGXB 1ZA6B 1MRDH 5IF0A 1RJZA 3RL2B 4JFDD 1BZ9A 3GHBH 3WKML 1KTRL 5TH2B 5JLZB 5AYUL 4TPRL 3ARRA 4GAYB 5J8OA 4JRXB 3IFOA 5IW1A 1YECH 1ZLVK 4MJIA 4DUWA 1I1RA 3FQXB 2IQAA 3QO0B 5FOJA 2YD1A 5JPMB 2DIJA 4UT7L 2GAZB 1FDLH 5IHZA 1DLHA 2D9QB 32C2A 3VI3F 5MENA 1IE5A 1IT9L 3MYZA 3RKDD 2NY4B 3E6FB 2OZ4L 5D5MA 1T5WA 4XP1H 3TO2B 2A1WH 4YR6A 4NNYB 2LE9A 4B5EA 4MD5B 5I0DA 1MPAH 1U8IA 4P5TA 4RFNB 2Z8VC 4JFZL 4MDJB 5DD1L 2JIXA 3WO4B 2NW2B 3AREB 1R5WA 1KIUA 3GB7A 2IANB 2W0PA 3K80A 1KF9B 2DBLL 1IZKA 4AG4H 3TO4D 3ZSTA 2BMKB 4AJ0A 2C7UA 4U1IA 4WI2A 3S3PA 1AI1H 1D5MA 4CN4A 3RZCA 1AXTH 2ZPKH 1JGUH 5E9DA 1X5ZA 3QI9B 3DLQR 4X7TB 3NN8A 4KI5F 1UB6A 3C08L 1MI5B 3GBML 1KSRA 5HHMB 4PRHD 1J1PH 1JF1A 2BVOA 3RUGA 2CMRH 1IVLA 4M5YH 2HJKB 4FNLL 3SY0B 4E0RB 1JYVA 1OTUC 3UDWA 5JDSB 5EBWB 4KI1A 4TTDC 4M03A 1EZVY 2KKQA 3T04D 3VFGH 3WCYA 4OZGF 1I8LC 4JFDB 5LBSH 1K6QL 4JFFE 4PRAB 2VXTL 1K2DA 2BRQA 3L1OH 1E27B 3ULVH 3BHBA 4MWFB 1NBYA 3K0WA 1OB1A 4FFWD 1SMOA 4S1RH 3FN3A 4EVNA 1G9EA 4WUUE 1IAMA 5C0CE 5I1JL 1C7SA 1A47A 4YHPB 3VA6A 1T21A 3MRKB 5E4EC 4WVRA 1YPZA 2H8PA 3G04A 5FO9B 3IU4L 3NCYP 3UJJH 4HGWB 3V4UL 3BGFB 3LHPH 5GS2D 1OGTA 3LQZA 1M1SA 1DQLH 1T83A 4GUPB 3NVQA 1PX3A 1EH9A 3OKYA 4HWZA 2JLLA 4CDGC 3WFBH 4ONGH 2Q8BH 4KRPD 1FRGL 3TA3D 1OCWL 1OHQA 2X6MA 1AKJD 1KPRB 2GKIA 5ESAB 2OL3B 4UB0L 1F3DJ 5F1IA 3FONB 2W9EH 1BFOB 2H9GB 2ZOKB 1NAMA 1G1CA 3ZSSA 5IW6B 3IU3B 3LZFL 3AAZB 3RVXC 2J8HA 1U8HA 3HUJA 4ZAKD 4CVZB 3MGTB 1QSEA 4HHAB 3B83A 3Q48A 1A7RH 1QBBA 1R3KA 5B3JE 1TDQA 3QIBA 3TO4B 3GSNA 1I9IH 2WWMD 1BM3L 1BZQK 1QSFE 4NUJA 4YGVB 4LSUL 1TZHA 1GC1C 5CFHA 1U2HA 1KN4H 3MV7B 2IBGA 3L3JB 3S7GA 3IVKA 3T0ED 2NYYC 4PRHB 2YMXH 1JPFB 4X6FB 1ED3A 1ONQB 2FR4A 2BNRD 2H2SD 5L6YH 1WCBB 3MRLA 4R3SB 4FABH 3CZFA 1TENA 4HBCH 2OJZL 2J6EL 5D1XA 4A6YA 5IOPA 4MLIA 4UIKH 3BYYA 4ODWB 4XP5H 3MBXL 4XHQA 1YNLL 4RMWA 1N8ZA 2E3VA 4NNXA 5CILL 3VJ6B 2EDRA 1I3RB 2AK4D 1MELA 3G5YA 3GIVB 3U0PA 4R4BB 4J3UA 3ARXA 4OQTA 3HC4L 3D87B 4OAWA 4JLRA 3D39E 4BJLA 3MRJB 5SWSA 4ODTH 15C8H 4O00A 2BSSA 3QBTB 3TF7C 3ESUF 5J11B 1KJ2A 4O2EA 3LQAH 3TIEB 4ZYKB 5HDQH 5CINL 4LSTL 4Z9KB 4I3SH 1TETL 4G8GE 1IL1A 5JOPE 4FZ8H 3QYCA 5HHPB 1TJHL 2AXGB 3WIHH 3F8UB 3QDGD 3B2UD 1UB5A 3DRTA 4KH2A 4ODXA 2WM0A 4X80L 1FVEA 1NEZA 4PJIB 2DF3A 1NL0H 4KRPB 4PJAA 1JNHB 1X5XA 3TA3B 5FF6A 4U3XA 1AKJB 4PJFA 2B0SL 4NBYB 1WIUA 4G6FD 3TYGH 3QUML 4NCC1 1UM6H 1S9YA 2BNUB 4GQPH 4EUPH 3OHXB 5KANI 3DX6A 4U6YA 1K85A 4DGVL 5CZKA 1NC2A 1JGEA 1TVBB 4M8QA 5DJDB 2D2OA 1NCUA 3BPCB 4ZAKB 3MLYL 2V5TA 1RUML 2MOVA 4LRIA 1VKXA 3ULUH 1CICC 2YPLE 4PJ8D 1JZ4A 1AJ7H 2CUHA 3CVHA 2CK0L 3T3PE 4GMTH 3LS5L 3FB8A 4HIJA 2MNUA 1F6AA 1JN6A 4RBPK 4YDKL 3D85A 3BP7B 4K94C 2VDPL 5D7JA 2C3WA 3MLTA 3D48R 3T0EB 3UTZA 2HH0L 5CMAA 1PLGL 3D18A 3K46A 5D1QD 2BNRB 4KVCH 4IDJH 4CBPA 4MX7A 1ADQA 4ETYA 4ZFOB 1A1MA 5JIKA 2DQJH 4Y5XC 3QNYA 1ACZA 1JWSA 1KYOJ 1QTYT 3C5ZD 1HI6A 3CUPB 4GRWH 1MRDL 4PGZA 5LQBH 3GHBL 3MOQA 4GLRI 2PYFA 1BWWA 3QEHA 3U6RB 2F54E 2R56H 2AK4B 2G2RA 4MAYD 4PIRF 4K23H 5TPWH 1SEQH 4WFFD 3MJGX 1YECL 4IRSC 3KYNB 4G5ZH 1VEMA 3GJFK 1H3XA 1RHHA 5F71A 4Z77A 1YMHB 3CFBB 1FDLL 3L5WB 1HZHH 3OGOE 5TDPB 1FO0B 1ZKAA 1QBMH 3IJHB 3QDGB 4YWGH 5D8JH 5GS3A 1OLLA 4MHHG 4HPYH 4OKVB 3NFPA 3GSOA 5EC1A 1N6QH 3BD5A 4G6FB 2BVTA 4NYLB 4Z7QE 1PSKL 3AS0A 5FGSA 3U7YH 2XOTA 2HAZA 3X17A 4J7RA 1AGCA 4PP2A 2DLFH 4PJHB 5J1AA 5HBBA 2NY4C 1UQSB 3WNLA 2AJZB 3RFZC 1S7QB 5DRNA 4YDIH 5HYEA 4LP4A 5GRYA 1A6WL 1XFPA 4OM0H 1JGDA 4AG4L 3U83A 1AI1L 3AU1B 5CKGA 1AXTL 2ZPKL 1JGUL 1NCBL 4JY6B 4PJ8B 4PJCE 5E8EA 3RWHB 1B2WH 2HT3D 4QGYA 2FIKB 4QOKE 4OGAD 2ILLA 1MCSA 3AREC 1RK1B 3O4OB 5KOMC 1J1PL 4TVPD 5J06A 1J0YA