1D6EB

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
179
Chain Sequence
b'TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPALLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
molecule tags Immune system/peptide inhibitor
source organism Homo sapiens
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
total genus 40
structure length 179
sequence length 188
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6eB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d6eB01
5ESQA 5IVNA 1J05A 4B5EA 4YK4B 1V3MA 1MIML 3WIHA 2FB4H 3LVEA 5HHMB 3MXVH 4KI5D 4PLKC 5TJWK 3UTSE 1HOCB 5T3XH 3FFCA 4NQEE 1H3TA 1RZKL 5KSBF 2M26A 4V2CB 2FX9H 3CIQA 4XTRC 1JHTA 4K9EC 3VW3H 4TNVF 2YXMA 1RJZA 4S10A 5DZLA 3UROR 1RULL 5AG8A 3UC0L 2ESVA 4YUEH 1OSZB 1INDH 2XG5A 3IDUA 3F12B 1RJLA 4YR6A 2JJTA 4P3CL 4F15B 4LHQB 3CVHB 4AQOA 1T22A 3ECBB 1KCVH 2RIKA 4A6YB 4BZ1H 2V9RA 1EPFA 3CFKB 1ES0A 4NQCA 1Q38A 2J6EH 1GHFH 3JXAA 3RBGA 1IAIH 3FO0L 1CDUA 4NNYB 3MYJB 3GJEB 4LQFH 5FO9B 1FL5B 1NCTA 2IAMA 4GJTB 3ELAT 5JDSA 4WO4C 1FN4A 1N5AA 4H5SA 4OQTL 4OF3A 1K2DA 4FNLL 1UWEH 3EJZD 3IAGC 2EYRB 1UXWA 3MJ7A 3AREB 4YXKH 3WD5H 2OJZL 3A6OA 1IC4L 1J1OL 1DBBL 1H3VA 3RZWA 1RSFA 3I9GH 1P1ZA 5EZIL 3KDMB 3TIDB 4D8PA 3BSZH 4NNYA 3M07A 3CFKA 2CDFA 1ZVSB 5DD0L 3BKYL 1NDGB 3VXTB 3LS4L 3FT4B 4M4PA 3V9FA 1AFVL 1CFSB 3F7RA 3EOBA 3LMJL 1OAKH 3LV3B 1XEDA 1LEGA 1NEZA 5GS0H 3T4AA 5KSAC 2FZ3B 3G6AB 2FL5B 3X11B 1BOGB 5IQ9A 5I73C 1AGFB 4NSKA 5DK0A 5I8CA 3L5JA 1HOCA 1MH5B 2X70B 3G5ZA 4G80A 4WHCA 5T1MB 1CLOL 1ZANH 1J05B 2VDPH 1T03L 4M5ZH 2CJUL 1BZ9A 1VGKA 3FFCE 3FN0L 4UTBH 4WUUB 3QUZB 4IS6B 1G7IA 4ZO8A 2NW3B 5KS9E 4LIQL 3D39D 1DL7H 3LEVL 3BRDA 5EZOH 3L3KB 2VMFA 3GHBH 5I9QB 4UV7L 5CWSA 1DN0A 4R7NA 3JTTB 1EERB 1JNJA 1MRDL 3L3OA 1YEEH 2I27N 4YIQB 5DRXB 1HK6A 4PRBB 3PHOA 4KTEL 3MOAL 3KXFA 3BZEB 2DIBA 1DQTA 1PY4A 2CGRL 4GSDL 4M93C 1LO3H 2X4QA 4N90E 1H8OA 4WU7B 1U8OB 5DO2C 3UZVB 4H0HB 1C16A 5IVZB 3QZWG 4IRSA 4BUHA 3F8UB 5J12C 4HJGB 3RGVB 1R0AL 4LPWA 5CWSB 2I9LA 4NNPH 4IIQC 1WGOA 3DVFA 2DLEA 2DF3A 4EN3A 1FGNH 1ZT1B 3NPZB 4TSBH 1XGPA 2B7DT 5E5UB 1I85C 2R15A 1CGWA 4X4MA 5HYQB 1HSBA 1A6UH 3ESVF 5CJXC 3ZT6A 1DANU 1AI1H 2X1PA 1A1MA 2CR6A 1HWGB 1QTYT 2HT2C 2ZNXA 2FNBA 5J11B 2V2WB 3T77A 5CLWA 4OZFH 4WTXA 2A77L 4PJBE 5CSBA 1KCLA 3FQTA 2Q7NA 5DWUL 5IBTL 2VLLB 2OJZH 5FUOL 3RVUD 2MMXA 4NO5B 4TULL 3TCLB 2GSGA 1LP9E 4IMKC 3WFDH 5DD6A 5CSGA 4Y5VB 5E8OB 2BSTA 3ZLQC 2G5BA 4XVJH 5JW4M 2AK4A 3VRJB 2BVQA 4HMCA 3RI5F 3IVKB 5LVEA 3CLEH 1WITA 3QI9B 1RUPH 4PRID 5TE7L 5C0BE 2DQGH 4XC3L 1AQKH 4F7PB 1QFWH 3SJVA 2IAMC 1X5IA 1HI6B 3DX6A 1LD9A 1G1YA 1HEZB 5IFAH 3H7LA 4F7MA 4XAKE 4KZDH 3RWGB 5A2JH 3QRFM 2YD5A 4I8DA 4YDIL 4AEIL 3GSXA 3SDDA 3GBNH 1XR8B 3NAAH 3KPOB 4JFXB 3QIBD 5TDNB 3K74B 1G9NH 4LAQL 2ZCKH 1Y18B 1TCRB 4X7CC 4K07A 4JGUA 2FL5A 5FK9A 3RUGF 1D9KD 2I25N 4A2MA 1CE1L 3MBXH 3LV3A 3MOBL 3MJ6A 1NL0L 4JFFE 4LPYA 3O8XD 2FIKA 3I6GA 2FBOJ 3TEUA 4WFEE 3K4AA 5IVXF 5D5MA 3TO4B 2VLKD 3UBXG 4NM8H 2ZOLA 2GFBB 3SO3C 3MJ8A 5CMAB 2UYLB 5D7SL 1NFDB 3HE6C 4PJ8B 4W6XB 2Q8BL 5C0ND 1RURL 2FD6H 4WUKL 4EI5B 4XCCL 4JVUA 3D3VB 4WO4A 2QQKH 2OTPA 3VWKB 3O11A 1NEZG 1U8PA 1KCSL 3ARDD 5T3XE 2GW5A 3FO2B 3UTSB 3W82A 4QWWC 1NC4A 1PD6A 5E6ID 3RVVC 2UVEA 4Z95H 3BT2H 3EYQC 1KGCE 4K3JL 4TSCH 3GSQB 4Z7VB 1U8PB 1BFVH 4JZJC 1ZA6A 5TE4L 1FNGB 1RZJH 5E03A 1JF6A 3ROLA 1RZIB 3BQUD 1SM3H 1MCBA 1FVEA 2XTJE 2D3VA 3SQBA 3BE1H 4OZ4A 2GK0B 4Q0XL 2F8XC 4MNHB 3IJHA 1NAKL 3CPLA 1OB1A 5GGVL 3EO1B 4KJWD 1EJOL 5CINL 4NUGL 4F37K 5DVNA 2E7MA 2C26A 2XY2A 4JRYB 5FYKU 1CXHA 3WS6A 1RZKC 3MRFA 2J88L 4IOFD 3OBAA 4XZUA 1HILB 3KNBA 2ADJB 4X8XA 4YXLL 3FB8B 4QHKI 2DMKA 4TRPH 4NRZB 3E6FB 3AU1B 4KY1L 3X14B 3ULVC 1S7VA 2BERA 1XGUB 2FB4L 4L8CA 4U1SB 3FQWB 2A74B 1BP3B 3V7MA 2CXGA 5C07A 3DXAE 3DX9A 1A7NH 4ODSH 3O3DA 1OAKL 1F5WA 1MEXL 1LEIA 1LD9B 2HTKD 5ELIA 4NWUH 5LXGH 1BJ1H 15C8H 4XGZB 4HH8A 2GY5A 5CGYD 2DBLH 3S35H 1UT9A 4LVHC 3KYNA 3T65A 2D7PA 5ADOH 5ADPH 5KSVA 2VDQH 4XMKL 4YEFA 2ZSVB 4XH2A 2F53B 3ARQA 4FXKB 3SGDH 3HMXL 3L3GB 1RQ5A 4QRPE 2C1OA 1PKOA 5DMGD 3B3IB 2FWOB 4JFDA 4M6ML 1EFXB 1HINH 3VD4A 1UEYA 5HDOA 4OI9A 4X80L 2NX5B 4P4KC 2D4FA 4JR9L 2O61A 3KLDA 4K7PL 1E6OH 3E3QC 4JJHA 3VFTB 5C0JB 5DJ6B 3R06A 4K3DH 4N8CL 5LAXA 3GJFH 2XZQL 4CMMB 1MELA 2V2XA 2X7LA 4I2XB 3DOSA 4D3CL 4C56A 1OPGL 5TDPA 1U58A 4XAKD 1MAMH 4QOKA 4ORGA 3G6JA 1NUNB 4R7DA 2FYYA 4EIZC 3FFDB 1JGLH 3VMNA 4PV8B 3GK8H 4FFWC 4OD2A 4HIHA 4I48B 3N9GH 3GSOA 3L9RB 2HLAB 5HYSG 4XMLH 1ACZA 1C16B 4MD5A 4K3GA 4KROD 1KOAA 5J13B 3HI5L 4WHYH 2R0LL 3MMEB 1BPVA 2EXWC 4HIEB 2BDNH 3GNML 4YDLC 4NZUL 3D48R 3HE7C 4H26A 4C83A 1ZVHA 1FG2A 4PD4K 3PXJA 2V2XB 2QKIB 2DB8A 4LPXA 3IJYA 5HJ3B 3GMOB 2Q8AH 1ZANL 3GIZL 1ITBB 2PYEB 4U6VL 3KLSA 3L3KA 2F15A 4H88H 1V7NH 3EGSA 1XGRB 1FRGH 3PWNA 4ZTOL 4IMLB 4Y2OA 1KB9K 4P57A 3TT1L 3HC4L 4PY8J 3RIFK 2Z31A 4XVSL 4ZUVA 3QDGB 4NQSA 4LLMA 4K2UH 3AMLA 4G6MH 4WFED 3KLHC 3PHQB 4LSQL 5HHQA 2NY1D 2WSKA 3G08B 4ONOA 5IR1A 2UZYB 3T3PF 3QULB 5EUKA 4YHOH 3UAJD 2WANA 4HUWA 1G7MB 3LKPB 4XP6H 3O6FA 2Z4QA 1E4WL 1PZ5B 4OZHA 5KVDL 1BJ8A 1CT8A 2AGJH 2JB5L 3MFFB 4RGNB 2VXUH 1Z3GH 3QA3A 5H37H 3F65A 3GJFA 3SDCC 1JGUL 4R4FL 5LG1A 3DTXB 3GBNL 1BGXL 2JF1A 4V2BA 3JWNC 4LDLB 3MLPA 3MRDA 3NZHL 2OQJB 1G6RA 2Z93B 3G6DL 5LJYH 3BZ4A 5BXFA 2VC2L 1AE6L 1P5UA 3QJFA 4JPVL 4TTDC 1JMXA 5C0RH 4MQXC 3IRPX 3P40A 3S36H 1BF2A 2X6MA 1II4E 1DEDA 2CQVA 3JTSB 4NC0B 3HG1D 3TCXA 3MRQB 4OGXH 1I7RB 2FATH 1DLHB 4O4YL 4WWKD 3ULUH 2XZQH 2JJVA 2VXQH 4XMPH 2GT9B 1OB1B 4HFUH 4O2FA 1W0WA 1EGJL 1MAML 5JUEL 3VU2A 4KDVA 3QDMB 1YC8A 1A4KA 5MP6H 1FIGL 4R8WH 3QI9D 4IJ3B 4E41E 3GMPA 3MO1A 3MV8A 5FHAL 4CVZB 1RURH 3GUTB 3CLEL 4XNMB 2H41A 3PWJA 4ONGH 1T66C 5C07D 4DZBA 1LE9B 1SYVA 1LK2B 4LCYB 3HHRB 4U31A 3GNMH 3L7EA 1J1PL 3LH2H 1UENA 3RKDD 2B20A 3FONB 5E2WH 4HLJA 1VKXA 1BIIB 2HVJA 3G5VA 2IWGA 3QDJB 4DAGH 1MJ8L 4L4VD 2QADB 4JO2L 1QHPA 3TBWA 6FABL 2NY4C 1TZIA 4I13B 1KEGL 4EUPH 4LCWE 3A6CH 1E28B 2B1HH 2F5AH 3VI4F 2H9GB 2IAND 1A6VH 4ZYKA 3GBLA 1C5CL 1BX2A 4GRLB 5I74C 5AYUH 4U6HA 2WWMC 4QNPE 1TJGL 2DL2A 3UP1A 1MFAL 1XZ0A 1ND0A 4KVNL 3N85H 4AEHL 2BC4A 3ESUF 5F7EH 3IETB 5INCA 3ULUC 4ZFOA 1KENH 1LK3L 3DMMB 2Q7YA 1MWAB 5LGJA 4NKIH 1FZMB 4HHAA 4LASH 3QHFL 5IFHL 3MA7B 4NFDA 4KUZL 4NZJA 4YDKL 2K1MA 4WENB 4MA1B 4AMKL 4DFHA 2Q76B 3UTSD 5DHYB 5DEFA 4HULB 5A16A 5FO8A 3DLQR 1QFUH 5D1ZC 3U2SA 2DLTA 4P99A 1KBGL 2AXJA 5BS0E 4N0UE 3GSXB 3SDDB 1EGJA 1IGFL 2A0LC 4NZTL 3LSOA 4TTGA 3VFRB 3P4OA 2V9QA 5HHOD 4K8RC 2Z31C 2OI9B 3OSKA 5T1KB 4E42B 2NXYB 4NN5B 1ZLVH 1DANT 1KLGB 5I16B 2IEPA 1UWXH 1Y6NR 3GM0A 4GW5B 1SM3L 3IU4H 4XCNB 5IB5B 2HLFC 2VZOA 1NC2A 5ISZE 3B83A 5KOVC 2R0KL 4X6EB 3O6FC 4Q9RH 2G5BB 4G6AC 1KJMB 4PGEB 4TPRL 3LZFH 4JHBA 1OW0A 3C2SA 4F9LC 5GGVY 3JWDH 4QGYA 3SDCA 4J3OC 3GSVB 2CKBA 1JMZA 2VYRE 2VLJD 3DX7A 4OLVH 4CMHC 3L5IA 4HXAH 3I02A 4S1DC 1X7QA 3FOMB 3Q6FA 3S4SB 1UXSB 3B9KA 4G9FB 5I8KH 2VN7A 3NCCB 2P8MA 2D7NA 4GMSL 2ARJB 4PYHA 4XP5L 3WXWL 2Q20A 4LSUL 4PUBL 1KJVA 1RZ7L 4GUPA 1G7LB 4U6XB 2V5SA 1CCZA 1Q9LB 1XF3B 3T04D 3SY0B 2WP3O 4XX1G 5GJSL 1QRNE 3BPLB 3B43A 3DO3A 5DQJA 3VFSA 3VFPB 3EHBD 5C09D 2FYYB 5I1IH 1OARL 4OZIA 3KXFE 4PJAF 1MCOL 1NC4D 2X9XA 5KJRL 2BDNL 1MJUH 1JGLL 2P46B 1GGTA 3CFIC 3QG7H 1N2RA 3T09A 1Z9OA 2ICWB 4FMKA 1NCBL 1A6VL 4WO4D 1EEZA 3HG1B 4UUJB 1OTSD 3MA7A 3HUJA 3KXFB 3QCVL 4NQED 1IAKB 5F6IC 3B5TA 5D96B 5E9DE 1NUGA 5DVMA 2WUCH 1ZEAH 1RUAH 4I1NB 1KJ2L 4N0YL 3TV3L 4KGLA 3CZFB 1DN0B 2WW8A 3PWUB 5BZWA 3QEGH 1FDLL 4FZEH 4ZOCA 3EYVA 5KSBE 2VAJA 1JNNH 5ALBH 1C5BH 3JWOL 5E1HB 3MJ9H 4KTDL 4K7PH 4NM8L 3SKNB 3O41B 3WXVH 4WTWA 5LQBL 3LB6D 5EU4A 3S5LB 3ZSTA 1I3RA 2NY3C 4LLWA 5EZLA 3TNMA 5E2VH 1KCUL 2KZ1B 4LCCA 1DBAL 5EPMB 1I3GL 1QRND 1HYRC 2G2RB 3BFOA 4L8CB 1Y6KR 1QSED 3V5DB 1KPRA 4FFYL 2GITB 4G8GE 2YZ1A 5J89A 3BPNC 1LK2A 4YUEL 3VXPB 4NO0D 4KMQA 5KAQG 1QR1A 3WUWB 1FG9C 4ZFFA 4XXCC 1IL1B 1C7TA 2HRPH 4ZXBC 5LGHH 1YEGL 2ICCA 1TFHA 3BHBB 2XWBB 1BAFL 2AXFB 3HB3D 1KIRB 4J4PC 5TE6H 1BGXH 3O4OC 3X12B 3MRHA 3RNQB 1CG9A 3GHEH 3IDIA 4XBPB 3RY6A 1KC5L 2YWYA 5F97E 2VLJB 2AJXL 3MROB 3O6ML 3RHWF 2EDJA 3U0WL 5KVGL 4UDTB 2VLRB 3LRGA 4XNUH 1BLNA 5HHOE 2YN5A 3U0TA 5CBEB 3DV4A 1FNAA 1EA9C 4KV5E 3T0DA 4QRQB 2W60B 5D2NE 4FQ2L 1K6QL 3QUMH 3M8OL 1AD9B 5CHNA 5FCUL 1WFOA 3WFBH 2A9NH 3BISA 5FYJD 4WI6A 3RWFA 3O11B 5I1EH 1JN6A 4JQIL 1LDSA 2BNRB 5GPRA 2P8PA 4AL8L 1V8HA 1PZ5A 2Y6SD 4AIZB 3RQ3A 4G9DB 3MFFA 4GW1A 3O6FB 1NDMA 1MJ8H 4KK6D 4R97C 1JPTH 3SKMA 3EYVB 1IM3A 4X6CB 3MRMB 3ZDZF 2ZKHL 3BDYL 1F4YH 2A1WL 1PG7H 3FJTA 1CLYH 2QHRH 2J8UE 2ZOLB 2FH8A 4XI5C 5GZNC 4KUCD 4JN2B 3EDKA 4DKEL 4PRPD 1MAJA 1QFHA 2PCPA 1IAKA 4PY8I 1KPVB 1PX3A 3MC0A 5ALBL 5MERA 4MA8H 3E8UH 3MOAH 4DEPB 1YYLH 2CSPA 2ICWA 3QCUH 1WBZB 1CK0L 4UINH 4ZSOA 1LDPL 2BVPB 3DHMA 1I85A 2YC1B 1IKFL 4APQA 2A6JB 4MJIB 5EIIB 1U3ZA 4PS4L 1A7PH 4M43H 4Z7WB 3JV6B 4IOIA 1Q9LA 1V3KA 5HDLA 2K3TA 2Y07L 3PP4L 3EOTH 4XRCA 4G42A 4ONFL 4TSBL 4XP1L 4NJ9L 1BQHG 5CGMA 5HXMA 2ICWI 4D9RD 4HUXA 4Y5YA 3S34H 2D03L 2BSRB 2ZCLL 2CIIA 4JO1H 2BSTB 2IMMA 3O8XC 1KBGH 1S7RA 5E2UL 2CLVB 3BXNA 5GZOC 2QADD 1KJ2A 1FGNL 4F80A 1W72H 3CC5A 3V4UH 1BHGA 2R0LH 3U4AA 1DQQB 3HE6D 3PWPA 3C5ZC 2DS4A 3P30L 4Y2DB 4X98B 2ATPA 1ED3A 3LRSA 4XCNA 3IGAB 4N0UA 2XN9D 3R0NA 4HKJA 1PBYA 3T0AA 2O61B 3BVNA 1G9MC 4MNGE 3UMTA 5DWUH 4NQVB 1MFBL 3WD5L 5KS9A 1IAIM 3ARDA 5ABDE 5EO1A 5KG9A 1E4XL 3T2NL 1N3NA 1BMGA 5E94B 4OV5B 1QPPA 1Q0YH 2HFGH 5ACZB 1D5IH 3BKMH 4PLOB 1EZVY 1T3FB 1W2KT 2EXYD 4KHTH 5DEFB 1QR4A 1NANH 4ZO7A 1C5DB 1G0XA 5C0CD 4XC3H 5L8LB 4Z7NF 2XNAA 4E9LA 3WBDA 1F58L 1NBYA 4FXGB 1WBXB 2WBKA 4R96B 4OF6A 1DUYB 1HIML 3BW9B 2PKDA 1BM3L 2EC8A 2DYPD 5EIQA 1BQLL 4Z8FH 3C5SA 3BUYA 3NA9H 5EOTB 3I6KB 5L0QB 2VL4A 1ZK9A 4KJWC 1QUNA 1TQCB 3TH2T 3U1SH 2ENYA 1HHHB 3IJSA 3T3ME 1T5XA 2XZZA 1G0YR 1BX2B 1FSKB 2N1KA 1DVFA 5J57B 4NRZA 2ZZUT 4YLQT 4LVOC 5GS0D 4G8GB 5GRZA 3E2HC 1NEUA 1E4JA 1B2WL 1NFDE 2DL9A 1T89A 2CJUH 2VLJA 1I1FA 4S1SL 4DCQB 3VXNA 1YEEL 5T3ZD 4NO2B 3IDIB 4QTHA 4XBPA 1G9MH 5C0FA 5DVOA 1AGFA 5GGQH 4LLQA 3GB7A 2VITB 5HGDB 4YXKL 1MPAH 1TVHB 1FVEB 4QHMB 1JNNL 4Z7WE 2HN7A 4GMSH 5DFTA 3WXWH 4OZ4B 1TDQA 4JKWA 5EOQH 3EOTL 4JFEB 1EMTL 2HFEB 4XX1E 4HWBL 1F3RB 4PG2C 2AS5M 4Y5XB 4CVZA 3GUTA 3U0PA 5EC1A 3S34L 5FKPB 3O2DA 1KTKE 5HVHB 4RX4D 5D2NA 3VXSB 3WUWG 5FDWA 5M94B 1JNLL 4J3SA 4P46C 2JCCA 3BAEL 1F97A 3MCLH 1IARB 4E0RA 5EO9A 3LN9A 25C8L 1CIDA 3CVHH 3AROA 2XQYK 4MAYC 4IDLA 1CLZH 5DJ0A 5KSAD 1YZZA 4HS3B 5E99H 5L6YL 2D0FA 2PTUA 1CDJA 5IHUH 4LHJB 1S9YB 1T03H 1KLUA 1A6UL 2I9TB 4LLDA 3D0VA 4WY7H 1Q9KA 4ZUSB 2AJSH 1HN1A 3IKCA 3ILQD 1LGVA 3RTQC 5I73B 4ZPTA 3CZFA 5JXAL 2VQ1B 3TC9A 2ZUQC 5GQBA 4YEEA 4RFOH 2XA3A 2EDKA 4OLXH 1ITCA 4PJGB 1YMMD 2NY5H 3P0GB 4ZXBA 1ZTXH 3CX5K 1LE5B 4WU5B 4M4RA 4U1GC 2DQGL 1M05B 2N56A 1XCTA 5CD5D 2HJFA 3VXRE 2CMRH 2NY7H 3LQAH 3W0WB 3KYOA 1B4JH 4IRZL 2OS7A 4KROC 3V4PL 1JV5A 2A9MH 4B50A 4F7CA 4MWFB 5IBUG 4ALAL 4JGMA 4OCLC 3L5XH 2DQEL 1OWWA 4LP5A 1K6QH 1DDHA 1PKQA 4LHUA 3BN9C 3RWCB 3G9AB 1CXFA 4CVWA 2DBLL 3MREA 1AGEA 4DGIH 3IFPA 3MUZ1 4NUJB 2ICWJ 4RMTA 1QA9A 4OD1H 1MOEA 2GTZA 5GRUL 1I1AB 1MEXH 4FQXD 4RRPA 1EO8H 3T4YA 1RJYB 5J06A 5KANI 1KTDA 4LAQH 3WEXA 2B2XH 1KPUA 3QI9A 3F6LA 4YPJA 3EIFA 2HG5A 3BESR 4W68A 3MJGX 4MCYA 4B53A 3QDME 4UOJA 3EFDH 1DR9A 5J8OA 9CGTA 3HUJE 3VXOA 5ITBH 1A6AB 4KK9C 4JN1L 1S9WA 3ZYOA 1CK0H 4UINL 1RVFL 4ESKA 2Q86B 1NGXA 3KPPA 4U0RC 5A2IH 2LU3A 3F62A 3IU3B 1I8MB 2Q3ZA 5DS8B 5E2JA 3TLRA 4RGND 4ZSOE 3QXAB 4L4JA 3BH8A 2WBJB 3CXHK 4HBCH 5FUZH 4PJEE 1KCSH 1MHCA 4EDWL 5J4MA 2DKUA 5I15H 2CRZA 2MCPL 1QQDA 5FECB 1OP5H 1NCDH 5FO7A 1M71B 3VE0A 5CZKA 3WFBL 4XCCH 4P23B 5K93A 1XH3A 5D5ME 4JPKH 2O26U 1TZHB 4BSJA 3PP4H 2IAMD 3IU3A 3SKOB 1L7TH 1J8HD 3T0EC 1I8IA 4PG9B 1VENA 2GUOB 5DA4A 3BZEA 1H3GA 4LNVA 5GSRA 4WU7A 2P8LB 2X4SA 2AXGB 5KW9H 3O8XB 4OTXL 4ZFOB 1YEHL 4MQSB 1AIFB 5GGVH 5F1NA 1XF4B 2QHRL 2ARJQ 1AP2A 2NZ9D 4XCYB 5EN2A 4EI6A 4R7NB 3MA9H 1K3IA 2YPVH 3DUSA 1FORL 2IH3A 5M7QA 2FJHB 2W9DH 3U7AA 4EZMA 3OKNA 4DK3A 4FQQB 2UUDH 4N9OB 1D5IL 4P3WA 4MZ3A 3W0WD 4HC1H 4KJYB 2Y5TA 3V7AE 3WNLA 3CDCA 1FFNA 2BMKA 5T3ZH 3QUYB 3HR5B 3HR6A 5C0AA 4GRLC 5I74B 2B4CH 3V6ZA 3QP3A 4NT6A 2D7TH 5C0BD 2AK4E 4K94C 3KNBB 4NDMB 3RBSA 2KZWA 3VWJC 1RU9H 2FZ3A 2IQAB 4KMLB 1C7SA 2ZSWB 3W39B 5C0GA 3ARDC 3HUJF 4Y4FA 5CEZE 4ODSL 4CW1B 5K9JH 1A5FL 4BH8B 1A4KB 2OR9H 5EDXA 5IJVB 2B1AH 1JWMA 1NMCB 3BYTA 1I1CA 2J2ZA 4QF1B 4GQ9L 2X4UB 1G6VK 1XR9A 1YEGH 1MFEL 4X80H 1T7XA 2X9WA 3VXRA 5T33L 2LU7A 4ZS7L 5TE6L 3SDXE 3EO0B 1FNGA 2V17H 4WEBH 3IDXH 5JOPE 2UZXB 5CBAA 5J1TC 3KLAA 1U8IA 2VKXA 2R8SL 1UB5A 5DSCA 5JOEA 1GOFA 4EQ3A 5F7DA 2VLKE 35C8L 4OF7A 4OT1L 3MLWH 1DJSA 4Y4KB 5H2BB 2IGFL 1NFIA 2GYSA 3BD4A 4J3UA 2PXYB 3KJ4B 2A0LD 4PJ9B 2O5XH 3V4VL 4J7RA 1GGBH 3OJMB 4K8RD 1CDCA 4RGMB 4S0SD 5C08B 1GH7A 1HE7A 4Y5XA 1MHEA 3ECBA 1RJLB 3QO1B 4LPCA 1RFDH 4PB9L 5HYSA 3B2UD 4P48A 1OSZA 2Y25A 4ZDHB 1QACA 4KFZC 3QPXH 4CUCA 1RZFL 4V1DB 3QULA 3D69A 3N1FC 3ARZA 2ADFH 5I1GH 3TH3T 3THMH 1RD6A 5J6GA 3T0VA 3U36B 4X6CE 4LLMB 1GXEA 5IBUB 1JRHI 1L4IA 2X4OB 1JE6A 2C3VA 2UZIL 4NOFA 5GRVL 2ZUXA 4PG2A 4AYFA 1K4CB 4FMFA 3QPQC 3BPCA 4R4ND 5IVXB 4YO0A 4K71C 4G8GD 1FBIH 1G1CA 1GGYA 4PJEA 4JDVB 2BK8A 4KI1A 4IHOB 4P46B 2R9HC 2F54D 1U3HC 5HJ3A 2F74B 2R39A 2AV1B 3ZL4L 2YEZB 1OW0C 2ADGA 1EHLH 2H8PA 5C0DB 2JKXA 2HYMA 2V7NA 1KG0A 4RWYL 4KKNA 3VH8B 3HNVL 5F9WB 4ZFGH 1IGFH 5DGQA 1I3UA 2H1PL 4LRIC 4M6AA 4WNQB 4BSWB 1CLCA 4EI5D 2OM5A 3V6BR 3DYMA 3QUMB 1A2YB 1MAKA 5ICXA 5DK3A 3OAYK 3JUYA 4I48A 1EO5A 5GGUA 1T0MB 2DQEH 1JPGA 4L29B 3TT3H 1F3DH 4L4TE 3FFDA 5HTSA 2DTSA 5B39B 3MNWB 2XZCL 4E41A 3IU4L 1DBJH 3G6JB 3F7QA 3DIFB 3EYUH 3ZZ1A 5D6DA 2NY2D 4Q97A 1R3LA 5JW3H 3SDXF 3NTCH 5KSAA 4L3CB 5HYJB 4X6CF 4OD1L 4Q58C 5C0RL 3DWTA 1N7ML 2BFVH 1NAMA 4OF8A 3SE4A 4OLZL 5F7NC 3NCJH 1SBSL 4L4TB 4O4YH 5ETUA 4P2OC 4UAOC 1KB5L 1QFWM 1K5NA 4D9QD 4YQXH 3WS3B 2V7HB 3M1BB 3CH1B 3W11C 4HFUL 4JG1L 4P5KA 4RQQA 4GBXD 5DJYB 5K9KB 2FJHA 3KS0H 4LSDA 3RWEA 3ULVH 3CCHB 1FFOB 5A3IC 4I18B 2ZSVA 1FO0H 1EX0A 4MDIA 3DUUB 1FPTL 3PGCA 2EC9U 3PV6A 1YN6A 1AKJD 2X5PA 5BV7C 3I2CH 3E2HB 2X4QB 3LAFA 4NP4L 2PUQT 3QDAA 4Z7WA 3VXMA 4ZXBD 4KJPD 3UTTB 1OARH 3FZUD 1SHMA 1VFMA 3EZ8A 4PJIF 3REVA 2R1XA 4XAWL 4GAYB 1P7KB 2NY0C 2XI9A 1NCNA 1EEYA 1TZHA 3TPUA 4P2RD 3V5KB 5EFIA 3LIZH 1JNHB 2NXYC 3NIFF 4P2RE 3IKKA 4N9GB 2VABB 5I1CH 3OXSB 5C9KA 5T1LB 3BZFB 2ZWLT 3D2UA 5HHVH 2R23B 3NIDE 1CU4L 4QCIB 5CAYB 4XXCA 3UJIL 4MJ6B 3OXRB 3MGOA 3S36L 1U8HA 1YNLL 5C9JB 3SDXB 3HNTH 1T5WB 3IXTB 4JQVA 1SJHB 4F3FA 1DBMH 1QLRA 3HNSH 1KTLB 3VFGL 3STBA 5TQ2L 3T0EA 2GQHA 5DMYA 2DDQL 4M48L 3T4AB 5JUEH 5DD5H 4NUGH 4OZFA 5E8NA 2X05A 2R29L 3F7VA 4HK0A 4KKLD 5DMKA 5D8JL 3MLSL 4KPHH 4R0LC 4R0LB 5I8EA 2D7TL 2CLZA 1F90L 4LDEB 2ZCHH 1B3JA 5I75B 1ZV5A 1HNGA 4U1KB 2PXYA 1OAZH 5FKAB 5HVGB 3RWHA 1MVFA 1B90A 4ONGL 3F5WA 1RHFA 5E00A 4DGYH 1NC4B 1EBPA 3FO1A 3ROOA 2GTZB 2FX8L 3VXUD 2ICEA 3V95A 3KLAB 3DV4B 5TGBB 4U1HA 3QFDB 5ICYB 2FR4A 2A6KA 4NKDB 1BLNB 4X9IA 4NO3B 5I30H 4XPTH 1F8TH 3MODL 4CN1A 4M7KL 2EE6A 1H3WM 3HZVA 5HYJD 3FQNA 3LEYL 3DHJA 2H3NA 2APWA 1N4XL 2EC9T 2EEBA 4NZRH 1XR9B 2X4NA 1AO7B 4YHNA 4AEEA 4NIKB 3SKUD 1P69B 4HWEH 5ESVB 5CEZL 1KFAH 3MJ8B 2NY4D 3JV4B 4M7JL 3U4EA 3WIIH 1JI1A 1EVTC 3KPRE 4Y0GA 4PJGA 4R2GC 5KVEH 1BOYA 1H0DB 3IF1B 5IB4A 1LNUB 4OFYA 5C07E 1LO3L 5JLZA 1KELL 3BPOC 4XCEA 2NXZC 3WFDL 1CDYA 3W81A 5IGXH 4YHKL 2ZOKA 3MRLB 1P84J 1L7IL 2CDEB 4Z76B 1B0WA 5GS3A 5ITFB 1PAMA 3BMVA 2OZ4L 3SDAC 1HDMA 2ORBL 3AFLA 2F54E 1N6QL 1NCWH 2BVYA 2P5WD 2ZUTA 3KPOA 3BD3A 1SEBA 1MY7A 1ETZA 2VH5H 5IROA 5C0BB 3SOBH 4HEME 4P5TC 4E0RB 3MRNA 4JQVC 4U1IB 4LEXL 3SKNA 1IGTB 2HT4C 4YC2C 2KQMA 3TN0A 1E6JL 3TYFA 1FNEA 4OBSA 4TNWK 3CK0L 5D71H 2EZ0C 5MENA 1WEJL 2H6PA 4R0LA 5I8EB 4XCYA 1CU4H 4MLIA 1IRAY 5DMKB 1SVZA 3E8UL 1FV1A 1K9TA 2WK2A 5HYFA 1TJHH 1ZSDA 1MI5B 5IEHB 1TVHA 5DUBA 3VD5A 4XHJD 3HPLB 4HWBA 1S5HA 3O9WD 1OT1A 2P42B 4QTHB 1BD2D 4OQTA 5F88A 2AEIT 1DE4A 1CR9H 1N2RB 2VRAA 4U1MB 1KCUH 4PREB 1OAZL 2VR4A 2VABA 2NYYD 4ZFGL 2EDOA 4NCC1 1M71A 4P2OA 5E6IB 3UTQB 5HY9A 1IAMA 4S1DD 2R2HA 3MRIB 5DUML 5LQBH 2A83B 1DVFB 2X4TB 1Y0LB 3RWDA 1N0XL 2E27H 3OAZH 5J11C 3KPQA 4RFEB 3I6LD 4QXGL 3S37H 1GL4B 1QSZA 1XIWB 4S1QH 4HGWA 3WCYA 3B5GA 3C5SB 5EOTA 3U6RB 3MBEC 4XXDA 1K85A 4JY6B 1J5OL 1J0YA 4LCWA 4TVPD 4JDTL 4CDGC 4P2QB 2D0HA 1FZKB 1QSFA 4LF3B 4O58H 1BREA 4UT9H 3RIAK 3LQMA 5D7LE 2GJ6B 1YQ2A 1TETL 3KHQA 5ACLA 1XF5B 5D96C 4KVCL 2YRPA 3L1OH 1C1EH 4Z0XA 4NHUB 4JY5H 3VGEA 1MFBH 4RDQG 3WNKA 1C08A 3E6HB 4Q0XH 2E9WA 1ERNA 4OCXH 1F4AA 1OTSC 3GMNB 4M1CC 2X40A 1TQBB 4X6DB 5I17A 1T1ZA 3MV7E 2QQQA 3MRJB 3CU7A 1AGCA 2XY1A 2ZUWA 3P0YL 5D1QC 1YDPB 2E5EA 5T1MA 3UTPE 4F58H 4H25B 3WIFB 4OLYL 4FP8H 1ED3B 1NCCH 4F7CB 4WFGD 1DQQA 3PWPB 1JFQH 2HRLA 1EO7A 4OZGF 2R4RH 3CDFA 3EOAB 1S7SB 4O2EA 1CD8A 3EFFA 2V6HA 1M7DB 5D5MF 5IKCA 4E41B 5L8JB 3CUPA 2A9NL 2NY3D 1XF2B 1YQVH 2G75A 4FFYH 3U30C 1S9XB 3C8HA 2BZDA 3I75B 3SDYL 1MJJB 5E24E 3S4SG 4J3XA 3IXAA 5F1SA 3IDMB 4PJFB 4YHMH 5HHNB 4K3EL 4WFHD 3NH7L 1CZ8L 5EO0B 1YMMB 4U1LA 4DN3H 1KLUB 3H42H 4WIQA 3QNXB 1W8OA 2DWEA 4PJIA 2FEEI 2WLZA 5D7JC 4PR5B 5H35B 5A2KH 1CE1H 4JAMA 1QO3A 3ZDYF 1HINL 4KRPC 2X44D 3C08H 5HHPA 4P46A 1UEMA 1AXTL 4JDVA 1RK1B 3B8SA 4ISVB 4UQ3B 3H3KA 2X42A 1XGQB 1CYGA 4OM1L 2EDBA 2VIRB 4YBQC 2O5YH 1H8SA 3AY4A 4RGNE 1I7UA 5DK2B 4XNXL 4QEGA 1F6AB 1OLZA 4QHLB 1SYVB 4LSRH 3LQAC 1I1AD 5F7EL 2A6DB 1GGUA 4QRSA 5TF0A 1IGJA 5I1EL 4JO1L 2MPAL 4IRSC 5JQ6L 5HYSB 4FQHB 4NN5C 1F02I 2VUOA 3MV9B 1UJ3A 1HHGA 4P2RB 2ZPKL 2P8PB 5IHUL 4KK9D 4K23H 3VFNB 1RULH 4Z7OF 1FO0A 1NBVL 3QG6B 3KVQA 3E3QE 5EBMB 4NZTH 5CJXA 5CIPH 4NQXB 5J6HA 1ZS8A 3WFHA 2FLBT 4HUNB 4J3TA 1QD0A 1K3ZA 1X4ZA 1ZT7B 1HHHA 1T83A 3IJSB 4KDWA 4MHHI 4MXWH 5KVEL 4HX1B 2MHAB 2RFXA 5D1XB 1OPGH 5K59F 1JPSH 1Q9OA 5D72H 1FO0B 1UM6H 1DUYA 1FRGL 4PTUA 1U3YA 1R3HA 1F3JA 4MQ7B 2LFGA 3LQZA 5C09A 5FF6B 3HNSL 5DZOA 3FL7A 1GZPA 5AD0A 5I19H 4XWGH 1CG9B 1L6ZA 4BQBA 5JHLL 1WTGT 2NW2A 4XPHL 1IILE 4BH8A 3NFPA 4OCRL 5E95B 4X0KA 4DOHE 1OAXH 2ITCA 1U8JA 5D7JA 3V6FB 1G7MA 4XT1C 1NUDA 3AXLA 4ZAKA 5ISZA 2RJMA 1VADB 5DJ2B 3EYSL 5DD1H 5HD8C 1BQLH 1N3NB 3C9NB 3QUXC 4DGYL 3CFBA 5SX4I 2IH1A 2RGSA 5A2FA 3HAEH 3LS4H 2HH0H 3MR9A 2VC2H 3N1MC 3PWNB 3MLYH 5CP7A 1QLFB 4NO0B 3MLXH 1MUJA 2O93L 5GISL 3EYUL 4PGCB 4WGVB 4R90H 1GCFA 2E7CA 3U48A 1WEJH 5KVFH 4O02H 1QBLH 1U91A 2D7OA 3HS0B 1AR1C 5FUCE 3S9DB 1KFAL 1S7RB 3VG0H 3STLB 4ELKA 1VGEH 1S7QA 7FABL 1GZQA 1ADQL 3MV8D 3MBEA 5GXBB 4JM2B 1U93A 3UJTL 2FCBA 3S35X 4PRIE 1U8MA 2P4AB 3BRFA 3D3VD 1CGVA 3AC0A 1HQ4A 3QQ3A 4QRPB 2AJVH 3CZJA 3H2WA 3RZCA 4HPYH 1RIVH 5CILL 2MPAH 1H9VA 5JQ6H 1U92A 1Z5LA 3WMSA 4GMTL 3QUKA 3CSYB 4QXUH 1FFPA 4MJIA 3R1GL 2DTMH 3TFKD 2GY7B 1OTTC 3I2CL 1X5AA 2GCYB 5JR1H 2EKSB 3BIAX 1U2HA 4F7TB 3H7BA 1CDHA 2BNRE 5HYIA 4K94H 3HCVB 5IMLB 4HSQA 2WNGA 4JO4H 3OX8A 5KSBB 3KPNA 3PNWA 4O5LL 3SGJC 4GAGL 3X3FH 4HAFA 4TSCL 2IANA 1FVCA 2ICES 5BRZE 2VB5A 2BNUB 4GXVH 3SCMB 4JN2A 3GMNA 3HE7B 1FYTE 1H8NA 3O81A 3MCKA 3N85L 3O2DL 3BGFC 3KYAA 4JFYA 1BQHB 4G6JL 4DZ8B 3LKRA 4PJ9D 1UXSA 4G9FA 4KKBD 4MXVE 1IC5L 4G6FB 5FGBA 2QSCL 4PRNB 3HC3L 3TN0C 5FHAH 4LNRA 1REIA 3GI9L 5DDHB 2KL6A 5GS0L 1YEKL 3PIQA 2B4CL 4WHDA 1RAMA 3MV7A 4OUOA 1CGYA 4YHPB 2D9CA 3BWAA 4PJDB 3RP1A 2EH7L 2J8HA 2XN9A 1EIBA 4XPBH 5F1OB 5DD1L 1XCQB 3P0YH 4GXUN 1W72B 3QIBA 3CMOH 1AD9A 5HHOB 3C6SB 2DN7A 4RFEA 2EDNA 4TRPL 1B4JL 3BGFB 4CU6A 1HH9A 4RDQF 4X7FC 3RWDB 5C1MB 3S37X 4M6OH 4EVNB 4OCNC 3K2MC 3NACL 1WT5C 1IEAB 4XP6L 3LKNB 1RUPL 5TE7H 2R2HB 3MRIA 3MV8E 3VRIB 4MNGA 4WHYG 5GRUH 3LD8B 1S7XA 3WJJC 3X13A 3MRRB 3PDOB 3G5XA 4ERSH 5KAQF 2VZ3A 1A6TA 1MHPH 3OKKB 4NHCL 4HKBA 5CZVL 2C4FT 5CEYA 4FQLH 4AJ0A 4P46D 3KYOB 4HUUB 3RZCC 2LVCA 5D2LB 2V17L 2XWBA 3BP7A 1GSMA 5TDOA 5MEQA 3QZWB 4ONHA 3OB0H 4YBLB 1ADQH 4Q6IA 1NANI 4OCXL 4YHLH 1UB6B 1ZKAA 4ZPTB 5KSUB 4PJ5A 2XXMB 4PGBA 4CL7A 3QEQE 2AABL 1SVCP 2MWCA 5DHVB 4WFFD 3RTQD 3T3PE 4YZFE 1INDL 4NKMA 4HKXA 3GSNH 5GIRA 3GMRA 5BRZD 3LQAL 5EPMA 1T7WA 4HK3J 4JRWA 3V5HA 4UOW0 2NXZB 2NY2C 3O9WA 4PRPA 2MJWA 4TVPH 1DTUA 3FO9B 3P11L 4WO4B 4HT1L 4N8PA 1ORSA 4H1LA 4R2GB 2ZJSL 4MGXA 2X4RA 2ZPKH 5IW6A 4DGIL 1UFUA 3FT2B 4PJ5B 2WIMA 3CDGA 3L7FB 3GSWB 3H0TB 4ZNCD 4Z6AT 3V52H 4RIRB 4U2YA 4HZLB 5IB4B 4MNQA 4GBXC 4EUPG 1FZOB 1JGVL 3BZDA 4J8RA 5K9QG 3QYCA 5TE4H 1YEJL 4H1LH 1KNOA 4P5MA 2BY2A 3HC3H 1NLDL 1CQKA 4NO2A 4OZHE 5EBLB 4ZPVB 5HGBA 3P77B 3K46A 1J7VR 2FRGP 4ISVA 3ZKXC 2OMBA 4ODBD 4FG6D 1NMAH 2WZPD 2MQ3A 1OTUC 2BY1A 3ARFC 5DEZA 4WWID 1BIHA 5D6DC 3SE4C 5C3TA 2CRIA 2YHGA 3G5XB 4B0MM 1UQSB 5IHZB 4MD0A 1CR9L 4J12A 1J10A 3WFEH 4Y1AA 3RWGA 2DQIH 5F9OH 3RPKA 1HHJA 2WUBL 4OFYD 4M1GH 2Z93A 4Y2DC 3EAKA 3DV6A 3TM6A 2ZG3A 3HMWH 3ARFB 4YDVA 4APQC 4NQDE 1P53A 3M17B 5F9DC 3I50H 2AJ3B 4PJDA 1OSPL 2MQ0A 4ENEC 1XCQA 3H9HB 4IDJH 1EEUA 4PJXE 1DQDH 4OB5L 5JQHC 3WN5B 4EBQL 3VXSE 1BAFH 4CAGA 3P0VH 3ABZA 5SWQB 3BWAB 3EYSH 43C9A 1ZEAL 4YHPA 1PLGH 3GSVA 4WJ5A 2W65A 1KTLA 5E08L 4Q7DA 1J5OH 3RDTA 3O0RH 3E1F1 1T2XA 3MOQA 1KJMA 4JANB 3NTCL 1MFEH 4PGEA 4OAWB 2FGWH 5BVJA 5IV2A 3SN6N 1JHLH 5FA3B 5EUKB 4ZAKC 5HHXL 4H0GA 3WL9B 3TPKA 1JYWA 5F89A 5EOCL 3VG0L 5EO1B 5MEOA 1T21B 3HE7A 4P23C 4KKLC 4ELME 3KPMA 3OGCB 4ZFZB 3U7YH 2ID5A 3P4OB 1RUML 2NZ9C 2C1PB 2QSQA 2YPLB 1RJCA 5GRYA 2AK1H 5D7KD 1CD1B 3FQRA 5F9JA 4ZUUA 1WCQA 3K7UA 1K4DB 4G7YH 5JPNA 4XCFH 3TNNB 4L8SA 4UILH 5IB3B 4L5FL 5TH2B 5CKAA 3ALWA 1HQ4B 1IGIH 3PABA 4XXDB 2EDEA 2HFFB 4QRPA 1ZWIB 4I77L 4MD5B 1CXLA 4OFDA 5D2NC 2R2BA 4JFED 4U6HB 4X7DC 2OXGA 4X6FB 3KPRB 4LRNH 4MD0B 3LIZL 1I1YB 4P5KB 1MFDL 1VPOH 2ADFL 5E1AB 2NCMA 3HNTL 4JZOB 1ORQA 4QRTA 2CUIA 5DVLA 1BZ9B 1VGKB 1WBYA 1TZIB 4YFLF 4LKXA 4ZOBA 1A4JB 4UTAH 4NFBA 2HVJB 1KACB 4FFZL 5DEGB 3VXUA 2ZP0T 1KJ2H 1JF1B 3TV3H 3L3IA 4HBQA 4HGMA 5JORA 1XGTB 2HJKB 3QXWA 4PRHB 1YEDA 2C7UB 3MRKB 4F9PC 2PXYD 1ZOXA 4JHAL 3TVMD 1P5VA 5L9DL 1MSPA 4GO6B 5F9WC 4JFDB 1X5JA 4GKNB 2DYPA 2VKWA 5HGGS 3NAAL 1G6RL 5E6ZA 3IRZA 3P2TA 4P9HL 1GGBL 1NC2D 3U82B 3AXLB 4OCSL 2VXTH 1T6VN 3TYFB 1DUZB 4G6ML 4LASL 5IFHH 3BIKA 1I75A 2VLME 3UCRA 1VB9A 1IGCH 3MTRA 4NNXA 3D85B 4LEOA 4X6BB 3RWJB 5ENWB 3O9WB 1S8DB 3L5XL 4MD4B 1D5XB 3HAEB 3ZT7A 2YEZA 2A74A 4JDZB 2DJ4A 5I30L 4K7PX 4XHJC 2MHAA 2RFXB 3VI3F 2NX5E 1JZ4A 1NGQL 3O9WC 2X1OA 4BH7B 4YPGA 4PJ7A 4PB0H 4F33B 1VFBB 2FECI 2CDEA 3WIIL 2E7LC 2JJUA 3DARA 4EN3D 5BXFB 4KAQL 1URLA 3MRLA 1YJDC 1K8DA 3VFWB 4PP1D 4ODUA 5C6PB 3CFEB 2VWEC 3VA6A 3OG4B 2ADJA 4YFDB 5BMFH 4Q9RL 1HCFX 3MRFB 4OLZH 4BQ8A 5CD3A 4KJQC 3LZFL 3ARGA 1YNTA 2NMSA 3NA4A 5IMMB 1IC5H 1WK0A 3HAEA 3U36A 3GSUB 5SWZA 4BQCA 3N1QC 3MRHB 3RNQA 3ARBD 4NN7B 1AKJA 3RI5K 2WIIB 3BHBA 1EHLL 5I0ZA 1WCBA 1UJTA 2LAAA 3BGMA 3VXMD 1HIMH 4MCZA 3BP4B 3EYFA 2OJEA 4XAWH 3MACL 4PLNC 3MNZB 2WMPA 5MHSD 4TVPE 4RMQA 3TBVB 3TO2B 1NGWB 1D3CA 2Q87A 2XFXB 3VFVB 4NP4H 2YSSB 4I0PB 3QEUA 1VA9A 4EDWH 4MX7A 3LMJH 2DI9A 4U05A 1GYAA 3V6OE 2SEBB 3P30H 1X4YA 4HT1H 4Y4KA 1VACB 1XGTA 2GJJA 4HFWA 2VIRA 1HKLH 3PDDA 4HF5L 3VG9C 2V5MA 3FMGL 3HFMH 5HHPB 3FCTA 1RZGB 2LTQC 3TNMB 4OFVA 3A6BL 3L5WA 3TT1H 4BFEA 5L8KB 4JAMB 4NWTL 3SE8H 2ZUUA 3UJIH 1KLFA 1LHZA 3VJ6A 3FQUA 1G9ML 2P7TA 3KGRA 3QJHA 4M62H 3PQYD 3FRPA 5KW9L 3QUXB 5F1IA 1I9IL 3UPRA 4DZ8A 2GAZB 4AH2B 2HT3C 3RY6C 1U95B 1E4WH 3TIEB 1S7UB 4GG8B 1YPZA 3OR6B 2QQLL 3QEGL 4QCIA 5MHSE 2EECA 5HHNA 4MXQD 3ZT5A 3I75A 2X1QA 5F9OL 3WKNA 4IRJB 3BPOB 4Z77B 1N0LA 4XPFH 4JPIA 1LEKA 2WV3A 3S96A 2VXTL 3HUJB 4L3EE 1FP5A 4CKVX 5EUOB 2IADA 3TWCH 1JNLH 3UTTD 3MLRL 4HAGA 5A43C 4M1DL 5A3ID 2DQUH 3HC0A 2PTVA 2F54A 3IFLH 1OP5K 1M4KA 1JWSB 2OL3B 4QXGH 4BFIB 2EYSB 2VERN 5DLML 3HZKB 2LAGB 1RZKH 1KCKA 3D39A 4H25A 4KGJA 4WV1B 3MRJA 5L2KD 3HLAB 3F58H 3LOWA 2FWOA 3S3JA 5KVMC 5IW1B 4HWEL 5D1ZB 2HWZL 5FXCH 3L95B 2H2PD 4PIRF 4F7PA 5JXAH 3RY4A 4JM2A 1N4XH 5I1DA 5L2JB 4LLVA 5B8CA 1ZTXL 1HKFA 5JDJA 5H37G 4JFZH 3IAQA 4U1JA 4Y5VA 4D0BA 4GXUM 3L95A 1A1OA 2A77H 4PY7A 1INQA 4DGVL 4RQQB 3SGKC 4F9LA 5E8EA 4ELMA 2AK1L 2Y7QA 3VD9A 4JM4H 2JELH 1BBDL 4WV1A 4XVSH 3C2AL 2FHBA 4XNUL 4PJ5E 4NO0A 2GTWB 1Q9WA 4AIOA 3IDXL 3MV9D 5T1KD 3OKMB 1HXYB 2A9ML 2FBJL 2AVGA 1CFQA 1U8LB 4M3KB 1FAIH 4JRYE 4Y1AB 5FHBL 2A73A 1G7QB 1LEKB 3Q3GB 4JPIB 4WDIA 1CF8L 4LCUB 2W59A 3H42L 1IC7H 1J18A 4WW2F 3BN3B 3FHQA 5F88B 2DLFH 1N5YL 1IQWH 3TIEA 2YN3A 3OWEA 2OLDA 1N6UA 1LO5A 1M6OB 2AJZA 5AD0B 5IK3B 1MCFA 4OFPA 4XNZC 3S35L 2B2XL 4OZIF 5DQ9A 1KIPB 4P5MB 4X5XA 3G9VA 5FAAA 1JHLL 2BOBB 2VDLL 3O4LE 4FQIL 2XXCB 3NGBC 3W9DA 4YNYB 2H6PB 4H8WL 2EICA 4OGAD 5C2UB 1AQDB 2D31A 1TVBB 5EOCJ 3FCTB 3S6CA 3UO1H 3GSQA 4IHOA 1H15A 1R6VA 1U42A 1NGPL 4PJXB 4PJEB 3AAZB 5FOBA 3IFNH 4HMDA 1E4XI 5C71A 3S5LG 4NQXA 3LKQA 2PTTA 5J6HB 3REWB 4P3CH 3QEQB 3SE9L 3L6FA 1A6WL 1MPAL 4YGVA 1TTUA 2NX5D 4XNXH 5FM8A 4KTDH 3C87A 3V0VA 1T20A 4D9LH 4LHUB 3QIWD 4UT6H 3T3MF 3QUZD 4M7LL 1FZJA 4HWBH 4S2SA 4YBLC 3OKDB 3FAXA 5DJ8B 4QHNA 1ZLSH 1HDMB 4U0QB 3NPSB 5EU7E 2VLMD 3SDAD 4NM4H 1NFDA 4NQTA 4ONFH 4LK4A 4XP1H 5IG7A 4S1QL 4Y88A 3FB6B 3ETBF 3OJDA 1DQLL 5E4EB 4OBRA 2HMIC 1BZ7A 2YD9A 3QXDB 4MB5A 4NKOB 5F7LB 4NZUH 5DK2A 1OM3H 3ULSA 5C0NC 3CFEA 2W9DL 1XGQA 4PJ7E 3WYRA 5JW4R 4ODUB 1DLFL 4QXTB 1T04A 2AXHA 5ESVA 1TCRA 1OAQH 1U8IB 4FQ1H 4YHNB 3Q1SL 3OB8A 4QT5B 3D18B 1A0QL 4PR5A 4RCAA 4PJBB 3SEPA 2G60H 3ZYJA 3IYLW 5E8DL 3RVVD 4F7EB 4K55A 5CJQL 5FYJL 2E7LA 3TVMB 2J88H 4U1LB 1YMMA 4OM0L 5FGCB 3V79C 1KXQE 4TNVK 3MJ9A 2BVUA 3IT8D 3K0WA 2FO1A 1R3IL 3C09B 3SDYH 1ONQB 3JVGA 1CFVL 1CIUA 1D5MB 1MQKL 1JFQL 5FKAA 3QIUC 1TVBA 2ZSWA 1UGNA 3MPCA 4K7FB 3MXWL 2DYPB 4IEFB 3SCMC 5EBWB 1Z2KA 1CT8B 1YJDL 1P4IL 2GSIB 1QNZL 1S7SA 2AV7A 2ESVB 4ZUTB 1I4FA 3GI8H 1AHWB 4FQJL 4KKBC 1FSKC 3GSRB 1GAFH 4Q9BA 5GJTL 4JQXA 5HI5D 1XT5A 3MBED 4IOFC 1I7ZB 1C1EL 3G04A 2R23A 5EBGA 5BZDA 3NZHH 5HPMB 1U8HB 4ZUVB 5DRWA 1HWHB 4FQXA 1X5KA 3MGOB 2WQRA 1V5JA 3C6LB 4X83A 4LBEA 3D2UB 3O2VH 1BFOB 3G6JE 4O02L 4WDIB 1F45A 1ZT1A 4HJJH 4QXWA 2OX5A 1Q1JH 1X5GA 1AJ7L 4S1RL 2EE3A 1MJ7H 3RNKA 2GJZA 4LVNC 2UUDK 1WTLA 4MS8C 3R4DA 1RZ8A 2HFFA 1AGDB 1AXSB 5F6HJ 1UCBL 3ARXA 5F7FA 5LCVH 2PR4L 5IMKA 4L8SB 3TNNA 1FNHA 3NGBB 2AXGA 4L3EB 2Z91B 3VXMB 1F2XK 4BZ2H 1RZ8B 3QNZA 1INQB 4DKDC 1IFHL 3QXUA 3IDNA 2E3VA 5D93B 1T1XB 5ISZD 5TQ0H 1C8PA 3C60B 2XPGB 4FABL 1KXVC 1U8MB 2QV2A 5DMGC 1NMCC 4LKCA 2Z8SA 3QDJD 1S9VB 4JFFA 1GZQB 1RIHH 1N59B 3QDJE 3VE0B 5H94A 5IW1A 4HPOH 1HXYA 1T21A 1OAQL 4W6YB 3O3AA 4BFGA 1PSKH 4OTXH 4QRRD 5I1LA 1F13A 1HHIA 35C8H 4H8WC 2CD0A 1WT5A 3V0WH 2J6EA 5F3HA 3HZMB 2H32A 2YBRA 3AVEA 3VFTA 4JRXA 2MKWA 4Z7OE 1JP5A 3WJJA 1S7WA 4QO1A 2GI7A 4W4NA 5DUPH 2Z35B 1R24B 3D9AH 5D4QA 4PY7B 43C9B 4ZUTA 4WVRA 2M8XA 2GSIA 4UNTA 4WW2A 4ZTPL 3NFSL 5IB2A 1OGAD 1WZKA 1MRCH 1WAAF 1R3IH 5ICXB 5KSVB 1NDGA 5DTFB 1H3PH 2V5TA 4IRJD 1A7RL 4WNQA 5GGSA 1A7OL 5BS0A 4QRRA 5T3ZL 1UKQA 1FAIL 5FGBC 3TIDA 4D8PB 4HIIA 3T4YB 5CEZD 2F5BH 4KUZH 2BVOA 1LO4H 4ODTL 1FC1A 3HE6B 3QNYA 5EH1A 2J4WL 4I5BA 1I8LC 3TVMA 4PGJA 1QYGH 2A6JA 1N6QH 5DLMH 1OP3K 4U1NA 5DJDA 3VA2C 2DLIA 5F8RC 1I3VA 2XKNB 3QH3A 4WV1C 5HHME 4MWFA 4IRSD 3AU1A 4Q2ZA 4OLUH 5KVFL 1OTUD 5C92A 2N7BA 4WFFE 3QFJA 2P49B 3BJ91 3ULSB 4JO3H 4PJAB 4UIMB 1AGBA 1J9CT 3QXDA 1JRHL 5IBTH 3UO1L 1B0GB 2HJLA 5HYEA 4IMKA 1OAYL 3T0BA 5CEXA 6CGTA 1IVLA 2IG2H 3OJDB 4YHLL 3SGJA 5IHLB 5T5NG 3AMKA 3B9KC 1U95A 5BMFL 3BMWA 3QQ4B 5D7IB 5C0CA 1FH5H 4APQD 1KT2A 4NRYA 1CGXA 3Q6GH 5FYLE 1HHKA 2DJSA 4GBXA 4ENED 4NN6C 1KB5B 3INUH 1TZGH 5CP3A 4OZGB 4LSUH 3I84A 4PUBH 1I8KA 1WC7A 1ZLSL 3RWFB 3DUHA 5CEXB 43CAB 5GJSH 5FM5M 4JFDE 4MA3B 4I3RL 3D25A 4UIMA 3DROA 2VQTA 4UT6L 2W0KA 4IBLT 3MACH 3EJYD 3IDGB 4O2CB 4DTGL 3SPVB 5H2BA 4AEFA 1EH9A 1IQDA 1EAJA 4P23D 2GK2A 1P7QA 4PJFE 1VFBA 5IROC 1S78D 3OB0K 1E4XH 2IBZX 5DF0A 3T2NH 1YNLH 1QO3B 2ED9A 3HI5H 3MROA 1X5YA 2QSTA 4GBXB 5EZJB 4JDTH 1KEGH 2RB8A 5DRNA 1A14H 3QI9C 2YPKA 3HE6A 3PWPD 3D9AL 4HUUA 3KWWB 3BPNB 5J9PB 3U9PH 4KROB 4CW1A 3VFUB 3TO4A 3LPFA 1DN2A 5C0GB 3KAAA 3QDHA 1T1WB 3SKJL 1FYTD 1T7YA 3MGAA 2EYTA 4XPBL 4JLRA 4YDIH 2IBGA 5DD5L 1QSFD 1UA6H 2OZ4A 4DKAA 5E5MB 2R4SL 3OKMA 3AS3A 2XRAL 3NABL 3OF6D 4YX2H 4PJ7B 4F9PA 4JKLA 2XQBL 4EQ2A 5I2IB 2G2RA 3QUYA 2R0ZL 1P7KA 3I6KA 3TWCL 1R3KA 5JIHA 5I9QC 2XN9B 3VRLF 1F11A 4TSAL 3BW9A 4OI7A 2X4PA 4YHZL 4K3JH 4BQ9A 2Y9RT 3NIGE 3CFJA 1UM4L 2VDNL 1MHHA 1ACYL 1QHOA 2HVKB 4M7ZB 3QAZB 1PW3A 2Y5TB 4FQLL 4I0KA 3PIQB 1I9JL 2BVOB 3D87B 1HI6A 2BOCB 2X1XR 3MXWH 4D0BB 2E6QA 1QP1A 3EYQD 3GSNA 3L3DB 2DMCA 3C09C 3OF6A 3UYRH 5FYJU 4JFFB 1PJ9A 2HRPL 4PRHD 1MVUA 5TF1H 1C08B 3BQUC 3E6HA 5EC2B 1BD2A 1YY8A 1JF5A 4RAHA 1I8LA 3TVMC 3WSQL 2HWZH 3B5HA 5DJYA 1YMME 4DN3L 3WS6C 2VDPL 1AJ7H 1CFNA 2VXSH 3GBML 5MI0B 4NQVA 2GUOA 1E0OB 1O0VA 4O9HL 2AAVA 3QIUB 2Y07H 1EHAA 3IGAA 1KELH 4N0UB 1NAMB 4YXLH 2CIKA 5BRZA 1I8IB 4GRWE 4NRXB 4PG9A 4PJ9C 4JM4L 1X6LA 1WBYB 2RHEA 2YXFA 3TN0D 2M1KA 4JZOA 1LP9F 2AKRA 3T8XB 2VAAA 3HC0B 1QQDB 1DSFL 4EDXA 4RA0C 5EUOA 3D5OF 4P23A 4FABH 2HLFD 4LKCB 1DEEB 2AQ1A 4G3YL 3O6FD 1LP9B 2ZUYA 5DS8A 2UWEF 1FE8H 3QXAA 1MIEL 5AZ2L 1RFDL 4AT6B 1BVZA 4TQEH 1YPZB 3OR6A 4WCYH 3LEXB 1AH1A 1S7UA 2DM7A 5ANMA 4JVWA 3ULUF 4KJQD 5DC4B 4FQJH 5JPNB 1ROWA 4LARH 4WI4A 4K2UL 4WJ5B 3U9PL 4LPTA 1YEFL 1H5BC 1Z0MA 4YZFF 3BKJL 1JK8B 1MCPL 1KPUB 4OZHF 3IDYC 2UZIH 3SKJH 2FLRT 3UDWA 3FB7A 3M17A 4P59L 3CFCL 4FFZH 3EHBC 3BPCB 3FOLA 3WFCL 1R5VB 2P5EA 4LBEB 3QCUL 5EZOL 2VXVH 2Y36L 3ARWA 2XFXA 3MA9L 4OLWH 3VMPA 1A7NL 3QXVA 1PKQB 4PGDA 3BP4A 3EYFB 4U6YA 1EHNA 5LXGL 2QEJA 4NSKB 2AEPL 4HCRL 3NIFE 2ITCB 3V6FA 5D2LE 4I4WA 4DN4H 3GK8L 1IM3B 4X6CA 3AY4C 1HHKB 2VZ1A 5DXWA 2ADIB 4LSSH 4D2NA 4DKFL 2IPTH 3P77A 1I9RH 1WIOA 3MV7D 3B9AA 3G6AA 1PLGL 4NQDB 4X5WB 4XPHH 2ZJSH 2Q7YB 2UWEE 2JB6B 4FFWD 4HS8L 3ARGB 3EDDA 3RUGE 1WIUA 4KMTH 4Y16B 4IDJL 5IBLC 3IETA 2BNQB 3QRGL 1NSNH 4PJ9A 3GKWL 4XPTL 4X99B 1NFIB 3TA3D 3D0VB 4J4PA 5JW3L 5E5RB 1OY3B 5E9DB 2QQNL 5D7LD 4ZQKA 3QUYC 4JRXD 4LLDB 1JJUA 4ZUSA 5SX5K 3STZA 3U0TB 3B4NA 4HS3A 5JTWA 4HIXH 4POUB 2YD8A 5JZ7D 3VXRB 1BJMA 1PEZA 3RWJA 2R0WH 4MHHG 1FLRL 5ICYA 3G5VB 1D5XA 3O6MH 2VSCA 1TZGL 4PJEF 4G7YL 4FG6C 5D6CB 1CTOA 1KNOB 2AXFA 3ARFD 3MLZL 4KXZH 4L5FH 2YS4A 5AYQA 4A6YA 1SMAA 1IC4H 1H3PL 3TO4C 4O58L 4UT9L 3FB5B 4I77H 4R4BB 4Q9QH 1UWXK 1QRKA 2JCCF 5E99L 4HZAA 2H2PC 5SX4H 4HF5H 3HPJA 1BD2E 1OSPH 2DWDA 2IALA 4UILL 3FT2A 4L3AA 1GVIA 1MQKH 2HJKA 1JWUB 4YDJA 5IK3A 1GOGA 4LRIA 1IBGL 3VXNB 1LO5B 2DLGA 1EO8L 4NPYB 4L4VA 4Y5YC 5C9JA 5C0FB 4F8TA 1MJUL 3N50A 1QBBA 3SDCD 5IT2H 3RWIA 1I1FB 4G8GA 3SE8L 4GW4A 5LBSH 4HUMB 1NJ9B 3QXTA 1U8NB 4P2CG 5F96H 3KPRA 1MLCA 2APVA 5KOMC 1U8LA 4RISH 1T2QH 3QCVH 2IH3B 1CFQB 3BZ4B 1I1YA 5SWSD 2OSLB 4TTDD 3ARBA 3WNPA 4ZAKD 1A14L 2OQJA 4X6FA 1AFVH 2CDGB 4UTBL 3KPSB 3L5HA 1JBJA 1RUKL 4PJFA 1KB9J 4FTVB 2BNQA 1I7TB 1CGSL 3U9UA 3IDYB 5ECJE 4JFHD 2Z92A 3QNZB 4R8WL 2Q8BH 1MCDA 4FXGA 2Z91A 2XNAB 5IFJB 5IMOA 4JRXE 2LTQB 3WIHH 3SKOA 1S5IH 2DIJA 4D0DB 5DURB 4KKAC 4DQOH 1EAPA 3QO0A 2VE6B 3UZQA 3TH4T 1G7PB 4PRIB 2YPLA 4MDIB 3HNVH 3OKKA 5C6WH 3C5JA 1CE6A 4JG0L 3CCHA 1P4BH 2BNQD 3RWEB 5CSZB 3VGGA 5B22A 4PJFF 4F2MB 3K8MA 1RK0B 3J7HA 4UV4H 3OKEA 4NNPL 3FRPG 5E2UH 1RVFH 5F72S 5I17B 1YUHB 2J8UB 2R2EB 2WM0A 4LVNB 4YXHH 3CU1A 4G8EA 4PJCF 5GGRA 4HKJB 1JGEB 4YDLB 2WAHA 5BZDB 3WL9A 3O3BA 2EYSA 1JWSA 3C5JB 1JUFB 1A3RL 1JK8A 2VDQL 3EO9L 4RAUA 4XMKH 3RVWD 1JZ5A 1G7PA 4QYOB 4N90D 5IV2B 2CGRH 4JJ5A 3PWVA 2VE6A 1KN4L 2VN4A 5DDHA 4M93B 4X4ZA 5DJZB 4L8DA 3H9YA 5CIPB 1T89C 2CIIB 4PRNA 5FYLL 3F7YB 1OP3H 5GGRY 4RAUB 3RZCB 3QDGE 4UDUA 4JG1H 1CWVA 5GRJH 3QFJE 5B8CC 2HLAA 1WICA 5B38B 1OQOA 1I1AA 3KR3L 3SDDD 2Q3AA 3SGKA 1JZ6A 1FVCB 1OL0A 4OFKA 2IPKA 5CUSL 4G7VL 1X5FA 4EDXB 2B1HL 2F5AL 3EDFA 5TFSL 5MI0C 2F5BL 1ZHLA 4RWHA 3DVGB 1NCAL 4KZDL 4F7TA 4XPGL 4PLJC 2IQ9H 3V8CA 4C58B 5CCKH 4HWZB 2KQNA 1LMKA 1N8ZB 3U7WL 4I2XE 2QR0B 4L4VB 3HZYA 4N0CD 4YHYB 4KTEH 2NX5A 4MNQE 5IMOB 2R0KH 3BKJH 1DVFC 1MNUH 5ADPL 1MFNA 1K4CA 1EXUB 1FZOA 3V0AC 4GH7B 3VGDA 4UBDD 3OPZL 4J23A 4DUVA 5IJKC 3QQ3B 3HPJB 1B6UA 1FCGA 3WSQH 3MNZA 1XZ0B 5EG6C 3MBEB 1JGVH 1PG7X 1R0AH 1D5ZA 3OJ2C 3QJHB 2NR6D 2FJFA 3SKMB 2ARWA 3QIUD 2ED7A 2Z9TA 4Z78B 4YE4L 3FO9A 3O4LD 5GRWA 1CI5A 3ARBC 3V5HB 4GMTH 4QXUL 5CHNB 3R8QA 5DUMH 2EDRA 2CPCA 2AEWA 3VXUE 1ZHBA 3BP6B 5KJRH 5FOBB 2YSSA 3QEUB 1FVDB 2DWDB 8CGTA 5C0AE 3IFLL 1H15B 4HQQL 5C0AD 3PE9A 3KXFD 3TBVA 2NTFB 1I9RL 2BSED 5CKGA 1QBLL 3FB5A 4R4BA 2VZVA 3RX7A 3K2UH 4LSTH 4JE4B 3VXQA 4YNYA 1DBKH 5IB1B 1BJ1J 4BJLA 2BVEA 3WHXB 4OKVB 3QZWA 5K33A 3BO8A 4KK5D 3OTTA 3NFPB 5D2LA 4JFZL 2NW2B 4LCWD 3BRGC 3DRQB 3DO7B 2X4UA 3UJTH 1UJ3B 1J8HB 4LL9A 5EZIH 4G5ZL 4OGZA 2AJZB 4JY5L 1NGZB 1DFBL 5ID1A 4OKVA 1VFAA 4ODXA 2B39A 4M9OA 1MCLA 1QSFE 2VWEE 1UYWH 3CX2A 1ZMYA 3CFCH 4LCUA 2P5EE 2FH6A 5I1KH 2VO5A 1AC6A 3R1GH 4QRUA 5JXEC 4LOUC 2NTFA 1CQYA 4R6UA 1HH9B 1ZT7A 5KTEH 1ADQA 4Y19D 1PQZA 3CJJA 3LKNA 2EDWA 4LHUD 3MLRH 1A6ZA 1P4IH 1MCSA 4MXQC 3RFZC 1FIGH 4M1DH 1RK1A 1RMFL 4WI7A 5ENWA 1XMWA 2XRAH 2VLKB 4HV8A 2L7UA 2NTSP 2FBJH 2JB6A 4DKFH 1A9EB 3MGTB 2FJFB 1GC1C 5J1AB 1KN2L 3GZKA 4ELMB 5H35A 4ODVL 2RR3A 1B6DA 1KV3A 4K8RL 2PW1B 1CL7L 1D5ZB 3SJVE 4Z7VF 4UV7H 1DBML 3DUSB 2OR8A 5DJXA 5GS1A 2CUHA 5EN2B 1NAMH 4JFDD 3MLXL 3G6DH 3ZL4H 3QDGA 1KC5H 4NQSB 1WIPA 6FABH 2DQTL 4KXZI 4PRAA 5KZCB 1TJIL 2D7QA 2F53E 2XOTA 3OKYA 5K59E 3RDTC 1T4KA 1JVKA 2DOCA 3EFDL 4PRHA 1XGRA 3HLAA 1JF1A 4YE4H 1Q94A 4JQXC 4NJ9H 3AS1A 4WEBL 3WLBB 1N8ZA 5AYUL 1B2WH 2VXSL 3DNKA 3EUUA 3FTGB 2CKBH 1CD1A 4U1NB 1VEMA 1OD7A 1ZLVK 4XVUC 4FQXC 3RKPA 5IOPA 1WVZA 1IZKA 3DECA 3SY0A 4GSDH 4GLRI 5B38A 1P7HL 4NM4L 3S96B 3LEXA 3MMEA 3NVQA 3NIGF 1G6RH 1KSRA 3PABB 4I9WD 2AK4B 1FGVL 4WW2B 4KK8D 5DD6B 1MREH 2RQ8A 3FT3B 1RIHL 4JKMA 1S7QB 1BBJA 2WQ8A 3OKOA 2R2CA 4LLUB 3SDCB 4QOKB 1CICC 2J5LB 2Z35A 5TDPB 1JUFA 4LF3A 5I71C 25C8H 4RGNC 1HYSC 1MCWM 1YEHH 1HSAA 3KJ6L 4JY6A 4D3CH 1HXMB 2H26A 4ORZC 5CLTA 2C1PA 3IS1X 5ICZA 3W9EB 5HDQL 1S3KH 5B21A 1U3HA 1FBIL 5DVKA 4WRLA 5MERB 5F7KC 3HG1E 1OGAE 3MRPA 4RMRA 3SQOH 2NY6C 5KTEL 5FCSH 4U6VH 2OR7A 5EORH 4X6DA 2VLRD 1JPSL 4OGAC 1S9VA 4OLVL 3WFCH 1L0QA 2F58H 5EWIH 2GJ6E 3T0ED 2YUZA 4HDIA 4EUPB 5JW5A 2FHCA 3UBXA 3KHOA 4D94A 5DHYA 5FO8B 5TFSH 5A2LH 5JHDA 4D0DA 1CDIA 3W5NA 3MRBA 2CR3A 1FNLA 3VFOA 1P2CB 2AEPH 4HCRH 1OAXL 1XCTB 4QOKE 3LQZB 1MHHB 1O7VA 4NJAH 3VCLB 2FGWL 3QIWC 1Q9OB 2EKJA 3QUZC 2XQYG 3T1WA 4G9FE 1GAFL 3GMMA 3MNVB 1NAML 4POYA 1F3JB 4ZOAA 1XIWA 2UWEB 2KUTA 4Z5RB 2GJZB 2NNAA 1PQZB 2HH0L 3RPIA 5J13C 1ZA3A 1RIUH 4UV4L 1U8NA 4J6RL 4BK4A 4MJID 4AENB 1QFPA 5BO1L 4I3SH 1IE5A 3FO0H 2APXA 2VLRA 2HMID 3DRTB 2EYTB 1D9KA 2VZUA 4X9BA 2QQKL 1A3RH 4ZNEE 3A6BH 2DIAA 4OJFH 4UB0H 5F7YC 4OUUB 4P2RA 2EO9A 2FDBP 1RPQA 1M1SA 3QHZH 4KU1A 5BVPH 1SY6A 3VFNA 3GSRA 3EJJX 3S37L 5BV7L 1FYHB 4HKXB 5GS1C 2FO4A 1Q1JL 4MNHA 1YN7A 4CVXB 2AERT 2ZOKB 3DETD 1BZQK 4XMPL 3LDBB 4MNQB 5IHBA 3TJHC 3H9SD 1UZ6F 3L7EB 3PWJB 4DZBB 1XFPA 4XCEB 3EOBB 3DYPA 1Z0NA 3VXPA 3DYOA 4Q6IB 1YYMH 2EDQA 5E4EC 1HZHH 1FNEB 4ONHB 4J3VA 2HJLB 3OKLA 3D1MC 3TN0B 1AGBB 1IT9L 2GITA 4MSWA 2VITA 4O2FB 3AM8A 1AD0A 2DJUA 2YA0A 4Q9QL 2FO4B 2QR0A 5FOJA 1UVQA 3RL1B 1QNZH 1OD9A 4UT7H 1CDGA 5DEGA 1DLHA 3RVXD 1QOKA 2YA2A 5BQ7A 5JIPA 1RZFH 3M45A 3SCMD 4UTAL 5JXEA 2OYPA 2X41A 4KKCD 4NKMB 4PJIB 4ZQKB 3UX9B 5JDSB 2OI9C 4M3JA 3DGGB 4MNGB 5F21B 1NFKA 4QXTA 4OCYH 4I5BB 1EUTA 1T5XB 2PF6A 3PWUA 4JM2C 5BZWB 1WZ1L 4Z5RA 1ZWIA 3MSPA 1N64L 1T2JA 4LFHD 3BP7B 4OFIA 3WJLA 4UI2A 3GJFB 5JW4N 3QFJB 3OAYH 4X6DF 2RCSL 1F00I 4G6FD 2G75B 1IEBB 4XC1H 3GEWB 1MF2H 2J8UF 5E2VL 5JW5B 3EOAA 5ESAA 5I19L 4M1GL 1YEIL 2FEDC 3PL6C 4JFXA 5F3HB 1BFSA 4G8EB 3JSSA 3QPQD 5HHQB 2CRYA 2R56L 4GG6E 2R2EA 4ODTH 4X8JB 1CICB 1ULVA 4EVNA 4NQCD 1U8KB 3MUJA 3FOLB 2VDOH 4WFHE 3SDAB 2VXQL 3A67L 3FB7B 4P57B 5C7XL 3BGAA 1P4BL 1INEL 3QEHB 2NY4B 4NQDD 4NYLB 4NZRL 1PZUB 2WBWB 4PJ8D 3VDAA 3W9DB 4X98A 2DM4A 1FNSL 2EKSA 2BOBA 2DQDH 4L8DB 2B1AL 4L9LA 1F4WH 4LSRL 4P9ML 2CKBB 5ID0A 2GSGB 4JJ5B 4EJ1C 3QIWA 3TZVB 4EI5C 1X5XA 4FFVD 2VLLA 4EXKA 4YQXL 1T7ZA 1QFUL 4LLAA 4NN6B 1FL6A 3LKSB 4FTVA 2VNCA 1LP9A 1AGDA 1AXSA 1EBAA 2IFGA 4AT6A 3CVIL 3S3PA 3S7GA 1V05A 4CN6A 5I8KL 5CD5C 4N9GA 3CVHL 1NGYA 1KULA 5IBLD 3NCBB 1Y0LA 1WSST 3QHTC 1XGPB 1J0HA 5IOPB 1NJ9A 4JVPA 2X7LB 4I2XA 3D0LA 3DXAB 3CH1A 4QY8A 5F7MC 1A3LL 3M1BA 4M61B 1A6WH 1R5WB 5BRZB 2Q1EA 4KQ4L 1FNFA 2MNUA 3LKSA 2XPGA 1B0RB 2GCYA 4IRSB 1FL6B 3QIUA 2AJSL 3R06B 5GGSY 4DOHB 1JYVA 4KVNH 1R3JA 5CGTA 3WJLC 4LSVH 1C12B 5EA0L 2OXHA 5LGJB 5HGHB 1BF8A 2NY0B 4K8RH 1RHHB 4HXAL 3CK0H 5D71L 3VXRD 2PYEE 2EDLA 1J88A 2AV7B 4PRAB 1ZSDB 5HGAB 3RVTD 2O5ZH 4FRWA 4G6KL 4QHUA 3FKUS 4HUVA 5ITBL 2F53A 3LN4B 2CDGA 4PJCB 1V3JA 1T0MA 5DJXB 3MV9E 2EH8L 3VH8G 1TENA 1YEJH 4GXVL 1JTTA 3GSNB 3L3DA 4XH2B 5DT1H 3QUMA 1NKRA 1V7NL 4RBPK 1JHKL 4KJPC 4JKPH 4ZYKB 2KBGA 4LAJH 1CTNA 1FJ1B 2H9GA 4LSPL 4NBXB 5D9SB 1YQVL 2BOCA 1E28A 4X8JA 2QLVB 3BOVA 5ETUB 5DMIL 4MMZC 1OF2A 3D39B 4F7EA 1G7HA 2FJGB 4PTTB 1RZJC 5F70A 2FD6L 4YX2L 4BZYA 4I0PD 3B2VH 1SEBB 1CXKA 1TNMA 4BFIA 3WXVL 1H3UA 1JYNA 3MLTA 1PYWA 1JWUA 1S7VB 3MR9B 2WUBH 2IALB 2VDNH 4BK5A 1FCCA 2IH1B 2BY0A 5KVDH 3E6FA 3QBTB 3JWDL 5I8OH 5EBWA 3JVGC 1GOHA 4L8SC 4HKZB 2Q6WB 4XNMA 2GJ6D 4JLRB 3B6SA 3BUTA 3GMPB 3IF1A 1MREL 1VFAB 4ODXB 4Y4HD 1T1YA 3BIBX 4C55A 1J8HA 5ILTH 3MUHL 4PJHA 2O5YL 1F4XL 2XKSA 3DGGA 4NN7C 1AE6H 3HMXH 3WHE0 4GRMA 1N7MH 2BFVL 1RZIA 1MCEA 5D1XA 1FZJB 4S2SB 2XWJA 1IQDB 5HSFA 3WUWA 4ETQA 5FB8A 1T20B 5IEKA 5CJ5A 1F6AA 4KKAD 3T08A 3OG6B 2C3WA 2C5DC 1EFXD 3FO1B 3QHZL 4U1HB 3BP6A 5E2WL 5FDWB 1UA6L 2AP2A 2V5YA 4O51A 4AG4L 2G5RA 4NQCB 4LU5L 2YD4A 12E8H 4R26L 2J7LA 5DJAA 2C3XA 3SGEH 3UEZA 5L2KB 4OZGA 3FO2A 4U1GB 4FQ2H 1A1NA 1HHGB 2OZ4H 1T22B 1SQ2N 2PYFB 5KANG 2XKUA 3MV9A 1RUAL 3MV7B 5IG7B 4DVRL 1F58H 4RNRB 1QLRB 3EOYG 1J1PH 1KB5A 1SJHA 4I4WB 3HI6H 3N9GL 5DQ9B 3KPLB 1W0YT 2VDKL 5DI8A 3G08A 1QVOB 1ZHNB 3DSNA 3PHQA 5AZ2H 2AJUL 5D5MB 3U1SL 3R0MA 4QTIH 5GGTH 1I7UB 4PJ7F 3LCYA 4HGKC 4JHZA 3SCMA 3W39A 1NGPH 5DFVD 3QAZC 2OL3L 4M7ZC 1JHKH 1U36A 1J1XH 3D3VE 1JPFB 4O2EB 4OIIL 3RPIB 4UUJA 4Y4KD 1P4LB 1TVDA 5SX5H 4XHQA 4OCYL 4YPGB 5C08E 2AJYH 3K4DA 4FZ8H 3WNMA 1A7QH 3EO0A 4MA8L 3MUGA 4JDZA 3TF7C 1Q9WB 2CIKB 1D5BB 2XZCH 5GGTA 1LO0L 1KJ3L 2CLRB 1A8JH 2Y72A 4X6BA 3QUKB 1UZ6E 5FUCC 5SWZD 4L9LC 5D1QA 3Q2CA 5L7XH 4HPYL 1UKSA 1VFOA 4YWGL 5FM5O 3V8OA 1FJ1A 2EZ0D 5D9SA 1O5DT 3QNYB 5BS0B 4F7MB 2NZIA 3K8LA 1BEYH 3J8F7 2GIYA 2H45A 1T0PB 4D9RE 5GISH 4N0CC 1A7RH 5GGSB 3UC0H 1NPUA 2IQAA 2LQRA 3F7YA 3MLUH 4M03A 4YXHL 4WUUE 3B2UC 2K9UA 1DQLH 3ARDB 4XPAL 4EOWH 4HS8H 2A2QT 4F15C 4U33A 2YBRB 4M5YL 4LLYB 1HHIB 4PRDB 1HXMA 1F11B 1S7WB 2H26B 2W0PA 4PGCA 5C0JA 4P9MH 2NR6C 4P3DB 4RGOL 2VISA 4HJ0C 2LE9A 4OI8A 5I1LB 4JPWH 2DM2A 5L0QC 2P43B 4RSVA 4DJMA 1MCKA 4M8QB 1CGUA 2DQFB 1EFXA 5MENE 3NBNA 1ODAA 4R4NC 5B39A 2NY6B 3OKNB 5FO7B 5HDQH 2Y1VA 5MEPB 5JHDE 2FX9L 2R9HD 5B3JE 4EN3B 5FV1L 2D4DA 1T1XA 2I9LB 5IW3A 3BDYH 3ZKQD 5EUOF 4G42B 2BXZA 3C8KB 2W07A 1AO7D 3IDNB 1FZKA 1QSFB 1KG0B 2CRMA 3PV7A 5EWIL 4AH2A 2J5LC 5C0DA 2DQCL 1UWGH 2CUMA 3DX9B 4B7LA 3QWQB 4L3EA 3QUXA 3SO3B 4PJBF 3DMMA 3GMQA 4HIJA 5KN5A 4NBZB 1GGIL 3MUGB 4KK5C 1JZ7A 4Y4FC 3E0GA 1YJDH 5CINH 1YPZE 3FN9A 2EIDA 4P2QE 3QWOA 2BJMH 5DR5L 2YMXL 5E9DD 4L4TD 2JCCE 5ALCL 4IS6A 5LBSL 5C7XH 4CJ1A 4MDJB 3NCJL 4ODHH 3MRNB 1WLHA 1ZLWH 5MEOB 3PL6A 3OL2A 4MX7B 4LOUD 1ETZB 8FABA 3C6LA 5CJQH 5FYJH 2YD2A 4LFHG 3V7AG 3TA3C 3TO2A 3TBWB 2R1YB 5D70H 5J6GB 1T83C 1BQSA 5JA9A 2YPKB 1FDLH 3KYKH 1QVOA 1ZHNA 4YDJB 5DRNB 1KT2B 1I4FB 2D03H 4NRYB 3W11D 1NDMB 5C09E 1S7TB 1EGJH 2WLYA 4K7FA 1A9EA 3MGTA 3VJ6B 1MCNA 1UCBH 5JZ7C 3SBWC 1D5MA 3ARGC 4A2LA 1AY1H 1SEQL 3AB0C 1OT2A 2EDDA 3MV8B 1PGRB 4UOW1 3SPVA 3JV4A 4XP9L 1NCDL 3K3QA 4G8IA 1P1ZB 5D6CA 1DBKL 4FOMA 4F57L 1QZ1A 3D25B 3KDMA 3FZUC 4QRUB 4KRPD 4PJAE 1RI8A 1YPZF 2E9IA 4X4YA 3RDTD 3AREA 2NY0D 3QDGD 5DJDB 2NY2B 4HJJL 4MCZB 4NKDA 3D18A 3RA7H 1T04B 3GRWL 5BQ7B 4PJCE 2NXYD 3D85A 1U41A 3ROOB 4PJHB 3X12A 4CRPA 3WNOA 3L1OL 2DLHA 4G43B 5EO0A 4C56E 1ES0B 2FHFA 1T1YB 3UTPD 1YNTB 5F93C 3VXQB 1BZ7B 2UVFA 4NKOA 3WO4C 3NCEB 4U7MA 4GKZA 5EU5B 5E8NB 2B0SL 4P2QD 4U3XA 4JKKA 1ZLUH 3SE3C 5D8JH 4AG4H 5AZEL 3ULVF 1JI2A 3C60D 4F3FB 2FX7L 2YD3A 3IXTA 2AQ2A 3A6CL 4OKDA 4Y1AD 3MV11 2HT2D 4GRWB 2KH2B 3CMOL 3CH8A 4OLYH 1PYWB 3IS0X 4ZD3H 1H5BB 3U30B 3KR3H 1NLBH 4Z7QE 1AXIB 1CVRA 4DCQA 5DQDH 2AEQH 4LLWB 3PL6B 1OCWL 4M6OL 5K9QI 2B5IC 1G7HB 2FJGA 4PTTA 1ZAGA 1TJGH 4NNXB 5CCKL 4K9EL 4LVEA 1GJIA 4OQ1A 3LEYH 3PWLA 4U1KA 4AENA 2F19H 3O0RL 3MFGB 4RFOL 3VD7A 4FS0A 3ARVA 4QHUB 4HUVB 4PPTA 3UPCA 1VSCA 4XNYH 3UPAA 5AWNL 1EMTH 1PVHA 2NY3B 4NCC2 4HIJB 5KN5B 4EKXA 1D6EA 2EE2A 4NQEB 5TDOB 3RL2A 1VESA 4WEUD 2HTLC 3GB7B 3O3EA 5HGDA 1BQUA 2I07A 4X5XB 3RTQB 3SDXA 1P2CA 3MRBB 3VFOB 1NBYB 1CFTB 4LPVA 1RUMH 3L3IB 3BQUA 5HD8D 4M61A 3I50L 3LPWA 3OR7B 4UQ2A 2JIXD 3MJ9L 3GSOB 3L9RA 5H94B 4MAYB 1YNKH 2NXZD 2R69H 3ARED 3JWOC 3PG2A 4YHIB 4PYGA