1D6EB

Crystal structure of hla-dr4 complex with peptidomimetic and seb
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
179
Chain Sequence
TRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPALLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 40
structure length 179
sequence length 188
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6eB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1d6eB01
1U8JA 3IKCA 1KTLB 2IAND 1AR2A 1J8HA 4P5TB 3BP5A 2GY7B 5EZOL 3CU7A 1AQDA 1OAZL 1WBXA 2C3VB 1PDKA 4PJAF 2P1YA 1NEZA 1NUGA 4E41A 4KJWC 5FO7B 1CDIA 3AAZA 4MA1C 3S5LG 2H9GB 5DRNA 1G7LA 5IVOA 3DMMC 4POYA 4M8QA 4DW2H 1LVEA 3SDXB 1CU4H 4OCRL 3SQBA 4WUUB 5JMRA 4IOIA 3QIUA 2XTLA 3H3PL 4MJ2A 3EUUA 4NO0B 4RGOL 3S96A 1JVKA 2Y6SC 5L8KB 1J8KA 3U0WL 1A2YB 1Z9LA 4DZ8B 5A2JH 3CFBB 3DV4A 1J1PL 5EFIA 4OI8A 1DDHB 4PJIA 4JZJA 5IKCA 2R0LL 3ZKMC 3BOVA 5CEZL 4XBGB 3SDCB 2CRZA 3EJYD 2EH8H 1VFBB 2VZ3A 4FQPA 2PW1A 2OS7A 2IQAB 2XFXA 3PIQA 4HWBL 4YGVB 4OLZH 1KCRH 1MHHA 4MB5A 8FABA 2YN5A 1N5YL 2C4FU 4U1JA 3RNKB 1YEEH 1FNEA 5CJQH 5D7SL 4P46D 2ZUXA 1C12B 1SJEB 1DN0B 1OTSC 4OM1L 4F7CB 3OF6A 4HT1H 4Q6IA 4FZ8H 4HPYH 2ERJB 2NYYD 4DQOH 2VLMD 1UZ6E 2HRPH 4RIRA 4JPKH 4S1QH 3TFKD 5HI4C 3RWCB 1DQDL 1OP3H 4IIQB 2L0DA 4KRLB 4OI9A 1RUML 2WWKT 1AI1H 2CJUH 5EU6E 2AV7B 3LKPA 4AK1A 4LSUH 3TN0D 2NY3D 1FHGA 4JVPA 1FNLA 4KUCD 5K9KA 4NM8H 4GG6F 2PUQT 4MJID 3RWFA 5GSVB 1R3LB 5D6CB 1YDPB 1FVDA 2VN4A 1NC4D 2F53A 3K4ZA 1JRHL 3CVHA 3U4AA 3FQWB 3MA9L 5FM5O 3KWWB 3HI6H 3MJ7A 3SGDI 2AJXH 4LMQI 3VXUA 3KDMB 2XN9D 1KIPB 3L5WA 4G6FD 4LRNH 5DEGA 3P11L 2IGFH 5IUSA 4OD2B 5MEPB 1U6AL 4Y8AA 1XF2B 3MLZL 3KYOA 1YZZA 3AREA 4LEXH 1A3LH 4PLKD 3KLAB 2PR4L 2NXZC 2XZQH 4JO4H 3NVQA 1I9JH 1T83A 2XWJB 3TP4A 2RCSL 1JGVH 2CDGB 5I1AA 3SE4C 1ZMYA 2Y07L 5JQ6L 4YHML 3RUGE 4CVZA 3V2AR 3V9FA 5HGAA 2C9AA 3F12A 5D71L 1ZHKB 2WIIA 4ZNEA 2Q7YA 1WT5A 5TQ0H 4CW1A 3AVEA 1WUNT 5E8EA 5D5ME 1AGFB 2YD1A 3HNSL 4NCC1 1MAJA 3EGSB 3LAFA 3JXAA 3SPVB 1EHXA 4NRXB 3GRWL 4XCFL 3BKCL 1XF3B 4XCCH 3CDCA 1XIWB 2DBLH 3P9MA 5ISZB 2R1XB 4HXBL 2VXQH 4R4BA 4PBXA 1HCVA 2Y5EA 5C09D 1D5BB 1JGUH 3PWPA 2AXFB 3FN0L 5BS0E 1XGUB 2OJEA 3IDXH 3BWAA 2AAVA 2R56H 1BD2D 1U8NA 1DUZA 3AU1B 3G6DH 5KSUB 3LY6A 3V0AC 3CSYA 1G7HB 1CR9H 3H8NA 5J6GB 3M17B 1DFBH 2WIMA 3HZYA 4WHYG 5CGTA 1QRNA 4Z78A 1MLBA 2D03H 4ELKB 1LDPL 3LEXB 1JK8A 3VXME 4MSWA 2MKWA 3NCJH 3V5HB 3OTTA 5GGSA 2R1YB 1BWWA 4BQ9A 5DFWH 1ZKAA 4LSVL 1MSPA 1MVFA 4JFHE 5DJCA 5I8OL 2IG2H 4ZFZA 2BRQA 5D1XC 1GVIA 3PNWB 2N1KA 1YQVL 3Q6FB 4FQLH 2ZG1A 4FOMA 3SE3A 4YAQA 3UTQA 2NZ9C 2CXKA 4LCIL 5DURD 1KN4L 4DZBB 4PG2A 4PRBA 4G8GD 3EYVA 3VWJD 1F6AA 5JLZB 1FL3A 4MAUL 3ULUF 1I9RH 4X7SL 4X7FC 5FB8A 4MDJB 4R90L 1HDMA 2NY4B 4MQ7A 4OLUL 1B0RA 3WL9A 4R97B 1NLDH 4OGYL 4PJHE 1KG0B 3BN9C 5I1EL 1FQ9C 3DLQR 2H2PD 1QNZL 2EC8A 5E56A 4KRNA 4WWKB 4I3RL 5HYSG 3MLRH 5GRUL 2Z0BA 4LKXB 4M5YH 2BVOB 2G5BA 3OB8A 3SDDA 3F58H 2PYEB 1AKJB 3LQAC 4FG6D 1HHKB 5I75B 3DO7B 3BGMB 3NFSH 1N7MH 1W0WB 5HDLA 1VB9A 2CO7B 3WFEH 5I1IH 1UM6H 2YA1A 3HAEH 2GUOB 5IQ7L 2GSIA 4Q74A 4FXLA 2ESVD 2CH8A 1XGQB 5D2LE 3D18A 4Y19B 5GSRB 3DX7B 3QI9A 3SE8L 3UMTA 3NZ8A 4GRWB 3OJDA 4U1KB 5DHVB 5DD5L 4XAKD 3U9PH 1PD6A 1VEMA 4L9LB 4D9LH 3ULUL 3OHXB 4AH2A 4PJXB 1OTUC 4Z77B 2OBGA 3IDGB 1V3LA 3VFWA 4L8SC 1Q9LB 4QRQB 5E94B 5FOBB 4NFBA 4HMEA 5I8EB 5J0BA 3VXTB 2R2BA 5MI0B 1LE9B 5KSAD 5BVJB 1KTLA 3QWOA 1DSFH 2ZG2A 3KJ4C 3IETB 3UDWC 1L7IL 2C3VA 2VXUL 4Y5XB 3MJ9L 1HQRB 2P5EB 4ONFL 1H8NA 1G0YR 5FO7A 1AO7E 2H9GA 4EDXA 4RRPA 5MEQB 1F6FB 4WUUA 2Z8RA 3CUPA 5LXGL 1CT8B 5TPWH 4NO0A 4NQUA 4MD0B 4P2QE 5K9JL 1U3ZA 1A2YA 5KBNC 1NFDE 3CFBA 3IXTB 5L2JB 4NIKB 2FX9L 3O6LH 1NC2D 4MXQC 4R8WL 3RI5K 2AV1B 5HHOD 4ESKA 3CH8A 1T66C 4XBGA 2DS4A 2OI9C 4LDEB 1PEZA 4TUKL 4Y16B 2OL3L 1TIUA 1VFBA 4ELMB 4HKJB 1CLCA 4KZDH 3VGFA 1HOCA 5IEKA 1U91A 4HKBA 1DLFH 1BJ8A 1S7TA 4YGVA 3MJ6A 4ZTPH 5MP6L 2YD6A 1CFVH 3WKNA 2XKUA 3NCMA 1JNNL 4JB9L 1SJEA 1DN0A 4F7CA 3QXDB 2EECA 2VB5A 1PFCA 3OMZA 4UQ2B 1NDMB 2O61A 4FFWD 2PCPB 3DJ9A 4MHHI 4HC1L 5CP3H 1AGDB 3NCFB 3RWCA 1GC1L 3QJHB 5FDWB 1GOGA 4P3DB 5CMAA 3Q3GB 4IIQA 4HF5L 2YD9A 4U6VH 3BJ91 2WW8A 2AV7A 2KPNA 1T20B 5B3NA 4WI8A 1ZLUH 2R2EB 3WDHA 4Y5YB 2DQCH 4XPAL 4HBQA 1R3LA 5D6CA 1YDPA 5HHXH 2VE6B 1MCLA 1VESA 1SYSA 4PJ7E 5FCSH 4LASL 3FQWA 1GGTA 5IGXL 3MV9D 3KWWA 2UY7A 5D6DC 5E8NA 3KDMA 3FCTB 4PJEA 5C8JB 4RGNE 1U8PA 2GQHA 1EV2E 4OD2A 1I3RB 4LIQL 4ZAKD 3KPSD 1XF2A 1IGMH 2B0SH 1PW3A 3QEQB 4ENED 1BX2B 1YN6A 4LHUB 5D7JA 2A83A 5DRZB 1YEGH 1MCJA 5J7CC 1SY6H 3EJYC 1FCGA 2G5RA 2XWJA 3A6CH 4N68A 4ZSOE 3OJ2C 2CDGA 2JK5B 3CFIC 4LNRB 5T1MA 2VZSA 4Z95L 2CDFB 1B0WA 4LGSB 5FXCH 1MCWW 3SHSA 3HE7B 1GGBH 3C2SA 3GNMH 1HSAB 4PY8J 3BI9X 1ZHKA 4XHQA 3IVKB 4DGIL 2D3VA 2J5LC 3V95A 35C8L 1WTLA 3QUZD 1A7OH 1A6WL 3SO3C 4DVRH 4MQXC 3EBAA 3LIZL 1LGVA 1NLBH 5IJVB 1AGFA 4HQQL 2F54D 2AGJL 4U05A 5TQ2L 5IFAH 3E3QC 5F9WC 1MY7A 4H26B 3SPVA 4NRXA 3TFKC 4JDVB 3CU1A 1XIWA 2CRYA 5ISZA 2VXVL 2DLGA 2R1XA 3MLSH 3OSKA 4DOHB 2F19L 1ACZA 4OUUB 1D5BA 2FX7H 2AXFA 5EN2B 1ZEAH 3N1QC 1TPXB 3TN0C 3AU1A 1AGEB 3U7WH 2NY3C 5KSUA 3JV5A 5IB5B 2P7TA 4M7LH 2VH5L 5J6GA 3M17A 1QSFB 3PWJA 1QPPA 4YDIL 3REVB 4P5MA 1IGFH 4XCNB 2ARJA 3GFUA 4OFDA 3LEXA 4P9HH 2D7PA 2ZUWA 3FOLB 1TVDA 1J0KA 5ILTL 2G60H 4EBQL 1MHCB 2XWBB 5I1HL 2FEEL 1WC7A 5BOPA 5HGBB 3ULVD 1OL0A 2YMXH 3ALWA 5GJSL 2LQRA 1LO0L 2J4WL 5J13B 3QG6B 1Z3GL 2W9DL 3VFGL 5DRWA 1FNAA 3ARBD 4YHKH 4PLKC 5CJ5A 3PNWA 4PGJA 3VFSB 4Y4FC 3RDTB 2VXSH 3PHOB 1T2JA 4OF8A 1MUJB 2YZ1A 4TVSa 2QKIB 3DGGB 4LHJB 1I7RB 3WS3B 4M8VA 5HHMD 1UVQB 5TE6H 4Y4KB 1MCBA 2Z93A 1AD0B 4Z9KB 1CXEA 1RU9L 4MDJA 3FFCD 1WFNA 3V52H 2BNRE 3S37X 4P2QD 4L4TB 4OZHF 4ZPVA 5E8DH 4X80L 1KG0A 4M7JL 4WU7B 5GS0H 2X1OA 4I5BB 1KJ3H 4S0SD 1RJZA 1F4HA 4WWKA 4JM2D 2ICES 2AEPH 1JNJA 1OAXL 5DUBA 1HIML 2RJMA 5L2KB 4LKXA 4BH8B 2BVOA 1I3UA 3K8MA 3D39D 3MTRA 3QXUA 3PGFH 2Q8BH 3BPLB 4XP1H 2PYEA 5F3HB 4EI5B 5L8JB 4Z7VF 4F7MB 2V5SA 3LEYL 3DO7A 1S5IL 3BGMA 4EN3B 1W0WA 4BUGA 2ZPKH 3MNVB 3VFMB 1GYAA 3IAQA 4XVJH 2QQQA 3LVEA 5T5NF 4P5KA 4F8QA 1XGQA 3LN9A 3CDFA 4XHJC 1BZ7B 4KKBD 4Y19A 5T3ZD 3DX7A 4O51B 1Q0YH 3QH3B 4U1KA 5DHVA 3C6LB 5I17B 2Y23A 1LDSA 3WNKA 2NTFB 2IBZY 5C0CB 4NKOB 2DN7A 3V6OC 3HC4H 4HAFA 3OHXA 4Z77A 3IDGA 4B7LA 1BMGA 2N56A 2DQHL 2UZXB 4MJ5B 2P5WB 4QRQA 2EDDA 5FOBA 3VXSD 2Z31D 4PV9B 5I8EA 4ZUSB 1GGIL 1FC1A 3VXTA 1UB5B 3HMWL 3VWJC 4W4OC 1LE9A 5BVJA 4QRTB 1MI5B 3IETA 3K80A 4I4WB 1HQRA 2P5EA 3C60D 1RZGB 2J8OA 1FFQA 2HFFA 2H2PC 3MV7E 5MEQA 3QUMH 3I50H 3PF2A 3QNZA 5F96L 1X5FA 4D3CH 1SYVB 1R6VA 3L6FB 3SOBH 4BZ2L 1CT8A 1NCBH 4BFEA 1FAKT 4FTVE 4K3JL 1TITA 3L3HB 1HHGA 3IXTA 3LEVH 3L5XL 5L2JA 3LD8B 3BZEB 4FG6C 1GCFA 5E70A 3RU8H 2AV1A 1M71B 4WRLA 1J1XH 2IPUG 4Y16A 3H2WA 3PWVB 1OSPH 1WBZB 1KC5L 3TCXA 4ELMA 4HKJA 4EXPX 1AE6L 3HUJE 4JG1H 5E2TL 3P30L 4OI7A 5HPOA 1AXTH 1N5AB 4KHTL 2X42A 4KK6D 1J1OL 3DOSA 3U9UB 4JFFD 2FSEB 4AL8H 1NCNA 2YRPA 1NDMA 5KS9E 3SKUD 1QSED 4NN7B 3OR6B 2YRLA 3VGHA 2BRRL 1AGDA 2FB4H 1P7HL 4LSRL 1G9ML 3K2UL 3MFFB 1EGJA 2J8UE 3QJHA 2Z9TA 4LAJH 5BVPH 5FDWA 4YFDB 5GS0D 3IFLL 3Q3GA 4ZFOA 4WI3A 5KSAC 2P8LB 4XC3H 5BZWB 3D5OF 2FX8H 2CRMA 1DQML 2JJUA 4OUOA 1FVEB 3GMPA 3OJMB 3VFNA 2CK2A 3VD7A 1T20A 4V2BA 4HFUH 5EUKA 2WM0A 4FQJL 1EO8L 3O8XB 1CBVL 5IMLB 2WNGA 2XTJC 2J6EH 3S88L 4YUEL 4OQTA 1MFCL 2BHZA 5SWSD 1KXVC 2K9UA 2XNAA 1A6TA 3SY0A 3FCTA 5C8JA 1P9MC 3EOYG 3NZHH 4HH8A 3MXWL 1I3RA 4NHUB 1ADQL 1NAMH 3LZFL 3QEQA 2CUMA 5HDBE 2WQ8A 5LWYH 4NP4L 4XPFH 4LHUA 5DWUH 2MJWA 4L3ED 1E28B 4XP9L 5DRZA 2I25N 1G6RB 1B6DA 2J2ZA 1EO7A 3D85B 3FN3A 3KLHD 1KB5H 4XPBL 3UTSB 4HFWA 4LNRA 1P4IH 3WIHH 4X6FB 4I0PD 2VLRB 4G8EB 3HE7A 1V7NH 1QR4A 4KRPD 5D1QB 1QUNA 3IVKA 1INQA 5JW3L 1XZ0B 5D70L 2EE9A 4HHAA 1CGYA 4FFWC 4OSUL 2HFEA 4U33A 4I77H 4JDVA 1FO0L 3MLUH 4MA3B 4OUUA 4XNUH 3NPSC 5EN2A 3IXAB 5F9JB 5DMKA 1AGEA 3BPOC 3I6GB 5K59F 3D48R 5IB5A 4C55A 4XPHH 1QSFA 1FH5L 1B2WL 2NW2B 3CPLB 3REVA 3MFGB 4XCNA 1JIBA 2MKLC 4F15C 2VLJA 3FOLA 2VERN 5CINH 1FRGL 1J18A 1MHCA 1I8KB 4LSPL 5E7BA 5HGBA 2DM2A 2W65B 2D0HA 4IM8A 2C3GA 3UDWA 5C0GB 4ODHL 4OAWB 4ZAKC 3QG6A 3IDNB 3SBWC 3TPUB 4OZ4B 4ENEC 2A6KA 2OK0L 4H0GA 1EEUA 4JM4L 3VFSA 3RDTA 2XKSA 3EFDL 3TBWB 3PHOA 2DTSA 3IFNH 4MNGB 2KH2B 3O4OC 1RUPH 2QKIA 1ZHNB 2PTUA 4RAHA 4X4YB 1I7RA 3WS3A 4KMTL 5AWNL 1D9KD 1Q72H 5CLWA 1UVQA 1RVFL 1P2CB 4PJ5D 4Y4KA 5LVEA 2QHLA 5GGTA 5B3JE 5E4IA 1AD0A 1FFOA 3CZFB 4PJEF 2DL9A 2KUTA 4NC2B 1QA9B 4MVBD 4HBCH 4L4TA 5INDA 1QBLL 4JFXB 4WU7A 4I5BA 3VCLA 4A2LA 3HG1B 3K1DA 1TNMA 5GIRB 5FOJA 1CDHA 4LLDA 3IDIB 1TJIL 1IKFH 1RZJC 1RJLB 5L2KA 1H8SA 2HLAB 3KG5A 3BQUD 3FQRA 2LV4A 5FYJE 4BH8A 1QBAA 5F70A 2AKRB 3C09C 3IDUA 5F3HA 5EORL 4TTDD 1FNSL 4F7MA 1RFDL 2ZUQC 3GMRB 2CLVB 3C08H 5JMOC 5MEOB 4EN3A 2YD2A 4XNYL 1OAQL 3ETBF 3MNVA 3U30B 5C0BD 4NSKB 5GPRA 3UBXB 4UT9H 3BESR 1NCUA 2XQYK 5AUMB 1BZ7A 4HUUB 5SWZB 4O51A 2APTA 3ULVC 3QQ4B 4RFOL 3C6LA 5I17A 4NQSB 15C8L 3Q5YA 2NTFA 4J7RA 5GJTL 4DTGH 2UZIH 5C0CA 1EUTA 3SDXE 1T7XA 3DVFA 3RIFF 3ARBC 2DQDL 2P42B 4FXKB 3WJLC 1T89C 4PY7B 4FFZH 5DYOB 4POUB 5C08D 5T3XE 4WFFD 3B9DA 3MV8A 2P5WA 4MJ5A 4NO3B 2JB5H 1W72A 4PV9A 1A7QL 4ZUSA 5FYJH 3VGAC 2D31B 3L3KB 2CMRH 4QRRE 5IW3A 4XVSL 1N0LA 2BVUA 4QRTA 1MI5A 4WTXA 3HC0B 4UDUB 4X7DC 4ZUTB 4G6KH 4CJ0A 4O2FB 1RZGA 4MCZB 2A6IB 3PWUB 3G5ZB 1MJUL 5HVHC 4BK4A 2I5YL 3B9KD 4JM2C 4OJFL 1SYVA 1DL7L 2OZ4L 3L6FA 3DV6A 3PGDB 5CUSL 4AM0B 3C8KB 3L3HA 2PF6A 4JGJA 4MB3A 3T0VA 2AK4D 3OAYK 4LAQH 2BX5A 5EUOB 2R4RH 3H6JA 5L9DL 1J0HA 1FE8L 3QDMB 5D93C 3D1MC 4CU7A 5M7QA 2H6PB 3GI9L 4LPVA 3PWVA 2HAZA 3DSNA 3ARUA 5T3XH 1KENL 1WBZA 5IT2H 3RA7H 3VFRB 3MREB 4JHZA 2CR6A 1NUNB 2UUDK 2GAZA 1GZPB 2YK1L 1N5AA 4KK9D 3BYYA 1DE4A 2XQYG 1F8TL 4YX2L 3U9UA 1JNHB 2FSEA 3O6FB 5KZCB 2ADFH 4PJ8B 3WLBB 3GK8H 1IGYB 3LN5B 4XGZB 3PV6B 1CLZH 1ULVA 2Z31C 4WIQA 2NY6D 3MFFA 3L3DA 1NCTA 2X40A 4PYGA 3CXDL 4WHYH 4JZNB 2DLFH 2P8LA 5DEFB 5BZWA 2NY5H 1FVEA 2WSKA 4WI5A 3KPPB 2R69L 3T8XB 3HPLB 3AB0B 3Q6GH 3WFBL 3C60C 4M62H 4G8IA 1VERA 4KKNA 5EWIL 1X4XA 3O8XA 4Y4FA 5IMLA 3LOWA 4JY6B 3ZHLA 4Q0XL 3OKOB 3U4EB 4LLVB 1XR8B 2DI9A 4OBRA 2BDNH 1KELH 2E27H 3LS4L 3U1SH 2P43B 3J8F7 1K5NB 5HYJD 1IAMA 4YE4L 1E28A 4NC1E 3QAZB 2IBBA 4PB9H 4V1DB 1G6RA 3D85A 3TH4T 3QDJB 4XMPL 1M7IB 4HIJB 1L6XA 4RAVB 1JWSB 1YY8B 3DX6B 3FAXA 5DVLA 4X6FA 2J8HA 5T5NG 5E08H 2VLRA 3ZTJG 5IHZB 2ORBL 3UJIH 2M8XA 1Z0MA 1G7PB 4F37K 3U82B 5D1QA 3O9WC 3KYKH 5LGJB 1XZ0A 4OFVA 1HHJB 5F71A 4PLNC 5FYJD 2Y72A 3VW3L 1S8DB 5HHQB 3E6FB 1J12A 4NQXB 4ZOCA 3MUY1 1MCHA 4KXZH 5SWQB 4OGAD 3X13B 4U1GC 5GS0C 5J11C 4MA3A 1RULL 4LPWA 1JTOA 1UCBL 4D0BB 2HJKB 1RUAH 3IXAA 5F9JA 3MLVL 5F3BB 3VMNA 5F44A 4FQQB 5ICZB 3I6GA 2A73B 1S9WB 5KVFH 3V6OA 2E6PA 1YMMB 1RZFH 3WXVH 1U8QA 3QEUB 5ACZA 1RIHH 1PY4A 2NW2A 3CPLA 3AY4C 3MGTB 3RPKA 3CAFA 4IRJD 1B6UA 2EIZB 4U6XA 1X5ZA 1YN7A 2HKFL 4MA7H 3L3OB 1KPVB 5D1ZD 4JO1H 2DM7A 5JIKA 5C0GA 4OAWA 2N7AA 3O2DL 4C56E 3IDNA 3A0OA 4G6ML 4QKXB 4OZ4A 3RKPA 1I9IL 5DHXB 3VWKB 1A4KB 1OW0A 2BOCB 1UKQA 3P4MB 2CD0A 3TBWA 1OGAB 4MNQD 3KLHC 5IBLC 4MNGA 4QRPB 4E42B 1VACB 3MUGB 2MCPL 3FFDB 1RZIB 5CD3B 1ZHNA 4S1RL 3AGVA 2K7QA 5DLML 1W2KT 5HHNB 4D9QD 2V9TA 5FA4B 4U1NB 4HS8L 4FQCH 2WUBL 4Z7OF 4KRPC 5AZ2L 4EOWH 3CZFA 2Q3ZA 4UQ3A 4KK8D 1TJGL 4Z0BH 4F7EB 4HEPG 1QA9A 5HYEA 5E5UB 4JFXA 1AQKH 2BSSB 2DIAA 5IVXE 5GIRA 3VRIB 2CPCA 4R7NB 3NIDE 1RJLA 4WTWA 5IB3B 4DKEL 2VDOL 1JFQL 2HLAA 1F3DJ 1N64L 2BNQD 5CSGA 3QIWB 5AYUL 3R06B 4PJXE 3H42L 4JFDE 2W1NA 3SKJL 1GHFL 5FHAL 3DNKA 4JRXE 3WNMA 5MEOA 2VOTA 5I8CA 1SJHB 2LTQC 5DHYB 4PRIE 4OD1H 2X70B 3RVXD 1MWAH 1UWGL 1LEKA 1S5HB 4HW6A 1FSKC 2E9WA 5D7LD 5AUMA 4HUUA 5FA3B 4D0DB 32C2A 5SWZA 4NM4H 1JYVA 4ODTH 3ARDB 3CXHK 1UQSB 4CMHB 2ZNXA 4YC2B 1QLFB 1J5OH 1F97A 3NFPB 3V4PH 4EVNB 4YR6B 2QADB 1KBGL 3TT1H 4O9HH 1IT9L 2EYRB 25C8H 4FXKA 3F65A 4HUNB 4JFZL 4PY7A 5DYOA 2ZKHL 4F58H 5A2FA 5CEZE 4PFEA 4NO3A 1E6OL 4LVEA 8CGTA 3RZWA 3H9ZA 2IALB 5ACMA 4Z0XA 4GKZB 2VTFA 1D9KC 4OZGF 4RMVA 4M4RA 5DT1H 1WFOA 4QWWD 3BD5A 3HC0A 2CKBL 4N0YH 4OCMC 4UDUA 4ZUTA 3RGVD 4NUGH 1TCMA 5EZOH 4O2FA 3M1BB 4MCZA 1OAZH 4UOW1 5IQ9A 3B2VL 1YNKH 3PWUA 1MLCB 3G5ZA 1K85A 1H5BC 2X89A 5I9QC 4R96A 3WIIH 5JHLL 4PJAE 4WW2B 4QXUL 1P7KB 4PJFB 3IU4L 3PGDA 1LK2B 5JNYB 3C8KA 1NPUA 2E9BA 3T0EB 3W9EB 2CUHA 4RFEA 1AD9B 1UWXK 3P2TA 3K2MC 2QR0B 4M6MH 3QDMA 2H6PA 5IW6B 4M93B 3RIAK 2DDQL 4PD4K 1SBSL 1WCBB 3QJFB 2JELH 4NN5B 1A1OA 3FTGB 4JVUA 4Y5VB 3VFRA 4HJGA 1HI6B 3MREA 4FZEL 5TE7L 1A7NH 1UFUA 5CD5C 2VIRB 4K3EH 3RIFK 3W9DB 1GZPA 1M7DB 1N5YH 4PJ9B 43C9A 1ZVYA 5JHDD 4LCCC 4JFEE 1JNHA 4GMTL 4ZS7H 3O6FA 3CLFL 5CLTA 4OM1H 3CXHJ 4PJ8A 4N5ED 3QFJD 4KROB 3WLBA 4WO4D 1IGYA 3LN5A 4XGZA 3PV6A 3MZTA 2AJVH 1P7QD 4X6DA 3VFUB 4NNPL 2N4IA 4JZNA 3T2PA 1CLYH 3KLDA 5DEFA 3ROLB 4NGHL 4G43A 4P4KD 3EOTH 1YECL 3KPPA 4PREB 3T8XA 3BH8A 3HPLA 1JYXA 4FA8A 4O4YL 4P9MH 3CMOL 4PJGF 1LP9B 3B9KC 2D7NA 4NQCB 1R5IB 3QRGL 4JY6A 3T3MF 4IMKA 5DMGD 2M2DA 4LSTL 4XPTL 2YUWA 5MENE 3OKOA 1ZAGA 3U4EA 1IAOA 4LLVA 1JF1B 4JHAL 3MA9H 1XR8A 3C8HA 4X99B 4FP8L 4GG6E 1T21A 4HCRL 4YK4C 3QSKB 1ZVHA 5EO0B 3QEHB 4UT6L 4PYHA 5FGSA 1JTPA 4G9FB 3P11H 1D5XB 4H8WH 4PY8I 1RIUH 5I1CL 3HA0A 2Z92B 4V1DA 4DOHE 1QRKA 2A6JA 1MIEH 1FBIL 3QDJA 1M7IA 2AXJA 4U1SB 4HIJA 5EC1A 4NQTA 1CDUA 1JWSA 1YY8A 3DX6A 4QOKD 5GHWH 5IB2B 2RCSH 4M61B 5HGDA 5IHZA 5F7HA 5IM7B 3UTTB 4PD4J 3N85L 1QFWM 2Y07H 5AEAA 3VA2C 4HWNA 3OX8B 1DBKH 4KK9C 4EEEA 5HDQL 2P4AB 1HHJA 5CSBA 3MJ8B 1VEOA 4KVCL 4LSQL 3C5JA 1SMOA 5JW5A 1RQ5A 1S8DA 3E6FA 5D2NB 5E9DD 1F5WA 4YEEA 3SGKC 2QSCH 4WI9A 2C1OA 3BP7B 1Z9MA 3E8UH 4O00A 3VGEA 3ZTNH 5CBEB 5SWQA 5DC9B 1Q9OA 4AT6B 1U8KB 3HNSH 5IROC 2NY6C 1FFNB 3HS0B 3BPNC 1A4JB 2O5YH 4PRID 1VGKB 4QGTA 5D96B 1HSBB 4L3AA 4D0BA 4JCMA 2HJKA 3LB6D 1G1YA 5SX5H 5F3BA 3FN0H 1H3XA 4FQQA 5ICZA 3VJ6B 3VXRB 1YMMA 1FYHB 2GJ6E 2X9YA 3C5SB 3EO0B 3QEUA 4P23B 2WWMC 4KUCF 2NXZB 4OFYA 1NGQL 1DCLA 1JRHI 3MGTA 5I8KL 1WZ1L 4Q9RL 3GJFH 1OPGH 1B90A 1J11A 4DN4L 3L3OA 4QYOB 4RNRB 1ZXQA 1KPVA 5IEHB 4UV7L 4RGMB 5IMOA 4YHYC 3BT2L 1CFSB 3VWKA 2XT1B 3ZKSD 2BVEA 1A4KA 5I8OH 2XWTB 4N0RA 3P4MA 3IJHB 1OGAA 1JNLL 2OTUB 3TWCH 4QRPA 1VACA 2AK1L 1CGSL 3MUGA 4NWUL 3RVUD 1FZMB 4Z7WF 3LN4B 5HHNA 3KXFD 1OARL 4LCIH 5FA4A 4U1NA 4XPGL 1KN4H 2YPLA 1BPVA 2EDEA 4F7EA 1F4WH 1G1CA 3HB3D 2E6JA 3W0WE 1GOHA 3D0LB 4W6WB 4R90H 4OLUH 2BSSA 1N0XL 2XKNB 3ULUE 2E7LC 1JUFB 5E99H 3ULSB 3VRIA 4OGAC 1QNZH 5IB3A 4TUOB 1OWRM 4X6EB 3C9NB 3R8QA 4ONOA 1SMAA 5GRUH 3SJVD 1GPOH 1MNUL 3QIWA 5D8JL 5JQHC 3IFPA 4JAMB 3R06A 4K3DL 1ZT7A 2NNAB 3D9AL 5I16A 3N50A 3UX9B 1JN6B 1TVBB 4S10A 4JGMA 1SJHA 4OCNC 1WEJL 2F8VA 5DHYA 3TA3B 2X70A 1S5HA 3BKYH 5I1JH 4IRJC 5IQ7H 1M7XA 3I84A 1IEAB 1W8OA 2VR5A 4D0DA 1R3HB 2FIKB 5C0FB 4WJ5B 4UTAH 3FB7B 5HHPB 3ARDA 3LDBC 3BPCB 4LDLB 4LHQB 4I0CC 5D1ZC 3SE8H 3H9SD 1JMXA 5FGBA 1UQSA 1AXSB 1QLFA 3MOBL 5BV7C 3NFPA 4EVNA 4YR6A 3D2UA 1RUQL 4L4VE 2AERT 2EYRA 3MRIB 5ELIA 2AJSL 5GRJL 3ULUH 3O11B 1INDL 4XC1L 4FQXD 1QBML 3NIFE 3D0VA 4S0TD 2VR9A 2IALA 4GKZA 4DKAA 3U79A 3WN5B 1CE6A 4WVRA 2D7MA 4ZOBA 1EDQA 1NJ9B 5DEZA 4KK8C 5MEND 3B5HA 2PO6B 4P2RD 1YNLH 2OYPA 3P0YH 3M1BA 4OB5L 4XMLL 1YEFH 2VZUA 1MLCA 3I6KB 3MPCA 4ONFH 1AP2B 3K1KC 4IHOB 4QRSB 3VFVB 1OVZA 4DW2L 5EBWA 5E4EB 4WW2A 5LGHL 2VWEE 3V0VA 4PJFA 5K33A 1LK2A 5JNYA 3BZ4B 4B5EA 4DEPC 5LXGH 1HE7A 1SEQH 3T0EA 1AD9A 3L3IB 1BECA 4MJ4A 2QR0A 2ICWB 1UEMA 2OX5A 4X6CA 5HI5D 5A2KH 5AAWA 5IW6A 2VAAB 3D3VD 2IADB 4M5ZH 1WCBA 3RVXC 4WTZA 1CD0A 3FTGA 4TUKH 4Y5VA 3QDGB 2OL3H 4FFYH 4KPHL 3WIFB 5CBAA 4J3TA 2L4OA 4OLZL 1R3KB 2VIRA 1MQKL 4QHLA 3W9DA 1GRWA 3GSNL 1YEEL 1M7DA 1NFIB 4U6YB 4PJ9A 5CJ8A 1MF2H 4Y4HB 1JNNH 5FGCB 1WJ3A 4HT1L 4FZ8L 4LIQE 4BJLA 3MA7B 3DX9A 4HSQA 4K55A 4V2CB 2NX5B 2HRPL 3M8OH 4BSWB 4QCIB 1FGVH 3VFUA 1OF2A 4U7KA 3NABL 1D6EB 4IEFB 1AI1L 2CJUL 5EO9B 3ROLA 2GFBB 4HF5H 2DBJA 2HVKB 4PREA 3P0VH 1FYTB 4UIKL 2AJUL 1AC6A 3UTSE 4HIIB 4NM8L 5E2VH 4LKCB 1LP9A 4NQCA 3GIVB 3QFDB 4N9OB 1A02N 5CJOH 5E8PA 5GGQL 4X8JB 3HI6L 2AJXL 1JF1A 2EH7L 4X99A 5JW4N 2A0LD 3Q2CA 2CIIB 1CF8L 2QEJA 4NDMB 5EO0A 5CIPH 4G9FA 1D5XA 2NMSA 3MRMB 1QHPA 2R0KL 3BP4B 2XACC 4LEXL 1A3LL 1Q8MA 5LCVH 4EUPG 3B4NA 4KQ4H 1G9NH 4JO4L 1I9JL 3NMEA 3MCLH 4EIZC 4M1CD 1JGVL 3BD3A 4U1SA 3G08B 5DQDH 5DS8A 5IB2A 4IJ3C 3VI4F 4M61A 5DVKA 5IM7A 3UTTA 4Z7NF 3WS6A 4Z95H 5TF0A 4UOJA 3OX8A 1PBYA 5TQ0L 4N0UB 2DYPA 1QSZA 1AXIB 3MJ8A 4DGIH 3LKOB 3MR9B 35C8H 2FJFB 1E4XH 1SJVA 5D2NA 4M7LT 4N5EC 3BP7A 4M6AA 4WO4C 4N90E 5JA8B 2AGJH 3TC9A 5FM8A 4AT6A 1LK3H 1U8KA 5TQ2H 4XCCL 4W70A 2BY1A 2ZOKB 3HS0A 3NH7L 3PQYD 2VXQL 3UROR 1VGKA 1V8HA 1HSBA 1JGUL 2VXVH 4K9EH 1TTUA 2F19H 3QIBD 2Q86B 4CRPA 2R56L 2DF3A 3VJ6A 1IC1A 3TZVA 3VXRA 2C7UB 3OKEB 1HWHB 1CR9L 1CGUA 1DFBL 3EO0A 4P23A 2O5ZH 2MCG1 3RHWF 5DMGC 2D03L 4YDIH 3L7EB 4ETQA 4C59B 4OZIB 4X6DF 1NL0L 2EE3A 1JGEB 4QYOA 4RNRA 5I1HH 1KJ2B 2HTLD 5IEHA 3HG1E 4P46B 5F88B 2GCYA 1LO0H 2J4WH 3BUYB 1CFSA 1Z3GH 3VFGH 3IJHA 4NQDB 2BHUA 2OTUA 4XAWL 4Z8FH 4BYHA 4MWFB 1FZMA 4J4PA 3LN4A 3PV7A 1CVRA 3CFJB 1XCQA 1I9RL 3JWOC 1TJHL 3DVNB 4GO6B 3D0LA 1HWGB 1RU9H 1S7WB 1DVFB 2XKNA 1FG9C 4X80H 3ULSA 2E3VA 4G5ZH 2EDNA 2MMXA 1JF6A 3C9NA 4X6EA 4OZHE 1HIMH 4OTXL 4N8CL 2XN9B 4APQD 3LB6C 4JAMA 2X4UB 2NNAA 3SQOL 3E2HB 1JN6A 4PJBB 4D8PB 1TVBA 3NFSL 5I1IL 3WFEL 4C4KO 2D9QB 4R4ND 3TA3A 4YFLF 4BQBA 3RY4A 5TDNB 4Z7VE 4HPOH 2CIKB 4HV8B 4TSBH 1IEAA 5F6IB 2FEEI 1R3HA 2FIKA 2H26B 2P46B 3G6JB 3FB7A 3QUYB 5C0FA 4FABH 5HHPA 3BPCA 3WNPA 2DD8L 1AXSA 3ULVF 1HXMB 1ZSDB 5B8CC 4D9LL 3GMNB 3MRIA 4XP5L 1CQYA 4N8PA 3TO2B 3ARPA 2RAMA 1J0IA 2DQGH 3O11A 2F74B 5IVNA 7CGTA 5I74B 2BOBB 5BW7C 3RVUC 5FO9A 1AHWB 4H25B 3WN5A 3DXAE 1DSFL 1NJ9A 2IPTH 2PO6A 1RZJL 3HB3C 5IMKB 1BD2B 5GRWA 3I6KA 4PRPE 1XGTB 1AP2A 4IHOA 5DC4B 4QRSA 3VFVA 3AUVA 3JVGA 4JM2F 5TPWL 4JQXA 5F96H 2YUZA 5LBSH 3BZ4A 3GI8L 1ZGLM 1G0XA 4K3JH 3JWDH 1BGXH 1YJDH 3H7BB 3O6LL 3TH2T 1J8HD 2ICWA 4TQEH 3KPRE 3NGBC 1CFBA 4U7SA 1QKZL 2VAAA 2IADA 2W60B 4E41D 2MPAL 3ULVL 4JZOA 4O02H 2WP3O 4YHLL 4NOBA 3UJTH 4JJHA 3VG9C 4F9LC 1KCLA 3VA6A 3QDGA 2D0GA 3FO2B 3WIFA 4ODUB 1Q94A 2J88L 4LVOC 1DLFL 1KC5H 1MCWM 1KCVL 4LLWB 4YHOH 1U3HB 1R3KA 5DURB 3S37L 3QIUD 2UUDH 1FORL 1A6AB 3UBXI 4PB0H 5E2TH 3P30H 1NFIA 4U6YA 4FNLH 3B3IB 4LCWE 1HHIB 4Y4HA 4KHTH 5F97E 1VHPA 3AFLA 5DQ9B 1EHAA 3MA7A 3WHXB 3U4BL 3FB6B 5DVMA 5BRZE 2NX5A 2PYFB 4FQXC 4G9DB 1A6ZB 5GISL 4QCIA 1C8PA 4H88H 5KVGH 4TSAL 4LSRH 4CNIB 4OT1L 4R26L 5FAAA 1NGZB 1G9MH 3K2UH 3T0BA 3LKQB 1D6EA 3IFLH 1T5XA 5EBLB 5T1LA 3JZ7A 1FYTA 4YO0A 4XZUA 3ZYOA 1DQMH 3T65A 3D6GA 4HIIA 2DQCL 4GH7B 3OF6D 4LKCA 4MAYB 4U2YA 4NKQB 1S9KC 3GIVA 2X44D 3MLPA 5T33L 1EO8H 2JJTC 3PE9A 4X8JA 2LABA 3BSZL 4YUEH 2F58L 4ODWA 2EO9A 2P49B 2CIIA 1A0QL 1IGJB 1P4LB 3MMEB 4NDMA 1T1ZB 5FYJU 1I1FB 2X4RB 1L6ZA 4LFHD 2YXFA 1MQ8A 1IGML 2B0SL 2QQKL 3MRMA 3MXWH 5FKPB 5J8OA 3BP4A 2WK2A 3GSVB 1Y18B 4MS8D 1ADQH 4PV8B 3LZFH 5T3ZL 2MFNA 1CLOH 5EU6B 4NP4H 5IB1B 4KTEL 3NCYS 2F53D 4JDZB 2C1PB 2ZCLH 3O81A 4PRAB 3QB7C 1GGBL 3GNML 4CAGA 3VXUD 5C86A 3O4LE 4JRYE 5K9QG 2O5XH 3JWNC 3V7AG 4DVRL 1ZK9A 3LKOA 5JW3H 1TDQA 2FJFA 1F4YL 5D70H 4X6CF 4H1LA 3ARED 3T2OA 4WFGD 3HN3A 5IFAL 3MRJB 1KLGB 3RVTD 1L0XA 1PJ9A 4H5SA 4JE4B 1YPZA 1I8IB 2Q20A 2ZOKA 4G8FB 2Q3AA 2VJXA 1V3JA 1FO0H 4BK5A 2FX7L 2YD5A 4IDLA 3U7WL 5JPNB 3RUGB 1E4JA 2R29H 4OZFB 4YXLL 1J05B 3LRHA 1ERNA 3FRPA 3PP3H 1MAMH 1DUYA 1UXSA 1J0JA 1IGFL 4OCWH 4M7ZC 2VDRL 5E2UL 1N59B 3L7EA 5D5MB 3KS0H 3QULA 4OZIA 2A0LC 5MERA 1JGEA 3VDAA 1EX0A 1KJ2A 1HHHB 5C0AE 3PWPD 3GMMB 1F6LL 4YHKL 1TQBB 4ODHH 3ZSTA 4NQDA 1WWAX 4M1CC 4M7KL 1QRND 3EFDH 4MWFA 5FECB 3CFJA 4PRNB 3TNNB 3UXFA 3L5HA 4KI5D 2VUOA 5TE6L 4A6YA 2HN7B 1A3QA 3DVNA 1LEGB 1F45A 3V52L 5E2WH 1JZ7A 1S7UB 5E8DL 3UPRA 1RUKH 3QXAB 3VXMB 5GS0L 1L7TL 3MC0A 1WAAA 1DVFA 3GSOA 1QBLH 4MXVF 4U31A 2DIBA 3S34L 2UWEF 4NHCH 1TJIH 1IKNA 3HZMB 3RKDC 3WJJA 5C6WH 5JW4Q 1QFWH 1HYSD 3OZ9L 3PGFL 2Q8BL 4XP1L 3QIBC 3AM8C 2BVQB 2AI0L 1FLRH 4PJBA 1FNSH 2E7CA 5M95B 4TPRL 1F90L 2APBA 2JTDA 4GRMB 1OAQH 4QHUB 4XVJL 2DKSA 2X4SB 2RBLA 3GKZA 5TDNA 4K7PX 3GDBA 4LCWD 5FO8B 4M3JA 4HV8A 3SCMB 3L3JB 5F1SA 2H26A 3G6JA 3QUYA 3MRFB 4MGXA 1Q0YL 1ZLSH 3SDDD 4RFOH 1FNHA 2XRAH 1ZSDA 4WFHE 3QUZB 4LGRB 2C3XA 3GMNA 3MLWH 3HC4L 3TO2A 1U42A 2DQDH 4FQ2L 2F74A 1L0YA 1JPFB 2EDTA 2BOBA 1VFAB 5JDJA 2AJ3B 1AHWA 1T4KB 3QISA 1TMCB 2NXYB 3NCCB 3QI9D 1QHOA 1VDGA 2X6MA 4ZO7A 4L3CB 2JJWA 5IMKA 4YIQB 2YWZA 3R1GH 5ESQA 5BO1L 1EMTL 1XGTA 4WNQB 3DI2B 2B1HH 4HIXH 5C70A 1KIRB 1MCEA 1MJUH 2I5YH 4OCYL 1U36A 3SOBL 1J10A 4HS3B 4OJFH 2OZ4H 2D0FA 3LEVL 4APQC 1X5IA 4GLRI 1WF5A 1TQCB 3CSGA 4NCDA 5B39B 3TVMB 3U7YL 3CGTA 4PIRF 5DA4A 2Q7NA 4I13B 5K9OB 5L9DH 1J1XL 1FE8H 5I73C 4R4NC 3GI9H 4JKKA 2B5IB 3MGOB 1OSPL 4NQEE 5TF1H 1JCKA 4ODUA 1KENH 4NFDA 3BEVB 2F5BL 4LLWA 4WUUD 1U3HA 2OTWA 4NBYB 4PGCB 3TNMB 4NO0D 4J3UA 1JZ2A 1AO7B 3VD5A 2ZUTA 3ZE1F 2OQJB 3DSFH 5DJ0B 3K46A 4WV1C 3HAEG 3B3IA 4QY8B 2YK1H 1HHIA 4DGYL 1E4KA 4AL8L 2X2YA 1MIML 2C4XA 4P2QB 2VZVA 1F8TH 5DTFB 4NO5B 3FB6A 1BJMA 3RTQA 2YN3A 4G9DA 2FB4L 1A6ZA 4S2SB 4Y88A 5MHSE 3W5MA 2QBWA 5BVPL 4Q9CA 1NGZA 4BFGA 3LKQA 1QG3A 3MLXH 4XC3L 3D39B 1ZS8A 5EBLA 1AIFB 4OCSH 4GKNB 4POZD 2YZ8A 3UO1L 2YEZB 4Y2DB 3IF1B 2R69H 5E6IB 5IOPB 4MAYA 3LQZB 1ZLUK 1MJ7H 3D69B 2E9JA 4HJJL 5GXBB 1NUFA 5CJXA 4Q0XH 3HPJB 3UAJD 1RZ8B 3T1FB 3QUXC 4JFYB 5F6HJ 5JPMB 1EAJA 1ZLWH 4EXKA 1IGJA 3NZHL 1P4LA 3MMEA 1T1ZA 4HAGA 5B21A 2APXA 4LLUB 5FKPA 1FFPA 3V5DB 5DWUL 1Y18A 1DBAL 2QQNH 4PV8A 3TBTB 5EU6A 5E1HB 5IB1A 4YE4H 3I9GH 4JDZA 3WIHL 2C1PA 3ZE0E 1QTYT 3LV3B 3MRPB 1V7NL 3BDXA 3QIUC 5D9SB 3DUHA 1LEIA 4PJ7B 1Q1JL 2WWKO 3BIAX 3F7PC 3GMOB 2ADIB 5C3LD 4MQSB 4CVWA 1EJ6A 3VW3H 4RGNB 5BMFL 1KLGA 5D7JD 4GRWH 3RWIB 1GL4B 1I8IA 3MLUL 4LVHC 4G8FA 4JFQB 4MYWB 3PUCA 5DJ2A 4K3HA 2VQ1B 1BF2A 1I3GH 5EIVA 5ERWB 4ZSOB 4N8VB 1DBML 3RL2A 1EFQA 1UCBH 5BJTA 3O41B 4XH2B 4E9LA 5JPNA 4XB8A 3RUGA 5GGVL 3WO4B 4OZFA 1J05A 4YHIB 4Q6IC 4GXUN 1DTUA 3MRCA 4X9FA 2K7PA 3KYNB 3MQIA 1N59A 3MV11 5D5MA 5CINL 3FHAA 5HJ3A 3T2NL 5KVEH 1FCCA 1P1ZB 3S3JA 1XIWD 1X5KA 5ISZD 1QLRB 4QHMB 4UMGA 2B39A 5HY9A 2HKFH 1HHHA 3L9RA 2CSPA 4GBXD 4MZ2A 4MS8C 3O2DH 1A1MB 3HZVB 3IDYB 4K94H 2EDLA 3VE0B 5BS0A 1RUPL 3VDBA 4GAJH 5FECA 3ZT7A 3ROOB 3WUWB 1H15B 5SV3A 1MH5B 4YHPB 3TNNA 1Q72L 2BNUA 3EDFA 2KDGA 5DRXB 4HUWB 2JIXB 2HN7A 4PJDF 4HS8H 3MOQA 1LEGA 2FO1A 5H37H 1CICB 5AZ2H 2QHRH 5KOVC 3QXAA 3VXMA 3P4NB 3QO0B 3AREC 4Z7OE 4MQTB 1S7QB 2V2XB 1S3KL 4LLMB 1IKFL 3RVTC 1T83C 2X09A 1L9NA 2XXCB 4TNWF 1RD6A 4DKEH 4B41A 3O3AB 1KOAA 2NY0B 2BVQA 1B4RA 1ZA6B 1BOGA 5AYUH 1U92B 2ZP0T 2GHWB 4HK3J 4DAGH 1WT5C 3H42H 4L4JA 4OCLC 1G9EA 2FD6H 1HN1A 2NY4D 2BSRB 1K8DA 4GRMA 4L3EB 4UT9L 3VXOA 1YJDC 4WWKD 5I15L 1UWGH 4HXAH 3SCMA 2X5PA 2BNRB 3L3JA 4L29B 1TZIB 5C0DB 4I0PB 4PJHA 3CCHB 1YPZF 3MRFA 3W81A 4CADB 4NC0B 1GIGL 3B2UD 2PYED 5HBBA 3QXWA 5D7KE 2UZIL 2DRUA 5C0JA 4I3GA 1IM3B 2LU4A 3JUYA 4YXHL 2W0LA 3U36B 5I71B 1U95B 2VLKE 1X9QA 4FFZL 1IT9H 1RMFH 3EO9L 4NZRL 5EU3A 4JFZH 5E1AB 2JB5L 4XTRD 3TV3L 1VFAA 4Q6YA 3ARFB 3QDHA 2AJ3A 3BRFA 4G6JL 1E6OH 1T4KA 1MRCL 2CMRL 4KI5C 4PRHE 5TDPA 5FUCE 4Y19D 3G5VB 3QUMB 4L3CA 1UACL 1OAUH 1CFQB 3EYUL 4L5FL 2EDYA 2CKBH 4YIQA 5D2LA 4OZGE 3OKNB 4LPYA 1XF5B 2R8SL 1KIRA 3B2VH 4KC3B 1ROWA 2CKNA 4HS3A 2BC4B 3SE3C 3LQAH 2FYYA 4EUPH 3IJYA 5CJBA 4QXUH 5FGCE 1HYSC 4PG2C 4NKDB 4IMLB 2OXHA 3ZKXC 5B39A 3WFZA 2CDEB 2R4RL 3TVMA 5IP4A 3O6ML 3SGEI 4Y1AE 5K9OA 2P5ED 3S35X 3AMKA 3WCYA 3S7GA 4HUVB 1FNFA 2BSTB 5IT2L 2LVEA 3MO1B 5BV7L 4LLQB 4QXTB 3TNMA 1IL1A 2EDXA 4LRIA 4PGCA 3RAJH 3TEUA 4YDLC 1AO7A 5TE7H 3MV7B 2OQJA 4PJ5B 5DJ0A 3D87B 3SDDC 4QGYA 4Z18A 2BFVL 1MEXH 3ARGB 2RQ8A 3RZCB 3FN9A 3MRGB 4P2QA 3DBXB 4N1EA 2ADFL 5DTFA 1NANI 1NFDA 1AR1C 4NO5A 5HI3D 3CLFH 1KNOB 4ZPTB 4Y16D 4S2SA 4R7DB 3RNQB 5IIEA 4LQ1A 3BQUB 3NN8B 2O93L 4WWID 4JPIA 4NNPH 2NY5L 5F9AC 2P44B 1XR9B 1AIFA 5EOCL 2NW3A 4NGHH 1LD9B 4GKNA 2JE8A 4M62L 4Y2DA 1YECH 4OIIH 5EG6C 3HUJB 5E6IA 4BH7B 3RWDB 3LQZA 5C0BB 4F9PA 1AY1H 3CMOH 1D3CA 3D69A 1T03L 2FGWH 5CP7A 5GGTH 2IANE 5KSBF 1NAMB 4N0UE 3HPJA 4XPTH 4KJYB 2Z35B 1RZ8A 3T1FA 2ZUVA 4JFYA 5TDOB 5BQ7A 5KS9B 2BDNL 4PJGE 3RP1A 5JPMA 5HHVH 2JJSC 1SY6A 2E27L 3MRBB 3T3ME 1NCCH 1KB5B 3I02A 2J8UB 4LLUA 3WE6B 3IS0X 1JP5A 3V5DA 2GTZA 4PB9L 4JFOB 3TBTA 2F9BT 5I1CH 4MNHB 3LKSA 5E08L 4KKAD 1FBIH 1TLKA 2NZ9D 5FM5M 3LV3A 3MRPA 3UJIL 5D9SA 4PJ7A 3KYKL 1C5DB 3GMOA 2ADIA 3QNXB 5IHLB 5HDQH 4K07A 3QEQD 2I07B 1XCTB 1P6AB 4LHUD 1CTOA 3SDCC 5C6PB 1N26A 3DVIA 2NTSP 3HMXA 2BXZA 3DIFA 4GMSL 4JFQA 2DLIA 2VQ1A 1FZKB 4OF0A 2ZJSL 5D7IF 1LO3H 3HE7D 5ESAB 3MOAL 5ERWA 4N8VA 4ZSOA 3QHZH 3O41A 4XH2A 1R3JA 4JHWH 4POZC 3E3QE 4KJQD 2GJJA 3CLEL 1W72H 5CCKL 3WXVL 5LAXB 1RIHL 3BAEL 2ERJC 2A77L 2IH1B 4KTDH 4M9OA 1BFVH 3I6LD 1NGQH 1A1NB 1WZ1H 3ZL4L 4Q9RH 1P1ZA 3G6AB 3UAJC 5ADPH 4GJTB 4MA7L 1QLRA 4QHMA 2Y06L 4IIQC 5ALCH 4OF3A 4MJIE 4OGXL 4JG0L 5DD3H 3DGCR 3N1FC 4KI1A 5HVWA 1A22B 5ESVB 4WI4A 2OP4L 3S5LB 1OT2A 3MCKB 4O2CB 3BT2H 1NMCB 1A1MA 1GXEA 3ZHDA 2FNBA 3VE0A 3GZKA 5I1LA 2XN9E 1LMKA 3WUWA 4FQIH 1H15A 2NY2B 4LLYB 4QTIL 1MH5A 2BERA 2VLJD 4NWUH 2H32B 2EKSB 5JORB 4FQCL 1AC0A 5DRXA 2DQIH 4HUWA 1HH6B 2JIXA 4EOWL 4Z0BL 5E0QA 4XRCA 5C1MB 1BQHB 5DD1H 1CICA 1V3MA 3WNNA 4Z7WE 1AQKL 1MCNA 2P24B 3P4NA 1SQ2N 3QO0A 3IAGC 3NCEB 3GSXB 1S7QA 5D7JC 5J9PB 4LLMA 3RDTD 3NFNA 3QA3B 4R4FH 2BCKB 3RWGB 3OPZL 3O3AA 1UH3A 1LO5B 4NPYB 4Y4KD 1ZA6A 5FEBA 5FKAB 1MNUH 2BSED 4ZO8A 2BSRA 2RB8A 5DD0H 4M6OH 4JVWA 4GQ9L 4L4TD 4P99A 4OD1L 4AEHH 3GGWB 3MNZB 1MWAL 1T66D 5C09E 2AABL 2BNRA 2XZAL 3EDEA 2ATKB 5C0DA 3CH1B 5JOEA 5L2KD 1BD2E 1M6OB 1XIWC 4CADA 4NUJB 3DUUB 4DJMA 4N5UA 2EKJA 2NCMA 3R0MA 5F89B 4Q7DA 1J5OL 3V4PL 1EH9A 4JLRB 4JR9L 1IM3A 1SM3L 25C8L 1KXTB 3U36A 1U95A 1RUQH 4EN3D 4KJPC 4F58L 3OAUH 3JWOL 1UYWL 2AXGB 2AJSH 5D72H 5E1AA 3V7AE 1CD1A 4XC1H 1INDH 3ARFA 1QBMH 3CX5K 3LPWA 3TIEA 1SBBA 3QUXA 2VL4A 4NZTH 2DOCA 3G5VA 1NCAL 3QUMA 4N0YL 1CXKA 4NUGL 4ODSH 2PXYB 1YNKL 5C0CD 5DJAB 3OKNA 4TNWK 1G7IB 3HRZA 1XF5A 4X5XA 4OB5H 1QO3A 4XMLH 4G8GE 4LVNB 3QBTB 4N1HB 3WIIL 4WDIB 3ESVF 3MV8D 2P5WD 3RBGA 1BVLB 5LGHH 1BJ1H 2VDKH 4NKDA 4IMLA 3ES6B 4AG4L 1HQ4B 4NKIL 3O3UN 2FZ3B 5L88L 3RBSA 3TLRA 3BD4A 1I85A 2CDEA 1MI5D 4M6ML 1U8OB 2CO6B 2JKXA 1E6JH 2NY4C 4QRRB 3EAKA 1Q9KB 1BQHG 1QP1A 4R97C 4X5WB 2JELL 4HUVA 2BSTA 3MRNA 4MNQB 4WWKC 3MO1A 4Z6AT 3GKWH 4LLQA 2OM5A 1A7NL 4MZ3A 4KPHH 4K3EL 3QDAA 3MV7A 3T09A 2HG5A 1MQKH 3B2UC 1DJSA 3GSNH 4MA8H 3NTCL 5DK3A 2CXGA 3ARGA 3TGXA 3RZCA 1HNGA 4FTVA 4ZS7L 4UUJB 5I75C 4L8DB 1U0QA 2ESVE 3JTSA 3DBXA 3QQ9C 4HS6B 4MQXD 4QTHB 3U48A 3JV0A 3B9AA 1FZOB 4NRZB 4H20H 1KNOA 4ZPTA 2GTWB 4R7DA 2AJVL 1T0MB 4XTRC 1NMBH 4XAKE 3L1OL 3NN8A 1CLYL 3A6BL 4KV5F 3LKRB 4PJHF 5C71A 3NABH 2ZUUA 3EOTL 1XR9A 3PL6B 3CX5J 2J6EA 4AJ0A 2FJHB 1A9EB 4P9ML 3HUJA 4UIKH 4BH7A 4L9LC 4YGAB 3RWDA 2AJUH 4Q58C 1JYWA 5F7EH 3REWB 1R5WB 1UG9A 5F93C 1NAMA 1X5AA 4EDWL 2LAGB 4KJYA 2GSGB 2Z35A 5GGQH 3V8CA 5TDOA 5KS9A 5MI0C 3TJEH 2XA8L 2B2XH 2EH7H 3MRBA 4RAUB 1EA9C 1CF8H 1KB5A 1AGCB 4WW1B 1E4WL 4H8WL 2J8UA 2XTJE 4M02A 1RIUL 3WE6A 4WUKH 3FO0L 2R0KH 4JFOA 1MIEL 5D2LF 5HYSB 2VSDA 3O8XD 4Y4FD 1DZBA 4HX1A 4H1LG 5EH1A 4DWHA 5GHWL 1IC7L 5IV2B 3RFZC 3Q5TA 2FR4B 3JBG7 4K94C 5HHOE 1DBKL 4GKSB 4Z5RB 1C5DA 1UM4L 5ETUB 3I2CL 3RGVB 2R9HD 3U46B 3VI4E 3QNXA 4G42A 1RSFA 4X0KB 1T04B 1Z9SA 4Z7NE 2I07A 3NA9L 2QSCL 4PG9B 3ZTNL 3E8UL 1I7ZB 5HI3C 4AYFA 4Y16C 2R0WL 3D85D 4U49A 1J9CT 3NCBB 1KLFA 3NA4A 2O5YL 3S4SG 2VLRD 3NH7H 1FZKA 3OGCB 5ESAA 5D1QD 5CS7A 3INUH 4TVPD 1LE5B 1QFUL 5JUEH 3O2VL 2ZCHL 5LAXA 4J3SA 1CG9B 4JO3H 2GK2A 1UADC 3EO1B 1NFDF 2IH1A 4JQIL 3QXVA 2WBWB 1OPGL 1KFAL 3GB7A 4RBPH 1A1NA 3V79C 2I60L 1JBJA 1XF4B 4MCYB 3G6AA 3SE9L 4XHJD 3NOIA 2J7LA 3UEZA 3CDGB 2X9WA 1NL0H 1UCTA 5F7KC 5ESVA 4CMMB 3S5LA 3MCKA 3FT4B 4O2CA 3MV9E 4Y5YC 5T1KB 3TWCL 3V4VL 1RHHB 5IB4A 1KYOK 1TETL 3L95A 4KKAC 4XAWH 4LLYA 1P7QB 2C4FT 2H32A 2EKSA 3KPSE 5I76A 5JORA 3VD4A 5E5MB 3FRUB 3MYZA 2WLZA 4K23L 4JO2H 1CXLA 1F4WL 3BKMH 4P4KB 3DURB 1KGCE 3EDKA 1QEWA 1TJHH 1DQQB 3GBLA 6CGTA 1BEYH 3THMH 3FQTB 1JZ4A 3GSXA 5E99L 4KKLD 2ZSVB 5J9PA 1I7UA 4C57C 1IM9B 3BGAA 3QA3A 4C56B 1IAIH 1GPOL 1V7MH 1RZKC 3KPMB 3MXVH 3HE7C 4YHZL 4OTXH 4N8CH 4JJ5B 3L7FB 2C26A 2F54E 5FKAA 1JV5A 1DN2A 4KJQC 3SQOH 5EBGA 5F1KC 4Z7UF 3MNZA 1IGIH 3BKYL 5I1JL 3TESA 1T1WA 4PJCF 1IEHA 5A3ID 2Y36L 2ATKA 3PGCA 3BIKB 1M05B 4GOSA 4UTAL 1HILB 1M6OA 1R0AL 4NUJA 1YC7A 4HD9A 5IVXB 5F89A 3KGRA 1JZ5A 4JLRA 1TPXC 2DD8H 4X9BA 5DFTA 4N9GB 3C8DA 2Z8WC 2V7HB 1SVZA 5I19H 4XP5H 3WSQH 2AXGA 2EO1A 4JFDB 3ULVE 5A2LH 3MRKB 4U3XA 5LQBH 5F7LB 4JRXB 1TZGH 4M43L 5F7YC 4PRIB 2RIKA 2JJSA 5SWZD 1HXYA 2G9HA 3HLAB 1I8LA 1KYOJ 1J0ZA 1YNLL 4P5TA 3P0YL 2PXYA 1YEFL 5HGGS 1RZJH 5J13C 5DJAA 4UU9B 1G7IA 1BQLH 4ZUVB 2DI8A 4MXWL 1EAPB 1FL6B 3KHOA 3WFHB 4B0MM 4EI6B 3P4OB 5HHME 4HGMA 4WDIA 4NBZB 3RDTC 2D2OA 2XTJD 2JCCB 1TENA 1BVLA 5E8OB 3SDXA 4YPJA 3FFCE 1S9YB 2OXGA 2YD7A 2X1XR 1SEQL 3ES6A 4FN0A 3GI8H 4QHNB 2FZ3A 2AEQL 4Y4KC 4DZ8A 4G7YL 1KUMA 1U8OA 4PGBB 1DDHA 4QRRA 1Q9KA 4X5WA 1M4KA 4JKLA 4M5ZL 5KANI 3H0TB 1O0VA 1QKZH 1JWMB 2ED8A 4K7FB 4OBSA 3SDCA 3DYPA 4X4ME 2MPAH 2A38A 2X89D 3D39E 2GI7A 3ULVH 4FFYL 4YHLH 5B38G 4OLEA 4NJ9L 3X14B 2IQAA 2ILLA 1IMHC 2J88H 4WFED 3KXFB 1B3JA 1KCVH 3S37H 2EDFA 1FORH 3DRTB 4DGVH 4DUXA 3BPLC 1MF2L 3RNKA 4EI5C 4PJAB 3P3YA 3T08A 1C12A 5AG8A 1HH9B 3B8SA 4UUJA 4L8DA 3QDMD 1TZHB 1DQLH 4HS6A 4QTHA 4EN3C 1FZOA 4NRZA 1TTFA 2X4TB 2VQUA 3M8OL 5T3ZE 5EB9A 1T0MA 5GS3A 1FGVL 5FYLD 1F4AA 3U4BH 2UZYB 2ICCA 4JKPH 3K4AA 4GAGL 4ORZC 5GISH 5J6HB 4TSAH 3MBEB 3LKRA 2AJYL 4OT1H 2CLZB 4R26H 5FV2A 2MNUA 5C7XH 2EICA 3P0VL 3PL6A 3C6LC 4HLJA 5F6HI 4XCEB 3OQ3B 4FQ1L 2FJHA 5ALBH 1A9EA 3PDGA 5E2VL 3VXSE 4K71B 5KZCD 4PJ8D 3CD4A 4XMKH 5CJOL 3N06B 5GSVA 4J8RB 1R5WA 4YLQT 1F4XH 5IW1B 5T33H 4JFEB 4XVTL 4YFLI 2GSGA 4U6HB 1YEKL 4F7TB 1KIPA 3BSZH 5CEYB 2F58H 1UXWB 3QQNA 4RAUA 1A0QH 1AGCA 4WW1A 5MEPA 5LCVL 3EOBB 5F21B 2QQKH 3QCVL 4KQ4L 1G9NL 3MCLL 4UT7H 5HYSA 3KLAA 5T3ZH 5DQDL 4FQXB 1KGCD 1QFPA 5FCUH 4CVXB 4KTEH 3W2DH 2FR4A 2OCFD 4Q9BA 1WFTA 3IB4A 4Z5RA 3KPTA 4U0QB 3ZKQD 3PABB 1EUUA 4XNMB 5I0ZA 4R0LB 5MENB 3U46A 3VXNB 4ODVL 1E4XL 4X0KA 1T04A 4GG6B 4PG9A 1I7ZA 4PJIF 1F4YH 4OKDA 2EC9U 1HKFA 4V1DD 1LK3L 1IFHH 2HJFB 3QDJD 3EGSA 5SX4H 3IU3B 2Z91B 1XF3A 2WBJB 3OGCA 4K9EL 5C0RL 4JFFE 3WLWD 5CKGA 2DKUA 1QSEE 2FIRT 1UH4A 1XGUA 1LE5A 3RX5A 5SX5K 4ZNCD 3FT3B 1IARB 1CFNB 5KN5B 5GGSY 1CG9A 2O5ZL 1G7HA 5JIHA 3EO1A 4RISH 4YXLH 3H3BC 2APWA 4NN7C 2K3TA 3Q5OA 1T2QH 4HUXB 4ELKA 5F8RC 2VDRH 4MCYA 2D4FA 5E2UH 2H1PH 1MCOH 5DUMH 3GJFK 3V5HA 1HZHH 4K7PY 4WHTB 2R1YA 4IS6B 1CL7H 4JKMA 4UINH 1BREA 5J3HD 4CMMA 2WQRA 3CMGA 3FT4A 5T1KA 3B9EA 3H3KA 3OB0H 5JOPD 1YMMD 5SWSE 1I1AB 4Z8FL 3Q6FA 3O8XC 1RHHA 4OFYD 2DJSA 4M7KH 5B22A 1F3JB 3STZB 4RQQB 2GJ6B 4DZBA 2EDKA 3ESUF 3FRUA 4UOW0 4OLXH 4GW5B 4W6XB 5JLZA 2DQFB 3F7YB 4L3EE 4NBXB 3VH8G 5EU7C 2Y4SA 4UB0H 2R9HC 3C5ZB 4TN9A 1DQQA 4ZXBB 4CBPA 3N1MC 3STLB 3VWKD 3FQTA 1OB1B 3RWEB 1L7TH 4GS7B 3C87A 5FYKH 2ZSVA 5HXMA 4G5ZL 1IM9A 3IKKA 5IWLA 1EFXB 4C56A 2EDOA 4QRPD 2N7BA 4O58H 3GJEB 3S34H 3KPMA 1ODAA 4ZOEA 4CVUA 4MXVE 4JJ5A 4Q97A 2IPUK 2YPLD 1C5BL 3OZ9H 5D1QC 1AKJA 4YPGB 4JN1H 2AI0H 2UWEE 2VDPL 1LILA 1HHKA 1CXIA 5ITBH 1PKQE 3ZDXE 4HWUA 4TPRH 1F90H 4CU8A 2GUOA 1XGRB 4HPOL 4TSBL 2HRLA 3W0WB 4QXGH 5GS1B 1M05A 1HILA 3DTXB 4FABL 1INEH 4W81A 1QLEL 5HDBF 5IVXA 5FHBL 5GSRA 3IDMB 4JY5L 3CVHL 2YS4A 4FMFA 4N9GA 5DVNA 2V7HA 4L9LA 4LEOB 2DQGL 2EDBA 4UBDD 2Q8AH 4PJXA 4KWUA 2A2QT 3KR3L 4JFDA 3ABZA 5EOQH 3MRKA 4FQ2H 4I2XE 4YJZL 2XG5A 4HIEB 2X4NB 5HPMB 1Q9LA 3S36H 5E94A 4JRXA 2CGRH 1FZJB 1NCDL 4HLZH 3FONB 1MHEB 4PRIA 3FB8B 4A2MA 3QRFM 4KI5F 3HLAA 2B7DT 2A6DB 2IPTL 3ARDD 3ZDYF 3BJLA 3E0GA 5GZOC 3WNLA 2V5YA 4TNVF 3EYQC 4Y5XA 3D2UD 4UU9A 3SGJA 3WFHA 4EI6A 5BO1H 1OW0C 3P4OA 1EMTH 4KKLC 2ZCKL 2I24N 3B6SB 4PJ5E 4ZMAT 4L4VB 4BKLB 5LBSL 4OCYH 1S9YA 4Y0GA 4ETYA 1QQDB 1FC2D 1HEZB 4GT7A 5I1KH 4MD0A 3T4YB 3JWDL 4QHNA 4GFTB 2NY1B 3ARWA 4YFEA 1BGXL 1YJDL 4X4XB 5H2BB 1A14H 5EPMB 4TQEL 2OL3B 2GYSA 4UAOB 4PGBA 4JANB 4UTBH 3U7YH 2XXMB 3AXLB 4AMKH 3H0TA 4O02L 4HWBA 1JWMA 3UJTL 5JZ7D 2D7TH 1CGXA 4I18B 1WIPA 2YD4A 5A3IC 4YHOL 4XX1G 4XBEL 3X14A 1WV7T 2H3NB 2FLBT 2VABB 3OAZH 3SDYH 2F5BH 4PB0L 1KT2B 2HJLB 3T0ED 4FNLL 5C0BE 2X7LB 4PJAA 4QF1B 3O9WD 4XP6H 1HH9A 1JPTH 3QXDA 4DGYH 3MRHB 1MIMH 4UQ2A 3U30C 5T5FL 3ZE1E 2PCPA 2X4TA 3CFKB 4NN6B 1KV3A 4H88L 5KVGL 5DJXB 4OLWH 3CX2A 3MBEA 5HTSA 4P3DA 1XEDA 2CLZA 1WFUA 5FYKD 5AD0B 2DQTH 4XCEA 4K7PL 4NZJA 5IF0B 4PJ9D 5C08E 2P8MB 4WFFE 4R2GB 2R2EA 4Y5YA 3UO1H 1EJOH 4CN6A 1ZWIB 1A7RH 1EZVY 1BM3H 4OF6A 4KROD 2VE6A 1H3UA 3BEWB 4J8RA 2EIBA 4F7PB 4JFEA 4HJJH 4U6HA 2WAHA 3O2WL 5CEYA 1UXWA 1PEWA 5EA0H 1WSST 2DWDB 4WV1B 3KLSA 1EBAA 2YXMA 1V05A 1JWUB 3EOBA 2DLEA 4NKMB 3BWUC 2DWEB 1CLOL 4FMKA 3U0TB 1BX2A 3V4UH 1DBAH 1OSZB 4NJAH 4YBLB 1DQTA 4NQCD 4JREB 1K3IA 2ZCLL 2AK4E 4CVXA 5IBLD 2JK5A 2IQ9H 2CDFA 3SDXF 1P5UA 5IMMB 2O5XL 3HNVL 1HSAA 3PABA 4CKVX 2DM3A 4L1HA 4R0LA 5LGKA 5GRZA 1NMAH 4G9FD 3GRWA 1Q1JH 1PQZB 4P49A 4GG6A 1T80A 5IJVA 3JV4B 2LU3A 4KTYA 1JPSH 5EZJB 5BMFH 2HJFA 4AEFA 1IEBB 3IU3A 4H26A 5TE4H 1KSRA 3ISWA 2YD3A 3PXJA 2WBJA 1CS6A 3UTTD 2VR4A 3TO4B 3IKCB 3S36X 1DBMH 3BP5B 4I0KA 2DYPD 3BO8B 3VXQB 2R29L 3FT3A 1CFNA 4LU5H 5KN5A 3O6FC 5GGVH 1MAML 1NGYB 3I3EA 4PJ8C 4OCWL 4J3VA 1J0YA 1FP5A 5EZIH 3UTPE 1PG7X 5F7UA 1A6UL 1U3JA 4IOIB 3T2NH 1REIA 2XWBA 3EZ8A 2VITB 4WHTA 4IS6A 3X17A 3FKUS 4FFVD 3CVIH 2RFXB 3BH9B 3RY6A 3AB0C 4TSCL 3TZVD 3VXRD 4LBEB 4JZJB 1UJTA 3CFCH 1I1AA 4RMTA 5IKCB 2I9TB 4P23D 1CZ8H 5AZEL 1GSMA 3WFCL 4IMKC 3TYGH 1BIHA 3STZA 2FL5B 4RQQA 1MUJA 3RWHB 1MFNA 5J57B 2GJ6A 3DGGA 3ZMRA 1N4XH 3QZWG 3EYOB 2BVTA 5HYJE 5C9JB 4GW5A 4HZAA 3F7YA 4FRWA 4CN1A 3K8LA 2OR8A 4OV6F 5E2WL 5JTWA 2WUCH 5I6XB 3C5ZA 1H3TA 2VDNH 1RUKL 3P9LB 4ZXBA 1AJ7H 4IDJH 4JPVL 3RWEA 3VRLF 4PJDE 2BZDA 3QAZC 1EFXA 4NHCL 1MCCA 4XNXH 5I18H 1S3KH 1H3WM 3GJEA 1QFWL 2IAMB 4J4PD 2ZSWB 3WLWC 1S7SB 1FLRL 3VD3A 3S3SA 4EI5A 4JGUA 4YPGA 5JR1L 3QNYB 5DK0B 5CEXB 3SN6N 1CGTA 3FOMB 3VFMA 5IHUH 3KAAA 1FVDB 1XGRA 3W0WA 5GS1A 5I15H 3DTXA 4PGEB 1ZLSL 4YH6A 5CD5D 1A6VH 3QH3A 5F9OL 3GIZH 2XRAL 3L5JA 1GIGH 5J3HC 1P4BL 2GITB 3MLWL 2W07A 4OZHB 1UJ3B 5IBUG 4RX4A 1MCRA 3X3FH 4NKOA 4LEOA 3KYOB 4YXHH 1UKTA 4M48L 1MCPH 3MSPA 3TA3D 4C58B 1NEZG 3EO9H 3OL2A 4HIEA 4NZRH 3BGFB 2CQVA 1I1CA 2PNDA 4U1HB 1XGYL 3TV3H 1FZJA 3MUHL 3WDIA 3MJ9A 3FONA 1MHEA 3FB8A 4G6JH 4NT6B 1MRCH 1UB5A 1FN4B 5BCAA 1JHKH 1QOKA 2A6DA 3K0WA 2NR6D 4X9GA 5HGAB 4Z7VB 4MNQE 3R1GL 1UACH 4I4WA 3EYUH 1IILE 3BE1L 3SDAB 4L5FH 3VWKC 2B1HL 4HIXL 1X6NA 2Q6WB 1S7RB 4D9QE 2EEDA 3B6SA 2R8SH 4PTUB 4OLVH 2BY3A 4L4VA 2DIJA 5DC0A 4D2NA 5DDHB 2V6HA 3T4YA 2DTMH 3EDDA 4OCXH 4H1LH 1CQKA 4X4XA 5H2BA 5EPMA 3PWPB 1D5IH 2P48B 2OL3A 3AC0A 3BZEA 3NACL 2PO6D 1ZGLP 3AXLA 3MBXH 3O6MH 4RFNB 1DUZB 1M71A 5F1NB 3DXAB 5HYFA 3S8WA 3VI3E 2FCBA 1B9ZA 2QQLH 5TF1L 1JZ6A 1NBVH 1Y6MR 2BNQE 4I18A 4TRPH 2J1KA 1T6WA 2MQCA 2Y5TB 1QVOB 5BV7H 2H3NA 1ZLVH 4PRPB 1JK8B 1EEYB 1KT2A 2HJLA 3DSFL 4MSWB 2X7LA 3QIWC 4HC1A 4O5LH 2BFVH 5C2BL 1FFRA 4HK0B 5DJCB 5D7LE 3MRHA 4LFHG 3L5IA 1T7WA 4UBDC 2UY6A 3CFKA 3OR6A 1JYNA 3KPRB 5DJXA 4AEIH 1ZHLB 4WEBL 3MLXL 5AD0A 1F6AB 3ARDC 4OCSL 3UTPD 1QD0A 1XH3B 5FGBC 5IF0A 4CMHC 2P8MA 4YC2C 5EOCH 2VL5B 4GRWF 3NIDF 5KVDH 1ND0B 2QADC 3H7LA 1ZWIA 4S11A 1MJ7L 4CGTA 3F6IA 2WWMD 4A6YH 5JIIA 2GKIA 3ILQD 2A1WL 5ANME 2NX5D 3KPLB 4LCWB 4PJXF 4F7PA 1T03H 1QFOA 3DYMA 5I1DB 1OP5H 5H35B 1BWMA 5L0QB 5BRZB 3CFEB 1A5FH 2DWDA 3UZQA 1GGCH 4LCYB 4M6NH 5T1LD 1MCIA 4ALAL 5KSBE 1JWUA 4NHUA 1FYTD 2QQNL 4NKMA 5KW9L 2DWEA 2OR7A 4LCUB 1OSZA 5JZ7C 3I9GL 2EZ0D 3RX7A 2OMBA 3F62A 2HT4D 3QHFH 3UTSA 4WW2C 5IFHH 3RI5F 4I9WD 3R0NA 1YC8A 2BJMH 4G8EA 5IMMA 3V7MA 4HDIB 2VKWA 1S9XB 3T0EC 2I9LB 3QI9B 5GZND 2QJDA 1YQ2A 1PQZA 2FBJL 1XAUA 3JV4A 1FO0B 2FWOB 4M93C 4L1DA 2WZPD 2F8XC 2IEPA 4NN5C 1A3RH 1IEBA 3VFWB 3VMOA 4Y5VC 4IRSB 3CZJA 3GHBH 2Q87A 4ACPA 5JHDE 4ELMF 5JA9A 4GMSH 1I3GL 5CILL 2XICA 5H94B 3TO4A 2R2BB 4P2OB 4PTTB 2ZJSH 3MROB 3QWOB 3QFJE 1YA5A 4P4RB 3MOAH 5E03A 2IC2A 4QNPF 4PJ9C 3B83A 3BO8A 2W9EH 3MLYH 3VXQA 3K74B 3HTLX 3QQ3B 3CLEH 5D7IE 5CCKH 1NGYA 5CGMA 3EJJX 3O4LB 4JRYB 4KROC 3BAEH 4EDXB 1VPOL 2A77H 3PP3K 3MUZ1 4JKWA 3ZYZA 5KVEL 1OQOA 3CUPB 2G75B 4QO1A 3U7AA 1CXFA 3ZL4H 2VITA 1I8KA 4U1LB 2Y06H 1A7PH 2W65A 1BP3B 3SGDH 4ERSH 2RFXA 3BH9A 4OGXH 4JG0H 3IDJB 1XT5A 4WEMB 2R4SH 4LBEA 3TPUA 4K94L 2OP4H 1FPTH 4YBQD 2I9TA 3GSUB 1KPUB 1F2QA 2DQJH 4GAJL 4B50A 5A1AA 4LPUA 2FL5A 4M1DL 1U8HB 3RWHA 1HOCB 5IEKB 1U91B 4HKBB 4X4YA 3EYOA 5DZLA 1S7TB 1MFAL 4QTIH 4JQVC 4EIGB 5C9JA 4KMLB 1P2CA 5DQJB 4LQFL 5ICXB 2QHRL 3LKNB 3P9LA 1OT1A 2ICEB 3X3GH 4QOKE 2VC2H 4G7VL 2Y1VA 4G6AD 4KXZI 1W8NA 2O61B 2EDWA 1T3FB 3HE6B 3HG1A 4NQDD 5C0AB 3IDIA 4HJ0C 4GXUM 4ZDHB 2IAMA 4TUJB 2ENSA 1CDYA 2ZSWA 4AQOA 3OPZH 1VFUA 1S7SA 3WS6C 5CMAB 2Y9RT 5E9DE 2AKRA 3NAAL 1YYMH 2KL6A 4TOYL 4DAGL 2FD6L 1QR1B 5IG7B 5J12B 3GMRA 3QNYA 5DK0A 2CLVA 1EGJL 3OKLB 4PGZA 5CEXA 4ZFOL 3FOMA 5D2NC 4YDKL 3LPGA 1DVFD 1Q0XL 4GQ9H 4NSKA 2XA3A 1SYSB 4HXAL 3UBXA 5JXEC 5IK3B 4HUKB 4KU1A 5GGRY 2AABH 2XZAH 4GRLB 4PGEA 2VO5A 3MGAA 5E8NB 5D96C 5I1GH 2WANA 4YWGL 3QQ4A 1G0DA 2FHCA 4FFVC 4PJEB 1U8PB 3O6KH 2GITA 4NQSA 4MB4A 4DKFL 4PP2B 4OZHA 1MCDA 2JCCE 1UJ3A 4OQTL 3ZZ1A 3TZVC 2PTVA 4JR9H 1RMFL 3KS0J 4R3SB 1SM3H 3QXTA 4KH2A 1YN6B 4P23C 1PG7W 2Z4QB 5D7JB 2A83B 4E0RB 3RL1B 3JWOH 1UYWH 1CE1H 1UGNA 3RJQB 1JTTA 4U1HA 3CNKA 1RJYB 5T1MB 3DARA 4O2EB 4RRPG 2D31A 3L3KA 4NT6A 3K7UA 3QUYD 1FN4A 2X1WL 5KJRH 4JEGB 1OAUL 4Z7VA 1NCAH 4RGMC 1I1RA 3SDAA 1RZKL 4XNZB 3WYRA 2A6IA 1S7RA 2Q6WA 3KXFE 3OG4B 2R39A 2W59A 1YEJH 2DICA 3HCVB 3AS3A 4D9RD 3EHBC 1WCQA 4PTUA 3LQAL 2B4CC 2GT9B 2IFGA 5DDHA 4J4PC 2D7OA 4AM0A 1ITBB 4AG4H 2BXYA 4NKIH 3KNBB 3MZGB 5L88H 4GBXB 5EUOA 2YD8A 1D5MB 3EJZD 3DXAA 2ITCB 5F1NA 2C3HA 2EE6A 2P7TB 5CGYD 4LSDA 5DA0B 1WITA 3SJVE 3PWJB 1IQWL 3FMGH 2Y5TA 5H8DA 4P5MB 1QVOA 4XNQB 2ARJB 3RAJL 4NZUH 2NQCA 4PRPA 1EEYA 4KVNH 2DQUH 4OZFH 1N6QL 2B1AL 1BBJB 1WC7B 1MCSA 1MEXL 1ACYH 1U8MB 3EKCA 3NTCH 1EO5A 4HK0A 4XP4L 3QCUL 5DRWB 3WXWL 4MA1B 3TA3C 5I30H 3KPRA 3DMMB 3P0GB 1ZHLA 3H9SE 1U3HD 3L1OH 3A6BH 2NR6C 4NQEB 2XZCH 4JY4B 2ENYA 2Z93B 1XH3A 2VL5A 4OIIL 1WVZA 1ND0A 5KTEH 3UJJL 3DECA 4PS4L 4KV5E 1AY1L 4ZPVB 1V5JA 2A9NL 3OKYA 3MNWB 1RJZB 2FGWL 3GM0A 5GGTL 3CC5B 3RTQD 4ZS6D 3KPLA 4LCWA 5DK2B 4P2RE 1YYLL 5DUBB 5I1DA 1ADQA 3QWRA 5HHVL 3TYFB 4EDWH 5H35A 3WN5C 2C3WA 5BRZA 3CFEA 1NCCL 6FABL 1T6VN 2W92A 4LCYA 2XA8H 2XG4A 1ZLWK 2PO6C 1BAFH 1K5NA 1E4WH 1C08B 4ONGH 4LCUA 1UM5H 1S78D 1DQJB 4MAYD 1C1EL 3FO0H 3I3DA 4GW4B 2E5EA 5E4EC 3JVGC 2KKQA 4RAVA 4P5KB 4JQXC 1T0PB 3MACH 1IC7H 4HDIA 1G7PA 3D3VE 1S9XA 1T1YB 1DBBL 2I9LA 3ZYJA 5GRVL 2PN5A 4OIAA 5LGJA 4BQ6A 1UM4H 3NIFF 3I2CH 1JGDB 2XYCA 3UPCA 1G7JB 1FO0A 2FWOA 5FUCC 1MFDH 1T5WB 5HHQA 4NQXA 1WBYB 3NA9H 5EU6D 4BZYA 3ZKND 4GAYB 4IRSA 2R0WH 5KSVB 1RURH 4P2YA 3X13A 1WWWX 1LO3L 5TFSL 5H94A 5KOMC 4P2OA 4PTTA 3QHZL 2R15A 4LOUD 3MROA 4LARL 4P4RA 4X83A 1YUHB 4JHWL 1W72L 1FIGH 4Y4HC 5LG1A 5EZLB 5C0EB 2A73A 1S9WA 1QFUH 3QQ3A 4X4ZA 3O2VH 1JZ3A 2ZCHH 5FIEA 3RPIB 1CWVA 3O4LA 4JRYA 3PP4H 2HFFB 4KTDL 1BFVL 3ILQC 1MPAL 4U1MB 3QNZB 4JQIH 5ADPL 4G3YH 2G75A 1KFAH 2IFFH 2EIZA 4KQ3L 5ALCL 2I60H 1GAFL 4U1LA 3SE9H 4X9HA 5KG9B 5DD3L 2AJZB 4HMCA 1HHGB 4XX1E 2APFA 2ARJQ 2YKLH 3IDJA 4YBHA 1CN4A 4ISVB 1OY3B 4KGLA 5EIQA 3GSUA 1KPUA 2FDBP 2BOCA 2EZ0C 4FQIL 2HT4C 3V4VH 4AIZB 1O7SA 4E42A 1U8HA 3VG0H 3FFDA 1RZIA 5CD3A 1TETH 2DQIL 4X8XA 1T7VA 5DQJA 1CDCA 12E8L 3FO1B 2GIYA 5GZNC 5DD1L 5ICXA 2SEBB 3LKNA 4K23H 4CJ1A 2ICEA 4JRWA 4ORGB 3RQ3A 1IC5L 1LO2L 4DN3H 1NKRA 3QP3A 3D25B 2PETA 3HE6A 1T3FA 5C0AA 3I3BA 3TT3H 1NCWH 5BS0D 1OGTB 4F3FB 4R4FL 4R7NA 1TXKA 5HVFB 4ZDHA 1GH7A 4TUJA 2F5AH 4F80A 4P59L 3ME0A 4ZFOB 4UV4H 5C6TH 3DYOA 4YHZH 3UTOA 3GMPB 1QR1A 5IG7A 3VFNB 5DD0L 4M6OL 3T04D 3OKLA 4AEHL 3VXMD 3GEWB 3PQYE 1KCUL 5D1XB 1JGLL 2YUXA 3QG7H 5EUKB 5E5RB 2R2CA 5IK3A 4JFHD 4NO2B 4PGDB 1JF5A 4ZFGL 4GRLA 2Y36H 4UNVA 4Z7UE 5FA3A 4AY0A 1LQSR 1VFOA 1FNGB 5HSFA 1R0AH 2XNAB 1A6TB 3SY0B 2YHGA 4PJCE 1BFSA 4PP2A 4R3SA 3OAUL 4YBQC 5D72L 3Q1SL 2Z4QA 3HI5L 5ACLA 3VGGA 4E0RA 3RL1A 2JLLA 2YR3A 1CI5A 2R0ZL 4CU6A 2CKBB 3SCMD 4HFWB 1RJYA 4HWZB 3MRQB 1GGYA 4O2EA 5DSCB 5JXAL 3T0DA 4NZTL 2BY0A 4M43H 1G6RL 1VSCA 3DO3A 4RWYH 1QFHA 4P46C 1PSKL 4ODSL 1INQB 1KN2L 2OZ4A 4EUPB 2UV3A 5JDSB 4XXCC 2J3SA 2GW5A 1M1SA 3WFDH 4G6AC 4HHAB 2DMCA 2HVJB 1RK0B 4M00A 4MXWH 1X6LA 3HCVA 2NYYC 2HFEB 4TVPL 2GT9A 1P7KA 1O7VA 2L7UA 2RR3A 2VDKL 5L6YL 2E7MA 5H37G 3RGHA 2VLKB 3VFTB 4KAQH 2X05A 3TIDB 1VA9A 2VNCA 3W9EA 2NXYD 1YMHB 3KNBA 1XMWA 3R8BB 2AEQH 4GBXA 1E6JL 3PJSB 4G7YH 3HMXH 5DMKB 1D5MA 2ITCA 4PRHB 1EHNA 1IGCH 1ZOXA 1KEGL 4WCYL 1DVFC 1KPRB 1L9MA 3HFMH 4BFIB 2COQA