4OZ4B

X-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSFYLRTFGGGTKLDIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVRWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab of monoclonal antibody, heavy chain
publication title Identification of structural determinants on tau protein essential for its pathological function: novel therapeutic target for tau immunotherapy in Alzheimer's disease.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4B01
1FNSH 1QSEA 4W6XB 3V79C 4H0GA 4NDMB 2M2DA 3O2VH 1MQKL 3Q5TA 4ODSL 5SWSA 4NKMA 3ROOA 1NUDA 2Y6SD 3MCKB 5IBTL 3X17A 2YPLA 1PLGH 3GSWB 1MRCL 1IFHL 2Z35B 3DURA 3KPMA 3EYVB 1DR9A 3BX7C 4HSQA 3OAYK 5CMAA 1EA9C 1W0VA 4HS3A 4BYHA 4XCEA 4LLAA 4H20L 1I8MA 4ZUVB 3MJ7B 1M6OB 1M05A 2X4TB 3BHBB 1NC2A 2YPKA 3QCUL 4FZ8H 4BFBD 2A1WH 3QDJE 1U3HC 3KLHD 1A4KA 4DGYH 1TPXB 2WUCH 3A6CL 4Z78A 4FQQB 1QSFB 4KC3B 4M1DH 3BEWA 1ZT7B 3O9WB 3CDCA 1QRND 4M6OH 2DYPA 3WIHL 4PTTB 2Y06L 5HHOE 5TE7L 5CEZH 3R4DA 1FL5A 1I1AB 1K9TA 3OB0K 1K8DB 4N0FA 3MRJA 1P84J 4WWKB 3F7VA 5F9AC 4I48A 1GGCL 5IVZB 3CDFA 3OKMB 2YBRB 2ARJA 3JV5A 3IU3A 2OK0L 5HXMA 4YXLH 3TBSB 3L5WB 4QRRD 4RFEA 1CFVL 2V5YA 1FPTL 4G9DA 1RJYB 1CGXA 1MF2L 3BPNC 4PY8J 4NJAL 2XWTB 4L29A 1BJMA 1A7RL 1K5NA 4PLJD 3DUHA 3RWCB 5FHBL 1R3HA 1MHPL 4MZ2A 3TNNB 3RKDD 1UKTA 3WNOA 1J8HD 2BVYA 1JNHB 1BF8A 3JWOL 3K4AA 3OR7B 4KJQD 4OFYD 4KK8C 3DO7A 5C08A 2CDEB 1A47A 4X5XB 1BVKA 3LKRA 2CXKA 4PB9H 2NY6C 4PJ7A 5F97E 1KBGL 4XH2A 1U92A 2QLVB 1L7IH 1LO0H 2PXYC 5BZWA 1TXKA 2Z92B 3PV7A 1I7UB 5DHYB 5E8EA 4HJGB 4RGMC 5IMMB 3KPNB 1IC7L 4V2CB 3WIFB 5K9OA 4G9FA 2Y07L 4YC2C 1KB9K 2IAMD 4HUXA 4Y2DA 3A6BH 1INDL 1Q9WB 4YBQD 4X99B 2FH8A 4RGNB 4G6FB 3QG6B 4RAVB 1HZHL 2Z31A 4ORGB 3U36A 2OBGA 2FGWH 5T33H 4NUGH 3LQAC 3EDEA 4Z5RB 3FRPG 5F9OL 1JPSL 1ZLWH 3MO1A 5I2IB 5A2FA 1OQXA 2VZ1A 1JGVL 3QXAB 5E8DH 4IDJL 3S36X 3O8XD 4PJBF 4BQ6A 3LQMA 4ERSH 5MEQB 4HWZA 4L8DB 1PDKA 5D2LF 5KVDH 1EUUA 1A6UL 3QEQD 2P4AB 1M4KA 1F4XL 1DLFL 3BIKB 3BP6A 2VNCA 1EFXB 2HJLB 2VDRH 4OZ4A 4ZFFB 5J6GB 1X5IA 2E5EA 1Z2KA 1R3LB 2MJWA 2VDKH 4GRLD 2CK0L 1RZKC 3CVIH 1JNLL 4RISL 1C5DB 4EIZC 1YEKL 1CQKA 2ADGA 2VLJE 3PP3H 3REWB 2A6JB 2G5RA 3SE8L 5I9QC 1HKLH 1KGCD 2JELH 5GGRB 3N1QC 1VGEH 3CXDH 3GMQB 2V7HB 4C83A 5JUEL 4UIKL 1INEL 1IL1B 1T2QL 4ORZC 5C8JA 3WCYA 4EJ1C 4KXZI 2IQ9H 3CXHJ 4KRPD 4MXWH 3ESVF 1S8DB 5EBWA 2VXVL 5FO9A 3IJYB 3UDWC 4XBEH 5ECJE 1KN2L 1V7NH 1I7ZB 2VDNL 1S7SA 1E4WL 4PRIA 2E7CA 5GIRB 1HEZB 2HT3D 5GSRB 4G6JL 1MUJA 3KJ6L 1A6ZB 1IZKA 4Z7VE 2DBLL 1SMAA 4Z95H 5GS0L 5HI4C 3UZQA 4ONFH 3O2WL 1KCUH 2ZCHH 2HG5B 1ZAGA 4NQDD 3CUPB 5JTWA 5I1CL 2DLEA 2ZUUA 4HXBL 4OZGF 2P8MA 5J9PB 3RX8A 4PJBA 5CEYB 4OD3H 5JLZA 2AJUH 4LCWA 1ONQB 5D2LA 5AZEL 3ULUC 5IVXE 5BZDA 1Z5LB 4MNGE 5DJ8A 4R4NC 3C08L 5FV1L 3VGDA 1VEPA 4Y4KA 3VXUB 4P3DB 1LO5B 1VGKA 2GT9B 4NKIL 3VG0H 2Z9TA 1N6QL 1Q8MA 4C56B 1P9MA 2CO6B 1QZ1A 5LQBL 3HC0B 3LS4L 1GC1C 2K3TA 2JJUA 2XN9D 2QADC 2FH6A 3QUMH 4L1DA 2O93L 4Z7OF 3QQ4A 4QF1A 4WWID 2AJVL 3HNVH 4GKSB 2WP3O 1ZHKA 4KV5F 4OCXH 3QQ3A 4IMLB 1S7VA 2FSEB 4XC3L 4M62L 2LTQC 1Q94B 3V4PH 1F42A 1UB6A 4PJGF 1S7XB 1FH5H 4JJ5B 5I1LB 2XZAL 3D85D 3K2UH 4HIXH 1T7WA 3TZVB 4KDTA 2VDPH 3O6FA 1WV7T 3DX9A 4Y5VC 4WFEE 3CH1B 3PGCB 4H1LG 1PKQB 4DCQB 3AMLA 1FN4B 4X6BB 3ES6B 3TO4A 3B2VL 5KW9H 4Q9QH 3VI3E 1UWEL 1UH2A 3ULUE 1F97A 2NMSA 2A0LC 3PGDA 4YGAB 4PP1D 3VD3A 3VG9B 3LEXB 1OB1A 4OZGA 1G1YA 4GRMB 3KS0H 3L3JB 3VXSE 1CFTA 12E8H 2AJYL 1HHIB 3L3DA 3TBTB 3VGAB 4ALAH 3BOVA 2VLKB 3CGTA 3OBAA 1F4WL 2EC9U 4GG8B 4NUJA 5CCKL 5IB3B 3MLRL 4OTXL 4LLWB 2JJTC 3U79A 4X7FC 1H15B 4WUUD 4N0YL 4B50A 4ONHA 2FRGP 1AHWC 4ZXBB 4JO3H 3UTQB 3ULVE 2BOCA 3RU8H 4NN7B 3GBNH 3S4SA 1L9MA 1GGYA 5AAWA 2C3WA 1OW0C 1DJSA 1Q9OA 4LU5H 3V5DA 4DUXA 3RZCD 3NZHL 3Q1SH 4NOBA 1VFMA 4RFOL 4WFGD 5EG6C 3ALXA 4LKXB 4H0IA 3CMOL 3VWKD 1KCKA 4PV9B 4GFTB 4QXTB 5DUML 4PJGA 1FL3B 1SQ2N 3UC0L 1OP5H 3TGXA 3VE0A 4MS8D 4OCRH 3L3KA 1CIUA 3LEYH 3L7EB 3BWAA 5HYIA 3CDYA 2DMCA 3EYSL 1SEBA 1ORQB 1G1CA 2VDLH 1BJ1H 1FV1A 2IH3B 4LSQH 2C3VB 3CZJA 1S9YB 4BZ1H 1X5LA 5EU4A 1PGRB 5E94A 4S1DD 3CDGB 5KZCD 1I75A 2BDNL 2ITCA 4Y19B 4F7EA 1ZA6B 4ELMB 4G80A 5K93A 1U93A 3TLRA 1LEIB 1H0DB 1CE1H 3L5HA 4K8RH 4LKCA 1DBBL 2BNRE 5T3ZD 4NP4H 3NCMA 2DBJA 4OZIE 1JRHI 4Z7NE 1RUAL 3QRGL 2H6PB 3M17B 1K2DA 4KUCD 3V7AG 4PJIB 1TZHB 4G8FA 3OXSA 3VJ6B 4GAFB 4Y7MA 5ACZB 2CIIB 4MX7A 5GGSY 3RHWK 5EZJA 4PGBA 1QKZH 1FNEB 3LRSB 2BVPA 1Q0YH 5DJXA 4MCYB 5JW4R 1AQKL 4M43H 5INDB 2XNAB 3K81A 5D72L 2P5WE 5IG7B 3W5MA 3F7QA 2WMPA 3JZ7A 5GRUL 5DRWA 3VRIB 4NKOB 3CK0H 2B4CL 2DQTH 2IH1B 4NNXB 4KVCH 4X4MA 3DI3B 4JHWH 4FQXC 4MD4B 3QJHB 2VWEE 1MELA 1U8NA 5IQ7H 4YPGA 1KCVH 1DBAH 3FO9A 3VDCA 4ESKA 5F88A 3L3IA 3ARFC 3HRPA 4GAJH 5DA4A 5B8CA 3EFFA 1OP5K 5C0AD 5FV2A 2PXYA 5J3HD 1T89A 1BJ8A 4GUPB 4PJ9C 4UDTB 3CVHH 2WNGA 3QSKB 5SWZB 5C0IA 4ZO8A 1A4JB 3Q6GL 2PO6B 4HHAA 4D0CA 4H25A 4PG2C 4P46B 2QQKH 1MFEH 3QWOA 1FVCB 3QUXB 1NKOA 1KTLB 4XXDB 32C2B 5GS2H 5F7DB 4PJDB 3Q0HA 2X41A 3AB0C 1N5AA 1II4E 1F58L 4H1LH 25C8L 3NTCH 2F74B 4XXCC 3MJ6A 2VLLB 3ZHLA 3RGVD 3MRFA 3MJ8A 3MRLA 1VHPA 2W92A 2NXYD 3DVNA 1SM3L 3VFGH 2EDFA 3N50A 3BZ4A 4HUVA 5F7EL 3OKNB 2MCPH 2VOTA 2VZUA 3IF1A 1CU4L 2GJJA 3RVTD 2ZOLA 2MFNA 3DX6B 2BSRB 4UV4L 3F5WA 5E7BA 4HPOL 5ESAA 4XPTH 5B38G 5LKNA 2VDQH 3DGGA 5B39G 2EZ0C 3IDGB 2P24B 1VKXA 3SDDB 5C9JB 2Q6WB 3ZDXE 2XOTA 1ZMYA 4Y89A 1FGNH 3RTQD 5IQ9B 4RDQG 2OS7A 1GAFL 3DXAE 4YGVA 1A7NL 4IMKC 3UTOA 2NTSP 1Z6JT 1CG9A 5GGTA 2JCCF 3KR3H 3MV8A 1X5ZA 3FOLB 4QGYA 5C0DB 3LB6C 3HNSL 1CBVL 4U1IA 4F57H 3DRQB 1IC1A 1OVZA 5IBLC 1F90L 1CICD 5E7FA 5L8LB 3SKNA 1REIA 5IHLB 1F11B 1YMME 1B6UA 2BRQA 2D7NA 3MNZB 3MBEC 4GAYB 3IDYC 4GRWH 2P48B 2DTSA 3EW3B 4POUB 3WD5L 1JMXA 4PJCE 3LPGA 1O5DT 5J12C 1T0MB 4HKJB 4HIJA 3ZE1F 2HTKC 1T2JA 1FNLA 4IBLT 4FQCH 3X3FH 4KI5D 3V4VH 3FB6B 3H9HA 4WW1B 2OTUB 1G7QA 5C6TH 4AEHH 1FBIL 1J10A 1QA9A 1ZTXH 1U8HA 2DN7A 2NW3B 5FECB 4XPHH 3EOAA 2XY1A 4EXKA 1DUZB 5TQ0L 4YHYC 1TNNA 1JZ3A 3K1DA 4WHYG 1D5XA 1H3GA 2R8SL 5KSUA 2P5EB 3KXFB 1ZXQA 3VXPB 2BSSB 3TIDB 3EBAA 3GO1L 2AV1B 5IIEA 3S34L 2AK4B 3EJZD 4ZD3L 1S5HA 4UT6H 3EDJA 1JGLL 3I50L 1AGBB 2A38A 2Q20A 1I1CA 1TDQA 4OQTL 2A6DA 1SJEB 5DZLA 2OQJB 2X40A 3ARBD 4GG6E 1FNGB 3VGHA 1J1OH 5C0BB 1U42A 3MLTA 5D70L 2QQLL 1XEDA 2JJSA 2Q7YB 1X5HA 2FL5B 4QRPD 1ZGLA 3BD5A 5KSBF 1UGNA 5EPMB 4ZO9A 5IKCB 3ARED 3DWTA 2H32H 2JCCA 5JPMB 2R1YA 3MX0A 3MV7E 4MJ6B 1FVDB 3RKPA 4JQVC 5KOVC 3T3ME 5C07B 1I8KB 4GW5B 4WDIB 2NYYD 3OTTA 4JM2D 1TVHB 3IDMA 5AZ2L 2DI9A 1T5WB 3Q6FA 1E28B 1HNFA 1Q0XH 4WRLA 3ILPA 3RGHA 3DROB 4EVNB 3X13B 1GHFH 3QP3A 1KPUA 4TSAH 3LKPA 1OD9A 4WTXA 1B0GB 4A6YL 1WTGT 3WFBH 4JG0H 3VXNB 3STLA 1FDLH 4CU6A 1TTFA 3RWEA 3O3DB 5EZLA 2DQIH 2GKIA 4PJHF 4YHNB 3JV6A 1B6DA 4PBWD 1AQDA 2AERT 3G6JB 2I24N 5CEZD 3D3VA 4WI6A 1JGUH 1AO7A 5D96C 3WNLA 1CD0A 1FORH 4DKFH 3OHXA 3QFDA 4B7LA 1CF8H 5HGHA 5CFHA 1PEZA 4XMKL 4O2FB 4OFVA 5TJWK 1RFDL 3WJLA 1ZLUH 2EIEA 3KPSB 4B7IA 3G08B 3IFPB 3ILQC 4EOWH 1UZ6E 4U7KA 3SQOL 3SEPA 4YE4H 4N5UA 2LV4A 3T2NL 4MAYB 4KDVA 2J1KA 4O4YH 1IGFL 5JHLH 5E9DB 4KROB 1X4ZA 4Z7WB 2IANB 1I3UA 1UG9A 2X4PA 3EYFA 1F6AB 4E42A 3BXNB 1SJVA 4EQ3A 2VO5A 5IJVA 3EIFA 1TITA 3H9SA 4HF5L 3NIFF 4QYOA 5KSBA 2YSSA 4L5FL 1HDMA 4X6DE 4P49A 5I1DA 4J2XA 2F5AL 1G84A 3H3BC 2QEJA 5KAQG 5F7NC 2B0SH 2WBKA 2H2PD 3RP1A 4HKBA 4KZEH 3MYJA 4P2QD 1HNGA 1OW0A 4JY5L 4XPAL 3U2SB 1ZVYA 4APQD 3SJVE 2F53B 3CLEL 1LQSR 4H88L 1L6ZA 2GFBA 3L5XH 1WJ3A 4IRZH 4WTZA 1HIML 5L2KB 4K94C 5BOPA 3S35L 1JRHH 4YX2H 1QBML 3I6GA 3OGCB 5CSZA 4UU9B 4NN6B 2X4QB 3UJJL 2EYSA 2NY4D 3WUWB 4PJHA 5EFIB 3OG4B 3N9GH 4AEIH 5HYJD 1U3ZA 2J6EH 3QCVH 3QUYC 5BXFB 4GW4A 1NQBA 3FFCE 3PWPB 3FZUD 4LLVA 1UZ8A 4Z7UF 1TJIH 2R2EB 5D93C 3EO9H 1MJ8H 3RVUD 4BA8A 5F1IA 5IV2A 4AENB 2KDGA 5DC4B 3HMXL 2P7TA 4XBPA 4XBGA 5FUOH 4XNUL 3ARQA 4GAGH 5BRZA 3WFDL 2YUXA 3TA3B 2RFXB 4FNLL 2HVJB 2MQ0A 2HAZA 3HE7D 4U1GC 5ICXA 3P30H 1UT9A 4CADA 4DN4H 4LCUA 4WHYH 2DJUA 1N0XL 2ILLA 1I8IA 2J8UE 3NAAL 4RGOL 2OTPA 5MENE 1KT2B 1OSPL 4DGVH 4S1SH 3WBDA 1MNUL 5HYQB 4YO0B 3W0WB 3P0VL 3GJEA 3TWCH 3OKEA 5CKGA 4AIZB 3TJHD 1JFQL 1LNUB 3QHTC 4JN1H 1S3KL 4K23H 5I8KH 4TSBH 2BFVL 3MA9H 5C1MB 1G7HA 3BESR 1J1PH 4XCFH 3AFLA 4FQXA 4YJZL 2VZSA 2FECI 1FGVL 3NABH 4RWHA 2H9GB 3G5XA 2DQEH 3QJFB 5I76B 3PV6A 4Y16A 4NM8H 3LKQB 4NT6A 5HI3C 2F58L 3TV3L 1U8IA 1CYGA 3IAQA 4HH9B 1Q72L 5D71H 4LNVA 4A6YB 4I0PC 2OR7A 3HR5A 1C5CH 3O41B 1J7VR 1AC0A 4CNIA 4PJ9A 3VXRE 1DTUA 3ALPA 3H9YA 5IOPA 4I13B 5ACLA 5E1AB 4J7RA 5ILTL 3ECBA 4FQ2L 5ICZB 3RAJL 5CP7A 4ZUWA 2DQJL 3WKML 1ULVA 3QEUA 1GGUA 3OKOA 1XIWC 3DX7A 1CGTA 2ZSVB 1T66D 4PJXE 3VXQB 1NC4A 2PYEB 2X4NB 4AQ1B 3QZWA 4XXCA 3KVQA 1IEAA 2XWBB 3D0VA 3PGFL 1OPGL 4JFOA 1ZT1B 3DVGA 1KB5L 2WV3A 4PRBA 4CMHC 1JUFB 2BNQD 2NY0B 3L3OA 5IMKA 1WITA 3O6LL 4UBDC 5CIPH 1TNMA 4I3RL 1A7QH 1RUQL 4DKDC 1QQDA 3BYTA 4LMQE 4QRUB 1P4LA 5ALBH 1Y0LB 1Q9LA 3BWUC 1EV2E 3EDKA 3QCTH 4W4NA 4FQJL 3MUY1 1P4IL 1MI5A 3C6SB 3IGAA 4BUGA 1GGBH 5ENWA 1OTTD 3VWJD 2XFXA 3NMEA 4YK4B 4M61A 3MRIB 3NA4A 1CZ8H 3VFSB 4QXUH 1FLTX 5FYJU 3UX9B 4IMKA 4J3OC 1S7RA 5I8CB 5FO8B 2W0FB 1NBYA 5DHVB 2E8ZA 5L88H 2VLRB 3GZKA 4IRSC 1O7SA 4RSVA 4EDXA 2VISA 5E03A 1P2CB 1T0NB 1AR1C 4FP8H 4NZTH 3SN6N 4N8VB 1WLHA 4LSPL 3SO5A 3PWUB 3MBEA 4UNUA 5I6XC 2VL5A 1T4KB 5J0BA 1KLGB 2PN5A 4F7TB 4U1NB 1QPXA 5CD3A 4WU5A 3E2HC 4TNWK 1YYLL 3BKMH 5FHAH 3C8DA 1QRNB 3QQ9D 2VH5L 4L4VB 1XGPA 1N5YH 4LSUL 5GZOD 4IRJA 2VLJD 4U6YA 1UB5A 3TBYB 1Y18A 2LE9A 4U49A 5C6WH 4YZFE 3RNKB 4XHJD 3CH8A 4MA8L 4NO0D 1A9BA 2H1PL 1DUYB 2UVEA 1E4JA 1TCMA 4WV1C 4D94A 3O3EA 4X83A 5MEPA 1INQA 5FGCE 1RJLA 2EECA 1MHHA 3KPLA 1XCQB 1W72A 3OKKA 5F3BA 4XX1E 3CFCL 5D9SA 3CAFA 5FGBA 1MCPL 2FNBA 4QCIA 1E27A 3JWDH 5AEAA 5TH2A 2AEPL 5E5MA 2E7LA 3GIVA 4PBVC 3SCMD 1K8IA 3V6BR 1OD7A 2Y5TB 3TYFA 1FFQA 2Z8RA 5ID1B 5FUCC 1J8HB 3QIUC 5JMRA 1QBLH 2AV7A 4WO4D 3VXTA 5HHME 5I19L 5T1LA 4G42A 1T5XA 1NJ9A 3KNBA 1BOGB 2ICWJ 2ED9A 3IXAB 2ADFH 2UWEF 5BV7L 3PE9A 5JW5B 1S7QB 5CUSH 2BOBA 5A3IC 3AS0A 2XA8L 5F1OB 4UINH 4HUWB 1RAMA 2DLTA 3VFTB 3KPRD 2LVEA 5C0RH 4ZOBA 4M1GH 3WO4C 4TRPL 3GMLA 5IF0A 2IAMB 5GISL 3GSXA 4MQXD 3GSNL 5C0EB 2RAMA 3PQYD 1MLCB 4NSKA 4K8RD 1WICA 1AXTH 3I3DA 1G7IB 5FM5M 4GOSA 2DTML 1DZBA 4MWFA 3I75B 5F21B 1A6WL 2FLRT 2V6HA 4HMCA 1ORSB 3C5SA 5EIQA 1RUMH 4N0CC 4X9GA 4U1MB 4OCWL 2R69H 2JJWA 1U8OB 5FUCE 3UPAA 1N4XH 4BFGA 5J7CC 3O8XB 1R5WA 1T20B 4FQHA 1NGZA 2X4RA 1FZMA 4ZFGL 1OL0A 1UVQB 3QEQB 2VDOL 1MHEB 1SEQL 2BSED 1KB5B 3FCTA 3DSFL 1WAAF 1C12B 4S1RL 4M6NH 3ZDYE 4DEPB 4GRLB 4Z76B 3CMGA 1F4YH 1NCTA 2PTTB 1R3JA 5I15L 1ZGLP 2Z4QB 3C60D 3S9DB 1HH6B 5ETUB 4YR6A 3P9LB 4HG4J 3T8XA 4M4PA 1F8TH 2G60L 1RIVL 2NPLX 4NWTL 3F58H 1OCWH 4JY6A 5IVNA 2VDMH 3MBXH 3NZ8B 2D7TL 1IEBA 5HGDA 2F54D 3S36L 3B8YA 5C0FB 2AXGA 1MCDA 4R26L 2EDXA 5DEGA 2H2SC 3OJ2C 1UJ3B 3RX5A 5CZVL 2FDBP 3PWJB 5E2WL 3IVKB 2L7UA 3S4SG 2ZOKB 4L8BB 1NSNH 5GS2D 4UQ2B 3TN0A 4XVUD 2OJEA 1MJJB 3ARDA 3Q3GA 5FUZL 1RZJL 5I8EB 3QUYA 5F44A 4P5MA 1ZHLB 3BPCB 3LQZA 3RWGB 4BQ8A 5T3ZL 2OL3A 1BFOB 2X4UA 5JIHA 3IYLW 3I84A 3TYGH 1Z0NA 1TPXC 8FABA 1J12A 3W9DB 3FOMA 3SKOB 1OF2B 4NQDB 2APWA 3O9WC 5JOEA 3CC5A 1QSZA 4J23A 1QNZL 5IMOB 1XF3B 3O3AB 1I1AC 3IDJB 4HEME 2V2TB 4MJ2A 4TPRL 4MA3B 4WWKC 5DUBB 2CRYA 3UYRH 3LSOA 4K9EH 4NQXB 4ODWB 4M7KH 2HVKA 5HDQH 1WAAA 1ZA3A 3HG1A 2Q87A 1S5IL 1YPZF 3IAGC 3KPOB 4OF6A 2BERA 3QHZH 1S9VB 5EWIL 2XN9B 1IGYA 2D0GA 3INUL 4RMVA 3ZDZF 4G7VH 4GBXD 2OI9C 2H3NB 3QPQC 4PGZA 1ITCA 3JTSB 2EO9A 1JHKH 4J6RL 1KXVC 3C6LD 3GJFB 5EUKA 1MWAL 3KYNB 4L4TD 3OKYA 3T0AA 1HHJB 3QG7L 5LG1A 1LK2A 3H42L 1FJ1A 1Y6KR 1CDIA 5LGHH 1QSFE 4LF3B 4M00A 5ESVB 4DTGL 2R1XB 4OJFH 5CBAB 4PRHB 1NGXB 3MTRA 3U0TB 3FONA 5GGSB 1QLEL 4FMKA 1ZSDA 4LIQH 5DLML 4ZPVA 4KJWC 1E6OH 1YMHB 3C9NA 1NANH 3KJ4B 1WGOA 4I0PA 2ZUSA 1JNNL 5FYKH 1J0HA 4EBQL 2R4RH 2AXJA 1I1RA 4NQVA 3T3PF 4ZODA 5F6IB 1UXSB 3UTPD 1AGDB 2C3HA 4F7CA 4RGNC 1QEWB 3HZKA 1HQ4B 3FO0H 1PX3A 4GKZB 3IAPA 1KJ2H 1SVZA 2LU4A 1XIWA 1DBKL 5C70A 5DC9B 2CKBL 4PJFB 3HPJA 4XAKD 4ODHH 1KYOK 5D1ZB 4OF0A 2PCPB 3GK8L 3IFNL 4XPGL 4XT1C 3MUGB 4HGWA 1MFNA 1AIFB 3HZMB 4N1HB 5C0NC 4AL8H 5EIIA 2GSIB 4JRXD 4TUKL 5AWNH 5FDWB 4WNQA 2VR5A 4KTDL 3QIBD 4M7LL 3EOBB 3RZCB 4KKNA 3QISA 5EUOF 3BQUA 4P5KA 5TE6H 2R9HD 2YR3A 4P4KD 1VSCA 4ZUSA 3NA9H 4I77H 3NFNB 1CDCA 3MRMA 2X4OB 3VWKB 4QOKA 2ZJSL 4XZUB 2Q8AL 4NQSA 3HUJF 3CU1A 4JY4A 3KLDA 3BDBA 2OXHA 3M1BA 3MXWH 3GMOB 4YAQA 1YEDA 4NRYB 1MVUB 3HE6D 2CDFB 2MOVA 5D7LD 2CMRL 5KSVB 1ACZA 1ETZB 4RGNE 5EBMA 5BMFH 3FN0L 3NPSB 5E2UH 3L7FB 2FD6L 1KCRL 4O5LH 4UQ3A 4U1JB 1TTUA 2ZCLL 4IJ3C 3KGRA 5FCUH 5DO2C 1OT1A 5KZCB 3MOAH 5GRVL 43CAA 1PKOA 3DXAD 1X5AA 5C09D 3VFVA 3DOSA 5C7XH 3GI8H 3DYPA 3REVB 3FTGA 3MJGX 4YXHL 3WKNA 1RK0A 3T77B 3ABZA 3WIIL 3CFIC 3ETBF 3BZDA 1QFWL 1ND0A 2FJGA 2ID5A 2NZ9C 3D9AL 2HRLA 3H2WA 1KPVB 2EEDA 3SGKC 3IJHB 4U33A 4PV8B 1J8KA 3UJIH 2FHBA 3MYZA 4XP9L 1T7YA 1FNSL 3RDTA 3O2VL 3TF7C 4AYFA 4N0UA 2CJUH 4WHTA 5DUPH 5TGBA 5FOBB 4X9IA 5F96H 4D8PA 4ZQKB 5C3LD 3HS0B 1PLGL 1FL6A 3FO2A 1D5BB 1YC7A 2XWJB 3JTTB 5MHSE 1XF2B 5EUOA 3NCFB 2P1YA 5EIVA 3PP4H 1YY9D 3UEZA 4NQCA 4FZ8L 5F9DC 2A1WL 1JF5A 1VA9A 4Q0XL 1DFBH 3FQNA 2VUYA 3HUJA 3P9MA 4DGYL 2WUCL 1U3YA 2GUOB 4M1DL 4YXKL 1HN1A 4MSWB 3QA3A 2BVTA 2EXWC 5C0AB 1YEEH 2VJXA 1MWAB 1KV3A 5CEZL 3U9PH 3PHOB 1MQ8A 1P4BH 3JWOC 1H3PH 3VFNB 4HWNA 5GHWL 3U7YH 3G04A 4JFEA 4ONGH 3ISWA 3ZKMD 1QLRA 3TZVC 1G9NL 1NCWH 4EI6A 4MXQC 4YXLL 3MV7D 5D7JD 5CJXC 1P7QD 3MGAA 3BRGC 3QDMA 3ZT6A 3QHFH 5DK0B 1LILA 4ETQB 3RA7H 2MTPA 1KXQE 3T2OA 2ATKA 4V1DE 3TPUB 4EUPA 5I1AA 2YD9A 4F7MA 3UTTA 1FYTD 2XY2A 3V8CA 1W8OA 4HFWA 3VG9C 2ED8A 3NACH 2V17H 3AC0A 1AP2A 2EDNA 1ZVSB 4RZCB 4X4XA 4C56E 5KTEH 3VGAC 1OLZA 2CKBB 4GW1A 3H0TB 2GJZB 4RNRA 4QRTA 3RY6C 1A1NA 4PB9L 3ZKNC 5CP3H 4H0HB 1U58B 3RTQB 1VB9A 1L7IL 1LO0L 2X9XA 5AYUL 4ZXBC 2XKUA 4OZHB 1MCCA 3MV9A 1DANU 5D2NB 2NY3D 4NN7C 1G9MH 1OAZH 3T0EE 2IFGA 4LVHB 1CGWA 1CICB 3QEGL 1NMCB 3X12B 3T1FA 2APFA 5TQ2H 4MVBC 1RZFH 3A6BL 4JRYE 1CT8A 2VL4A 1KSRA 3QFJA 4E41A 4OUOA 5FO7A 5KVFH 5HPOA 2V2WB 4P2RA 1LEKA 1PKQE 3K4ZA 5T33L 5E6YA 3ZE1E 4NUGL 4OCLC 1TQBB 3G5YB 1KB9J 1XCTA 3L3HB 1F3JB 3BP4B 1YNTA 3P11H 1OTUD 2F8XC 4QEGA 1N6UA 1QVOB 2HLAB 1M1SA 3TO2A 1H8SA 1C5BH 5FA4A 2PF6A 1EEZB 5E8DL 1CD1A 4KKBC 2PETA 3TBVB 5EO0B 5DMGD 5E8OB 4ZUVA 4ERSL 3MJ7A 3QNZB 1F45A 2X4TA 5KVDL 3BHBA 3THMH 5A40E 4YHIB 3WXWL 2D7OA 2DQUH 2MHAA 4JKWA 4WTZG 2LU3A 4RMTA 3GMNA 2VDRL 3OPZH 1ZT7A 2BC4A 1CDUA 4LLDA 3O9WA 4Z8FL 1ZLSL 1NKRA 1RZKH 2FX9H 5HVFB 1AY1L 2VDKL 1TCRB 4LPTA 5JPNA 1WFTA 3F6IA 3KHOA 4XPBH 3CVIL 1JV5A 4G8IB 2ZG1A 2IPKB 4PTTA 3BUTA 4KQ3H 1WCQA 1ACYH 5GS0C 1EMTL 4ZFOL 1J0IA 5TDPB 2ESVE 1K8DA 3RWIB 3FMGH 2EE9A 2W60A 3GRWA 1HKLL 4UDUB 5C0CE 5TFSH 4QRPB 2JELL 1VGEL 3CXDL 4L3CA 5JO5B 3AREB 5DJYB 1KFAH 4EN3A 4XNZB 5DT1H 3QIWD 3B9KA 1NEZB 2IQ9L 5DJ6B 3QWQB 3BUYA 1CL7H 4KI1A 3CLFH 4XBEL 2XWTA 1V7NL 5I71B 1BMGA 1FO0A 1IBGH 5BS0E 5DXWA 1AI1H 4IHOA 3RWCA 4ZO7A 3FFDB 3U0PB 1G6RL 4CVZA 1JI1A 1YNLH 2NW2A 3BZFB 4J3UA 1M7DA 2R0WL 4K3DH 4Z95L 3S3SA 1EK3A 4ONFL 1D6VH 1LGVA 1KCUL 2ZCHL 1GZPB 1MRDL 5MEND 4Y19E 5TDOB 4J4PA 5DEFA 1Z9SA 4ELME 4FA8A 4XNQB 3ARGC 3V4UH 2A6IA 3AXLB 3PWNA 2NX5D 1R6VA 2R2BB 1OARH 4OD3L 2AJUL 4R0LB 1I7UA 4FFWD 1J87A 1MFBH 3KPNA 4PJIE 1QSED 1QR1B 2PO6C 5IW6A 4KHXH 3BO8B 4P46C 5H8DA 3MCLH 5SWSD 3QUXC 3TCXA 5CHNB 3D39A 1O7VA 1PZ5B 1LE9A 2YPLD 4FTVE 1Q9WA 1XGRB 4X99A 3GHEH 3AS1A 3QG6A 3WSQH 3BZEA 3W5NA 4RAVA 4MMXC 4FFVC 4ORGA 4KGJA 4U1KA 3QUML 3DJ9A 3TCLB 3QULA 5I75B 4D9QD 4Z5RA 4Y0GA 2V5RA 5I2IA 4HIHB 4JVPA 1AJ7L 5F72S 5I66B 1XGUB 3K8LA 3MRDB 4DOHE 2VSCA 3O2DA 3V4PL 1CDBA 2FB4L 1FH5L 3VXRD 4OD2B 1HQRB 4HV8B 2GIYA 3EYQC 4IS6A 4HIXL 2YUWA 3S98A 3WE6B 4LSVH 5DFVD 4P2QB 4YQXH 5T1KA 4WFFE 2VDPL 4JVWA 1ES0B 5DS8A 1EFXA 3QZWG 2VLMD 2E7HA 4HKZB 4IDLA 4ZFFA 4ISVB 5IGXH 5J6GA 1U36A 1R3LA 1UEMA 4I18B 3RBGA 1MCRA 2JTDA 4BFIB 5KW9L 4BQCA 1A0QH 1IAMA 1AKJA 2NY4B 5FF6B 2A6JA 5HYJB 1RZGA 2R15A 3FHQA 1JJUA 12E8L 4PJDE 5GGRA 4Z7UE 4FFZH 1XAUA 3GMQA 1KNOB 2CRIA 1IL1A 4X0KA 5SX4H 5KG9A 4ZDHB 4OIAA 3IKCB 5ISZB 2H41A 2I9TB 3IJYA 3GDBA 4JO3L 3BE1L 3SE3C 2ZKHH 2EEAA 3LVEA 1I7ZA 3RU8L 3GBNL 1FFNB 1NCBH 1SYSA 2D03H 4S2SA 5LCVH 4TNVK 3HE7B 5GIRA 1HEZA 5GSRA 5C2UB 2AQ1A 3WYRA 2W9EH 4LU5L 1IGIH 1A6ZA 4MNQA 2LU7A 3Q1SL 4CVXB 5DJAA 3JVGA 1SY6L 4MJ4A 3QDJB 2YN5A 4KKCC 3SGKA 1ZLVH 4N1EA 2HG5A 4JM4H 4G8EB 1U8QB 4L8CB 5I1JH 4Y2DD 1HI6B 4JZNB 4ZFOB 3RBSA 4OCRL 3S3JA 5CEYA 2V9QA 4QO1A 3SKMA 2VERN 1I3GH 3D25B 5EC2B 2Z31D 1EJOH 2PUQT 3LEYL 5HHOB 2XPGB 2VDLL 1JGEA 4OSUH 4LSQL 5DURB 5H37G 3VXUA 4OM1H 4X80H 4DK6A 1LO5A 1DBMH 5CILL 2G75B 3C5JB 5C0JB 4IOFC 1XFPA 1ZKAA 4PY7B 1UA6H 4Q2ZA 5IW1A 3PXHA 5IM7B 3O6KH 1TJHH 1G6RB 3NCJH 3NIGF 1BPVA 4MDIA 3RWDB 2B4CC 4K8RL 2ZG3A 4NNYA 1EO7A 4GKSA 4IMLA 4KQ4H 1Q94A 4HZAA 4XCNA 3BKYH 1LDPH 4QTHB 1S7XA 4NQEE 3B3IA 4KK6C 3KXFE 1MHCB 1I4FB 1QKZL 3TZVA 3SKJH 2AK4E 5HHMD 3O3BA 1Q0YL 4EKXA 5CJXA 4LRNH 3N1MC 3C8KB 5LBSL 4KK9D 5LVEA 4M43L 1EEQA 3ARXA 3CH1A 3PGCA 5GRWA 4DCQA 1PSKH 4Z6AT 3MRPA 3V6FA 5C0BE 4FXGA 3LKOB 5CD5D 1FN4A 3PHSA 4CGTA 3U4EB 2EKSB 2BHZA 3OJDA 3CK0L 2DQTL 4KVCL 3QXUA 4JHAL 4J1UB 1BWMA 4R6UA 1PQZA 1CXHA 2A83B 4Z0XB 3LEXA 4MAYC 1P5VA 3P0YH 5CS7A 3QUMB 4GRMA 3L3JA 3BPOB 5C07E 1SBSH 4KROC 4PRID 5F1KC 3TBTA 3ZKQD 3AS2A 1RZ8B 1MEXH 1UKSA 2VLKA 2ZZUT 4LCIH 4UT7L 5EOCH 3RY6A 2IG2H 4GAJL 3VWJB 5INCB 1HSBA 4OF7A 1H15A 3V0AC 4X6CB 1KIRA 1PG7H 3EHBC 1C7SA 1A6VH 3AY4C 3CVHL 3MLSH 4RMWA 1N0LA 5FM8A 4R90H 4YHZH 2F5BH 1WBYB 4I4WA 1MCWW 3RVVC 4LCWD 1K4DB 4LMQI 4MCZB 1HCVA 3ULVL 1T21B 5HI5C 4GLRH 1RIUH 4OGAC 4KGLA 2F8OA 5FYKD 3NTCL 4WCYL 5EB9A 3TM6A 4TYUA 4PJEB 1FL3A 4P23A 1IQWH 1DL7H 4HQQH 2WWMC 1GOFA 1UXWB 1NGQH 3VDBA 4WW2B 3L7EA 3OZ9L 1JYWA 2VLJB 4PREA 1BVLB 4LRIC 2C3VA 5E9DE 1S9YA 4XPTL 4Z7WE 1S9WB 4NO0B 4OLXL 4UIMB 4YUEL 2HT2D 1EEYB 1FGNL 1UQSA 3CDGA 3OJVC 3S3PA 1ZA6A 1DEDA 3W11D 5HPMB 4LHUA 3T65B 3KR3L 4L3EE 2DWDA 4AH2A 3TA3C 2OSLB 3O6FD 4F57L 4L8SA 3EO1B 3G6AB 3MLPA 5IFJA 2NZIA 2H6PA 3M17A 3SCMB 1UWGH 1BD2A 4HFUL 3VJ6A 2CIIA 5IROC 1NUGA 4WO4B 1FNEA 5ICYB 3LRSA 5IHZA 4JG1L 1U2HA 3J8F7 1HXYB 4LLMB 1FIGL 5E24E 2UWEE 4FQCL 4DKEH 5E2TH 3V4VL 2XNAA 1QLFB 1DLHB 4BUHA 5C6TL 4R4BB 4AEHL 3G5ZA 5DTFA 5BOZG 1LP9B 4XPHL 4I2XE 3VRIA 4NKOA 1QG3A 5BCAA 4XI5C 3KPRB 3UBXG 2IH1A 2R4SL 4AY0A 4JCMA 3HB3C 3QJHA 5H37H 2JIXD 2B39A 1QYGH 5E2VH 4PB0L 1W72H 4MJ5A 1NCNA 3PQYB 5IK3B 5JW3H 1RK1B 3OL2A 3U83A 4H8WH 1WWCA 1GGIH 1JP5A 2EYTA 4U6HB 3N1PC 1J1OL 4TVPE 3QUZB 2VUOA 1J5OL 3PDDA 4GUPA 2YD1A 4UDTA 4TTDD 2WSKA 5SWZA 4DUWA 2DDQH 1WK0A 4PLKD 3KYKH 5DC0A 5A43C 1UWXH 3VFWA 1JPTH 4Q97A 2Q8BL 4F9LC 4QHNB 1FZKB 3ZE2E 1A21A 1FVCA 1F3DJ 5E6ID 4Y1AE 3CFKA 4OIIH 3W0WE 2RCSH 4QY8B 2COQA 2JB6A 1D3CA 4GMTL 2VLLA 5DRZA 1Q0XL 5D4QA 5IT2H 1S9KC 2Z93A 5FB8B 4QT5A 2HTLC 1G9EA 4LCYA 1GHFL 2NY0C 4TSAL 1A02N 4NCC2 2ITDB 2FEEL 5HBBA 3WFBL 4JG0L 1VADB 5DD3H 1AGEB 5E5UB 1FDLL 1X4YA 5JHDE 1R0AH 5D1QD 2DQIL 3IDGA 3VXSB 3SDDA 4BQ9A 4YK4C 2ZUVA 4C59B 4KMQA 1JNJA 1JGUL 5C92A 3CVHB 1FORL 4DKFL 1JPFA 5HVGB 5F1SA 1CF8L 1CFNB 3RWHA 1I1YB 2B7DT 3FOLA 2Y6SC 5KS9B 3QRFM 1X5KA 3VXOB 4M9PA 4LSSH 3JV4A 4EOWL 3LCYA 4D0DB 2YZ1A 5GGQH 1F11A 4N90D 1ERNA 4YE4L 4Y5YB 3TIEB 4H1LB 3MNZA 4O4YL 3IDIB 5DVLA 5JHLL 1DCLA 3MLXH 5GRXG 3KLHC 2G9HB 1F6LL 2OTWB 2HN7B 1EAPB 2C4FU 2PYEE 3NCYP 1T0MA 2A6KB 3O4OB 3P73B 4Y5VB 3UP1A 1DE4B 5SV3A 2DQCH 1UYWH 1U2CA 3ORJA 3FB6A 4ZYKA 4KK8D 2R1WB 3G6JF 2NW3A 1B2WH 5FECA 2XQYG 3BN9D 3PL6A 4BM7A 5C86A 4WY7H 5BJTB 5DSCB 2V7NA 1QUNA 2B0SL 1MCFA 4I8DA 4KZEL 3DVIA 1E6JH 4C58B 3CPLB 2P5EA 1YPZE 4JANB 2XG4A 4F9PA 2BSSA 3TIDA 5EOTB 3L5XL 4IRZL 4JFDE 4YFDB 1QO3B 3V6ZB 3ARSA 4YX2L 1H9VA 3ZDZE 2EDLA 2NNAA 1FNGA 4PLJC 3SDAA 4GBXB 1T7ZA 2FWOB 5HVHB 5GRYA 3O11A 4AEIL 2OL3H 2YD2A 2BNRB 3SE9H 2J6EL 3QCVL 3C6LB 4AMKH 1JZ5A 3RKDC 2FL5A 4RIRA 5ID0B 4OZIB 1MFAH 2BVOB 4M93B 4KJQC 1TJIL 5JPMA 3K1KC 4MJ6A 1A7OH 3EO9L 1MJ8L 3BDYH 1I8KA 3NOIA 2ZP0T 4GW5A 4HCRA 4WDIA 2NY2D 5A1AA 1TVHA 3EOTL 1TMCB 1T22B 5FUOL 5HHPB 3GIZH 5AAMA 4GAGL 2W0LA 5A16B 1L0YA 2P5WB 4M1CD 3P30L 4DN4L 3BEVA 3FHAA 4KWUA 1Z9MA 4P57B 3T3PE 1U6AH 1A7BA 2IAMC 5JIPA 3VXNA 4JB9H 4QXWA 1T1ZA 4DGVL 5SX5H 4S1SL 4QRRE 3D69B 1N59A 1NFDE 1W2KT 1XR9B 2I60H 4OI8A 2VXUH 4OD1L 2AK1H 1CDGA 3G6JA 3TWCL 4PD4K 1LWRA 4HWEH 4JKKA 1ZVHA 5CJBA 1L0QA 4MD0B 4S0SD 3DUUB 4JN1L 4K23L 1RJZB 5DMJB 5I8KL 4TSBL 4HIEB 2PW2B 5EU6E 4O2FA 2OYPA 3KPSA 5D6CB 3G08A 1K3ZA 4JRXB 1J1PL 3FRUB 3IFPA 1J8HE 3O8XC 4R8WH 4XCFL 2DMBA 2P44B 3OF6D 4GXVL 5EOQH 4JZJB 4OZFA 2APVA 4MA7H 3NABL 3U46B 3OKDB 2DQEL 1H5BB 4R96B 5ESQA 3RL1A 2IANA 2XXMB 2IF7A 4NM8L 1F6AA 4P4KB 3STZB 5CGYD 3DV6B 4EUPG 2BK8A 2NLJA 1HXMB 3HCVB 4HLJA 1C5CL 1KELL 4GRLC 4DEPC 3VD9A 2EDWA 3JSSA 4XWGH 4FG6D 4HZLB 3B4NA 3HE6B 4MNHA 4PG9A 3RPIA 5CBEB 3D87B 3DUSB 1PG7X 3V5HB 1N3NA 1IAII 3U0WH 3MRHA 3BT2H 3AU1A 2F53A 5E00A 1IEHA 4NZJA 5IR1A 4LLQB 1EIBA 4GT7A 1UJ3C 5L2KA 3WFHA 5K59E 2A74B 3DXAB 5C09B 3BDXA 2J7LA 3P4NA 2J2ZA 3OGCA 1NDMB 3EGSA 2Y7QB 4UU9A 1UACH 2X4QA 3AVEA 3QXDB 4PRDB 1RSFA 4IOSD 1JN6B 3WUWA 2P8LA 1A7QL 3C5ZD 5EFIA 2HT3C 3T0ED 3WDIA 4K2UH 5ALBL 2AGJH 4BELD 4F2MA 5BXFA 4KUZL 3BP7B 3QCTL 3PWPA 2NR6D 4FQIH 5F8QC 1A1MB 1GGBL 2R2EA 3IDNB 1L7TH 3L1OL 3GB7A 1CZ8L 1DP0A 4PJCB 4YDVB 3X14B 4AENA 4QXUL 2K7PA 5LAXA 2V9TA 4JO4H 1KENH 2YD4A 4LL9A 2I26N 1QRKA 4NFBA 5L88L 3BGAA 4XGZB 3TA3A 3ZHKA 5B38B 2BMKB 5HGAA 5B39B 2APXA 1HSAB 4CU8A 5DQ9B 3GSVA 5H94B 1AO7D 4NZTL 1J18A 4NO3A 2X9YA 1S9XB 5DZOA 1KGCE 4WI7A 2EXYD 4ZS6D 4WHDA 4U6TA 2IFFH 5HYQA 3IFOB 5F1NA 2KKQA 4NRZB 5AD0A 2C26A 4TN9A 1JPGB 3BKML 4U0RB 3QFJE 1BF2A 4MAUL 5DQJB 1CFQA 1CTOA 3EKCA 4XVSH 4W6YB 3H7BB 2DWEB 2B20A 1N5YL 5FIEA 4GQPH 2Y72A 2WK2A 2ESVD 5BW7A 4U1LB 5EA0H 3H9SD 1LD9A 2GW5A 2ICEA 5C0CD 3GSOA 1JK8B 3I85A 1CE6B 4ACPA 3GI9H 3D0LB 4KTYA 3QJFA 3T4YB 3VMPA 3MV7B 5D7JB 5I76A 1P7QB 3D6GA 3LKQA 5E4EB 2AABH 1IAIM 2M26A 1XZ0B 1GJIA 3VI4F 3KJ4C 1WC7A 4A6YA 1J88A 2IALA 2C5DC 1N7MH 3JWDL 5DD0H 35C8H 5BS0D 2O5YH 5HYEA 3O4LA 4PP1C 1FFRA 5F6IC 4N9GB 4X6EB 4BKLB 1MFCH 5HDLA 2BVQB 1PX4A 1QBLL 3VRLE 1AE6L 1CGSH 1A7PH 3EYUH 3PNWB 3MROA 5DMIH 4HEPG 2YWYA 2DKUA 3BGMA 3VXQA 1DSFH 1CR9H 2X4NA 2P47B 1BLNB 2X5PA 3IRPX 2XWBA 3BPLB 1EUTA 2XQYK 5JQ6L 1MLBA 3X11A 4UINL 4WI8A 4IIQB 3WN5B 1JUFA 3FT4A 4DZ8B 5C0RL 2NY3B 4M1GL 2XTLA 2UUDK 3VMOA 5JXAH 1EXUA 2YD3A 4LCCB 3MA7A 4L1HA 3RZCC 2Q76B 5L2JB 2P46B 4FTVD 1KC5H 1AXTL 5IB5B 5CJOH 4XC1H 2FO1A 2ARWA 1T04A 3D5OF 1NCDL 4NHUA 3MFGB 1G7LB 4WENB 3VWKC 2W65B 4EUPH 4MQSB 2YRPA 1VACB 3VFMB 3IXTB 3VDAA 2QR0A 5I8CA 2D9QB 2YHGA 4MS8C 2X7LB 2VLRA 1T83C 3RL2A 4X6DB 1N4XL 1C8PA 1P2CA 3ME0A 3OWEA 3CD4A 5DRXA 2YXFA 3FQRB 4ODUA 1OHQA 1YEGH 1BQLH 3BYYA 2PTUA 4D3CH 4S1DC 1KLGA 5IESH 3W9EB 4OLZH 1VFOA 4WUUE 1B0WA 5B22A 1IC4H 2MKLC 1KCSH 4M6NL 1QRNA 1B0RB 1SHMA 4R4FH 1RZJC 3V6OA 4L4VA 4PGJA 3LPWA 5DR5H 3BRFA 4U7MA 4Y16D 2DQHL 3BIBX 3Q5OA 5FKAB 2HH0L 1F8TL 4LNRA 1OCWL 2VDML 3D48R 3MBXL 3LV3A 5IHUH 1FG9C 1HH9A 3RUGB 4W4OC 4PJ8A 4RX4D 2F8VA 4F33B 5J06A 3QIWB 5LWYH 1XCQA 2BCKA 3UTZB 3WO3B 1NFIB 1IGMH 5DJDB 1IGCH 1DQMH 3O45B 1NSNL 4Q6IB 2AJZA 1JTTA 2C1OB 1RHFA 4LSTH 1KJVA 3MZGB 4I3SH 3WDJA 1C16B 4OFKA 1P53A 4LFHG 2J8UB 1YUHB 4BFEA 5T5NF 4F3FB 5MENB 1BOGA 1AD0B 5IFHH 4PGCB 5KN5B 5HD8C 3SDXF 2O5ZL 5J3HC 1MI5D 4NZUL 2EZ0D 5CEXB 5T3ZE 5EORH 4HUWA 3E6FB 1OP3K 4RAUA 2XIDA 3DETD 3DMMA 1QSEB 4K9EL 3LIZH 4M7KL 4WEBH 2I07B 5HDQL 2IAMA 5SWSB 1NLDH 2X4SB 2SEBB 3ROOB 1BZ9B 5C0EA 2YPLB 2Y4SA 3KPMB 5CMAB 4OIBA 4XCEB 1G7IA 1FO0H 2QSCH 5M7QA 3I75A 3MBED 3RGVC 2VKXA 2XZQL 2NXYC 1A4KB 1ORSA 4PUBH 1JHKL 4JEGB 4U1MA 1K4CB 2HTKD 3JBG7 3BEWB 3VXRB 1UM5L 2CLZB 4NBYB 3MXVH 1GIGL 4NQED 1T20A 4BSVB 2EDOA 2B1AH 1UVQA 2F19H 5KBNC 3QEQA 4GKOA 4IRJD 3FQTB 3NIDE 4OJFL 2FZ3B 4U6XA 4N0FB 3MRJB 3F7VB 1MHEA 3RTQC 4DWHA 2X6MA 3PWLA 4I48B 5DRNB 1U41A 1C12A 4NO5A 2ARJB 5FYKL 4DN3L 5D2NC 2R4RL 4GRLA 4Z76A 4U3CA 2P42B 1ZT4A 2I27N 5FEBA 4LVHC 1CICC 1NMCC 5CJ5A 2G5BB 4L29B 5F7WC 3FO0L 1FNAA 2R23A 4PRPA 3SDXA 4EZMA 2GTZB 1KJ2L 1ROWA 1MRFH 1TQBC 2CLRA 1UJ3A 3R06B 5GJSH 1HILB 4ODHL 4KI5C 1YNKH 5T1LD 2GJ6A 5K9QI 3DO7B 4K3HA 1IAOA 2ZOKA 1D5MB 4AL8L 5D8JH 1I3RA 2A77H 3GMRB 5AWNL 1U92B 3SGEI 3BPCA 1KYOJ 4NKDB 5BO1H 1BFOA 1XGTA 2Q86B 5JW4N 3HC3H 4LDOB 5TE6L 4XP4H 3W9DA 1XR8B 3SKOA 3SO3B 3NA9L 4R97C 1PFCA 5K9OB 1OF2A 4NQDA 4I77L 5H2BA 3EJZC 4CAGA 1U3JA 4NZRH 4DQOH 4HUXB 4TQEH 1RURH 4OZHE 3UMTA 5GJTH 2NY1B 4CKVX 3ARBC 5IMOA 3MXWL 3ZKXB 3O3AA 2Z31B 2HWZH 4PJFF 4FMFA 4MA3A 1QFOA 3JUZA 4ODWA 2AVGA 5F6HI 5J1SC 3OR6B 5HY9A 3AREC 5BMFL 5E2UL 4NNPL 4MJIA 4TNWF 3CFEB 4O5LL 4XNZC 3KPOA 4LHUG 5FCUL 3MOAL 4O51A 4PJAF 4HK0A 2NYYC 4CVUA 1S9VA 4KI5E 2EE3A 2XN9A 3IS0X 5FGCB 2YC1B 3OKLA 5C7XL 3GI8L 1YEHL 5EO9A 3QCUH 1N8ZB 5I71C 3BKCL 4L3ED 2AEWA 4JGJA 4ENED 4NM4H 4JO2H 1IC5H 3JTSA 1KJ3H 1N6VA 4IRSB 5I8OH 4P3WA 3GJFA 3KYNA 1MCWM 3O0RH 1A1OB 1J05B 2Y23A 1HHJA 5EC1A 1F13A 2AXFB 1NLBH 2GEEA 4KFZC 4LF3A 4Z77A 2NY5H 4NYLA 3UJIL 5HHMB 1P5UA 4G8GE 4PRHA 1OWWA 5F89A 4HS6A 4YDJA 2VXSL 2CJUL 4J3SA 5DUPL 5F96L 1MIMH 1PVHA 3TNMB 1YMHA 4R0LC 1PD6A 3ARWA 3LD8B 4C83B 3TBWB 2OK0H 4B41A 1I9JH 1QPPA 3E0GA 4ETYA 1G9NC 5IBUB 1CFVH 3PP4L 1BBJB 1MCOL 1FAKT 1MAJA 4X7TB 2HKFL 5EBWB 1UXSA 5EDXA 3MRGA 4NJAH 2MMXA 5KSAD 5FKPA 1S7SB 1NAML 4GKNB 4LP5A 4PRIB 3TN0D 4OLYH 5ANME 3ARDD 1PJ9A 4J3VA 5I75C 3QUYD 1MHPH 5F71A 5MP6L 4PJFA 5K9QG 1MUJB 1YEEL 3EDDA 1MCIA 3RI5K 5D1ZA 1OGAA 3SDCA 3U9PL 1UH4A 3MUGA 4TVPD 1P4BL 4K7FB 1H3PL 1URLA 1AIFA 5H35A 3U7YL 1MCQA 2GSIA 2GI7A 1KBGH 4ONGL 4LP4A 4AG4L 5FDWA 3ZTJG 2H2PC 1HWGB 2GY7B 4PJAA 3R0MA 3O3UN 3HI6L 1NCWL 2EC9T 5HTSA 3RZCA 8CGTA 1FZOB 2ZUTA 1B4JH 5CEZE 1BFVL 5BZDB 2Y07H 5DJ8B 4NPYB 3LKSB 2X4OA 3HG1D 1H3XA 3CU7A 4JFFA 2VXQH 2DLGA 5BQ7B 1DEEB 2DJSA 3GMOA 1D9KD 2NY4C 4NRYA 1MVUA 1UM4H 2CDFA 4V2BA 3NACL 4K3JH 2V17L 5FGRA 1KJ2B 1V5JA 5KTEL 1ZHKB 3FZUC 5JHDD 1W0YT 3QQ3B 1KCLA 1S7VB 7FABL 1VPOH 2IBBA 4Z7QE 3OAZK 4IDJH 2IBZX 1X5YA 2X70A 3UZEA 5IB1A 2D3VA 4PJ5A 3REVA 3V7MA 4JN2A 3O6FB 1G9ML 1OAZL 3T77A 3HE7C 3LH2H 1UCTA 5DQDH 1BIIB 5L7XL 5TQ2L 4P2QE 1RZFL 4M48H 4I0PD 2FJHB 3LS5H 1KPVA 6FABL 1JNLH 4QWWD 4RISH 2YEZA 4UTAL 2JKXA 2PYFB 3N0PB 5B3JF 1NUFA 3B9VA 2QQNH 1RU9H 1I85C 1OB1B 3BJLA 3P11L 4OZGB 5F7UA 4P99A 3TJHC 3U9UA 3L3DB 2D2OA 4ZQKA 2UZIL 3HS0A 4NUJB 1XIWD 1DN0A 3QI9A 2XWJA 4ODBD 1DQLH 1S7UA 1XF2A 1LVEA 1I8LC 4XVJH 4LSDA 4YWGH 4MMZC 4XWOD 1ED3B 3THML 3ZE0E 3ZL4H 4TSCL 3P9WB 2MPAH 4QRQA 5HGBA 4Q9RL 2JIXB 4D2NA 2BZDA 1JWUA 3HPLA 4UBDD 1JE6A 3QH3A 2GUOA 4LBEA 4UTBH 3E3QE 2EC8A 2FX9L 3V5DB 3BVNB 5CLWA 3AROA 3TT1H 5C0AA 2DBLH 4HKXB 4L4JA 4XPBL 3VXME 5GS3A 3WJJC 3BQUD 4JHZA 2MWCA 4KQ3L 4PJ7F 3PHOA 4F37K 3VFNA 3FMGL 4QOKD 2YK1H 4PJGB 1YEFH 5TFSL 1H8NA 3GMPB 4YFEA 3B2UD 5E6IB 1YEJL 2FR4B 1L9NA 1WBXB 5HHVH 4RQQB 2N56A 1SEBB 1T66C 4L9LB 2Z91A 4JKLA 1FV1B 1CL7L 1AGFA 4ETQA 4ZMAT 3AUVA 4WI3A 3CLFL 1AI1L 5EU4B 5E94B 1P6FA 3HI1A 1IKNC 3W81A 1YNLL 2ITCB 3H3PL 3J7HA 4G80B 4DGIH 1NAMB 4OBRA 5TE4H 4OKDA 1X5FA 1ZVSA 3BPOC 4LKCB 5D1QB 3CFBA 1FC1A 2CKBA 2KZWA 2ZSWB 4X6FB 4YEEA 1CXKA 5GSVB 3H0TA 2GJZA 5D1XA 1OTTC 3VWJC 4ZO6A 1KN4L 4TUOB 1IM9A 1I9EA 1K2DB 4BZ2H 3V4UL 1BM3L 1U58A 1T03H 3OXSB 2VN4A 1OARL 5EZJB 3S96A 2OI9B 3SGEH 1MFBL 4LLUA 2JB5H 4MXVF 1L0XA 4KK5D 5DJXB 5EU6D 3RDTD 3QO1A 3BAEL 3QUKA 4OZFG 1P7KA 3ZTJH 3MCLL 1BX2B 1EBPA 2DF3A 1TJGH 3GHEL 3WSQL 4OGXH 4CDHA 1V05A 5DRWB 1KJMB 5CZXD 5JNYA 4HK3N 4NQCD 2XXCB 5D5MF 3SPVA 4EIGB 5IFAH 4Y88A 5K9KA 3L3HA 3P3YA 3BP4A 2C1PA 1W0WB 3FO9B 2X1QA 2AJYH 2BNQE 3PJSA 5FYLH 2HLAA 3T4AA 4WW2C 5C2BH 4E9LA 4RCAA 5GZOC 3FB8B 4HPYH 4XVTL 5B8CB 2YWZA 2UV3A 3QNZA 3K8KA 4XHJC 1WUNT 4LSVL 4M9OA 4YQXL 3TC9A 3H7LA 1EBAA 2VIRA 2CPCA 5C0IB 3ZSTA 2ORBL 3C8HA 5IVOA 4JFED 4HHAB 4X6CE 1HHKB 2C7UB 3OXRA 4D0CB 4P5TA 1I7TB 1I9IH 3QWOB 1WTLA 5DWUH 1DQQB 3PIQA 4XB7A 2CLVA 2DS4A 1TCRA 1QACA 4JFHD 3S88L 1P6AB 3WUWG 4JPKH 2IPKA 1A0QL 4P2OA 1N5AB 3QDMD 5TDPA 3SCMC 3CMOH 1AR2A 1B90A 3GGWA 5EZOH 4QRPA 5F9JA 3MRLB 3UC0H 4FFZL 2YRLA 4WO4C 5JO5A 3UTTD 3AREA 3HC4H 4HUVB 5DJYA 4PLNC 3L3GB 4BQBA 3IF1B 2J5LB 4PJEE 1NEZA 2NY2B 1NCCH 4W70A 1IQDA 2ZKHL 2BVUA 1UCBH 2OXGA 1VKXB 4FXKA 4RBPH 5CINH 5LCVL 2GCYB 4YGVB 5L8KB 1D7FA 2W9EL 1IGIL 1ZANL 4LPVA 4OV5B 4RMRA 5D5MA 4MQXC 3KLAA 3RNQA 1BGXL 4U1IB 1P1ZB 4JM4L 4G5ZL 4K8RC 1U91B 4PYHA 4YHMH 5TDOA 4GSDL 2FX7L 3SKNB 1RUAH 3QRGH 4IJ3B 5I1JL 4KU1A 3AXLA 2W0PA 1ZV5A 1FRGH 3MRKA 5DK2A 3QFJD 4E41D 3QUZC 1I3GL 4ZTOH 5TPWH 3ZMRA 1EJOL 3IFLH 4R0LA 2W9LA 5GGVH 4P2RD 4YDIL 4BH7B 3MNWB 3FJTA 3OG6B 3BO8A 4OSUL 5HHNB 2L4OA 4HCRH 4OM1L 1G7QB 4GH7B 4X80L 1FZJB 1DBML 3LN4A 1U8HB 1XGRA 4OUUA 5GRUH 4F15B 1UA6L 5J8OA 1PBYA 2B4CH 4XMPH 3TCLA 1WFNA 3MRCA 2AAVA 1TJHL 3NCJL 5DJCB 5D6DC 5KSUB 4MA1B 1LP9E 5LGKA 5I66A 1RVFH 4DW2L 3KPRE 3MRDA 2IJ0C 4V1DB 3BKYL 1LDPL 3C60C 1S5HB 3EJYD 1T1YA 2FGZA 2K9UA 2A6DB 1EVTC 3LHPH 3WE6A 3GSUB 3PQYE 3SKJL 2DRUA 4XPFH 1ES0A 4LRNL 4Q74A 4JQIH 4LEXL 3PDOA 3Q6GH 1ZGLB 5DJZA 1OM3H 4HWBA 1PSKL 1KIPB 5DEZA 1EHXA 4I18A 2R1YB 2OR9H 4RBPK 1D6EB 2WQRA 4BFIA 4EN3D 4DZBB 3LEVH 3FB7A 3B9KD 1KTKE 2FX8H 3ULVC 4OZFH 1FNHA 4K55A 3DVFA 3C5ZB 4XVUC 5FF6A 4Y5YC 5HYJA 3T0EB 4KY1H 2W07A 2CDGA 3P0YL 2V5MA 1QP1A 1SBSL 5I18H 1ZS8A 1NFKA 4JRYB 2R0KH 2IBZY 1MEXL 4LCIL 4KKLD 4NO2A 1NGYB 2IG2L 5F7EH 5KJRL 3O4OC 2UYLA 5EBLB 4ZDHA 3MRRA 5F7MC 1AD9A 3IKCA 5ISZA 1PG7L 3STLB 3UTSE 2I9TA 3RWEB 4HPOH 4NFDA 3JV6B 1A6VL 1YY8B 4J4PD 2DICA 3MLSL 1AQDB 4IOIB 4R90L 4GJTB 4YHZL 2F5BL 3MFFA 3HE7A 3UPCA 2AXHA 4G6MH 2D7QA 4GXUN 1A7NH 1AO7B 4P3CH 3OHXB 5D7SH 4YNYB 4BK5A 1I9RL 1KTDB 2F54E 2GTWA 1BEYH 1RIUL 3QDJA 3MSPA 1NUNB 4LPUA 4UMGA 4ZSOE 2GQHA 3U7AA 3D39D 4L8CA 1U8PA 3Q48A 5E8PA 4JZNA 5KS9E 1YA5A 1CFSA 1DL7L 3OQ3B 4GBXC 4CRPA 4HQQL 1NGQL 4QHMB 3V5KB 3WD5H 5HVHC 3EYFB 4E42B 5HHOA 3C6LC 1CXLA 3MRQB 2XPGA 4IM8A 3GM8A 3MOQA 5HJ3A 4ODVH 2ESVB 5DFTA 4M93C 4UI2A 4QYOB 4C4KT 5C0CB 5KSBB 2YSSB 3D2UA 1XF5A 5C0JA 3C5JA 5I1DB 3MGTA 4RAHA 4PY7A 5TQ0H 5ABDE 4M3JA 3SGJC 5IM7A 4I0CC 3KDMA 1G6RA 1CGUA 1EJ6A 2AJ3A 5T1KD 2DLHA 5HVWA 1A2YB 2RJMA 1EFXD 3QDGE 1QOKA 5JXEC 5BS0B 2GFBB 3HFMH 4QXGH 2GAZA 4AEFA 3KHQA 5IEKA 1UWGL 3QDHA 3I6GB 4HS8H 5CSZB 2DI7A 2VWEC 4JKMA 1I4FA 2EE6A 4WW2F 4F8TA 1U3HA 2VABA 2XKNB 2BSTA 1AKJD 4PJHB 2H26B 2E6QA 4GW4B 4DKEL 4NQUA 5E2TL 3F7RA 4LLVB 1QSVA 2IPTL 1UZ8B 4GRWE 3BW9B 5EOCJ 1IKNA 2OMNA 3ARTA 4L4TE 4JZJC 4Z0XA 3QUMA 1QYGL 5ADPH 1NBVH 5E2VL 1H5BC 1W72L 5ICXB 2ARJQ 4FTVB 4R3SB 1KEML 2J4WH 4P4KC 3VWJA 5INCA 3FQXA 4H8WL 3IU4L 4MNQD 1GGIL 4CW1B 1SJXA 4Z7VF 3L95B 1EGJL 3T2QA 1V3MA 3EUUA 1Q9KB 4QTIH 2DMKA 1LE5B 5FCSH 4LFHD 2DDQL 4DOHB 3HE6C 2J88L 4R7NB 5HHXH 2HKHL 3KYKL 3S5LB 1WBYA 3OKEB 3UTPE 4JFPA 2W59A 4JAMA 3ZYIA 4C55A 1K4DA 1BAFH 4MCZA 1CIDA 1T21A 3E6HA 4OIIL 2RCSL 1JHTA 5CJQH 1H3WM 1NMBH 1RFDH 5IVXF 2A9NH 3V7AE 4XAKE 3ARGB 2PW1A 3EJJX 3WFCH 2HRPH 5IT2L 5IB2A 2WINB 5B21A 1JWSB 2ADJB 1R24A 4U0QB 1UXWA 4WW2A 3F65A 3PV6B 4JRXE 3K3QA 4Y16B 5T5NG 4XNMA 2DL2A 2VLJA 1BVLA 4QNPE 1OT2A 3QYCA 4X4ZA 1R0AL 4HF5H 1N64H 2XTJD 3EFDL 3BFOA 4OT1L 5IWLC 4Z7UB 3KYMA 2F5AH 1XF4B 4XP1L 5D7IE 1A3RH 3MUZ1 4JZOB 5CP7B 1C1EL 1U0QA 3R1GH 4JY5H 1F3DH 1HYSD 2OSLA 3OKOB 3DX7B 3EO1A 2XI9A 3G6AA 3CLEH 4K3GA 4QLRA 5D7LE 4LSSL 4JPIB 2X9WA 43C9B 5GGQL 1HIMH 3QZWB 3SCMA 1SY6A 1YY9C 1IEAB 3NBNA 1HHHA 1IT9L 4ZNEE 1SYVA 3S35H 4JFOB 3MREA 3DVGB 2P8PB 4KXZH 3MLXL 4PRBB 2C3XA 4Z7VA 5JMOC 4H5SB 3VI3F 5DMKB 3HAEA 3ULUF 4LLMA 1U8KB 1QQDB 3EYOA 1P4LB 5C09E 4U0RC 3ZLQC 1EPFA 1Q9LB 1WVZA 5F3HA 5FYJE 4TNVF 1QLFA 1UKQA 1M71A 5JOFB 4XCYA 4LEOA 4R4BA 1MI5B 2YKLL 2XFXB 5KVEH 1UH3A 3CZFB 1EAJA 1BIHA 3WS6C 5IVXA 3T0DA 4MNGA 4X98A 2KH2B 4OCYH 3RWFB 3ELAT 5DJ0B 3B43A 3HN3A 3ULVF 5EU5B 5D7JC 2VISB 4X5LA 5I74B 3MMEA 5E4EC 4L9DA 3IRZA 1D5IH 2JJVA 2Y36H 1Q38A 2R0LL 1N0XH 4U6HA 2OJZH 3UDWA 2VL5B 4OKVB 3QUZA 3B9EA 4KRNA 3B5TA 3RX7A 2OL3L 5EU3A 4QHLB 3SE9L 4WU5B 15C8H 4HLZG 3NFPB 4HBQA 1MFAL 4P23D 4NQEB 4QHNA 4TVPL 1MH5B 2JLLA 1XGPB 4ZNCD 1A7OL 5HDBE 1JTOA 4LQFL 4IRJB 3OAUL 1UB5B 1Y18B 4G8GD 5FM5O 5ERWB 3BPLC 4AM0B 3GIZL 1E4XI 4ZPTB 5D6DA 1A9BB 1FGVH 4IIQC 3WN5C 3O3EB 2O61B 2EYRB 2NY3C 1QFHA 3GMMB 1FG2B 2ITDA 4I0KA 1BQUA 1RJLB 1MHHB 3KPLB 4LHUD 4P0DA 4LCCC 1U6AL 1W72B 3OKKB 1AGEA 4JB9L 5TH2B 5E5MB 1DN2A 2CRMA 3VXSA 2I60L 3IB4A 3FQWA 4OZIF 1K8IB 4Z7NF 3TYFB 4HWEL 3VU2A 1BD2D 1GH7A 3CVHA 3WL9A 4YHOH 1OTUC 2AV7B 5E56A 2DQJH 1S7TA 5T1LB 1FYTE 3N1GC 4AIXA 1JYXA 1T5XB 1F3RB 1NJ9B 3QAZB 3GSRB 1OSZA 2AKRA 4KJYB 5EOQL 4D0DA 5DMGC 2QSTA 4PD4J 4J3WA 4A2LA 2OP4H 3P4MA 2BOBB 4MA7L 3VFPB 3FT3A 3B83A 1BWWA 4LDEB 4MHHI 1WZ1H 2OTWA 2HN7A 2P45B 2A6KA 1NDGB 4Y5VA 2E7BA 1DE4A 3CSPA 3KYOA 1JZ7A 2WWKO 3GSXB 5D7KE 4ELKA 3GSQA 4FQJH 4OI7A 1P4IH 4NSKB 1JWMA 2OZ4A 5C0GA 3MNVA 1MAKA 4MWFB 1G7MB 1OY3B 4LASH 5BJTA 5FYJH 2N7AA 4U2YA 4KMTH 1IGTA 3C5SB 3G5VB 3U0WL 2H45A 3BT2L 5SWZD 4JANA 2W1NA 2V5TA 2WANA 4M8QB 4JO1H 1ZWIA 2WP3T 3QIWC 4EEEA 2JJTA 1I1FA 1RY7B 4FQHB 1FZMB 3C2AL 1DQJB 4Z18A 4LSPH 4KAQH 1IVLA 1AHWA 1A64A 4L3EB 4Q6IC 1TFHA 2HFEA 1T7VA 4FFVD 1FE8H 4JDVB 3O6MH 4IEFB 2BNRA 4K2UL 2XA3A 2AGJL 3C6LA 4OZIA 5BVJB 5ID0A 2X1WL 3RVXD 5JZ7D 2BNUB 2BVOA 1YJDH 4FQIL 1QFUH 1R3JB 4OAWA 2ENSA 1L7TL 5FYLD 2HFTA 4F80A 3T8XB 4PGEB 3VA2C 3EYQD 4JO4L 1KENL 4OLVH 1T22A 1F4AA 2UWEB 5HHPA 5HGDB 1A22B 5GRJH 3SDDD 2P5WA 2AXGB 1JF1A 5JORB 3ZDXF 2EH7L 1Z3GL 4KH2A 5JXEA 4I2XB 4LK4A 4FQ1H 1JBJA 3RUGE 1SJHB 4QKXB 3T0WA 5K33A 5KSAB 2IFFL 3D69A 1XR9A 3TN0B 3IJSB 3JWDC 3ARDB 4LHQB 2WBJD 3VFOB 4P5MB 2OL3B 1X5JA 2X4UB 4LVNB 4XVSL 3DUUA 4HGMA 1Q1JH 1RJZA 3VXMD 5I19H 8FABB 4HAGA 3UJTH 4HIEA 4PJCF 3FOMB 1QFWI 1FAIL 4ODTL 4HLZH 2R2HA 1MPAH 3CC5B 4HC1A 3FRUA 2J3SA 4JZJA 5DDHA 1CN4A 5DFVC 3W39A 2HJKB 1U8MA 3LMJL 4FS0A 2XA8H 1H5BA 3PL6D 3I2CH 4Y1AB 4JR9H 2AABL 4P4KA 4X8JA 3STZA 3UBXB 4PRAA 2HVKB 2NX5E 5E6ZA 3DV6A 2VN7A 3HG1B 2P5ED 4DJMA 1F6FB 4P9HL 2HFGH 1QSEE 4HZLA 2O5YL 2VR9A 1D9KB 2GITA 4O2EA 3HE6A 5SWSE 1Y6NR 5HHQA 1MFCL 3WNKA 5LXGH 3SDAD 2YPLE 3WLWC 4TUJB 4G43B 3RFZC 3V5HA 4GG6F 1GPOH 1GOHA 5JHDB 2AP2A 1A7PL 3EYUL 1IZJA 1J86A 3K80A 4WJ5B 3ARFA 5EUKB 4D9QE 1QD0A 4UT9H 1CR9L 5A2LH 2A74A 3DXAA 2IADB 4ZFGH 2IPUK 4JFYB 1JL8A 1FJ1B 1NDMA 3T0VA 3T3MF 3QXDA 4PRDA 4S10A 3QNYB 3FONB 5JXAL 1K6QH 1ZSDB 3BP7A 4ZPVB 4PG2A 4WI9A 4S1RH 3C9NB 1LK3H 3ULSB 1YMMA 2VXTL 4Y4FB 1ODAA 3RVWD 1FC2D 4E5XA 3DYOA 2HMID 2VLME 4XC1L 5CJOL 3SO3C 5I15H 5IWLA 3L9RA 1AFVL 1NBZB 4PJCA 4YDVA 4LPXA 5DD1L 3X3GH 2NY1C 4KZDH 3GJFK 4F7CB 1MJ7L 3ZKXC 3HLAB 4XGZA 2Z31C 4ZUUA 4XP5H 4HX1A 2BMKA 3S36H 5DQ9A 2AQ2A 4G6AD 3SDYH 1HHGB 2NXZD 1S9XA 1QFWM 4MYWB 5E2WH 1YEGL 1BQLL 5FA3A 2YUZA 3KPSD 4D3CL 1WCBB 5EIIB 5IESL 4NGHH 4OLZL 1YPZB 1KLUB 3I6KA 1IC4L 4NRZA 5FUZH 3RJDA 4WNQB 1KCSL 2OM5A 4JFDB 2XYCA 4O9HH 5C08E 4JHBA 4R4FL 3WNNA 1VFAB 5DR5L 2IAND 1T2XA 3L6FB 3DHJA 4P5KB 4PJ7E 4GG6A 1DVFD 2VZOA 4ZUSB 1RULH 4NZDA 4GS7B 1EHLL 2BX5A 5HDOA 3MRMB 1X6NA 2EDYA 2GHWB 4QOKB 4Y5XB 3WS6A 1OTSC 3RWJB 4NQSB 1OGTA 1ZHBB 1CDHA 2HJFB 1CE6A 5CLTA 4DVRH 5IHUL 5J56B 3D0LA 4X6DF 4G9FE 1NL0H 1E4XH 1NEZG 3MV7A 1MCLA 5LWYL 1DDHA 3HZVB 4B0MM 2EDDA 5EO1B 5CD5C 3LD8C 2FHCA 1BQHB 3QNXA 4K9EC 1IGML 1MCHA 2ADIB 2F53D 1IGCL 1DQML 4OGAD 4BSWA 4LAQH 2CSPA 3MJ9H 4MQ7B 43CAB 5A2JH 2DQDH 4X6EA 4R2GD 3WS3B 4BKLA 2VQ1A 5GGVY 4KJPD 4I3SL 1GXEA 2GSGB 5I1HL 3VGFA 5SWQA 1GRWA 4QRRB 1NFDB 1IKFH 1A6TA 2FJGB 1A3QA 5AUMB 1BLNA 2WBWB 4O2CA 4M5ZL 3S97C 2GYSA 1AC6A 1NCUA 3H42H 5EORL 2E6PA 3WN5A 1G7PB 1S7WA 3QEHA 1YDPA 5T3XE 5EU6B 2OR8A 4YHPA 3LIZL 4WEBL 4WHTB 5F7LB 1TTGA 1EO8L 3DNKA 3RY5A 1NLDL 1MFDH 4D8PB 3TA3D 1MOEA 4MD5B 1RMFH 5L2JA 1FL6B 1JNNH 3UAJD 3MRNA 1PW3A 4JQVA 5IB5A 1FO0L 2FYYA 5I1KH 4JGUA 5I73B 2QSCL 4HK3J 1G7LA 2W65A 4NQCB 3VFMA 3IXTA 3BRDA 1OAYL 1DANT 2J8OA 4Y4HD 2J8UF 4QGTA 1P9MC 4PUBL 3FO1B 3HUJB 3P9MB 5DHXB 1GGTA 2D7MA 4DAGH 2DD8H 4X6DA 5T1MA 3I6LD 3UYPA 2DL9A 4JFZH 2B1AL 3WHXA 1RPQA 5CSGA 4PRIE 4EXPX 3MRBA 3OV6A 4O58H 2HT2C 3G04B 3SJVA 4JFEB 4N5ED 3L5JA 2FATH 1QLRB 5FGSA 3I3EA 4KTDH 4WEMB 4KDTC 2YD8A 3O6FC 2QSVA 5DD5H 4PTUB 2G2RA 3MLYH 3QDMB 4MZ3A 4WU7A 4PJBE 4NC0B 4HGKC 4LCWE 4YFLI 1JI2A 5D2LE 5ITFA 3M8OH 3T09A 2Q8AH 2B5IB 4LIQE 3FFCA 5FM4A 4EUPB 5I1AB 2DB8A 5E95B 2YZ8A 4GMSH 4NOFA 3BH8A 3O4LD 5FYKE 4F33A 3FAXA 4ZAKD 2ZCKH 2CMRH 5FXCH 4NC2B 4LDLB 2NTFB 4HDIB 1YNKL 4X4XB 2EO1A 3UTZA 3UTSD 4GW1B 2ICWB 4RNRB 2OX5A 3FN0H 4QRTB 5DJDA 1A1NB 4KHTL 2FD6H 2Y5EA 3O45A 5D8JL 2QL1A 2ZCLH 4PJXF 1A3LH 3WXVL 3RIFK 4JFXA 3QBTB 1U9KA 3OX8A 5BO1L 2HTLD 3CX5K 4RRPA 1E4KC 3HC3L 4YXHH 1C16A 4XP4L 3U1SH 5MEOA 2J8UA 3GHBH 5MENA 3I3BA 4F3FA 1X4XA 4NZRL 4PFEA 4DQOL 3AS3A 1RURL 4PGCA 5GJTL 1JHLH 4DUVA 5KN5A 1CT8B 3LN9A 1UM6L 4KRPB 1KIQA 1X44A 2NCMA 3QFJB 3HNTH 5FO7B 1LEKB 4TTDC 2EDQA 3WFEH 4PLKC 3B8SA 3HHRB 3PABA 1XCTB 1YNTB 4JDZA 2I07A 5TDNA 3U30B 5E6IC 1CD8A 2VLRD 2X4SA 2SEBA 3TO2B 1R3KB 1BZ9A 5FA4B 1YZZA 4XNYH 3ROLB 1FCGA 1CD1B 3V95A 1CK0H 4I5BB 4L9LC 4PP2A 5JOPD 4OZGE 2BXYA 2RB8A 4CN4A 2LABA 3A0OA 1MIEH 5CZKA 4Q0XH 4NM4L 4JO2L 1IC5L 2MHAB 3AMKA 1KJ3L 5LJYH 3GMNB 3QDGD 4RWYH 5I8OL 1K4CA 3BGFB 4YXKH 5I17A 1WIOA 2BC4B 3O0RL 4LLDB 3T2PA 3F6LA 1KXTB 3VXRA 2CLZA 3DECA 2C9AA 2WUBH 4TULH 5AG8A 5JPNB 4BSVA 4L4VD 5D1QC 1JV5B 1NLBL 2NY5L 3FQTA 2FZ3A 2CK2A 1PYWA 2V9RA 5GHWH 2W60B 3AM8C 4Z7OE 2HT4D 4YZFF 4KTEL 5DRNA 4PJXA 1MIML 4PIRF 4K7PH 4L3CB 4KV5E 4C57C 1G9NH 1F00I 4M02A 1I9JL 4PJ8D 4OI9A 4EN3B 3DARA 3B9KB 4PJGE 5GRVK 3VFUA 2WIMA 2G5BA 3BUYB 1ZOXA 3D85B 1F2QA 4LARH 1FO0B 3GKZA 4IHOB 2DOCA 2D4FA 5BV7B 2D31A 3U7WL 4OLYL 2GTZA 1S78C 4CVZB 2NW2B 3NN8A 2AJSH 3SHSA 3R06A 1M7DB 3P40A 5CWSB 1HILA 5KVGL 4Y8AA 1CLCA 4N8CH 5DEFB 4JREB 1D5MA 1GZQB 1CXEA 5B8CC 3BN9C 3CFJB 3GSNB 1EX0A 2A6IB 3GMRA 1WT5C 1VFBA 1KTRL 3PWNB 4LGSB 2AEIT 5AYUH 1T89C 1IGJB 1WWAX 4NRXA 3DO3A 4NKDA 4X4YA 4PLOB 2Q86A 4HWBH 3DMMD 1B4JL 1WIUA 3H8NA 1XR8A 5IW6B 4Z0BH 3QEGH 1G9MC 2QJDA 3D39B 4WUUB 4NQTA 1LE9B 2VXQL 4OCSH 3BZEB 1ZK9A 4D0BA 1UM4L 4FXLA 4U1KB 3P4LA 3VH8A 3UPRB 3QULB 4N90E 4K3JL 4BSJA 3MC0A 5HYFA 3ESUF 1AXSB 3CCHB 4M7ZB 5CGMA 3OR6A 1I7RB 4ZTPH 3WLBB 1VPOL 3CFEA 4X4ME 2B1HH 5T3XH 3DTXB 4UUJB 2EIDA 2J5LC 1LO3H 1JGDA 2NY2C 1FFOA 3C87A 3VRJB 4IS6B 3R8BB 2YC1A 1N8ZA 5T1KB 2FO4A 4M6MH 3UO1H 3WXWH 4M1CC 4XAWH 5DS8B 4WEUD 3LH2L 4IRSA 5DQDL 2BJMH 2IQAA 4G3YH 4Z8FH 1JTPA 1A1OA 1ZLSH 1J05A 4M48L 1AY1H 2ZNWA 2QBWA 3LS5L 3HAEG 1NGWB 2AXFA 3ZDYF 3RQ3A 4H26A 1AKJB 1LO2H 1EMTH 2QQNL 1RU9L 4X7SH 2CGRH 2I5YL 4E0RA 4HW6A 2MCG1 4ZFZA 1RZGB 4F7PB 1NBQA 2HP4A 5FYJD 4ZG1A 4PRPD 3NCYS 3TNMA 4RMQA 1F02I 3TBWA 4X0KB 1DQLL 5KG9B 1R5IB 5K9JL 1GL4B 5CAYB 1BBJA 4XVJL 4YWGL 4X7TA 3MLZH 2GJ6D 3ZL4L 3IDXH 1M7IB 2MPAL 3MR9A 4F15C 4GKNA 4WV1A 5J13B 1SYSB 4S2SB 3C09C 1G6RH 1N26A 4UTBL 3VCLB 5DJ2A 1V3LA 3TT1L 5CGYC 4AT6A 4MNQB 2R0WH 3MLVH 4MA1C 4HIIA 4PRNB 2VC2H 5DJAB 1MRDH 4FG6C 4K7FA 1ZLWK 1YECH 1ZHNA 3MV8E 4EI5D 2YK1L 1YEFL 2H8PA 3JWNC 3SKMB 2ZUQB 3QIUA 2JJSC 4J3XA 5HHVL 1FZOA 2BY0A 3LPFA 3RIAK 3QO0B 1JGEB 4NPYA 3LKSA 4M6OL 4U7SA 4MJID 3V0VB 1AGCB 5BQ7A 3WEXA 2ZPKH 1DEEA 4Q2ZB 5GGUB 2XRAH 2EIZA 3MLUH 3C5ZC 1G0YR 5IW1B 1U95A 3T0EC 4DGIL 5TE4L 4ODXB 4MDIB 1KJ2A 1BFSA 4NNYB 2NR6C 1AJ7H 4X5WA 1JCKA 2XTJB 5E99H 3PP3K 1IE5A 1FFPA 4XCNB 4BZ2L 2FB4H 1T03L 4G6KH 3B3IB 3KWWA 3W2DH 2V2XA 3BP5B 5MERB 3RGVB 2NXYB 5J1AA 3O3BB 4PRHD 2JB5L 5HYSA 2AJXH 1BIIA 1YYMH 5BVPH 4WGWB 4N8PA 3BD3A 1TJGL 3MRPB 4I1NB 3LY6A 4FXGB 3V6FB 1KULA 1SVCP 2EXYC 2FJHA 4ZS6C 4MDJB 4OGXL 3NCBB 1ADQA 3WJLC 1XGQB 3E1F1 5IB4A 2PYFA 3OJDB 1NAKH 4R9HA 3EOYG 5IFAL 1PQZB 5B3NA 2JCCE 5IJKC 7CGTA 2FEEI 2LFGA 5D7KD 5FYLL 1NMAH 5C2BL 4HXAH 4X7DC 4HPYL 1JYVA 1HSBB 1T3FB 1IRAY 5D1ZD 1OGAD 1KIRB 4X8XA 3SDCD 1ED3A 5TF1H 5JW4Q 1VFUA 3BE1H 2YRZA 1T7XA 3TT3H 2JIXA 3MV11 3FB5B 1E4KA 3LQAH 1X6LA 3TFKD 2FGWL 3RZWA 4P48A 4I4WB 1I9IL 3PHQB 5DWUL 4NDMA 3BVNA 4HKXA 2KQNA 4JPKL 5E0QA 2QSQA 3HRZB 3MCKA 3VFRB 1SY6H 3GSWA 3D3VE 3DPBA 2Z35A 3EYVA 4YIQB 1AO7E 1X7QB 5EZOL 4FABH 1M6OA 5F93C 3GMPA 3HAEH 1TZIB 4P23B 4JFFD 2B2XH 5E6IA 2W9DH 4YDKH 2X44D 3HC4L 2FR4A 1LEGB 5GGTH 1WBXA 3V52H 4RQQA 4FQQA 1QSFA 4PREB 4R97B 5T1DH 4L9LA 1NCCL 4G8GB 2GK0B 4PGDB 4ZOEA 3GFUA 1LHZA 3JUYA 4CJ1A 1UCBL 3ARBB 2PR4H 5F70A 5CILH 4I3GA 5CINL 1UQSB 2CQVA 1I1AA 3S7GA 1XF1A 3H9SE 4WWKA 4LHUB 1NAMA 5KSBE 4PJ5D 1IM3B 1V3JA 2DWDB 4AH2B 2X89A 1HKFA 5IVZA 2BRRH 2WAHA 5DD6B 4QRSB 3OKMA 2YBRA 5D1QA 4L8SB 2ZSWA 4X6FA 5GSVA 4YHML 3TBSA 3L5WA 4ZUTB 5IFJB 4TUOA 5ANMB 4MXWL 3AM8A 4JM2B 1BD2B 1FRGL 1RJYA 3V0WH 5TPWL 4ZTOL 3IFLL 5GGVL 4XMLH 5IHZB 4WTWA 1BHGA 5LBSH 3TVMD 3TNNA 1BX2A 4DVBB 3F62A 4JDTH 4POZD 3LRHA 4XTRC 4HCRL 1DQDH 1JNHA 1IILE 2EDHA 3U4AA 3SGDI 3G5ZB 3OR7A 5DTFB 4PJHE 4K7PX 3QI9D 1A14H 5JA9A 5F6HJ 3RI5F 2CDEA 1KJMA 4X5XA 4XMPL 4JHAH 2BHUA 3LZFH 4HT1H 5ADOH 1W0WA 1RVFL 3DIFB 1FYHB 2Z92A 3ULUH 5DHYA 4MJ5B 4HJGA 4Y16C