4OZ4B

X-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSFYLRTFGGGTKLDIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVRWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab of monoclonal antibody, heavy chain
publication title Identification of structural determinants on tau protein essential for its pathological function: novel therapeutic target for tau immunotherapy in Alzheimer's disease.
pubmed doi rcsb
total genus 50
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4B01
1OAKH 4JKLA 4ZMAT 4U6YA 4KK9C 1T0PB 4POYA 3HUJF 1MFEL 1MPAL 5JDSA 3ARFB 3VXTA 4PJCB 1KCSH 1LO3L 1F42A 1RUAH 3S98A 4ZOCA 1YN7A 4P5MB 4M1CD 3VXUA 3O3UN 2MHAB 2W9LA 4JAMA 5CEYB 4PGCA 1NGYA 4C57C 5K9OB 4CNIB 1PW3A 1ZHLA 2R0KL 1UM5H 2BVQA 4OKVA 5CGTA 3CCHB 5EBWB 1KCKA 2ZSVB 4ZFGL 3TPUA 2FJFB 3HNTH 5E2UL 1XF1A 3QT2A 2WWKT 1OGAA 4P5KB 4PYHA 3T0VA 4RX4A 2EDOA 3MGAA 1ZGLM 4UTBH 1UH2A 3TN0D 3QBTB 2ENSA 5E08L 1DQQB 1P1ZB 1EO8H 3CPLA 4Z5RB 3K0WA 4AQ1B 3QUZD 4OCXH 2IH1B 4PRHB 2XZAL 5DFWH 3BE1H 5DR5H 4GW5B 2E8YA 4R8WL 3QCUL 2B7DT 3VXSE 5DD6B 2H26A 4D0CB 4N0YL 2CUIA 2XY1A 2LFGA 5IMOA 3VXPA 4DVRL 5BV7B 4GQ9H 3OAUH 1G6RL 4FZEH 4JN2A 4YHOH 3C60B 4P46D 1CL7H 1Z3GL 3HUJA 2YPKB 3UPAA 2AVGA 3CX5J 2HFEB 4P23A 3C2SA 5LGJA 1K5NA 3PP3H 4WUKH 1A3QA 1G84A 4EN3A 2WBKA 2Z31B 3WHE1 1VFAA 3RL1A 2NY1D 4NHCL 1ND0A 2ADGA 4AJ0A 2AI0H 3F5WA 4AQOA 4EDWL 4PG2A 5HHVH 3EHBC 1WLHA 5JOPE 4G5ZH 2W65B 4K3DH 2V5YA 3O9WA 3BEVA 1KIRA 1BZ9A 2HLFD 5EU6A 2EYSB 4X99A 2CIIA 3CIQA 2IANB 1RV6X 4FXGA 5DK0B 3ZE0E 4OB5L 4PG9B 1GGCL 5D1ZA 1DE4B 4FQ2L 1NAMH 4MWFB 1MHHA 1PLGL 4I77H 4PJAE 5EBLA 4NCDA 3KXFD 3IS0X 4XXCA 4Y5YC 2CR3A 3I75A 4NPYB 5D1QA 5F3BA 3IJYA 3UYRL 3MRLA 5HHQA 3D25A 1QBLH 1MHEA 5HY9B 3HI6H 1NKRA 1DLFL 1WBXB 1W0VB 5I1AB 3K8KA 1QTYT 4G3YH 4PP1D 5F89A 3V4VL 5C0DA 1ZHNB 4OZFA 4QRSA 1JZ5A 2HAZA 5EZLB 3MV8B 4IRSD 1OW0A 3SO5A 4LLUB 4XAWL 3QNYA 1UJ3A 2MSPA 4G6JH 2CDFA 4KROD 4NO2B 4L4TB 4OLYH 5A16A 2VDRL 1JTTA 3VXUE 1J18A 4RGNE 4KU1A 3B9KB 3HPJB 5E94A 1XCQA 3OL2A 5B21A 4BKLB 1JE6A 4GOSA 3MA7B 2DOCA 5DF0A 2OJEB 1PKOA 4LHUB 4NM8H 2ZCLH 3VFGL 5ISZD 5EG6C 4JG0L 2WWMC 1U8MB 1U92B 3BI9X 1FJ1A 2YRZA 3O6LH 1I7ZA 1A1MA 3FQWB 4S1SH 2CR6A 3S7GA 1H15B 1OGAE 2I60H 1MFAH 4AEIH 1EO5A 1KJVA 4JJHA 1EZVY 4ZQKA 2ZUUA 3ZYJA 1EUUA 15C8H 2Q8BL 4MXQC 3O8XD 2EYRA 2FX7L 1KLUB 3ZDZE 1N8ZA 1E6OH 3GEWB 4WEUD 1W0WB 4S1QL 1T5WA 3LKNA 4RNRB 1MAMH 2RAMA 4X9HA 2AJXH 1YMHA 1FVDB 4HWEL 5I15L 3MUJA 2VLMD 4XZUA 1FNSH 3MJ9H 1WFOA 1S7SB 2ITDA 1RZKL 3VRJB 1CLOH 5L8JB 4HCRA 1F4XH 4NKMB 4YFLF 3IAPA 1MNUL 5IKCB 1AGEA 4XAKE 2F5AL 4NZTH 4F9PC 2VB5A 5FYJH 4TVPH 1S5IH 5KVDH 4XP4L 4TUJA 1CGXA 3U6RA 4YWGL 1IKNA 2HLAA 4AL8H 2P8LA 2Y07L 5D7LE 4L1HA 5D2NC 3UEZA 2QKIA 3PDOB 1CTNA 1G9ML 1ZHKB 4V1DA 4B50A 4R0LC 3H7LA 3KPLB 2BSTA 2W38A 3RVWD 4YDVB 1JL8A 3B83A 4UDUB 3T0BA 1FQ9C 2H9GB 4PB0L 1HQ4B 2BY3A 1NAMB 5B39B 2WIIA 2ADFH 5EOTB 1RZIB 4KUCD 3AMKA 3VXQB 1D5XA 3QULB 3A6BL 2GUOA 3C9NA 2NLJB 5GSVA 1MQKH 4U1NA 1PDKA 2J6EL 3TC9A 5KW9H 3QIBD 5IEKA 4FP8L 2ADIA 2VXUH 5IVXF 3S35X 4XC1H 4TNVK 1JF1A 3LHPL 3UAJD 1SJEA 3O6MH 3O6KL 1R0AH 3S88H 1N64H 5ERWB 3DRQA 3VGHA 4Z9KB 3AB0B 4P4KA 1WWCA 4JFHD 1JGUH 4AIZA 5DLMH 1X5IA 5FM5M 3UROR 2F54B 5L9DL 3MGTA 3JTTA 4Z7QE 3WUZA 1G9EA 1K4CA 4MD4B 1X5GA 4UZGA 2ADJB 2VDQH 1JPST 2EYTA 1X5LA 3WLBA 3PGDA 4RZCB 3JXAA 3CDGA 3V5DA 1TNMA 5FO7B 1KTLA 5SWZA 3OJ2C 5LVEA 4RFNB 3BHBB 3GMPB 4HC1L 4KVCL 1P5UA 3RGVA 1XFPA 4ODUA 3EOBA 4Y2OA 1OAKL 1YEKH 3MOQA 3EFDL 3G6JB 4KKLD 4IRJD 1RUAL 4MD0A 3FHAA 1U2CA 3T65B 1A7RH 2NY0C 4P23C 4XRCA 5T3XD 1EX0A 4RCAA 1NJ9A 3VCLB 5IFJA 5EOQH 4H1LB 4U1IA 3ORJA 2VTFA 1H3GA 2LTQC 3UC0H 2OX5A 1QR4A 5CD3B 3F6LA 3ILQD 1CVSC 1UEMA 3HFMH 4IOIB 5IK3B 4KRPD 3VDBA 5D9SB 3P4MB 1SMAA 3O9WC 2DWEB 4I9WE 3DMMA 1ZWIA 4ONFH 4J6RH 4P2RD 1T4KB 5ACMA 5GGVL 4V2CB 3QRGH 1C5CL 3BPNB 3T0XA 3B5HA 4L9LB 3W9DB 3RZCD 4Y4HD 4MNQB 1OVZA 4ZTOL 3QJHB 4NJAH 4KKBC 3AM8A 3BE1L 3AREB 1I1YB 1I1CA 4XXCC 4HX1B 1TCRB 3JV6B 1S9XB 3ZE2F 3TZVB 3VI4F 2G60H 4JANA 4Z95L 2V7HA 4Y19D 2NY6C 4Z76B 2R1YA 4Y5VB 3TWCL 1QA9B 4FZEL 1H3UA 3ET9F 4YHOL 4WFGE 3VWKA 5E9DE 1NBVL 1W0YT 2C3VB 4IIQA 5IB5A 4WUKL 1VFUA 4PRDB 1CXKA 3HTLX 4J4PD 4LP5A 4XPGH 3VRLE 2HTKD 1HCVA 1KYOK 5I75B 3LS4H 2DQJL 4QTIH 2AI0L 2GW5A 4NQED 5IMMA 2E6QA 3L3HA 1TVDA 1WGOA 4XMPH 1UZ6E 2AV1B 4H25B 2X4RA 1INDH 1UJ3C 1NBQA 4UDTB 5FO8B 4MB5A 3D39B 4K3DL 5LBSH 1JTPA 4JE4B 4BSWA 3Q6GL 1T0MB 1X5XA 4XNMB 2O61A 1URLA 1KUMA 4JFYA 1HINH 2HFTA 4QRUA 1CE1H 4P48A 3FOMB 1NAML 1EVUA 4LDOB 3VXRB 2YUVA 5I8EB 3U7YL 2ID5A 1S7WA 4U33A 4P2QE 1KEGH 1JF5A 3G5XB 3RVVC 2B4CL 4X80H 4HWBL 3PV7A 4M7LT 2OK0L 1W72H 5B8CB 3OAZK 4WIQA 1A7OH 4EBQL 2R1WA 1EFXB 5DJ2B 4CDHA 1T22A 2ESVB 1NBZB 3U4EA 2VXQH 3MRIB 1FNGA 3WXVH 4CKVX 3MREA 1F8TL 3S96B 5DSCA 4L3EA 3C60D 5D72H 4S10A 5DJXB 3HRZB 3ARBA 4UIMB 1JZ2A 1NGZB 5BQ7A 1JPSH 3V6FB 5CJXA 3IYLW 3TPKA 3PQYE 3KJ6H 5DA0B 3HR6A 1G7HB 5HPOA 1VA9A 4PJIA 3K4DA 4R26H 5BRZA 1VADB 4NM8L 4EXPX 1R3HA 3VXMD 1NGQH 4B7IA 1K85A 4PBVC 2W60A 1X5KA 4HAGA 3BISA 4KUZL 2ZUTA 5E1AA 5I19L 2MQ3A 3NBNA 4CVWA 4S1SL 2IBBA 2FHBA 2Y5TA 5SWQB 4N8VG 2I60L 1MFAL 5JXAL 4HGWB 4GRLA 2BP3A 5FOBB 4NQXA 3RKDC 4MXVF 3SDCD 4NT6B 1P69B 2NW3A 15C8L 2DL9A 1ZLUH 1IFHL 5EZJB 4TPRL 3FT3A 4X7SH 2X4NA 1UYWL 1X6LA 3VFWB 3PE9A 4BSVA 1MAML 1DBMH 2CPCA 3QDJB 4H8WL 4R3SA 4UTAL 1JGEA 1FPTH 3V52L 3PIQB 2XQYK 5I74C 1R3LB 2FSEA 1UT9A 6FABL 5I1EL 1QLFA 3NIGE 2PCPA 5I73B 4RDQG 2EKSB 5EU4A 1JBJA 4BFIA 4O2CA 4HKZB 1CLOL 1XF2A 4E41A 1F45A 4HWNA 4OQTH 4P4KC 1F4XL 4YDLC 5CJOH 2NY5H 3EIFA 5ITFA 2PO6A 4N9GA 1KCVL 3KHQA 2ZOLB 3WIIL 5IVNA 3RWCB 4NZTL 2MFNA 1AXTL 5FYJL 4UT6H 4TVPL 1V05A 3K81A 4X6EB 2EDWA 3O0RH 2GEEA 1J1XH 1I9JH 3MLUL 2IF7A 1FFOA 2W0KA 3DI2B 4WO4C 4KH2A 5JW3H 3L6FB 3B9EA 4L4TE 3WV0A 5C8JB 5HHOB 2CJUH 2ICWB 5DD1L 3GMMB 3ARGB 4ELMF 2C3HA 4D8PA 3F7VB 4WHTA 1AI1L 4NZDA 5HYSB 1S7UA 1IM9A 3BWAB 4F2MA 3PL6D 2JCCB 4EI6B 1KN2L 3B6SB 1FG2B 1T2QL 4GSDH 3ALXA 4FABH 3BN9D 5CSZA 3C8HA 3FB7B 3KPOA 4K7FA 5DI8B 1NC2B 4PGBA 5IF0B 1W72B 5EO1B 5KW9L 3QI9A 4R96B 2DJ4A 2IPUG 5BO1L 4ONGL 5A43C 4QGTA 2BC4B 4MJID 1U8LA 2Z91B 4L4VD 5F7LB 1N3NA 3CVHB 4OSUH 3O6ML 1R0AL 3S88L 3WL9B 2P46B 3QG6B 3HAEG 5ACZB 3PWNA 4IRZL 1JGUL 5DLML 1C08A 3WIFA 1DFBH 1VB9A 2OBGA 4YFLI 4XNYL 1G7QA 4NO0A 1JRHI 1OSZB 4H20H 4M7LH 3ULUF 3H9SD 1II4E 3LN4B 3BW9A 4Z6AT 4LGPB 4TVSa 3EGSA 3LPWA 1BQLH 3MJ9A 4PLNC 1IJ9A 5CBEB 3RWJA 2VLJB 2LU3A 5JO5A 4ERSL 4ELMA 1MI5A 2VLKD 1D5IH 1D9KB 5KS9A 1JK8B 2J3SA 5IWLC 5I17B 4BELD 4QT5B 2OCFD 2VXVL 4CU6A 1KPVA 1IKFH 4O02H 3RTQD 3RVUD 4FTVD 4ESKA 1F4AA 4TULL 3VWKC 3LD8C 2YK1L 5HDOA 5D4QA 3P4OB 4UOJA 5IM7B 4BUGA 3RZWA 4NM4H 1PQZA 5FYKD 4DN3H 4GRWH 5SX4H 3QDMD 3UC0L 4PJFB 5EPMA 4HKXB 4Z7NF 3FRUA 4KQ3H 4KJQC 1YDPB 5IEHA 1RUQH 1J1PH 4X6CB 3KYKH 3GMRA 2F53A 5CGMA 4L8SA 5FK9B 4E41E 5GGSY 4ONFL 5HYJD 5IMKA 3PDGA 1RIVL 3NAAH 4RAUB 4XHJC 3QRGL 1KG0A 3STBA 1V5JA 1U8KA 2NY3B 4WENB 3SGDI 4D0BB 4Y1AD 5INCA 5DRNB 3MA9H 2ATKA 2F54E 4U2ZA 2G60L 3QQ3B 3V0WL 3L3OA 1AKJA 4GBXA 3O2WH 3GB7A 3QH3B 1JGVL 1ACYH 3KPRD 3MRPA 1NFIA 3DXAA 3O3BA 4H0IA 4HDIB 5HVWA 5BCAA 1F5WA 3G5YB 2UZIL 4GLRI 1CWVA 3ARTA 4I18A 4XPGL 1P7QA 1LO4H 3LQAH 3QSKB 4NO5B 4P57A 3QP3A 2JJVA 2QADB 1MELA 4U6HA 4N8PA 3G6DH 1EK3A 1KIQB 3SDYL 4UMGA 4NQSB 1INDL 3X3FL 3V0AC 4WUUB 4QTHA 2OTWA 3EAKA 5D6DA 2F74B 1SY6A 3HR5A 3DHMA 3TBTB 3FB6B 4FQXD 1ZVYA 4RBPK 5IV2B 5C0FB 4P2OA 3CFKB 3RNQA 4WFFD 1KACB 2WMPA 2RB8A 1NCNA 1IRAY 2YMXL 2JJTA 5FKPB 5F7UA 4IHOA 1UH4A 5HD8C 4OBSA 3D0VB 1P6AB 2G5BA 3O6FB 5JW5A 3U9UA 5FDWA 4OF5A 4YFDB 1FVEA 1PGRB 5TGBA 1W72L 3HA0A 4XVTH 4U1SA 3PABA 1G7LA 4JRXA 1A7OL 5ESQA 2EH8H 2KQMA 3ARRA 4MDIB 4POZC 2DMKA 3GO1L 5KS9E 1SM3H 3CVHL 1CFQA 1EFQA 2ICEB 1AGFB 3VFUB 4XCCH 4LSVL 5FYJE 4TVPE 4M4RA 2OLDA 5D72L 4M1DH 2JB5H 5E6ZA 2D7OA 1ZA3A 4HPOL 5HI4C 1MCBA 1JPSL 1J88A 4NQVB 2H1PH 3KJ6L 4QF1A 3VXOB 1Q9WA 2AJVL 4LDEB 5C92A 1E6JL 1YNKH 5HDLA 4R26L 3DX9B 1WAAE 4MJ5B 4K7PH 1NGQL 5J6GA 5IROC 2AV7B 5I66B 2V9TA 2PYED 2VDOL 2HTLC 4NO3B 4Y4KA 5E00B 4JY6A 5AZEH 3AAZB 2F53E 2J88H 1VEPA 4JPWL 4NNXB 4XP5H 2V2XA 2F58H 2P5ED 3RHWF 3UTSB 3IDJA 1T5XA 4X4XB 4JR9L 4H26B 3TGXA 3WCYA 1P2CA 5BS0B 5D7IA 1OTTD 5CS7A 2PTUA 1DBML 2EEBA 3VXRE 3SKJH 2DQUL 4MAYD 2ZZUT 3DXAE 3U9PH 2YD6A 1A9BA 3PNWA 2ZCKH 2XFXB 3VG9C 1T20B 3HLAA 5HDQL 3BMWA 3L1OH 1HILB 5KSBF 4QHNB 4OQTL 3PWJA 5CJOL 2ESVE 1INEH 2NYYC 3VD7A 4JVWA 3AS0A 2E6JA 2EH7H 1U3JA 3O4OB 3O0RL 1K6QL 1J1XL 4PJ5B 1HYRC 3L7FB 3U2SA 4LCWD 4PJ9B 1M7DB 1U9KA 1I3VA 1JMXA 1RJYB 2CJUL 4R7NA 5H8DA 5CBAA 3BPLB 1I1AD 2GJZB 5F7HA 4OZHB 2Q1EA 4G8FA 4YR6B 4ZXBC 1DDHA 3CSYA 5F44A 5I8OH 4DCQB 2JK5B 1GPOL 1FL3A 1MJUH 5EB9A 4J2XA 1RZJC 5ADOH 3VWJA 1KSRA 3HG1A 4FQ1H 1KCUL 3WS3B 2A9MH 2BVOA 4JRXE 1G9NC 3EO0B 3A6CH 1HXMA 1PX3A 1YEFL 2NY2B 4KMTL 3G04B 2NMSA 3WNOA 3EYVA 1DN0B 1SHMA 3QUKA 1YQVH 3DYMA 1D6VL 3VG0H 3D0LA 1I1FB 1DFBL 3GSVB 1A6UL 5BXFA 2ZSWB 4JFFB 3MJGX 4LSUL 1RK0A 5J6HA 1NANI 5ID1B 5CMAB 5TE4L 2VXTH 2P44B 3UDWA 3OKNA 4M7LL 5E8OB 3W5MA 5FKAB 4L8SC 5HXMA 2HA1A 4I0PB 2NX5E 5IESH 3P30L 1YECL 3V5HB 3ULUC 5E5MA 5DRZB 2HT4C 2UY6A 1PX4A 4JFOB 4HS8L 2N56A 1GVIA 4WEBH 1JCKA 4K8RC 2WQ8A 3OKKA 3MLWH 5HHOD 1Q9LB 2VZ1A 3GI9L 2Z9TA 5FIEA 4KK6D 4ONOA 1RHHA 4GW4B 4HFWB 4Q0XH 5DJZA 5E8DH 2YUWA 1JI1A 5HI3D 3T77B 1ZOXA 4UB0H 5D7IE 4JZNA 4NM4L 3M17B 4S2SB 5F1KC 3BIKA 4NWTH 4DN3L 4WJ5B 4OAWB 4LPVA 3U36A 1RJCA 2DQHL 5E6ID 4PJEF 1AGBB 2V2WA 4RBPH 2BSED 3D85A 1ZANH 3G9AB 1BQSA 2P42B 1RUQL 1J1PL 1R5VB 5I76B 1PD6A 2OQJB 3I6GB 4NNPH 5FECB 5D6DC 1E27B 4A2LA 5C0ND 4OZFG 4FQCH 3G6AA 1BZQK 4NFCA 2A6KB 1DEEB 4XB7A 3DVGB 4P2OC 3F7YA 1ORQB 2EDRA 1XGTA 2NY4C 2VZOA 4MA7H 1OB1B 1JGLH 1EVTC 1IVLA 4HF5L 4X6DF 1Z9SA 1G7MB 3RWIA 4QNPE 3BYYA 4Y16C 1SMOA 4RA3A 2AJYL 1ACYL 4MB4A 3UJJH 2X09A 3KR3H 1QLRB 3W5NA 3QDGB 1MCWW 3NVQA 4NN6B 3V6ZB 1LO4L 1JV5B 3V8OA 1ZA6B 2VLJE 3RDTC 2O93L 5K9KA 1NMAH 4N5EC 3ZDYE 1BIIB 3TN0A 4HGKC 3T4AB 4C59B 2J8UE 3FT4B 1MJJA 1HHKB 3S5LB 5ANMB 3QUZA 4PJEA 1NMCB 2O5ZL 1KJ2B 3BYTA 4NBYB 1WCBA 3R1GH 2GK2A 1OTUC 3FO0H 3T2NH 2EDEA 4QRPB 3U83A 1X5YA 1IMHC 2X41A 3DSFL 1A6TB 3PGCA 4P46A 3MR9B 5F7EH 3CU7A 3TA3D 1CGUA 4N90E 4IMKC 2EE9A 4GXUN 4ODWA 4Y4KC 1FIGL 2HRLA 5C07E 4FFZH 4DUVA 1O0VA 5H35B 4MX7A 1RURH 3KVQA 4XVTL 5I1HL 4KY1L 4CVXA 2EECA 1OY3B 1A2YA 4FQQA 5J12B 3SE9H 5BW7A 3UXFA 2GJ6D 4QHMB 3GGWB 1S7XB 1YN6B 1RU9H 2MJWA 4L8CB 4G8GD 2IALA 4U1JA 1J0HA 4XVSH 5CWSA 3VW3L 4K2UL 1MF2H 2JB5L 4XCYA 3AS1A 3KXFA 4X6FA 3OJDB 1QD0A 4EZMA 4DK3A 3BAEH 3Q5YA 4LLQA 1YNKL 4I4WB 1HEZA 2DICA 4JGUA 1ZMYA 4K7PL 2BNRD 3INUL 1J0KA 4XH2B 3QG7L 2R8SL 3H9ZA 3QCTH 1JHKH 3E3QE 4NUJA 4NKDB 4K3HA 3IVKB 5ADPH 1IM3B 2Z4QB 3IFLH 5AZEL 1NCDH 4XCEB 5TPWH 4UQ3B 5EUOF 3ECBA 3ZKMD 4WUUE 4CN6A 3ULVL 1QO3A 4IRSA 5FA3B 1BVKB 1PY4A 4HK3N 1QFHA 1LWRA 4CDGC 3DX8A 4PJXF 4U6XB 3WUWA 4ODXA 3MLVL 1FAIL 1EHNA 2Q76B 2QSCL 5TDOA 3REVA 1UWGL 5DMJB 1KJ3H 1I3RB 4AENA 1MH5B 4I3GA 4MQTB 3JWOL 4QRQB 4KRLB 1JNNH 2AXFA 5ISZA 1WBZB 4XBGA 3VFNA 1AR2A 3MRQB 1TZHA 3WE6A 1U91A 3L1OL 5DRXA 4M03A 1MJ8H 1ZLVH 2V2TB 4P9HH 5C9JA 2ARJA 5E5UB 2ZOKB 4Q9BA 2H3NA 3MV9D 2A9NL 2AABH 2DF3A 3EYQD 2GQHA 3JTSB 5GS1A 4KUCF 2XN9A 3SGEH 3EDFA 3O8XA 1IAKB 4Z7OF 5GRJH 5JLZB 2QQQA 4MCZB 3UTTB 3IJSA 2XICA 3HMWH 3LCYA 4QWWD 5HHPB 4PTUB 4JKMA 3BVNA 1RZ8A 5GZOD 3QIWB 5GGRA 3O11A 3BGMA 4H88H 1FDLH 5I8OL 4DEPC 4U7KA 2MKLC 4Z7WA 3EJYD 1A1NA 2A9ML 1TVBB 2EDDA 1E28A 4E5XA 3CFEB 5CILH 2PTTA 3A6CL 4GKOA 1KPRB 5J89A 4YNYA 2NXYD 1CDJA 2MPAH 3AGVA 3HC4H 3A67L 1JPFB 1KJ2L 2DYPB 1DBJH 1KYOJ 1JUFB 3IRZA 4P49A 5M94B 1BD2D 2CKBH 2WNGA 2DI9A 3WFDH 1JI2A 4JFXA 1VGKB 4FFYH 3IGAB 4OZGF 2EIEA 5FYKH 4I8DA 3CXHK 3OPZH 1P9MA 3KXFE 5FM5O 5CIPB 1D5MB 5E2VH 4LKCA 3FFDB 1CR9H 2LVCA 4NHUA 3PWLA 1VCAA 5IR1B 2YC1A 2HFGH 3O4LB 4ELKB 3QIBA 1MCSA 5J11B 3D69A 4JY5H 1IC5L 4OF7A 5FYKU 1CVRA 3LMJL 5KAQF 4OLXL 4HIHA 3LN9A 4M1CC 1AGCA 4MLSA 4TUKH 3BX7C 4XHQA 4TUOB 1FZKA 1QOKA 3LN5B 4PJHB 1GGTA 1Q94B 1ZEAL 4YBQD 4PJ5E 4WW2B 1TQBB 4PJBF 4YHLL 1CFVH 3NZ8B 1T1ZA 3I84A 3OF6D 5F6HJ 3SDAC 3JV0A 3TM6A 4OZHE 4UB0L 5C08B 1HKLH 5L0QC 2B39A 3GBMH 1MAKA 1MHCB 3TN0C 3FJTA 1NGWB 1ZANL 2HKHL 2BY2A 3TVMB 1XF5B 1X5AA 3LKQB 2CDEB 2FGWL 4O58L 3WSQL 4DAGL 3RNKB 4FZ8L 4JB9H 2Q20A 2W92A 4PRID 2IG2H 2V9QA 2Y23A 4R4FH 1BOYA 4FQCL 1VKXB 2AK1H 2FIKB 4IRJA 4KHXH 4JZJB 4P46C 4QXGH 7FABH 3P0YH 1UZ6F 3RX8A 4JZOA 4RMTA 5M95B 1GRWA 4HS3A 3M1BB 5D8JH 5DJDB 4JFFE 1O5DT 4CJ1A 4PJCF 2NY1C 1UACH 4WV1C 3L3GB 5GRVL 3REWB 3T0EC 3PUCA 1T83A 3UMTA 3QIUD 4GMSH 2ZWLT 2DQGH 1K2DB 3MGOB 5BW7C 2E7HA 4Z7UB 3PWPB 4PRNB 1YMMB 2EXWD 3RI5K 4NC2B 4RFOH 4XNUH 4Z7WE 4LCUB 4MHHG 4C83B 2IADA 5DFVC 4HK0B 4P2RA 1ULVA 3O3EA 3S34H 4XT1C 1BX2A 5BJTB 2YSSA 3RZCA 4Y4HA 1SJHA 5D6CA 1F6AB 4JM2D 2CSPA 1LQSR 1F6FB 4DTGH 3N85H 3QEUB 1BBJB 3VH8B 1JHLH 3R1GL 4M5YH 3HE7C 4LFHD 3MV7B 3JV4B 1KC5H 4M00A 4Y19A 4NN7B 5B39G 1M05B 5F7EL 3ZHLA 1UA6H 3MRMA 3LEYH 2X4PB 4K71C 4PP1C 2R4SH 3UJIH 4J4PA 4ZUVA 2DTSA 1NL0H 5EC2A 3G08B 3R8QA 5F96H 1KIPA 2BNQB 2VABA 3P9MA 5T1LD 2FZ3B 5C0BD 3MFFA 3HI1B 4NQEA 3ARFA 4PJCA 1DL7H 5D7JC 5ILTL 4YK4C 3SE9L 4BYHA 4KROC 3X17A 4MDJB 1A6ZB 1RU9L 3LZFH 3ZHKA 3D2UB 2ERJB 3O3DB 5K9OA 5DZNA 2R29L 2VZVA 2C1OA 5B38G 3CCHA 5L2KD 1OT2A 5GHWL 1LE5A 1OAXH 5ETUA 2Z8RA 3BAEL 1J8HD 1TZIB 2RHEA 3ZL4H 1RVFL 3S4SB 4WGVB 3MODH 4ZUWB 5ALBH 3QDGE 8FABA 1NEZA 3H42L 4U4BA 5EU3B 2G2RB 5GGTH 3QCTL 1JHKL 4GXUM 5GS1C 1T6VN 4YEFA 1OF2A 5ENWA 1NCDL 5J3HC 1CGTA 4LASL 2X4TB 4EI5C 4D0CA 2DM2A 5ANME 4JJ5A 3BP7B 5JNYB 5AAMA 3GK8H 3H6JA 2J5LC 1XMWA 3QFDB 4KQ4H 5E8EA 3C60A 3SY0B 5EO9A 3Q3GB 4XNZC 5JOFB 4QRPE 1JNLH 2FBJL 3IDNA 2X4SB 4S11A 1M7IB 2Z31A 1MY5A 4APQD 4NKQB 1KJ3L 4YC2C 4F7PB 4NRYB 5FXCH 3VXMA 1JNNL 4RIRB 4BH7B 5GRUL 5LWYH 4F37K 2Q3ZA 2GK0B 3QJFB 4PY8J 1NMBL 1ZT1A 1MJ8L 3MBXH 4N0UB 2W59A 4ZAKC 4XNXH 2EYSA 4P2RE 3LEVH 3IXAB 3MCLL 3KPQA 3SDCA 2AABL 2YPVH 2P5WB 2I9TB 4MXWH 3ARDD 1Q9OB 1F4YL 3QA3A 1H8OA 1E0OB 1G7PA 1YYLL 4WI2A 5GRJL 5MHSE 1T1WB 4GAYB 1CGSL 1BFOA 1FFPB 2FWOB 1OP9A 5CJQH 5IHUH 4U1MB 1R5WB 5IFHH 1VENA 4Y19E 5F7WC 2IPKB 4F3FA 5AYUL 4GKNB 4HIIB 1DQJB 3QISA 1FN4B 2NXZD 3MXVL 2A2QT 2QQLL 4RMWA 1U8NA 4KI5F 1AE6L 3MRFB 3UAJC 1ZHNA 2JB6A 5LGHH 1AGDB 3FQXB 3BP6A 4LU5L 1U95B 3V0VA 1EJOL 4YDKH 2HJFA 1IGTB 2MPAL 1KJMA 3HC4L 5BZWB 3IFOB 2DMCA 3UJTH 4KJWD 4QRRD 2PF6A 5K9JL 3HPJA 2Y7QA 2CKBL 5ELIA 2P24A 3FO2B 1QNZH 5EORH 1TQCB 2BNUB 4FFYL 2KPNA 5T5NG 1MCPH 5HHXH 1C5DB 5DWUL 3PL6A 4NBZB 2BOCA 5E2VL 4RRPA 3DRTB 2H32A 2FO1A 43CAA 4HH8A 1D5BB 1ED3A 3SCMC 1CR9L 4ZDHA 5SWSD 3QO0B 2JJWA 3HZYA 2HFGL 3RVXD 1S7QB 5IHZA 1NUGA 1MLBB 4F7MB 2XTJD 1J8KA 5HGBA 3E8UH 1IAIL 2EZ0D 5I1KL 4MJIA 1EDQA 3CK0H 4L4VA 4TUKL 2JIXB 1U8PA 4WU5A 1XF4A 4N0CD 2BRRH 1AFVL 2HKFL 4LDLB 5KTEL 1BEYH 4P59L 1T83C 3M8OL 1QP1A 1C1EH 1ORSA 4KK9D 3UTTE 3B43A 5JA9A 1CYGA 2A74B 4OLEA 3SKNB 3CC5B 2W0FB 1AIFB 3ILQC 4GW1B 1RMFH 3HE6B 4GKZA 1B88A 1FL6A 1QVOB 2A83B 4KPHH 5EFIB 1XZ0B 3K8MA 1OWRM 4GMTL 3H9SA 1J1OH 3D3VE 3RPKA 3GBML 2AXGB 1A3LH 4CMMB 3KPPA 4MA3B 3SKOA 2BMKB 2PTVA 2E5EA 3VXME 4DVBA 5C0GB 4ZTPH 5DVOA 3GJFH 3P40A 4OZIB 4XBEH 3KYMB 4I5BA 1FYTD 2VLKA 5FA4B 5J57B 5DJ8A 3FTGB 1ERNA 5D2LB 5GJTH 1B0RA 2WLZA 5EBMB 4F33B 4JB9L 2IG2L 2FB4H 3HC0B 1BAFL 3U30B 2AK1L 4FTVA 4KHXL 3L3JB 2BCKA 5E1HB 3F7QA 7FABL 2YEZB 5C6WH 1MIEL 3Q48A 1N5YL 1TDQA 1MRFH 3G6JF 1VEMA 4CW1B 1F11A 3C5ZB 4NIKB 5I0DA 2HTKC 2C7UB 3QDMA 5E7BA 2P7TB 3VE0B 1A3RH 3BRGC 5F9AC 2G5RA 5DT1H 4JFZH 3ARFC 1MJ7L 1D5ZB 4TRPL 5DQJB 2DQGL 5FO9A 1RZFH 2XWJB 4GG8B 5JMRA 1YPZA 4PGDB 3MROB 4K3EH 2DQIL 2Z93B 5ITBL 4RFOL 5ERWA 3KLDA 1X4ZA 1H5BB 4GT7A 5HYJA 3BMVA 1I9IL 1A1OB 1K4DA 3S34L 2AQ3A 4ZD3L 2BDNL 1IGYB 4IDLA 4PREB 3GSQB 4HHAB 3NFNA 4OGAD 5C0JB 3SKUD 2R2BB 1IQDB 2NZ9C 4X8XA 4DTGL 2W9DH 4Y1AA 5J1AA 4H0HB 3N85L 4HQQH 3QUXD 1RZKC 4F7CA 1MFBH 3EHBD 4M5YL 5J1TC 3FB5A 5HHNA 5JR1L 4QOKD 5AG8A 2D2OA 3FO9B 5DD0H 4F57L 5I1GH 3IDYB 1YJDL 3KPRA 5C08E 4BM7A 3RQ3A 5F7DA 4G7VH 4GAGH 3NCBB 4M61A 2AK4B 2VE6A 4X5XB 1P4BL 2PW2A 2UVEA 4KHTH 4QY8B 3B2VH 3HCVB 3VDCA 3B5GA 1G9MC 2CLVB 5JIPA 1DL7L 1Y0LA 3UYOD 5BV7C 4P3DB 5IUSA 3K2MC 3C60C 4PUBH 2WINB 1RUPL 2R2CA 1EEZA 1AQDB 4MJIE 3BRDA 4ODHH 1UZ8B 2HVJB 2Z31C 1SQ2N 5TJWK 3X14A 5CHNB 4GXVL 1IGCH 1WBYA 4FQXA 2B0SH 2X70A 3O45A 5IB3A 2YHGA 2B5IB 5ID0B 4YHNB 1MVUA 1KLGB 2EIZB 3RJDA 5MENB 1I75A 2XIDA 3N06B 3FL7A 3IU4H 4N8CL 4Z7UE 3PWPE 4JG1H 1LK2A 5FYLD 1YMME 1CS6A 5A2KH 5TH2B 4MNHA 4YHYB 3TIEB 4KGLA 3BKCL 3NIDE 3QUMH 2FYYB 5GGSA 1UWXK 2VLKE 2YBRB 5TDPA 3K3QA 4OF6A 3BT2H 4BK4A 1MWAH 4YGAB 4DFHA 1XH3B 5TFSH 4M8QA 1H0DA 5HYEA 1C5BL 5BVJA 1RUMH 3QQ4B 2RJMA 3GK8L 4FTVE 1F97A 4PLJC 2C3VA 1HN1A 5E2TL 3CZFA 1L7TL 3DTXA 4PRDA 4MXQD 4LEXH 3DNKA 1XGPA 5KJRL 5FYKE 3N9GL 4DZBA 2MNUA 3QDME 4X7FC 1DUYA 2R2HB 3VFVA 5FUZL 4ZFOB 1WCQA 4QCIA 1AO7D 4WI4A 4X8JB 1KGCE 3I3EA 2PYEA 3VFSA 1YPZE 5CINL 5FO8A 4UDTA 1A6AB 4MZ2A 4JFQA 3V5KA 3T3PF 2CLRB 1T0MA 3D2UD 4XNXL 4GG6F 1V7MH 2A1WH 1SJXA 2O5YL 1A7BA 4MXWL 1OSPL 1RZ7H 1ZGLA 5I1JH 2C1PB 1L0YA 5I8EA 3MRDA 2EEDA 3B4NA 3WEXA 2EDXA 3MCKA 3VGDA 3BN9C 4NQCD 2GTZB 1AHWA 3FAXA 1WWWX 4Q58C 1QR1A 1H3VA 1Z5LB 4MAYA 3KPRE 1ZGLP 1I8KB 3OMZA 2WLYA 4P9HC 5IGXH 2H45A 2WW8A 3KPSD 3OSKA 5GGTA 1RIHH 1GZPA 4HKBA 3LEXB 4PRAB 4KI5C 2IAMB 4LGRB 2CH8A 4J3XA 3GUTA 3TH2T 3NCCB 4UIMA 4JFPA 1WC7B 1XCTB 3UJTL 4K7PX 2DB8A 2YD5A 5KOMC 1BWMA 3V6FA 3ZTJH 2VH5H 4LCWA 3WLWC 2X4OB 4OI9A 4LVHC 3SDDD 4N0FB 3SJVE 1QNZL 1MCLA 1EGJL 3KPNA 5FCSH 5IG7B 1I1AA 3T1FB 5C0RH 4GG6A 3H0TA 3BESR 3NCJL 4JM4L 4WFFE 3NTCH 4YBLB 3VFPB 4FNLH 3FFCD 4EDXA 2VNCA 4XCNB 3ARQA 4HGWA 1PJ9A 5FOBA 5T1KB 4J3OC 4LLAA 4RISL 2RCSH 2JCCF 1PY9A 4NT6A 4KZDL 4LVEA 4UV4L 4G8EA 3TBYA 4HIEB 4N0UE 3CLFH 3OGCB 1CLCA 3E8UL 1P84J 4K3JH 2E27H 1U8JA 4P9ML 2HN7B 4QRTA 3CK0L 1A8JH 1FP5A 2P5WE 2W0PA 1FO0H 3W9EA 2B4CC 1BEYL 5FUOH 3KDMB 2VN7A 1BM3L 1QSEB 3PIQA 1QHPA 4M5ZH 1BGXH 1R3LA 2AXHA 4LAQL 2BVYA 3CLEH 1IC4H 1CLZH 4LEOB 1WT5C 5T1DH 3OZ9H 4MHHI 4XBPA 4WEMB 3AB0C 3TO4B 3RA7H 5F9DC 2KL6A 1SBSL 2OTUA 4ZTPL 4RMRA 5L2JA 4HJGB 2FO4A 4FXKA 1OAUH 3LH2L 4LCCB 4X7TA 4X6EA 1OHQA 3IJHB 1A47A 1MUJB 3B9DA 5KANG 5KVEH 1GZQA 3WFBL 3WNMA 5HHOA 1TMCB 2OI9C 3OKMB 3ZDYF 3MRRB 2P5EE 4RGMB 1DSFH 3TT1H 3MOAH 1FCCA 2JCCA 4RFNC 1YYMH 1KOAA 3GSXB 1HQRA 3TBSB 1FCGA 3TBVB 1KB5H 2VUOA 4Y0GA 1HWHB 5DJ6B 5EO1A 3D9AL 5E6IA 1OLLA 3MNZA 4ZFOL 4C56B 4PB9H 3DSNA 5C9KA 1NCCH 2NY6D 1RZFL 5AG9A 4GAFB 4K3EL 3H7BB 4PJFF 4FRWA 1OP5H 3WIHH 4TSAH 3U0TA 1S78C 2OMBA 4H8WC 5C6PB 3QWRA 3ZMRA 3B2UC 4YHIA 3S6CA 2BERA 4FQPA 4LSRH 2VLRD 4X6CF 3JV5A 4NJ9L 3T2PA 3ZE1E 3WKML 2HJKA 1OSZA 3A0OA 3HPLA 1NCUA 2W9DL 1FGVL 2PW1A 3EJJX 4HQQL 1MFBL 5MEPB 5I71B 1EHAA 5ICYA 2VL5A 2UUDK 4WFEE 1KELH 4JQIH 5GJSH 3DVFA 3ZO0A 1J5OH 4DFIA 1JF6A 1CQYA 5DD0L 5I1GL 3MRBB 3I6KB 5D5MA 4JHBA 3BPNC 1QSFB 4L9LC 4TYUA 5F3HA 3WDIA 1IAOB 3BSZH 5C0CB 43C9A 1JK8A 1MCOH 3AREC 4M02A 1HHJB 5IJKA 4IDJH 2PUQT 1NFDB 3B2VL 3KG5A 2EDTA 5JHDB 4I3SH 1WFTA 4Z0BH 5D2LE 4Y5VC 3I9GH 3C8KA 4PUBL 1EA9C 3ROOA 5C2BH 4J7RA 4ODHL 5ACLA 2H8PB 5FB8B 2MOVA 3WFCH 2MCG1 3GIVB 4XWOC 5I75C 3S37L 5HGDB 3LKOA 4CVZA 2VLLA 4WDIA 1QBML 4CN4A 4EJ1C 5DTFA 4A6YH 1WV7T 4ODVL 1WUNT 4YHZH 3TA3A 4F37F 2AXJA 1UKSA 4X6CA 1IQWH 1C7SA 3OB0H 4UT7H 1XIWB 5D70H 4RQQA 1I8IB 2Y4SA 1IILE 3LKPB 2AAVA 1U58A 1N26A 4JG1L 3L5HA 5DGQA 3EOTH 1Y6NR 5AD0B 2F8VA 4X83A 4QGYA 4MJ6B 1PAMA 4LARL 1F3JB 4M62H 3ZZ1A 2BVPB 2GJ6A 3IB4A 1GYAA 3MLZL 3LVEA 3NPZB 4G8GA 4OD2B 3QH3A 5B8CC 4GKSB 5GS0L 1MFDH 4MAYC 3SBWA 3K46A 1KTKE 3RKDD 1X4XA 3MLPA 2PR4H 1K8DB 4LEXL 1YEEH 3IDIA 1KLFA 2AK4E 2BRQA 5CUSH 3QCVH 5DURD 2L0DA 5GSRA 2BNRA 4OLWL 5DMIL 5L7XH 3H9HA 1RIUH 1FVCA 1XEDA 5KSVB 1YUHB 3EDDA 5I2IA 1ROWA 2J2ZA 5GXBB 3MBEB 5HJ3B 4WY7H 2CRYA 3IETB 2SEBA 4G9DA 3QUYB 3DURA 4G9FD 1MRCL 4MA8H 4KFZC 1F4WH 4KJYB 3Q0HA 1PZ5B 1U8QA 5F1IA 1I1AC 1BF8A 4X98B 3FZUC 1RZ7L 2YPLB 3NA9L 1OAQH 3H3PL 5D1XB 2V17H 1R3KA 2AKRB 5CCKL 4ORGB 1TETH 2ED9A 4OLZL 1VGEH 1S7RA 5I30L 4LSPH 5MENE 1FG9C 3AU1A 5IQ9A 4WO4D 3JUYA 4HMDA 5D5ME 3OKYA 3GRWA 3L3IB 1T80A 1A9EB 5EU5B 1ITCA 3R06B 3QZWA 4QHUA 5IGXL 4RMVA 4HUKB 3LS5L 4ODSL 4HIXH 3L9RA 5DJAB 4PJGB 1T7XA 4YO0B 2G75B 3MV9A 4R4NC 4AY0A 2B1AL 1HI6A 2C9AA 1MWAA 4X9IA 5IBTH 2MMXA 4HT1L 5GISH 5I73C 1CXEA 2GTWB 2VDKH 1TVHA 4O4YH 4UUJA 4JKPH 2VH5L 3B3IB 4R2GB 1UVQA 2EDJA 3T4YB 3ZLQC 5FGCB 1FFRA 4WW1B 5EN2A 2WSKA 1MLCB 3KNBB 5C0RL 4LQFH 1F3RB 1HYSC 2GSIA 1ZT7A 5I66A 1B4JH 3V9FA 2DQFA 4PLKC 3NTCL 5LAXA 1S3KL 3PP4H 4FNLL 4PJ8B 1BFVH 2NNAB 3MRKB 3RL2B 3W0WB 4KV5F 4MVBC 3OHXB 2HYMA 3LKRA 3OXSB 2RCSL 3GMNA 4O9HH 1AD0B 1BF2A 1R3IH 2K7QA 3ARGC 1S7TB 4KK6C 5HHMD 1N6QL 3CLFL 3K4ZA 4PJ7B 1CXLA 3GJEB 3C6LD 5DQ9A 4DKDC 4KTEH 2DTMH 4XCFL 5JA8B 1CU4L 4LVOB 1IGMH 2XA8L 2E7CA 1CD1B 1BD2A 3GIZL 2H6PB 5FUOL 3SOBH 5F97E 4M5ZL 2I9LB 5GPRA 4HMCA 3LRSA 1KULA 2C4XA 2A6DB 4O51B 4MQ7B 1ETZB 1TZGH 1Q72H 3KYOA 1T1XA 5CEXB 1OCWL 1QACA 2DQTL 5T1DL 4HXAL 4Y5XB 3RA7L 1MCQA 2HMIC 5D93C 4J3SA 5IP4A 2BNRE 4R7DA 1A64A 1C12B 4WFHE 1UB6A 5D96B 4PP2A 1M7DA 3QXAB 5DJCB 1A02N 2M1KA 3BPOB 4KJQD 2NW2A 4U3CA 2ICWI 2AGJL 3VU2A 2LAAA 3KLAA 2OL3B 3FQUA 4JRYD 4F15B 3QDAA 4BH8A 1DSFL 2EC9U 4IS6A 3TT1L 1CF8H 3MUGA 3TYFB 3OF6A 5GGQH 3UTQA 1ZLWK 4AEFA 3P2TA 3O2DH 3ULVF 1XGRB 3MNVB 1GOFA 3ARSA 5KZCD 3LV3B 3GSNB 1FORH 1T0NB 5T1KD 4OGZA 4JM2F 1OQXA 5EZIH 5C7XL 4JDTH 3S36H 1JN6B 1NEZG 3DGGB 1NCCL 4JFDD 1LP9B 1FNAA 3IDMA 5HGGS 4XWGH 3AS3A 3WDHA 1KCRL 1NDGB 1RJZB 1EHLH 5HDBF 4TSAL 4FFVC 2X5PA 1HHIA 2PETA 4PRIA 4Y4FD 5DHVH 3UP1A 3QHZL 1U8HB 1LD9B 3Q6FA 4JPKH 3MV9E 1I1FA 1HHGA 4LSRL 4WRLA 1VACB 1DLHA 1AY1L 1NLBL 2BSRB 4JQXA 3DUSB 1FO0A 4NFDA 5DRWA 4L3ED 1QSEE 3HAEB 4JO3H 3EYUH 3IF1B 5E8OA 1KBGH 3DV6B 3I50L 1KELL 5HVHB 4YZFF 1DQLH 3T3MF 3QIUA 4F80A 3WDJA 3TP4A 2CO6B 3BSZL 3QEGL 3HMXL 3R4DA 3UPCA 1MCOL 3ZYZA 3I02B 2I07A 5C0AD 2E3VA 4ZS7H 2KZWA 4J8RB 3EYSH 2PKDA 1U93A 2D9CA 3C6SA 4U1KA 5DUMH 2RFXA 4I3SL 4Z0BL 1M6OA 4NNYA 3I9GL 1SEQH 4JM2A 5ESVB 3RRQA 4DKFH 5CD5D 2R4RL 4M3JA 2D31A 4ZUSB 4PRPB 3T77A 3DVIA 3WFCL 5E56A 3IS1X 2DD8L 1BD2E 1I7TA 2QV2A 3QXWA 2X9YA 4P3CH 2QADC 4HAFA 3RUGB 1MIMH 3P77B 2OTPA 2V5RA 3PWUA 5AUMA 1KB5A 2OQJA 3BGFC 2R2EA 3S35L 5I0ZA 2XWTB 1IQWL 1NPUA 4C56E 4UU9B 3RY6C 2OR9L 5HI4D 4ZO9A 1TJHH 4LP4A 3I6LD 5T1LA 1MCNA 3IDGA 5C0BA 1PYWA 3PV6B 4NC1C 4WI9A 1F4HA 3U0PA 3EOTL 3TNMB 2CQVA 3WIHA 3WHXA 2X1XR 4W70A 4M62L 1A14H 4PV8A 1ZSDB 1FNEA 3IAGC 4O2EB 3O6FC 1NBYB 5TE7H 2HTLD 3FB8A 5DK3A 3VI3F 3QEQB 5F7MC 4LIQL 4XPBL 1KXTB 2X42A 3ZKSD 3MXWH 5L2KA 3GKWH 3TO2A 1ADQL 1C16A 5J9PB 1J8HA 2Z92B 1AQKH 1FZMA 2HVKA 4WTZA 4XNQA 1YEEL 3FCTB 2DDQL 5CUSL 2XZZA 2XRAH 1S9WA 1AP2A 5T33L 2JELH 1RIUL 3EYOA 1HHKA 5JIKA 3BN3B 4P5TD 2VWEC 3TT3L 3VRIB 4BQ8A 4Y2DB 4UNUA 3P4NB 1NFDE 1MFNA 3VD4A 1B0GB 4ZSOA 3UTPD 4PRIE 4MA8L 4N5UA 2OL3L 3ZKNC 4HUVA 3FOLA 4YHPA 2FNBA 1FNFA 5GZOC 3JWDL 3VDAA 3NCEB 2NYYD 5GZND 4APQA 4A6YA 3EJYC 4UILH 3GSNL 2KZ1B 4CAGA 4JO4H 3MRJB 2VQTA 3WN5A 4G8IB 4L4JA 4XVJH 5D7KD 3D18B 1NQBA 1JFQH 2QBWA 3CAFA 5GRXG 4FG6C 2K9UA 4QHMA 1XR8B 1V8HA 4JFED 1YEGL 4ZXBD 3MJ7B 4KRNA 5HGAA 3AXLA 4ZYKA 1NCAL 3NZHL 2FX9L 1CFTB 1KPUB 4NSKB 3VJ6A 3WJJA 3ARDA 3O3AB 1FE8H 5JQHC 1LDPL 5ALCL 2CLZB 5IBTL 4YIQB 4AG4H 2VDKL 1J12A 1JPTH 3VXSB 4ALAL 5SX4I 2B1HL 1J7VR 4X5WB 3EW3B 2A73B 4OIAA 2XKNB 3LQZB 4KZEH 2AEIT 1EAPA 1CIUA 1FZJB 3MLTA 4WWID 4DGVH 3O4OC 4MNGB 3MBED 2XKSA 1IM3A 1I7RB 2Z4QA 1MEXH 5JORA 4BZ1L 4HMEA 4PJ9C 2IQ9H 4NZJA 4YX2H 4PLOB 1R5IB 5FA3A 4O9HL 1N2RB 2DLFH 4ETQB 4F9LA 3BPLC 5CGYC 4OFKA 4GRMA 4YDIH 1BVLB 1QKZH 4ZS6C 2IQAB 3ULUD 4QRRA 4KAQL 1IEHA 2J1KA 1A7PH 3MZGB 2HT4D 4XP9L 4NRXA 4HIJB 2D7TH 2YPLE 2HJLA 3TYGH 3K1DA 3SOBL 4EIZC 4OV5B 3NCYP 4K8RD 3RU8L 5HYQA 5IFAH 1L4IA 3E6HB 3EYFA 3RWHA 3DARA 4PJAB 3V7MA 1IEBB 3SPVA 1XGYH 5L2KE 1N59B 4OD1H 1Q72L 4L5FH 1J8HE 3DROA 1TCMA 5DVKA 3S4SG 4YDJB 4JPIA 5SWSA 4PRBA 2ZOKA 4Z7VF 2ORBH 2JF1A 1JWUA 2FEEL 1A6PA 2VISB 1MCCA 4UV7L 1NGXB 3NFPA 4JQXC 3P0GB 3FT2B 1QRND 4AYFA 2RR3A 4U6YB 1UXWB 5HHPA 4WU7A 1JVKA 4ZSOE 3BZEA 4I0PC 5HGHB 3VXTB 3NFSH 2NY7H 1TJGL 5I1IH 5E8PA 1CDUA 1CF8L 1X5ZA 2VUYA 4UIKL 1H3WM 3VXUB 5GGQL 4RGNB 4PJHF 5GIRA 4NDMB 4Q7DA 2AJSH 4JAMB 4P2OD 3K80A 4PGCB 2NY4D 4WW2F 1NGYB 4O5LH 4DQOH 4YFEA 1ZHLB 4M1GH 5E2WL 3CSPA 2BVQB 3T2QA 3N1PC 4NQUA 3ULVC 4OKVB 1H8NA 5EZIL 4Y16D 2XZCL 3TPUB 1FYTA 4JM2C 5TQ0H 1FNLA 1NLDH 4PV9A 4TOYH 4J3WA 1EHLL 5EIIB 1OGAB 5CZKA 4UOW0 1CZ8H 1CCZA 4PJ7E 4WVRA 4J3VA 3U82B 4M7ZC 3IGAA 3RDTD 3JWOC 3CPLB 5FFLA 3QPXH 3P9LA 4G6FB 5T3ZD 4Z7VA 1A7QL 3WNPA 4JO3L 2VR4A 4NQDD 3FFDA 2X2YA 1PG7H 2FH8A 4RA0C 4FXLA 3VMOA 2FATH 3VXPB 5MI0B 1DQLL 4ZUTA 2Q7NA 3HUJB 2NY0B 4PJDA 3THMH 4P23B 5LGJB 4K94L 3OR6A 3SEPA 1KB9K 4EN3B 4LPCA 1VFAB 5C09D 3QFJD 4IOFC 2ADGB 4HCRH 1EUTA 4Y4KD 1F6LL 5DUML 3F5WB 4YPGA 1R24A 1DCLA 4M6NH 1BJMA 2N4IA 2WUBH 4LSQH 3NZ8A 3NIDF 3LKSB 3O9WB 3BEVB 1KIRB 1BZ9B 4NN6C 4R4BA 5EU6B 3QUXA 4NKIL 2DQDL 1NCBH 3V6OE 4E42A 2IH3A 2YUXA 2CIIB 2G9HA 2KDGA 4FXGB 2BVEA 1U3HD 4QOKA 4YGVB 1NC4D 4BQBA 1CICB 1OGTA 1TITA 5D1ZB 1MIML 4Y8AA 1NAKH 3MO1A 1MHHB 3O2DA 1NGWA 1BZ7A 4D9RD 1HXYA 1XF5A 4MA1B 3WYRA 2CDEA 5D1QB 1OT1A 5HYIA 3H3BC 2QLVB 5F3BB 3IJYB 3SN6N 4EUPA 4M7JL 3EO1A 4Y5YA 5M7QA 5SWSE 1LP9E 3W82A 3ZKXB 3LRHA 3MRLB 5HHQB 3D25B 2QTEA 1MHEB 4G6KH 5E8NA 1CDBA 4NQTA 3FO1A 1L9NA 2OZ4A 1Q38A 1U6AH 2J8HA 2XTJE 4HWZA 5F89B 1CLYH 1A14L 1PBYA 4YHMH 4YXLL 2M8XA 1AJ7L 5BZDB 5C0DB 4OZFB 4M93B 4QRSB 1EMTH 3DV4B 1NUNB 4XXDA 4WI6A 1FL5A 1DUZB 3QNYB 1UJ3B 1ZAGA 4XPAL 3F58H 1VFBA 5A16B 1T1YA 5J12C 3MGOA 2BHYA 1JRHH 1UCTA 5C0EA 1ES0B 5E94B 2FX8H 1XCQB 1DQDH 4CJ0A 3HS0A 3ZDXE 3MNWA 1ZHBA 4RMUA 3OB8A 4LLYB 2XRAL 1N0LA 1NSNL 5DUPL 2JELL 5I16A 3S97C 3IFPA 3BH9B 5CP7A 3WKNA 1FJ1B 5TF1L 3ARDC 3WJJC 12E8H 1QQDA 2ICCA 1I7ZB 4OCWH 4F58H 4S1RL 5EWIH 4OLVH 1EV2E 3MJ6A 1KJVB 2A77H 3TJEL 1SBBA 4ZQKB 2Y9RT 3EDJA 4FFWD 1F00I 1U0QA 3DETC 3R8BB 1M05A 1QLEH 4PRPE 5BVPL 5EA0L 1OAZH 5EULV 2EYRB 3EO9H 2NXZC 3BQUD 4GUPA 3LKNB 4TSCH 3VXNA 1MY7A 5AZ2L 2BNQA 3TIDA 1YMHB 3ZT6A 3U48A 2EDLA 1WF5A 1CDIA 1GC1C 2HFFA 4PJDE 1AO7A 4XVJL 4XZUB 4LQ1A 4ZG1A 4WWKD 32C2A 3CD4A 2ITDB 3EJZC 1HSBA 1DZBA 3D2UA 3MLSH 4BSJA 1SYVA 2AEQH 3BKJH 5LXGH 1YNLL 1AGEB 1KXQE 3GMOA 1QG3A 3ABZA 2ZCHH 5CSGA 4NP4L 4TUJB 1EXUA 1XT5A 2O26U 2NPLX 1I3GL 2JJSC 3MJ8B 3SGDH 1UB5B 4YXHH 3U6RB 2HLAB 2P8LB 2QKIB 5MERA 4V1DB 4NQCA 2BSTB 4PPTA 3CGTA 3BZ4A 4QOKE 5D2NA 5EU3A 3IKCA 4FQIH 2VC2H 1KTRL 3F65A 2A0LC 3TNNB 4F7TA 1WEJL 3MV11 5KSUA 1D5XB 1M4KA 3W81A 1MEXL 1F2XK 2GUOB 4GLRH 5AAWA 3C9NB 3ME0A 3KPSA 2ZUWA 2IQ9L 5E99H 4U1NB 5GSVB 2E7BA 5I74B 5IEKB 3QFDA 2BVTA 2DLFL 1DBKL 2ADIB 2D7MA 1JF1B 2IMNA 1SJEB 1LO0L 1M7IA 3DRQB 4P4KB 4YDLB 4MSWB 3SDDA 2ZUQB 3TYGL 5F9WC 1FC2D 4H5SA 3WFHA 2DAVA 1SYSA 3GHBH 2DI8A 2X05A 3BDYH 4YAQA 3MGTB 4LLDA 3UTZB 3JTTB 2HWZH 4N68A 4OD1L 3SQOL 4P2QB 1K4CB 2R69H 2F9BT 5I1LA 3FFCA 2EYTB 3JVGA 8CGTA 3MYZA 3WLBB 3PGDB 1MCJA 3SDAD 3VA2C 3NPSB 3CDGB 1UWEH 3MOBH 3V5DB 1T21A 3T0DA 3MRGA 5SWZB 2Y72A 3RGVB 3MZTA 4ODUB 3EOBB 4NZUL 2B2XL 2GYSA 4OT1H 4X4ZA 2UWEF 1P53A 2BSSA 3Q1SH 2DM7A 3U1SL 1OP3K 5I1IL 3BJ91 4YQXH 2YWZA 3AUVA 4XRCB 4JPVL 1NJ9B 1YEHL 1U8IA 2UYLA 3PQYB 1UM6H 5E2JA 3FQXA 4DQOL 3F12A 1A0QH 4YXKH 4XVUC 4M1GL 1A4KA 1RULH 2RBLA 4MNGE 3BIBX 1AO7E 4WW2C 3T0ED 2UZXB 3STLA 3V79C 4G80A 4X6BA 3P0VL 4OGAC 5TQ0L 3CFBA 2CXKA 4U31A 4OD3H 1JWMA 4BJLA 1FRGL 4I3RL 3QXDA 2VAAA 3G5ZA 3QUXC 3DMMB 1ZWIB 4XP1H 4U1LA 4PR5A 3MLYH 5F7YC 5DMYA 4OZIF 1F3DJ 5DFVD 2VDNL 5JIHA 2PYFA 1T89C 1ZE3C 5D2LF 3TLRA 1EH9A 3GMQB 4X4YA 4YHKL 5EUKB 2VSCA 5IVZA 3RAJH 5FAAA 4EOWL 4JANB 1CD9B 3QO0A 4U0RC 2R1YB 4CU8A 4Z77A 2UWEA 3R0MA 5MEOB 5DD3L 5D2NE 1DR9A 1MLBA 3HE7D 3VWKB 1N4XH 2Q6WA 4IIQB 4JZJC 5L88L 4Q6IA 1T03L 4LSTL 4S1DC 1CDYA 2XWBA 4Z0XA 5HI5D 1P7HL 4JGJA 3C5SA 4HCRL 3FKUS 5IMMB 3L3HB 1CG9A 2VLRA 1IGFL 3SKNA 1DVFB 4AH2A 2X4RB 5GS3A 5T5FH 3CFDA 2XA3A 3BJLA 5D7JD 4BSWB 3SKMA 1KEML 5IQ7L 3FQRA 4LF3A 4HULB 2O61B 4NRZA 3ES6A 3IFNH 5C0IA 4JFYB 3RJQB 5IBLD 4M6AA 5INDA 4QRUB 4G6MH 4J3TA 4TN9A 4K23H 4OTXL 3V4UH 3ARXA 1X7QA 3EZJB 3FTGA 5KSAD 2A6IA 2ED7A 3D1MC 5L8LB 3FFCE 3QZWG 2C3GA 1MHPH 1A4JB 3L3KA 4G6KL 4U7SA 3SGEI 3MV01 4NN7C 5CEZL 4D0DA 3LOWA 4R90H 2R1WB 1U6AL 4XP6H 5JW4N 4S0SD 3VFRB 4OFPA 1T22B 3U4EB 2XN9D 1WJ3A 2PNDA 1FGNH 1FNGB 1IBGL 4DKEL 3MREB 3ZYIA 5J3HD 5DSCB 3K2UH 3RPIA 4EI5D 2GT9A 3KS0J 5DQJA 3ARBB 1GGBH 4JHZA 35C8L 5BQ7B 3DYOA 3MROA 1BJ1J 3ARVA 2IPUK 1NANH 4JO1L 3HUJE 4PJIB 3MYJA 3PJSA 1NCWH 4OFIA 1CDGA 1G0YR 5BRZB 1FC1A 1K3ZA 4OCRH 1R3HB 1IGYA 1IZKA 2W60B 4WHYH 5E1AB 5C0JA 1RZJH 5FV2A 5CFHA 5EWIL 4LL9A 4OLVL 2Y5TB 5D7LD 5JHLH 5I6XC 3SE3C 2EE2A 3DX6B 4LK4A 1GCFA 4GRLB 2WZPD 1G9NH 4NQXB 2FECL 2X7LA 4CADA 2NW3B 5EU6E 1QLEL 4ZAKD 3C09B 4J1UA 1I9EA 3RWDA 5EZOL 3TF7C 4Q9RH 4OM0H 2X4NB 4FQLH 5EOCL 4OGYH 3RHWK 4RMQA 4K9EC 1VESA 4BSVB 1AC0A 4I1NB 4R3SB 2V6HA 1JGEB 1ZLSL 4W4OC 2FSEB 2VDMH 2D7NA 2OMNA 1QLFB 4JGMA 2PCPB 1IAII 4OGXL 4UINH 5EU4B 4AMKH 4KTDL 1CXHA 4O2CB 4UT9L 5DYOB 1BBDH 1EIBA 1UZ8A 1XF2B 1UQSA 4E41B 1HSAA 2NTFA 3MLSL 4G9FA 3ULUH 2AEQL 3SDDC 5CHNA 3WXWL 3BKJL 3OKOB 2PO6B 4N9GB 1CXFA 2KQNA 4KVNH 5IW1A 1LO2L 5DEZA 1VHPA 1NH6A 2ZCHL 3ZTJG 5ID0A 5LCVL 1RFDH 1FFOB 4K8RH 1J0ZA 4I13B 5ICZA 1MREH 1OM3L 3JVGC 1ZT4A 5DC4B 3U46A 4F7EA 5B38B 5I1DA 5DS8A 4WO4A 4D8PB 4WHTB 3X11A 1S7UB 1IM9B 4F2MB 3CFCL 1AXSB 1CBVL 3MRCA 1J86A 5CSZB 4NGHL 3U7WH 1T7VA 3KPOB 4K7FB 3TFKD 4PGBB 5E99L 1XH3A 4H0GA 4LKXA 5DJ0B 2JTDA 2FR4A 3OTTA 2W9EH 3SCMD 3QI9B 5DDHA 1T6WA 1YJDC 4ENEC 2FHFA 4HKJA 1U8LB 4XGZA 1N3NB 2WBJD 1KCSL 4WNQA 2XKUA 1SY6H 5HYFA 3PWNB 1C08B 3F7RA 3WIFB 1UM4H 1BVZA 5IVXA 5TE6H 3BP5A 1HH6A 3AS2A 1G7QB 2IMMA 3G5VB 2GY7B 1RHFA 4NO0B 2HWZL 4ZO8A 2MQ0A 2R69L 1UKTA 1UM5L 4LGSB 3BW9B 3CH8A 1J05A 3EGSB 4ZPTA 2UVFA 3HNTL 1YY8A 4HS6A 1TQCC 1ZTXH 4AM0B 1CFBA 3RWJB 5JO5B 1MI5B 3SE8H 1PKQA 4UTBL 5KS9B 1CT8B 3C6LA 3RWEA 1XF3A 4WGWB 1EO8L 1IL1A 1FSKC 5T3ZH 4OCXL 2QR0A 3Q1SL 1CDHA 5DR5L 2N7AA 2VQ1A 4LFHG 5IWLA 1N7MH 5E9DD 1I8KA 4V1DE 4HV8A 1HOCB 3L95A 1QPXA 4GQ9L 4Q6IC 3OAUL 2BFVH 1E4XH 1CL7L 2HT3C 3GSOA 3OKDA 4YXKL 2X89D 2F19H 3FRUB 3GMLA 3QAZB 1WC7A 5IEHB 4L3AA 5J7CC 3ARFD 3GMRB 4JO2H 3HE6C 4OD3L 2F53B 2Q7YA 5CEZE 1G7IA 4XP1L 5HHVL 4N0FA 4XPHH 3UBXG 4G9FE 2XNAA 3MLYL 4MJ4A 4G5ZL 1KG0B 4JRYA 1U8KB 3EDKA 1Z9MA 2BVUA 4PGJA 3QR2A 3DO7A 2XYCA 2R23A 2ATKB 1IEAA 3L5WA 4I77L 4XCNA 2NZ9D 3L3OB 3NABH 1AKJB 4GBXB 4GAJH 3GB7B 5T1KA 3MRPB 1NFIB 1CK0H 3LIZH 3DXAB 2EDBA 3U30C 4DGIH 4JFDA 1ZVSB 3OGCA 4BZYA 2OJZH 1QBLL 4I18B 2M2DA 3HI6L 1P7QB 1FBIH 5IMLB 3HZMA 5SWZE 4PRHD 4G3YL 1FLRH 4U6HB 4Y4FA 3KDMA 6CGTA 4BA8A 4DW2H 4NKOB 2DJUA 1MRDH 4QTHB 2BOBA 2OTWB 1RUKH 4G6JL 4E0RA 4OLYL 4KGJA 3IFNL 4MLIA 3L5XH 1H5BC 1S9YA 5IVXE 4Z8FH 2OR7A 2Z31D 2XPGB 4K23L 3RNQB 4HJGA 1WITA 3L7EA 2L7JA 2VIRA 4IHOB 2G5BB 2ZCLL 5JW5B 1MUJA 1OARH 1GJIA 2VO5A 4XC3H 5FDWB 5C0AA 3U9UB 1FVEB 2DWDA 2GJJA 1MHPL 2J4WH 3O6LL 5GGVY 4U1SB 3PABB 1G7LB 4JRXB 4ZOAA 5ESQB 5GQBA 1IC7H 4R90L 1BMGA 3IDYC 1DP0A 2Q86A 4AEIL 4XP6L 4W6XB 2IAND 1BJ8A 3PHQA 1CFQB 4OCYH 1Q9KA 1UG9A 1N5AA 5CZVH 1DBAH 4OCSH 3BXNA 1P7KA 1E6OL 3DJ9A 1HH9B 3K2UL 1B4RA 2AJXL 4FQHA 2OS7A 4QF1B 4PLJD 4L3CA 1Q9WB 2AJ3A 5AWNH 2NX5B 4N0RA 1FNSL 3MJ9L 4OCRL 5J6GB 1WIOA 4BQCA 1ONQA 2CDGA 4OQ1A 3ESUF 5TQ2H 3MV8D 1RZJL 2B5IC 4G42A 5IROA 3RWGA 1T04A 4ZUUA 2E7LC 4L4TD 1S5IL 5KVDL 3HNSH 5B3JF 5JW4M 2V2XB 3B9KD 4AL8L 1Z9OA 4JRYE 4QHLA 3IDJB 3QHTC 1Z2KA 1T5XB 3HHRB 1DANU 4HUUA 4YHYC 4LHUD 4OM0L 5C0CA 4Q9RL 4FQLL 4PTTA 4QXWA 2IGFH 1P2CB 5D7IB 1AD9A 2X6MA 2ADFL 3CMOH 4EVNA 3BDBA 4P5TA 1MQKL 2WQRA 2K3TA 3VI4E 4AMKL 3HLAB 4MYWB 5KVGH 1EBAA 1K8IA 5FB8A 5ICXA 2VXUL 4QHKI 1G1YA 3PWJB 4XC1L 5DA4A 4BFEA 3LDBB 5GGUA 4FN0A 4KVNL 1N64L 1UXSA 2FD6H 3GHEH 4KI5D 2DL2A 1RFDL 4L3EE 3LY6A 3QPQD 3U2SB 2H41A 2FH6A 2P1YA 1G7JA 4HUWA 1AC6A 1I8IA 5DMKA 4KI1A 4R7NB 5CBAB 4C55A 3WLWD 3DIFA 1GHFH 2VDQL 2XTLA 1X3DA 4G8FB 4PJIE 4PD4K 3T2OA 5ESAA 5BRZE 1DDHB 3CSYB 3E6FA 3C6LC 3VWJB 3X12A 3U0WH 3HG1B 4MAUH 5C0AE 3TV3H 4JFEA 3X13B 4HK3J 1M71A 4DGYH 4ZXBA 1V3LA 1ZVHA 1JIBA 4OD2A 2BVOB 4LCYA 2J8UB 1TLKA 1YEKL 1HXMB 1R6VA 3VA6A 1JWSA 2VERN 1AXIB 1WZ1H 3EYVB 4PJGF 4DN4H 1KB9J 1KN4H 3QUKB 3FONA 1JNJA 1YZZA 1SY6L 1A7RL 4NZRH 5LQBH 3D0LB 3IU3A 3K1KC 3M07A 5IT2H 2IAMC 5EOQL 2VZTA 4ZFZA 4U1HA 1UCBH 1H3PH 1RK0B 1BQUA 2XQBH 5J6HB 1MCHA 3OR7A 1YEIH 4JREB 2DLEA 4PS4H 3MBEA 4U2YA 3OKNB 5C07B 1KT2A 3HFML 3EBAA 3I6LE 5EU7C 4KJYA 5E5MB 4M7KH 2ZKHH 4J6RL 3OAZH 4DEPB 1A22B 3S9DB 1WFUA 2F54D 3SDXF 5T3ZL 4U6VH 3OKKB 4IEFB 4NJAL 2EIBA 2J8OA 2CIKA 2AJUH 3ESVF 4PJ7F 1N7ML 5IW6B 1RHHB 2R0ZH 1BIHA 5DJZB 1UFUA 3U79A 3ARUA 4V2BA 2EDNA 2BFVL 1TPXC 1E4XL 1NKOA 4JZNB 3UO1H 3BIKB 4MXVE 3BO8A 5DJAA 3UPRA 3U36B 2F19L 4Y4FC 1GGIH 2V2WB 3M45A 3D85B 3LS4L 5GS0C 4QTIL 5E5RB 4MGXA 4JO2L 2GTWA 1QRNA 1S7VA 1T66D 3LSOA 4XMPL 1JPGA 2Q3AA 4FHBD 3FN9A 4RDQF 2UZYB 4XPHL 2GSGA 2XOTA 2D4DA 3G6AB 3TO4C 1FLTX 5LBSL 4NYLA 1S78D 3F7YB 2AQ1A 3ILPA 3O2VH 1XGTB 3B2UD 1HINL 2VYRE 2VZUA 5A2JH 1CE1L 3KYNA 4KDWA 3RL2A 2Z8SA 4Y89A 2V7NB 3OHXA 4GAJL 3RWIB 1LEGA 3SDXA 1KEGL 1ZS8A 3UYPA 3UZVB 4DGIL 5D7KE 4X80L 4Y16A 3EZ8A 4RGMC 5IJVA 4N8VA 2X44D 5CD5C 4CMHB 5DO2C 2Q8AH 4MNQD 2VRAA 1J0JA 3CFJB 4TVPD 1GAFH 3D87B 4ELME 1MI5E 3ARED 4WI5A 3P3YA 4BZ2H 3TN0B 1LP9F 4DUWA 3TZVD 1MJJB 3QDHA 3RDTA 4DW2L 5KN5A 2VXQL 2AEPH 4O51A 5TDNA 4EEEA 4ZODA 3QUZB 5FF6A 1ETZA 3WXVL 5DD5H 3P73A 1I4FA 4OJFH 5MEQA 1WCBB 1RUKL 4NQDA 4JKWA 4ZPVA 3SHSA 3OKEB 2A6JA 4AEEA 1LK3H 1BQHA 3PGCB 4P46B 4XWOD 1WICA 2QJDA 4GRWB 4M9PA 3DX7A 3GSUA 2X1QA 4ODWB 1OARL 2NY1B 5C09A 3QFJA 3BD4A 1V3KA 3L5IA 4IMKA 4MX7B 3EKCA 5I71C 1B6UA 1MFEH 3D39D 2D3VA 4LNRA 1MPAH 4CVXB 1LO3H 4FQQB 2NR6C 2P8PA 3ULUE 1QEWA 4D9LH 4OCYL 3IKKA 2CGRH 3D5OF 4U1JB 2FJGA 3DECA 3VXRD 4X7SL 4OCSL 5CWSB 5FDYA 1U3HA 4OIBA 2R0KH 1NC4A 2VJXA 1JN6A 4I2XA 3KXFB 5JZ7D 4X6FB 5C1MB 4ZFGH 4P5TC 2V5MA 1FPTL 3KLHC 1RJZA 4LLQB 3RUGF 1EFXD 1IT9H 5DEGA 1HEZB 2BHZA 3KPMA 1LD9A 5T1MA 2ESVD 5DZOA 1PG7X 1VACA 4OUOA 1XR9A 4NUJB 4K71B 5TQ2L 5HSFA 2WANA 4WI7A 2NY5L 5FM8A 4L8BA 1QRNE 3HAEA 1JZ4A 4R8WH 3QCUH 1YY9C 4UT6L 2EDHA 1XIWC 1JMZA 4N0YH 5GZNC 4Z7NE 3ECBB 2GHWB 3HNSL 1QO3B 4KTYA 1DTUA 4IRSB 1I9JL 1U8OB 1Z3GH 5JW3L 3DX8B 4NCC2 4KROB 1ZXQA 5SV3A 5F88A 3ROLA 4ODXB 4OV6F 3FZUD 3SQBA 5TDOB 1B6DA 3REVB 4X0KA 4NHCH 2GCYA 3CSBA 4AENB 2L4OA 3CMOL 3T04D 4GSDL 4FABL 2AXFB 4EDWH 5ISZB 3Q5OA 3CSGA 4PIRF 4XBGB 3MPCA 3VFNB 5A2LH 1TZHB 2YD2A 4P4RA 3WE6B 4JLRB 5KVGL 4HJ0C 5DRXB 1CFNA 2DKMA 5C9JB 4D9QE 2ARJB 1LEIA 4PGEA 1BP3B 1I9RH 2EO1A 2H3NB 1RAMA 4LLWA 2R9HD 1GGCH 2R1XA 4OSUL 5GS1B 4FQ2H 2ATPA 2FD6L 5T3ZE 3O8XB 3QDJD 4Y88A 5T3XH 5KSBA 3BQUA 3NN8A 4R4ND 3GDBA 3UYRH 3MBEC 4NQDE 3IJSB 1KV3A 5F8QC 2J5LB 2NCMA 3QUYC 4H20L 3V4PH 2FGZA 3BVNB 1RZ8B 4KC3B 2P8MA 3TBWB 2ITCA 3H2WA 5GGRB 3O11B 3BGMB 2OSLA 5D1XC 1BQLL 4WWKA 5AYQA 4U05A 2W1NA 4LSSH 1HYSD 4Z7WB 4PLKD 4DGYL 3WO4B 4B0MM 5ECJE 1JYXA 1A1NB 1D5IL 4E5XB 3DVNA 4XAWH 2PTTB 4MVBD 3VFOA 4YNYB 2E9BA 1IKFL 5JUEH 1TXKA 4O02L 4DN4L 1XGUA 3ARGD 1N6VA 1KN4L 2HP4A 2XXMB 1JHTA 5DGRA 1YQ2A 2XT1B 4NZRL 3GM8A 3CH1A 4LOUC 4JFXB 5IT2L 4M48H 4LRIC 3VFGH 4JG0H 4I2XE 1CXIA 1NC2D 5JPNA 2XQBL 4D9RE 4O00A 3PF2A 1YEIL 1MFCH 5L8KB 3TESA 4LKCB 1XGQA 4NHUB 4L1DA 4D3CH 1B0GA 4KQ3L 2H2SC 5H37H 2YC1B 3KYKL 3UBXI 3BZDA 3QIBB 3D69B 4N1HB 4KDTC 2WM0A 2Q8BH 5EBGA 2HMID 4HIHB 2CD0A 3QWRD 3NAAL 1AGCB 1LNUB 1A7NH 4S1QH 4UQ2B 4U6VL 1Z9LA 2DKUA 3NOIA 5EH1A 1D6EB 1J9CT 2DQEH 3MA9L 4Z78A 5I15H 3NMEA 1S5HA 1T1ZB 3O2WL 4KKAD 3ALWA 4W6WB 1RZKH 1IAIM 3ZE0F 1RK1A 3UO1L 5EC1A 2VLJD 4LVOC 2HG5A 3QO1A 3SDAA 5IOPB 1D9KD 4PJAF 4F8QA 5CP3H 3FQNA 1GGIL 1MNUH 1KPUA 1FZOA 3LQAL 3RY4A 3HG1E 3AROA 3BUYA 3PHOA 5BMFH 2C5DC 1HWGB 3BD5A 3G6DL 4YIQA 4YWGH 1RJLA 3VD5A 2BJMH 2Y07H 1G9MH 4X5WA 1CFSA 4Y5XC 5BV7H 2I26N 3OAYK 1GOGA 2X4QA 1S8DB 4IRJB 1PSKH 4HUXA 4PB0H 1FV1A 4FFVD 5E4IA 1QRKA 2UY7A 1FZJA 2X4UA 3O2VL 4N90D 4HLJA 2EC8A 4JZOB 4BFBD 3C5JA 5KSBE 1I7RA 3A6BH 5F6IB 4MZ3A 4ZOBA 5D96C 1P84K 3BPOC 2J6EH 3EOAA 3GSRA 4WV1A 3MX0A 1EJ6A 3T0EA 4F15C 4KKNA 5CZXD 1L6XA 1IGJA 5IB2B 3LHPH 4KRPB 3JWDC 4X6DA 1QFUH 2EH8L 1Z0NA 2Q8AL 3STZA 2IADB 2EEAA 4P2RB 1REIA 2NY3D 3RBGA 4BZ2L 2R39A 3PWVA 1SM3L 4HH9B 1U3HC 2DBJA 3T8XA 2YSSB 3RZCB 4OBRA 2WUCH 3E6HA 4XCCL 4Y4HB 4PJAA 1SJHB 5D6CB 4OZ4A 3NGBC 1MCWM 2EXYC 1WWAX 4M1DL 3O81A 2E9IA 1W8NA 3DLQR 2HRPH 1GSMA 2B8OT 4Y19B 4IJ3B 1LK3L 3ZDZF 2H1PL 3HE7A 2VISA 3MRMB 4X7CC 3C2AH 1O7SA 2K7PA 2QADD 4HC1H 5C2UB 5J8OA 5EC2B 4OI7A 3EFDH 1QFWH 1UXWA 2QEJA 1KIPB 2VABB 3P9MB 3TCLB 4WUUD 3MFFB 4NQEB 5HGHA 5HVHC 2YR3A 2J88L 5BOZG 5D7JA 4D9LL 4XP5L 1HK6A 2F58L 1E4KC 4NDMA 3VFTA 2CGRL 1JYVA 3VFMA 3O6FD 2C1OB 4U49A 5K33A 5DQDH 1X9QA 3VGBA 1LE5B 5ETUB 3SKJL 2H32H 4XB8A 2GFBA 5KSAA 3L3DA 5A40E 3OX8A 5EIIA 3U9PL 3MRHA 1KNOA 2WBWB 2ZCKL 4YEEA 1IT9L 1BLNA 5GGVH 8FABB 1NEZB 1C5CH 3QWQB 4FFWC 4EKXA 4ZTOH 1OF2B 5ENWB 1RZGA 3BEWA 3KLSA 4JDVA 3BQUC 1INEL 5DEFB 3EFFB 2Y5EA 4OIIH 2EH7L 2Z8VC 4PJEE 4Z95H 4JJ5B 2XACC 3QEHA 3TWCH 1OWWA 1JZ6A 5E8EB 5EO9B 4EI5A 4LPWA 1NBVH 4DJMA 3ZKND 4L8DB 3IDNB 1LEKA 2QSQA 2X1PA 4WWKC 4JHAH 5GS2D 5EUOA 5FUCC 2YD7A 2DQJH 2VITA 5A2IH 4GRWE 3D3VB 1ITBB 1P4LA 1MJUL 4Z7QF 3VXMB 4PJXA 2MWCA 5ADOL 3RIAK 4FQ1L 4MCYB 5F1NA 3T0EE 1WFNA 4KMQA 5IIEB 1UEYA 1ZT1B 4X6DE 3LKSA 3QNXA 4U1GB 3Q6GH 1HDMA 2AJZA 4WHCA 5D7LA 3UTSD 3SO3C 4LVNB 3UZQA 4FG6D 1I9RL 4YGVA 3KPQB 3SDCB 1CICA 1YQVL 2WAHA 3NACH 5DC9B 5BS0D 4ZAKA 3QA3B 1G7PB 3VG0L 5T3XL 3U7YH 4WTWA 4Y2DC 4A2MA 5HBBA 1BFOB 3FMGH 2B4CH 1MOEA 5GGRY 5IB4A 5CKGA 4HWBH 2OK0H 4F3FB 5E4EB 2D7QA 3V4PL 1OTSC 2FEEI 2VXTL 4K7PY 4MD5B 4EBQH 4CVUA 5IESL 2OR8A 1U8NB 3OQ3B 4LSSL 5IB1A 1YEDA 5BZDA 2JB6B 2D0GA 1S9VA 3LAFA 1E4WH 2OM5A 3BP6B 3DV4A 3V0VB 5DMGD 1F8TH 4PJ5D 7CGTA 4IMLA 4PJ9D 4WEBL 1PEWA 2GITA 2HJFB 1DUZA 2HT2C 3MLWL 1I7UA 1KJMB 2BZDA 5JUEL 5CGYD 1BOGA 2RGSA 1ES0A 3GBNH 4K94C 3N50A 5FGBA 1G6RA 2Y7QB 4HJJH 5EO0A 4ZS6D 5FCUH 4RWHA 4OFDA 2P24B 4Q0XL 3OAYH 5E8DL 4LLYA 5DJYA 4M48L 1VSCA 4ODTH 3HB3C 3BH9A 4KUZH 4NWTL 3OKLA 3PL6B 2BOCB 5I19H 3RVTD 1MFCL 4X9GA 2H32B 43CAB 1ED3B 3IXTA 5ISZE 4ZDHB 4D3CL 2NY2D 5JXAH 3ARWA 1JZ3A 3QNZA 5I1CH 2ED8A 4OZGA 1QBBA 3HZYB 3N1FC 5IHZB 3PXJA 4NNPL 3SCMA 4JY4A 4PY7A 4AT6A 5HGBB 3VRLF 1B0WA 1IFHH 1V7NH 2XZQH 4TPRH 3GSWA 4MJIB 5DHYA 1UYWH 4L4VB 4RAVA 1A7NL 4LLVA 2WBJA 4H1LH 1U8PB 4WU5B 1XF4B 2XN9E 4JFFD 1INQA 1FAKT 3CDFA 4H8WH 4UTAH 2ZUSA 4UBDD 4MA7L 3V52H 1JGLL 1ORSB 1I8MB 5IBUG 2DQEL 3OXRA 6FABH 5I1EH 3QXTA 4I0PD 1NDMA 1R3JA 2VL4A 4GKZB 1FL6B 3UJJL 5EUOE 2PXYB 3QQ9D 2FIRT 1CD0A 4LVHB 2QSTA 3H9SB 3KR3L 4X4MA 2VLME 2OXHA 1Y18A 3KPPB 3DUUA 5JXED 3SKOB 1QFPA 4PJBA 4PJXE 4DVBB 1KCVH 3WIIH 1AXTH 5BMFL 1SVZA 1NMAL 4I5BB 2VLKB 4L29A 5DJ8B 3MJ8A 3ULVD 5DK2A 1UB5A 3MLUH 5HPMA 1B0RB 4Q2ZA 2BJML 2Y6SC 3RX7A 1LE9B 1CE6A 4OM1H 5DD1H 5BV7L 3RTQB 3FN3A 1PSKL 4FTVB 5E9DA 1HHHA 1AI1H 2BCKB 1V3MA 3FO0L 1DJSA 5FYJU 2CKBB 3T2NL 1KN2H 1JZ7A 3MACH 3TNNA 5F9JB 1T2QH 1AH1A 3RWFA 1F11B 5HI5C 3QDMB 2X89A 4Z7OE 1IARB 1OLZA 5BO1H 4FFZL 5FO9B 4ONGH 1YPZB 1ZLUK 3KAAA 1RURL 3MC0A 2VMFA 1QFUL 4RGNC 4FQJH 4MSWA 4S0TD 4P5MA 5HYJB 4IRZH 1K4DB 2YD4A 4IOFD 5IBLC 4EQ3A 2MHAA 2WUCL 4XNYH 5CEYA 1H3XA 3UTZA 3NFNB 4DK6A 4XPFH 4JFHE 3OBAA 4CNIA 4Y1AB 5J1AB 4XVSL 4P2QA 3VGAB 1MF2L 4HLZH 4F7CB 5KSAC 4LAJH 2HRPL 3FB5B 5EBWA 5HHNB 2ZSVA 3QDGD 2OI9B 2FJFA 4O2FB 3KPRB 3JBG7 2JLLA 1L7IH 5F7DB 3C2AL 4P5KA 4M61B 2VE6B 2LV4A 1F2QA 4ERSH 2FJHB 5CP3A 2PW2B 1DQQA 3W11C 1P1ZA 4Z5RA 1QFWL 2VXVH 4PRHA 2AQ2A 2IH1A 4EIGB 3AY4A 4OZGE 5ADPL 4GW5A 3NIGF 1A21A 1Y0LB 3IFLL 1FNHA 5MI0C 3BWUC 5TPWL 5DD6A 4TULH 4PD4J 4QRPD 1EEZB 1KFAH 2YK1H 3WHE0 3PQYA 3O41B 3RP1A 4EN3C 2YPKA 2HFEA 3SJVB 3X14B 5T3XE 4R97B 1WBYB 4FQXB 4GFTB 2X70B 3O45B 1MCRA 5IB3B 4PG2C 5IHLB 2FEDD 4X9BA 2PN5A 5DQDL 1MVUB 2J6EA 4OFVA 3MRNB 3E1F1 4X4ME 2YA1A 4C54A 2YOCA 2IJ0C 4WHYG 1RIVH 1LK2B 4FMKA 4PJBE 2W65A 4MNHB 1CICC 4P9HL 5D1ZC 2BK8A 5GGSB 3GMQA 5MHSD 2IANA 5DK0A 5TDPB 4G6AC 4MA1C 4PG9A 5EUKA 5D1QC 1DE4A 3V0WH 4MWFA 3W39B 4OIIL 4M8QB 5E7FA 1H0DB 3ZKXC 4ZFFB 3F62A 4NPYA 5BVJB 1P6FA 1JGVH 3BZFB 5MEOA 3HMWL 3MFGB 3CZFB 1F58H 3DETD 3ULSB 3DTXB 2UZIH 3F7PC 4JHAL 5CJ8A 5HY9A 1WBXA 1W0VA 5J13B 1XGPB 5I1AA 4DZBB 4M93C 3QWOB 4H88L 1FDLL 4HC1A 1DUYB 3VFVB 1QFOA 1OW0C 4QCIB 4DKAA 3SDYH 1DVFA 2PYEB 3X3FH 3VFSB 5EZLA 3MV8A 4JFQB 4PJIF 3V5KB 4NQEE 4PJCE 1N6UA 5CILL 4LLUA 5FGBC 5J0BA 2CMRH 3EJZD 4NO2A 4L4TA 1UH3A 3EOYG 4YJZL 4F8TA 1DBJL 3B9KA 3NACL 2P5EB 1ZGLB 4BKLA 4CBPA 1FFNB 3MA7A 2R15A 4WHDA 2OJEA 4LHUA 1U2HA 2YMXH 3MRDB 3WFDL 3WEXB 3FMGL 4B7LA 2ZP0T 3MCKB 4KJPD 5FYKL 1U8MA 1AHWB 1U92A 3OPZL 3TFKC 2IBZX 3BD3A 1QR1B 1A4JA 3FQWA 4UAOB 4MAYB 3E2HB 1H15A 5L6YH 3GO1H 4FOMA 3VFRA 2DLHA 3CVHH 4U3XA 4JY5L 1EHXA 2WBJC 4LSVH 2A0LD 1GZPB 1E4WL 4HKBB 2ZUYA 4PRHE 1KLUA 2R56H 3GUTB 1W0WA 3HRPA 3UTTD