5IJVB

Crystal structure of bovine fab e03
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
253
structure length
248
Chain Sequence
b'VQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGNIDTGGITGYNPGLKSRLSITKDNSKNQVSLSVSSATAEDSATYYCTTVHQKTLEVRSCPDGSRLIGNDCRNEDGDDVNYITTFDYEWYVDAWGQGLLVTVSSASTTAPKVYPLSSCCSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMVTVPGSTSGQTFTCNVAHPASSTKVDKAVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bovine Fab E03 light chain
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 40
structure length 248
sequence length 253
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ijvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ijvB01
1R3KA 4ODXB 3UTQA 1F6AB 3C5ZD 3W2DL 1R24B 3NIGE 1CFBA 2EH7L 4W6YB 4K23H 1ZT1A 1A5FH 4DN4H 3LAFA 3TN0C 3UBXI 4BUHA 5IK3A 1DP0A 4X8JA 5TGBA 3QIBD 3MRHB 2AEQH 3B9VA 1OP5H 5IMKA 2VDML 1MCWW 3MYJB 3MUJA 1XGPA 1NBYA 2M1KA 3REWA 1BEYH 3IETA 5J1TC 3LRSB 2ADFH 2H2PC 1FFPB 3DVNA 4PRBA 1H3WM 3RWHA 2JB6A 4LNRA 1BFTA 2WIMA 2YD9A 4Y4FD 1NEUA 1BZ9A 2NXYD 4R4FL 4PLOB 1KJ3H 4ONHB 1CDJA 4M6OH 2DL2A 2YR3A 3HA0A 3IU4L 3I50L 2A1WH 4FQIL 5LGJB 4HAFA 1K8DB 3PGDB 5INCA 1K6QL 3E8UL 1XIWA 5IR1B 1OCWL 1URLA 5C0ND 3ARFC 2DF3A 2PXYB 4NC0B 3V52L 4BKLA 4KFZC 5B3NA 3BP5B 1GHFL 3KR3H 2JCCB 1GAFL 3OPZL 5DI8B 1FVEB 4M5YL 4HCRL 4LOUD 5C92A 3TIEB 1T04A 1OAZL 1JUFB 1F3JB 3F8UB 4OZ4A 3IDJA 1N0XH 3RVTD 1AGBA 1P9MC 1U6AL 3IDGA 3GK8H 4LAJH 4C59B 2H6PB 2N7AA 5CEYA 4X4YA 1U95A 4JY4A 1F58H 3OKEB 5F1NB 3T2PA 4XCCH 4BSJA 4JFZH 4Y4HD 1UWXH 3IJSB 1HSAB 3QFJA 1KIUA 1KN2L 1M05A 4FQHA 1LDPL 3OR7B 3V2AR 3RL2A 3OG6B 1L7IL 2LU4A 5I1AB 3ZTNL 1RZIB 4LMQE 1AQDB 4UU9B 2DWEB 1QSFE 3QFJE 4RBPH 1DN0A 5L8KB 2VABA 2FYYA 3S35X 3QEHA 3CPLB 5EZJB 1ZXQA 3QIWD 1QR1A 3QUKB 2D9QB 3LQAH 2WUBL 4DGYH 1HHKA 1M6OB 4Z7UE 2B1AL 1RJZB 1T20A 5F8QC 3MRKA 3BRDA 4H5SB 1B90A 3M1BB 1ZK9A 4I0PB 5TE4L 5EOCJ 3DX6B 3CFDA 3H9SA 1F8TH 4D0DA 3L3JB 3MLVH 2AJYL 3DUSB 5IMOA 1G1YA 8FABA 5SX4H 4WI6A 1CLYH 2BNQE 1J0KA 1WC7A 5L88L 4CL7A 2AJXH 4N0CD 3WO4C 4KUZL 4QHMA 5HJ3A 1JYXA 2ICWA 3VXOA 2BRQA 1RU9H 4Z7WF 1AIFB 5EU7C 3VRLE 1LE9A 4B53A 1C5CL 3C5SB 3FB6A 2FO1A 2YRZA 1WFNA 3OV6A 2OCFD 5INDB 3L9RB 4KHXH 1X7QB 4OGAD 1XF4B 4JPVL 1ZHBB 3NOIA 4C57C 2XTJB 1CFSB 1YEFL 2D7TL 4N90D 2OXGA 4GUPA 3CH1A 2BSED 1HH9A 5DD6B 4JPWH 5HI3D 2R29H 5DMJB 3IVKA 4KJPD 4N68A 5DGQA 4NZTL 1OTSC 3VFTB 1IAIM 2BMKB 1Q0XL 3BMVA 4X5WA 5D93C 3SPVA 3BKCL 2VDKH 1TVBA 2AXFB 2G2RA 1KIPB 3MLWL 5IEHA 1H3PL 3LKSB 3ARXA 1LK3L 2ZCHL 3N06B 4FRWA 2BP3A 3RWEB 4YDJA 3X3GL 3MRGA 1UXWA 4JKPL 1KB9K 2PW1B 1BD2B 3NIDF 1YYML 3S8WA 1IARB 1IM9D 5HGHA 3TJHD 4JDTH 1NL0L 4K3EL 4Z7NE 2J1KA 1OVZA 3FFCD 4Q6IC 2FL5A 4HK0B 3MRCB 2N7BA 4M02A 2R0ZL 5E8EB 2W9DH 3PWPA 2XA3A 1YEGL 1N5AB 1OF2A 1KJMA 1LO4L 2E7MA 3VD4A 4PG9B 1U8HA 4X7TB 5JQ6H 4ENED 5C07A 2ZUTA 4L3EA 4XNMB 3PWPE 4P2OA 3VGEA 4FQXC 1AGCA 3TIDA 1SMOA 4M1GL 4XMKL 4DJMA 4CN1A 4N8VB 3LKPB 4LVNC 1UWEH 3HKFA 4MAYB 5FGRA 3GSQA 1GC1L 5DFVD 1J0ZA 4J1UB 3T1FA 4GXUM 3SO3B 1SYVB 4EN3A 1M7XA 3ARFD 5KAQG 3MRRB 3PP3H 3AS1A 5ID0A 1Y0LB 4PRDB 5FCUH 4IJ3C 3O11B 2QHRH 2HH0L 2Y23A 4JG0H 2Q8BH 1CU4L 5E6IB 1GL4B 3D1MC 2CK0L 1G7HA 1F45A 1NDMA 4JZJA 4MQ7A 2VSDA 4X7FC 3I9GL 4PGDB 2Y25A 1EHLH 4J8RA 4JVPA 5TE7L 1QP1A 3K7UA 2W91A 5DC4B 5ECJE 5LGHH 1INEL 4X99B 1CTNA 1DFBH 2OR9H 4PJ7B 3F7YB 1F4HA 2NY6B 4EKXA 2EE3A 2DQIL 1YEDB 3U4BL 4FFZL 1V3LA 1OB1A 5E0QA 3PDOB 3CUPA 3BEWA 2R8SL 5TFSH 1TZGH 2VLLB 3C60A 4HLZG 4GG6B 4MNQA 2FSEB 4NNPL 1EGJH 3C9NB 4PJ8A 4D9QE 4IIQC 5IFHL 2C4XA 3KPQB 1TTGA 2VDRL 1HCVA 5EUKB 2UZIH 1F3DJ 4ETQA 5I18L 4QCIA 2ZNXA 2DTMH 3ARDB 5FKAA 2J88H 1OAXL 2NY3C 2JIXB 3RGHA 3O4OC 2Q6WA 3VD9A 1NLDH 4M62L 5JIPA 4HZLB 3MUY1 4R4NC 1I7RA 2CR3A 3TM6A 1QLEL 3GI8L 4MXWH 5HI4C 5E2VH 4PY7A 5ACZB 2ZOLA 3CSBA 3O2DA 1GGCH 3V95A 5I0DA 3B9KB 1BWWA 1I9RL 4PJXE 4QRQA 3ULUF 1E6JH 3AC0A 5EO1A 5FYJD 2R0WH 4YZFE 1RJLB 4YHLH 1K3IA 2IH3B 2FLBT 1A6TB 2OXHA 1FNSH 4G8GD 1OAUL 1KG0B 2J8UE 5HGAB 3MJ9A 2NYYC 1G6RH 3P4MA 3HZVB 3EDEA 1HHJB 1KTLB 3Q6FB 4JM2D 4XCYA 3WHE1 2FGZA 1MJJB 5FUCE 4O58L 3SKNB 2QSCH 4JFFD 5B8CB 4HKXA 4PY8I 1JGLL 1NBQA 4AZ8A 4GRMB 1SBSH 2AABL 3JV6A 4ZO8A 3DRQB 4EQ3A 4HPYH 5TQ0H 4XHJC 4IOFD 2M8XA 5JHLH 2L4OA 3Q1SL 1CLZH 5GSRA 3RWFB 4Z78B 1NGWB 4Y16B 2C1OB 2VDOL 4UOW0 2CDEB 4AEHH 3KLSA 4HH9B 1B88A 1B0GB 4U2ZA 4WO4A 3AGVA 2B1HL 3SGJA 5DDHB 5EU4B 1TPXC 4ZUVA 1Z2KA 1RK0A 1HXMA 1JNLH 4X6FA 5D6DC 5E00B 5FIEA 5FHBH 2V5YA 1S9YB 4HGWA 3FO0L 4D94A 5DK2B 5FKPA 2NY4C 3AS3A 4JRYA 1X5GA 3GMLB 2A9MH 2VLRB 4P4RA 4N90E 4AENA 35C8L 4FQXD 4G9DB 4DZBA 5E1AA 2W1NA 3RNKB 1X5HA 4JHWL 4BZ1L 1R5WA 5EFIB 3LV3A 3KPOA 2CRIA 3TO4C 1NEZG 1RHFA 2UY6A 2QADB 2ATKB 4PJEF 4E42B 3FONB 3BWAA 4M6ML 1MFCL 3QDGE 4WTZG 5TDPB 3V0AC 1JZ6A 4HS3B 4OIBA 2V2TB 3QEUA 3VG0H 4PY8J 1JTOA 1HZHL 2KQMA 4FN0A 1NC4A 3O6ML 2HYMA 1BBDL 4PRPB 3QEGH 2BFVH 5H37G 1QR4A 4JFQA 5FO9B 5DD5L 3STZB 3VI4E 3H7LA 3RWJB 5HDQH 5T33L 1CE1H 1T22A 2HFGL 3I3EA 3RDTA 1H3TA 1UT9A 2A9NH 2IPKB 4C55A 3FFCE 4GRWF 1DJSA 1DDHB 4LCWB 1CFVH 4HXBH 3ZDYE 2C4FT 1U3HB 1ZVSA 1YMHB 4EUPH 2FH6A 3TBVB 2O5ZH 3RL1B 4QHLB 1K8IA 3B2UC 1KEGL 5CSGA 3GMQA 1FO0A 3DECA 4KK6C 3VGGA 2FECL 1LO2L 2KDGA 2NZIA 1LNUA 3PDDA 1KCKA 1DQQA 4OTXL 1XF2A 3KPSA 4CNIA 2EDQA 2YD7A 5JORB 1CZ8H 5KSBE 4F3FA 4U3XA 5CP7A 1Y6MR 1FFNA 2ZP0T 4CMMB 1JWMA 4I4WA 1FFQA 2E9WA 3OSKA 4B0MM 4YXHH 5E8NA 3VXMD 4JPKH 3HR5A 3O8XC 2Q86B 2AV7A 3BIAX 5L7XL 3AY4C 2MMXA 1FVDB 3KYKL 2FCBA 2VYRE 4FFVC 5F7WC 2NY3D 4JPIA 1VERA 1KTDA 2KH2B 1WICA 4R4ND 1G7IA 3DURB 1CIDA 3UTZA 4WI4A 4HIHA 4Q9QL 4C83B 4LU5L 2YPLB 1CDCA 4WHCA 4HC1H 5L2KB 1YJDC 4R0LA 4MQSB 4KTDL 1UJ3B 4O9HH 5F6IB 3EO1B 5IVNA 4Y5XB 4MA1B 1NFKA 1DQDL 1X5ZA 1FL3B 3QXVA 5LAXB 3HG1A 5D96C 4HV8B 5ANMA 5GRYA 1E4XL 3RBSA 5FECA 3V0WL 1AHWC 4U6XB 1NBZA 1CQYA 3P9MB 2EKSB 5C0CA 1FFRA 5ICXA 3UC0L 3UZVB 1P7QB 1R3JA 1MIMH 4HHAA 2LAAA 2NYYD 4RA3A 2BX5A 3EOBA 3HMXH 3LIZL 5DURD 5CCKL 4P23C 5EBMB 3VWJD 1XEDA 4RGNB 2Q3AA 4LRNH 4GMSL 3KHQA 5FYKE 4UV7L 2VLJA 3T0WA 2NCMA 4NWTL 5EIIB 3MV8B 4MQXC 1F4XH 5JOEA 3PIQB 1JYVA 5F88A 3QYCA 4ODTL 1N4XH 3IXAB 4G7YL 3FOMB 3UP1A 5HYJA 1I9EA 3FKUS 4YR6A 5KBNC 3D2UD 4F7TA 3HI1A 2EYRB 5IG7B 5D1QB 2GCYA 4MMZC 1OW0A 4D0BA 2Y06H 3TBWB 3L3HB 2IQAA 1RZKH 1LO3H 3MODH 3P11H 4NO2B 4XAWH 4P2RE 3DHJA 3GJFK 1T5WB 1PG7H 5EU7E 1I9IH 1SJXA 4ONGH 4K7PX 2PTTB 4ODXA 1F90H 1F6AA 3KJ6H 5FYJE 1R24A 4OJFH 4XP9H 4RRPA 1FV1B 1W8NA 4XVTL 5TQ2L 3MRBB 2FBJL 1BQHG 4RMVA 5KAQF 3B6SB 4OZFB 3TO4D 2X7LB 3MRHA 4LPWA 3ZHDA 2JJTA 2EIEA 3ILPB 1S9VB 3A67H 1QA9B 5EC2A 3MYJA 5I1CL 2AS5M 1L7TH 3IU3B 2IAMD 5I73B 2GY5A 3LRSA 1T3FB 1FFPA 1UEYA 4V1DA 4Y5YC 1Y6KR 1J0YA 3BSZL 1SMAA 3N1PC 5FOBB 2APXA 3VD7A 1T7ZA 1W0WB 2FGWL 5D8JL 1WIOA 3TPKA 2UY7A 4V1DE 2Y5EA 4OZHF 3NACH 3WJJA 5DS8B 3QCUH 5IR1A 5C09B 5MEOB 2OTUB 3WFBL 3B43A 4KK6D 5EB9A 2FX8L 1U41A 5C9KA 4F7EB 1J8HD 1C7TA 1UFUA 5E8DH 2JCCA 3AM8A 5FO7B 5I1KL 5KVEL 5DI8A 1NGZA 4GMTH 2VXUL 3TIEA 1JUFA 3FT3B 4FTVB 4OB5L 5T1LD 4WENB 4TSCL 3D39D 4WWKC 4MSWB 1IC7H 4O00A 5DLMH 1GGBH 3TT3L 2CO6B 2H6PA 4JR9L 3KXFD 3O8XD 3OKEA 3NCBB 2EDFA 3IJSA 4JFDA 4U1JB 1HSAA 3P4NB 5DR5L 4KPHH 1Q9LA 4FFVD 3RX5A 5SWQB 4RAUB 3OR7A 5I1JH 1J7VR 4M1DH 2GT9B 3EYSL 1K4CB 4GW5B 1RZIA 1F00I 3VFUB 5GGVH 1HDMB 1AQDA 2DQFB 3FOLB 3K4DA 3NH7L 4L4TB 3ZDXE 4UU9A 5IT2H 2DWEA 4WTWA 3ZMRA 4I0KA 5D2NB 1T03L 4MJ6B 3C8HA 3DSFH 3CMGA 1JRHI 1KJ2H 2VAJA 3CPLA 1QBML 3E2HC 4OCSH 5EZJA 5IEKB 5JR1L 3QUKA 3A6CH 1NMAL 1ZLVH 5I6XB 2P5WB 4LPCA 1M6OA 3BP7B 3SDCB 1RJZA 3L1OL 4H5SA 4WY7L 3M1BA 2RJMA 4I0PA 1MIEL 3O0RL 3VE0B 2VRAA 3DX6A 2DLFL 2P47B 3L3JA 1EFQA 1QPXA 3DUSA 3ES6B 2X1OA 4ZQKB 3EDDA 4P23D 4PLJC 4PJAE 2B39A 5IW1B 3W9DB 4S0SD 1I3UA 4HAGA 1TCMA 5DJZB 4PYHA 1JN6B 1AIFA 4GAYB 1I9JH 3VXME 1SM3H 4MQXD 3C5SA 4OFKA 4JZOB 5JTWA 3PWLB 5INDA 2Y6SC 3L9RA 4XX1E 1X7QA 1ZHBA 1UWXK 1CFSA 3VGAB 4FMKA 1U2HA 5DD6A 3KLDA 1WBYB 4Q9RL 1A6UH 5AZ2H 1SEQL 4P9HC 4ZFOB 3G6JB 2DMCA 2D0HA 3BKML 3VFTA 5ITFB 3VG9B 4GBXD 2HVKB 3MBXL 4GRLD 4UAOC 3UYRL 4RBPK 3NCMA 4S11A 2AXFA 4KI5F 4WI9A 3LCYA 3RX7A 2ZUXA 4JO3L 3CSGA 4TSBL 4G43A 1X3DA 4HUVB 3LKSA 3P9LB 2FBOJ 2EECA 1V8HA 1BFOB 4XWGL 4ZAKB 3RWEA 5HD8C 4H1LB 1BD2A 3GEWB 4M7KL 3GM0A 3VDAA 2R2CA 1WFOA 2XACC 1N64H 3CXDH 2XFXB 3PDGA 3T04D 5KTEL 3GHEL 3T0BA 3PWUB 5ALCH 4J3SA 4Q2ZB 1IGIH 4FQLL 5E8EA 1IRAY 1BGXH 3O2DL 1N5AA 5I8OL 2FEEL 5GRZA 2PYFB 1JPTH 4X6EB 5FUOH 4PG9A 1IC4L 2YWZA 4X7TA 3HNSH 3WIHA 4HS8L 1MJ8L 3EGSB 5EZIH 4QT5B 5DUBA 3WFCH 5T3ZL 1J11A 5KANG 3BDYL 3PWVB 3SDXF 3CFKB 3QQ4B 4N8VA 3LKPA 3QEQE 4MAYA 4BA8A 3MJ9L 3U48A 4J1UA 3J7HA 1FNGB 5BOPA 1DQML 3S5LB 1NSNL 1SJEA 4I18B 1AO7B 4PJIE 4GS7B 5CZVH 1M71B 3MRRA 3NA9H 1Q38A 4YQXH 1H8OA 1QFOA 1Y0LA 4PRDA 3K0WA 3GIVA 3O11A 2R1WA 3EDFA 4GAJH 1J1OL 5E6IA 1NFDE 3GZKA 5J13C 1IAIL 3SBWA 4WWKD 3F7PC 4ISVB 4DVRH 4D9RE 4PGDA 2CQVA 1I7ZB 3AXLB 1AR1C 4QWWC 3NN8A 5IVZB 3UTTE 4PB0H 4X99A 1OT2A 4GFTB 4PJ7A 3F7YA 3X12B 4P9MH 4XCNB 3O3EB 1YEDA 3G5YA 4XNUL 3VI3F 1FYTD 1NC2B 2BVOB 4S10A 4U1LA 2VLLA 2FSEA 1NANI 3BO8B 3D25B 3C9NA 3L6FA 3HUJF 3KPQA 3K2MC 1EMTL 2GKIA 3H9YA 4J3TA 3VRIB 4IRJB 1YEIL 4NCC2 5EUKA 1MI5E 3UJTL 2Z92A 1GJIA 3VWKB 3B2VH 1N26A 5E7FA 1ZTXH 2OMNA 3BD5A 3JVGA 1H3VA 5H2BB 1B2WH 4M8QB 3PP3K 3QO0B 4WNQB 2N1KA 3EZ8A 4QXTB 2GQHA 4KXZI 4KK5C 2JIXA 3RVVC 2BCKB 3THMH 3EYFB 4HZLA 4GKNB 5H8DA 4DN3L 4M93C 1XIWD 5FYLE 1VCAA 1RZJH 2I24N 5ACZA 2V9RA 5BRZD 4K3HA 3B9KA 5F7DB 4NHCL 1TZHB 3VGFA 4YDIH 1PBYA 5J8OA 2OR7A 3KXFE 4PPTA 1NBVH 2Y6SD 3ET9F 3BJLA 1RJLA 1JFQL 4YXLH 4GO6B 2IH3A 4LEXH 1IQWH 3GDBA 1FL6B 1A6TA 1FO0L 3WCYA 2YXMA 1FNAA 2XZAL 4NFCA 4G9FB 1KG0A 5HGAA 4I9WD 4HG4K 3HZVA 1FLRL 4IEFB 1HHJA 3Q6FA 3PGFL 2ZG2A 3RY4A 3V6FB 5B8CA 1EK3A 3DARA 1NAMH 1S7SB 4GRMA 1MJUH 2Z91B 5T3XD 2LTQC 3HRZB 5HD8D 3ECBB 3U6RB 4QOKD 4TUJB 12E8H 3RWGB 2W0FB 2O5XH 5MI0B 4Z78A 3QRGL 1NGWA 3VH8B 3WYRA 2XWJB 3WSQH 5GRUL 3TBTB 2F5BH 1T21B 3HRPA 4HH9A 3GO1L 1B0GA 4PG2A 1KUMA 3EUUA 4X80H 5DDHA 1OSZB 4MS8D 2JB5H 3H9SD 2RB8A 3DGGB 2H8PB 1S9YA 1YEKL 4Z9KB 3GMLA 5K93A 4NO5B 3GRWH 3TF7C 2VLRA 3ISWA 1HKLH 1HQ4B 1BMGA 5SWSB 3FQNB 4KJQC 3RNKA 5AD0B 2DIAA 5EFIA 5FYKL 1XT5A 4K07A 3TYGL 2KQNA 1G9NH 3QHTC 2ZUQC 3OHXB 4FFWC 2EXYC 4I2XB 5KSAB 2ATKA 1MCOH 4E42A 1CL7I 3QFDA 1KB9J 3FONA 1WWWX 4QHUB 1IGCL 4KDTA 3NPSC 2X9WA 3BH9B 3BQUB 4WUUD 2V2TA 1OD7A 4ZS7H 3QWQB 4LHJB 5ICZB 1JK8B 1IL1B 4FP8L 2OP4L 4NQEB 1CFNB 1EDQA 3MJ7B 5FO9A 1AQKL 3STZA 2YRPA 3RWJA 4J3XA 1AKJB 2ED7A 2VH5H 3D9AH 1AR1D 4QWWD 4NRXA 3R1GL 1FRGL 1F4YH 4LCWA 1DDHA 5IJVB 1U3HA 1KCUL 1YMHA 4J3VA 3P0YH 3TBVA 3RL1A 4QHLA 4BFEA 5I1HL 1BM3L 1RIUH 1RHHB 1F4WL 1R3HB 2EIZB 2CK2A 3OAZH 5HPMB 3FRUB 5JORA 1JYNA 1Q72H 1XCTB 1BQLL 4O51B 4OFDA 1J1PH 4PJDE 3SE3A 4PJBF 4CMMA 1V3MA 3WIIH 4DZ8B 5IM7B 5D6CB 4CJ0A 4BZ2L 5C07D 4Q9BA 2Q86A 3MMEB 3G04B 3ZYZA 2WK2A 3KPNB 1NJ9B 3G5VB 2A73B 4P2OD 5F9OH 4OD3H 3B5GA 2ZPKH 2OBGA 5D7IF 3RVVD 3OXSB 1WT5C 4P2QD 2DICA 3EAKA 5A43C 3DX7B 3DURA 4C83A 2YPLA 5L2KA 4PJ9C 4JO2H 1UJ3A 3LKQB 3EO1A 5L6YH 5T1MB 1ZMYA 5LAXA 4WFFD 5T5FH 1RULL 1MRCL 1A3RL 4HV8A 2BY1A 4U6XA 1P5UA 5IF0B 4WRLA 3P9MA 4XWOD 2EKSA 3CDYA 1P7QA 1FYTE 3P40A 4BQ8A 1QG3A 5KW9H 5EBMA 1UC6A 3MOQA 3VFVA 1DLFH 5IHBA 4YHKH 1NUDA 4XVJH 4RISL 1QFWH 3TJEL 5EIIA 3MV8A 3PIQA 2BVYA 3BE1L 4LVEA 4C4KT 3IXAA 4HWEL 3C60D 3FOMA 2XT1B 4NM8L 5HHOB 5IHZB 2IFFL 4J4PA 1HOCB 4NZRL 3KPLB 1FE8L 4PJ8D 3BZEB 4NBXB 1ZLSL 4LSPL 1QSEE 1U92B 4R3SB 5FYJH 2RQ8A 4NQDA 3BWUC 4Y19B 5C71A 2I60H 1Z9LA 4ZDHA 4EUPG 4P46D 4W4NA 4GQ9H 3L3HA 1A7NL 1MSPA 4QY8B 5B4MC 5I8CB 4Z7VF 5GHWL 4NO2A 2R2BB 1F2XK 1J0HA 1MHEB 1T5WA 4NQDE 4BQ6A 5BRZE 1RIVH 5KZCD 4NCDA 2DKMA 3RA7L 2PTTA 4DKFH 5D1XB 2P8PB 3CFJB 3JWDL 4L8BB 1DLHB 3B8YA 3IDYC 4G42B 2KL6A 1BPVA 5A40E 1MCNA 1FV1A 1PX3A 1WCQA 1KBGH 1TQBC 2FWOB 4KJQD 3MRBA 1DANT 2XG4A 3MRQA 1LO5A 5D7KD 1KV3A 4JHAH 4KHTH 5CFHA 3B6SA 4OZFA 2X7LA 4OZHB 4FFWD 4QHNB 2EDBA 1H9VA 3ILPA 2EIBA 3MGTB 2DQDL 1S9VA 4WW1B 1QA9A 5DQ9A 4KAQH 3T2OA 3UTSB 1AE6H 3TA3C 1QQDA 1ACYH 3W2DH 3NAAL 1S7UB 2Q7NA 4M9PA 1Z0NA 2EH7H 3AAZB 5T3XE 1ZLUH 4JM4L 4TUKH 1T3FA 4M7ZC 4QOKE 3QXTA 4DGVL 2NLJB 5KG9B 5C6TH 1NMBL 2ED8A 3EFFB 4FQJL 3QUXB 2Z31C 2V5TA 3I75B 4U0RB 4RMSA 5DS8A 5MEOA 3MCKB 3SE4C 2OTUA 2DDQL 4AMKL 2OL3H 4PFEA 4O2EB 3FB5A 4PRNB 4R90H 3C6LC 5FO8B 5J9PB 3ALPA 5FO7A 2EDOA 3FT3A 4WO4D 4R4FH 2QQLH 5D2LB 4FTVA 3IU4H 4FQIH 1S7XB 1GGYA 4MSWA 2IANA 1R6VA 2HT2D 3EDKA 2QL1A 4CADB 3E8UH 3PQYB 3ZT5A 1DE4B 2VC2H 3D87B 4N9GB 3BRFA 4YC2B 3ZTJH 4LSUL 4U1JA 3QIUC 2OK0L 3P4NA 4TSAL 2ZUYA 4QRPD 4WUUE 1GHFH 3AS0A 3DMMB 4RAUA 5SWQA 2P44B 1ZEAH 4M5YH 3WIHL 4HCRH 2GT9A 1X4XA 4GW5A 2CXKA 3VFUA 1HIML 4XMLL 1HDMA 2DQFA 3FOLA 4L4TA 1KCSL 1R0AH 4PJ9D 5KSVB 5D2NA 4AM0B 4MJ6A 4Z7WA 4JGUA 1U6AH 3X11B 4YJZL 5IEKA 2HP4A 3ARZA 5JPMB 3LHPH 1MFDL 2A2QT 4KJYA 2P5WA 3WXVL 2XQYG 4XXDB 1IEBB 3O4LD 3RZCB 2CDFB 3VE0A 1WWCA 5DJXB 4JCLA 1JPSL 3WFEH 3ES6A 1EAJA 4ZQKA 1FFOB 3D85B 1FCCA 1SHMA 5ILTH 4OIIH 5IW1A 1IEHA 3W9DA 5DJZA 1JN6A 3Q3GA 3QUMA 2VZSA 5EA0H 4H8WC 1MAML 4EXPX 4GAYA 5DQDL 3QDJB 3RJQB 3U79A 3VFSB 4JZOA 1DVFC 1H5BA 2B1AH 3PWLA 5B39G 5BJTB 1CDHA 2AJ3A 4ACPA 4K7PH 4MXQC 4YWGH 3K46A 3IDUA 3R06B 1FLTX 1KLGA 2GK2A 3QUYB 4MNGE 1E4KC 1WBYA 2AJYH 3V4VL 5GS0C 4ZFOA 2OJEB 4P2QE 2HRPL 1Q1JH 3G6JA 4GLRI 4KUZH 2HVKA 5B4MD 1CF8L 3EYQD 5B3JE 1WBZB 4UNVA 1U8MA 1YECL 1A6VH 2X10A 4RMTA 5CUSL 1AD9A 3U0WH 1JCKA 1QFUH 5IB5B 4HUVA 3P9LA 3V79C 2V6HA 1BFOA 4ZAKA 4WDIB 4KKLD 2D7TH 4XP4L 1ED3B 4H1LA 3C08H 1FH5L 3QHFH 1YNKL 1MCPL 1OAKH 2VE6A 5FYLL 2ICCA 4PGBB 2P43B 1DBMH 4NZTH 4BUGA 1JF1B 5D7JB 5I1EL 4MA7L 3VXQB 1CT8B 1Q0XH 4I3RH 4FABL 3PWUA 4R7NA 1DUYB 2R1YB 3PABB 1RAMA 4FZ8L 4OLXL 3TH2T 1C16A 4YFLF 3TA3D 2PYFA 4X6EA 1LK3H 2ZCHH 4TVPE 4KKBC 2NY5C 4UTAL 4J6RL 3X3GH 3UZQA 1VESA 3HAEB 1U8IB 4JKPH 4C4KO 3MSPA 2OR8A 3NCJL 4HD9A 3FO2B 4JQXC 3MV9B 3CFKA 3D3VB 3QQ4A 1NL0H 2VLJD 5GS3A 2XPGB 3QWRD 4OCXH 4NZUL 4HBQA 3CLFH 3I02B 2Z31D 1FNGA 1S3KL 3S5LA 5HYJD 3EJYD 4PGEA 4E5XB 3HE7B 4I18A 1AO7A 4OF0A 1EPFA 4FXGB 5LXGH 1M71A 3T3MF 2HWZH 3BDBA 5ITBL 1KIQB 3C6LD 2DMBA 1YMME 4L8DB 3K8LA 1ZVHA 1IGTB 4DOHB 3HUJB 5JOFA 3GMPA 4M1GH 3LD8C 3QDHA 4JRXB 4XT1C 4U1IB 3MO1B 1GC1H 1WWAX 4ISVA 1MFNA 4F9PC 3X17A 1I7ZA 3AXLA 5IVZA 1HEZB 1CR9L 3NABL 4JHZA 4V2CB 5BV7H 2CKBH 3X12A 2QKIB 3DXAE 3LOWA 4OLWH 3HC4H 4XCNA 3O3EA 3VXPB 1NH6A 3MQIA 3QIUD 5D5MF 4U2YA 4ZFGH 3DUUA 2ARJA 1NC2A 2HH0H 2BVOA 4QNPE 1BVLB 4ESKA 3ALXA 1K4DB 3P3YA 3D25A 4TTGA 3RY6A 3MLRL 1KJVB 5CSZB 4HWNA 3VRIA 4IRJA 4HPOH 3QDME 4LHUB 4LIQL 4UINH 1KPUB 1YPZF 5IMMB 2NY1B 1INEH 3CSYB 1JNJA 3WV0A 4WEMB 1IQDB 4KI5C 4WI8A 3MV7B 2DI7A 5H2BA 2V7HB 2NY0B 3QO0A 43CAB 4WNQA 4DFHA 4QXTA 4LVOB 1VPOL 2EE6A 4EVNA 1C1EL 4NJ9L 4OQTL 3EYFA 6CGTA 5J7CC 4PJHB 4GKNA 4OD1L 2RIKA 3HTLX 3CDFA 2ZWLT 5I18H 2P4AB 2PXYD 5DA0B 4EDWL 1MCIA 1UM6L 5F7DA 1MNUL 1OL0A 3GSNH 1EUUA 1TZHA 4R4BB 2R1XB 2K9UA 4OZGE 3UPCA 2VDPL 1T7XA 5DVMA 1MRFH 1YJDH 4N1EA 1R3IL 4QXGH 3TBSB 1WT5A 4MXQD 1TLKA 2YD8A 5KANI 2I26N 3X13B 5D7LA 4R97B 3I3BA 4QRPE 5EU6D 4G9FA 1CGUA 1VACB 2XQBL 1QLEH 3GI8H 3LS5L 4XPHL 4Z0XB 1LE5B 1XGQB 5D7LE 4NSKA 2YOCA 3F62A 2DI9A 5HGBB 1QRNB 4MJ4A 1QVOB 3GJFB 1S7SA 5I9QC 3CZFB 2LU3A 5SX4I 3ARGC 3ILQD 2Z91A 1GZPB 3HRZA 3ECBA 2F8XC 3U6RA 2VJXA 4TUJA 1QFPA 3O4LE 3QR2A 5BMFL 3RWGA 2W0FA 3QNYB 5I15H 3VH8A 2XWJA 5CEZE 2VXSL 1BFSA 2JELL 3PHOB 3TBTA 5I66B 4KY1L 2FJFA 3ARDC 3IFPB 2HLAA 1T21A 2DD8H 2C1PB 4Q7DA 4LGPB 4O58H 4KU1A 1J0IA 5IESL 3TLRA 5BOZG 3ZL4L 1X5XA 4I0PD 1OSZA 4YXKL 1Q9KB 2AABH 4KKBD 4PJEE 3AB0B 5FHAL 1VADB 2H8PA 3DGGA 4YHIB 5A1AA 1L6XA 4Y2DB 5HHXL 2HT3C 5E9DB 4MNHA 4NO5A 5T1DH 1T1WB 1HQ4A 5SWSA 3FQNA 1OGAB 5E2JA 5AD0A 1KLUB 3G6DL 4RFEB 2A6JB 5EUOF 4NJAL 4OM1H 1A47A 4PJGB 4S0TD 4AH2A 1JZ3A 2VDOH 3FQRB 5JOPD 1JBJA 2O5YL 2V2XB 4XNYL 4C56B 3GB7A 4QHUA 1NDGB 1DBJL 5HVWA 4UTBL 2EXWC 3BH9A 1OQOA 3BQUA 5LCVL 3RUGF 4GRWE 4O4YL 3FO0H 1FGVL 3JV4B 1IAMA 2QSVA 3BN9C 4BJLA 5ICZA 1JK8A 1IL1A 5MERB 4WUKH 4P49A 1VGKB 4QRUB 4JHWH 3ROLB 2DB8A 2XWTB 5CJOL 1EZVY 1FAIH 2MKWA 4G6AD 2B5IB 4EOWH 2EH8H 5JLZB 4QKXB 3O2VL 1MFCH 5IJVA 4KI1A 4FQ1H 2VITA 1MF2L 2R39A 1A7PH 3K80A 3QBTB 5F89B 5C3TA 5J6HB 1RSFA 1JMZA 3C8DA 5DFTA 4DTGL 4EDXB 1RHHA 2HN7B 3DTXB 3QCVL 1R3HA 4P5MB 4RDQG 4KRMB 3TBYB 3C09C 5HPMA 1TCRA 1DEEB 3FRUA 5DD5H 4AEIL 1CGSH 4O51A 4BSVB 2YUVA 2XXCB 2XA8H 4OM0L 4DZ8A 2DQGL 3O3UN 2ZUWA 5IM7A 4N0YL 1JPGB 5D6CA 4P57B 1MCJA 4GQPH 3RIFK 2VWEC 4U1GB 1WEJH 1OM3H 3MMEA 3KPNA 1NJ9A 1RIHL 3G5VA 2A73A 2ENSA 5KS9F 1D9KB 2MPAH 5CILH 4MCYA 5CJXC 4KMTL 3SDAB 5E5MB 3CSPA 3SGKC 1FBIL 4XB7A 3IRZA 3M17B 3OXSA 1N5YH 2FHCA 2WIIA 3DX7A 4YGVA 2VXTL 1TIUA 3KPTA 5TJWK 4G8IB 5CLWA 1U8QB 5TDOB 1JZ4A 4OUOA 5T1MA 5DUPH 5F8RC 1YDPB 5FB8B 4PV8A 1MQKH 3O6KH 3LH2L 4R26L 3U0PB 1MOEA 3PWNB 4LCIL 4OKDA 5L7XH 3R0MA 4RGMC 4CU7A 5IF0A 5JMOC 2X4OB 4LPUA 4Y5VB 1U8OB 1GOGA 3DROA 5J56B 1T89A 2PR4H 5DEGB 5EU3B 3OAZK 4WFEE 1MWAB 1KCVL 1B4JH 4JQVC 3JWOH 3ZKMC 3ZT7A 3WKML 1CDYA 4P3DA 3REVA 1TTFA 3ARGD 5J1SC 3MLZL 3BKJH 4YGAB 5IHZA 5HHOA 5DJAB 5ETUB 4PJFF 5I8EB 1IT9H 1HOCA 4YFLI 3KPLA 2ID5A 3BZEA 4RFNB 2IF7A 1FORL 1CK0H 2E7LC 4J23A 4ZUSB 1U92A 4R3SA 5CCKH 4WFHE 1CXEA 4Y19A 1QHPA 5DK0B 5C0BD 1MLBB 3ARDD 4Z7UF 1J86A 4Q0XH 3WL9B 4RWHA 4QY8A 5I8CA 1CGWA 2R2BA 3DVIA 4P9HH 4NWTH 4JFED 1MHEA 1WTLA 2W9LA 1PYWB 4ODTH 1E4KA 4G7YH 1ONQA 2P8PA 3BXNB 3CFJA 1DLHA 3QNXB 5JUEH 2FJHA 1DQLL 3P0VH 1WK0A 4HG4J 2HT3D 3N85L 1YY8B 2E7BA 2F54D 4IRSB 5HHMD 2F19L 5GSVB 2FWOA 2AK4D 3MCG1 4Y5XC 3U9PL 3RGVC 5EU6E 3B9KD 3OF6A 3MNZB 3MLXL 4OZHA 5DRZB 2VR4A 1YQVL 4QHNA 3FRPA 4PUBL 3ZKXB 3JV0A 2EC9T 4L9LC 3AS2A 25C8H 4WW1A 4BFBD 5KVGL 5L2JB 2EXWD 3QUML 3UTSA 4AYFA 1CCZA 1C08B 4YUEL 1AI1L 1S7UA 3S37X 5BO1L 4F2MB 3AAZA 3BN9D 1GGUA 1TQCC 4H0IA 2HJFB 1FZKB 3KS0J 4NP4L 3VW3H 2WP3T 4DEPC 4XVTH 3MOBL 5KG9A 1GPOH 4OV5A 3MLUL 4AEEA 2EDTA 2BY3A 4XC1H 4OF7A 4TRPL 5FGCB 2A77H 1E28B 4ZFOL 2GJ6B 3QUXA 2O61B 1S5HA 3TV3L 3I75A 5CZXC 3MCKA 1QBBA 2V2WB 5D1QC 5GS1B 4G6ML 3FQUB 4O2EA 4Y16D 4PRNA 4HKBB 4H88H 5FO8A 5J9PA 1HINH 2MJWA 5D70L 5E2WL 1GZQB 1FDLL 4PRIB 5I17B 1ULVA 2G5RA 3WUWG 2Y4SA 5D2LA 2BZDA 4FFYL 1S7XA 1UKTA 1MUJB 2WUCL 1AFVL 4CADA 5ALBH 3PQYA 4TVPL 1MFEH 1DE4A 2ADGB 5JOPE 3BRGC 2XN9E 1F6FB 3HE6C 3O3BB 2VLRD 1CD1B 4FQCL 3NBNA 1JZ8A 3DMMA 1IE5A 2FEDC 3GSVB 3CU1A 4F9PA 4YBLC 2X1WL 2ED9A 1EA9C 2OTWB 1G7LB 5SWZE 4OB5H 4TSCH 5KSVA 1NUFA 4P59H 4AM0A 3NTCH 1FIEA 3K74B 2AJVL 3X11A 3TT3H 1XGRB 4G5ZL 5JPMA 4MCZA 4JREB 5GRVL 4LLQB 4PRPD 1L4IA 5DR5H 1ZHKB 3HPLB 4GSDL 4XXDA 1IEBA 3RZCA 3TFKD 5GXBB 1N7ML 5DJXA 1PDKA 3DV4B 3ZE0E 3GIZL 1FFOA 3RPKA 5D7SL 4YK4B 1FPTL 1JPFA 4BQ9A 4QLRA 4X6CB 1VSCA 3DVFA 2DQJH 2WBWB 2P5EB 3ZKMD 1QBMH 1D5IH 5JR1H 1HQRB 1LO0L 1L0YA 3VFSA 5LWYL 4HQQL 5BJTA 4NNYB 1IC5H 2LVCA 2RGSA 3L1OH 2JLLA 4WY7H 4KI5E 3AREC 3O0RH 3WLWD 3R06A 2DLFH 3QUYA 3RIAK 4PTTB 5IW6B 5DA4A 1ZA6B 2EC8A 2OJEA 1YEJL 4MYWB 3LEVL 1ZSDB 4LCCB 5I2IA 4FOMA 3Q2CA 1WBZA 5I75C 4XXCA 3ULUL 3O2WH 4NKIL 3UO1H 1E4WL 1WIUA 5IB5A 2LVEA 4CVWA 3BIBX 2FB4L 2XKUA 4ELME 1XFPA 4WDIA 4RAVB 2ARWA 4ELKB 1ED3A 1C5DA 1IKFH 5E6ZA 4GKSB 4XRCB 1SEQH 2R4RH 1SY6A 4PJXF 5D1ZC 4R7DB 1EFXB 3QDAA 4PGBA 3QG7L 1JF1A 5D7JA 3BKMH 2DQHL 3KHOA 3VXQA 1U58B 1CT8A 4JKWA 4J3OC 1JHKL 3SDXE 1BREA 4PRHD 3SDCC 3ZTJG 5DJDA 1DUYA 1AXIB 1WJ3A 3BPOC 4S1QL 3PABA 4S2SB 3OXRA 4JO3H 2ENYA 3AVEA 1EEQA 4NN7B 1VFMA 2YBRB 2J8UF 2P46B 3FO9B 4JFXB 3SJVB 4HXAH 3HAEA 2Y1VA 1U8IA 2CUIA 4PP1D 4GG6E 3HMWL 1AJ7H 4M7KH 4RGND 3R8QA 5IWLA 1HWHB 1UGNA 3FO2A 3MV9A 4HJJL 2BHYA 1TENA 4HFUH 2Y36L 3D3VA 5GGRY 5AYQA 2XPGA 5F97E 5LBSL 4XPFL 4HEPG 2YPKB 1V7ML 3I02A 5C0BE 2YK1L 3LKOA 4Q74A 3KYNB 4FQLH 4E5XA 3HE7A 4K7FB 4RDQF 5HGGS 2VKWA 1TJGL 4FXGA 4JG1H 1I8MA 4JFEE 5D1QD 1I1AB 4Q58C 3MGAA 5FGBA 1KIQA 2G60H 1RURH 4KZDL 3T0XA 2YC1B 4HS8H 1MJ8H 5J3HC 4L8DA 5CEZL 4LSVL 1U8NB 1LWRA 1IGTA 5E5RB 1JHLH 3HUJA 1AXTL 2MQ0A 3PGCA 4U7MA 5L0QB 2F54E 4JRXA 4HMDA 5HHME 5JIIA 3LS4H 2YD5A 4K3DL 4HF5H 3VI3E 3LN5A 5IBTL 2AK4E 4U1IA 3SDYL 4BH7B 1OAYH 1YPZB 5IUSA 5DFWH 3IFOA 1DQMH 3MRFB 5C08A 1HEZA 1CFTB 2NNAB 3EFDH 1KLFA 4NQCB 1A7QL 3BAEL 3HE6D 2QKIA 2IMNA 3WDHA 5IVXB 3VXPA 4ALAL 5FA4B 4TTDD 1RFDL 1GGTA 2GIYA 3NCFB 3ZSTA 5DJ2B 4EBQH 5C08E 4AIXA 1BLNA 3N1MC 2FEDD 1J1OH 1BVLA 5J12C 2GJZB 2YS4A 1K4DA 4PBXA 2HKFL 4U6YB 15C8L 5CSZA 5ADPL 1NKRA 1OP9A 1IAOB 1G0YR 5E70A 1KPUA 5IMMA 4YEFA 3CSYA 1CGYA 3X3FL 1IQDA 3RIFF 4PJCB 1MCSA 3MV7A 4NZDA 4XNUH 4F7CB 1OOAA 4WW2C 2PTUA 5ICYA 43CAA 5I76B 4U0QB 5F7HA 4KRPB 3FT4B 2R23B 1CD0A 5FV1L 3QUZB 2DL9A 3SE8L 4PJHA 4ZPVB 1EMTH 4JDVB 4L8SB 4JGJA 5C09D 2B20A 1ES0B 1WAAF 4DCQA 3F7QA 1ADQA 4R4BA 2YA0A 3LN4B 2VWEE 3CFEB 3SGKA 1RUML 2P49B 3DIFA 3TBSA 2J4WH 3ARED 5C0JB 2D0FA 3X13A 3FHAA 4FTVD 5GQBA 4YE4H 1NGQH 4OLYL 2PNDA 5JO5B 1VACA 4EJ1C 2F9BT 2DQTL 4WVRA 3VFRB 2ZJSL 4Z0XA 1KYOK 5F93C 3GSOB 3MXWH 1XGQA 3HC3H 3ARPA 4TOYL 3VXRD 3TZVB 1ZANH 1J5OH 4A6YB 5HGBA 4NHCH 3BZDA 1QRNA 3F58L 1QVOA 3M45A 3GJFA 4M5ZL 3CZFA 2VISA 2KBGA 1GZPA 3BPLB 4PGZA 4WFGD 1VA9A 1XZ0B 2CXGA 3O9WB 1G9ML 4X7SL 1MFBH 2BERA 1FO0H 2ZCLL 1WISA 3LSOB 3Q6GL 5EUOB 3ZT6A 2X4SB 3QNYA 5D1ZD 4NO0B 3BKYH 2PYEB 2HTKC 3PHOA 4JFYA 3VWKC 5GZOC 5I66A 5FM5M 3IFPA 5F7YC 3S96B 3PGFH 1JV5B 1LP9F 3SDCD 2C1PA 1FC2D 1IGFL 3RUGB 3QB7C 4PREB 4AQ1B 1Q9KA 1W72H 2LV4A 2D31B 4AIZA 1VADA 4YHIA 3EW3B 3U36B 3U46B 1PQZB 4OI9A 5E9DA 2NW2A 5F44A 1FZJB 3BIKB 1T1WA 4UBDC 5IOPB 1OGAA 4GH7B 1KLUA 4RFEA 2A6JA 2FX9L 4GKZB 2E9BA 4R2GC 2HLFD 3FQRA 3V6BR 3LDBB 5C0AD 4C56A 1UEMA 1NDGA 3RVXC 1T6WA 3LB6C 2XKNB 4JO1L 1KPRB 1MAKA 2AEIT 4KRLB 3JV4A 5J3HD 5MERA 1Y6NR 4QRUA 1MREL 3B5TA 1S7VB 4FG6D 4XNZB 5D71L 2XWTA 3L7EB 4WEBL 3TYGH 5JLZA 3KPRA 1KB5H 2EYSB 1OLZA 1NAKL 3KNBB 4IDJH 5IP4A 4OCRL 3SQOH 1GCFA 4ZAKD 1UWGH 3WFDL 1XGPB 4PRHE 2VZOA 1P7HL 1J05B 4PJBE 1S9WB 1NGYB 3FO1B 5F89A 3U30C 5J6HA 3KPRE 1IKNC 3LKRA 4EDXA 5F6HI 4K8RL 4PRBB 2HN7A 3DTXA 3QQNA 3QA3B 4FP8H 1VGEL 4ZTOL 4P5MA 4NOFA 1HYSC 5GS0L 3TBYA 4JM2F 1PX4A 3PP4L 3MNWB 4BSVA 4AG4L 2EDRA 5D7IE 2C9AA 3V8CA 4CMHB 3R1GH 3SKJL 1BZ7B 4HUUB 1JPGA 4P57A 4S1SL 4P5TB 4D9LH 4PB9L 3D69B 3N1FC 5I1HH 1D9KA 4HDIA 3P9WB 3SDAA 5E5MA 32C2B 2HT4D 3MOAL 3M17A 2PO6C 2AGJH 2ZUSA 1BQLH 5KSAC 2C5DC 1MJ7L 1U8QA 1AO7D 5TDOA 4O02L 4S1RH 2YD6A 1CL7L 5JDJA 1GIGH 4G6KH 4KK9D 1YDPA 5CEYB 4BZ2H 4MB4A 5FB8A 3TPUB 4E41A 4W70A 3U0PA 3PWNA 5IW3A 2NY5L 3F6LA 2YSSB 1LMKA 1QSFB 3QFJB 2Q8AL 4F57L 4LDEB 2X4OA 4Y5VA 3O6LH 5DWUH 1WZ1H 4E41E 5F6HJ 5DEGA 1NUGA 2QQNL 4HEME 4Z7UB 1TETL 1MCCA 4PGCB 3VFMB 4JN1L 1IGJB 1MWAA 1SQ2N 3LMJH 3PF2A 3DOSA 4Z7VA 3NCCB 1KTKE 3FFDA 1UCTA 3CZJA 3WNLA 1KFAH 1VENA 1KJ2B 2X42A 1T20B 1NC2D 3AFLA 2BNQB 5DJAA 5ETUA 5I8EA 2AJUL 4H8WH 3CFDB 4OF5A 2DBLL 3AMKA 4R96B 3MLSL 2KKQA 5SV3A 4IRJD 5FF6B 5IMOB 5K9JL 5CP3H 3T0AA 4ZUSA 8FABB 5I71B 5MP6L 3RIAF 3S34H 2QV2A 3S36L 3VWKD 1JPST 1HI6B 5DK0A 1MLBA 4QHMB 2CH8A 5HJ3B 3TCXA 3WL9A 3QG6B 3W0WE 1CDIA 3BUYB 4QXWA 2YMXH 2NXZC 3IDNB 2AEPL 1O7SA 1MEXL 5IKCB 1PYWA 4QTIL 1FG9C 4NM8H 1FNFA 3BGFC 1WFUA 2IFFH 3QNXA 4NBYB 3UMTA 1YUHB 3EYOB 1MY7A 5EC1B 2DQCL 1BJ8A 1YY8A 4LSPH 4IRSA 1ZKAA 4UBDD 5C8JB 3C6SA 2AVGA 3PL6C 2VDQH 4MJIE 3MZGB 4R2GD 4KMQA 3RZWA 1A7NH 5DHVB 1RY7B 5DRZA 2BRRL 4POUB 2B4CL 3HI6H 5GGSY 5GHWH 2IG2L 4ZXBB 4Z8FH 3O6FB 5ADOH 3VXRE 3S98A 5L2JA 4S1DD 5MENE 3RA7H 1WCBB 4L4VD 4L9DA 4XMPL 3KYMB 1WZMA 1C08A 4NKOB 5TPWL 4KROC 4YDJB 3MRGB 2H1PL 4F2MA 4X4ZA 2VQUA 2X89A 4WFGE 2KZ1B 4UQ2A 1FZKA 1ZS8B 3KGRA 3LY6A 1WIPA 1SJVA 3FQWB 3DHMA 4HWBA 4FXLA 3VGBA 4LGRB 2HVJB 4ZD3L 3I2CL 4QRTB 5F70A 5AWNH 1E28A 2GJ6A 3BT2L 2O61A 1HNFA 3QI9C 4RFOH 3PWPB 2CGRL 1CGTA 2DQDH 2FH8A 4KQ3L 1NCUA 3C8KB 1FIGL 1E6OL 3TNMA 3OJ2C 1RZ8B 3P73B 2YD2A 5T1KD 3NAAH 2V2WA 5GS1A 1NCAL 3TVMC 2EDDA 3G5XB 3FQUA 4R8WL 4L3EB 4HKBA 3WNKA 2L0DA 4LLYB 4I77H 1W2KT 2CIKB 1GZQA 5LQBH 5CINL 1EERB 4PRIA 5CSBA 5I17A 1A1MB 4K9EC 3GSQB 1T80A 4FQJH 3OB0H 1SY6L 4OFVA 3S37L 1MUJA 4XAKD 5DTFB 2FRGP 3CNKA 2BOBB 2ADGA 2V9TA 1TJHH 3OWEA 2C3GA 5C0AE 5EDXA 4PLNC 3O3BA 1INQA 4JB9H 5DD1L 1MPAH 1YY9C 1CD1A 1X6LA 3RVUC 3OZ9H 5HHPB 3QIBB 3MC0A 4PS4H 4WU7B 5IGXH 3GSVA 3O41A 3T0EC 2OTWA 5KSAD 1KENH 1CLOL 4J8RB 2UUDH 5GISH 2APWA 3BQUD 2V5SA 1H0DB 4OF8A 3K81A 4NDMB 3HNTL 2DM7A 3RPIB 1NLBL 4K2UL 2FIKA 1WQVT 1XF1A 4LLQA 5I8KL 4MX7B 3RWDB 3B5HA 5HHQA 4WV1C 3MBEB 1OPGH 4Y4FB 5ESVB 4NQED 2HTLC 3MCLH 4TSAH 2XG5A 2NXYB 3HPLA 5CD5C 4APQC 1DN2A 1AKJD 5FDYA 3WIHH 1UADC 2AKRB 3DV4A 4KKNA 4XMLH 2K1MA 3RU8L 3OKYA 1KCSH 3L5JA 4LRIA 2JJWA 2MQCA 4X6CA 5HYSG 3K1KC 2P5EA 2D03L 1MFDH 1HQRA 3CVIL 4NGHH 3OKNB 3WXVH 3NMEA 4ORGA 4OSUL 1A6AB 4XPBL 4PJXB 1KXVC 4G8EB 4PTTA 1FGNL 4ODSH 3VD3A 5IW6A 1ZLWH 5JQHC 7FABL 1ZA6A 2VLKD 4IRZH 1N6QL 3T2NL 4LCCA 4Y4HB 1FP5A 4Y4KC 1MAMH 5FM8A 1KC5L 1P69B 5IHUL 2Y5TA 2JK5A 4KKCC 3TESA 5I1DB 1A1NB 2VKXA 3DO7B 4RAVA 4ELKA 1H8SA 2WBKA 1FJ1B 1QFWI 4GKSA 4XRCA 5LG1A 5GPRA 3QIWB 3PL6D 4R7DA 2HRPH 5FAAA 5AAWA 4XCYB 2J2ZA 1U58A 4XTRC 3VFGH 4N8CL 1FVCB 3QAZB 5HYEA 1OARL 3S9DB 5E2UL 3SQBA 1F2QA 1ZHLB 1ZT7B 4S2SA 5CUSH 1FC1A 1ADQL 3RTQC 2YBRA 5EWIH 2E27H 3FO9A 4H20L 3SJVA 1MRDH 4XP4H 2YRLA 1YNKH 1MCPH 1JTTA 4YDLB 1VEOA 3T3ME 1JF5A 2GUOB 2WQRA 1OSPL 2F53E 1CICC 5AZEL 4MA7H 2ERJC 4ODVH 3MGOB 2YPKA 2BXZA 3U7YH 3QI9D 4M8VA 2C26A 5HHOD 5JW5B 3KYNA 3WS6A 4K7FA 4X6FB 4LEOB 4J3UA 1MELA 3C5ZC 1HSBB 5HTSA 1A4JA 4JRYB 1TVDA 2BSTB 4NN5B 2CLZB 3VXNB 4P4RB 1FZMB 2YC1A 4Y19D 4AENB 4DZBB 4XNQB 3DWTA 1JI1A 3QDGB 5D5ME 1KIRB 2H2SD 3TT1L 1R5WB 3BESR 4M4PA 4YHYB 4WI3A 3BDXA 4BH7A 2ZKHH 4NZUH 3QT2A 1DBBL 1YPZA 3TNNB 1S3KH 5D1XD 3MRFA 4QHKI 3ZKSD 1CFTA 2IJ0C 4LFHD 5JXAH 4NQCA 4UNUA 3QPQD 1IM9B 5JDSB 1YY9D 2BNUB 1EJ6A 5IVXA 5F7LB 5FA4A 4L4VE 3TN0B 2OJZH 1QNZL 5DJ2A 4ZNEE 1MCRA 4GAGL 3SDDA 4Z5RB 3T0ED 2XXMB 1JGUH 5DMKA 4HFWB 2XRAH 5DMGC 4E9LA 1I8LA 4U6YA 3A6BH 5KVDH 1NCDL 1IAOA 3ARSA 4YHML 1K3ZA 3NABH 4LP5A 4MDJA 5E2TL 5C0NC 1UM4L 4YNYB 3GMQB 4X4XB 3WN5C 5KSBB 1UM5L 2HTLD 3GSXB 4F7CA 5CD5D 4EUPA 4APQD 3FN0L 5I76A 4TULL 2ADIA 3FT4A 1PW3A 2R23A 3MX0A 4LOUC 5ABDE 5EIQA 3WJLA 3QUXD 3QUZA 5FK9B 3WHE0 3NFSL 4JDVA 3ARFB 3RVTC 4I4WB 1V5JA 3V6OA 4K23L 5E8NB 1ES0A 1IBGH 4PD4K 4CRPA 1A5FL 4DN4L 4QRRE 2AV7B 3HI5H 3LN4A 4Y1AA 2AEQL 4HJ0C 2PO6A 1NMCC 4M9OA 1FCGA 5C0JA 1RZJC 1VPOH 2FZ3B 5I1IH 1UH3A 4NJ9H 3SGEH 4HIHB 5JO5A 4OD1H 1X6NA 4QYOB 1BEYL 5CS7A 1FSKC 3IAGC 4I2XE 3PQYD 5IROA 4OAWB 3GSOA 3G9VA 2X1PA 2OS7A 4LSRH 4EDWH 1CLCA 3TZVA 1UM6H 4A6YA 1MNUH 4LLDA 4QGYA 5GJTH 3MRJB 1KJ3L 1VKXB 4P99A 4N9OB 5F9JB 2A1WL 1NBZB 2X1XR 1XZ0A 3O9WA 2IADB 4NQEE 3GI9L 1BQUA 2DRUA 5J6GA 4HHAB 4K3JL 1I7TB 3MRDB 1ITBB 5EUOA 2X4SA 1RVFH 4NO0A 1T83C 3VD5A 5F7UA 4XP1L 3LS5H 4XPHH 2PYEA 3VXSA 4Z18A 3KLHD 4ZUUB 4XTRD 1EZVX 3S96A 4GG8B 1JV5A 5I19H 3QNZA 3RUGA 2HJKB 1AC6A 3SCMC 3RZCD 1N0XL 5DVOA 2D31A 5GIRB 4OGAC 4X6DE 3HZMA 3VDCA 1MCEA 4F7TB 3U36A 3WO4B 3DV6B 3D85D 1F58L 1ZWIA 1FZJA 5BMFH 4HK3N 2WBJC 4PBVC 4P2RB 5C0RL 5IOPA 2WV3A 4KJPC 4ODHH 3Q5OA 1CICD 2VXSH 4GKZA 2CJUH 5GRJL 1MY5A 3QDJD 2VLKE 5DJ6B 3GGWB 2B2XH 3BPCB 2MQ3A 5TE6H 1ORSB 3ARVA 2FO4B 1MWAL 5C86A 5DO2C 3ZL4H 3OJVC 4YXKH 2VDNH 3ARBC 2WW8A 5C70A 5D9SA 2XKNA 2DIJA 1KPRA 1K85A 5FHAH 1G9NC 1HILB 2FX7L 3EKCA 1DQTA 2JJSC 3LQAL 2VZ3A 1AXSB 3FHQA 4LARH 5D93B 2VR9A 2I25N 1S7VA 3TJHC 3G6DH 3CFCH 5IQ7H 2YPVL 1T7VA 3L7EA 5EOTB 1H3UA 2Q87A 1F8TL 3O45A 2EYSA 5GJSL 2O5YH 3MLVL 3KNBA 1XR9B 3HFMH 1T0NB 2D3VA 4NC2B 5EC2B 1DBJH 1F13A 1J05A 1CLYL 1S9WA 1NGYA 1GGIL 2LE9A 3FO1A 1S7WA 5EORH 1FGVH 4ENEC 4YFEA 1RU9L 8CGTA 4XC3L 2AERT 4Q6IB 3QA3A 4V1DB 3JTTA 5JZ7D 5KS9E 3MRNA 5B39A 5DMGD 5CJOH 2F5AH 1I3GH 3MNWA 5DFVC 4LSTL 3MLPA 5GGTH 4JPWL 5DD0H 1AR2A 1BZ7A 3QXDB 2R29L 4HUUA 4P5TA 4XPAH 4F7PB 4WHTB 1CBVH 3CVHB 2CSPA 4FQXB 3D69A 1S8DB 5CEXB 4DTGH 2XKSA 4OCMC 2VDKL 4LVNB 3QCVH 2BNRE 5CLTA 3T77A 4OZIE 1NGZB 32C2A 4EIGB 1YNLL 5F7KC 3DJ9A 5HVHC 5ACMA 1RJCA 3HE7D 4HWBL 5MHSE 5J1AB 3B9EA 2VL5A 3TPUA 4JDTL 2YSSA 1DSFL 4JFDB 3BEVB 1NGXB 1KT2B 4HJ0D 4IMKA 1QSFA 1Q9LB 5K9QI 4JRXD 3I6GB 2CUMA 3RWCA 3TO2A 1TVHA 4KMTH 1BJ1H 2B5IC 3IDXH 4PJFE 1KXQE 2VSCA 5E95B 2A0LD 4Z7UA 3T0EE 1I1FB 4PGCA 3VFMA 5BS0E 1LEGA 1IGJA 4K55A 1HXYA 3UPAA 3QPXL 4DVBB 5BW7A 4NWUL 1ROWA 2APVA 4R26H 4B7LA 1KJ2A 5IBUB 1UWEL 3WDJA 4NZJA 4LPXA 4PJAB 3E6HB 2BNQA 5BVPH 1CE6B 4UB0L 3TYFB 4IIQB 5H94B 1PKOA 3JV5A 4UIKH 1SEBA 3TCLB 1I1YB 4R96A 5ISZA 5FF6A 3VXMB 4ERSH 4YX2H 4LHUD 5FCUL 1EAPA 4RGOH 3G5ZB 1S5IH 3DNKA 4KH2A 1HI6A 1KCVH 2DLHA 1M1SA 4X5LA 1EO8H 4HSQA 2QHRL 3QG6A 4JG0L 2GTZB 2Q8BL 4EI5C 2A6DB 5ISZE 3BUYA 3D0LB 4YHOH 4L29B 3IDNA 4UT6L 3RNQB 1RZFH 2NY3B 1LVEA 3SCMD 2W9EH 1F11B 1OTUC 3O4OB 5IKCA 5I0ZA 4KKAD 4C54A 1EHLL 1YUHA 3EYOA 1KYOJ 5EC1A 3LEYH 3E6FB 5LGHL 1DFBL 2OR9L 3GHBH 2NTSP 1A14H 2WBJD 2MCPL 4BK4A 4XBGB 5C8JA 4Y4KA 1H3XA 2AK1L 2EEAA 4JM2C 3MV01 5TFSL 5DHVA 3NFNB 1HKFA 5F9WB 1TZGL 4MZ3A 5DO2D 4ZXBA 3O6FA 5E1HB 1A6WH 3H3KA 2GTWB 3S3SA 4G43B 3ARBD 1WCBA 3KYMA 3BD3A 4NKOA 3GBNL 4I3SH 1CTOA 3L3KB 4IOFC 4RRPG 2C3WA 4KK8D 2HA1A 4LVHC 2F19H 2JJUA 1Q9WB 1ZS8A 2IQ9H 4U49A 4M61B 5B3JF 2J88L 3VDBA 3FQWA 4M03A 2HVJA 3WXWL 4QRTA 3OL2A 4ZG1A 1YQVH 3EO0A 4PUBH 1YYLH 1DUZB 2ADJB 1P4IH 3C8KA 4OUUB 4MXWL 5E2VL 1RZ8A 3P73A 2GFBB 4KTYA 1AI1H 3QEQB 4U1SA 5BO1H 2Y9RT 3G5XA 1BOYA 1GGCL 3UBXB 1E6JL 3M8OH 5DUBB 4LLYA 2WNGA 2ZG1A 5HHVH 2FIRT 2CIKA 5JIHA 3TEUA 4PJIB 3MOBH 1FG2B 1S7QB 1TPXB 4YHLL 1A1MA 3ZKNC 4TNVK 1CVRA 5ESQB 3T8XB 5AUMB 1FNSL 1EH9A 1G7JA 3WD5L 5DTFA 1SJEB 2NY4B 5DQJA 2BOBA 3VGHA 4Y2DD 1NFDB 5E9DD 4YHPB 2QBWA 2FJGB 2EDXA 1U8PB 3GIVB 5DMYA 3N1QC 5HHPA 2R1WB 3QIBA 5D70H 3TO4B 3UTTB 3UPRB 3W11D 4WU7A 5E2WH 1FDLH 1RZGB 3A0OA 4H1LH 1SBSL 2VXVH 3EYUH 3NGBC 5TQ0L 2CDGA 5C2BH 5JHLL 1CLZL 2WUCH 3NN8B 1J12A 1H0DA 1UCBL 4NDMA 3RPIA 3HB3D 5HDLA 1I3RB 4MDIB 4U6HB 4RQQB 1XAUA 4MX7A 3G5YB 3RWDA 3MBEA 4Y4FA 5ESVA 4AEHL 4FQCH 5CD3B 5CBEB 1ZAGA 2CKBB 1L0QA 1MI5B 2COQA 4Z77A 4U1LB 5E4EC 1JNLL 4DGIH 4XP6L 2AKRA 2P24B 1T4KA 3L6FB 3UDWC 5JXEC 4MJ2A 2FECI 4UZGA 4ZPTB 3S4SB 2Z92B 2AJVH 5DRNB 3OB0K 4RIRB 3GSRA 1J8KA 1MHPH 1V7NL 1OHQA 4M6NL 5A3ID 2XI9A 4XP5H 4QNPF 4X6BB 4M1CC 1ZGLM 3OKNA 1P1ZA 2MCG1 3FAXA 4GSDH 4OGXL 3MJGX 3DX9B 1A6AA 4H0GA 1KN4H 1Q0YH 5K9KA 4JAMB 4PJXA 3ZYJA 4G8EA 2Z8VC 3GIZH 3VG0L 1A21A 5C2UB 3KXFB 3O8XB 5FFLA 2DI8A 2GSIB 3TH4T 1C7SA 4Y4HA 1D5ZB 4EI5D 4W4OA 2UUDK 1IAKB 2ZNWA 1DL7L 1LO0H 4HT1L 5LWYH 1D9KD 1OTUD 2W0KA 1CE1L 4HQQH 1N59B 2J8UA 2VUOA 1O5DT 3HZYA 3SDAD 2UWEE 3IXTA 1DBAL 2A9NL 5I1DA 1A1NA 3DLQR 1A8JH 3DO7A 1PLGH 4DOHE 1CFVL 4HXBL 1YZZA 1FJ1A 4ZTPL 3U7WH 4HW6A 2L7UA 2VXQH 2O5ZL 4X9IA 3MV11 3FL7A 5EZLB 1F3RB 3O3DB 4PV9B 1T66C 1FNHA 3QIWA 2F58L 1E4XI 3VWJC 5D96B 4OZGF 2B8OT 4KV5F 1AHWB 1FVCA 3DETC 4LASL 1CZ8L 3ULUH 1ZHLA 1ZT7A 4RX4D 1E4WH 4M7LT 2FB4H 4YXHL 2QQKL 4P23B 1T83A 2P7TB 3GMMB 1PFCA 2YZ8A 4GW1A 3NZHH 1R3LB 2GUOA 3IYLW 4W81A 1EV2E 1IGYB 4CW1B 1ZLWK 3LRGA 2DQHH 2P8LB 3QWOB 1EEYB 1JHKH 3MGOA 4G3YH 4MJ5B 5KJRH 1YA5A 3H7BB 1HCFX 2R56H 1RUPL 5JW5A 4F9LA 1BX2A 2DYPD 2I5YH 4LEOA 4LDLB 3JWNC 4ZSOE 4O9HL 4A6YL 3VMPA 1HSBA 5CIPB 1VFBB 4X8XA 2BSTA 1JTPA 2CLZA 4L3CA 3VXNA 1FZMA 2C3VB 4XNQA 4N8VG 3QDGA 2C7UA 1KIRA 3MFFB 1KNOB 4FA8A 3ZKND 1PG7W 5DJCB 3WFHB 2P8MB 2YK1H 3TNNA 1EVUA 4P4KC 3QFDB 1MIML 1OY3B 3ULVL 1IM9A 5FCSH 4L5FH 4PJ5D 1XCQB 5JDSA 2BNUA 2IAMC 4UV4L 4XI5D 1GC1C 3TN0A 3E3QC 4JKMA 43C9A 3T3PF 3FFCA 1F4XL 2ICWI 3GBLA 5EIVA 4Z5RA 1N4XL 4I3GA 5BV7C 4HFWA 4KQ4H 3IDIA 3V4UH 4NRXB 2VOTA 4WGVB 3W82A 4AL8H 1A7QH 2X89D 1C5BL 4YNYA 2Y06L 4Y5YB 4X4XA 5KSBA 4PJDB 1WAAE 3GSXA 1RZKL 1LO3L 4MVBD 2J6EA 1PG7L 1T1ZB 5FK9A 5JXED 15C8H 4OJFL 3IFLH 1OP3H 5ADPH 4XP9L 3ARFA 1U2CA 3QHZH 3KPMB 5HYQB 1A7OH 4H25B 4OI8A 2AXJA 4KDVA 3X3FH 4OGZA 4UT9L 4QXUH 4M1CD 5KVFL 1MCWM 4LBEB 4UDTB 1EJOL 4EI6B 4U7SA 5L9DH 1KCRH 2IBZY 4WWKB 2OI9C 2V17L 2FZ3A 2AAVA 1P9MA 1L7TL 4PJGE 3KAAA 4QYOA 4ZO7A 2Q20A 4ORZC 3QO1B 4OAWA 2APFA 2QQQA 1L9MA 3B8SA 2DM3A 4K71C 4ZYKB 3RI5K 4EXKA 1KEMH 1ZGLA 4UIMB 3WFZA 4HUXB 4QEGA 4WHDA 3CFBB 3MRJA 1VKXA 4KTEL 1LP9E 5TH2B 4PBWD 5F9JA 4IHOA 2IADA 1QZ1A 3NACL 3LZFH 4NM4L 5KSUB 3MJ8B 3T1WA 1I7TA 3MRDA 3E2HB 1T66D 3IS0X 4XPGH 3OX8B 5F21B 4ZUUA 2CLVB 3GNML 3VFVB 4CJ1A 3DETD 1BQSA 4TOYH 4GG8A 1CXHA 1QSEB 2HJKA 3CCHB 4KC3B 5KOMC 5GIRA 3VU2A 1IC7L 1G9MH 5DLML 3W39A 2YUWA 4K7PY 2PTVA 3DV6A 2ZCLH 4AJ0A 3Q6GH 1NCWH 4FQ2H 1QKZH 4P2RA 2ZZUT 4NQDB 5BRZB 2D2OA 2P5ED 4OD2B 4QTHB 4KPHL 4LAQL 4ZDHB 5JA9A 4GBXC 5I1JL 5DJ6A 4GRLC 3GGWA 4M1DL 3BPCA 1ORSA 1RUKH 2FO4A 1IGFH 5GGVL 5IT2L 3RKPA 2APBA 3VXUD 3P30H 2PW2A 2PF6A 1U36A 3DSFL 9CGTA 5JHDD 1KJ2L 1Z9MA 4OCSL 1HILA 3A6CL 4Z7OF 1AXSA 3MLYL 4UAOB 3OKOA 2J5LC 2H32B 4G8GE 1IFHL 3MRQB 1LO5B 4L3AA 4WI7A 5EOTA 3BYYA 4GXVH 4YO0B 2IBGA 1CXFA 1WLHA 4P4KD 4X0KB 3AMLA 2ZCKL 1XR9A 4QOKB 1T0NA 3S88H 2D7PA 5DQ9B 4JFFE 1QQDB 2BOCA 1D6VL 3QULB 4U31A 3OKMB 2HKHL 2AQ3A 5HYSB 5DRWB 1EFXD 1I9JL 4N0UE 5CGTA 4Q6IA 1EBAA 4U1KB 5AAMA 5F1SA 2FEEI 4YDVA 4WEBH 4XBEH 3L5IA 1MFAH 1N0LA 1A6UL 2X4QB 3QXDA 3KYAA 3F12B 4TNVF 3WFDH 2GK0B 4F7PA 4WHTA 4K9EH 3CVHA 4FQXA 2HAZA 1VB9A 2I9LB 1S8DA 5CEXA 3FB5B 4K8RH 3H0TB 3MUHL 2OLDA 1VGEH 2OL3A 1M7DB 1UA6H 4F33B 2XZQH 4BFGA 3LEXB 4AG4H 4G6JH 1TJIH 2IANB 3SKJH 4WUUB 2XZZA 3EO9H 1PKQE 1I1AD 2IALB 1RZ7H 3L3IA 4RMRA 3MACH 5J1AA 1OP5K 2ZSWB 3CXDL 3PV7A 5C0EB 4OGYL 5DSCA 1IAII 3BEVA 1NGXA 1KT2A 2VL4A 5CGMA 5JW3L 4PJ5E 5J13B 1UZ6F 2KZWA 1IGIL 3I6GA 3MOAH 2I07B 4KZEH 1FQ9C 1JPTL 5FUOL 4IOIB 1I1FA 4Y8AA 4HLJA 4Z7WB 3ZO0A 4NQCD 5EZIL 3WFCL 1FNEB 4DVBA 4D8PB 4KJYB 5H35B 4RSVA 1TITA 3BGAA 4YAQB 2NW3B 4PJAA 3QJFB 3E6HA 4NN6C 1CE6A 3TYFA 4IIQA 4FZEL 5H94A 4F57H 4L8CA 1JGDB 2OQJB 3TCLA 4YHZH 1IGML 1INDH 1I1YA 3JWOC 1ACZA 4KWUA 5CZVL 4PD4J 2RHEA 4GT7A 3VXMA 4H26B 3NA9L 4N5EC 1XIWC 3G5ZA 1AGDA 3R0NA 2JJVA 3Q3GB 3QUMB 1HH6A 4GAJL 2ORBL 2GTZA 2IWGA 2A6DA 3D0LA 4L29A 4V2BA 3RNQA 1H5BB 1F11A 1QPPA 4KRPD 2AJ3B 1TXKA 3ZE0F 4P2QB 3VMOA 3MRLB 1UKQA 4P2YA 2AJUH 4M93B 4MAUH 4PB0L 2ESVD 1KLGB 5C0FB 3S35L 2V9QA 3E6FA 4JANB 4Z7QF 4OKVB 4P9ML 4XBGA 2EZ0D 4TQEH 4U1MB 5MP6H 3S36H 4X9BA 2EEDA 3NFNA 1U8MB 3OAUL 3TWCH 2W59A 4XVSH 4M4RA 1AD9B 3JSSA 2GTWA 4JGMA 3VJ6B 2VUYA 1DQJB 2WQ8A 3T65B 3L3KA 4NQXB 3H42H 2VE6B 3P2TA 4POYA 1ZE3C 1Q9WA 7CGTA 4M61A 1K9TA 1B2WL 4IBLT 5E94B 3TZVD 2XWBB 2R9HC 4R7NB 2LTQB 5F9DC 4ODUA 1SVCP 4ELMF 2IG2H 1DUZA 3THML 4DAGL 2ADJA 3D2UA 2C3XA 3MR9A 3O9WD 1C16B 4MS8C 4OUUA 1A6PA 3OGCB 4XMPH 5TPWH 2XNAB 2GFBA 3QEQA 3UBXA 4NO0D 4JEGB 5HDBF 1AGFA 4NUGH 2PYED 1BOGA 1NKOA 1NBVL 1JYWA 4PJIA 4PJ7F 1PVHA 1EX0A 3B3IB 1FG2A 2BVUA 2Z8WC 1S7QA 4YXLL 3ULVD 3DYPA 4ZD3H 5HHNB 4LEXL 2NX5D 1IQWL 5KZCB 5D6DA 3DBXB 2C3HA 5ESQA 1YMMB 3T8XA 4IMLB 5AUMA 4PGEB 2CGRH 4PRAB 2CO7B 4GG6F 1DR9A 4BM7A 5IIEB 1NFDA 3WE6B 4YHPA 2FJGA 4ONFH 1JP5A 4NQSB 1JWSA 5CBAB 1NCAH 5DRXB 3VXUE 1U8PA 2CD0A 4GOSA 1D6EB 5JHDE 3TO4A 3UTTA 3UPRA 2ZUQB 5JOFB 3GMPB 4LL9A 1RZGA 1AY1H 3RJDA 3ALWA 5F7EH 4D0CB 4OLUL 3NPSB 3DXAB 3KJ4C 1U8KA 3EJZD 2BY0A 4G7VH 4BK5A 12E8L 3CMOH 4LCUB 2O5XL 2IAMA 3TGXA 2OZ4A 4NRYA 1I3RA 5FOJA 4R6UA 3V8OA 2DQUL 4MDIA 3WSQL 4HULB 4U6HA 4RQQA 4RA0C 4ZFZB 1CGVA 1RMFH 1JNNL 3DUUB 1CD9B 1EXUB 5CD3A 5CBEA 2ARJB 2CKBA 1ZV5A 3INUH 1MI5A 2VDLH 4X80L 3QDMB 3E3QE 3H8NA 3HAEH 2JB5L 2P24A 4K3GA 2E6QA 1CYGA 2RAMA 3ROOB 3Q48A 4E0RB 4ZPTA 3S4SA 2N56A 1HKLL 5DRNA 1D5BB 4F15C 1EO7A 3K8KA 3U7AA 4RIRA 2XYCA 1NLBH 3B4NA 3ARUA 3CLEH 4X6BA 4P2OC 5EOQH 3BI9X 1VFAB 3KVQA 4EVNB 3DX9A 3ELAT 3STLB 4WCYL 4JAMA 1J8HE 3E1F1 5J11C 3T0DA 3IFNL 2D7MA 2HFEB 4N5ED 3HN3A 4OZGB 3RU8H 3L5WA 4ZS7L 3KXFA 3O8XA 5DD3H 4EN3C 4P5TD 3WNPA 2GSIA 2YKLH 3AY4A 3D39E 4I1NB 1D5ZA 4GXUN 3V4PL 3UROR 4QRPB 1IAKA 1RUQH 3DYMA 4Z6AT 4JHBA 3RI5F 1N59A 2DKUA 3D9AL 3QZWG 4XWOC 5D7LB 2EO9A 2W0LA 4JZJC 1SVZA 4PJ9B 4TPRL 2IPUG 1F6LL 1EHNA 3Q5YA 1FGNH 3LQMA 5EZLA 4X83A 1A9EB 2J6EL 3O3DA 4PV9A 3MRMA 1OWWA 3T2NH 4NSKB 1AHWA 1NCCH 4ZFFB 1G6VK 3QFJD 1Q72L 4PYGA 1J1PL 3V0VA 1GOHA 5FA3B 3C60C 1FYHB 4H1LG 1A0QL 4P23A 2P7TA 4PJ8C 3GMMA 1DBKH 4Y88A 3QH3B 4LQFH 1P4BH 4DKAA 1R3LA 2FD6H 1U42A 2UYLB 4KDWA 1CXLA 5F9OL 1IGYA 4CW1A 1KELH 2R9HD 2FJFB 4PJEB 4EQ2A 3SGDH 2E6PA 2HLAB 2P8LA 3QWOA 4P46C 5DEFB 1EEYA 4MJ5A 1P2CA 5E2UH 3H7BA 2BNQD 2GHWB 4BH8B 2WM0A 1D5XB 4YIQB 1JNHB 1BFVH 5E99L 3ETBF 1ZVYA 4JO2L 3ZE1F 5TDNA 5L6YL 4ZUWB 5CIPA 1VFBA 4Y7MA 4MNHB 1W72B 3W5MA 5T5FL 3W5NA 1N6UA 2VLMD 3UJJH 1WZLA 4BSWA 2ESVE 2C3VA 2P48B 4GRLA 4UI2A 3MFFA 4I48B 3BGMB 1KNOA 3FQTB 5E56A 4AH2B 2IPTH 4GRWB 5DJCA 5IBLC 3WFHA 3MA9L 2BC4B 3NZ8B 2P8MA 1T1XB 5E08L 3ESVF 1I7UA 3GB7B 3IDYB 4I8DA 2W60B 1BIHA 5KW9L 4OCWH 4YDKH 3BISA 1TQBB 3OMZA 1XCQA 1DLFL 2VZ1A 2WWKT 3GJFH 2BDNH 4OQTA 4XVJL 3U82B 2R2EB 3U4EB 3DX8B 1EHAA 4HKZB 5IFAH 3RY5A 4D3CH 5GRXG 3O6FD 3HHRB 4P0DA 4Q97A 3NFPB 1DBBH 1VHPA 5E5UB 5C7XH 2Z35B 3N9GH 5FYJL 2VITB 3QRFM 3K2UH 4M7ZB 2JTDA 2NMSA 4Y5YA 2FR4B 2X41A 4GQ9L 4PJDA 4FNLH 2PN5A 5F96H 2RCSH 4YPJA 3CK0H 2DLEA 3ZYOA 1RIVL 2X2YA 2Z31B 1TCRB 1T1ZA 3OJDB 1G9EA 4WO4C 2Z8RA 3PWPD 3SGJC 4DKEL 3KPMA 1NCDH 5HYQA 2HT2C 1UVQB 2NX5E 3OKKB 3NCYP 4H25A 3C6LB 2EYTB 3VFOA 2VTFA 4L3ED 1WGOA 5DT1H 4KHTL 2E3VA 4LLWB 4JY5L 4LBEA 4K94H 4UDTA 2R69L 3CIQA 4OF6A 4EI6A 2X6MA 4LSQH 3N50A 2HJLB 4MCYB 1BAFL 3V9FA 4TULH 1YNTB 4WWKA 2BVEA 1AE6L 2WIIB 4YGVB 1ACYL 2J8OA 3NFSH 5C3LD 3WIFA 4EN3D 2X09A 3QO1A 1P53A 4TUKL 4LGSB 4XCEB 6FABL 3QIUB 4ZYKA 4PV8B 1MCHA 4LPVA 4UIMA 3ZSSA 4HUXA 5C6TL 1FYTA 3CFBA 5CJBA 1I8IB 4ZOBA 5TH2A 4ZOEA 5I1LB 3CVHL 1T0MA 3ZKQD 4P5KB 3DROB 2AXGB 3FZUD 5KSUA 3MJ8A 3RDTC 2G9HB 3L5HA 2OL3L 2JF1A 5B38G 4R90L 5C1MB 3OX8A 5A2LH 2CLVA 1OP3K 3BPNC 4D9QD 3MBED 1J1XH 1CN4A 3N1GC 1QSEA 4P3DB 3REVB 2QQLL 3SY0B 1FN4B 1BP3B 2R4SH 2Q76A 3CCHA 5A16B 4MNQD 2X4PB 4HWZB 4KUCD 1ZT4A 3GI9H 2VC2L 4OBRA 4K3JH 3VH8G 1GXEA 4JFHD 3HLAB 2OX5A 3AUVA 5BRZA 4XP1H 4OT1H 4OD2A 4QTHA 4NRZA 2EIDA 1DVFB 5KN5B 1ZEAL 4HH8A 2VAAB 3EYQC 2DMKA 4OLEA 2NTFB 2H9GB 3HS0B 1CS6A 2HG5B 1ONQB 1R0AL 5EU6B 2FJHB 3EOTH 1EO5A 4KKLC 2I27N 4PR5B 4EZMA 1D5MA 1LILA 3FT2B 2LABA 3LHPL 5CMAB 4R0LC 3FCTA 1AGEA 1WSST 5DUML 2DLTA 4YBQD 5C0RH 1UACL 2H32A 5GRJH 5IBLD 4I9WE 1A6ZB 4YO0A 5C0IB 3WHXB 5DHYB 5I74C 4X0KA 1MWAH 2DQEL 2UVEA 2Y07L 3WFEL 3NVQA 5T3ZD 4QOKA 5KOVC 1SYSB 3UCRA 3KPPB 5ILTL 2UVFA 4OIIL 1EBPA 1WVZA 3QULA 2F8OA 3SKMB 3OKMA 5EA0L 2FX7H 5HYSA 5DRWA 3ZHKA 4OLZL 2W38A 4U1KA 3WUZA 1JHTB 3KWWA 4OV5B 4K7PL 4QO1A 4YWGL 1L6ZA 2YPVH 2NY2C 2W92A 1S5HB 2VDMH 1NGPL 5GJSH 4OFYA 2X4QA 3EJYC 3R4DA 3F12A 1UQSB 2GK0A 5HVFB 1Q1JL 1GGIH 2I9LA 3WNMA 3H9SE 2CRYA 5C6PB 4XC3H 3H0TA 1OW0C 5DEZA 1A6VL 3L5XL 1M7DA 1YN6B 3U4AA 3U0WL 1ND0B 1QFUL 2VLME 2XN9B 4F33A 1MLCB 2VQTA 3VA2C 2XQYK 3UTPD 4AQOA 3LEXA 3I50H 1DZBA 4GKOA 3C08L 4LSTH 3QHFL 5ENWB 1OAKL 1E27B 4WUUA 3QQ9C 2BVQA 3H2WA 1K6QH 1J18A 2IALA 2YN3A 1OCWH 4JRYD 3OR6A 5ID1B 5HBBA 1DBML 2ZSWA 5C0EA 3LD8B 5SWZB 3V52H 1QEWB 4I3RL 2B7DT 3QDGD 5CWSB 2VN4A 1GAFH 3OPZH 2WWKO 2OTPA 1OAZH 2I07A 2VO5A 4RCAA 2GW5A 2E9IA 2JJTC 1YNLH 4IOIA 3A6OA 5I16B 4HWBH 1FNEA 4M3JA 2PUQT 4XVUC 2IFGA 4MCZB 4D8PA 3TN0D 4I13B 4AEFA 1NC4D 5H35A 2CPCA 5FDWB 5TF1L 3MRPB 1DSFH 4YAQA 2NW3A 4OCXL 1ERNA 3QJFA 3CLFL 3G6JF 1KN2H 1IMHC 1LDPH 3MREB 3FQXB 1L7IH 1JGDA 2OQJA 3RDTD 3ZTNH 4UDUB 5LXGL 1QFHA 2HWZL 1A2YB 4H26A 1QACA 2H2PD 2BVTA 1JPFB 3WJJC 3FB8B 1HHGB 3D18B 3C2AL 2PXYC 3QPXH 2W0PA 4NWUH 3ORJA 1MVUB 3V7AE 2WUBH 4MNGA 5EOCL 3SGEI 1OAQL 5FM5O 5C07E 2OZ4L 5IJKC 1T2QL 2JE8A 3AM8C 3KPSD 4L3EE 4P2QA 4UB0H 5TE4H 4XHQA 1NEZB 4F8QA 3MRLA 3L3DB 3F65A 5C0FA 4JANA 1M4KA 5BV7L 2CKBL 4WU5B 1S9XB 4OKVA 4OLWL 3RP1A 3HC4L 2C4FU 5B21A 4U1MA 5L88H 4ZFGL 2QTEA 2W07A 4ELMB 5I2IB 4LF3B 1QUNA 3CX5K 1I75A 3VXTB 1C5CH 4UT6H 4WW2F 2DN7A 4WFFE 3VJ6A 5JIKA 1ZLVK 3ILQC 5AG9A 1OGTB 4LFHG 4HPOL 4JPVH 1DQJA 3WS3B 4UT7L 5IB3B 1YEFH 4N0RA 4UINL 3T65A 4NQXA 1C5DB 1QOKA 3SDXB 2QR0B 5GRWA 5C6WH 2MCPH 5AEAA 2PKDA 2AK1H 5E94A 2XWBA 3JWDC 5I9QB 3ARGB 1N3NB 3FRPG 3HG1D 3BKCH 3MXVL 1QHOA 5DJDB 4ZS6C 3ZLQC 1T5XB 3MLWH 3OXRB 4I0PC 5C0CD 1H3PH 3WEXA 2QSQA 3OGCA 4OCYL 5IV2A 5FYKD 2GAZB 2XNAA 3GBNH 1X5KA 1REIA 3MUZ1 3QQ3B 1O0VA 4NQUA 4XGZA 4MNQE 1YYMH 5C0BB 3GSNL 4P46A 1ETZB 4UQ3B 1MRFL 1YJDL 4QXGL 3U0TB 3MA7B 4K3EH 3B3IA 5K59F 4JFHE 4JFEB 2NY2D 5HHNA 3WXWH 3DBXA 3LKOB 3MTRA 1YMMA 2R0ZH 4IMLA 1G84A 1YEGH 4PRAA 2XTJC 3D5OF 3EOAA 5IIEA 1I1CA 2F54B 3KS0H 3WE6A 1I8MB 1LO4H 5HHMB 4NQSA 5CBAA 5EO9B 2AK4B 5DRXA 1A7RL 4P2RD 3BH8B 3V5DB 3FMGL 1D6EA 2P42B 4HZAA 2YN5A 4DWHA 4HUKB 3PGCB 2G75B 2NR6C 4XMKH 4QRSB 2YA1A 5F9WC 4D0CA 3LN5B 4LHQB 4N0FB 3DXAA 3F7RA 2OM5A 4G6AC 3OQ3B 4G6FB 3BMWA 3IFOB 5D7KE 3QQ9D 4LCUA 5C08B 4RMWA 3WD5H 5JNYA 4W6XB 5I15L 4TVSa 2Y72A 5E4IA 1OTSD 5T3ZE 4B41A 4ZFZA 3QXUA 4OCNC 2DD8L 5T5NG 1EXUA 3VCLA 1BLNB 3MUGB 3QDMA 1CU4H 2CK0H 5E8OB 2KPNA 1A4KA 3LQZB 3ROOA 4NPYA 3I9GH 4XH2A 4E0RA 5TE7H 4ZOAA 5T1DL 1D5BA 4XVUD 1OT1A 1UCBH 4OM1L 1SJHB 2DQIH 3U4BH 3C09B 4FFZH 4V1DD 1GOFA 5ICYB 2R8SH 1VFAA 3STLA 4MAYC 4U4BA 4XP6H 4NNPH 3T4YB 4KMLB 5IFHH 2HFEA 3SO3C 3FN9A 4OZGA 3QJHA 3UYPA 2VDRH 3G08B 5CJ5A 3UTPE 3OKLA 2EKJA 3RKDC 4WUKL 4DCQB 2VERN 1TMCB 1CFQB 1V7NH 4HIXL 4QRPA 4M6NH 1BQHB