5IJVB

Crystal structure of bovine fab e03
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
253
structure length
248
Chain Sequence
VQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPGKALEWLGNIDTGGITGYNPGLKSRLSITKDNSKNQVSLSVSSATAEDSATYYCTTVHQKTLEVRSCPDGSRLIGNDCRNEDGDDVNYITTFDYEWYVDAWGQGLLVTVSSASTTAPKVYPLSSCCSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMVTVPGSTSGQTFTCNVAHPASSTKVDKAVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords bovine Fab E03 light chain
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
total genus 40
structure length 248
sequence length 253
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ijvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ijvB01
4LOUC 5L9DL 4WTWA 4FQPA 1VERA 5C0JB 4YHMH 4WW2A 2L4OA 2R0KL 5J56B 4O2EB 1PYWA 2WBJC 4L4TA 5J1AB 1XT5A 5E8PB 2DL9A 4Z7NE 4JFYA 4M93B 3HNSL 3JSSA 3VXMD 4AEIL 3PV6A 2HFTA 4OLVH 2X9XA 5C9KA 5CP7B 2WBKA 2EDFA 4ZOCA 2BNRE 5F1IB 5HHQB 4L3CB 1FV1A 4IM8A 1Q9WA 3K80A 4WFHE 4U1NA 2YUWA 1FL3A 2VDNH 1NMBL 3SDXA 5CWSB 3VXMB 1QFWM 1CICA 3D0VB 1U92A 5I18H 2ARJA 1GHFL 5F44A 1DQMH 3QEQA 5IESH 4BJLA 1HXYB 2OTUB 3BEWA 2A83A 2YK1L 4YK4B 3KLSA 4U1KB 4YGVA 1LMKA 1ZA6B 4PBXA 4HXBL 3MJ7A 1H5BA 1ZANL 3VFUB 5CZXD 5HYQB 1NUDA 1INDH 4AK1A 2QQKL 2FR4A 2AEQH 3MOBL 5CBEA 1G7HA 3K81A 4JFED 4YE4L 1I3RA 3C5JA 5CZKA 4ZFOL 4WFED 1FIEA 2JIXD 4L5FH 3ZHKA 3OZ9H 4GXUN 2WV3A 3ZE0F 3T2PA 3AS0A 1AQKH 4HQQL 4LRIA 1IGYB 4C83B 4HDIB 4LPTA 5C0CA 5IFJB 5FKAB 5B22A 4K7FA 1HH6A 1E4JA 4TPRL 1MRDL 1TIUA 3BZ4A 4NKIH 2DQTL 2JIXB 4Z9KB 4H5SB 5IT2L 2W1NA 2HTLD 1JFQH 1TZGL 4NM4L 1UCBH 2QTEA 4JM2C 4Z76A 4YDJA 2XNAA 2M8XA 3B8YA 4OLYL 4OCRL 1OTUC 3RWDA 2ZUUA 2BVTA 1LO0L 3O4LE 4I4WA 4XNXL 4GAJL 5D7JA 5SWSD 3LS4H 4XBPA 3KJ6H 3ARDB 1I1FB 3P2TA 2BOBA 1FNFA 1A9BA 3VW3L 4OGAD 1MUJA 4OZGB 4X6DE 4OV5B 4JN2A 2B5IC 1E27A 2NY0C 3FN0H 2H2SC 2ESVD 3MC0A 4ZQKB 5C0AA 3T8XA 4K3JH 5SWSB 4EJ1C 3O0RH 2YD8A 2CLVA 5FO8A 1U36A 4WHYH 5F89A 3V5HA 1A21A 1CGVA 5KS9B 5AWNL 3NA9H 1KELH 1W8NA 4W68A 3SO3C 3UC0L 4NYLB 1KLGB 1OCWH 5ESAB 3W9DB 2ZCKH 2NY4C 5IVZB 3KLAA 5GZNC 3BRGC 3MBEC 1EEYA 1BZ9A 3DECA 5L2KA 4XP4H 3RTQD 1S9VA 5TE6L 1VFAB 4LHJB 1MJ7L 1Z9OA 2KZWA 5ITFA 2NX5E 1Q0XH 2VH5H 3OAZH 5ISZE 1FO0H 1KF9B 1BJ1J 1U8MB 1MAMH 1Z5LB 3ZDZF 4M93C 5JQ6H 4LCYB 4U7KA 2CK2A 3HR5A 3PHOA 1U93B 1G9MC 5FO9B 4X80L 1J87A 4NUJA 1UZ8B 2WLYA 2Q3ZA 1T22B 4HIHA 5B8CB 4X7EC 5FHBL 3P9LB 2ZUVA 4PV9A 2H3NA 5SX4H 1MCKA 2XWJB 1CLCA 4U6TA 5DHVA 5IM7A 3DV4A 1N6VA 1TNNA 5FYLE 3HNVL 4M6MH 5GGSA 3L5XL 1DQQA 4YK4C 2Y5TB 3L9RB 1JPFB 5D93B 4HH9B 5E8NA 3O2DA 4BYHA 4LNRB 5A16B 3NN8B 1YMME 4QXGL 5JUEL 1QFWI 3FONA 1WF5A 4AG4H 4LCCB 1G7PB 3Q48A 1KC5L 2J2ZA 5IB4A 1RUQH 3I3DA 2YD4A 4ZTPH 2HFEA 5CZXC 5ALCH 4YO0B 4DKAA 1KCRH 3MCLL 4ORGB 5JOPE 4LSPH 5IFAL 1N5AB 5JORB 4ZNEA 3MV8A 4KPHH 4HUXA 2JKXA 4HZAA 4IBLT 4NZDA 5ALBL 1UM4H 1M6OA 3N85H 1BD2A 3WSQH 5IKCA 3VGGA 3WUWA 3KPLA 3WFZA 4OAWA 4IRJB 5KTEH 3HZYB 1CD0A 2AW2A 3RVVD 4F58L 4FNLL 2ZKHL 3ZTJG 1NEUA 2YA1A 2Q76A 1I1AA 2ZUXA 2HTLC 1A5FL 4JFDD 4UUJA 3CC5A 4PJ5E 1TZHB 5T1MA 1NLBL 4G6MH 2AVGA 1F4YL 1IGCL 1OAXL 4U3XA 4XRCA 5F7DB 3ARDC 5T1DL 2PXYA 4O00A 2P43B 4R97B 3V4VL 5JLZA 3MA9L 4Z7VE 2C3VA 3H3KA 1MFBH 4NZJA 4X4XA 1CFVH 3QCVL 4G6KL 5IW6B 1FAIL 4OGAC 4TVSa 4HG4K 3HPJA 5C2BH 1H3UA 3BDYL 5DEFA 5L8LB 4NUGL 3HI6H 3S36L 4GW4B 5GZOD 1KJMB 3PQYB 3NPZB 2R15A 1CCZA 5GHWH 3BRFA 2DBLL 2AJVL 3DUUA 1LE5B 3DI2B 3OAYH 4NIKB 4LLAA 2ATKA 5HHPB 5DMIH 4UBDC 2Y7QB 5F6HJ 3DTXB 5HSFA 3IJHB 4LKCA 1L0XA 2HG5B 3MXWL 5KSUA 3K8LA 4L4VA 1Q1JH 1HINH 4YHKH 2FECL 4RWYH 1YJDL 2HT4D 2VWEC 5FYKU 5CD5D 4JFPB 4KV5F 4G9FA 1PD6A 3PDDA 5F97E 1F13A 3QUXD 2VISA 3VXSA 5DA4A 1JMZA 1JZ7A 4XC1H 2WUCL 1P1ZB 4HCRA 5B8CC 4DFIA 3S4SG 3KYMB 4F2MB 5IGXH 4EOWH 3IXTA 1V5JA 1S9WB 3QUXB 1YUHB 4KUCD 5MEOB 1K2DB 2HMID 3UBXB 5FEBA 3CDCA 1ZGLP 5BMFH 2WIIB 3VG9B 3B6SB 4ZXBD 4WUUB 5AAWA 4XPGH 5DD1H 5E6IA 3MFFB 3RKPA 3S35H 1HCVA 4NDMA 5AYUL 1G7LB 5FV1L 4JANA 2WM0A 4J3TA 2YS4A 1ZEAH 1M71A 3TZVA 2NW3B 4LCCC 2VMFA 1AGCA 2IQAB 3SE9L 5C0RH 3GB7A 4WFGE 3IDUA 2EEBA 1KJ3H 2ZOKA 1NDGB 3QZWA 3VFWA 1CLYL 4X5WB 4P3CH 3S3JA 1UFUA 3REVA 1ADQL 1W2KT 5GJTL 3HPLB 4GG8A 1I7ZB 1RUAH 3IJSA 4KZEH 4JDVA 4KKCD 1IKFH 1CXLA 1JHTA 5JR1L 1FFOA 1OAQL 4HLJA 1A4KB 5CHNB 5KJRH 3MLYH 1MNUH 2P8PB 3GBMH 5KS9F 1MCQA 4CU8A 5I1KL 2YA2A 5CD3A 4OFKA 1A6UH 2HJLB 3INUL 2XPGA 2MCPH 4CNIA 3VG0H 4L8SA 5EC2B 2GT9A 4N1EA 3EOYG 3KPRE 4G3YH 4GUPA 3RVVC 3MV9B 3IVKB 3EIFA 1P4IH 2PYED 5EU4A 5D7SL 3ZE0E 1ZT1A 3G6JB 3VWKA 5LAXB 3HG1E 1P9MA 5GRJH 2VN7A 4XMPL 3LEYL 1EDQA 1LHZA 4JO1H 4LSSL 5CSZA 1HQ4B 3CVHL 2AV1B 3X13B 3PGCA 2R2BB 3BD3A 4BK4A 4PJXF 3D6GA 1V7NL 4Y5VB 5CEXA 4NNYB 4YXKH 4JFQA 3O6ML 4JO4H 3L3OB 5C0BE 5DJZB 1VFOA 5T1KB 4NWUH 3RVXD 2XZAL 5GZOC 1IEAA 5DD5L 4XCCH 1WBYB 4MJ5A 4NOFA 1FJ1A 2BVPB 4QHNB 1PKOA 1H15B 1RZJC 4GFTB 1AXTL 3MRQA 3QO0A 3OAUH 4NHUB 4O9HH 3IKCB 4OZHF 1R3JB 1DQLH 2ZJSH 3W0WA 4O4YL 5GRVK 3AREB 3QJHB 4GAGH 3I3BA 1LO3L 4MDIB 3TBTB 1P6AB 3MLUL 3O4OB 4JPKH 3HNTL 3B9AA 3HAEH 5HD8C 1NFIB 4R4NC 1WCBB 5CD5C 1RHHA 5DUMH 2GCYB 4XXCA 5CUSL 3QUXC 1N7MH 1FCGA 4HJJH 2BSTB 4Y4KB 3VG9C 3IDNB 2RGSA 2EYRB 5EZIH 3KPPB 4PB9H 4LVEA 5CIPA 2F15A 2DM2A 4GJTB 4FABH 4PJIF 5ELIA 4I3GA 1C1EH 3MJ9H 5F7EL 4WO4A 1A8JH 1G6RL 4PFEA 5ADOL 3OKLA 1P2CB 5LJYH 3DETC 3DMMA 1I3GL 4CN1A 3ZDZE 3T3MF 5HHOD 4YHLH 5E1AA 4CL7A 3HC0B 4RAUB 4MAYA 2VDLL 4WU7A 3K0WA 4NWTH 5B38B 3EFDL 2W91A 4BZ1H 1Z2KA 4Z0BH 1VESA 4G8GA 4KXZI 1DUZB 1L7TH 3B2UC 3OKDA 1A47A 3FQRB 4ODXA 1OVZA 2X09A 4LGRB 4X4YA 2M2DA 4J4PD 1E4XI 5TF1H 5HHXH 4AZ8A 1WFTA 1GIGH 4O5LL 1MQKL 2IC2A 4NQDE 3J8F7 5IEHB 2OL3H 4JB9L 1FL5A 3LS5L 3I6GA 2OP4L 4HWZB 4PGDB 5CEYA 3ALWA 3PWVA 5FGSA 3MLSL 4ZSOE 2NW2A 5H37H 3SGJC 5K9JH 2F54B 1JNJA 5FXCH 1NCWL 3S9DB 1FGNL 3I9GH 4DAGH 2KUTA 3PABB 2QSCL 4HT1H 3IKKA 3EO9L 1B0WA 3RY4A 4NBXB 1N26A 1JF5A 5IHUL 3IFOA 5C08D 3VGDA 4WIQA 1HIML 5GGQL 3QIUB 1V8HA 3ZKSD 5C71A 2HFGL 3SKJH 5DJ8B 3ZKND 4HAFA 4OQTH 3KYNB 2R56H 3HTLX 3FFCE 1IGFH 4OT1L 2I9TB 3WE6A 1CXKA 3ZSTA 4Y5VC 1BQLL 4POYA 2DL2A 2Q8BH 3TNMB 5I0ZA 4KTDH 1FORH 1RSFA 5E6YA 2O5YL 3L95A 3BH8A 4UOW1 3CLFL 3LKSB 2DJ4A 4NRZA 5DJAA 5K9KB 3GMPA 1VACA 4RA0C 1M7IB 1NFDF 4KK6D 1MCPH 1DFBH 1IQWL 1JZ8A 1I3UA 1HZHH 2J8OA 2VQ1B 5D7KE 4MJ6B 3NCFB 3AREC 4JGMA 2IBBA 4PJ9D 1MWAB 4M8QB 1KCVL 2VLKB 3O4OC 2V2TB 3N1GC 3QIBB 5C0EB 4E42B 5F1NB 1CE6B 5DI8A 1KULA 1I85A 5C3TA 1NCCH 3KXFB 4PJ9B 3BP6B 3NZHH 1N2RA 4Y4KC 4KJYB 5KW9H 4C56E 3M17B 4XPTH 1JP5A 1JYVA 3G6DL 1JN6A 3UXFA 3REWA 3MNWB 2FYYA 2YD3A 3ZE2E 3TH2T 1VPOL 2DDQH 3OXSA 5CFHA 5HXMA 2KZ1B 1RFDL 4S2SA 4UT7H 5AZ2H 1T7XA 1T1WA 1I9JH 1I1YB 2FBOJ 4KV5E 3EBAA 4ODSL 3RNQA 2EDQA 3RGVA 1N5YL 4ZUWA 3GSNA 1LE9B 4JZOA 1JI2A 3LKRA 5ACMA 4OD3H 3G6JF 2HAZA 4ZUVB 3QFJD 3LHPL 1I4FB 2H32H 4PJCA 3ZO0A 1T7YA 3NTCL 5FV2A 4WWKB 1XGYH 4KDVA 3TCXA 1CL7L 2PTUA 4CJ0A 3GBLA 1R3KA 4R3SA 1YNKH 4W81A 3BSZH 1N0LA 1WWWX 3L6FA 4L4TD 2CSPA 2EDJA 1CFQA 3FQTA 4WW2B 4J4PC 1TJIL 2APWA 4I9WD 5I19H 3UPRB 3KYOB 2DD8L 3FT2B 3T09A 5EB9A 1UH3A 3I6KA 2AQ1A 3T2NL 3MLVL 4G7VH 1CICD 3E0GA 1ORSB 4MS8C 3RWIB 5I74B 1GYAA 5CBAB 3VWJB 1LEIA 1QBLL 4JCLA 2FRGP 1UM5H 4U1NB 4N90D 4X4ME 1QRNE 4WI3A 3DUHA 5ABDE 2VLJE 1U92B 3BQUD 3FFDB 3QUYB 5JW3H 2CUIA 3QEQB 5LCVL 3A6CH 5EO0B 4JFZH 2G2RA 3BEWB 2A83B 2FD6L 4YGVB 3PGFH 3ZKNC 2VQUA 3LSOA 4Z5RA 1JWUB 4KKLC 5DA0B 3GMMB 1UGNA 4B50A 1JF1A 2EDXA 1H5BB 1FG2A 1I9RL 1EMTH 1UVQA 2FR4B 1KCKA 4KWUA 4R4FL 1OP5K 4EEEA 1MRCH 3LIZL 5C0DA 1I3RB 3C5JB 2VDPH 3MRNA 4PJ7B 4R7NB 2J88H 1FLTX 1FYTA 3S5LA 4MJIA 5C0CB 4MD0A 5I1JH 4K7FB 1HH6B 4KK6C 4LP5A 4WI2A 3FQUB 4U1GB 4N8VG 2BFVL 4OSUH 5GIRA 3VXTB 4PJXE 4Z76B 5D2NE 1JK8A 1JHLL 3VRIA 5D7JD 4ZOEA 4PJ9C 1YY8A 1G9EA 3RWDB 5BO1H 1NCDH 5FGBC 1WZ1L 3MR9A 3F7YB 3QI9A 1W0VB 1YN6A 2IALA 4U1SA 3DXAD 4MD5B 4YEFA 5CZVL 1J5OH 5I66B 2P7TB 2BOBB 3EYVB 5BZDA 1U8LA 4OZHE 1MUJB 1SYSA 2YRPA 4NO0A 5DJDB 1HEZA 1WEJL 4KRPD 1E27B 4S1QL 3GNMH 5C0AB 1KN2H 1CF8H 2CLVB 5FO8B 4OTXL 5F89B 3VXPA 2DTSA 3F6LA 1HH9A 3PHQB 4YC2B 5L2KD 2BVYA 4KRPB 1CE1L 4G80A 3MODH 1PLGL 5B3NA 4R26L 3ZL4L 4WWKC 1KV3A 4LAQL 2J4WL 1YNTA 1EEYB 1BZ9B 3GSXA 4YH6A 3X12A 2X9YA 2NLJA 2Z8WC 5IR1A 4YHML 4ZPTB 4GRLA 4PJIE 4WW2C 3MO1B 6FABH 5H2BA 1IAOA 3LCYA 4DUXA 4PPTA 4QHKJ 4HMDA 2B1HH 3T3ME 5B4MC 1JTOA 2KDGA 1UQSA 3R1GH 3A6OA 2PO6A 3CFBA 3AMKA 4DUVA 3NFSH 4HEME 5HDLA 5I74C 4PRBA 1OAKH 3VWJC 5FAAA 5HGGS 2VDNL 4XWGH 4HIHB 3CK0L 3QYCA 2MSPA 5I18L 5LWYH 5DFWH 1JHKH 3T0EA 1DVFA 2PETA 2C3XA 2KQMA 5SX5H 5GGSB 5D4QA 3EHBC 3ZDXF 4U6YB 4NC0B 4K71C 4PJFA 4JFHD 5E8NB 1H5BC 4B0MM 4KI5E 5DEGB 3SKNB 4LEXH 3FONB 3TJHD 4L5FL 4NO5A 3RPIA 2VDKH 1I8KA 3OZ9L 2X4OA 2DI9A 2BNQB 3PUCA 2W60A 1DANU 1BD2D 2Z4QA 4EIZC 4YR6A 1H3XA 5DGRA 1UA6H 5BJTA 1JFQL 1SQ2N 1XGQA 1DTUA 3HFML 3MV8B 3QPQC 4HUXB 4MJ2A 4U1GC 1I1AD 4GKNA 4F57H 3FOMB 4U1JA 4B41A 5IKCB 4PJHB 3KJ4B 1KJVA 4OAWB 4JHAL 4GKSB 5AZEH 3NGBB 4U31A 2Q76B 4KUZL 1I1AB 2PXYD 4UUJB 4LCWE 3VI3E 4ZNCD 5C9JA 2CD0A 3CX2A 5T1MB 3LS4L 4OQ1A 4JDZA 4X6FA 3KJ6L 1FVDA 1TTFA 5D7JC 4WUUE 4XRCB 1NFDE 4YAQA 1F58H 3L5WA 4XCEA 1CI5A 3I50H 5JLZB 1B6UA 3FN0L 4ZDHA 4M6AA 2VXQL 3VFGH 2AXJA 2C3VB 5IJKA 3MOQA 3CFKA 2EXYD 4V1DA 3FB8A 3IDIA 4H26A 4X4XB 1UACL 3CMGA 3NA9L 1RK1A 1G9MH 2DRUA 5EO9A 1N3NA 4MXWH 4QF1A 4XPFH 5TQ0H 3T3PF 1OCWL 2R9HD 4YC2C 3L7EA 1P4BL 4Z8FL 3BYYA 5GS0L 4KRPC 3A6BH 5DK2B 4JREB 1JTTA 3H9YA 3PP3H 4EBQL 4P57A 3QNZB 1AY1H 4XI5C 5CKGA 2VZTA 4F3FA 4LFHG 3G04A 4L4VD 4LSUH 3DUUB 2AERT 1NFKA 2ICEA 2CH8A 5CS7A 1QFWL 3C60A 2EDTA 3MRCA 4G9FD 4M5ZH 5DD0H 1Q0XL 2VH5L 3AROA 1FO0L 2XG5A 2D4FA 4LKCB 5IROC 4DGVL 1FDLH 3DX7B 4LIQE 3ZKMD 5KSUB 1MAML 4UDUA 5JQ6L 3C6LD 4OCSH 3EYFA 4NP4H 1Q8MA 1ZVHA 1BLNB 4DK3A 3MV9E 1KIRA 1ETZA 4KTYA 4Q9CA 1I3VA 4D9QD 4F37K 2VISB 4C58B 5EBLA 3SDCB 3VDBA 3VXSB 5FGCE 4PJ7F 3UTSB 3G6JE 5IMOB 3FB5B 4YFLI 1FNLA 4P49A 3V9FA 5E6ID 4ETYA 3IXTB 2GJ6B 5T1LA 5KZCD 1FNAA 1MCJA 2GFBA 4M6ML 3LN5A 3QISA 4GLRI 4RMRA 1YECH 4IOIA 1I8IA 4F15B 2X4TA 3O3BA 5C0GA 3FT4A 5E6IB 3DVGA 4JKWA 1LILA 1NC4D 5KZCB 4NDMB 4BH8A 1EHLL 4KKBD 4JANB 2VIRA 1N59A 5L0QB 3SJVA 1M71B 2NY7H 3TZVB 3Q2CA 5KSVA 1RUQL 4ZTPL 3KPNB 3WDJA 4HBCL 5JO5A 5ALCL 4N0FA 4HWBH 5MI0B 2WAHA 2ZOKB 4IJ3C 4ZO6A 3ULVD 4CVUA 4LSPL 3QZWB 2R23B 1RPQA 3VFWB 5GXBB 2ZG1A 1OD7A 4KROB 3REVB 2EDYA 3TJHC 4M5YH 4NQCB 4E5XA 4GG8B 4MSWA 4KPHL 1UM4L 4JDVB 2AK4E 5KSAA 4A6YA 1X6LA 3WSQL 1FFOB 4S0TD 5J89A 3HI5L 3V5DA 5KTEL 1WZKA 3VFMA 2MMXA 2NYYC 4IDLA 5JW5B 3OB8A 1KACB 3NGBC 4NQVA 1I1AC 2XPGB 3X3FH 3V6FA 4Z7WE 4G6ML 4L8SB 3UZVB 4EN3A 4DZ8A 1IEHA 2GT9B 2NY2B 3VWKD 1HWHB 2AJYH 3RKDC 3SKOA 4GUPB 2PXYC 1A6TA 4HX1A 4PJ8A 5SWZE 5CJ8A 5A2KH 4IDJH 1MFBL 4D9LL 3LMJH 3CFJA 1JNHB 5C2BL 3PP4L 1WC7A 3HZMA 1L9NA 2ZCLH 3P0YL 3G5VA 3VXUB 3IRZA 3UJIL 3HI6L 3T0XA 3PGCB 1F4HA 5HHVH 2GTZA 2V7HA 4JFQB 4PGZA 2VITB 4QRPE 3WO3B 4OFYA 4OJFH 3C09B 2R9HC 3PIQB 2GITA 5DMIL 5BXFA 1LP9F 3P4MB 2QQLH 3ROLA 3W0WD 1IEAB 4ZFZA 2D7QA 3VFRA 4A2LA 4MJ5B 5FO7A 1Q1JL 1T4KB 4RWYL 3MRQB 1ULVA 3P11H 3QO0B 4NO2A 4NRXA 2LQRA 3MROA 1NEZG 2YPLB 3Q5TA 3O9WA 2HYMA 5LBSH 3SHSA 3V6OC 5FCUH 4RGNB 4OZ4A 1T1ZA 4G5ZL 3VMOA 5E2VH 3QUZA 3CVIH 4KMTH 3O6FA 1OF2A 5JZ7D 3MLRL 4EOWL 3UYPA 5HI5D 3K74B 4PGEB 5ICYB 1MEXL 1MCHA 4PG2A 4S1SL 4UIKL 5BMFL 3G5YA 1R5IA 4BQBA 4MVBC 1BAFL 1BF8A 4XPGL 5DD1L 5I1CL 4RZCB 2EIBA 1FPTL 4WO4D 4F15C 2IF7A 5HVHB 3S35L 4PJHF 3DMMD 5E6IC 4NC1E 4P2RA 1X6NA 3QRGL 2UUDK 1IKNA 5CIPB 1C7TA 5L0QC 3TZVC 4O58H 4PTUB 1S7WB 4P23A 3UTQA 4MAYD 4LSQH 1KJ3L 3BT2H 4F7PA 5FYJD 3VD9A 5MI0C 3IU4H 4FN0A 1VHPA 3MRLA 4X9GA 5JW4N 4G8GD 4P3CL 4KKBC 5E1AB 1MJJA 2P46B 1DEDA 1CZ8H 4U1HA 1RUAL 3WN5A 4KROC 2YZ8A 4KZEL 1JGLH 4WU7B 1IKFL 4LAJH 3LQMA 3LKQA 1M4KA 1FC1A 1J0JA 5KJRL 1WQVT 3MLYL 3ULVC 1MNUL 1IGJB 2E7CA 1YNLL 2EDWA 4FZEH 4NPYA 4ODXB 2CXKA 1RUPH 2VLKE 4X4YB 1HYSD 3QULB 5CLWA 3VDAA 2EKJA 3FRUA 1KBGL 5JIKA 2MCPL 3TYGH 5DEZA 3DVFA 2VLMD 3WS3A 3HUJB 4G3YL 2Q86B 4L8SC 3I6GB 5CEYB 5C8JA 1DLHA 2UY6A 3PWVB 4JPIA 5TQ2H 4KJQD 1S7VB 3TO4B 4FQIH 4DZBB 1L7IH 1OTTD 3FQWB 1C5CH 3BESR 1CGTA 1RZJH 1J8HA 2FNBA 5GRJL 3IF1B 3VWKC 3CPLA 3IFOB 4CDHA 2IFFH 4D94A 1I7RB 2PR4L 5F9OH 1RK0B 4UIMA 1KB9J 5KN5A 4U49A 3OGCA 3IFPB 1WVZA 2PTVA 4ZPVA 1NGQH 3LN9A 4HULB 1B2WL 2RCSH 4LLUB 2EDDA 1PVHA 1HHGB 4YXKL 4DVBA 5IVXF 3MOAH 4JO4L 3WE6B 5E00A 4RNRA 4KKAC 1TQBB 4NWUL 4JN1H 4LASH 3C09C 2NY3B 2N1KA 1JWSA 1CG9A 3L95B 4I0PA 3BH8B 4L8DA 2JELH 4XCCL 3D2UA 4NRZB 2EO1A 4JJ5A 3TN0B 1VACB 3OAUL 1ZGLM 4X98B 1V3KA 2P5EB 5BRZE 1DQLL 2ZJSL 5L7XH 1Y18B 2I07A 1T0MB 3ARXA 4JZNB 3PWJB 4OZFA 5GRYA 1OTSD 2DQGH 3UTTA 3T3PE 5EH1A 4QKXB 3U0PA 5J11B 2GAZA 3U2SA 1HNFA 1QSFB 4GAYB 3E6HA 3RWGA 4ZG1A 4XXCC 1N7ML 1KYOJ 4TQEL 4HJJL 5CJOH 3QPXH 1PW3A 4M6OH 4K9EC 4NQXA 2CMRL 5JZ7C 1N2RB 5I8CA 5EZIL 5HVHC 3DSFL 4MX7A 5IB2A 5I0DA 3U36B 2CKBL 2ZWLT 3V4PL 1J86A 1F2QA 3REWB 2YRZA 2FYYB 2I27N 3MJ9L 3TCLB 1QFHA 5J57B 1UEYA 1QKZH 3RGVD 3P77B 1GSMA 4WO4C 1VFMA 1T5XA 3DMMC 4FQCH 4S2SB 3ULUD 1T1WB 3FO2A 5EZJA 3WUZA 4P9HC 2HLAB 3RGVB 4NWTL 2FO1A 2KQNA 4MAYC 4QRRA 1R0AH 3GGWA 1YC8A 4JZOB 4LLDB 4UILL 3K2MC 4Z0BL 4OLZH 5E8OB 1OD9A 4JY4A 3LB6D 4QNPE 3UYOD 4PJCB 1KG0A 2X4SB 3ARGA 2XY2A 3ARYA 4IS6B 4PP2A 3LV3A 1GIGL 2GK0B 5C07A 1QPPA 5I1GH 1R3KB 4YFLF 3L6FB 1QHPA 3GJFK 4H0IA 4YBQD 4P2CG 3H42H 1CFQB 2OSLA 3FQTB 2FX7H 3MTRA 4LEOA 5K9JL 1HYSC 1CDGA 3GZKA 1WAAF 3I9GL 4Y1AB 1T2QH 4R8WL 4DAGL 1RURH 2MQCA 4HT1L 2J6EA 1KGCE 1T5WA 1JJUA 2X7LB 1A6ZA 3I6KB 3E3QE 4YHNA 1WBZB 1WSST 1ND0A 2WNGA 3H7BA 1ITBB 4KJQC 5CP3A 4D9RE 1LEIB 4HKZB 1T0NB 1IAMA 1OTTC 1OP3K 2A6IA 2C3HA 4OQTL 2MPAL 2R56L 2KBGA 3K7UA 3P30L 1IGFL 4M7JH 2UY7A 5DLMH 1UH2A 1PGRB 3TC9A 5DR5H 5L2JA 2G2RB 4KTDL 1TQBC 4RBPK 2HTKD 4JEGB 4AM0A 3GEWB 5E5UB 25C8L 1XIWA 3LSOB 2DTMH 4P2OA 3LQZA 1FG2B 2W9DH 1FYTD 3L7FA 4MJID 1VSCA 3ZKXB 5C0ND 4OGYL 5T3ZD 1MCPL 5C0DB 4TRPH 4X6BA 4E41A 1DL7L 1AR2A 1FYTB 3S5LB 2X1WL 3VH8A 2H2PD 3QEUA 4MD0B 4ETQA 4W6YB 1GH7A 3K8KA 1OT1A 1WT5C 4YNYB 4QOKE 4YPJA 5J11C 3QI9D 4HK0B 1M05A 4WUKH 1NCCL 1I85C 1OW0A 3OBAA 3LH2H 3O6KH 3L3DA 3VI4F 3VRIB 1CR9H 2R1XB 1O5DT 3K46A 4XPTL 4QHMB 1LP9E 3QI9B 4FQXB 3RZCA 4PG9A 3QUMA 3VDCA 2DDQL 4U1SB 1U8OA 5EOCJ 5F71A 2X5PA 5EO1A 4MB5A 3OXRA 2ADJB 4X0KB 5AZ2L 3RNKA 2AJXH 1Y6NR 5BZDB 3EGSA 4XNQB 1U8LB 4HFWA 4XVSL 3HUJF 1SYSB 4NO0B 2ATPA 1WCQA 1M7DA 1QFPA 5KVEH 4KK5D 3RGVC 2FLBT 4OD3L 4O2FA 1DQTA 3VXPB 2BNQE 5JQHC 1GJIA 3AMLA 3ECBA 3KPOA 3UPAA 1ZS8A 3RI5F 2UVEA 1AP2A 1XGYL 3W39A 1ZHLA 4GRLD 1NMCB 1YNKL 1YNTB 2BNRA 4K7PX 3GSXB 3X12B 2J8UE 4PJHE 3GM0A 3K2UH 3D69A 5GS1A 5I1EH 1KJ2L 1FN4A 3WNNA 2PO6D 2FBJH 4Q6IA 4I77L 3UYRL 2HWZH 5I19L 1J1OL 1X5ZA 5DVOA 1IAOB 5E7FA 5E9DE 3WD5H 5DJYB 2GSGA 1HILA 3ES6A 4YBQC 3I85A 1UQSB 1V7MH 4JRYD 2CDFB 1RUML 3FB6B 1MCBA 2PO6B 3CFBB 5M94B 5ECJE 4HUVA 3RVWD 2GTWB 1DVFD 1UM5L 4KHXL 4TUOA 3WIHA 1GGTA 3AS1A 1DCLA 5ETUA 2IPUG 5HI3D 2Z35B 4DFHA 1JF6A 2APBA 3MNZA 1RZFH 1EPFA 5GRUH 3BIAX 1MWAH 1Z9LA 1ZLUK 1RJZB 2APXA 5JW3L 5C09A 4UV7L 3EO1B 5CEZD 3T0EB 3BI9X 1U0QA 5A3IC 2AKRA 1QNZH 4R90H 3WMSA 3HAEG 4PJFB 2IADA 4B7LA 4UOW0 3VXNA 3WNPA 3C8HA 2H8PB 2R39A 4MXVF 1PEWA 1MRCL 3ZKXC 5HGDB 3MGTA 2VDPL 1OQOA 2HTKC 1MVFA 3WIIL 3MYZA 3QIWA 5F7YC 1FZKB 3UZQA 1BFOB 3B3IA 5EU5A 2BJML 1U2CA 2W60B 4IHOA 4ZUSA 3S37X 1X3DA 5I1JL 1U91B 1LNUA 1VADA 5C0NC 1IM3B 3F5WA 3VU2A 5HY9A 5CGMA 4PGJA 1XF2A 5BJTB 1XGQB 3T0BA 1PZ5A 3RVUD 2B39A 4HWUA 1MFCH 1Q9KA 4GQ9L 4RISL 1KIPA 4X6DA 5C6TL 7FABH 4NHCH 2H2PC 1EZVY 5IVXE 1T03H 5D6DC 1RV6X 2OZ4L 5TH2A 3OSKA 3LPFA 1NUGA 3IJYA 2GJ6E 1P4LA 3HC3H 2DM3A 3QXVA 4PP1D 2VDRH 3QI9C 5DQ9A 1D5BA 1EA9C 5C9JB 2AXGA 4JDZB 4X6FB 4MQTB 2DM4A 4NZTH 3OAZK 1DQJB 5HHMB 1T7WA 5I8KH 1J5OL 4V1DD 2VXUH 4YIQA 4XCEB 1BQSA 1T1YA 3VCLA 3H0TA 2GEEA 5EOQH 1KN2L 1Q94B 5F9DC 4ZDHB 4XCNA 3CFKB 1QA9A 3FB8B 5SV4A 5GRXG 3IDIB 5CJQL 5H37G 2EKSB 4OM0L 3TT3L 1RK1B 5ISZA 5EO9B 1KIQA 1ES0A 1N3NB 1P7QA 4QF1B 5F1OB 3U46A 43C9A 1FAKT 3MODL 3L7EB 1H8OA 4KK5C 1NMAH 4Z0XA 4P57B 1NMCC 5AEAA 3GSQB 4OIBA 2G60L 3DX9A 4QLRA 3G04B 1RJYA 1KTKE 1CT8A 5I16A 5E4EC 3L3HB 3OG6B 6FABL 3C60B 4GRLC 3MRCB 5IVNA 2D7PA 3VFPA 4ZS6D 3G5ZA 4UDUB 4PJEB 2ITCA 3EYFB 1KENH 4HS8H 1DN0A 3O81A 3BPNB 3IDGA 1KIRB 2PO6C 4IRSB 3WNMA 1YMMA 1JWMA 5T1LD 5TF0A 4BSVA 4XWGL 2UWEB 5EBLB 4FTVE 3VE0A 5HYJE 4XBEH 2D0HA 2A0LD 3D0LA 3I6LD 3VFNB 1W0WB 4EI6A 4P9MH 4Y2OA 3RVWC 2GFBB 3T0EC 2NMSA 5BVPH 4C59B 1HHKA 1A7PH 3SJVD 2NXZD 1I8IB 5FOBA 5HI3C 3O3BB 4LLQB 3THMH 3FT4B 3OKKB 1QSEA 3VGAB 2VAAB 1CFTA 1F5WA 4BH8B 1B0RB 3EYUL 2Y5EA 3MREA 4X7SL 2VIRB 3RDTA 1EFQA 1A22B 1N59B 1IEBA 1WAAE 3L3KA 4LKXA 5D1ZB 5KSAD 3F7QA 4PJ5A 2CLRA 1I75A 1GRWA 2VZ3A 4X99B 3BUTA 2CQVA 3PV7A 4YHZH 2J1KA 1GGIH 1UA6L 1ZVYA 3MQIA 4MSWB 3TJEH 1A7NL 4F57L 1ZLSL 1YEKH 4A6YB 2XXMB 3T0WA 2DYPD 1A7RH 3V5DB 4Z7VA 4EN3D 1XGPA 4FRWA 5AZEL 2O5ZH 2APTA 3SBWA 3BXNB 4OD1H 5DJXA 3IB4A 2H41A 3QWOB 1GPOL 4NQVB 3OAYK 1S7RA 3V6FB 4JFEE 4PJ8D 3ESVF 4NZRH 2B1AH 4LF3A 4WFEE 4EN3B 3C5SA 3ILQD 5EWIL 4HD9A 1F58L 3SKOB 5I1HL 3I50L 4GO6B 3CSGA 4PP1C 4HX1B 4PJ8B 3VFGL 4FZ8L 4N0RA 3CU1A 4NKOA 4BA8A 3BKMH 3CSBA 1MHHA 1VGEH 3WFEH 2P8LA 1G7IA 1TITA 5IJKC 3UTZA 4XVTH 1G9ML 4MXWL 4XPFL 1QZ1A 5TQ0L 4U1LB 2A73A 3A6BL 4LBEA 1N0XH 2J7LA 4QHUB 3GO1H 3P4NB 5JHDB 1XEDA 1NGWA 3MRMA 1S7SA 2JTDA 4C57C 1LVEA 5FYKD 2F53B 4Z95H 3DRQA 1CXIA 4LSUL 1QUNA 4MXQD 4PRDA 4HKXA 2GITB 4LDLB 4QWWC 5BXFB 1NAMA 1KB9K 1QFUL 3O9WD 4M5ZL 3ROLB 5DD0L 2VXVH 3C60C 1BFSA 2WP3O 3VFOA 1FDLL 4HGKC 1OAUH 2ICES 4Y5YA 4GG6F 2XACC 5FO7B 3PJSA 1UWXH 3O2DH 2ESVE 4PJBB 4OCSL 4DUWA 4NP4L 3O6FD 4NRXB 4QRUA 3MROB 5IOPA 5KSBF 2Y06L 3QO1A 2QSVA 4IRSC 4OZ4B 1T1ZB 5HI4D 1H8NA 5DVNA 1AGBA 1CDJA 1AGEA 4AMKH 4DGYH 5E56A 3QUZB 4ZS6C 4FFYH 4ERSL 3QHZH 1D3CA 5FDWA 1S7QA 3CJJA 2QEJA 1GC1C 3WHE1 3V0VA 2ZCHL 3QG7H 5DRXB 2ICWI 5DFVD 1R5IB 4P23D 2IFGA 4R2GD 1NCTA 2A0LC 4M7ZB 3EOAA 2QV2A 3VGAC 4P2RB 1CD1A 1SJXA 2D31A 3QEHA 1GGBH 1G9NL 1MF2L 4UDTA 4PRPA 1OAZH 4P23B 4HWBL 5DO2D 5F9JA 1MCWM 1F11A 3G9VA 2CUHA 3MRLB 4EDXA 4RQQA 1MJJB 3KPRA 2EO9A 4U1HB 4XAKE 2P5EE 1UADC 5DJCB 1X4XA 4YZFF 1NANI 4QRQA 3KDMA 1T66D 3JWDC 3AAZA 1F4XH 1WLHA 1S7TA 2C1OA 2P8MB 4N0UE 4QT5A 2EH8H 3HG1A 4NPYB 4WI9A 3VXOA 4TSBL 5E2UH 1NCBL 3FRUB 3X3FL 2QHLA 3FO9A 3G08A 4N8VA 4Q9RH 2W0FA 3ZTNH 1J8HD 4EN3C 1QACA 1M1SA 1UM6H 5ANMB 2XTJB 5C8JB 4NKMA 3U83A 1DLHB 3VGFA 2XFXA 3V6ZB 1IC5H 2NQCA 5CINH 3IDXH 2C5DC 3T65B 3QCTH 1UH4A 4PJ8C 3LMJL 3CPLB 2YEZA 4X9HA 3ILQC 1F4AA 3AVEA 4U6XA 1EUUA 2ZCLL 4PJEF 4ZOBA 5DT1H 3OGCB 3MLXH 2RQ8A 4JFXB 2F58H 2FX8H 4DQOH 8FABA 5IJVB 2DM7A 4PLKD 5HHVL 1D9KA 5ESQA 2UWEF 1RZ7H 4JFDE 4HCRH 4DVBB 4I0KA 3D2UD 1A9EB 4OJFL 1J12A 4RNRB 2IANB 2QQLL 1JWSB 2Z92B 2APVA 4I0PB 1UWEH 3MRIA 3D2UB 4G9DB 4GRWB 4JJ5B 1PY4A 4S0SD 4M7LT 1BQHA 3TH4T 4MXQC 1Q72L 5LBSL 3UTTD 1AFVH 2B4CC 4W6WB 2I07B 3O9WC 5FM4A 1KXQE 2BVEA 4XB7A 5E2VL 3CVIL 2XICA 3JV4A 4JLRA 1BIHA 5C0IA 4OZFB 4RAVB 3QUZC 3U0PB 3RUGE 1IZKA 1INEL 4KMQA 5HPMA 3GIVB 2GAZB 3U2SB 3E6HB 3RWGB 1K8IA 3F58H 3ULVH 4NQXB 2ID5A 5I8CB 1XGRB 4M7ZC 4XNYH 5HGAA 4IOFC 4EVNA 1U6AL 3DX8B 4GMSH 2QQNH 1IKNC 1IBGH 4O58L 1F90L 1MREH 5DFVC 3RWHA 2B0SH 3BT2L 3FN9A 4P23C 3SKMA 4R2GC 4ODVH 1HYRC 4QRRD 4AIZA 2C9AA 4WNQA 2B2XH 2Z31A 5EBWA 1CZ8L 4UTBH 1XF4A 3JTTB 5A2LH 1MJ8L 3ARTA 3FO2B 4MZ2A 5EZJB 1EO8H 4YDVA 4FFWC 1Y6KR 3ARGD 3WNOA 1WISA 4ZSOA 2OLDA 3O2VH 3ME0A 4J3WA 4R0LA 1FNSL 3TV3L 4JDTL 2E8YA 4JY4B 2X4NB 2R4RH 1A2YA 3LDBC 4FZEL 1RUPL 4PP2B 4OKDA 5IMKB 1T66C 5C07B 4JM4H 3VXQB 2ADFH 4JKPL 5EUOB 5IB5B 1CVRA 4K3DH 5EZOH 1A7BA 1EHNA 5GGUA 1DE4A 4PJDB 2OSLB 4M61B 2GUOA 2VB5A 3FFCA 3GUTA 2XTJC 3MRGA 1IFHH 3X11A 4MQSB 5TQ2L 3BO8B 4FQIL 4S1RL 1L7IL 4K7PH 3O2WH 1C5CL 2VYRE 5BS0E 3LN4A 1ZHKA 1T5WB 1A6ZB 3SY0A 1EH9A 1N4XL 2IFFL 5KBNC 4YHNB 2ZPKH 3MBEA 3AUVA 4MMXC 4QYOA 2BDNH 4PJBF 1LD9B 5F9OL 4Q7DA 1ND0B 1A6WH 5E24E 3H7BB 3LKPA 4YX2H 5L88H 1IAIH 1X5KA 3DGGA 5BCAA 2A6IB 4M7LH 2RCSL 5D8JH 1CTNA 2VLLB 3C2AL 3VMNA 4P2OD 4O2EA 1L4IA 4WV1B 4JN1L 2D9CA 4DKFL 5E8PA 4QXTA 4XPBH 4LASL 5L2JB 4ISVB 4L1HA 2FJFB 4AM0B 2D7MA 2JELL 4K9EH 1XIWB 2W59A 4KK9C 4PLKC 4I0PC 4P2OB 4PYHA 5CP7A 3TPKA 3GSVA 3L7FB 2HH0H 2PYEE 4L3CA 4XNUH 5CJBA 3HZVA 5HGBA 3J7HA 2AJZA 3QXDA 4DN3L 1IM9B 2BRRH 3P4LA 5CIPH 5CWSA 4N1CA 1SJEB 4X6BB 4E41B 4NJAH 1J11A 4K3EH 1UT9A 5H94B 1HXYA 1PX3A 2OTUA 4OFDA 1ZK9A 5DVLA 1FZJB 3RRQA 2Q1EA 2DQGL 5C7XH 1BGXL 1ZA6A 4ETQB 5B39G 5KG9A 4P9HH 5D1XD 3T1WA 3VFUA 4YHYB 1BWWA 1DBAL 5HYIA 5K59F 5BVJA 2AK1L 3QPXL 4IEFB 4M6OL 4YDIH 3S37H 2F8OA 3RZCD 3JV0A 1RQ5A 4LGPB 4EI5A 1K8DA 4I3RL 3QDGD 5T3XD 4XH2A 5MHSE 5KVGH 1NLDL 4CVWA 5IB3B 3CXHK 1EIBA 2QL1A 4G8IA 3S4SB 4H1LA 1IGYA 3RPKA 4C83A 4ZFOB 5M7QA 4PG9B 3QUMB 4K55A 4NN5B 1QKZL 3S96A 1U8OB 4GG6E 1T0PB 3D18B 5EO1B 2XI9A 3IFNH 2FB4L 3H3BC 3RNKB 3PWPE 3EGSB 5KSBE 5EFIB 4KQ3H 4NGHH 3U9PL 1G0DA 3GMOB 4M3KB 1M7DB 2IBZX 4FXLA 4KVCH 1VA9A 4C4KO 4OLZL 1GVIA 4JO3L 4O2FB 2BNRD 4DVRH 5F9WB 2M26A 5HVFB 3PWLB 4WFHD 3KPOB 5HVGB 3GSUA 1ZS8B 1AP2B 2HVKA 3G6AA 3ARDA 4MHHG 3ARGC 4JO2H 5I1GL 4PY7A 1W72A 2BNRB 4BQ9A 4OV5A 5L6YH 4X4MA 5GS1B 1QRNA 2R0LH 3D69B 3PXJA 1ED3B 4PLNC 2FX7L 2WSKA 1U3HA 1FN4B 4HPYL 2VLJA 2LAAA 5HJ3B 3LQAC 2FGWH 4Q6IB 5HHOE 5KS9A 1T2QL 1RURL 4X5LA 3RA7L 1BREA 3IXAB 4NYLA 1KLGA 1JPTL 5IB1B 2GSGB 2YA0A 1HILB 4N0YH 5B3JF 1T3FB 5HHME 1MCNA 5IQ7H 3U7AA 3U30B 5C09D 3ZDYF 2GJZB 4BZ2L 3ZYOA 4HUVB 4EXKA 4Y19B 1PG7X 5D5MF 4M7JL 5ETUB 5DLML 4XPHH 3MNZB 4ZYKB 1JYWA 5DR5L 2CJUL 2VTFA 4N0CD 4WV1C 3VGBA 1RZKC 1U8MA 4X8XA 2AKRB 5F7HA 2DTML 3W82A 1HOCA 3QIWD 2IADB 1X5HA 1XIWC 2W9DL 3QQ4B 4XAWH 5FHAH 3VXNB 4P2OC 1UZ8A 4ZTOH 2XKSA 2F5AL 4PJXA 4YHIB 3GSWB 1S3KH 4M1CD 5IFHH 3STBA 5JXAH 5D2NA 2YD2A 3MGTB 5DD3H 1D7FA 3P9LA 1PKQB 1DQDH 3V0AC 2QLVB 5C08E 2ZSVB 3QIWB 3SQBA 5EU5B 3O4LB 4ZUSB 1CD8A 4TVPE 5IBUG 1VADB 1LNUB 3EDJA 5FDYA 3F5WB 1RJLB 3L9RA 2BVOA 1JPFA 3UPCA 1IRAY 1XF2B 1YN7A 2E27H 4YHYC 1R3HA 1PZ5B 4LNRA 4OZHA 5A16A 1E6OL 2VDML 3GSNH 2XG4A 2XQBL 4X6DB 3DHMA 2V6HA 3O6KL 3QCUH 1OW0C 5FOJA 2R69L 1HDMB 5IBTH 3T4AA 2FECI 2E7MA 3IJYB 4JG0H 3UAJC 1P4LB 3VFTA 4HF5H 4HUUB 1N5AA 5DQ9B 3DWTA 3TT1H 2AXGB 2DWDB 4N9GA 2EXWD 2E6QA 5ISZD 1P7QD 3UO1H 2IPTL 3VCLB 5TDOA 3H0TB 5L8KB 5KVEL 1WICA 4IRJA 1LEKA 3HZYA 1RY7B 3KAAA 4PJIA 4XCNB 4JG1H 4Q6YA 3TO2B 3MLPA 2NX5B 2BY1A 5ISZB 1CGUA 1ES0B 1KIQB 1P7QB 5C70A 4HKBB 4LCIH 1I9IH 5BQ7B 5F1KC 5EU7E 1WUNT 5SX5K 3MMEB 3ZMRA 3P9MA 5FYLD 3CFCH 2WBWB 3HMXL 3K2UL 4JFFB 3DX9B 4CVXB 1AXSB 3U4AA 5GS1C 1CT8B 5DVMA 1P7HL 1JNNH 4NBZB 5I16B 1VGKA 1CDIA 2OXHA 3CXDH 5DJ0A 5JMOC 2Y1VA 4HV8A 4Q6IC 1YMMD 3F7RA 3WD5L 3UCRA 1YDPB 1JRHH 4YUEH 2BNUA 2ITCB 3UBXG 1DN0B 4LCUB 3HE7A 3IDGB 3EYSH 3SGDH 1KJMA 3PQYA 3U30C 2VDOH 1N64H 4TULH 4LSVH 4BSVB 3VE0B 1LE5A 4JHBA 2V17H 5GRUL 5DK3A 5T3ZH 1MWAL 3IJHA 5FCSH 1QSED 4EI6B 3KGRA 4L4TE 5DK0A 3RDTD 3QDJB 4L3AA 4MAUH 1CDBA 1FLRL 4JFPA 3SDYH 1IMHC 1CLOH 4I9WE 1U8HA 5IUSA 1CFTB 4PJ5D 2IH3A 4N0CC 1WFOA 3MREB 1V3LA 3SDXE 3RDTB 1HWGB 2ITDB 4LKXB 3KYMA 3QIWC 5IMLA 1DEEA 1WITA 4PJ5B 1S9WA 2FL5A 2CLRB 4D2NA 5MEOA 1K2DA 4OF8A 4M1CC 4PJBE 3GRWH 2YZ1A 3SQOH 2WIIA 4CVZB 4WUUA 5HTSA 3RL1A 5CMAA 4K23L 1NFDA 3JXAA 3MFFA 3WNLA 4LPYA 4MA8L 7FABL 1G7LA 3LZFH 4QRTB 4NHCL 4QTIL 3ZKQD 4MCZA 1KXTB 1T03L 2VLRE 1FSKB 2NW3A 4RFEA 4KRLB 4V2CB 4OBRA 2LTQB 1JYNA 4P0DA 3HC3L 1QLRA 2VDRL 1NDGA 1UJ3A 5I6XC 1S7RB 2R0ZH 2DLGA 4K8RD 1CDUA 3C5SB 3BGAA 4NZTL 3HPLA 5F1SA 2VUYA 1I7ZA 1NC2A 2ORBH 2VXUL 4Z18A 1CGSH 1J1XH 3EOTH 3OJMB 5CHNA 4MA7H 4RSVA 4H25B 3IDJA 4NKOB 2X1XR 4Z7UF 1MHHB 4MDJB 4RMWA 4H8WL 3T0VA 2P8LB 1G7IB 4HHAB 1AGDA 3RHWK 3EJYD 3UTZB 5JHLL 5C2UB 1DSFH 2Y36H 5GS3A 5ID1B 2EXWC 3BE1L 1JMXA 2A73B 4MD4A 5K59E 1VB9A 5GGVH 1O7SA 1JE6A 3KR3L 4LBEB 3WBDA 2RR3A 4HG4J 2B20A 2ZG3A 3MV9A 3IVKA 3WLBB 1NGWB 3MRMB 1S7SB 5EC1B 3JWOC 3DHJA 1MHPL 3DRQB 4RGOL 3G6JA 5LAXA 3DXAE 4PRDB 4HKXB 1L0YA 2DMBA 1PDKA 4BZYA 3PJSB 3X13A 1C16A 5GSRA 4HS8L 1FIGH 4QRUB 3P73A 5IOPB 5ANME 1MLBA 3TBVB 4QEGA 4Y5VA 1FBIH 3QO1B 3CVHB 4PTTA 5L2KE 2PTTA 3L3OA 4TUKL 5T1KA 1AGEB 4DGIH 4XBEL 4ZO7A 4MLIA 5FDWB 1S7QB 1U3JA 4X5XA 1EVTC 4XP5H 2EIEA 3AS2A 1SBSL 3GBNH 3Q1SL 5GS2H 1WGOA 4QHNA 1H15A 1SMAA 1A7PL 5JDJA 4CMMB 4NHUA 3IKCA 2D7OA 4PRPD 3THML 1R3JA 2AK4A 4EUPA 2Z8SA 1A7QH 5I8EB 5K33A 1MCWW 3FTGA 3AREA 2YKLL 3HLAA 4KU1A 2D31B 5I75B 2IANE 3KPRD 4UDTB 3RDTC 3WKMH 1PSKH 1T7VA 1NFIA 1YA5A 4TSCL 1F6AB 2GCYA 4WTZA 4DK6A 1XCTA 1F11B 1UJTA 2F19H 3KS0J 2NNAB 1LO4L 2IQ9L 4RQQB 1IGTA 4YHZL 1JYXA 4FP8H 1GGIL 2BSTA 3KPRB 3TA3D 4Y4KA 2WWMD 3TJEL 1JGEA 4F7EB 4LQ1A 5D5ME 3V5KA 4QRQB 4RIRA 1YEKL 3AAZB 2C1OB 1A3LL 1UC6A 4XX1G 1WZMA 3DNKA 4QT5B 1FFNB 3HG1B 2O5ZL 1F8TL 4JFHE 2LTQC 4UV4H 2A77L 4OD1L 3FRPG 3SBWC 3TP4A 3FO0L 4WEMB 2DQIL 1J10A 4Q2ZA 3NFNA 2B1AL 3JZ7A 4N8VB 4GSDH 3HC0A 3BP7B 3KPSE 2W0FB 2X44D 2IEPA 4FXKA 4GKOA 2ZSWB 3NFPB 1SYVA 1YQVL 1ZVSA 4S11A 3NH7H 5B38A 4ODWA 3WFBL 1BD2E 4QRPA 5C0BB 1DUZA 1EO5A 3D3VD 3BKML 4JRXD 4AL8H 1VGEL 2YC1A 3ABZA 4K8RC 3WFEL 3M8OH 1IE5A 1P6FA 5KAQG 1QQDB 2YEZB 4XVTL 1D9KD 3OKOA 4U6XB 5AUMA 3CMOL 4HWZA 3CH8A 5ESQB 4Z95L 2F54A 3EJYC 4YDLB 3SOBH 1GC1H 2ZG2A 4MA1B 5CGYC 2R1WA 2MTPA 4UOJA 2P42B 1OGAD 4LDEB 2FEDD 4G8FA 1X5YA 4DTGH 4LSRH 2VXVL 3MRIB 3U4EA 3QIUA 5GPRA 2MCG1 3O2DL 3CSPA 1TFHA 4Y5YC 4JFOA 3T2OA 3KYNA 1NJ9A 2WP3T 1FZMA 1SBBA 3GSRB 3SDAB 1QBMH 4MA3A 4AMKL 1K4CB 4DGYL 1E28A 5JIPA 3HE6A 1CL7I 3JV4B 4FFYL 3DJ9A 3QHZL 2K9UA 5C0IB 5JW4M 4DN4H 4JR9H 5TGBB 1OLZA 5K9KA 5HPMB 5TE7H 2IPKA 3BP5B 3JWDH 1X5AA 3QG7L 4L4VE 4EKXA 4A6YH 1M7IA 2BSRB 3ARZA 1PFCA 2AGJL 2PN5A 4OF0A 1N6UA 1OPGH 4G9FE 1E4WL 1MELA 5HGAB 4MJ6A 4EVNB 4JM2D 1GGBL 3I2CH 2IAMB 1KTRL 5I75C 1RIVH 4YGAB 1OAZL 2OJEB 4NRYA 2VLKA 2V2TA 3ULUF 3UMTA 3RWHB 3QIBA 2SEBA 5AYQA 4D0DB 4E42A 4AIZB 5F1NA 4D9QE 4WNQB 1MFAH 1YPZB 2ICWJ 4NQDB 2Z31B 3KPTA 4PREA 3W11D 5LGHL 1MIEL 1LO5B 1UXSB 4JPWH 1SEBB 4P5TB 1MJUH 4WW1A 4Q0XL 4YDVB 3R0MA 4F37F 3QEGL 1F4XL 3VD5A 4ZSOB 3S34H 3B9KA 5T33H 4R0LB 2KH2B 2EH8L 3T77A 1A2YB 2YN5A 1D6EA 1RUKH 1XF5A 3GIZH 5E2UL 4CUCA 2OYPA 2WWMC 3FFCD 4PBVC 4UNUA 5I76B 3DBXB 5MP6H 5EBMB 3NPSB 4HIJA 3NIGF 3BKJH 1I1YA 1K4DB 3LRSB 4M62H 4I1NB 4HUNB 2H9GB 2PW1A 3V52H 2HP4A 2NY4D 1UM6L 5GGUB 1DE4B 5GZND 3GUTB 3FFCB 5MERA 1LE9A 3MBED 3IDXL 4ZUVA 5E1HB 1RZGB 2VRAA 3QCTL 3X17A 5FYKH 2DLFL 3WFCH 3LN4B 1WIOA 1EEZA 1I7UA 3PDOB 4PB0H 3S36X 3ZHLA 1TVDA 3SY0B 1SVZA 1Q9LB 3C6SB 2O61B 5EG6C 1CIDA 2B4CH 5D7KD 5DRNB 3MLXL 1GAFH 3LKPB 2F58L 3CNKA 3DGGB 4WI6A 3KHOA 1RZ7L 4LHUA 5IHZB 1D9KC 1FVEB 3ZYZA 3CFEA 4YDLC 1CFSB 4XP6L 3UPRA 3KYOA 3FT2A 1QLFB 2FCBA 4QXTB 3F7VB 1PG7H 1HKLH 3NABL 4YXLL 1UWEL 2D7TH 3P3YA 1ORSA 3S88H 4R4BA 2N56A 2VZUA 3RWIA 5CBAA 3GSVB 3VWJA 1C5DB 3HZVB 5HGBB 3I02A 2FEDC 2VNCA 2AJZB 1SY6A 3QJFA 3QXDB 2EDHA 1AFVL 2HJKA 4J2XA 4OGXH 4PJGF 5I8OH 3MRRA 2PW2A 3FFDA 3QUYA 4Z7UE 4C56B 4ONGH 3SDAC 4CJ1A 2H1PH 1VEMA 5EO0A 1J1PL 2J3SA 3OR6A 5ACLA 1NGXA 1Q0YL 1BQUA 1YEGH 5SWQB 3RZWA 3QNXA 1JWUA 3GMMA 5KG9B 1MFDL 2EECA 1F3DJ 3T4YB 2EE9A 3IGAA 5BVJB 2UZIH 1NPUA 1OOAA 3U48A 2DF3A 3F58L 3GJFB 4Y19E 3QUKA 3ULVL 4IRZL 4YPGA 4EI5B 2XV6B 1K8DB 1JV5B 4XH2B 1NDMB 4CMHB 4PJ7A 5JNYA 4R7NA 1KNOA 4XNYL 5INCA 3DGCR 2MQ0A 5EA0H 2I5YH 4G8IB 5IIEB 4H1LB 3MV7E 1ZTXL 4GMSL 2VL4A 2IAMC 1MREL 2B0SL 1I8MA 3S96B 5DF0A 3FQUA 3RWJB 4AIOA 3OX8A 5HDQH 2B2XL 5FM8A 3VXTA 4UTBL 1U2HA 5EIVA 1JGUL 1EO8L 2Z31C 2YPVH 3VXRE 3W2DH 3RAJH 2E9JA 2V7NB 1PKQE 2C7UB 3ARDD 1W0YT 4P2QE 4KDWA 4J7RA 3F7YA 4HJGA 2R4RL 3MV11 1HI6A 4R0LC 3NCJL 1W0VA 1GGYA 2AXHA 2EE2A 5J4MA 3W11C 3GSUB 1QRND 5I9QB 2ADGA 2HVKB 2YR3A 4MD5A 1U3HD 1CXFA 2VLJD 3B2VL 3G6AB 5I66A 2P7TA 3EYVA 1BEYH 4PY7B 1W72B 2ADFL 2Y72A 4R9HA 5DJDA 4K3DL 3TIDA 1QRNB 1TMCB 5E2WH 4HWNA 5I2IA 1IFHL 1U3HB 5FYJE 2VLJB 4Z78B 3QRFM 4K7PL 1Q9OA 1OARH 3O2WL 5F8RC 4G8GE 3PHQA 1MH5A 1RVFH 4OI8A 4OLXH 3ZT7A 4RFOH 4GRWH 5AAMA 5HDOA 5J13B 2GK2A 4UBDD 2ZPKL 2BDNL 1A6WL 3C08L 4F9LA 5L88L 3RU8L 4OLWH 3O41A 4KQ4H 4M7LL 5D8JL 1HQRA 4ZPTA 4OGZA 3AS3A 4U3CA 2Q20A 4OZFH 2OJZH 4IIQB 3MO1A 5C0FA 5IROA 1U8IA 4XPBL 1KJ2A 2VLME 2VXSH 4EQ3A 3QWRD 3MA7B 4F80A 5IW1B 4D3CH 4K9EL 4UT6L 3VJ6A 1CIUA 4QOKA 4LVHB 1HOCB 1IC7L 4K07A 3ETBF 3M1BB 4PJXB 4WI4A 4NQEE 4XZUB 4J1UB 4JFFE 2BRRL 5D2NB 1QVOA 2HVJB 3EZ8A 1P53A 2BOCA 4OCXL 3WUWG 4LRNH 3K1KC 1BM3L 1LP9A 1L9MA 1RIUL 2ZP0T 1GL4B 5IHBA 2W0PA 4XNZB 5C7XL 4U6YA 3KG5A 2FHBA 2BVOB 2ARJQ 3SE3C 1YPZF 4AQ1B 2JB6A 4Z6AT 1YN7B 1R3HB 4OZHB 2Q8AH 3HHRB 5FYJL 4WFFD 5DEGA 4YDIL 2NCMA 4LU5H 4LARH 3SKNA 1YYLH 3PF2A 2FWOA 4JGUA 3IAQA 4WCYH 3B5GA 5FUOH 5JIHA 4EI5C 4P48A 5KVGL 3T4AB 1FL6B 4RRPG 2BNQA 4JJHA 4ZFGL 5D2LB 5ILTL 1BBJB 3AC0A 2CK0H 3VFTB 1GOGA 2EYSA 2R4SH 3F62A 5CJ5A 4IRJD 3QDJE 2JF1A 3T2QA 1U8NA 3IFNL 1AQDB 4UTAH 4OBSA 4GH7B 4KQ3L 4N9GB 3LQAH 1CBVH 5SX4I 3FOMA 4HIXL 3QQ9D 4U3HA 4PJHA 1UWGH 1MIML 1UKTA 5TDOB 3MLZH 1RU9L 4GW1A 1LEKB 4GKSA 4KVCL 4PJIB 2J6EH 3BD4A 3EO0B 4XMKH 4P3DB 1T6WA 1H8SA 4DVRL 2X4RB 2XWBA 2OZ4A 4JVWA 1LDPH 4UI2A 3AU1A 5I9QC 4Z77B 5CP3H 4C4KT 2IJ0C 4JO2L 4RMQA 4Y5XB 5DHXB 3DPBA 3P9MB 1W8OA 2QADD 1PEZA 5L6YL 2R0LL 5L9DH 2PNDA 1RZKH 2DMCA 5ACZB 1KOAA 2FGWL 4G6JL 1VGKB 1U3HC 2XZZA 3GM8A 1G7QB 2R0KH 5DJ0B 3WCYA 3HE7D 3PQYD 2OX5A 5KVMC 4HV8B 3ULUE 2QADB 1A3QA 5E70A 1WFUA 1ZLVH 2BNUB 2E7HA 1DDHB 4K3GA 5DK2A 1YEFL 1ZT7A 5IQ7L 5J13C 4YLQT 3QNZA 2LV4A 2R1YA 3HE7B 5CLTA 2DKUA 2JJVA 4J8RA 4Q9QH 1NMBH 1SEQH 4XPHL 1NBQA 3ULSB 4JHWH 4LLWB 2FDBP 4IIQC 3EDEA 4B5EA 3ZE2F 5DK0B 3DX7A 2JCCB 2YK1H 5D6CA 2VOTA 3BX7C 1OM3H 3NIGE 5HD8D 3QZWG 4R4ND 1BLNA 3V6OA 1EXUB 5FHAL 2BY2A 2XKNA 1G7JB 2D9QB 5H8DA 4ZTOL 1U8HB 3VFSB 5DUPH 5IFHL 3SDCA 2XXCB 2QQKH 4RDQG 2XN9B 2IH3B 2NZ9D 5DD3L 2C4FT 4U0QB 5F93C 3UTSA 1XH3B 2IGFH 2Q87A 3U1SH 5IVXA 1DQDL 5D2NC 3FB5A 5IMOA 4ZMAT 4WUUD 2VR5A 4MNGE 3QUMH 3OR7A 2GJ6A 5T3XH 3IDYB 1DEEB 4HQQH 3UJTH 5IMLB 4LCWB 5J3HD 2FL5B 1T2JA 1NL0H 4LLYB 2AAVA 3O3DB 2DQTH 3RL1B 5CMAB 3DETD 2E27L 1MHCA 2GJJA 3BPLB 1NFDB 5D93C 5IT2H 3A67L 1TZGH 4HC1A 3GSNL 4LDOB 1CLZL 1MLCA 1BJ1H 3TBYB 4MCZB 2P5WE 3ULUL 4WENB 4RFEB 1NCNA 4PRHB 5IBTL 4OLYH 2ED7A 4OCRH 3KPNA 5D70H 5LGJA 4BFEA 3ALPA 4JG0L 1KUMA 3ARQA 4MJIE 1QLRB 4M7KL 3B2UD 2R23A 1UJ3B 3TT1L 3PGDA 4XVJL 4NQCA 1NC2B 3ZSSA 3WXVH 2XTLA 3VW3H 1SM3H 1HSAA 4PJGE 5ADPL 4JAMB 5E8DH 3DROB 4KJWC 3IDJB 4JG1L 4IRJC 5JW5A 1TTUA 3N06B 5E4IA 5INDA 3MV9D 4ELMB 3SN6N 1AGDB 5F7WC 4F7TA 5AWNH 1ACYH 2HT3D 5D7LB 4LCIL 3QQ9C 1I9IL 4MD4B 1EJ6A 1A0QH 4G8EA 3ROOA 2W65A 4HK3N 4ZS7H 3WIHH 2G9HB 1HSBB 5ICZA 4NO3A 3L3JB 4Y5XC 4FTVA 4R97C 5FGCB 2MNUA 4FQJH 3WFHB 1SJHA 1JNNL 3CXDL 3WKNA 1JNHA 3IRPX 3ARPA 2QADC 1WBXA 1JRHL 3VXUA 5T1KD 4JZJA 1Z0MA 4K94C 1C16B 5GSRB 3P73B 3ZT5A 3KLDA 1MLBB 1O0VA 3EYSL 3ARUA 2K3TA 4X80H 2VDOL 4TULL 5GGRA 3HE7C 4LSVL 3AXLA 4PTTB 5GS0C 5D1QB 2VITA 4KI5C 2PTTB 3TH3T 1WAAA 3CDGA 2C3GA 2WQRA 1MI5E 3E6FB 3PIQA 4O51B 4DOHE 5T3ZL 1S9YA 4X8JB 3P4MA 3WLWD 4X5XB 3IYLW 4ELKA 3HNVH 3ARED 2R2HB 3IFLH 2AV7A 2F74B 4U2YA 1T4KA 3MNVB 4P4KA 3BPCA 3OB0K 1DANT 1S7XA 4MAUL 1H0DA 2YPLA 3MJGX 2NY1D 2AK4B 4EUPB 3CDYA 1UCTA 3FTGB 4QXGH 2HN7A 3HLAB 5JUEH 1UYWH 5LVEA 2X1OA 5D96B 4JRYE 1KC5H 4Y4KD 5DC0A 5D2LF 2NY1B 1AKJA 5I73B 1AE6H 4FQ1H 4PGEA 5ICYA 2YBRA 3IDYC 1XCTB 3LRGA 4Z7WB 3SQOL 2NZ9C 2OI9B 1OY3B 3N9GL 1IGTB 4HLZG 5DJ6B 4HJ0C 1CDHA 3RWFA 4RZCA 3BIKB 1JGEB 4PD4K 3V5KB 3BPLC 4RIRB 1DUYA 4U6HA 5CEZE 3RX8A 5IK3A 9CGTA 2RAMA 5J6HB 5J3HC 5SWZB 4NFBA 3GJEB 2BY3A 1FGVH 1K85A 3S7GA 2DI8A 4F58H 3RVTD 4PTUA 1S7WA 1AI1H 3DV6A 3NIFE 3CFDB 4ODTH 3P0VH 2R0ZL 4QRPD 4RGMB 4Q2ZB 1A3RL 3NFNB 2OR9H 3JWOH 1UJ3C 3NA4A 4X83A 4HGWB 1IGCH 2ORBL 2BHZA 1BBDH 5I15L 4FXKB 1CGSL 1J1XL 1UWXK 1SYVB 3E2HB 3EOTL 4UT9H 1ZVSB 5T1DH 2A6DB 4ODWB 4MA7L 3V4VH 4QRPB 2CIKA 1IGJA 2HJFB 2E9BA 1B4JH 4LQFL 5FYLH 4M9PA 1KB5A 2YC1B 3QULA 3S3SA 3QCVH 1DSFL 1S5IH 1RHFA 2Y36L 1DN2A 2F54D 5F6HI 3OKOB 5AUMB 1YPZE 1UXWA 3BDYH 3TVMB 5GGVL 2CO6B 2Q86A 3HUJA 1BVKA 3S36H 4W4NA 4KI5F 4MS8D 4L8BB 3QIUD 1BPVA 1S7VA 3TO4A 2HT3C 2R1WB 4DZBA 3FQWA 2AJVH 5HYSG 1FCCA 4G8FB 4KTEH 1QR1A 3EDFA 3IF1A 4W6XB 3DX6A 1Q38A 4V1DE 5IQ9A 4WWID 4WDIB 3RQ3A 2JCCF 1I7RA 3U4EB 2P45B 3MXWH 1RK0A 3RTQA 1NSNL 5CEZL 4ZUUA 4F7MA 3IFPA 3HE6D 4I48A 1OAYH 4JFOB 1FIGL 1G0YR 4LLMA 2A9MH 4KKLD 2A9NL 4LLUA 4ENEC 4OZIF 1NJ9B 4OKVB 2HKFL 1HHGA 4ZAKA 1FZMB 4MA3B 5D1QC 1E28B 3HE6B 3HCVA 4XP5L 4GAFB 3GBNL 3NBNA 5TE4L 3VI3F 1TVBA 5DWUH 1KTDB 2IPKB 3S6CA 2HLFC 3TN0A 1DP0A 4X98A 2P5EA 3O6LH 2VLKD 3WNKA 2JB5H 1A7QL 3CU7A 4G7YL 1Y18A 3WLWC 3QIBD 4GXVL 1L6XA 1T0MA 4N0UA 3OKNA 5EU6E 4JZNA 3PWJA 5D96C 3KXFD 1NGZB 3WKML 4NRYB 1WT5A 3SE9H 3FZUD 5IW3A 3NAAL 2SEBB 2NY1C 5EIIB 4I2XE 5I73C 2W38A 3CGTA 2F19L 1QSFA 4GAYA 1Z3GH 1D6VH 4UU9B 4PREB 3QG6A 4FP8L 2ZUTA 4TUJB 4U33A 1ADQH 2OI9C 4Y4FB 5IEKA 3I6LE 4WW1B 3N1PC 4R96B 4K8RH 1CGYA 2X89A 1QO3A 5JR1H 1TLKA 3B9KB 4LGSB 3T08A 4ZUTA 3CX5K 3U36A 3SJVE 3T77B 4ELMF 4YXHL 3TCLA 1D6EB 1XF5B 4PGCB 3FKUS 2R0WH 2NY6B 3P77A 5LQBH 2CKBB 3BAEL 4HIJB 2LU4A 1AIFA 4RGMC 4GSDL 2FATH 4XB8A 2PW1B 1T89C 2HLAA 3PDGA 4WWKD 3RVTC 4XXDA 1EBAA 3BJ91 4JFDA 4QXUH 5F9AC 3AM8A 4Y16B 5MERB 5CJXA 4LLDA 3E2HC 5E8OA 1EAPA 1NAMH 5BW7C 1BVZA 5D7SH 4Y89A 4N5EC 4BFGA 4ONFH 5ITBH 2X4SA 4KGLA 1EEZB 1I7UB 3MYJA 4ACPA 1LWRA 1KN4H 4IS6A 4QHLB 2GK0A 5I1IH 4LSSH 2VZOA 2WUBL 5B4MD 3CVHH 5EU3B 4N1HB 5EPMA 1DBML 3C8KA 3RX7A 5BRZB 2YD5A 1IGMH 4NM8H 1V7NH 4LHUB 1CN4A 3RWCB 3SOBL 4FQQA 3CFEB 3O6MH 3VWJD 4Y1AA 5E2TH 2XZAH 4DTGL 3S5LG 2X7LA 4LP4A 1H3GA 4DKEL 1WBZA 3QUYD 4R4BB 3SCMA 5LXGH 4HFUH 3QEQD 4OCNC 3QIUC 5CSBA 4HKZA 1T0NA 3EHBD 5ICXB 1KTLB 3WL9A 3F6IA 3I02B 3QJFB 2QHRL 1C08B 4AY0A 2HJKB 3P0GB 4FFVD 3MRRB 2PW2B 4O4YH 3MRHA 4NC1C 4M43L 1BOGB 3OR6B 1NGXB 3HE6C 3AB0B 1N8ZA 2W9LA 2DQDL 2NPLX 4XPAH 3UJJH 1FVCA 1FE8L 3HA0A 3QNXB 2DQUH 3K1DA 3WJLA 1Z9MA 1U95B 3SDDB 5TE7L 4Z7WF 3E8UL 3IGAB 3UTPE 4X6EA 4TNVK 4XCFH 4A6YL 5EULV 5C0CD 1TCRA 3QUKB 4YPGB 3KYKL 5IP4A 3HI1A 2NTSP 1OPGL 3PHSA 3QPQD 5JNYB 1KNOB 1C8PA 5INCB 1MCIA 3K4AA 1UB6A 2DQHL 1A14H 1DLFL 4LLVB 5GGSY 3CLEH 1RIVL 1G84A 4ZXBA 4YFDB 2VZSA 1TJHL 1I8MB 4YNYA 4E0RA 3H3PH 2VSCA 4WY7H 3QIBC 2C4FU 3OX8B 5J6GA 2AJ3B 4HK0A 4U1MA 3SGEH 1F97A 4JPWL 5D6DA 1MJUL 1A6VH 1TZIB 3MZGB 3STZB 4Y4FC 2VDLH 4O02L 3S34L 3FZUC 3RIFK 2R1XA 4WEUD 32C2B 4QHMA 4UNVA 3B9KC 4HJGB 1ORQB 4FQXA 1HI6B 5BS0A 3U6RA 3GIZL 5C0AD 3MXVL 2ADGB 2ADJA 2NY6C 2VXTH 4X0KA 1PAMA 1YEJL 5MP6L 3GRWA 4XNQA 3BKJL 4M62L 1S8DA 5I1AA 3R06B 3DUSB 2VZ1A 3V52L 5DQJB 4G43B 1DBBL 3TIDB 5J06A 3ARFA 1MQ8A 5FUZL 5I2IB 4PIRF 3I75B 1NUNB 4XI5D 4L8CA 5DTFB 3RIAF 5F72S 1Q9OB 1IQDA 4OIIL 1R5WB 5D2LE 2F5BL 1MH5B 5FYKL 3H8NA 3WFCL 5DZOA 2EE6A 1JZ4A 5DD6B 5F7FA 3EO9H 1EFXB 5IHUH 1T83A 1IZJA 4CU6A 4GMTH 2A1WL 3D39E 2QSQA 5CILL 3WYRA 4HEPG 2Z9TA 1GAFL 2VQTA 2ZOLA 2H6PA 3O41B 2E3VA 2CDGA 1HQRB 3DVNB 3C5ZA 4QOKD 4WHTA 4ZD3H 5C0FB 4PJAF 2YPKA 4FMFA 1U8IB 2VN4A 1KJ2B 1KLFA 1HKLL 1PG7L 5DJYA 1J8HE 5F7MC 3LPGA 4LSTH 2CDFA 3VJ6B 3Q6FA 2YXMA 4Z7OF 4OLVL 4QOKB 3FB6A 5DZNA 2GI7A 5SV3A 1J05B 2AQ3A 3Q3GA 2BHYA 6CGTA 2GTWA 3L5HA 1NQBA 1INQA 2X9WA 3ARRA 2XZQH 1QVOB 4F8QA 4OGXL 2Z35A 5I8OL 2BOCB 3I84A 1DQML 1RJZA 5IESL 3ARBA 4A2MA 1ZGLA 2H1PL 3EO1A 3QUYC 1LP9B 2YHGA 2VR4A 1RZ8B 3WO4B 1QOKA 1YEGL 4TNWF 1MHEB 1KCVH 4GG6A 4JQXA 2Z91B 1AO7E 2NR6D 4FFVC 1INDL 1IARB 2JB6B 3PWPA 4FXGA 2UZIL 5KSBA 1HHHB 2BNQD 2DICA 2H8PA 2AEQL 1OSZA 2V5RA 5HGDA 2FWOB 1XZ0A 1X5LA 15C8H 4JVPA 1ZLWK 1F6FB 1J88A 1FZKA 3U9UA 1BFOA 3RBSA 3MV8D 2EYTA 1AQKL 3HS0A 4IOSD 1FHGA 2JCCE 1U91A 2EYSB 3GI8H 1IM3A 1X4ZA 1MCSA 3TBWB 4NKIL 3UTTE 2NYYD 4F8TA 1VPOH 1MCEA 4OUOA 3EKCA 1U8NB 1KFAH 1RFDH 2V9QA 1UCBL 3DURB 4NCDA 5CCKH 2G5BB 4OZIE 4AT6A 4FQLH 2J8UB 2YPVL 4WHDA 2XN9E 3W2DL 4GW1B 1N5YH 3RKDD 1J18A 3IDMB 5HYFA 1R3IH 5E9DB 2XWBB 3LHPH 5D9SB 3TFKD 2ED9A 3Q5OA 2OK0H 3AU1B 2XQYG 1PY9A 1A1NB 1DQJA 3E3QC 1BEYL 3LKNA 1EJOH 1MCCA 1MY5A 1K3ZA 1Q94A 4PYGA 4K3JL 3O0RL 3EYQC 4F33B 4PRHE 3QT2A 2WBJB 1TJIH 1OARL 2EKSA 3SO5A 1KELL 3QBTB 4LVNB 3O11B 4RFOL 2WIMA 2DLIA 2ZCKL 4LSDA 3MLVH 1ZT7B 4LMQI 2R1YB 3MX0A 3GSQA 4OLWL 1QBLH 4KQ4L 4XP4L 2VERN 4J8RB 4UZGA 2K1MA 4F9LC 1LO2H 1SHMA 2RIKA 5C08A 3L3HA 4U2ZA 2OJZL 5GSVA 1E4KA 4XT1C 3NCMA 4ELME 4UNTA 3W9EB 2X40A 2VXSL 5D7LE 3SDCD 4LVOB 3VXSD 3VRLF 4D3CL 2FD6H 5D6CB 3UTSD 3IS1X 4KY1H 4PJEA 1OP9A 1FG9C 1MY7A 2XKNB 3TGXA 1I9RH 3TPUA 4IRSA 2GJ6D 2FO4A 4M9OA 2UWEA 3H6JA 4R4FH 5IVXB 2P48B 2M1KA 4MVBD 4H1LH 4U4BA 4K7PY 2OMBA 3VFNA 1BIIA 1J0ZA 3OR7B 4LRNL 4QRSA 4XGZA 3D85B 1W0WA 4QNPF 4YDKH 3MUHL 5D71H 1RULH 1KPVA 1A6PA 3TZVD 3OG4B 4LLQA 3OKKA 1MHCB 2MKWA 2VAAA 2BFVH 1B0RA 1CGWA 1D5IH 1YYLL 1MLCB 5EIQA 5F96H 4AG4L 2VJXA 3MRPA 5FUOL 1JHLH 5D1ZA 1HHIA 4KROD 4OF7A 3K8MA 4NQCD 1NKRA 2NR6C 3EZJB 1X9QA 5LGJB 1RI8A 1WZ1H 2CK0L 1KCRL 4X99A 2DQJH 1W72H 3MRJA 3PGDB 3K3QA 1AC0A 1S9KC 4UTAL 5CZVH 3LQAL 1CBVL 1GZPA 3N85L 1I1CA 1B4RA 1HSAB 1D5MA 5ID0A 3KJ4C 4PRAB 4L3EE 1UKSA 2VKWA 2NY2D 4X6CB 3U4BH 2J6EL 4HMCA 4OTXH 3B9VA 5ERWB 5INDB 3BXNA 3QSKB 4F7TB 3LAFA 5HDBF 3SO3B 3QWOA 1QTYT 2FJGB 1MFNA 4FTVD 3FT3A 3QQ3B 4QHKI 3QDGE 2MHAA 4G8EB 1PLGH 3V0WH 5GGTA 4R26H 3ZL4H 3ROOB 4LAQH 2W65B 2P49B 3QB7C 3RP1A 5D72H 4XHQA 5FUCE 5ICZB 5DURB 4NO3B 1BZQK 3F65A 4FTVB 2YUVA 4D0CA 3TFKC 3AGVA 3P4OA 3VXUD 1RZKL 1SJHB 4I3SH 5HYJB 5BOZG 3GHBH 4GW5A 1CFVL 4N8CH 3O8XB 1WK0A 4KKAD 4U1LA 1LK3H 3SPVA 2UZYB 4LVNC 1WBXB 5E0QA 3SKUD 5HHNA 3MUY1 4JZJB 4HW6A 4QHUA 3FO1A 5FA3B 3NACH 3P4NA 4K2UH 4U1IB 5JHDA 4JREC 3QFDB 4U7MA 2F53A 5GGRB 5GHWL 3AXLB 4LPWA 4P4KD 4Q9QL 1SEQL 3CK0H 4MQ7B 3CDGB 2H45A 4YJZL 1AC6A 4JHWL 1S9YB 2YPLD 2R2CA 2YD6A 5DC4B 1R24B 4RGND 4ELKB 2EIZB 1LK2A 2AV7B 2FJHA 4J6RH 4PJBA 4P4KB 1HINL 3BPCB 4LVOC 2Z8RA 4YHKL 1OM3L 4M6NH 1T7ZA 1FNEB 1S7XB 2BVQA 1H0DB 3BQUA 3B83A 3QH3A 1AKJD 3C2SA 5DUPL 1HKFA 4MHHI 1EGJA 2HN7B 3CUPB 2IGFL 3BH9A 4XC1L 3SDCC 3U1SL 5J7CC 2VLRA 1ZT4B 2DB8A 5I1LA 3QUML 1T20A 5IGXL 4ALAH 5T3XL 1AKJB 5C09E 3UJTL 1NAKH 4KRMB 3TESA 1MAJA 1NL0L 2YBRB 5DUBA 1F3JA 4JFEB 5DRXA 2I24N 4BSJA 1XF3A 4MCYB 3RWFB 3B5HA 2CGRH 4X7TA 3HFMH 4PGBB 2J8UF 4U6HB 1DUYB 2GSIB 5IK3B 4ZOAA 3CDFA 1ZLUH 2E7LA 1ZEAL 3QDME 5F7NC 4PJAE 5DDHB 4IMLA 5C0RL 1NBZB 4JHAH 5D70L 3UX9B 4AQOA 4PRIE 1YMHB 3DV6B 5KOVC 1F4WH 4KUZH 4YBHA 4Z7OE 5B39B 4BELD 3DYMA 1HXMB 4AEHH 1F3RB 1G1CA 4OFIA 5DFTA 3WXVL 2D7NA 1T2XA 5DJCA 5IWLC 4J3OC 1SM3L 2P8MA 1JUFB 4J3VA 1XGTB 5HBBA 1QG3A 5E8DL 2CIKB 3QAZB 1S5HA 3DXAA 2VXQH 5FB8A 4GBXA 3GBML 1KB5B 1MVUB 3G5XA 4NZUH 2KKQA 4K94H 4WHYG 4OB5H 1A6UL 1ACYL 1UACH 2R2EA 5LGKA 3N1MC 3TO4D 3VG0L 1UXWB 2ESVB 1A0QL 1P4BH 1R5VA 4QCIA 4Z8FH 5GS0H 3TWCH 5I1DA 4FA8A 2NY2C 5ANMA 4ZS7L 1BVKB 3WIHL 3ZHDA 4EBQH 1T6VN 3V6ZA 4KFZC 1P4IL 1HN1A 1VENA 2N4IA 3CH1A 4JY6A 4YHPB 2E7BA 2EC9T 3T65A 4FQJL 5D7IF 4I5BB 1QR1B 4F9PA 3MGAA 3N0PB 3DX6B 1QFWH 4EDWH 5IQ9B 4OZFG 3TM6A 4ZAKD 5L8JB 2LU3A 3EYOB 3O8XC 4QTHA 4JO1L 1CDCA 4DGVH 2EICA 3VA2C 1QBAA 3RTQB 2F9BT 4ZUUB 4JFXA 4F7MB 5FF6B 4I48B 2NY3D 4JZJC 3L3IA 4LLMB 5IJVA 4FMKA 3WXWH 4ZAKB 3H9SE 1A9EA 4PS4H 4U05A 2I26N 3TN0D 3HCVB 2IANA 2MOVA 4XAKD 2VZVA 2P5ED 4P5MB 2ICWA 2Z92A 4CW1A 1PZUB 4MMZC 1U8PA 1IC1A 2VABB 2CPCA 4MNHB 1TVBB 3IFLL 4G9DA 2R29H 4IMKA 4HH8A 4P4KC 4O9HL 2VDQH 4JM2F 5D5MA 4ODUB 4RGNC 4GAGL 1QSFD 1UYWL 4N0UB 3L5JA 3OKNB 1EHLH 1MSPA 4JPKL 4RAVA 4ORZC 1AE6L 4FQ1L 4HBCH 5DUML 2X89D 3GIVA 2VC2H 2XQYK 1XFPA 5J1TC 4RWHA 3QG6B 5DRWA 3KPSA 2BXYA 5IEKB 1JI1A 3KHQA 1XGRA 1QSEE 5MEQA 1QO3B 4HGMA 4PB9L 3UBXI 4ZUTB 4X6CF 4FABL 5JW4Q 1C1EL 3DX8A 4AENA 1FGVL 2AEIT 3HI5H 1AI1L 4LIQH 1FFRA 5GRZA 4P3WA 3VRLE 5IBUB 4ODTL 3P0VL 2YWZA 5JPNB 1G9NC 4X9IA 3HKFA 2OR9L 3JWOL 3N50A 4YHLL 3HC4H 3JTTA 1YEHH 1AIFB 2OXGA 4N9OB 4NN6B 1NGPH 3RJDA 1BBDL 3QNYB 2D3VA 4XXDB 4UT9L 4M1GH 4JFDB 1FRGH 4BZ1L 3U0WH 1EAPB 1L7TL 1B4JL 3U7WH 4EQ2A 2X4NA 4RRPA 5FYLL 3QAZC 1P69B 2WWKO 2DIJA 1X7QA 5A1AA 2YD7A 4D9LH 3MRDA 3MYJB 5HHXL 5TF1L 2ED8A 1S5IL 4UB0H 1VFBA 3SE4A 5IMKA 3PP4H 5FECA 3AFLA 3CFIC 4X9FA 3VXQA 5EUOA 5IB5A 5FM5O 3P0YH 4Y1AD 2OL3L 3UJIH 4PV8A 3WJJA 4XBGB 5EPMB 3C8KB 4PJDA 3DI3B 4R7DA 5ESVB 4M61A 4YBLB 3FQNA 3BO8A 4FQQB 5EZLB 3ILPB 3SCMD 1IC4H 3OWEA 3TO4C 5JMRA 4KTEL 3BEVA 3H9HB 4XNMA 5EOTB 1A7OH 4H20H 3VH8G 3BMVA 3RUGB 1LD9A 5E2JA 3SCMB 3RX5A 5IHLB 4EUPH 3TNNA 1OAYL 3UZEA 5A3ID 3SKJL 3RTQC 2A9ML 2X70A 3WL9B 3VMPA 2EDKA 2VLLA 1XGUB 4I8DA 4PRNA 5JOEA 3TBSA 4ZAKC 3FQXA 4PLJD 3MRHB 4G5ZH 4WV1A 1HNGA 2Q8BL 1TVHA 3C6LA 4ISVA 1FORL 3BZEA 1A4JA 2FJFA 5HDBE 3RHWF 1BWMA 2KPNA 1N8ZB 3MLRH 2NY3C 1FVCB 1X5IA 2WINA 5DWUL 5JOFB 5GGVY 1MEXH 3HRPA 2ICCA 5IG7A 4S1SH 4UIKH 1CFNA 1JNLH 4X6EB 3O6LL 1TCRB 1IM9A 3TN0C 1BAFH 2JB5L 1DFBL 3HI1B 5I1CH 1SJEA 5I17A 1FPTH 1HZHL 1VKXA 3OL2A 1K9TA 4GKZA 1UB6B 1IL1B 2WW8A 5H94A 4BM7A 3QRGH 1CQKA 1FZJA 4ZXBB 3NCCB 4E0RB 3EFFA 2QJDA 1EVUA 1NC4A 2A38A 1QHOA 4LPXA 1Z3GL 1D6VL 4Y8DC 5J6GB 1FZOA 4U1MB 4UAOB 4FQXD 3BKCH 4Y0GA 5BS0D 3NZHL 4K8RL 1QSZA 4OZGF 1ITCA 5KW9L 5IB3A 1MFEH 1BVLA 2JJTC 3S4SA 1M7XA 1QRKA 4ZFOA 2Y9RT 1N6QH 4NO0D 5BS0B 3MLTB 1YNLH 1KPRA 1U3YA 3U6RB 2R0WL 4PRPE 3ARFD 3D18A 5LQBL 4WI5A 4HUMB 1X4YA 4UT7L 1T21A 1KBGH 3NCBB 1I9JL 5EFIA 2BXZA 1S8DB 3QXTA 5I1AB