1LGVA

Structure of a human bence-jones dimer crystallized in u.s. space shuttle mission sts-95: 100k
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
ETALTQPASVSGSPGQSITVSCTGVSSIVGSYNLVSWYQQHPGKAPKLLTYEVNKRPSGVSDRFSGSKSGNSASLTISGLQAEDEADYYCSSYDGSSTSVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN LAMBDA LIGHT CHAIN
publication title Comparison of the three-dimensional structures of a human Bence-Jones dimer crystallized on Earth and aboard US Space Shuttle Mission STS-95
pubmed doi rcsb
total genus 45
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lgvA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lgvA02
5LKNA 5L9DH 4XC1L 4PS4H 4R9HA 4H8WH 4DK6A 5TQ0H 5EU6D 2YZ8A 2QSTA 4MB5A 4X6DE 4YDIH 5BV7B 4JO3L 1IEBB 8CGTA 3MRIB 1HYSC 1CGVA 3OKEB 4PRNA 2IWGA 1XGRA 5I1GL 3BIKA 2YC1B 4RMTA 5DJ2B 5ICZA 4X98A 5A1AA 1KB5B 2VRAA 1BZ9A 5FDYA 2XQYG 2VZTA 1N6UA 2D3VA 3MODL 1A3RL 2F53D 3EOBA 5C0IA 1F4WH 4P2RE 1PEZA 4Z77A 2B39A 2CIIB 4JGJA 3JV6A 3HR5B 5C70A 4XX1G 5GJTL 1QSFB 3CFCH 2OX5A 3JSSA 1OAZH 1AGBA 4QHKJ 4WTWA 4AZ8A 3BP4A 4DOHE 1FO0H 1NCWL 1FYTA 1RZIB 4K8RD 3D85D 5HVFB 4G3YH 3BPOC 1YEJH 5CBAA 4QRTA 4PJBB 1AQDA 3CU7A 3TJEH 5E70A 5GIRA 3SE8L 3MUY1 2YN5A 3S37X 2QSVA 2IG2L 4NRYA 1I7RA 3IXAB 4XCCH 3U9PL 3GZKA 4IRZL 1AXTL 4ZDHB 3A6BH 5JXED 5IB2A 1KJ2B 3IFPA 4KAQH 3TIDA 1M7IA 3C5ZA 4HWZB 3HTLX 3P9MB 3BEVB 3SQOL 1FIGH 2DYPA 2APVA 3V5HB 5C3LD 3VFRB 3EOTH 5B8CA 3IDMB 1FG2A 4ODXA 4GKZA 2DQHL 4AQOA 5TE6L 3GRWL 4YK4B 1FNEA 1I1AA 1SJHA 1XGYH 4JG1H 4L9LB 4PGEB 3QEGL 1KSRA 4RGMC 3LQAL 2ZSVA 4TN9A 4YHZL 1HHKB 3P9LB 2VL5A 2R2EA 1OWWA 2EDEA 1PVHA 2W0FB 2G60L 5TH2A 3MV9D 4U1KA 2Z8SA 3SKNA 5JHLH 3BT2H 4XB8A 1G6RL 2HTLC 5E08H 4JKPL 1HCFX 3VE0B 4APQC 3OJDA 2HFGL 1QRND 4MXVF 4NZRH 4I2XE 3CH1B 4KKCC 3MX0A 1UZ8A 1JGLH 2FX7H 3MRKA 2BVOA 3G9AB 3VD5A 4JB9H 3RU8L 4XGZA 3CXHK 3VXME 1RULL 3QUML 3QNYA 4U7SA 3ARUA 5JDSA 3NGBC 4M6OH 1U91A 5HI4C 4OTXL 4XP5L 3C5JA 1HQRB 4NQSB 1H0DA 4W81A 5E94B 1RIVH 2DLFL 3VRIB 4G9DB 2Y6SD 2XZAH 3BYTA 2BVPA 2DMCA 1IARB 4FQ1L 4K2UH 3LEXB 4MNHB 4HQQL 1JWUB 3D3VA 4XMKH 4JFEE 4WU7B 2ZUVA 4GRLA 4RRPA 5J6GA 3MUHL 3QEHB 4ZPVB 4K8RH 1J1XH 1U2HA 1T2QL 3FMGH 4N9OB 4PJIF 5CLWA 1BOGA 1DLHB 4JO4H 3SKOB 5D7LD 1J0IA 3B9EA 3VWJB 1A6WL 3GIZH 4BZYA 1QBAA 2DQJH 5ESAA 2ZG2A 3HG1A 5BS0D 3ZHDA 4AEIL 2J6EA 3L3OA 1XR9B 4XB7A 4BSVA 4E9LA 1AR1D 3QPQD 3MRLA 5DJ0A 3ARDD 5F1IA 1D6EA 4JFFD 4MCYB 2UZXB 4RIRB 2AV1A 5HHOA 4CRPA 1X7QB 4XPGH 4EI6B 1X5AA 2DBLH 4Y4FB 3BP6B 1ZT4A 5CMAA 1BVKB 2EZ0C 1AGCA 3S6CA 4UQ2A 4QF1B 5DHXB 1YY9D 2W9LA 1SJVA 3QDHA 3V4PL 3VXRD 5CZKA 2APTA 4PLKC 1CFTB 1CFSA 3RGVC 2HAZA 4LCWA 3RWCB 1IQWH 4JY5H 1J8HE 3GMRA 1ZHNA 4KQ4H 2E9JA 1L6ZA 1JTPA 4P9MH 2YD1A 1G7LA 4LIQL 4M1DH 2WW8A 4OD3L 2IADA 1A0QH 4GW5B 5IVNA 2ICES 4Z6AT 2FZ3A 2JB5H 5HTSA 5IB4B 3EYOA 3HNVH 2AJZA 2ZZUT 3TV3H 1N59A 2IQ9L 4N8VG 1PY4A 1A6UL 3OB8A 2VWEC 4ELMF 3HE6A 4WV1A 4XP4H 1TENA 3JBG7 3MLSH 2QR0B 1DANT 1D9KD 3KPQA 1IT9L 4JQIH 2WINB 4JDVA 4XNMB 1AP2B 3VXPB 2EIBA 1H8OA 1VGEL 1BLNA 4OZGA 1HQ4B 2DTMH 2UVEA 4RMWA 4G8IB 1NC2B 3HMWH 5J12B 3NCEB 1K8IA 3MJ9H 5F7HA 5IM7A 3WXWL 3VWKB 2MKLC 4WI2A 5DLML 4PGBA 4FQXD 4X6DB 3VD4A 4QGYA 4KJWC 5C0AE 3IGAB 1AE6H 1YQVL 3MRFB 2JJSC 2ATPB 3BFOA 2R29H 3P4NB 1G0DA 4OCYL 1HH6B 4DAGH 1Q9KA 1S7WB 2PYEA 1XFPA 2NZIA 4O2FA 4FQQA 4FHBD 3DGCR 4XTRD 1IAIL 3CK0H 2NR6C 4N9GA 5C9KA 5GHWL 4GH7B 3PWNA 3DSNA 4M1GL 3LS5L 5EIIA 1RJLB 5ID1B 3ZKMD 2P8PA 3RL2B 4M62L 2BNQD 4JFZL 5I30H 3P0VH 4O9HL 5EOQH 1BQHG 3QRFM 1QRKA 4P2RB 3BHBB 3V7MA 3DUUA 2NW2A 1RZFH 3TT3H 1S7UA 4UT9H 1JFQL 4C4KO 1SHMA 4JN1H 3QFDB 4X7FC 4ORZC 2G5RA 5E4EB 2OM5A 3WFBL 2HJKB 4F3FB 5FO8B 3D0LB 4Z0BH 4DOHB 4HWBH 5DWUH 4PFEA 1MI5B 2A1WH 4WENB 1OGAE 2XACC 4NNPL 5CJXC 4QRRA 3HI5L 3BP5A 1TITA 7CGTA 4J2XA 1EEYB 4MXVE 3VFPB 1GZQA 1ADQL 1NGPL 2X4RA 3G08A 3IXTA 2NW3A 3BGAA 2BMKB 4PIRF 1RK0A 4KTEL 3MOQA 5A16A 2C3WA 2O26U 2QADD 3H9ZA 5F9JB 2BJML 3L9RA 3PWJA 4U1SA 1MFBL 1LO4H 5J9PA 1DQDL 4QY8B 4GW4B 5C0CA 2R2CA 1RZGB 3IJSB 5F7EH 4R96A 5EUOA 4C56E 4Y1AE 1JHKH 4XPTL 3ZYOA 4AY0A 1WICA 2JJWA 1I9EA 2ENYA 4MA1B 5L2JB 1DQML 1U9KA 5IWLA 2AK1L 2P43B 1ZHLA 4X83A 3RWIB 1HHJA 5SWQB 1NCUA 2HVKA 1NLBL 5D9SB 4NUJA 1NKRA 3RL1A 3TC9A 2DM2A 2WIIB 3IKCA 1FQ9C 2ZOKB 3KPRE 2XZQH 2DD8H 1A7QH 2AABH 3MOAL 2YD7A 2P46B 4PGDB 3NH7H 5D7IB 2VDOL 4KRPB 1BREA 1A6ZB 1NUNB 1X5YA 2VDMH 4I2XB 4IRJA 3VD7A 1RZKC 2VITB 4WDIA 2IC2A 4GSDH 4OCNC 5I1KL 2QEJA 1Q9LA 3DPBA 3AU1A 3DX7A 1ONQA 1SYSA 3WE6B 5DD0L 2Q7YB 5L2KA 4Q0XL 2HWZL 3KG5A 4JAMA 1DBJH 1H9VA 1UWEH 3FFDB 5GS1A 5C09A 4TTDD 4R0LB 1Z5LB 2A9NH 2ESVD 1Q9WB 1XR8A 5C9JA 1CG9A 4D9RE 3O3UN 1MCEA 4UDUA 4PP2A 1WBXA 4YC2C 4WGWB 3UC0H 2WLYA 5I1JL 3ETBF 4WO4A 5I17A 4GXUM 2AS5M 2HT4D 2DLHA 1BFSA 1GH7A 4LVOC 2R0WH 4LCCC 4QTIH 2APXA 3QDMA 2BXYA 3WS3A 2X4QA 4JFEB 3UYOD 3KXFD 2PR4H 2R9HD 5DVLA 4H88L 4J12A 1F11A 2N4IA 3HAEG 3CFJB 1EFXD 3U4BL 3VXTA 3ARBB 4PJXB 4XVJH 3GSNL 4A6YA 2HG5A 4P4RA 4ZPTB 3MLRL 4YXHL 5CHNA 1AFVH 2AI0H 4ENEC 3DVGA 5EC2A 1DQQB 4ZS6C 1AGDB 2HFTA 3SDAD 3V6ZA 1FDLL 3GSQA 1JUFA 3HNSH 4NOBA 2ZUQC 3MCLH 3NZHL 3GSUB 3SDCA 2CJUL 2ZNXA 3EFFA 3T0EE 1AR1C 1X3DA 3HCVB 2WP3T 2DMBA 4I0PB 1HSAA 1BBDH 1N0XL 3GJEA 3KLSA 4Q6YA 5C0FB 5F96H 4FZ8L 4WFEE 5C2UB 1SBSL 2ZUWA 2FGWH 1ZOXA 5HGBB 2OJEB 5BZDA 4JY4B 1UXSB 3I6LD 3O3AA 4OCXL 4QRUA 1YY9C 3NPZB 3NN8B 3R0NA 2HJFB 4RFNB 4LBEA 4EI5C 5I71C 3BOVA 4PB9H 3AXLA 2J88H 2GQHA 3CDGB 4Z0XA 3ULVD 4M7JL 1X5XA 1BM3L 4M5YL 3TO4B 3TYFA 5MI0C 2X7LA 5CEYA 3QIUB 4L4VA 4X6EB 4O2EB 1C12A 2A0LD 5J3HC 1OT2A 3K74B 3O2DL 1A7RH 5FK9A 4P2OC 2IALB 1PBYA 3AY4C 3KAAA 3KDMA 3HB3D 1KNOA 2VN4A 3HAEH 4O5LL 4PUBH 5FYKE 1H5BC 5D70L 4AEFA 4ZNEA 5J89A 4IOFD 1LD9A 4UBDC 4GKNB 1NGYB 1G9MC 4KHTL 1XIWD 5GGSY 2HRPL 2APFA 1D9KC 3C8KA 1HDMB 1MCIA 2VUOA 3MBED 3NZ8A 4NWTH 4Y4KD 3RIFF 3D5OF 1U3JA 2V7HB 3T4YA 2NY2D 3RDTB 2FCBA 1FO0A 3D2UD 4XT1C 5IMMB 1KT2A 3O3EB 1CDUA 4GFTB 1TETH 3AREA 4Z7OF 5F21B 4WTXA 3WLBA 1S7SB 3TBSA 4Y5XA 1AY1L 1FZKA 4ONGH 3QUYA 4P5MA 1R3KB 4ZQKA 1JGDB 4JFQB 1FFPA 3KPSE 4Z7QF 1KG0B 2PETA 3QA3A 3B9AA 4OUUB 4XTRC 3X14B 1KIPA 5BMFH 5C2BL 1M7DB 4M8VA 4TUJA 4HIHB 3V4VH 2XT1B 1QP1A 1J05A 3ZKMC 5KS9A 3PV7A 1N0LA 4GS7B 1MPAL 4JRXD 2QSCH 1KEML 1KTLB 4L8SB 3UTSE 4HT1L 2O5ZL 1KYOJ 5I1LA 1I7UA 1NEZB 1RZKL 5CZVL 5GGTH 2EDHA 2CK0L 5FDWA 5DEGA 2XA3A 2XY1A 4GLRH 2AJYH 3CZFB 1HWHB 2Q3AA 1OP5H 1OAQL 2E7HA 4HH9B 4NQVB 2XKNA 3GKWL 1J87A 4I77H 3AUVA 1R3LA 1EMTH 3WO4B 1INDH 4ZG1A 1QSFD 4H0HB 1MJUH 3RGHA 1OF2A 3NCJL 1MWAB 3IFLH 3RUGF 4N5ED 3RIFK 4WHYG 2HFEA 2CKBB 1G7HB 3QEQE 4G8GA 4PJGF 2Y06L 2QADC 5DJ8A 4XAWL 1IAMA 4X6BA 2Q1EA 1RUAL 4C56B 4Y1AB 1MRDL 4Y2OA 3OHXA 2NY7H 3B3IA 2DLEA 4L8BB 3FQRB 3MPCA 3MFGB 4KDVA 4NKOB 3S88H 3PQYD 2AKRA 3BGFB 2DBJA 2R2HA 1PLGH 3HZVB 2IPTH 3FQNA 4XPFH 3NACL 4YHPB 1I8MA 5D7SL 1T0MA 3W9EA 3LMJH 2MCPL 2R0ZL 2F74A 4HXAH 2P5WE 3U30B 4YX2H 2X70A 4BYHA 1IM9B 5DSCB 1T1WA 3KPRB 2LU4A 3OKNB 2ZJSL 3T2QA 1Z0NA 4BH8A 2HJLA 1MFAH 1T3FB 3D25B 1KPUA 4JDZA 3D85A 5D6CB 5E2UL 2ZPKL 4RMSA 5E8OB 3B6SB 3CIQA 3MYJB 3T4AB 2ARJA 3SY0B 2FL5A 1JZ8A 3VFOB 1RJYB 3RWGA 4PJCF 1F58H 2IBBA 1TJHL 1NCDH 3PG2A 1OAXH 5ENWB 1KJ3H 3O4LE 5I1EH 4MAYA 1QLFA 1S5IL 3RVWD 3LKNB 4YHNA 3O81A 5JXEA 3G5XB 5DDHB 2IANE 4FQHB 1T21B 4LVHB 2IFFL 4YHOH 4NRZA 5DJCB 1GZPB 2IH1B 4TTDC 4PRIA 5DI8B 4JREB 1FZOA 5C07E 1KPVB 1TJIH 2YPKB 1U58A 4KMTL 1HXMA 4N1CA 2E6PA 5LXGL 2CIKA 3LB6D 3CSYA 1V3LA 1K2DA 1NCAL 5D1ZA 4O4YH 4HSQA 4KZEH 2HT4C 1PSKL 3CJJA 1IFHL 4FG6D 4WI9A 1YEGL 4UTBH 4U1HB 2Y36H 5IBTL 4L3EA 1QPXA 3ULSB 3KYNB 3MV9A 1CDHA 2AJSL 3A67H 5IW6B 1UYWL 2R9HC 3BW9A 4U1JA 3W9DA 1KC5L 1U95B 5BQ7B 1I1FA 3QIBC 1YMMA 1A1OB 4NC2B 1KLGB 4F7MA 4Z8FH 3KR3H 5KAQG 3GBNL 1HHIA 3WKMH 1CDBA 1T5XB 2QKIA 3DV6B 5JUEH 5CKAA 3T0EB 3VWJD 3SDAC 1A7NH 4YZFF 1V05A 1BD2E 1G9ML 4Z7UA 1DSFH 1M7XA 4GJTB 3WHE0 4YR6B 4GUPB 4OD2A 3H9SA 2P8MA 4R4BA 4B50A 1V7ML 3FQUB 3QXAB 3ZKQD 1U8KA 2WBJA 4AMKL 5A43C 5J6HB 4GRWH 3GMQA 5K9OA 1ZHKB 5KSVB 4FQCL 1KBGL 2F19L 2LU3A 3EIFA 4WNQA 1PX3A 4L3CB 4PGZA 4V1DD 3RPKA 3MJ9A 2RGSA 4Y4FD 5FUCC 4RGOL 1OSPH 2I60L 4Z7OE 2VLLB 3LQAH 3IJHA 4IIQC 5EULV 2EDLA 1N64L 2WSKA 2BOCA 2G60H 5D7LA 4TVPL 4Z7QE 4LSUL 3NA9H 4NQCA 2VLJA 1LE9B 1L4IA 5I1AA 3ULVC 2IGFL 2PN5A 1WF5A 1CICC 1CDCA 2A6KB 2EE9A 4I5BB 4UQ3B 2DICA 1IAII 5I0DA 3RPIB 3JUYA 3K4AA 2OJZH 3BP7A 2FBOJ 3MV8A 4LEOA 4GBXB 2W60A 1B3JA 4PJEF 4Q9CA 2A0LC 5C6TL 2X4SB 4NNXA 1RURL 3ARDA 3KYMA 3VD3A 4JFFA 3OX8A 3UBXB 4AM0B 3LVEA 3HB3C 4CNIB 4DW2L 2VDLH 4D8PA 3UTZA 5MP6L 1R5WA 1D7FA 1JHLH 5DEZA 2AVGA 3V4UL 3SJVE 4Z9KB 5IFAL 4IOFC 4NQEA 3DRTB 4JFOA 4N8VA 3MJ8B 3UTPD 1N8ZB 3PWLB 4HWBA 1XIWC 4LNRB 1IGML 2D03H 5ANMA 3PP3K 5TE4L 3MBEC 1JMXA 1CK0L 4Y4KC 5GSRA 3EYVB 3P0YL 4OZHF 3PDDA 3U46A 4YHIA 1NC2D 1WC7A 2XZCL 3RUGE 1AQKL 4OF3A 4AH2B 1AKJB 4FRWA 4I8DA 5FUZL 1K3IA 2DLGA 4XRCA 3VWKD 2WZPD 4PJGE 3KPSB 5DVKA 5IMLA 2Z4QB 2CK2A 1UENA 1HE7A 1R6VA 1I7ZA 4ONHB 4FXLA 1ZHBB 3BKJH 3PWPA 3W39B 4BSWB 4WEBL 4UOW0 2XWJB 2R1XA 3C2SA 2V5MA 3U4AA 3D9AL 4DGIH 5I9QB 3QUXB 5F7DA 3HMXL 2ATKA 4AG4L 1TTUA 1QBLH 1KOAA 5FA3A 4P46A 1NBQA 1T0NB 3TN0B 5ALBL 3I6KB 5DR5L 2R0LL 3CFDB 1T20A 4NO3A 2NY4B 1JF1A 3BVNA 4N0RA 1JHTB 3MA9L 2HP4A 4XBEH 5ADPL 3CDFA 5TFSH 4OGZA 1MHEA 5ILTL 3FHQA 1I8IA 2Q87A 1BVZA 5I19H 3V4PH 1VDGA 4X4YA 3V7AE 1WIPA 3C60A 4FQXA 1RY7B 3JV0A 5EUKA 4PJCE 3UJTL 1HOCB 4OM1L 3TIEB 5DRNA 4YPGA 5F7FA 4XBPB 1MI5D 1WCBA 1T04A 1QYGL 3BQUA 1TDQA 3VXQB 1NPUA 3QEQB 3UEZA 4G6FB 4HK3N 3SGKA 2FB4H 4M1CC 5FHBH 4N5EC 3KJ4B 1PQZA 3LKQB 4HFUL 2IQ9H 5HYJA 4LLWA 2C7UA 2Z0BA 2BCKB 4L8DA 4M93B 5DTFA 4F58H 5D2LA 2DWDA 4Y4HA 3MLTB 3OR6A 1KACB 3FRPG 4HZAA 5JOFA 1F8TH 1LEGA 1MCSA 3PUCA 4QCIA 2P5WB 4YUEL 3AMLA 2P5EA 1PD6A 4PJAF 5JR1H 3O6LH 4CMMB 3GHEL 3L3IA 2G5BB 4PJDA 3O6MH 4NQXA 4X9FA 4OLVH 4YXLL 3PGDB 3TEUA 2C1OB 1IC4L 4YK4C 5DQJA 3MUGA 4ETQA 5IJVB 4L9LC 4MA3A 1QHOA 4LSVL 3DX9B 3O4LB 2DM4A 3PXHA 1EXUA 1FPTH 1LO3H 1P7KA 4KRPD 4QRPE 2IANB 3BESR 3F12A 3MRQB 4G42B 1MCWW 1CU4H 5F89B 4QHUA 3HC0A 4PB0L 2GK0A 5DK0A 5FCUL 3DGGA 1EEZB 4S11A 3PIQA 3BH8B 1RUKH 4NRXB 5KANI 1KCUL 4U1NB 3OKDB 3LKOA 4R4ND 1I85A 3BPLB 4LHUG 1WZMA 2KZ1B 2JB6A 2FEDD 3L7EB 5ICYB 1P2CB 2X9WA 4BELD 3CC5A 4Y5YB 1CR9H 4HIIB 4S2SB 3LB6C 2IEPA 4DK3A 1QLRA 2PUQT 5IB5A 3ULVL 3SGDI 1G7MA 4OBSA 4FG6C 1KCSH 4X80H 2AP2A 1J9CT 3DX6B 3QXDB 4H1LH 2VL4A 3G6DL 3NFNA 4IMLB 1CBVH 4NP4L 4JFED 5L88H 4XCFL 5DUBA 2R23A 3FO9B 4YHLH 3S34H 1LK2B 4YLQT 3VJ6B 4M5ZH 1U8LB 3WEXB 3TYGH 4X7CC 3P4OB 4UAOB 1WBZA 3ARBD 2DM3A 2MSPA 5D4QA 1LE5B 3IRZA 5JIHA 5GRJL 1BD2B 5BJTA 4JVUA 3OJMB 3HAEA 3V0AC 3VWJC 1BF2A 2GJ6A 3D0VB 2E3VA 3EO1B 1JMZA 3MGTB 5GGVL 1B0RA 2C3VA 3LCYA 1AHWB 4LCUA 4X4ME 1N2RB 4JFPB 3ROOB 3KPPB 4JJHA 5I6XC 1QFWL 3K2UL 1IAOB 4I0PD 1GGCL 4B53A 4JFHE 1CT8B 5H37G 3UROR 3MNWA 4YFLI 4XWGH 4OZHE 1HK6A 5FOJA 4MD0B 3J8F7 3SN6N 1FL6A 1Y18A 2C5DC 3EGSA 4Y4FC 1ZS8A 4NN6B 4Q9BA 2APBA 1OW0A 3NFPB 1FAKT 4MZ3A 2BHZA 5TQ2L 3N9GH 1EAPB 5H35B 3MOAH 3DETD 1ND0A 1JZ5A 1CLYH 2OTUB 1T89A 1D5ZB 3L1OH 5L8KB 4HCRL 5FECB 1K5NA 3M17B 1DVFD 4MAUH 5DD6A 3G5VA 4PGCA 4DN3H 2M26A 5L0QB 4JQXC 5EBLA 5D1XB 3TO4D 1KB5L 2XZZA 3MXWL 4N68A 3QIUD 5C0RH 4JJ5A 1CXLA 3E1F1 3IDUA 1V7NH 1U93A 3KJ6H 4RFEA 2C1PA 4QXTA 2PO6B 5IB3A 3SJVB 2WUCL 3GBML 2NY5C 1XGTA 3WFHB 2N7BA 3OXRA 3F6IA 2H32H 1MVUA 1OY3B 4FQPA 3EW3B 2VSDA 1KJMA 2GY5A 2PW2A 5MENB 5ABDE 3TBWB 1N5AA 1W0YT 4G7VL 4JO1L 5DUML 1BJ1J 2OR9L 3V6FB 1NC4A 1IJ9A 4G8EB 5TDOA 3D39A 4HG4K 5KTEH 1P4IL 4PJGB 2C3XA 1RUML 5LCVL 4OZIF 4G43B 2Z92B 3U4BH 5KJRH 3GSNH 5J12C 4LPUA 1MCWM 4F57L 4KTDL 2XNAA 5H37H 3VWKC 3C6SB 1FGNL 1EA9C 3V9FA 3GO1L 2CH8A 5FF6A 1KJ2L 1BVLA 3E3QC 4NC0B 3CLFH 1S9XA 4NKDB 2DI8A 3DXAB 5B39B 3ULUD 5IP4A 3O9WB 3LY6A 1KGCE 1XF4A 1TZGL 2R15A 3NOIA 3RVXD 5JPNA 4UDTB 4PJAE 2ED9A 1YPZA 2RQ8A 4ZUWB 3U7AA 2EYTA 2JCCA 3QRGL 4OCWH 4Z7NF 5FB8B 4PY8J 3V5KB 4U6VL 4BJLA 1N0XH 5F88A 3QP3A 5ACLA 2QBWA 3MGOA 1NKOA 5E0QA 3PDOA 1C1EL 2Z31B 1INQB 4JANB 3D2UA 4UT6H 4XXDB 4PJCB 1G7QB 1WVZA 5B3JF 4MXWL 3MLUH 4AL8H 4PR5B 1JN6B 1LP9A 3WFCL 4G5ZH 5GS2H 2FD6L 4DFHA 4HKZA 5E4EC 5DJDA 4M7JH 2BDNH 5DJAA 4J3SA 4WI8A 2D7TL 1IKFL 3DVNB 3ZTJH 3ZYJA 5SV4A 3SE9L 1WAAE 1CXFA 1CS6A 1A22B 4XPAH 3U4EB 3EFDL 4AIZA 1INEL 3GSVA 1MVFA 4MJ5B 4LP5A 5JO5A 1XF3B 4N0FB 3M1BB 1NL0H 4Q2ZA 4C83B 1EK3A 4AT6A 4C56D 3QCVH 4JRXA 5EDXA 4Y1AD 2W9DH 2WV3A 1A1NA 4DKEL 5T1MA 2G9HB 4ZUTA 2D31B 2IAMD 1T1XB 4NN7B 3VFTB 2ZSWA 4QLRA 3FHAA 4S1RH 5FHAL 4YDVA 3T8XA 4MA1C 2EXWD 2F54A 2NTSP 4RNRB 5HYEA 3MROA 2VDRL 5I1HL 2AEPL 2M1KA 1IM9D 1UFUA 1XCQA 3KPRD 4K3GA 4WW1B 3GMLB 1KPRB 1JTOA 5T33H 1RZIA 4I18A 4QHMB 3GSWA 4QRPB 2F5BH 3TPUB 3MLZL 3GBLA 4Y19B 2VDPH 1K4CA 4B7IA 4PTTA 2BVQB 3KLDA 1VADA 2B1HL 1X9QA 1MHPL 4KRPC 3WUWA 4NBZB 5IK3A 2WUBH 3MNVB 1SMAA 3WYRA 1I1RA 3QDGA 4XPHH 1U8JB 4K3EH 4UINH 1R5VA 3GSXA 3HN3A 2Q6WA 1QSEA 3PQYA 3BX7C 5HHVH 4ACPA 3MJ7A 3O45A 4CDHA 5DD5H 5KSUA 1FG9C 4KK8C 3VA2C 5KAQF 5C08A 2YKLL 4R0LC 2FHCA 1FYTE 3I50H 4JPWL 2MWCA 1I3VA 4TSAH 1FH5L 1RZKH 5CZVH 3RVTC 3PHOB 2DQCL 4J3VA 3SDYL 4P0DA 2F8XC 2HA1A 1FC1A 5ESVA 1Z6JT 3RHWF 1QQDB 4LPVA 5CSZB 4A2LA 3WHXB 3I84A 4DGYL 1V5JA 3VFNB 1JL8A 3UPCA 1NDMB 3O3DB 1KN2L 3OF6D 1SEBA 2P45B 3RWJA 2E27L 3C5SA 2NY5L 3ARBC 4HZLA 4ZD3H 3HHRB 3JTSB 1DEDA 2UWEA 3RNKA 2AXFA 3VXOA 2Y06H 2FECL 4RMQA 1X5HA 4JHZA 5ISZB 1K8DB 1TQCB 4AENB 5BRZD 3VFGL 3T0ED 4DZBB 3LN9A 2B7DT 1BWWA 1I1CA 1KJVB 4HK0B 5HHQB 4MDJB 4FFYL 5ITBL 5J13B 1FZJA 4OZHB 4ORGA 2P4AB 2X9XA 5BZWB 1DBBH 4XAKE 4L29A 4GXVL 4I0PC 2MCPH 3VG0L 2ICWA 4YXKL 1H3UA 1QFHA 4KTYA 4O58L 3LSOB 5JQ6H 3WS6A 4KUZH 4OF7A 1OVZA 3SGJC 5E2UH 3QQ3A 4LU5H 1SEQL 2V5YA 1FCGA 2F58H 1NGWA 2JJVA 3V52H 3DETC 1YUHA 4RFNC 4LVEA 2ITCB 4WGVB 4LHJB 5EBGA 3MLVL 3MRPB 4I48B 3QG6B 5EUOF 3BKML 1R24A 1X6LA 2B0SL 3TO4C 1MIEH 1MFEL 1A02N 3RHWK 3MFFB 2LAGB 3QIUC 4NDMA 2BRQA 4GBXD 3T77A 1FFOA 4YIQA 4KGJA 3S5LG 3RWDA 1MCOH 4MLIA 4HDIA 4UU9B 5FYKD 1PKOA 2AQ2A 4HIEB 1FZMA 3S3JA 4OFKA 3D3VE 4FZEL 2OBGA 1QACA 2IF7A 1WSST 1GYAA 1AJ7L 1CGSL 3BAEL 3NCYS 5IVXF 4V1DA 3BSZH 3VXUD 1KENH 5B3JE 3ARPA 3RWHB 1DP0A 2H26A 2ZCKL 3UJIL 1W72H 4K23L 5KSBB 3MREA 2AJSH 1NANI 3N50A 4OCLC 5CUSL 1ZSDA 2NY0C 3FN0H 4C55A 5BVJB 4X4XB 2NTFA 5ICXA 5K9JH 3RDTC 1D5IL 1CD8A 2D7MA 1A7PH 3R1GL 3JWNC 5IEKB 1AKJD 5HHOE 1Q38A 1UKQA 1A6PA 1I3RB 3PGCA 5D2NE 3QQ9D 1KXTB 3X13A 3ZKXB 4LLYB 1HINH 1IL1A 2Y72A 2I07B 4KPHL 3TT1H 2EDDA 4JPVL 4X9GA 4IM8A 4O2CA 3FB7A 3BN9C 3STLB 3ULUC 4ONFL 5C0BD 5T3ZD 3QUXD 1FFQA 3AM8C 1L7IH 2ZUXA 4R90L 3GUTB 1RZ7L 2F19H 5IF0B 5IG7A 5HHNA 5LVEA 5DC0A 1C5DB 3TA3A 4D9QE 2FHBA 5D5MF 1MLBB 5TF1L 4ODWA 4NPYA 3EBAA 4GS7C 3W5NA 2FJFA 4NZTH 2NY4D 5KVGL 5F7KC 2NNAB 1IGCH 4L8SC 4PRHA 4Z7VA 3JV5A 3S4SG 5I8OH 1S9YA 1S8DA 1JGUL 5EPMA 4JKWA 6FABL 1JPGA 1G7PB 5JIPA 4LFHG 4TVPH 1XF2B 4OCRH 1UACH 1WEJH 2AEQL 4FQ2L 1U92A 3KYOA 4KUCF 4R7DB 2K9UA 3WD5L 5I1CH 2P1YA 4M6ML 5E2TL 4F7CB 4MD5B 3WO4C 3GMOA 4MQXD 3QEQD 5C6TH 1RURH 4XBGB 5MHSE 2BNUA 1XGQB 1CE1L 3BISA 4OZGE 3O6FD 2V2XB 2ORBH 4H25B 4RQQB 5DHYB 4TUKL 2VQ1A 4I3RL 3EDDA 5IFAH 1E4WH 1WISA 4NKIH 1RJCA 4PRNB 3ZYZA 1XGRB 4H1LA 3BIKB 4QOKE 3BGFC 1ZLUH 2P5WD 5ICZB 4RA0C 5IVZA 3WSQH 5KVDL 4H0GA 3P0YH 3GI9H 4QGTA 1N7ML 2VXQL 2EXWC 4PLOB 5EIVA 1RUQL 1BZ9B 3U30C 4JQVA 4NWUH 4XNXL 3IAQA 1QKZH 1EEYA 3VI4F 1I3GL 3UTTA 1MCFA 4QTHA 5IFJA 3EOBB 1E27A 3MOBL 1P5UA 4Z77B 1DR9A 1CXHA 4XHJD 3TWCL 1E6OH 2IAND 2X1XR 1E6JL 5DXWA 1J86A 5EU7C 1ZGLA 2R4RH 3IJSA 1OTSD 1TTGA 1AGBB 3BP4B 3CMOL 2PNDA 1FYTB 2WM0A 5T3ZH 3QJFA 4LVHC 5CBAB 4QRRE 5D8JL 4QRTB 1AQDB 5EC1A 5IKCA 2DQIL 5GIRB 3BRGC 1RMFH 4FQIL 4D94A 1KFAH 1EJOL 5J1TC 1YJDH 4NRYB 4LHUA 4QRQA 1I7RB 1AH1A 4EDXA 1YEKH 5DRZA 1VSCA 5IB2B 3IFPB 3TIDB 1M7IB 3C5ZB 2MPAH 4S1SL 5D7IA 3NFSH 3OKKA 1NANH 2DYPB 1ETZA 2DAVA 5EUOE 2VITA 5B8CB 4WRLA 1FG2B 3EZJB 4GKZB 1WFNA 1YY8A 1FNEB 1I1AB 2PKDA 3IDNA 1SJHB 5GGQL 4HFUH 4WEUD 4PJ5A 2Z91A 4GAJL 5DMIL 5T3XH 1BD2D 4ODTL 4QKXB 2ZSVB 2EDRA 5BO1H 2VOTA 2VL5B 2R2EB 1QG3A 1HXYA 5DMKA 4Q9QL 2W9EL 3T0EC 3FQXA 2H32A 1HKFA 2ZUSA 5TH2B 4CGTA 4U1KB 3DO7A 4ZXBD 4LLVA 3SKNB 1WWAX 5GISH 1E4XL 1YYML 4P9HC 5F7NC 5EOCH 5HGAA 3GDBA 4POZD 1LO5A 2DQEH 3OJDB 1A6AA 3LKPA 2CUMA 5BVPL 1K6QL 4OFYD 1UZ8B 4G6MH 2E6JA 3MRKB 4YXLH 3EYUL 2Q7NA 4WI5A 2R56H 2VDQH 5L2KE 4XGZB 4LRIC 3W0WA 2BY1A 4XP1L 3QNYB 4J23A 3OMZA 3VRLF 1D3CA 5C09E 4OIIL 3QHFL 5JDSB 1U91B 4OLXL 1H3VA 2GAZA 1CFVH 1C8PA 4J3UA 2GEEA 2V17L 1ZK9A 4ZPTA 3C5JB 1YYLL 3ULUL 1H0DB 4YFEA 3F65A 3KPMA 4IDJL 4GKOA 1AGDA 4EDWH 1NCCH 1A7BA 2BVPB 1JPST 3S37H 4BQ9A 3SQBA 4UIMA 1M4KA 3GI8H 4L8CA 4JKKA 4NJ9H 3JTTA 3QDME 3HNTH 5D1XD 3D3VB 3OAZK 4GRLB 3B2VL 4GBXC 3R8QA 2YD6A 1I8KA 2KL6A 1PY9A 2CR6A 1F00I 3FAWA 3RNQB 5J57B 1DN2A 3Q6FA 1YA5A 1BOGB 2PO6D 4NC1E 3SJVD 2F5AH 1YEHL 4RX4D 5EU4A 4K7PL 2NXYB 3S35X 1G7JA 4YQXH 3GHBL 1QBMH 2YPVL 5ESAB 4DN4L 4XNUH 3HG1B 2UYLA 5FYLE 3ME0A 3T1FA 1QFOA 2EDBA 3L3OB 4BSVB 4E41B 3MCKA 2YSSA 5HHME 2AV7A 5E6ZA 3WNLA 5MEND 2E7LA 3U0WL 2DQGL 3V6OA 4V2CB 1MY5A 3MRLB 5DJ0B 5F1IB 4DUWA 1D6EB 1S3KH 3VD9A 2AV1B 3CPLB 5HHOB 5FOBA 1DVFA 2CKBL 1ZKAA 4YDLB 4P5KB 1ZT4B 4KQ3L 2NYYD 5CMAB 5GRJH 3PWUA 3WO3B 1AGCB 4UQ2B 3RY6C 4X6EA 5CGYD 5AUMA 4LLQA 5T5FL 5HYQA 4QEGA 2BFVL 4P2YA 3FB6A 2VQTA 1CFSB 4UIKH 1FHGA 4ZOEA 1R0AH 5F3HA 3LDBB 1F4YL 4LCWB 3DXAD 3GMRB 1ZHNB 3Q1SH 3OV6A 1T6WA 4OLUH 5I9QC 5KBNC 1Q0YL 4P5TA 3QUXC 3LIZL 3L3HA 4NKMA 3MV7E 4GMSL 3TN0C 3IDJA 2OTWA 2IADB 2V2TA 2FZ3B 3WIFB 2CR3A 2LAAA 3EYOB 2JIXA 5LG1A 2AJZB 4L4VE 1N59B 4L1HA 2QTEA 1HN1A 2NY4C 2Z31D 3C6LB 3DURA 3S36X 1CXKA 5DT1H 4LARL 3U7WL 4PYHA 3O3EA 2K3TA 5E1AA 1Q94A 3HE6B 4WV1B 2G75A 4HCRH 1DBKL 1C16A 5TE7L 5JTWA 5DFVD 4ZNEE 1U8QA 3EDJA 4Z7UF 3KPQB 4JDVB 5TDNA 4D0CA 1BLNB 3L6FA 3MXWH 4OZGB 2V5SA 1T7YA 1TVHA 4OLYL 3RAJH 3EO0A 1K8IB 4OUUA 3QH3A 1QR1A 2YUVA 5IM7B 4X8JA 1A2YA 2XFXA 3WFDL 1CDJA 3KJ4C 4PGBB 2VMFA 4GRMA 2YD3A 1OP3K 2VXTH 3E6FA 3EUUA 4OF8A 1XH3A 5IESL 1CLOL 2FX8L 4M93C 4R26L 4DGVH 5JORA 4YWGH 1Q9KB 2PYEB 2YBRA 1QBBA 4J4PD 3KWWA 1OM3H 2OK0L 4O2FB 1JK8A 4OLZH 1AXSA 4FQQB 4GG6A 4OM0L 3U0PA 4N9GB 3O0RH 2VAAA 1IM3A 3PWNB 4PJFA 3A6OA 2OR9H 2QHLA 1PG7L 4R8WL 4JCLA 5EIIB 1IKNC 1A7OH 2P8PB 3PABA 2VLKD 1V3KA 1QEWA 5TJWK 1OSZA 1MWAA 1V3JA 1FGNH 3DUUB 4WHCA 2NW2B 4PRPD 3BZEA 1MCNA 1S7UB 2OR8A 1PEWA 4QRPD 1YN7A 3GO1H 5KN5A 4Y19D 4POUB 1A14H 4P9HL 3BJLA 5BXFA 1MRCH 3SE3A 4CW1A 4XHJC 1M05A 5BW7A 5HPOA 4UB0L 2X89D 4YHKL 1RUPL 4LKXA 1PX4A 5GXBB 1N5YH 4L8BA 2AJVH 3BP5B 5IBUB 3QRGH 5FYJH 1GZQB 1OTSC 2OI9B 2NZ9C 1KXVC 1F3RB 2IAMA 2X4RB 3G08B 3HPJA 3IXTB 4HJJH 1A3LL 2NW3B 1S7RA 1CGYA 2VISA 3DROA 2YZ1A 5LGHH 1RK0B 5A16B 4BK4A 5SX5K 3L9RB 3PWJB 4YJZL 4U1SB 4X6CF 3ZE0F 5J1AB 3VRLE 4MXWH 4ZO6A 5J9PB 4Y5YC 4G8GE 5HVGB 5C0CB 3WFCH 1NUFA 1UM6H 2FD6H 2ZUYA 4R96B 4AJ0A 1LO0H 2VLMD 1GGUA 2W65A 1IZJA 2F53E 1CGWA 1DBAH 5DD1H 4ZUSB 5ADOL 1T0PB 3LEVL 1CFNA 5FYKL 3SE9H 1ZHLB 4LSQH 1HHJB 2E9WA 1FCCA 2HVKB 3PF2A 4UAOC 4NUJB 3RL1B 3IKCB 4NQDD 2ARJQ 2Z8WC 5ISZD 3CXDH 5KW9H 1N6QH 2B2XL 1FP5A 1JWMA 4OBRA 3CVIL 5TPWL 4HUUA 1MJ7H 4WDIB 3ARWA 5FO9A 3SHSA 3HZYA 5E5MA 1Q9LB 3SE4C 3AU1B 3CVHH 4G6KH 4JFHD 1W72A 5F71A 3DX7B 4DZ8B 5IEHA 4POZC 5DJYA 1ONQB 1SYSB 1AHWC 2GCYA 3WJLC 5HDOA 5L2KB 1U6AH 4P2OA 4U1HA 4JAMB 1NFDF 1G0XA 1H3TA 2AQ3A 5GS1B 1WWBX 2SEBB 3UMTA 1XR8B 3I2CH 5C9JB 1CG9B 1T4KA 4NJAL 1KTRL 4UDUB 2ERJB 4PP2B 1WBXB 5DA4A 4WO4B 4ERSH 4NN6C 5GS0D 1PKQA 5I17B 2CLRA 1FORL 4EN3C 4XCYA 4ZYKB 3QDMB 5F9OL 3WS3B 2X4QB 1QFUL 1GHFL 1RI8A 1TJGH 3DV6A 5BRZA 3C8DA 3MRJA 5EN2A 4J6RL 5C71A 2EYSA 5DZLA 5L0QC 1F11B 4G6JH 5D1XC 4L3EE 4RBPH 3VXTB 1WK0A 3WJJA 2X09A 5AYQA 1T83C 3MV9E 4A6YB 2HG5B 5J6HA 4P4RB 2QQNL 2R4SL 3LKRB 5CHNB 1LO2L 1UM5L 1OAYH 5K33A 2FH8A 3OSKA 2DTSA 4YEEA 3DVGB 1WLHA 5EC2B 2PO6C 1NAKH 1YMME 1QRNE 3ESVF 5LBSL 3V6ZB 3I75B 1L0YA 1JUFB 3SDYH 4M7KL 1D5BA 2A74A 2EE3A 2BSED 2O5XL 4HLZH 3SDCB 2IJ0C 1FV1B 3EFFB 4LAQH 1B0WA 5E2WL 5D72H 3H8NA 4Z7UE 4V2BA 5DZNA 3EDFA 3JWOH 3AC0A 1A6VL 1HSAB 2DQFA 3GJEB 4HPYH 3ZE1E 2DL2A 1N4XH 5DK2A 3C08L 3H3PL 3OB0H 4ELKA 2ADIA 2IPKA 2NYYC 2FSEA 5BZDB 2RCSH 5CGYC 3O3AB 2X4SA 2D2OA 3G5ZA 2Y07L 3O2WH 4LBEB 5IHZA 3VFGH 2X44D 1NGXA 1OQXA 3AXLB 2CGRH 3O2VH 5GGRY 3AFLA 3INUH 3VXUA 4X5XA 3CDYA 4Z0XB 1L9NA 1RZJC 4MNQD 5I1DB 3G6JB 3O9WC 3TYFB 4S1QL 5D7LE 2FDBP 1BQLH 5CCKL 2X7LB 5CEYB 4YAQA 5I74B 4L4VB 3DRTA 4NQCE 2VLJE 3SBWC 1C12B 3C2AL 5JW3H 1XGPA 5L7XH 4BQBA 4K94C 4TRPL 5F72S 1DBMH 1NUGA 1DEEA 3EYVA 3KDMB 3ZTNH 1KNOB 1L6XA 2Z31C 3RRQA 4M3JA 1VFAA 3PJSA 3QI9A 4JFFE 1MOEA 1MCPL 2B4CH 3ES6A 3G04A 1LK3L 1Z0MA 3ZHKA 1LD9B 3N1FC 3T0WA 1ZLUK 2X4OA 1ACZA 1J7VR 2A73A 1BAFH 1ZHBA 3C8KB 5E2VH 3N0PB 3NZ8B 1JV5B 3BDYL 4WTZG 5CD5D 3T4YB 3VXRE 1QR4A 5BCAA 5C0BA 1FNGA 1FO0B 3S98A 3CUPA 5ANME 1KT2B 1P84K 4C4KT 1CIDA 1GL4B 1UVQA 4XMLH 3AREB 1NCBL 4FZEH 4GW1A 3WLBB 3MRGA 1N26A 3PV6B 3TBSB 3P4MA 4Y5XB 4X6CE 1FZKB 4P5MB 3QUYB 4RFOL 4ZQKB 1BQUA 4KJYA 3NCMA 1FFPB 1LEIA 4Z7WF 5B21A 3OR7A 4J4PC 3QA3B 4JVWA 3QCTH 5FGCE 1KIPB 4ALAL 3PWPE 3C87A 2XKUA 4NN7C 4TUJB 5CUSH 3LPWA 5F6HJ 1J05B 3OZ9L 5KS9B 3V79C 4HUWA 1F2XK 1B90A 4QXGL 3MO1A 1ZLVK 2NPLX 3LEYH 4WCYL 1FRGL 3VXQA 4N90D 5KVEL 4U7MA 5I1LB 3SDXF 1I7UB 1WIOA 2ED7A 2FATH 3Q6GL 4X9IA 5FDWB 3O6FA 5DEGB 2DJ4A 4NOFA 5AWNL 2BCKA 4LQ1A 1CZ8H 2HN7A 2XKNB 1E4XI 1YECL 1XMWA 4U3XA 1R3LB 5HI5D 2I24N 3LZFL 5TGBA 1OF2B 4ODSL 3E2HB 3ZKSD 5GZOD 1YEEL 5IJKA 4JR9H 3CZJA 4HGWA 2HFEB 3ULVF 4IMKA 4G8GB 1F2QA 5DJ8B 4X6BB 1N3NA 4CU8A 1BBJA 4MJ2A 4XCEB 2WWMD 5EU3A 4Q7DA 3OGOE 3OHXB 3L3DA 4RWYL 3B3IB 4Q6IA 1OQOA 3DWTA 2BNQE 4KDTC 3P2TA 2AKRB 3X3GH 1IGYA 3DX9A 5CBEA 4EXPX 1W0WA 5HSFA 5I8EB 3ZL4L 2R2HB 1MAML 4XMPL 4M6MH 3C5ZD 4KU1A 3NABH 1NFKA 3FQNB 3RA7H 1I8MB 2DYPD 1T0MB 3GMPA 3NTCH 3B8SA 2F74B 3L5HA 5IV2B 5MERA 2X70B 2P5EE 1FAIH 1T1WB 1YPZF 1W8NA 2AK4A 4BH8B 1UM4L 3P3YA 4PJDE 1I1AD 1KPUB 4JDZB 3MRHA 1JYNA 1RIUH 1OPGH 1YEFH 3L5XL 5E8NA 2ARJB 5CILL 3TZVA 2UZIH 2FL5B 1EJ6A 4FQLH 3RWGB 5I15L 1TQCC 1DLFL 3NIDF 1P2CA 3RWEA 4XAKD 2D0FA 4MAYB 1QLFB 1ZVSA 4YHNB 1HKLL 1MIML 4HS8H 5HGHA 5JMRA 4IMLA 2HKFL 3QNZA 4NRZB 3UJJH 4ESKA 4HS6A 2JJTA 3P30L 2FGZA 4PRIB 5E7BA 1FYHB 1FZOB 5GGVY 2K7QA 3ARSA 5DVMA 1I3GH 3OTTA 1U58B 3SOBH 1HXMB 3W2DL 3RVVD 4JHBA 2CIKB 15C8H 3CSYB 1K2DB 2YPLA 5D1ZB 4X6FA 3W11C 1RZJL 1WV7T 3F62A 4U1GC 1MF2H 4XWOC 3VFSA 3UYRL 1IGIL 4L3EB 1E6JH 4DVRH 2WMPA 1I9RL 3CFBA 3T08A 3CNKA 4ZXBA 5C7XL 3BW9B 4U1JB 3W9DB 1F4HA 3PNWA 4K94L 3D3VD 1ZTXH 25C8L 1I1FB 4GRLD 3BUTA 1YMMB 4F7MB 4H20L 3TCLA 2DQIH 3QCUH 1HHIB 3W82A 1LMKA 1A3QA 2ZCHL 2NXYD 3EJZD 4F9PA 3HG1D 1H3GA 4I3SH 4LDLB 4OD2B 4PJBF 3H9SB 2P8MB 1EVTC 4R4BB 5HD8D 4E41D 2HT3D 1U8KB 2WBJB 2GJ6E 3U9UA 5DK3A 2LVCA 1EBAA 3U1SL 3GMQB 1NJ9A 3DX8A 5K9OB 5EU5A 1UCBH 1KCVH 1NEZG 3HI6H 4WNQB 5HHOD 2DN7A 1P4BH 3MBXL 4GRWF 1RFDL 1M6OA 3TNMA 4P3CH 5I8KL 5J0BA 1KIUA 2ADJA 4Q97A 4GAJH 2D0HA 2MTPA 3KXFE 1A64A 1FNSH 1X5ZA 2CMRL 4GMTH 4ODTH 2KPNA 4LQFH 2EH8H 3PP4H 4LCIL 3MLWL 3ZKXC 4WW2A 2BOCB 1BF8A 1EO8H 4FQJH 5D7LB 3FTGA 4FXKA 5DYOA 1IC7L 2OZ4L 4NQCB 2VLJB 1JBJA 4LCWD 5GQBA 5I1AB 3NIGF 1EHLL 4DKDC 1NSNH 2XWTA 2Y4SA 3BP7B 5BVPH 3MV8B 3WCYA 4EOWL 4LEOB 2W60B 3STBA 3N1MC 4NNXB 2FJGB 3ARDB 5DQDL 3KYMB 2HT2D 3HRPA 4UTAH 4JFFB 3Q48A 3OX8B 4S1DC 1LDPH 1NAML 4JG0H 4XP1H 3RP1A 3C6LD 3MRRB 4YBLB 3SDXE 4D8PB 1Q1JH 3QXTA 3UTZB 4OCSL 2R8SL 1R5WB 3OJ2C 2ILLA 4NQEB 1IAIM 3HE6D 4HUXA 4JFOB 2ARWA 4N8VB 3QHZH 2G2RA 2VKWA 4RMUA 4U2YA 3D1MC 4W4OC 4ODVL 5ANMB 2D7QA 1I9JH 3I6LE 3RX7A 5GSRB 3NAAH 5CD5C 3HUJA 3TGXA 2F15A 3U46B 4YHIB 1WC7B 1TVBA 1MNUL 2B5IB 4XH2A 1DDHA 5T1LA 1Z9SA 1NQBA 4XRCB 4X9BA 3LH2H 4HBCL 4TSCH 5IMLB 2I5YH 1ZLSL 2X1OA 1I7ZB 1KELL 5FGCB 2VUYA 3PWPB 3V6BR 1T6VN 2LVEA 2R1XB 1ULVA 3UX9B 4H26A 2VXVH 2PYED 3CLEH 1E0OB 1UB6A 3U0WH 4PR5A 5F7DB 2A38A 3HC4H 2ATKB 2W0LA 5FA3B 3QDAA 4P46B 4RISL 2BZDA 3IS0X 4BQCA 2QHRH 3MR9A 1EGJH 4ETYA 3UBXI 3ALXA 1T20B 1YPZE 4NO3B 1JF1B 5DGRA 3BVNB 4KQ3H 5DURB 1MHEB 1PYWA 1I8IB 4ZTOH 2NXZC 4YNYB 1WTLA 1FFNA 4X4YB 1K85A 4HBQA 1G9NH 3C60B 4FQXB 5EUKB 5FGBA 3L5JA 2BVTA 3NIDE 4LEXL 4DUXA 5DRNB 4YPGB 4ZS7L 3UP1A 5K9QI 1NCTA 3T0DA 1LP9E 5HI5C 2O61A 3CVHA 5I75B 1WCBB 1Q0YH 1T04B 1FGVH 3BQUB 3LIZH 5C0GA 1BP3B 3BKCH 2C3HA 5LGJA 1WZLA 1IBGH 3ZE2F 5D96C 2V9QA 4R7NA 1JE6A 5HYJB 4LLWB 4RNRA 2C7UB 4IS6A 4OFPA 4L8DB 4DJMA 5DTFB 3R8BB 5D2LB 2VLKA 1QO3A 2WWMC 3EOAA 3GMLA 2P8LA 4JGMA 4Y4HB 1CTNA 2BX5A 1Q0XL 2VH5H 3OR6B 5C0CD 4PRPA 5JOFB 1IAKA 1LEGB 2A9ML 3KPLA 3WHE1 4JRXE 4J7RA 4QCIB 5DEFA 5ACMA 4Q9RL 2P5EB 5FUOH 3T2NH 3C5ZC 4CADA 1T03L 2EDTA 2YK1L 3L3IB 4XI5C 4PJDB 5IR1A 4KKAD 1ZWIA 1PZUB 5CEXA 4NQXB 5B8CC 4OLYH 2CRYA 2ICWJ 1A9BA 1T5WA 1G1YA 1I1AC 3MV11 3MUGB 5DQJB 4ETQB 4S0TD 4MA3B 3JWDC 4RCAA 5C8JB 1OWRM 2VN7A 2FX8H 1S5HA 3O11A 3IFOA 1EXUB 1T22A 1P7KB 1AXIB 1CL7I 2OK0H 3F12B 4PJBE 4QHUB 3HC0B 3PHOA 3UBXG 2GK0B 1B4JH 4OQ1A 4U49A 5DK0B 4X6DF 1ITBB 2FO4A 3PIQB 2L0DA 5GRUH 4MJ4A 4PJHA 3EYFA 1L7TL 4N0YL 4HUKB 3FRUA 5DMGC 4WWKB 2EIZA 4GRWE 4I0CC 4FMFA 2JB6B 3PQYE 4JO2L 4TPRL 5HHXL 1JNLH 1IVLA 1SBBA 3CC5B 1FE8H 2N1KA 2NLJA 5C08E 4WO4D 2XA8L 1QLRB 3EO9L 5IB5B 4NQDA 1G7MB 4JFXA 2ZUTA 1DZBA 3NFNB 3QDMD 4LSSH 3WIIH 4AEHL 1MJ8L 3NIGE 5DUBB 2BXZA 2R23B 4MJ6A 1P9MA 2P48B 3BE1L 2VTFA 4NHCH 4HK0A 1RVFL 3MACL 5FKPB 1EV2E 4WFGE 1MCRA 4YBQD 2GTZA 5J11B 4GRLC 1WBZB 5T1DL 2D7NA 2W92A 5AYUL 2IMNA 5BJTB 4EBQH 1GCFA 3HAEB 4QT5A 3IVKA 4GQ9L 1JNNL 2UWEE 2GJ6B 2NXYC 4U1LA 1KF9B 2AW2A 2VLRA 1EO5A 1OLLA 1OAUL 5DVOA 4U0RB 5FV2A 1Q8MA 1B0RB 5IOPA 2C3VB 2EICA 3SDCD 1WTGT 2YD4A 5HD8C 4LCUB 1NMBL 4H5SA 3F6LA 2R0KH 2FX9H 3ZDYE 4QXUH 5SWSD 3KPNA 3MNWB 1JRHH 4U0QB 5CEZD 1UH4A 3THMH 1O0VA 3QG6A 2CQVA 4M48H 4XXCA 5EWIH 4EUPG 1FL6B 4RWHA 1RIHH 4JEGB 4NM4L 3EGSB 3B9DA 3HI1B 4YDLC 2EE6A 2JELL 4JKMA 3PGFL 4K3DH 1FSKC 2VDNL 3EJYD 1TVDA 4PYGA 1ND0B 1QZ1A 3OXSA 4ZTPH 1QPPA 1F90L 4LLAA 1NMAL 3BH9A 1OB1A 4OUOA 1K5NB 1NBYA 5DD6B 3G5VB 4PGCB 1U3ZA 4JHWH 5HDBF 4FTVD 1QSVA 1B6DA 4L4VD 3WNNA 2ZG1A 2GW5A 4M8QA 4JJ5B 5D7IF 1JF5A 1ZLWK 5A40E 4F8TA 1JPTH 1U93B 1VB9A 3BD5A 3UTQA 1Y6NR 4RFEB 2C1PB 2XTLA 4QXTB 5IB3B 5CJQL 2W0PA 1DFBH 1XGTB 1GGYA 3VFVA 3ROLA 2ITDA 2XPGA 2BRRH 3OXRB 3F58L 1MVUB 1ORSA 1FORH 1J1PL 4KXZI 3U6RA 2VXSH 1KJMB 1I8LA 3CSBA 3HE6C 4WV1C 3PHQA 4V1DE 5HYFA 5LQBH 1AI1H 2PW2B 1MEXH 3Q0HA 1N5AB 4XVUC 2Y23A 3DUHA 3X3FL 3IFNL 3I9GH 1NC4B 1J1OL 5TDOB 3D39B 4MNQA 2A77L 4P3DA 2VC2L 5EO1A 3ZE2E 4MQSB 1MY7A 2EECA 2C9AA 2XNAB 3ARED 4KKLD 5I1IH 1GOHA 2PTUA 2ZUUA 4P59L 4DKAA 1NEUA 2RBLA 2IH3A 4EUPH 2ZCLH 4HC1H 5IHLB 3PL6A 2W0KA 3V0WL 1C5CL 5FF6B 4OIBA 5HYIA 2KBGA 1BVLB 4ZFGH 1S9XB 1CL7H 4PJXF 3EDKA 1S7VA 1F5WA 3HKFA 1XF4B 4JM2A 4OV6F 5JPNB 4LSTL 1YPZB 1G7PA 2EYTB 2JCCB 4YGAB 1EZVY 5CJOL 2CD0A 5HJ3A 5F88B 5E99H 5DMYA 3MGOB 3PDOB 3JWDL 4FP8H 5CEZH 3CSPA 4MD5A 2DQDL 1RU9L 4OQTH 2IPUK 12E8L 3FT3B 4MX7A 1JPSL 1WITA 1J5OL 1IC5H 1LP9B 5DUPL 2Y7QA 1ZANL 5AZEL 1MFNA 2O93L 4Z7VE 4NGHL 3KHQA 4RAVA 1CDYA 5DJDB 4XVTH 2QQKH 4OT1L 1U3HA 5I76A 3B5TA 5DJAB 3K46A 2OCFD 2XTJE 2AJUL 3CSGA 4P4KA 3E3QE 3H9HA 2DM7A 1NLDH 3UO1L 1A5FL 4AIZB 1HILA 3FT4A 1V8HA 3GSVB 1JI1A 3E0GA 4G8GD 4ODBD 4O02L 5DF0A 5JO5B 4Q2ZB 1KCRL 4AT6B 4JRXB 5DD3L 3AVEA 2MNUA 1A1NB 1UEMA 1J12A 4XNYH 5T1MB 2Q8AL 4XPBL 5F1OB 2FJHA 4ZUTB 4KROB 1P6AB 2ZSWB 4KZDL 4YDVB 2DI9A 4LL9A 3T8XB 4P2QD 1IZKA 4EXKA 1TXKA 4MCZA 2F54B 5MEOA 5IWLC 3MROB 5L8JB 3QISA 5FYKU 3CAFA 1XCQB 4NO0A 3EDEA 2J2ZA 3GK8L 1BFOA 5IFHL 1VA9A 4YHML 2YN3A 4BM7A 4I18B 3BIAX 1MI5E 3GSWB 1UWGL 1GGTA 5HDQH 3WIHH 2IBGA 2VXUH 1BZQK 2BNRA 2DQTH 5E7FA 4OZFH 1K4CB 1QLEL 2J6EL 3UTTE 4PTTB 1GGIH 1VADB 3DHMA 3O6KL 3WUWB 1HNFA 5IK3B 4IRJC 4HH8A 3QDGB 4LLDA 4MAYD 1JYWA 2CDEA 1R5VB 3GSXB 4GRWB 2Q6WB 3FOMA 1QSEB 3PQYB 3MJ7B 3O45B 3KYKL 3WFZA 5KSUB 4FABL 1HI6A 1OAKH 5GS1C 1DUYA 4QXGH 5C08B 2P42B 4P57B 3WN5B 3ZYIA 3ULUF 4PRID 2J4WL 1FRGH 2V5RA 3VGDA 4AEEA 1BFVH 4NSKA 2ERJC 5E8DL 35C8H 4WO4C 4ODUA 1UQSA 4D3CL 5D1ZD 3FFCA 4PV9A 4OLWH 5ESVB 1HHGB 3DUSA 3ILPA 4POYA 2GKIA 4XP6L 4L3ED 5KVMC 1IGFH 4TVSa 1BGXL 5HDBE 3QO0A 4QO1A 3IDXH 4DTGL 1KB9J 1SEBB 4YBQC 5C0AA 3IU4L 4DUVA 3RWJB 5D7IE 3C5SB 4NC1C 1YMMD 4HZLB 3WFEL 4BFBD 4YDKH 2UWEB 3FN9A 2ZKHH 4NZUH 3RNKB 5B39G 2AXFB 5F7LB 3VXOB 2LFGA 3DHJA 1LNUB 3RBSA 1B2WH 3MLXL 4U2ZA 3KPOA 2XWBA 1KN4L 2HYMA 4RWYH 2OP4L 1I4FA 2KQMA 4PJ5E 1ACYL 4R4FH 2EH7H 2VDKH 1FZJB 5C1MB 4OD1H 3H9SD 1JGVL 3QWQB 3SDCC 4ORGB 3V7AG 2WBJD 2DQUH 4HPOL 5E8EA 4L29B 3QIWA 4K7PY 1OCWH 3MRMA 2ICWB 3WDJA 4YO0A 5LJYH 4JM4L 4MA7L 1I9IH 5J4MA 2GFBB 2GTWA 1QOKA 3EYSL 3QQ3B 4OGXL 1WZKA 4UT7L 1D5XA 5MEPA 1D6VH 3FONA 1NGWB 2BC4A 5D7KE 1A9EA 4XP9H 5E03A 1OGAA 3EJYC 3W0WE 1YUHB 5I15H 3RNQA 2X4NA 1DLFH 2A6JA 2O5YL 2R1WA 3T1WA 4I13B 4H8WC 4PJXE 2H3NA 4R97B 3I6GA 4NQCD 2VLJD 4HFWA 3QR2A 5EZOL 5HPMA 1R24B 2ADGA 5EO9A 1KCLA 2YMXH 3MZGB 2XQBH 4KVCL 3MV8D 4NDMB 5I74C 4E41A 3T77B 1FFOB 4NCDA 1ZEAH 2OL3H 1EGJA 2KKQA 2XRAH 4YIQB 3RWDB 4HDIB 1FZMB 1HZHL 4QRSA 4AYFA 5K59F 3CPLA 5JW5A 3P73A 3QG7H 4V1DB 5ALCL 1GIGH 1I7TA 1MRFH 5DHVH 2BVYA 4P5KA 4HIXL 2H26B 2VZ1A 2Z9TA 4NQED 3VFMA 3R06A 5IW1A 3ZLQC 5C0EA 3MREB 3ZO0A 1ZSDB 4ODHL 4PJIA 3OAYH 2NTFB 4JE4B 5ICXB 1DUZA 2V7NA 4NQUA 2Z35A 4KHXL 4OJFL 4QWWD 1UB5A 3AREC 4KKLC 1CLZL 4U1IA 3FO0L 3PGCB 4L4TA 4M7LH 4N0UA 3X13B 3WIFA 3WKNA 4Y5XC 1IL1B 1XGUA 3QUYC 5TDPB 2HH0L 3PWPD 3C6LA 4C59B 4GKSA 1NGQH 3FB7B 3AAZA 4O2CB 3GJFH 2DOCA 5CINL 2JLLA 2EXYD 4IHOB 3BPOB 4RAHA 2DS4A 4WUUA 4P46D 1R5IA 5IG7B 5HHNB 3BXNA 3TA3B 3IU3A 4FS0A 4GT7A 4ODWB 4NPYB 3V8OA 3QQ4A 5I8KH 2DRUA 2FJFB 5DURD 4PRHB 4Z7VB 4YEFA 4O00A 1X6NA 5B38A 2AJXL 4LDEB 3EOYG 5DGQA 3MLWH 1S9YB 1S8DB 2EDJA 4RZCA 3KLHC 5EPMB 4JCMA 1JPGB 4XC3L 4D9LL 3C60D 5C0NC 2XTJB 1IC7H 3DECA 2YEZA 1U92B 1FIEA 1A4KA 3KYOB 2E8YA 3BKYH 4LVNB 4R6UA 2YOCA 3G9VA 1CF8H 3CFKA 4LPCA 3BQUD 3GMOB 1H3XA 4CUCA 4YE4L 3E2HC 5DQDH 3TBTA 2AGJL 2BNUB 4JDTL 2X41A 3L5WA 5CIPH 4ELMA 3ULUE 3PP3H 1NAMH 2AJ3A 3WLWD 5HYJD 3STZA 5IB1A 5GJSL 1FBIH 2VQ1B 1H15A 2C4FU 2FRGP 4GAYA 4Y4HD 1TZHA 1AO7A 4OGYH 5DC9B 4H1LB 4MB3A 1RK1A 2H2PD 3FB8A 1S78D 2P5ED 5IVZB 3OKMA 1Z3GH 3ZDXF 1HIMH 5JA8B 1IE5A 4GG6E 4A6YL 1KTKE 1YNKH 4PJFE 3ARFA 4RGND 3ZSTA 5FYLL 1CE6A 3UTTB 4K8RC 4OLEA 4M6NH 4QTHB 4QHNA 5IFJB 4WUKH 2V9RA 3MA7A 2NY6B 3VRJA 1E27B 1GAFL 3RJQB 1MCHA 5C86A 5EZIL 4AIXA 3VGAC 1EHAA 3TH3T 4LSPH 5J1AA 4HWNA 1MQKH 2RFXA 1BEYL 4TOYL 4MAYC 5E6IA 1ZGLB 1CVSC 3FJTA 4GQPH 1SY6H 1DQLH 4KDWA 5JLZA 4K7FA 5JXEC 3H0TA 1CGUA 3QJFB 4G7YL 5F1NB 3SCMA 5EC1B 3A6CH 2YXMA 4WWKD 2VZOA 4LMQE 4ZUSA 5IKCB 1UA6H 3QXUA 2D7OA 4I0KA 2HFFA 3H42H 3K0WA 5L9DL 4PS4L 4LHUB 4H8WL 3LAFA 4QRQB 4EDXB 5DRZB 3OKLA 4YDIL 5D1ZC 2NX5B 3NCYP 5DZOA 1QFWM 4B0MM 5FYJU 4ZFZB 6CGTA 2AAVA 2WNGA 2GUOA 3QJHA 3MUZ1 4PG9A 3OKKB 3VMNA 1ETZB 4KVNH 5IGXH 1YY8B 4NBYB 4DZ8A 1EHNA 4F7TA 1VFUA 1C5BL 3IDNB 4OAWA 3RY5A 1QSZA 4PJ5B 2Z91B 4ZODA 5D71L 1A6TA 4DKFH 5K59E 5EU7E 4MLSA 2SEBA 3LPFA 1F4WL 4JFDA 1HXYB 4W70A 5DMKB 3MNZA 1F13A 3FQXB 2H32B 3RX8A 2CXKA 2GJ6D 5J8OA 3DO7B 4BSJA 4LLVB 4Q9RH 3LHPH 4TNVF 2H41A 3O8XA 5HGAB 1LO5B 3CFCL 1A6AB 3FO1A 3LKPB 4PY8I 2WBJC 1OAZL 5HGDA 4ZYKA 1FO0L 3UTSA 5FO7A 5LWYL 5F9WC 4G3YL 4RA3A 1YEJL 4KH2A 2Y6SC 3S3SA 4JZOA 3TJEL 3GSNB 5I18H 3W0WB 5KVFH 1EBPA 1W2KT 1FVDB 1F4XH 4HKJB 2GAZB 4XCCL 1XZ0A 4EUPA 4HC1A 4R2GB 3LKRA 4ZUVA 1GC1H 1J11A 3A6BL 5DA0B 5LGKA 3KPMB 4KY1H 3TH2T 3K4DA 1PKQE 3K4ZA 4XHQA 3U83A 4X0KA 3I75A 4UIMB 4CN4A 4L8CB 2IBZY 2D0GA 3JTTB 2HMID 3EOTL 1MFCH 4PJ8A 3FO2A 2A6IA 5BRZE 4Y5VA 1FV1A 2F8VA 1CGXA 3QPQC 2HLAA 4FFZH 1I8KB 1XGYL 3ARDC 4JG1L 1BECA 2YHGA 3Q6FB 4MA8H 5SWSA 2W91A 4CVXA 3VDAA 4JPIA 3QZWG 3QUZA 5EU4B 4YBLC 4MHHG 1G7JB 4OQTA 4UILH 4MWFA 4OB5H 1WFTA 5JHDD 2UYLB 3BRDA 5CJ5A 3T1FB 4DQOH 5JHLL 3BT2L 3UDWA 3MCKB 2YSSB 4TULH 5E08L 1YDPA 2AV7B 2VZVA 5JOPD 4DWHA 4NZRL 2E9IA 4RMVA 3QSKB 1NC4D 5FOBB 4TNVK 1DVFB 1JGLL 3D39D 3NCBB 2FX7L 5I1DA 3G6JA 3CDCA 1ERNA 5T1DH 4FTVA 3PWUB 4OKVB 4QWWC 2B5IC 3E6HA 1TQBB 4W6YB 4LLQB 5AUMB 4E0RA 4M6OL 4JPKH 5HYQB 3FB6B 2AXGA 2H6PB 2FBJH 5F3HB 1RIVL 4CJ0A 3I02A 3N85L 4UNVA 2YD8A 3AB0B 1FJ1A 4K2UL 2BY0A 3LS4H 4P5TB 5EOCJ 4NUGH 3VXUE 5C07A 3L3HB 4XMKL 2EXYC 4NKMB 4M6AA 4P46C 3IDJB 2OTWB 3ZDXE 2V2TB 4K8RL 4LPTA 3M8OH 2JIXB 1J1XL 1JV5A 3FMGL 3NA4A 4U3CA 5KZCB 4JO4L 1MFDH 3DURB 1ZA3A 4LASH 3SO5A 3WIHA 2DQJL 3KS0H 4OZFA 5E1AB 1Q94B 2G75B 4OSUH 2MQ0A 1FVCA 3C60C 4CVUA 3PV6A 4FQXC 5GGSA 5E24E 1C16B 1BJ1H 1OTTD 2AXHA 1U8QB 3HE7A 1HSBA 3S35H 3ECBA 5TDNB 4HMDA 3F7RA 5I75C 3BQUC 4D0CB 3L6FB 4XPGL 5C0JA 1S7QB 3GMNA 3V0VA 1TVHB 1KYOK 3EO0B 3QH3B 1QR1B 3ARYA 2DBLL 4X8JB 4XVSH 1SQ2N 3SGKC 5EORH 1A2YB 2XFXB 3D87B 4JHAH 4GRMB 5C0BE 1WUNT 1YEDA 1A4JA 3E6FB 3WLWC 1EZVX 5T3ZE 2LE9A 1XH3B 4GAGH 1ORQA 3GGWA 2I9TA 5JORB 4MQ7A 4Y4HC 3C9NA 8FABB 2J8UA 4Y2DD 1P1ZA 1Q72H 2YBRB 3KWWB 1BOYA 4JY5L 3ZSSA 1JK8B 1AXSB 3IDGA 4KQ4L 4EEEA 4GG6B 3U0PB 1EVUA 2H2PC 2KH2B 4KROD 3DMMA 1S78C 2VAAB 1IM3B 2VAJA 4PJFB 5L6YH 4M1DL 4NO5A 5M95B 5DFWH 1J1OH 1A0QL 2E5EA 1S9VA 2F54D 1NBZB 3PABB 3HNVL 2FR4B 3T2OA 1IEAB 2NY3B 3B9KA 1QEWB 43CAA 5JOEA 4WY7H 1OSZB 4KK9D 3BZEB 2HVJA 1YEIH 1YN7B 4KC3B 4EN3A 5KN5B 4XP4L 4XZUB 3GM8A 2XI9A 5BXFB 4RRPG 3TO2A 2WWKT 4QXWA 1QHPA 3MLSL 4CW1B 5T3XE 4XCEA 3M45A 1M05B 3S36H 2GSIA 4JQIL 5IBLD 4MQTB 4LKXB 4D2NA 3QDGD 4U7KA 2C4XA 3PE9A 3IRPX 1UJ3A 4Z5RA 2Q86A 4KRMB 3K1DA 2DTML 4JRYA 5FM4A 3S8WA 1QSED 3HMWL 2IAMB 3HPJB 3MJ9L 5I8EA 4BFIA 2J1KA 1I85C 1S7RB 4P2QA 3UZQA 1ZA6A 2VISB 3DROB 5C08D 1AGEA 1URLA 2KUTA 4FXGA 1GPOH 3RZCA 5IV2A 1AE6L 1DL7L 3VDCA 1ZAGA 1DQTA 2R29L 1A21A 1WBYB 4DAGL 2Q3ZA 1UXWA 1VPOH 3FZUD 4K9EH 3GSOA 4MS8D 3VXSA 1O7VA 2ADFH 2H1PH 4OT1H 3CK0L 2W65B 4XC1H 2OXHA 3AS1A 4WFGD 3RUGA 4PJ9A 1OT1A 2DDQL 2PW1A 4JO3H 1CFNB 2GIYA 3DBXA 5I1GH 2MQCA 3P0VL 5EOQL 2OL3A 5J11C 4U6TA 4UT9L 4PG2A 4PD4J 4EZMA 2EDYA 3V95A 3OKOA 4PRBA 2AK4E 1JWMB 4MJIA 5DHVA 4HUUB 3MODH 2MMXA 1A3RH 4Z0BL 2EDXA 5FO9B 1NFIA 1P6FA 3HZYB 5E5MB 1NCNA 3T0BA 5IEHB 4U0RC 4WHYH 1W72B 2DJUA 1T2XA 5DJYB 2GCYB 2OYPA 4HXBL 3WNKA 1MHHB 4D0BA 4P2OB 5GJTH 2W59A 1T4KB 2W1NA 1PW3A 1NCWH 1BPVA 3DV4A 1LO4L 5EZJA 5D1QA 1OW0C 1PKQB 1BIHA 4I4WA 2CLRB 1SJEA 2WQRA 4XCYB 3SE8H 1JHKL 4PV8A 4Z78A 5F3BA 1T89C 3S7GA 5BRZB 3MRJB 2IG2H 3GJFA 5EN2B 5AD0B 3NBNA 2EC8A 2EYSB 3U9PH 1X5GA 3OAYK 4IRZH 2HMIC 1AXTH 5EFIA 2J12B 3IAPA 3K7UA 1MUJA 2MQ3A 5GGUA 4U6HA 3RI5F 2PYFA 4UI2A 3SQOH 3QXVA 2XZQL 4K7PX 2DQHH 1A7QL 3ORJA 5TE6H 2AABL 5FXCH 1QNZL 4PREA 4ZAKA 3GRWH 3T0VA 3BGMA 3NH7L 2R39A 2VDML 3QEGH 3GJFK 1D5BB 2A74B 4GSDL 1U0QA 3J7HA 2VYRE 4YHZH 3CX5K 2OSLA 4NN5B 5EIQA 1P5VA 3BPNB 2HLFD 2FLRT 2M2DA 2BY2A 5DJZA 1DBJL 1UWEL 2DQFB 2L7UA 1G6RH 5C0DA 4JKPH 2P7TB 2A9NL 4QNPF 2HFGH 3Q3GA 5DK2B 4KI5D 4ELKB 2ADIB 2IPKB 2FSEB 5CIPA 3CX5J 2QV2A 3UC0L 1NAMA 1F4AA 3ZT7A 1OARL 2VR5A 2FJGA 5HYSG 1HNGA 3G5ZB 1J0YA 3QXWA 2QL1A 2OP4H 5IHZB 3RU8H 5IBUG 1NGXB 1C7TA 5FIEA 2R0WL 4QTIL 1RULH 3MXVL 3QUMH 4OF5A 3VXUB 5F1SA 2DIAA 3MRRA 4X5XB 4PLNC 2X42A 4OTXH 4XP5H 2PR4L 1FLTX 4YAQB 2DLFH 1JZ4A 1XGPB 4XVJL 3TA3D 4FQ1H 5GGRB 4HQQH 3EHBD 1DEEB 3UYPA 3EYSH 5MENE 2NY2C 5IHBA 1VFAB 3PJSB 2EIEA 3B2UD 3QI9B 4PRHD 5INCA 5CJ8A 3RI5K 3QO1B 4Q58C 3HNSL 4CU6A 1T2QH 4NCC2 3ES6B 3G04B 2X1WL 2XTJD 3VXNA 2X4OB 1A6WH 4PGJA 4PJEA 1OTTC 2A73B 1NMCB 1VERA 1FC2D 4AEIH 1BBDL 1SY6A 4KVCH 5C0BB 5F96L 1FNGB 5BV7C 3CUPB 1F6FB 2FGWL 1UVQB 4GW1B 3DXAE 3X17A 5FYJE 3OWEA 4ZOCA 2WLZA 2R2BA 3MRGB 3FQTA 3P4MB 4BQ8A 4M43L 1G6VK 2YRLA 4PRAA 4WI7A 3RTQA 4PB9L 4KJYB 1LEIB 5CP3H 4TNWF 2J88L 3OR7B 5I16A 1HCVA 4K3JL 4YNYA 2YWZA 4OZ4A 4KROC 4PBVC 2GSGA 4X7SL 1BQHA 1PG7X 2Q20A 4HUWB 4Y16A 3VW3L 4KHXH 3LD8B 3MO1B 4L1DA 4LIQH 1XF5A 3V8CA 2D4DA 3BO8A 4RAUA 3UTTD 4RDQG 5F6IB 4OD3H 5KSBF 5E9DA 5HI4D 4I18C 4KK9C 1E4JA 3UTOA 2NY6D 3O6FB 2VABA 1KEGL 2HH0H 5FA4A 1B88A 3DTXA 1T1YA 2I26N 1A6UH 5FAAA 2Y5TA 2HN7B 3DVFA 4ZFOA 2BERA 1BIIA 4NWTL 5IBLC 5TGBB 3N06B 5FV1L 2VZ3A 2VB5A 4JZJA 1BJ8A 4OFDA 1FNAA 3ARTA 4HGWB 2EKSA 4WJ5B 1IT9H 2DWEA 3MRBA 1VGEH 2GT9A 1N3NB 1BBJB 4ONGL 1GOFA 5EU3B 5GPRA 3L3DB 4C58B 3WXWH 2X4TA 4OIAA 4NHUA 4Q6IB 5DLMH 4LHUD 5I73B 4PP1D 3FZUC 4D9LH 5CS7A 4D0DA 4TUOA 1AR2A 4X9HA 4MS8C 5C8JA 2NX5D 2VLKE 1IGYB 3D69A 3K8KA 4P23A 5CBEB 1W0WB 1YQVH 5BMFL 4OCYH 4H0IA 3BDBA 3FCTA 3V4VL 4PRPE 4TNWK 3GMPB 4Y19E 1ED3A 5MERB 2W07A 1C08A 1IAIH 2C26A 2DIJA 3RVWC 2OR7A 2QSCL 2EZ0D 2AK4B 5GHWH 1IQDA 3MRHB 4M1GH 5IVOA 3LS5H 1WAAF 4PJ5D 1XCTA 5E8NB 4M62H 5GRZA 4F2MA 3TZVB 4JFZH 4WWKA 2PXYA 4X99A 4O9HH 1E4KA 4TYUA 1G0YR 2AJYL 4PJAA 3MRDA 3RWEB 1VFBA 2K7PA 5HGGS 1JFQH 1EMTL 1ZVSB 4YFDB 1INDL 1AD9A 1MJUL 3LKSA 3WFBH 4KKNA 3ARQA 5HGHB 3IFLL 2D9QB 3QNZB 2XV6B 4HS6B 4NNPH 1JZ6A 3BWAA 2Z93A 3HI5H 2B20A 2VLME 5D7KD 4QNPE 5IMKA 4PJHE 3WS6C 3W0WD 5FKPA 1ADQH 3JVGA 1NGPH 2NY7L 4YHYB 2MHAA 1CD1A 2YPLB 1JTTA 4X6FB 3HFML 1CDIA 4KTEH 4R2GD 5T5NG 3LV3A 3S88L 2BJMH 5DQ9A 1MFBH 3VFSB 3BUYA 1PLGL 1DQDH 2IPTL 4R97C 4LGRB 4NQDE 3ARGA 2BSRA 3CFBB 2GJJA 4XPFL 4ZXBB 2EO9A 3LMJL 1R3HB 3PNWB 5ISZE 4HXAL 4YX2L 4XPTH 2I9LA 1KLUA 3A0OA 1DQMH 1EFQA 3TCLB 2AK1H 1JF6A 1EX0A 1NLBH 3MRCA 4NKQB 2BHUA 3HI1A 1F58L 1NCDL 1TNMA 1OAXL 4S10A 1KJ3L 5I1EL 4G9FA 5GS2D 4IOIA 3QZWA 2NR6D 3U9UB 5BV7L 4KFZC 1EPFA 2VLRE 2VDOH 1NJ9B 3DX8B 2HLFC 5EU5B 1JPFA 1L0XA 3T65A 4YHOL 2OS7A 3GB7A 5I1KH 5ID0A 3IDIA 2L7JA 4CVZA 1M6OB 3TNMB 2NCMA 1C5BH 4Z76A 4KI5C 5DD0H 1TJIL 2ADJB 2FIRT 4Q0XH 2HWZH 2IBZX 5D71H 5EH1A 3KLAA 3F5WA 4M61B 4O4YL 4KZEL 3HPLB 4WW2B 4HLJA 5I8CA 3FTGB 4UTBL 4FXKB 3QFJB 5DYOB 5I1JH 1LILA 2Y36L 4LPXA 5F7WC 3UZVB 5JHDA 3A67L 5GGTA 1G7IA 2XWTB 4P5TD 3BZDA 1UJTA 5LWYH 2D4FA 4R3SA 4HWEL 4XCNA 2C4FT 3ABZA 2H45A 1J8KA 2V2WA 3KGRA 3KR3L 3TA3C 4Z8FL 2JIXD 1P4LA 4H88H 3EHBC 5KZCD 3WKML 4E42A 4WWID 5JUEL 3OAZH 5KSBE 1U8NA 3B2UC 1A7NL 3MLRH 1VKXB 4YXHH 1DSFL 4HUXB 2J8HA 1AIFA 2G2RB 2Q76A 2XTJC 2DKMA 1P7QD 43C9A 1FDLH 4OGAD 4LVNC 3NZHH 3HUJB 2FHFA 2CJUH 3SDDA 3NMEA 1TVBB 3K80A 3HLAA 4XH2B 1DDHB 5T1LB 3S96A 1OSPL 4MNQE 4UV4L 3HZMA 4FZ8H 3V2AR 1OL0A 3ZDZE 1SBSH 3B8YA 4KI1A 4NO2A 1Q9OB 1JIBA 4JFYA 1RJZA 3NA9L 1OGTB 4H26B 4OCXH 1T80A 1ES0A 1UB6B 3FT3A 2XN9A 1A8JH 4PPTA 4OZIA 3ARZA 2BOBA 3SGDH 2OJZL 1YC8A 1KLFA 3MR9B 4F8QA 3PWVA 3LRGA 1L9MA 1BM3H 4M5YH 4JQVC 3RBGA 1F3DJ 5F1KC 3ILQD 2NY3D 4Y0GA 2VDLL 1PYWB 3O2DH 5KSAA 1HHHA 4HV8B 1JHLL 5JNYA 2PF6A 4HD9A 3V5DA 1FFNB 1CGTA 1TLKA 1BZ7A 2NY6C 5HHPB 5D6DA 3QUKA 4F9LA 4O5LH 3TVMA 3N85H 4J3XA 1CTOA 5D70H 5JXAL 1YMHA 2D03L 3CXHJ 4ZFFA 2O61B 3CVHB 3DYPA 4Y2DA 2BSSA 5C0GB 1FL5A 2A6DA 5LGJB 4KHTH 2HRPH 1X4YA 3BDXA 1M1SA 3QDJA 4M9OA 4U4BA 2IMMA 3KNBB 5IROA 4R7NB 1AD0A 4ENED 2LV4A 3ET9F 1BQSA 5JW4Q 4ZS6D 4IS6B 3CFEA 2VLKB 1QO3B 3BKJL 3EOAB 2P8LB 2V9TA 4PP1C 4GG8A 4PRPB 3E8UL 1IAKB 1WT5A 3CCHA 3KPLB 5EBMA 4DGIL 1V3MA 1AY1H 4IRSA 5DEFB 1OP3H 1UKSA 5I6XB 4LDOB 4N90E 3TFKD 1QBLL 4CADB 3ZKND 4J8RA 5IR1B 1ZWIB 3ALPA 5D2NA 4EIZC 5CEXB 3X12A 4ZO7A 1FL3A 5C2BH 1A9BB 3BJ91 5GS3A 4XBEL 3U82B 1T5WB 2EDKA 4UUJA 5TFSL 3CFIC 2EYRA 4RMRA 4NCC1 1HEZA 4R4NC 5I19L 1JP5A 3R4DA 4EI5D 1MPAH 4NNYA 3W5MA 1S5HB 2RAMA 3VFWA 4LSRL 3WN5A 4P57A 3O11B 4OZGF 1KEMH 3IFOB 3GRWA 3VI3F 2UZYB 1TPXB 1QA9A 4HT1H 4KRNA 1T22B 2O5ZH 2FEDC 2ZOLA 5H8DA 1EH9A 2BNRE 1R3IL 5JW4R 2YRPA 3ARVA 2CK0H 4CKVX 4LLUA 3QWOA 2FO4B 5GRVL 1ZMYA 3VG9B 1OAQH 4PJHB 5J3HD 3EYFB 1HHGA 2FB4L 1E28A 1T7ZA 3GKWH 4P2OD 5FHBL 2XOTA 3FRUB 1G6RA 2EIZB 1LEKA 4J3OC 5JW4N 3NCJH 1Z9OA 1YQ2A 4F58L 1GSMA 2NLJB 5T1KA 3NPSB 5JMOC 4NQDB 4R2GC 4UBDD 1J0JA 1F8TL 2ED8A 4XAWH 1LNUA 1RUAH 4JFXB 5SX5H 3QUMA 1MRDH 5F93C 4ZMAT 5JR1L 3IJYA 5GSVA 5IUSA 1Z9LA 2YRZA 4MJ6B 3O6LL 3FFCE 4P49A 3O6ML 4XNQA 1OLZA 1MLCA 1FNFA 2Z8RA 4OLVL 2GTZB 3RKPA 1B9ZA 2JKXA 3NACH 5D7SH 2APWA 2R0ZH 3DRQA 4QT5B 4TTGA 1DL7H 2ZJSH 5F70A 5JPMB 3IVKB 3S3PA 2Q8BL 4QOKA 5AG8A 3TESA 2GFBA 4U6XA 1FPTL 1LO3L 4U1LB 2VLRB 2KDGA 2ZPKH 1B4RA 2IQAA 3LPGA 4OI9A 4CBPA 1CU4L 5IOPB 4TVPD 4F7EA 1VACA 2WANA 1IGTA 3U36B 4H5SB 3H7BA 2E7LC 3V6OC 2DDQH 5F6HI 1RUKL 1KV3A 1TJHH 3FQWA 3KPNB 3IF1A 3FB5A 1S5IH 3VH8G 1DVFC 4O51B 2QSQA 2C3GA 2N56A 4WFHD 3T0XA 4TSBL 2IFFH 2QJDA 3GIVA 1CR9L 1TQBC 1LWRA 3P9WB 5D7JA 1FNHA 3OXSB 1UT9A 4MNGA 1KCSL 3ZMRA 4KMTH 4X80L 2YD2A 3BH9B 1MCKA 3BN3B 1CBVL 5CP3A 5LXGH 1OB1B 2YA1A 3MSPA 1NBYB 5KG9A 5L88L 1KCKA 5HYSA 1NCAH 3AB0C 4OF0A 4YHLL 3S34L 1PSKH 4HXBH 1IFHH 4M5ZL 4P5TC 5CD3A 1JWSA 1YEGH 5F7MC 3FOLA 2EDFA 5IBTH 3TYGL 1Y6MR 4M8QB 1DJSA 3L3JA 3HG1E 3HZKA 3UTQB 2JK5A 1UYWH 1DE4A 1MH5A 1KC5H 4E41E 1UWXK 4LCYA 4HKXB 3ISWA 4G6AD 3VFVB 3ROLB 2ITDB 2XPGB 3QI9D 2K1MA 3O3BA 1ORSB 2DB8A 2DKSA 3GBNH 2BY3A 5CP7B 4PY7A 3U6RB 4E5XA 3PHQB 4NQTA 4FN0A 3SPVA 4QHLA 2X40A 3WDIA 1MELA 1G9MH 5TDPA 4G8FA 4OGAC 3UCRA 2OXGA 4XWGL 2J3SA 4MNQB 3WBDA 4AIOA 4LFHD 4P3DB 1V7MH 5EO1B 2B1AL 2H2SD 4WHTA 3BMVA 4AMKH 5IVXA 2GI7A 3RVXC 4Q74A 3X11A 1TCRA 2OLDA 2PCPA 4IHOA 1T7WA 4LCWE 4PJIE 4EVNA 4RDQF 4FQCH 1KBGH 2IH3B 3N9GL 1QNZH 2YWYA 3PL6B 1F6LL 1CLYL 2BSTA 4RGOH 2I60H 3LRHA 3L1OL 4L4TE 4N0UE 2HKHL 2Y1VA 1S7VB 4MAUL 4JM2B 4DN3L 1N64H 3L3KA 5EOTA 5C0RL