3IFPB

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12b4) complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 12B4 FAB antibody heavy chain
total genus 51
structure length 218
sequence length 218
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB01
1BOGA 3FRPG 1HZHL 1YN7A 1GOHA 1YYML 3DYMA 3EOTL 4XC3H 4EI5D 3NCJL 4MJIE 5EU6A 3V4VH 1JGUH 4XWOD 1X6LA 1JWUB 4HWBA 3GSRB 4KK6D 4QRUB 5J56B 4J2XA 1U8QB 4WY7L 4XPFL 4AJ0A 3CFBA 2E9JA 2DQTH 1WWAX 4FZEL 4WWKC 4QT5A 4XCCH 3TC9A 1M1SA 1CXHA 4KZDH 1JZ7A 5ESQA 3T09A 2W65A 3VXUA 3L1OL 5I1CH 5TDNB 3ROOA 4D0CA 4LGPB 5I30L 3ZO0A 4K3GA 5DJCA 5B8CC 5E8OB 2BNRA 4W4OA 5DLMH 3GSNH 3HR5B 1QFHA 2W91A 5HJ3A 3W9EA 3CUPB 3EO1B 5HHXL 3KR3L 4UTBH 1EHXA 4JHAH 1T7YA 4LCCC 2QHRL 3PWPA 1DSFL 1DEEB 5ISZB 3A0OA 1CFNA 3OXRA 3TBWA 1F3JA 4ONHB 3U4AA 4R96A 4I18C 3EJJX 1T0PB 1ZHKB 2QQKH 5DD6A 4YHZH 2GAZA 3ARRA 1RZFL 3HNVH 4MXWL 5KSAD 4ZNEA 1AGCB 3TBSA 2DI9A 5FDWA 5EFIA 4F37F 3QJFB 1MY7A 3UTTD 4L3AA 5SWSD 1QSFA 3RWGA 43CAB 1UACL 5CZKA 3S3SA 1WVZA 1X5LA 3JTTB 1RJYA 5IQ7H 4YK4B 4U1LB 2V9QA 5C0GA 1D5BA 3DNKA 2OTWA 1II4E 4NRYA 5B39A 4F58L 3Q1SH 3SKOB 1CFQB 4V2CB 5DWUL 5IROC 4GKSA 3NCYP 1QR1A 4JZJB 3ELAT 4WFGE 4KK6C 1IC7L 2AJYL 3SGKC 4LLMB 2Z91A 4TNWF 3MUGB 1U8LB 4FQJH 1FHGA 3DX7A 4Z7OF 1KN4L 4KH2A 1QRNB 4PJXA 2H32H 5CILH 2NY0C 1IGTA 3T1FA 3UTOA 3WIFA 3QO0A 1FNEB 4F8TA 3C6LD 3V6FB 1FL6B 2Z35B 3WUWG 4NFCA 3HPJA 3KLDA 3D18A 3NA4A 4X9IA 2E6JA 1BF8A 1LK3H 4D0DB 2B1HL 4OZ4B 4IRSA 3IS0X 1XF2B 4HUUA 4ZS6D 5E2TH 4LFHG 1QR4A 2PO6D 4JN2B 1AJ7H 4S1SL 4HH9B 1Z9SA 3MRJA 4KVNH 4GRWB 1DZBA 2I60L 2MKLC 3QNYB 1TZIB 4Y4KB 3LEYH 2MWCA 5FYJL 2QADB 4GRWH 3L3JB 1TJGL 3QDMA 3X12B 5E4IA 3BVNA 4PV9A 4WHYG 5C09B 5B39G 5F70A 3LSOA 4E41E 4AIOA 4MCYA 1MFEL 1Z9OA 5I1GL 3WIIL 4OLUL 1MLCA 2VR9A 1F6AB 2WIMA 4QXTA 1WT5A 1HOCA 1YNKH 1KCRH 2HT3C 2APXA 5EO1B 5DD3L 2L0DA 1AO7A 1HOCB 3LZFL 4UT6L 3T2QA 5HHNB 2CSPA 4S1RH 4RSVA 4UT7H 5J13B 4PJ8D 3RWHA 3OXSB 1Q38A 1QOKA 2AJUH 4JDTL 4FQLL 4HK3J 4D9RE 5A2FA 3P0VL 5TQ2L 2HG5B 4MNGB 5DMYA 1G7IA 4BK5A 1LEGB 1S7QB 2HFFB 3INUL 2EYSA 3QIBB 4H20L 1A7NL 2CIKA 5D1QA 2NY7L 4U33A 4DKDC 5T3XL 5EUOF 3QIUA 4YR6B 3S5LG 2E7CA 2AV7B 3FAXA 4LQ1A 3S96A 1I1YB 1S7TB 5GISH 4Y7MA 3LEYL 4JFQB 2FSEB 3DIFA 1ZK9A 4MA8L 4Z7QF 3O6FB 1NJ9B 1D5IL 4JFEB 3PP3K 5DJXA 4CN1A 4PYGA 1LO0H 1X3DA 5DMKB 5E94A 5C9JA 3WUWB 3ZDYF 3BZDA 4GG6E 3WO3B 5H8DA 1E27A 3DX6A 1AKJA 1J11A 4DZ8B 3BQUD 4XWOC 4JVWA 4LF3A 1TCRB 2PETA 4P4RB 4Z7QE 4DK6A 4FTVB 5L88L 1CD8A 1MCSA 2EICA 1GIGL 2B39A 2VWEE 4RGOH 2VXUH 5CEZE 4M03A 2BSRA 3IDMA 3HUJF 4V1DD 6FABH 2EIBA 1H3XA 3HE7C 2RCSL 1YJDL 1QSED 2BVYA 5E1AB 3SGEI 4PGDA 5C0DA 3BD4A 1RUPL 2NNAA 5I8EA 2BJMH 1TQCB 2J2ZA 3WEXA 4LSTH 4XT1C 5E1AA 1A7OL 4L9LA 4KPHH 4BUGA 5F3BB 4R97B 3O8XD 3D85D 3ARVA 4TSCL 1DN0A 3TA3B 4FMFA 3Q1SL 4MNQD 2MCPL 1HDMA 4DGVH 1AGCA 4JFZL 4ODBD 2F9BT 3RWDA 3S35H 5ALCH 2X9YA 4HAFA 1CE6B 1OB1B 2IMNA 3BUYA 5ADOH 2AJSL 2X70B 2NW3B 5HHME 3P11H 5FFLA 1KJ2L 4FQQA 1MY5A 5KOVC 2AXFB 4GG8B 1RJLB 3H9ZA 1U58B 4LHUA 3OR6B 1P53A 3S36H 4PR5A 4TQEH 5DEFB 5FO7A 3S98A 4Q6IB 2JJUA 4Q0XH 5I66B 5B4MC 2J6EL 1JYVA 5KSUB 2MPAL 1EXUB 1EJ6A 2FEEI 5HYSA 3U0PA 2VN4A 3O3AA 4KUZH 1IFHH 4XP6H 4PIRF 1OP3K 4NWTL 5FYKE 5DQJB 1A22B 3AAZA 2Z9TA 4MB4A 3LSOB 3JWDC 1IZJA 3BP5B 3IFNH 1DQDL 2XKNA 5EU4B 3S35X 3FOMA 3VFGH 3VMOA 3KDMA 4FP8L 5IM7B 4I13B 4J4PA 4K23L 2FWOB 3OB8A 4PLJD 4HJJH 4PJ7E 3RX7A 3MRQB 3GM8A 2DTML 5JHDA 1F6AA 3BIAX 1EZVY 3QXVA 2G9HB 4IS6B 4GW1A 5CJOH 1OOAA 1P4IL 2Y5TB 4OB5H 4PJEB 2A77H 1WICA 5CGTA 1A3RH 4NQCE 4BFBD 1G7QA 5C6PB 1F11B 1NEZA 4GXUN 4NSKA 1QLRB 5IJVA 5BV7H 3IU3A 5BS0A 3ARFB 1C1EL 3G5VB 3QXDA 2EYTB 4IJ3B 5J4MA 4G9FA 5EZLA 2D3VA 1DANU 4X5XA 2WQRA 4GSDH 1DBJH 2R1WB 4ETYA 2FO1A 3PL6C 3FO2B 4HH9A 2WINA 5I18H 5I1LA 4NJ9L 3RGVC 5A40E 4WV1A 3SDXF 4UINH 5D4QA 1B2WL 1DN2A 3K2UL 1LEIB 4KZEL 2X1XR 5D7JB 3NFPA 1KIPA 4L4VA 5HPMA 3BIKA 2ORBH 3QEQE 4P3DB 4PJFE 5CSZA 3S4SA 1MFAH 4M1DL 1DLHB 5DJ0B 5C8JB 4HLJA 4HPOL 4FZ8H 4L5FL 4U31A 5JQ6H 4NWTH 4E0RB 4RMUA 3DGCR 4R0LA 1WBZB 2DYPA 3GJEA 1SHMA 4YPGA 4GRMB 2V2WB 3BKYL 5FCUL 3DX7B 5EOQH 3L3GB 3BWAB 4K9EH 5DVKA 1MQKH 5EFIB 1KCVL 4JRYB 1RMFH 2OQJB 3OTTA 4KTDL 3GO1L 2AEPL 1FJ1A 1T3FB 1D7FA 4L8DB 3SKOA 3CDCA 4M6OH 3WN5B 5J7CC 3D3VB 3MV11 5D7IB 3NCFB 1U3HA 4OFVA 3VXTB 3ARDB 5J57B 4Q2ZB 3X17A 1P1ZA 3CFEA 3C5ZD 1A7QL 4I3RH 4L9LC 4OTXL 3DSFH 2GUOA 4D9RD 4NO0B 3TWCL 1CFVH 1PZ5B 2DM2A 2Y07L 1KIUA 3BEVB 4RQQB 4Z5RA 2NLJB 4M7JH 1NFDB 3Q2CA 4XWGH 5I1DA 3THMH 4JPKL 2X1OA 5CMAB 2HVJA 3U1SL 5D2NA 3VFWA 2DM3A 4HIXL 2BX5A 4G8GE 2G75A 5D7LB 2AERT 1GAFH 4Z7VA 1P2CB 1EUTA 4QRRA 4ZDHA 1AE6L 3C60B 5I1EL 4FFZH 2ZUQB 4QHNA 1A8JH 3QJHB 3IXTA 1OAUL 4CVXB 5J9PA 4IMKC 2A38A 4A6YB 1XGQB 3MLRH 4HWEL 5CJXC 2EE3A 4I5BB 5F9WB 2CKNA 4LARL 3O8XC 3ZMRA 4W6YB 4L29A 4G3YL 4X6BB 2XN9D 1A47A 5EA0L 2BY2A 1UXWB 1W0YT 5HDOA 4LDOB 3HI6L 5KZCD 5IB2B 3MOBL 4NRZA 5GRZA 1VEMA 1VACB 4TUOA 1RD6A 2JJWA 1JWUA 2QSQA 5D8JL 3MRLB 4KK5C 1NMCB 4FFWD 2EYRA 3T8XB 4YHLH 1DL7H 1BIIA 1MCKA 3QIBC 3AFLA 2NZ9C 3F6LA 3L3IB 3X11A 1BD2D 3CCHB 2DQIL 2R2HB 5ID0B 5B38B 4JM2D 1QQDB 3U6RA 3TBTA 4XHJD 3FONA 4YHYB 1MRDL 1RZGB 5D2NB 3VFWB 4UNUA 1YNLL 2HT4D 1IBGH 4RIRB 5E2UH 1Z0NA 1OGAD 32C2A 2RQ8A 5DEZA 3RUGA 3A67L 3C08H 1OT1A 1HNFA 5D1XD 3PP4L 1NDMB 5DS8B 5GGSA 3I6LE 3CH1B 3DMMB 3L9RA 3IJHA 1X5GA 1ZS8B 2NXZC 3RY6A 1BZ7A 4RMRA 2OZ4H 3WIIH 1Z9MA 4JR9H 3N9GL 4PUBH 2PNDA 3NFNA 1JWMB 1RY7B 1KTDA 1WT5C 1SMAA 3IETA 1TJGH 4HXAL 1TETL 2YC1B 1OSPH 3H3PH 3ARDA 1H5BB 3O8XB 4NZTL 3UXFA 2Z92A 4R26H 1J0IA 4I0PC 3V8OA 3WFDL 4TSBL 3EYFA 2J1KA 5TGBA 2BHZA 3E2HB 3FQXA 3VXUE 2VLKE 3VD5A 2BXYA 2BOBB 1K8DB 4OF0A 4P23A 1SJHB 4WCYH 1NGYB 4G7VH 5J3HD 3LHPL 2FGWH 2J4WH 3RVUC 2X4NA 3X13B 1QRND 4UIKL 3HA0A 3CAFA 2ADIB 3QI9A 4F9PA 1G6RH 2RFXA 4XP1L 3ZDYE 2F53B 2YD4A 1NCWL 4PJEE 4QOKD 1PLGL 1TVDA 4AEHL 4UT9H 5DO2D 1YPZF 3DI2B 5FO8A 4HJGA 4CADB 4MX7B 3SDCB 4OD2A 4YZFE 3I02A 3EYQD 5A3IC 1LO4L 2OMBA 3IJSB 1JPSL 1ZS8A 4H0HB 4XPHL 1MJJB 1IAOA 5C0CD 1OAKH 5DQDL 1PW3A 5MERA 1BREA 2FHFA 1UEMA 1L6XA 4JJ5A 4YDLB 4RNRA 1QKZH 1JPGB 3B2UC 5IIEA 3LH2H 3BZFB 3QDJB 4PJ9A 3HS0B 1A7RH 5AUMA 2QLVB 4KKNA 2CKBB 5AZEH 3RAJL 1T89C 2VXSH 4G8FB 1HYSC 4MJ4A 4ISVA 5EN2B 5CBEB 4LVHB 1BAFH 2Q8BL 1PY4A 2Z0BA 1BQUA 1T83A 5DD5H 3UCRA 2Y9RT 3T0EA 4LRNL 4YDIL 5EC2A 3QIUC 1WZKA 1NLDL 3BGAA 1U8IB 2G75B 4PB0L 1Q0YL 5GGSY 3IAQA 1FAIH 1SEBA 5TQ0L 2XI9A 5E4EB 5I1DB 3FRUA 4X6CE 3FJTA 5IBTL 1CLOL 1ETZA 5D1ZA 1A6ZA 1AC6A 1ORQB 4PJIA 4U0QB 2Y6SD 2CLVB 2Y5EA 2E7MA 4PV8A 4PJGA 5C08B 3O3AB 4Y4KD 3EW3B 3D69B 1A4KA 3QT2A 4UUJA 4QHMB 2C4FU 4S0SD 1KTRL 3KPNA 3RIAK 1ZT4A 1FPTH 4OZIE 1KC5H 3P0YH 4X7SL 1U8PA 3ARFC 3EGSB 4D9QE 1EA9C 3BP6B 3BKML 1B4JL 1ZOXA 4MQ7B 3EDKA 4XPFH 3P30H 1DL7L 2CDFB 4HUXB 4X6EB 3CFDA 1UVQB 1FPTL 5CZVH 3WO4B 3D39D 4YXKH 3PV6B 1T3FA 2ERJC 3O9WC 4L8DA 3TLRA 3X13A 3I50H 1OB1A 1NMBH 1NQBA 4CNIA 1NGYA 3HAEH 5HHOA 4S10A 1PG7X 2ADJB 5AWNH 1KLFA 2NZIA 2ZSWA 2CLRB 2FX7H 2YN3A 2ZPKH 2YRZA 2P8MB 5CJXA 1OCWL 3GSNA 4PLOB 3F12B 4HIHB 4JG1L 5TF0A 4XZUA 3UC0H 4WUUD 1MEXL 2EDBA 2VXTH 5E03A 2E8ZA 2R39A 1GHFL 1N8ZA 1RIVL 3B3IB 1ZA3A 3HG1B 4OCXL 3ARYA 3QR2A 1R3HB 3MV9E 3AC0A 1BFVL 2H2SC 5D7JA 3F7PC 3CH1A 4R8WL 1BVLA 3PQYB 4KI5E 2R1XA 2OP4H 4MNHA 1TITA 3O2DL 4R0LB 4ODXA 4NNXA 1IGMH 3WLBA 3I3DA 1WIPA 5D1XC 1A7RL 1MWAH 1Z9LA 4GQPH 4OLWL 1OAXH 3KNBA 2EZ0D 1P4LB 4PJDB 4K3JH 5DJXB 1OTUC 5IB5B 1YJDC 3AMLA 3B4NA 4IS6A 5J11C 4YBHA 5FB8B 3DIFB 3VXMA 3GK8H 3BXNA 5K59F 1JPST 3VJ6A 2QR0A 3GMLB 5FGCE 4NGHL 1EJOH 2ID5A 3KHQA 3MCKA 3TCLB 1ZVYA 3HZYB 1EH9A 4B41A 5DC9B 1TQCC 2NPLX 4FFWC 4LLDB 4JREC 1FL5B 2F54D 3V5HB 3GO1H 4JM4H 3L95B 1YEGL 4NKIL 3O9WD 1CFTB 5IV2B 1KEMH 2D7PA 1OW0A 1X5ZA 1NMAL 1OM3H 4D94A 1JRHI 5DQJA 5DRXA 1U9KA 2AK4B 25C8L 1RURL 2VDKL 3TIEB 3U7WL 5GJTH 1AQKH 4ONGH 2UWEA 4GOSA 1KNOB 3UJJL 4WCYL 3OR7A 1WK0A 4P46C 1Q72L 4R4NC 4U1SA 2YBRB 5E8NA 3ZYIA 3R1GL 2GJJA 2HLFC 4KZEH 1R3IL 1BQHA 4JGMA 4QXUH 1A6PA 2V5TA 4U1NB 4I0CC 4L8SB 5J8OA 1IGML 4NQED 2HKHL 4NZDA 4HUMB 2AJXL 1LWRA 1MFBL 2V2XB 4TSAH 5I18L 1TENA 9CGTA 3MRIB 3LQMA 4M7KH 5ICXB 1CL7I 4YHIB 2GHWB 4LL9A 1CU4H 1MVUA 3NN8B 5LQBL 3OR6A 2R69L 2ED8A 1BBDH 1TTFA 1VGEL 4YO0B 4GJTB 3V8CA 2XFXA 3NAAL 3UTZB 3MACL 5IG7B 3UX9B 1TLKA 4FQPA 4ERSH 3UYOD 3GSOB 4R4FL 2NY4D 4G6KL 5GIRB 3ARGB 2EECA 2O5XL 1JHKH 2YPLA 4OD3H 3IDMB 4U7SA 2OL3B 2A9MH 5DJAA 1X6NA 5EUKB 2VL4A 1HHGA 5DJ6A 1U8NA 5DD1H 2DYPB 2OYPA 2VC2H 3KPSA 1MJUL 4JZJA 3O4LE 4ZO8A 2IAMD 5EBMA 4K3DH 5E2WH 3MUJA 2LQRA 4Y4KC 3UTTA 2Q1EA 1CCZA 2DOCA 5C86A 4N9GA 4GAYA 3TT3H 3GHBH 4PJHE 3VFRA 3NCEB 4P46D 5FGCB 4JVUA 3BHBB 2R56L 1B0WA 3HZKB 4NBYB 3AVEA 5CP7B 3TF7C 1PX3A 5JPNA 4KQ4L 5IBUG 5KW9H 4H1LG 5D1QB 2X4QB 5ADOL 4JANB 5GRJL 4HPYL 4Z7UF 3JXAA 4I3SH 3P4NB 5FYKD 4JFZH 2KZWA 1N64L 3OXRB 5J12B 5E08H 1N0XH 4Q58C 2QEJA 4PP1D 4R7DA 4ZXBC 2R1YB 4OIBA 1W72L 3RWFB 3DRTA 4KI5C 2R23A 2HLAA 4XPAH 1UWEL 3DHMA 4ZFOL 1R0AL 3MC0A 4NBZB 4NC0B 2A6JB 4OJFH 3DVFA 5TDNA 4OLVL 4KHTL 3QUZB 2K1MA 4XP9L 2E3VA 2AK4A 2BRQA 1XGTA 3P9MB 3UJTH 4GBXB 4NFDA 1EHNA 5T3XE 4M5YH 3HNSH 3QUMA 1MQ8A 2DKSA 4LCIH 3FQRA 5IMLB 3RWHB 3U0PB 4M02A 3G6JE 5GS1A 5HYSB 3G6AA 4YC2C 1L7IL 2FHBA 4PRPA 3MCKB 4P9MH 2JCCA 5JXAL 3VFMB 3VJ6B 4NKDB 2APFA 4E5XA 1LO5B 4LCWE 1KF9B 2IANA 4CKVX 1YN7B 1S9XB 2DLIA 3RBSA 4LHUB 1CXKA 4K07A 4R7DB 1I8KA 3L3DA 4RGMB 3E6HB 1HE7A 3TPKA 2VLRB 3L95A 4XAKE 5D7LD 4WEMB 1F58H 3NPZB 1Q8MA 3K7UA 2A83B 3HI5H 4KMQA 3U0WL 2HKHH 4HIJB 3BUYB 4KFZC 4LKCB 2PO6C 3FTGB 1JHKL 1I7TB 4PY8I 1CDHA 3BSZL 1QPPA 1YECH 3QH3A 5KSVA 4HUUB 5EUOB 4W6WB 4GKZB 1IEHA 4QTIH 2YD8A 4NWUL 4WTZA 3O6KH 5CIPA 1QLEH 1CDUA 3PHOA 5I1AB 2R0KL 4WWKB 5C0EA 4LSRL 2EIDA 1VEOA 4UTAH 2HT3D 3T1FB 2XT1B 2ZJSL 4APQB 2IPUG 4WU7B 1J05B 4FQ1H 2JCCF 1K5NA 1MFEH 2AI0H 3BN9D 2D0HA 1RFDL 5C0BD 1CK0L 3LN5A 4EN3D 2NX5E 4HWBH 1TVHA 5JO5A 1AD9B 2A9NH 1AHWC 4I18A 1KXQE 4WFED 1CBVL 4JFPA 2JJTC 3WJLA 1EJOL 2GAZB 4WEBH 1CTNA 4XP4L 3O2WL 1UVQA 1MHHB 2FIKB 3BH9A 1CDIA 2HKFL 2PUQT 1K4DB 4JFEA 1EGJH 2EDRA 3CDYA 2VAAB 2C5DC 1QSFB 1EVTC 4PJ9C 2VDKH 2GT9B 4N68A 2DQIH 3GMQB 2Q3ZA 3SJVA 5D7LE 4JN1L 4XMKL 3W0WA 3GGWA 5KSBE 1A1MA 2NTFB 3MRKB 1AIFA 4HT1H 4NOBA 3SDCC 5CKGA 4P5TC 5KZCB 2W65B 3VCLB 1OQOA 5IGXH 1LHZA 4GFTB 5GXBB 5J6GB 5CWSA 1W8OA 1UB5B 4OFYD 1CR9H 1PZUB 4I1NB 4NT6B 4I77L 1WWCA 2MHAB 3OXSA 2VLJE 2QHLA 4Y4HC 3VRJB 5I75B 3SE9L 1Y0LB 2ZUYA 5CIPH 4HWEH 1ACZA 1BEYH 1YY9D 4AYFA 3H9YA 2P48B 1IGJA 3WFCH 5C3LD 2FDBP 2IAMC 4K7PL 3LKRA 4PJFB 4QXTB 4ALAL 4PRBA 5I16B 3CMOH 1QLFB 4QXGL 5FA4B 1EEYA 2YN5A 3FCTA 1CFTA 5IV2A 1DBML 5F7KC 1PAMA 4GBXC 3QNYA 5H2BA 5IMOA 4RGNE 1R5VA 4ZAKB 4N8PA 1C5CL 3QUZC 1ZGLA 4OZFH 2D4FA 3MJGX 3T0EB 2J3SA 2QQKL 1RIVH 1B4JH 2VLRE 3OKNB 3BPLC 3NH7L 3UPAA 5EZJB 4PYHA 3O4OB 4A2LA 3PIQB 1WAAF 4NJAL 2F19L 3IJSA 1VGKA 3IDJA 3T4YB 5FHBL 5ABDE 3SDCA 3KR3H 4UTBL 1MRCL 3C5JB 3LS4L 2JB6B 1CD1B 1JRHH 5DSCB 3QO0B 1FH5H 2DDQH 4PJ7B 1HWGB 3SCMC 3I50L 1WAAE 3BZEB 5KS9B 1FV1B 3GSQA 4P59L 3MR9B 3U48A 4R6UA 1A6UL 2B4CH 4X80L 3ROLA 1KCVH 4PJAB 5CD3B 2D31B 5SWSE 1A1OB 4PRNB 4F15B 3CX2A 4XNQB 4KJYA 3LN4B 4WNQA 3QPQD 1RK0B 4KUCD 3T0DA 3S6CA 1H3PH 3OJMB 4U0RC 4X4XB 4R2GC 2VC2L 1A0QL 3VGGA 1KPRA 4Y4FC 3GMRB 5LWYL 5F9OH 3PWPD 3NTCH 3R06A 3B2VL 5GGRB 4PGZA 5GSRA 4ENEC 1QBLL 3TO4B 4JFYB 3FQWA 3NFNB 4C4KO 5LCVH 4IM8A 3FOLA 1Y6MR 1XGPA 4LASL 3I6KB 3LKPB 1H3GA 1KLUB 3CK0L 5E99L 1A6AA 5KSAA 3D5OF 4ZSOE 2XPGA 4P5MB 2Q3AA 3OAZK 5DS8A 2AV1A 3WHXA 3FQXB 5TGBB 1LD9B 2WIIA 3RUGB 3CFDB 1IGFH 2MTPA 4PTUA 5L7XL 1RZ8A 5HY9B 4LMQE 2D0GA 1H5BA 3U9UA 3GMRA 3PWPB 1Z5LB 3IXAA 4HWZB 2XRAL 5L2JA 1FN4B 1ZT4B 3MFFB 4WNQB 3IXAB 4HWZA 1QPXA 2OTPA 4CN4A 4MD4A 4M00A 1OSZA 4CU8A 3ZKMC 2BHYA 3KLHC 1FFOB 4JN1H 2X05A 5IOPA 2HRLA 1OQXA 1BP3B 4J3SA 1D9KB 2YA1A 1RIUL 4HUVA 5T5NG 2J4WL 3VXNB 4XX1E 1DQJB 1X5HA 4PJ8B 3IRZA 1OAKL 2BHUA 2I07B 1DBBL 5GRWA 3NIGF 3WXWH 1T03H 3FKUS 3KPTA 2MNUA 3GMNA 1JTPA 3N50A 5E7FA 3OB0H 3ULSA 4L29B 4EUPH 3EOAA 4QRPD 2J6EH 4PJCA 2XKUA 3PWNA 4ORGA 3ZHKA 1JNHA 4G7YH 1VDGA 3WXVL 4ZQKB 4ISVB 3PQYE 2PO6A 4JPIB 4QY8A 3D0LB 4XVTL 1NC4A 5DRNB 4HCRL 2IH1A 3OAUL 1GGIL 3VXSA 1XCTA 2EH7H 4WHCA 1ZLVK 5HHVH 4U05A 1U2HA 3QDMD 4RNRB 3H0TB 1CGWA 4P5KB 1I9JH 5IP4A 1MNUH 1SM3H 2VISB 3RBGA 3O6KL 4Y19B 4M61B 4PRBB 4GAFB 4DGVL 1OLZA 1E4JA 2VABA 2ZKHL 2JB6A 4Y16C 2NY2D 3I02B 4EBQH 4POYA 2GUOB 4Z0XA 4Z7VB 5FO8B 3HN3A 2YA0A 4P2QD 4JE4B 4PLJC 2VZ1A 2IADB 2VB5A 4LSTL 4N0CC 3WJJA 5C9KA 1NFDA 5JHLL 5GZND 1S5IH 1IGCH 3O41B 3FMGH 1VB9A 1DUYA 4XMPL 3RGHA 4R3SA 2HWZH 2J8UE 4JFXB 3RWJA 1GIGH 1QFOA 1SJEA 1CGSL 3ES6B 3HAEA 3UC0L 3CNKA 2DWDB 3MRBB 1TZHA 1HIML 1K8IA 1HNGA 5FA3A 3ZT6A 1CD9B 3TO4A 4FQIL 2LTQB 2PN5A 2W60A 5GGRA 1FC1A 4LHJB 3MBXH 3QQ9D 3M8OH 5ETUA 3UPRB 1AE6H 4IDJL 3QO1B 4XNZB 1A6VH 3EDFA 4NKQB 5IK3A 4P2YA 1NSNH 1QG3A 5CSGA 1DBMH 3CC5A 4XC3L 2PR4H 4YQXL 5JQHC 4LBEB 3O11A 5MEOB 2ERJB 3O9WB 3Q6GL 3C6LC 2H8PB 1W72H 4G8IB 1RUAH 4MHHI 3FT4B 4H20H 2LAAA 5E08L 2H6PB 3ZT7A 3BN3B 4X5XB 5C2BH 4I3SL 3W0WB 1DLHA 5DJ0A 4EDWL 3L7EA 5TDOA 3G5VA 2VMFA 2DBLL 1NAMH 4N0YL 1W0VB 4JGUA 3PHOB 5I1AA 4GQ9H 2VAAA 3MCLH 1AP2A 2ICCA 4DN3H 3MNZA 1AY1L 3IU4H 1HXYA 3SGDI 4HS6B 4J23A 1BIIB 3FL7A 1ADQA 1JGLH 5C08D 4MQXD 5IBTH 5CEYA 4JPVH 1I3RA 3VG0L 1KG0A 2JJSC 2B7DT 5DT1L 4XRCA 5GS2D 2VDLH 3VD4A 5C3TA 2A83A 5H2BB 5F7HA 4OCSH 2Y07H 5GRUL 2C9AA 2GITA 3MBEB 5IWLA 4X6BA 3MRPA 3HE7B 4PB9L 4BFIB 1FNSH 4EI5B 3G6DH 1U8MA 4L5FH 4LHUD 5L2KA 2ZCHH 3ZTJH 2A73A 2ADGA 1KJVA 3CFJA 4P4KA 3QEQB 4GMSH 5EU7E 4Q6IA 3S36X 1FORL 4X7TB 3T3PF 4WJ5B 5DR5H 4ZFGL 5AAWA 3FB8A 1P7KA 3T65B 4EI6A 3VRJA 4HWBL 4H1LA 5I8CA 3FQRB 2WZPD 3QNXA 5C0RL 1ZLSL 2AEPH 4KHXH 3RVVC 3ZHDA 3CU7A 4GG8A 4QHUA 4JKWA 1FVDA 4XCYA 4JQVA 3I6LD 4MQSB 3TVMB 1EGJA 3MRCB 4Q9CA 1DUZB 1PKQE 5DYOB 2R69H 2YD2A 1T7WA 3ZZ1A 3E6FA 5I66A 2IBZY 3N1PC 1GZPB 5DEFA 3CXDH 1FIGL 3QEQD 2FLBT 1I8KB 2ZCLH 2QQNL 3WD5H 1CVRA 1LEKA 5DRZA 4NN5C 4RFEA 3G5ZA 5JW4R 4G8EB 4YLQT 3VGAB 2RBLA 3FO0L 3HFML 1DQML 4LIQH 4UILL 3WSQH 4NDMB 4PLKD 5I19L 5DJ8B 4RX4A 2ZSVB 4G5ZH 3B9DA 3CIQA 4JFPB 2VR4A 4HV8B 3KPRD 3QUMB 5I1IL 3RWDB 2IEPA 4D3CL 4E42A 2GW5A 1HH9B 5FUZL 2CLZA 4I9WE 3FT2B 1EMTH 5IW6B 4YPGB 4ZUTB 5C0AA 4WU7A 5GJTL 2YUZA 2DMKA 1FO0H 1HQRA 4OB5L 2WANA 1JPFA 1KLGA 4NHUA 2FZ3B 1H5BC 4Q0XL 4LVNC 3RL1A 3CLFL 4JB9L 2XIDA 1P4BL 2XV6B 3EYVA 5HYQA 2B20A 4L4VB 3QEHA 2BNQD 4YHMH 3A67H 3C08L 2FHCA 4BSVA 4M5YL 2AEQL 2EC8A 4KJQC 4DGIL 4OF3A 1AGBA 3WV0A 5CZXC 1NCBH 1ES0B 4DGYH 4PJCE 3KXFA 3S96B 5IVXE 2AV7A 1OGAB 2D4DA 3S88L 3FO2A 2P8PA 4J6RL 3S35L 4XPAL 5JXED 5INDB 3G9AB 3OKEB 4OV6F 2MPAH 3V7AE 5JPNB 2BOCA 1ZTXL 5CLTA 1SY6H 5CP7A 5C9JB 1QEWB 1DE4B 2GKIA 1TPXB 3O45A 2DD8H 4PJHB 5D1ZC 2BSTB 5DT1H 3C5ZA 4YE4H 2PYEE 1T5XA 2ARWA 2VXVH 2BJML 2OTUA 1AO7B 1CR9L 1S7TA 3UTTB 4Z7WF 1RK1A 5DZLA 5EBMB 3QCVL 2HVKA 1A5FL 1XZ0B 3P11L 4PRPB 1FP5A 4KKLD 3SDAA 2V2XA 4Y5YC 1PQZA 1NAML 2NW2A 4ORZC 2HFFA 4HKBA 4KMLB 3UAJC 1G7IB 3EYQC 2DQHL 1FIEA 1Q9LA 3AXLA 5GSVA 1H15B 1JP5A 1LP9B 1RHHB 1VEPA 2CIIA 1FGVL 2YBRA 5E8NB 3QUZA 3TCXA 3FQTB 2C1PA 3SE3C 1VADB 4OM0L 4KPHL 5JR1L 3VFNB 3PGFH 4EUPG 4XWGL 2WBWB 4KKCC 4PR5B 3F7VB 1G1YA 4P48A 2FBOJ 5MI0C 1UM6H 1JTOA 3CGTA 3HUJA 4XNMA 2AJVL 2BFVH 4S11A 1ZLWK 4DFHA 3V5HA 4JO4H 5FCSH 4WTWA 1UQSB 1TJIL 4FQCH 2OSLB 1WZMA 5CZXD 3D25B 3RL2A 3RTQC 1IM9A 2UZIL 4BQBA 2C3XA 2I5YH 1U8LA 3MUGA 2EEBA 4KXZI 1UM4L 4XC1H 3TZVA 4H1LB 3EO0A 3FB8B 2Y6SC 1P4LA 4PJDA 4YK4C 5A16A 4GKSB 2D7QA 4RFOH 5I1JH 5JHLH 5F3BA 4X6CB 2CO7B 3TJEL 3V6FA 4YGVA 3OAYH 1NEZG 4BA8A 4G42A 3BSZH 1YY8A 3V0VA 2ATPB 2AJXH 4HFWB 1X7QB 4TYUA 4QGTA 4BJLA 1KIQB 4GAGL 5L6YL 4NM8H 1OP9A 1XR9B 2MFNA 3CXDL 5GJSL 5LG1A 3VRIA 2Q7NA 5C0CB 3NABH 3RRQA 5ESVB 1D9KC 3QULB 4JFFB 4QHKI 2XG4A 5I73B 5GIRA 1N7MH 2P44B 2R9HC 4DTGL 5TFSH 1K2DA 1F4HA 3JUZA 5E5RB 2R2EB 4BH7A 1DEEA 5ISZA 2EDHA 4HIHA 1YNKL 4RWYH 3BP7B 1B3JA 1QVOB 4X4YA 3IKCA 3WHE0 4JFQA 4AK1A 3QJFA 4ZFGH 4QGYA 2BNRB 4Z76B 1MJ8L 4YXLL 1IC4L 3BYYA 3MUY1 4LHUG 4G8IA 4Z7UB 1CICB 4OLVH 2NYYD 3V7MA 4OZIF 1UCBH 3QIBA 1ZHKA 2X7LA 3TBWB 2X89A 3UBXI 4E42B 2COQA 4ZTPL 1ZSDA 2B1HH 1YQVH 5E0QA 5DHYB 3CUPA 5EU6D 2QSVA 5KANI 2N1KA 1PSKL 3IAPA 1FG2B 1X5IA 2DS4A 5MEPB 2R15A 4OZFG 5F7UA 2P8MA 5HI3C 3TFKD 4YC2B 2CGRL 3DSNA 2H2PD 2I27N 1VPOL 4M93C 5CILL 4AENB 4UV4L 1AFVL 1I8MA 1BFVH 1YDPB 1WTLA 3QFJD 4GW5B 4M62L 3FB5A 4WO4B 3GMPA 3C2SA 2HN7A 5MEQB 2ZNWA 3TCLA 5I17A 4JN2A 2X40A 1HHHA 2F74A 4PRHE 4LEOA 2FATH 4OZ4A 1XF2A 2FX7L 5E8PA 4OZIB 5HHXH 5T3ZH 4OUUA 2LU7A 1C7SA 4Z7OE 1MCLA 3GSNL 3DROA 3S3JA 1T6WA 4JRXA 4Y8AA 1MIML 3HE6B 1S9VA 2H41A 5DRWB 5J12C 5KS9F 3HI1B 3BPLB 4U1JB 3ILQC 4NQCD 2A9ML 4WO4D 1ZVSA 1DTUA 2VISA 1RZFH 1H3UA 2BXZA 4FQIH 4L4VE 1WFOA 5INCB 5D72L 4MWFA 2PYED 1CIUA 3ULVH 4XP5H 2XA8H 4PBXA 1FFPA 1WFTA 3TNNB 2FEDD 5D93B 3MJ7B 3RY5A 5JNYA 3ILPA 4PREB 4NHCH 2BRRL 1WCBA 4M5ZL 3BISA 1PG7H 1VPOH 1KJ2B 4U2YA 4CMHC 2G5BB 5FOBA 5L88H 2Z8WC 4JZOA 1P6AB 3QCTH 1XCQA 3CPLB 4JKPH 1TZHB 4G9FE 1SBBA 2CKBA 4JO1H 1FZJB 4OD1H 4RFNB 3ES6A 1CG9B 1OAUH 2WNGA 3R1GH 5C7XH 4UIMA 3BW9A 1QTYT 2G60H 3BZFA 4Y2DA 3BKJL 4Z77B 2EXWD 1MH5A 3BMWA 4D9LH 5GGVY 4POZC 4LSVH 3BZ4A 4H1LH 4K8RC 2NR6D 4WI3A 3U0TA 2WK2A 3DXAD 3LKSB 5ILTH 3QUKA 3U30C 4UB0L 3AU1B 2Z8RA 3PHQA 1INEL 1J1PL 2OZ4A 4IRSD 4ZOEA 3G04A 3RWCA 2H2SD 2CUMA 2R0ZH 2YUVA 3HRZA 4MCZA 1UYWH 3BAEL 1QRKA 4M6AA 2VNCA 3F5WB 1KN2L 3RFZC 4H26A 3TWCH 2AABL 1A4KB 3L5XL 4ELKA 4OLYL 5EU7C 4Y1AD 5E00A 2NMSA 5I73C 1IILE 3EOYG 3WIHH 5HPOA 4RWYL 5DQDH 1KFAH 3EYOA 1QBAA 1AH1A 4P5MA 4S1RL 4C58B 4PGEB 2M26A 1JPSH 3QCUL 1F3DJ 1GGUA 3CZFB 1XGPB 5EWIL 1NANI 3LB6C 2CMRH 1ZHBA 3MGAA 5L8JB 1S7WA 3L5XH 3VWKC 1UENA 3MGOA 3W39A 3QUXC 4P46B 3VRLF 4KTDH 3ZSTA 1KPRB 2Z31D 5HDQL 3JV6B 1G6RL 4JKMA 4MXVE 4PJDF 4X9FA 3TJHD 1XF3A 4UU9B 3RZCD 1NFKA 4YAQB 1FFPB 1MCQA 1VFAB 2VQTA 5B3JF 3P4LA 3SGEH 5E6ZA 4YDJB 1PY9A 5D1QD 4NZRH 1S78D 3AREB 2BVTA 2ZUXA 1WBXB 5DJ2B 3DWTA 3WNOA 2J12B 3DV6B 1XCTB 4F7PA 4R90H 4M9PA 3DO3A 3GMOA 3M1BA 4AT6B 4JPIA 2Q6WB 3VFSB 3WFHA 2OZ4L 4ODUB 3MFFA 3DROB 4HS3A 4YQXH 4P2RB 4IHOB 4CVWA 1GZQA 1KN4H 4BZ2H 1BQSA 1NFIB 5LWYH 1YMMB 3MV9B 4WENB 2Y1VA 3MV8A 5I17B 1S7WB 4YXKL 4PJ7F 1BQHG 3QNZB 2XA8L 1XGUB 1IBGL 1JV5B 4IDJH 5IMOB 4LRIC 4OM0H 1JE6A 4OGYH 5EU6E 4BM7A 4F58H 3MBXL 3PABB 1S7VA 3MRMA 5BJTA 4GW4A 1BZ9A 2B4CL 1OT2A 4G80B 5F6IB 1QLFA 2W9EH 4HGKC 2ICWI 3LVEA 5IB4A 5L8KB 4POUB 3K4AA 2ITCA 4MAYB 3D85A 3QJHA 1ZKAA 5JHDE 3O3BA 5IVZA 2E7LC 2FO4B 4XMPH 4M5ZH 1SYVB 1ZHLB 3LS4H 1KPUB 5J6HA 1Y0LA 15C8L 3NCCB 3VXOB 2X4RB 2GFBB 1S7RA 1IAKB 3RWIB 4DUWA 2X7LB 3EYOB 3O81A 1MCCA 2OXHA 4OFKA 5DMGC 5D1QC 1FV1A 3S36L 1WBYA 1IZKA 2IH3B 4RCAA 4V1DE 1C5CH 1JGDB 5J06A 3QXWA 1YEIH 2YPLE 2FR4B 1X5XA 5A1AA 3QEUB 1IGIL 4JLRB 3TFKC 1I9JL 3G04B 4XP9H 3GI8L 2RHEA 2VXSL 1MPAH 1A9EA 1QNZH 1SJXA 5JIKA 4QXGH 3HRPA 1KB5L 1YEIL 4P2RD 5JA9A 5DD0H 1J8HB 4ZUVB 1WCBB 4TVSa 4IMKA 1YMME 3D3VA 1EHLL 5T33L 1J18A 3IAGC 2VE6A 3H42L 8CGTA 4X99A 2R1WA 2SEBA 3DYPA 2D31A 1QBML 2VQ1B 1HSAB 3AS3A 4MNGE 1FZKA 2V2WA 4GRMA 5IHZA 1YYMH 1J05A 2DLFL 2IWGA 3H7BA 1PEWA 4D8PA 2DJ4A 3B9KD 4JZNB 4X5WB 5BQ7B 4PJEA 3GUTB 3RUGF 1FFRA 3KWWA 2VERN 2VLLA 3KXFE 3EKCA 3DX9A 5IVXA 4X6CA 1ADQH 4LCUB 5IESL 2IGFL 1IAII 4CW1B 5HI5D 2UY7A 1T0MB 1DQLL 5DURD 3VFVB 1JF1B 3B9VA 1BECA 2WBJB 3S5LB 2ITDA 5ANMB 3H9HB 1YN6B 4XBGA 4JO2H 3FQUA 4I2XE 3GDBA 4ZFOB 1UCBL 2D7TL 3BEVA 4TVPE 3MNVA 1YEEH 2F5AL 4ZUUA 3P77A 4PRPD 1UXSB 2XN9B 5D7KE 1A1MB 2AK4E 3GGWB 2ZG2A 5ESAA 3GMQA 2GT9A 3TV3L 4FQ1L 2IAND 4NQXB 4GXVL 4PJFA 1GC1L 3KPOA 1OAQH 2PTTB 8FABB 5IFJB 3GSVB 5FECB 1WZ1L 1LE9B 3Q3GA 3IFOA 1FVCB 4PJ5E 1NL0L 2AJZA 2QADD 3WFZA 3L3HB 4OI9A 4BQCA 3WKMH 1FJ1B 3V0AC 1AGEB 3UZQA 3LZFH 4UT6H 1YDPA 1YNLH 3NABL 1WCQA 3NPSC 1N3NA 4LVOB 3TP4A 3LQZA 1MCWW 3K8KA 3DECA 3SQOH 1GC1H 4O4YL 2DQDL 5DZNA 4GAGH 4ZFFA 1GC1C 1JHTB 4K71C 2FH8A 4OV5A 4OCSL 3FFCD 1JWSB 2YZ8A 3S97C 4QNPF 1J8KA 3V4PH 2MCG1 4YHPB 3RTQA 2I60H 1ZT7A 4PGCB 4MA1B 3IDNA 1E6JL 4JY5L 2R2BA 3BIBX 5JIPA 3EHBC 3IU4L 3JSSA 1MHPH 5AEAA 3ISWA 3GSUB 5E2TL 4QTHB 3MLSL 4JKLA 1P9MC 4NN7C 4X98B 2XZQL 25C8H 3HZVA 3D2UA 2FYYA 4NJAH 1TVHB 5GZOC 1TJIH 4FQCL 5EZLB 3RWEB 2VDPH 3FT3B 3BRFA 4LU5L 4Z76A 1AGBB 4QRRD 4HF5L 1WWWX 2R4RL 3IKCB 4NP4H 4LSQH 4YFEA 4OCRH 4BSVB 1T20A 4G8GA 3PL6D 3T77A 5C6TL 4LPWA 2Y5TA 4JFED 4NGHH 3FN0L 1KIRA 2IANB 3T3MF 4YGVB 5FKPB 4P0DA 1MCOL 2CDGA 4QOKB 4LQFL 5B8CA 4P9HL 4A6YH 2FWOA 3H42H 2ZNXA 4JHZA 5CEXB 1S3KH 2NY0D 2EYSB 3UBXG 4X7EC 3WE6A 2AXHA 2QKIB 3VFTB 4JVPA 5B3NA 5DGRA 3C8KB 5GRJH 4CRPA 4QRQB 4P9HH 3BPOC 2YPLB 3TH3T 3GSWA 1HN1A 5DFWH 1NFDF 2FECL 1BD2A 3L6FB 4K94C 4JM2A 4L8BB 4ODVH 4WHTA 2HWZL 4OGXH 5EU3A 4W68A 3WUWA 4HHAB 4RZCB 4URTB 1LQSR 1I3VA 3TIDA 5ENWA 1NUNB 4YE4L 1MHCB 1MHCA 3ABZA 5BZWB 4Z7UE 1CICC 1T4KA 3BEWA 4HIEA 5AZ2L 3P4NA 3WLWD 1FDLH 5BMFL 5HI3D 4XCFL 4KJWC 5FCUH 2P7TB 1JMZA 1V5JA 4ZS6C 1IKFH 3NA9L 4HC1A 1H15A 3C87A 2W0PA 3DVIA 4XNMB 1UWGH 3HUJB 2HG5A 4MNGA 5FUZH 1EPFA 4IOFC 4G6ML 4MB5A 3NZHH 3O2WH 5MHSD 1B0GB 3GFUA 1JF6A 2A6JA 4DUVA 5ELIA 3ZYJA 1XZ0A 4NQDD 3P30L 3T04D 4HCRH 3E1F1 3ARDC 4YXHL 3QEQA 2GQHA 4M48H 1RFDH 1LNUB 4JM2B 3HAEG 3DRTB 3GRWH 2ZJSH 1MAML 5HSFA 4Q9QH 3SQOL 1QRNA 5GSVB 1KENH 4JM2F 1A6TA 3X12A 4BELD 5AG9A 3DBXB 3QI9D 3CVHL 1UZ8A 1IQWL 4XVUC 3ARTA 1FL5A 4RX4D 2FYYB 4KK9D 4N0RA 4WDIB 4QOKA 5EBLB 2EKSA 1DQQB 1KG0B 3QA3B 4Y5YA 3CD4A 4HH8A 3C5ZC 4KHXL 2D7MA 4IRSB 4OLUH 3TESA 3L7FB 1INQB 1KJMA 2DIJA 1Z3GH 3RTQB 2D9CA 3NIFE 5B22A 3NN8A 1FL6A 4M7LT 1FO0A 1A7BA 3KPPA 2ICWJ 4L8CA 4S2SA 3UJJH 2FBJL 3ARUA 5IFHH 3MXVH 4TVPD 2DWEA 1GGCL 2IC2A 4PB9H 4KJWD 5DJDB 5HHOE 1L0YA 4IJ3C 4YEFA 2Z91B 1BQHB 1IC4H 4CUCA 4PY7A 3EO9H 1U42A 2BVPA 1R3HA 3E2HC 5HYQB 4CDHA 5C70A 1C7TA 4EKXA 4KGJA 4JPVL 5E1HB 4IIQA 3W82A 1OP5K 2FO4A 2AVGA 2ITCB 4MAYA 4DTGH 4DW2L 5IHBA 1MI5E 4MLIA 4KAQL 4XPTH 3UPCA 1ZLUH 1UJ3C 2RAMA 5T5FL 4UT9L 4DVRL 2NXZB 3HAEB 3A6CL 4GLRI 1HH9A 3MOAL 1RU9H 2C1OA 2OLDA 5ACMA 3SO5A 1KN2H 4C55A 1TZIA 4Y4KA 3RGVD 2PYEB 2EH8H 4JRYD 5DFTA 1J0HA 4YBLC 1I9RL 4U1MA 3DV4B 4XCYB 2NZ9D 3NACH 1KB5H 3RNQB 4RAVA 4NUJA 3S34L 1M05A 1T4KB 1YEFL 1XF5A 3BEWB 3KPOB 4Q6IC 4L4TE 3VXMB 1HKFA 4JAMA 3U46A 1AY1H 5K9KB 4L3EE 4RZCA 1M7IB 4LNVA 3MRRA 4GRLB 5F21B 3PJSA 2GJ6E 5D5MA 4UOW0 3BRDA 1EO5A 3IFLL 1MRCH 2IBZX 3T1WA 3WIFB 2R56H 4F7PB 4JO1L 4YHZL 1NMCC 1JNJA 5C6WH 1R5WB 5C09D 4ETQB 2W0KA 1BMGA 4AQ1B 3PP3H 1JGEB 1MCNA 2ITDB 1BVLB 3VXSB 4J3VA 2DQJL 1WISA 4M4RA 5AYUL 3TVMC 4JFDD 2VQ1A 4LLDA 1FYTA 3V6BR 5JOFA 4GMTH 3FMGL 1AXSB 3VXRD 1UM6L 4KTEL 1F5WA 5GS0L 2A2QT 5K9OB 3WFBH 3QXAB 4R97C 5EG6C 1XF4A 1N8ZB 1I3RB 5B39B 3EHBD 3JV6A 4DVBA 5C0GB 3GUTA 1YEDB 4PGBA 2V17H 1M6OB 1RJYB 5IQ9B 1A4JB 2VO5A 2YMXL 1OW0C 3Q0HA 2Q86A 4EBQL 4TRPH 5J3HC 5BVJB 2X41A 2YMXH 1CVSC 3M45A 2HJFA 3L3OB 3BDYH 1JNLL 1SEQH 4LPVA 4OKVA 4Y8DC 1BWWA 4FQLH 1JGDA 2Y25A 3HZVB 1L9NA 4OFDA 4ODHL 2WUBH 4JFEE 5D8JH 1A7PH 4K94L 1BM3H 4NFBA 3GM0A 5HHVL 1KXVC 3VH8G 3H9SB 4U7KA 3O11B 4QRSB 2YR3A 4HKXB 4N1EA 3VG9B 1IAOB 3BDBA 3I3EA 1WLHA 2VXVL 4JFOA 5KVEH 1UA6L 3BQUB 3U4EB 1V7ML 3O4LD 1WC7B 2E9BA 3VXOA 2J8UA 3O6FC 1K4CA 4JO3L 5DK0B 4OLXL 3STBA 1H9VA 2BNUB 1HCFX 3VWJC 3PHQB 3SO3B 3BP4A 3AU1A 2JIXB 2PTVA 3K81A 1JZ5A 4FQ2L 3BKCL 3QUKB 1U8KA 4XPGH 2J5LC 1WBYB 2HJKA 2IH3A 3L3KA 4U6TA 2A1WH 4MLSA 1N6UA 3O9WA 3EUUA 4Z6AT 3GIZL 1CE1L 1FFNA 1HEZA 1PVHA 5FKAB 2XPGB 1A3LH 2QBWA 2YPKA 4GRLC 1S7RB 4I4WB 4XP4H 4ODWB 1KEGH 1SMOA 4R7NB 3PV6A 3GNMH 2H3NA 2CDEB 3I9GH 2YA2A 5J13C 2FCBA 5CEZD 3PWVB 2V7NB 3VGFA 1CI5A 3PV7A 1T2QL 2G5BA 5FOBB 1ZEAH 3UDWC 1IARB 3IETB 3CLFH 1DBKL 3FQNB 4KY1L 4F9PC 3DSFL 5IEKA 2VLJD 5ALBH 4KAQH 4XPTL 1CDBA 4LPUA 5IMMA 3OX8B 1SJEB 4N5UA 2M1KA 4M7ZC 3IJHB 4ZUUB 4UUJB 3NCYS 1MSPA 1N4XH 5DQ9A 3MV7D 4Z0BL 4PJIE 3G5YA 5ANMA 2XQYG 4PD4J 2EDWA 4LLYB 3VFVA 1NGPH 1T0MA 5B3JE 4XGZB 1T21A 3N1FC 1MCBA 4G43A 3C5JA 4P4KD 1CF8L 1EV2E 2VLRD 2QV2A 3MXVL 4TUKH 2R2HA 2XTLA 5FYLH 5TF1H 3RIFF 1FLRH 1A9BB 5D7SL 1FNFA 2IG2L 4XVUD 4WW1B 4EXKA 2O5YL 5GRYA 4LEOB 4DZBB 4OCXH 5HI5C 4Z78B 4M1CD 1NKOA 4PJAF 1Z3GL 5JIHA 1KELL 1CIDA 3GMNB 4LLQB 3ZKQD 3FB5B 4WO4A 4N8CL 4OD1L 2YKLH 1A6UH 5GZNC 4QRTB 1E0OB 5CEZL 1RQ5A 2J88H 3OF6A 5E8EA 1IT9L 2EIZA 4JHAL 5I1JL 1TNNA 2E27L 1KB5A 7CGTA 3MA9H 1KULA 1CN4A 3HNTL 4IRSC 2LU3A 5F6IC 4HKJA 4KVCL 4OCMC 5CS7A 3KYNB 1JRHL 2DLHA 4HS8L 1MJJA 3V52H 4CVXA 5J9PB 2APTA 5KN5B 3U4BL 2XTJD 1IGJB 1NGXA 4M8QB 5I8KH 3ULVL 4PS4L 4GKNB 1NH6A 2E5EA 4KKAC 3BE1L 2F53D 1PD6A 4P3WA 5IMKB 4R4ND 1H8OA 4YHLL 2VUYA 4NO3B 1D9KA 5HHQB 4NN6C 4HK3N 4RQQA 2DL2A 2Q8AL 3CX5J 5L0QC 1ACYH 4APQD 5FGBA 1YEJH 3VG0H 1I7UB 4WUUE 1PZ5A 1KT2B 1R3KB 3EOTH 4Y2DD 2GFBA 4YDVA 4NKMA 4WFEE 2GIYA 2GJ6D 4MJ5B 4LCYB 3HNTH 1CZ8L 2Z31C 3L3OA 5SX5H 1D3CA 3QEGH 3BGFB 2YC1A 4BH7B 5C2BL 5AZ2H 1QA9A 3BZ4B 4X4XA 3VXME 3H9SA 1KELH 4Y4FD 3VW3H 1RK0A 2EO9A 1QYGL 4OCWH 4Y2DB 3TNNA 3SKJH 4AL8L 3K2MC 3KS0H 4HIXH 3ROLB 3QCVH 1BGXH 1OWRM 5KS9A 1J5OL 3KLAA 4E0RA 4C59B 3ARGC 4ZPTA 4ZODA 1N59B 2LV4A 4Q7DA 5FYKU 3IDUA 1L0QA 4P2CG 3WIHA 3BT2L 1CS6A 3G5XA 3MLVL 5TJWK 1YQVL 5CLWA 3MRRB 2P42B 1M7IA 1AHWA 3RX8A 3VD7A 3P9LA 4Z0BH 4XNQA 4J6RH 5IR1A 1J1OL 4FQHA 4M1GL 3OKNA 2Q20A 4MJIB 4ODTH 1EFXA 1ZMYA 5I1LB 3QHZL 5MENA 1CU4L 4DKFH 1F4XL 1U92B 3PQYD 4X4ZA 3QWOB 4AEHH 2C3WA 1NBVL 2W1NA 2I25N 1EERB 1RIHH 2VXUL 5CSBA 4C56A 5HI4D 1NCWH 3H6JA 3QXDB 5D5MB 3OPZH 4NO0A 1OPGL 1A6WL 4ENED 4MYWB 1XMWA 3KJ6L 5E8PB 4H5SB 4F7CA 4EIZC 1A64A 2HFGH 3FO9B 4RAVB 4LEXH 5D7IA 1KCSH 4AH2B 1QLEL 5C0BA 1SM3L 1MF2L 2ORBL 3LIZL 3RVXC 4NZTH 3QPXH 1KOAA 3T0EC 2OQJA 2VZUA 3GJFA 4BQ9A 3KJ6H 4LDEB 1JUFB 3ILQD 4Y4FB 3L3GA 5T3XH 4WO4C 1A1NA 1BFOA 5E5UB 1R24A 3O6ML 3VWJA 3INUH 2P47B 2J6EA 5MEPA 4H88H 4OQTA 3TJEH 3SE4A 4HGWB 2B2XL 3BPCA 4R4BB 4ELMA 1JHLH 1FGNH 2JJVA 4FQXD 2WP3O 5LBSL 4BYHA 1W8NA 4XC1L 4BH8B 5JPMA 1HHJA 4HFUL 1QSEB 4CBPA 4PJHA 4LVOC 1KCUL 1JZ2A 3FZUD 4O02H 4ZD3L 1U3HB 4HKXA 5DJDA 2IPKA 1L7IH 1CLYH 3PWJB 2X70A 1AI1L 1JN6B 4MSWA 5BRZA 1TVBB 3FN9A 3EOBA 3SE3A 4KJQD 5ESVA 3VRIB 2HT2D 2FLRT 1CG9A 4NIKB 4OKVB 5CBAA 3KAAA 3DRQA 4Y5XA 1ORSA 2HJFB 3NGBC 1EEUA 4WTXA 3PWUB 5IJVB 4J8RA 4Y1AB 3WNKA 3LAFA 5E8DH 1JI1A 4P3CL 3ULUD 3MPCA 3TA3A 3ULVD 1QRNE 2VUOA 3HC4L 5E95B 3HCVA 3P4MB 3AS2A 4OSUH 1QO3A 1UB6B 4J1UB 4AIXA 4HG4J 1E6OH 1K2DB 3BOVA 4WHYH 1YNTA 4AIZB 1XF4B 3VGBA 2YRLA 4JFFA 1MLBB 2XTJC 2MQCA 1HQRB 5F9DC 4XCNB 5KVDH 3K4DA 4MWFB 1PEZA 3KDMB 5E99H 4FG6C 1Q0XH 5ICZA 3DUHA 3V95A 3QP3A 4OCLC 3AAZB 3JVGC 3MV01 2F8VA 2ZSVA 4RBPK 1IE5A 1H3TA 4ZXBA 3ZLQC 1SY6A 4APQC 1YEFH 3LEXA 3RY6C 4RFEB 3OSKA 3B9KA 2VZTA 1G7QB 2DQEL 5DEGA 4C83A 5F3HB 1GH7A 4TVPH 5MHSE 4PJBA 3QHFH 5DMIL 4PTTA 4XPBL 5K93A 3VWKA 4NO2A 4PJGE 4U6HB 5FGBC 5ECJE 4FFYL 2OK0H 1UZ6E 3VFMA 4L8BA 2ZWLT 5FV1L 2DLTA 3GSWB 4JFDB 4KK5D 4AMKL 3DARA 3T2OA 3JV5A 3S9DB 1KTLA 1NCUA 4DGIH 2QSCL 2YXFA 1FH5L 3C8DA 2YHGA 5FIEA 5DHXB 1PQZB 3WMSA 2Z31B 1FBIL 4YDKH 4R4FH 2EDKA 1L7TL 2CDGB 4NKOA 5A3ID 1KPVB 5KJRL 1W72B 2VLMD 4WHTB 4MJ2A 4X7CC 5EU3B 4K9EL 4EOWL 3MLUL 5C0DB 5C2UB 3GKZA 1T5XB 2ZUSA 2BSTA 1B9ZA 5C71A 5SWZB 3VI4F 1EEZA 1NUDA 1YEKL 3ZE1F 4MA8H 4LSPL 4M7KL 3B9EA 3T0AA 3O2VH 5I30H 1PKQA 3TYGH 1PDKA 1F8TH 4IRJB 3V0WL 4P4RA 3SDAB 3HFMH 4LIQL 4UILH 3WSQL 4X8JA 5HGBA 5B38G 5I2IB 4UINL 5HGDA 1AKJB 3GSUA 5C07E 2FNBA 4JHWH 2AEIT 5GGUB 3MNWB 3HCVB 1MF2H 3MACH 4ZO6A 4JRYE 2ZCLL 4AQOA 5GS0C 1OAYH 4HFUH 4YFDB 1Q72H 5EOCJ 2F8OA 5ACZA 4P49A 4Y1AE 1S78C 2BDNH 4ZXBB 5D7IE 1X4YA 1KGCD 4MSWB 1RUKH 4E9LA 3ARZA 5C0AE 3LQZB 1ZLSH 3BX7C 1A6TB 3D9AH 1S7UA 3LV3B 1TTGA 3QPXL 5M95B 4RISH 3OZ9H 3QHZH 4WGWB 2ATPA 2B8OT 1JPTH 4G6JH 4HULB 4X6DA 5DHVH 3JV0A 1D5BB 1DBBH 2EE2A 4I8DA 2OR9H 4W70A 4CJ0A 1LO3H 4TTDD 3PL6A 3G6DL 1LEKB 4MHHG 2W60B 3QPQC 1AQKL 4ONGL 3QRGL 4NQXA 3VXSD 1LK3L 4Y1AA 3H3PL 3MLVH 5J1TC 5GGVH 4BFGA 4PV9B 2ADJA 4L3ED 3SDDC 5HHOB 4QHLA 1MRFL 1FVEA 3DMMC 4JFXA 4WI9A 2GY5A 3RL2B 2YD6A 4R3SB 2VDML 5F1KC 1IAIM 3AMKA 5F1OB 4RMVA 3K46A 3MRJB 4GRLD 4HIEB 1TPXC 1B90A 3VWKB 5IG7A 4CAGA 3QCUH 4HBCL 3TNMB 5ID1B 1MCPL 3SKMA 5KG9A 1JYNA 3DVNB 3KPNB 5FDYA 1IM3B 3RZCA 3KLSA 4AG4L 1NBYA 1MHEB 1BD2B 4B5EA 4HDIA 3SKNA 5DYOA 5HHPA 2J5LB 1LP9A 4IIQC 4QRQA 5FGSA 2NXZD 3FQUB 5IVNA 4Z95H 2VJXA 4YHOH 2QKIA 3B2VH 3QYCA 4QT5B 3S5LA 1NMBL 2YUXA 1J7VR 3MTRA 3PWLA 1NPUA 5IFAL 5I8CB 3QQ3B 5SWZE 3LMJL 1CGUA 4OCYL 4AH2A 2NY3C 3ZYOA 1KBGH 1MCHA 2Y06L 1NCDL 3DX9B 2G60L 5JW4M 4ZOAA 1GHFH 4KI5F 3BWUC 3TT1L 3MCG1 1EIBA 4OIIH 4PJCB 3KYMB 3T77B 4JKPL 4OFIA 3NBNA 4UI2A 3RWGB 43CAA 4MA3A 3MV8D 3G9VA 2VDOL 2VOTA 3TBSB 2V9RA 1I3GH 1W0WA 1AQDB 1HI6A 4Q9RL 1U41A 2H6PA 1LP9E 3LDBC 3S8WA 4XMLL 1JFQL 3DYOA 4ODXB 3LRSA 2EDOA 3QDGB 4MJIA 4DCQB 5IJKA 3D6GA 3SGDH 4PRHB 3STZB 3ARBB 4ONHA 1JYXA 2UUDK 1OSZB 3CC5B 1E28B 1RZIB 5SV4A 2Y06H 1MREH 1FZMA 3IYLW 3NCBB 2FECI 3B3IA 4LCWB 4P2RE 2V5RA 1KPUA 5L9DH 5FUOL 4QF1B 5EO0B 2F5BL 4U1LA 2XQBL 1FFQA 5EUOE 4JDVA 3JTTA 4XAWH 5DGQA 1MNUL 3W5MA 2GY7B 5F7MC 2BNQE 1CGTA 2FRGP 3A6BL 3ZKXB 1JMXA 4ZUTA 2ADIA 2UYLA 3MA9L 3MROB 2O5ZH 4M9OA 3OAUH 1S7VB 2H45A 2VTFA 1ONQA 3LH2L 4P23B 1IEBB 5DK2A 5I9QC 1YUHA 4KKCD 3QZWB 3HG1A 2R8SL 1I4FA 3LPWA 3UTQB 1FVCA 3SE9H 1QA9B 1RMFL 5KSAC 1CGYA 3R06B 1NFIA 2WM0A 5GGVL 3BKYH 2Y7QA 1J0YA 4HKJB 4P2RA 3TYFB 5H37H 3RA7L 4XNZC 3OHXA 1G7PA 5D9SA 4X83A 5T1DL 5IUSA 4HLZH 5T1LB 4U1GC 1GPOL 3QDAA 4C56B 5CP3H 4M93B 3IKKA 2V5MA 3MR9A 4K8RH 3KG5A 5IESH 2I9TB 2NY6C 2CLVA 4PRAA 3MV8B 2P46B 3K2UH 2P5EE 4OF5A 4YUEH 4FTVD 4ZTPH 4WW1A 4G7VL 4KGLA 1BVKB 2HKFH 4QRPE 5EPMA 3HLAA 3P9LB 2Y36L 5F8QC 2OXGA 4GKOA 4EDXB 1I85A 1OTSD 5EU6B 5EZIL 3KWWB 5IKCA 4LLYA 5A2KH 1KENL 5E2VL 3KPRA 3T4AB 3D87B 1AR1D 3CSYB 2EYRB 1N2RB 1ZEAL 4OLEA 1UC6A 4PJIB 1C08B 4TUOB 3JTSA 4NNPL 1MCEA 2H2PC 2ZOKA 3UTSD 3WNPA 2DB8A 4BZ1H 5H37G 2BDNL 3VMNA 4KKBC 2NXYD 2XKSA 2VE6B 3LIZH 2GJZB 2WUBL 1SVZA 4DZBA 5E2UL 4M6MH 3W5NA 4LSDA 5DURB 2F5BH 1H3WM 3MLZL 3QSKB 4FQ2H 4QKXB 3VXRA 1F2XK 4JRXE 3U2SB 4B7LA 4XP6L 1GGBH 1Q94A 3TGXA 3ZL4H 4JLRA 5TDOB 2XYCA 3EFFB 2MHAA 1GCFA 4X80H 3FO1A 4YDVB 4PJ8A 3SGJA 4NT6A 3VXPB 1DQJA 2PW2B 5CWSB 5SWSB 3CMGA 3MRFB 4JJ5B 5GS0H 3BJLA 5DHVA 1FFOA 3MRFA 4LSSL 3OKOA 4ODHH 1F4YL 2X4NB 3ZDXE 5IT2H 1BJMA 2JIXA 1HH6A 1OGTA 3BP4B 1TMCB 2I5YL 5E7BA 1QP1A 5SX5K 4PJCF 1OF2A 2G2RB 2W9EL 3VXQA 3ZT5A 3MRHB 4OIIL 2D0FA 4RDQF 3RI5F 5JA8B 4NQDB 2PKDA 1TXKA 3MLTB 5KN5A 4YH6A 5DZOA 4LLVA 3BT2H 5I74C 3DXAE 1F4WH 2XG5A 2DQTL 3IFPB 3KYNA 5IB4B 2OCFD 4RMWA 2GTWA 5SV3A 5DUBA 3STLB 4NQSB 5D5MF 3BMVA 3QDGD 4PJEF 2D7NA 1T2JA 3D2UD 1AGFB 4UDUB 1A14H 3QNZA 3SPVB 1XIWD 2NY1D 5IEHB 4OCWL 1ED3B 3C6SA 1U8KB 1N2RA 1BFSA 4Y19E 4JDVB 4PGBB 3MRNB 3MJ9A 1RV6X 1ULVA 5DSCA 2IADA 5C0FA 1OY3B 2AQ2A 3HZMA 5DK0A 5T5FH 3UZEA 1OGAE 3GHEL 4ODUA 2R0LH 4OGAC 3MJ7A 5D2LF 1WC7A 2X4SB 1JNNH 4JY4A 5E2JA 4R2GB 1V7NL 3B6SA 1Q1JH 4OSUL 5EUOA 4UBDC 4MNQA 4A2MA 1MJ7H 3DGGB 4MQTB 1ACYL 4GS7B 1U93B 1VACA 2A6KB 2CR3A 3ZKMD 2N7AA 4G6FD 4YHNB 2H9GB 2IH1B 3RJQB 3JTSB 3OKDB 1GRWA 5CD5D 2NY7H 3ZHLA 5F44A 5K9JL 4ESKA 5BVJA 3DTXB 3U6RB 1BZQK 4WFFE 2CMRL 5ID0A 5IEKB 3KYMA 3CCHA 2VLKD 1N26A 2OR9L 5HBBA 3FQNA 1JNHB 4G6AD 3S37X 2J7LA 4CL7A 3RKDD 3CU1A 3MRQA 1I85C 2AEQH 4ZDHB 4RISL 3PUCA 1ZHBB 4JQXA 5D6CB 4YHML 2DLGA 3GB7B 4GG6B 5DHYA 2CDEA 2HN7B 5MEQA 5EPMB 1G9NH 5TDPB 1CK0H 4I4WA 1HILB 3SDDA 5TQ0H 3JBG7 4Y16D 3HE7D 4C4KT 4L3EB 4NNYA 3GI9H 5ADPH 1KCUH 1R5WA 4U0RB 4HDIB 4J4PD 5LQBH 3SKUD 1R3JB 3MLZH 3PJSB 1BAFL 5F9WC 5EO0A 2Q8BH 5FM8A 4WGVB 4H88L 1QUNA 4DJMA 3SKMB 1MAMH 2KUTA 2PF6A 4NPYB 3D48R 2R1YA 2IAMB 5JORB 1Z5LA 5DVNA 2DTMH 4I9WD 4HSQA 3U9UB 5A2IH 2GSGB 4PG2A 3VXTA 5ITBH 4FQQB 3BH9B 2LFGA 4NNPH 5BS0D 5H94B 1GXEA 5KVGL 3WD5L 5BOZG 3LB6D 1AR1C 1D6VL 2NY0B 2W9DL 4G9FD 4YHYC 4S2SB 1KCSL 2R0WH 4NN5B 2XY1A 1KLUA 3PDDA 3QG7L 3ARGD 1NCCH 5FXCH 3BWAA 3CVHH 4E41B 3EJZD 1IFHL 3BHBA 3MMEB 3MRGB 1WBZA 4APQA 4NCC1 4XBPA 4FQJL 1N6VA 4JY6A 1KJMB 3ORJA 5BMFH 3RI5K 1IC7H 3OGCB 3P73B 3V2AR 2HRPH 5GS2H 4QF1A 3NFSH 3NMEA 3ILPB 1BF2A 3VA2C 3MGTB 4U3HA 1IAIH 1FSKB 1LDPH 1ZT1A 3D39E 4K23H 2WBJC 3F7YA 2FGWL 2VZ3A 3H9SD 1XR9A 4WV1B 4UDTB 1S9WB 3PNWB 3ZE0F 4ZSOB 1IM9B 3B9AA 4OJFL 3L5WA 4ODSH 2YSSB 3M17B 4O2EB 4HIJA 4PJ7A 5GRVK 5FYKL 5I75C 5I71B 1OARL 4UOW1 4XPBH 3BH8B 3MREB 4M3JA 3MV9D 4LCCB 4TVPL 3L3DB 3ZTJG 3SY0B 2AEWA 2DKUA 2XFXB 3IDJB 3T4YA 1JJUA 5CIPB 3EJYC 4NQCA 5FF6A 1MCOH 5EZJA 1YMHB 1M7DA 1H0DB 3ULVF 2F74B 1DQQA 2OBGA 4LFHD 3QFJE 2AXGB 4N0UA 5KW9L 4DN3L 3BYTA 4YWGL 1A7PL 4K94H 2PYEA 1SBSH 3RGVA 1I3GL 2DBLH 4ZUSA 5IMLA 1YPZE 5LXGH 4JFDE 4U1NA 1I7RB 2XQBH 4QHLB 1G9MH 4S0TD 1F11A 1NEZB 1P7QD 3P9MA 2N56A 3ARED 2XZQH 4TRPL 3U79A 1Z6JT 4OZFB 4C56D 3SKNB 3TT1H 3Q6GH 2NY1C 1J0JA 1MHEA 1EAPA 1LO5A 1I9IL 1NBYB 5JW3L 5I15H 2HVKB 4NO0D 5GHWL 5IW3A 5IF0A 4WY7H 4PS4H 2V2TA 5EO1A 5D71H 5FO7B 2JCCB 1B6DA 3LMJH 2UWEB 4AM0B 4P3CH 1HKLH 4U4BA 4H8WH 2N7BA 3C8KA 1KCKA 3TN0D 2XKNB 4K7FB 3TVMD 5C09A 2VL5A 4YXLH 5HYJB 3BVNB 1F4WL 2BOCB 4HZLB 4UBDD 4F2MA 3HMWH 5BW7C 4FFVD 3DXAA 1MUJB 2IALA 4G3YH 4U49A 3TN0C 2DBJA 4JFDA 3ARPA 4O4YH 2YD1A 4WI7A 2VDNL 1FYTD 3HZYA 4MZ3A 2YKLL 4ERSL 4MAYC 1CGSH 1ES0A 2AW2A 1HDMB 4XXDB 5D7JC 2LVCA 4O9HH 2AKRB 3O3EB 2X4PA 3O3DB 4LSSH 2BMKB 4KRPB 4LLAA 1HHKA 4C83B 5AG8A 3TIDB 1TCMA 3BESR 5E5MB 2A6DB 2R2EA 4JPKH 3U1SH 5TF1L 4ZMAT 3KYOB 1FNGB 2EDYA 5I2IA 4NM8L 4M7JL 1CLZL 4GUPA 4JPWH 1CF8H 5KVMC 3WLBB 1AD9A 4RGMC 4QXUL 1A7NH 1OGAA 3JVGA 4IRJA 3PNWA 3NZ8B 1PKQB 4KK8C 3F7YB 5F7YC 1YEEL 2F5AH 5BV7B 2OL3A 1FLRL 1MI5B 2YWYA 4QRRE 2IPUK 3QG6B 4U2ZA 1YYLH 3DX6B 2HFEA 2XA3A 1E27B 2HFEB 4G8EA 4NRYB 4PGDB 1JPTL 1W72A 4G6JL 5BZDA 5E94B 1RURH 2HTLC 3MNWA 5IHUH 4J8RB 1XH3B 1YEGH 1FNHA 1N4XL 4HZAA 1GZPA 5FDWB 1N3NB 4JFFD 2FX9L 4AEFA 4NO5A 3GJFK 4U6XA 4CVZA 3GNML 3C09B 1E4WH 3SBWC 5JMRA 3LS5H 2GK0B 3AS1A 4JG0L 3J7HA 3G5ZB 4TUJB 3GSVA 5SWZD 4D9LL 5F97E 1XAUA 1G9EA 2AGJL 4JQXC 1YPZB 2RJMA 1DQLH 3JV4B 4UQ3B 5F93C 3I9GL 3ZKXC 3UEZA 5DJZA 3VH8A 5DD0L 3ULUC 5FEBA 5E8OA 3LEXB 1B4RA 2VLME 2ARJQ 2ILLA 3MRIA 1A3LL 2BSSA 3D69A 1E4XI 5IW1B 3MNVB 2EO1A 2PW1A 1N5AB 2OP4L 4F7TA 4LLUB 3QDJD 5HD8D 1BGXL 1YEKH 4KV5E 1I7RA 2V5YA 5F7LB 2BRRH 4KDVA 4MXWH 3VXUD 1F3DH 1SEBB 1NDGB 1B0RA 1EDQA 3N1GC 2AJZB 4QRUA 3RDTA 3BI9X 1MLBA 5HDBF 4HMEA 1T1WB 1JBJA 1KV3A 5F71A 1RK1B 1L7TH 3HR6A 3U30B 3BDYL 2VLLB 2QHRH 4P57A 1I8LC 4H5SA 4XTRC 1YY9C 4HEME 5F3HA 4NZJA 4D8PB 1G0XA 4NQVA 5F72S 3LKOA 1T04A 3DTXA 3A6BH 3MBEA 3DUUA 5JMOC 3O2VL 1GGYA 5AUMB 1UJ3A 3GKWL 4N0UE 2ZOLA 2RB8A 2SEBB 2BERA 4MMXC 2W0FB 1I1FA 2AXGA 1IKFL 4WW2B 1P4BH 5K9JH 3QDME 4JREB 2OJZH 2X2YA 3RVXD 5DMIH 2UUDH 4M43L 2JK5B 2X4OB 4NZUL 3F7RA 2R2BB 4QEGA 3T0WA 1P6FA 5DO2C 3IJYB 4F7MA 3VFRB 5I8KL 1LP9F 2Q76B 4LP5A 2WV3A 3HE6D 1WIUA 2HJLB 4FTVE 5IVXB 4PJXE 3L7EB 4ONFL 4UV4H 2FIRT 1TFHA 4OZHE 3HC0A 2QSCH 4ODVL 3AM8A 2F53A 1ZWIA 4U1IA 3RQ3A 3DMMD 4TULL 3GHEH 1E4XH 5D1XB 4UDTA 1D9KD 1RJZA 2R9HD 4Y5XC 2VAJA 1FQ9C 4D9QD 1F00I 1QFUL 2YOCA 1WUNT 3QFJB 3W2DH 1KBGL 2XWTB 2JELL 3L3HA 5C0BB 5DUBB 1RZJH 1WZLA 2GTWB 4IDLA 5H94A 5FHAH 1ND0A 5F7NC 4MDIB 5F88B 3IFPA 4JG0H 1F3JB 5FECA 3NCJH 4S1DC 3RZCC 3GRWA 2BVEA 4WUUA 2BCKA 5TE4H 4Z0XB 4XTRD 1EK3A 2EH8L 3UYRH 4YNYB 5T1KA 5GGTA 4OT1L 1F6LL 4CNIB 4QYOA 4LU5H 5JUEH 4IEFB 3WFCL 3AB0B 4OF8A 1JV5A 2Z93A 1H3VA 5DHVB 3MRCA 5J11B 3O41A 3H0TA 4P5KA 4L3EA 1FVDB 1T0NB 1KCLA 3CDGA 3TBYB 3WO4C 3D0VA 1H8SA 4QY8B 3HC4H 4Y4HB 2NX5B 3TBVB 1LGVA 1RZ7L 3GSRA 1V8HA 2VDMH 3ECBB 1KNOA 1J1XL 1N0LA 4X4ME 5CBEA 5DRXB 3TIEA 5HVFB 3MJ6A 4Q97A 1BJ8A 1HXMA 4P5TB 5TH2A 1BLNB 1CLZH 5ERWA 3MV8E 3IDYB 1LVEA 2CR6A 1NLBL 3RZWA 1E4KC 4JKKA 4W4OC 4MXVF 4PJDE 1M71A 4POZD 3HS0A 2EDQA 4GG6A 4KMTL 3BJ91 4L3CA 4G9DB 5E4EC 1OAZH 1DBAL 5IOPB 3QWRA 4A6YA 1EX0A 3RTQD 3DX8B 3QQ4A 1FNLA 5IR1B 3D1MC 3KPMA 1MFNA 2VDRH 5EBWB 1BX2B 1V7MH 3HMXA 1AKJD 3HZMB 4YXHH 5E2VH 4D0BB 1Y6KR 5EZOL 1NBVH 4FMKA 3L5HA 1TJHH 5DMJB 5FYLD 1BFTA 4H8WL 4TNVK 3ARSA 4PTUB 2A77L 4MNQB 2IPTH 4P2OA 3ZKNC 3OBAA 3QB7C 4G8GD 4V1DA 4HK0B 2HFGL 1UH2A 1YECL 4FXLA 3QUXD 4YAQA 4K2UH 3CVIL 4J4PC 1U91A 1EO8L 4MB3A 3DLQR 3O8XA 2A6IB 3UO1H 3RVTD 4FHBD 3F12A 1PG7L 4MDIA 5F88A 4WFFD 3VXQB 3UBXA 1OF2B 1RULL 1G7LB 1CXFA 5JW4N 5E6IB 2CO6B 2X1QA 2YPLD 4XCFH 3VRLE 4EXPX 4LKXA 4LPTA 5D72H 3OAYK 1QBMH 1TTUA 3OKYA 5JLZA 3NIFF 5I76B 4WUKH 3PWPE 1DP0A 4FRWA 4KROD 3R0NA 1OARH 4F9LC 2A6IA 2AAVA 1U8PB 3EGSA 3QEGL 1LO2L 4GKNA 2ZG1A 5EORH 3H7LA 1A2YB 2EDJA 4OLZL 4LQFH 1MPAL 3CJJA 3QDJE 2W0LA 1G7JA 1U95A 2VZOA 3L3IA 3X11B 1IJ9A 3GMOB 5EBGA 3MX0A 3ARBA 4DCQA 1U2CA 4DOHE 2GJZA 2E8YA 1NCAH 1QFWI 3IDYC 4XCEB 4I2XA 1ZANL 1ZVSB 4PRIE 3BE1H 5FUCC 5IB2A 1N6QL 2DAVA 5KVFL 2EXYD 4YDJA 4MXQC 1UXWA 4NQEB 1U8IA 3C5SB 2UZXB 4KDTA 2K7QA 1YMMD 2DQCL 5DFVD 2IF7A 3C8HA 3Q48A 1B6UA 2RCSH 4H25A 5EB9A 4PJAE 5DLML 2XOTA 3SE8L 4OZIA 4LSQL 4DKAA 5DDHB 1JL8A 4KC3B 4KQ4H 4KVCH 5JHDB 4LSUL 1U3HC 4QHNB 2VDOH 4PREA 2YUWA 4N90E 3EJYD 3GMMA 3SCMD 4WRLA 1P2CA 3JWOC 4EVNA 3EO9L 1QACA 7FABH 3WNNA 1M7XA 1GJIA 2AK4D 3TBYA 5EOQL 4F3FB 1I8IB 5ERWB 5E2WL 1GGCH 4UOJA 4F7TB 2I9TA 3KPRB 4GAJH 2Z93B 3T4AA 1BJ1H 2F53E 5BO1L 1KTKE 2UY6A 5D6DC 4ELKB 5DD1L 1MIEL 3IXTB 2WLZA 3SQBA 4L4VD 3V52L 3RZCB 3F5WA 3RP1A 3OJDB 4U6VL 2OJEB 4OD3L 4B53A 3RWCB 4XNUH 5BXFA 1C5DA 4HUWB 2ZUQC 4K9EC 2VDRL 2FEDC 1XFPA 2VLKB 4XXCA 5CEZH 1M05B 4I0KA 4K3EL 1F90L 1CDCA 1OLLA 1WFNA 1G1CA 1JGVL 1LD9A 1QFWL 4MA7H 2XTJE 3NAAH 3HC3H 5D2NC 5DR5L 1DBAH 4XB8A 2H3NB 4WFGD 1EZVX 4LKXB 3KGRA 2D2OA 1XIWC 4KQ3H 3HB3C 4OF7A 1AIFB 1J86A 3LN5B 5FAAA 4PY8J 4PJ5A 2F54E 2CUIA 3KYKH 5DD3H 3MYZA 3FQWB 3FFDA 5E9DB 2HJKB 3L3KB 3RDTC 2JIXD 1A4JA 4GS7C 1DN0B 4MAYD 1HK6A 4Y5VB 1YC7A 4L9LB 3ZDZE 2FIKA 2X42A 4O5LH 1U91B 4FA8A 4LPXA 5CUSL 1Q9KB 2VITA 1FZMB 3EFDL 2Q76A 4L8SC 4MVBD 5HPMB 1C8PA 1MI5A 2BY1A 1A21A 3P40A 5JO5B 4JRYA 4QRSA 2CPCA 3QDGA 4N0YH 4N0FA 4EN3A 1KFAL 5FHBH 2R4SL 4FS0A 4M7LH 4N5EC 5JW5A 4CVUA 1FDLL 4YHKH 3GZKA 1KEML 5K59E 1N6QH 4U1JA 4Y89A 1PX4A 2VZVA 3VXSE 5ACZB 4LCWA 4EI5C 4MA3B 2W9LA 3TPUA 1SVCP 2KQMA 1A14L 4GW1B 1A5FH 1VFOA 1YEDA 3E8UH 5I1HH 3L7FA 1PYWB 3O3DA 2AS5M 3B8YA 3QUML 1ITBB 5HYIA 2CRZA 1WV7T 1T22B 1BM3L 3RNQA 2GJ6B 3W0WD 5F7DA 3GI8H 3F6IA 5DUMH 3LKNA 4ZYKB 3G6AB 5JOFB 2ZOLB 4RWHA 1L9MA 1M71B 2HAZA 4JHWL 3FOMB 2NY4B 5EU4A 5KS9E 5F9JA 1IKNA 1AR2A 3SOBH 3QCTL 1UM5H 2PW1B 1F6FB 1C5BH 2DICA 2DF3A 1EXUA 5HHNA 3TYGL 4X0KA 4E5XB 3CLEH 3T2PA 1U36A 4YEEA 2XQYK 1MCIA 4Y4HA 3C6LB 2APBA 3D0VB 4KRMB 3ZKND 3LQAL 1U58A 5GGTL 3RU8L 5HGAB 4KK9C 5ICYB 4GBXA 3L3JA 4JANA 2C3VB 5GZOD 4ZAKD 1RZKH 4PJXF 1RZJC 3LD8C 5HHPB 3T3PE 4Z7UA 5IW1A 1EGJL 1EMTL 2C1OB 3CVHA 3O4LA 4U1KA 1UZ6F 3DPBA 4DK3A 2Y23A 3GBML 3P3YA 1U8HB 2HMIC 5KG9B 2NXYC 1CBVH 4Y2OA 3C2AH 4GMTL 1NC2B 1CQYA 5DJYA 2EH7L 3PL6B 4FFYH 2OK0L 1AC0A 2C7UB 4PRDB 3SDCD 1SQ2N 1HHIA 4XVJL 2HH0H 4X6DB 5EH1A 5KSBB 1F3RB 1JZ8A 5CFHA 3T0EE 1REIA 3GIVA 4RRPG 4K8RD 5LGHL 1RU9L 1FIGH 2P8PB 3O0RL 1TZGH 2XZAL 4WEUD 4YFLF 4BZ2L 1K5NB 2NW2B 1J8HD 5C0NC 1MCFA 4DN4H 1G7HA 1AGDB 1DDHB 4U1IB 1JGVH 4MA7L 1EUUA 3LCYA 2E27H 3HC0B 1KYOK 3ARGA 2P5WD 4N9GB 4KRPC 1OAQL 1NGQH 5I8OH 1KIRB 4P3DA 3S37L 1JPFB 1KLGB 1PSKH 4JEGB 1I9RH 4G8GB 4XBPB 4PRID 2BSRB 1DE4A 4LIQE 1LEIA 3MV7A 2VZSA 3LD8B 1MIEH 2JE8A 3OKEA 3RPKA 5DJAB 1OD9A 4YGAB 5D7SH 1HSBA 5DC0A 5IFHL 3K0WA 1I1FB 3D25A 2XWBB 2DI8A 4GUPB 1UQSA 2OL3H 5DD6B 3HG1D 1EVUA 2IPKB 3PWJA 3V7AG 5EOCL 1JCKA 5GRUH 1MVFA 1PG7W 2VLRA 4HMDA 2IGFH 5JTWA 4TTGA 1CL7H 1HHKB 4BH8A 2CKBL 3FAWA 3NIDF 5GGUA 4JJHA 2DQGH 3GEWB 4PJ8C 3T0ED 3UYRL 4LOUC 3EYUH 4HGWA 3V4UH 4O02L 3LOWA 1BWMA 4MZ2A 3CVHB 5KANG 2R0ZL 3E6FB 2P5ED 4X0KB 1VCAA 4Y0GA 3VWJB 1YYLL 4FXGA 1MFDH 4X6FA 4UV7L 3WHE1 1BFOB 1A1NB 1RHHA 5IM7A 3TZVC 4ZUWB 3KPLA 4UB0H 4L1HA 5LAXA 1BPVA 2NY3D 1H3PL 1RUQL 3T3ME 3KPLB 2Y4SA 2FJHB 4PLNC 1NKRA 3MODH 4EI6B 3BAEH 2XY2A 5KSUA 3U7AA 4U1SB 4CGTA 5F7DB 2HLAB 4HXBH 2R23B 3OR7B 2PR4L 3FZUC 3IB4A 2DRUA 5DRZB 1KJVB 1M7DB 1JK8B 3QQNA 1JIBA 1SJVA 3JV4A 1JF5A 1BOGB 4LSVL 1KUMA 3NZHL 4LRIA 2WBKA 2BK8A 3TPUB 4XPGL 5EO9A 2VN7A 5TE7L 3FT3A 4HXAH 3UTSA 1NC4D 1IGTB 3P4OB 3TN0A 2NY3B 1RUAL 3TVMA 3QZWG 3QUYB 5D2LE 4KWUA 2QR0B 3GMLA 1R5IA 4NZUH 4OZHF 3MXWL 4NO2B 3BXNB 3Q5TA 4I0PA 3IDIA 4X9BA 3B6SB 5KSBF 4D0DA 4NQCB 5FF6B 5DEGB 2X09A 4JY4B 3QEHB 4Y5VC 4ZPVA 1Q9KA 2VITB 3CLEL 4UAOC 2IANE 4G6MH 3WFEH 4NM4H 2I26N 1J1OH 3G6JF 4YIQB 4Z7NE 4NHUB 1SEQL 4X8XA 4Z7WA 2UWEF 3U83A 4ALAH 3VXRE 3MRPB 4G6KH 2P24A 1OP5H 1I8LA 1T1XB 3F8UB 4NOFA 1HIMH 2OX5A 3OKKB 1HHGB 1G9ML 3AUVA 4Z7VF 4HV8A 4X99B 1TCRA 4X98A 5IK3B 4IRJD 1ZA3B 1V3JA 4DZ8A 4I77H 3I6GB 4HJ0D 1RVFL 1RUMH 1YNTB 4OM1L 4X6EA 3ZKSD 1F13A 3QO1A 2DIAA 4R96B 2C7UA 1HZHH 3RPIB 3E8UL 4P99A 1GYAA 4DKEH