3IFPB

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12b4) complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 12B4 FAB antibody heavy chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 218
sequence length 218
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB01
3G6JE 5D72L 1ADQH 2PTVA 4OLWH 3PGFH 2OJZH 3L3KB 2EKSB 5C7XH 3VI3E 4OLXL 4X6DE 5DO2C 3ARFC 5B3NA 5JR1L 1MHHB 3U46A 3IU4L 5DWUL 1AXTL 3EO9L 2GYSA 1I8MA 1FGNH 1ZHNA 5HHOA 4JRYE 4QHNA 5TQ2L 4UMGA 1IQWL 1MELA 5LXGH 4UDUB 1NL0H 4QCIB 3L5WB 5E2UL 1G9NL 2ZNWA 2BVTA 4J8RA 4NGHL 3JBG7 4HWUA 2E3VA 1OY3B 1JZ4A 5I8CA 1MIEH 2BSTA 4KHXL 5IIEA 5IWLA 5T3XL 4D0BA 4LEXH 3EJZD 1MCPH 3B3IB 4FABL 4POYA 5JTWA 1U91B 4N9OB 1OM3H 1OT2A 1CXIA 1U8HA 5BRZD 4WWID 1IFHL 1T66D 3HNTH 2J1KA 4HWNA 4ODVL 2ADIB 3TV3H 1DLFH 5AAMA 3VMNA 2GY5A 4HHAB 2BSSA 4P23C 1ZHKA 4PJ5A 4TSAL 5FF6B 5BVJB 4DUXA 5EA0L 2NY5L 1AXIB 5GSVB 1UJ3A 4Z5RA 2CKBL 3HC0B 3EOBA 1XCQA 1IGJA 2GSIB 1F4HA 4WU5A 5I1EH 4FFZL 2ZUVA 1B88A 3BH9A 1EEZA 5IFAL 3MYJA 3NAAH 2QQKL 2VO5A 1NC2A 2WBKA 4PV9B 1EEYA 1TTUA 4JPIA 4O2EB 4QHLB 4B7IA 2PYEA 1JFQL 1OTUD 4O51B 4GUPA 4NP4L 5F93C 3PG2A 3B9DA 4CADB 1FSKC 4M9OA 5E1AB 4KUCD 3WE6B 1TJGH 1VERA 2CR3A 3EKCA 4E0RB 2IFFH 4C56B 4XPHH 1YEIH 4KKNA 5FYJL 5JQ6L 3VJ6B 3OKKB 5I1AA 1U8OA 4RGOL 2EDFA 3WHXA 1QFWI 2WW8A 3OKNB 1WQVT 3UTTE 4WY7H 3H0TA 3BYTA 3WFBL 2OQJB 4XXCA 1SMOA 3DO7B 4ONFH 2X41A 3N1MC 3T8XB 3GO1L 2VLRA 4GSDL 1JNHA 4ODTL 4LCWE 1TZGL 4ONHB 3PWNA 4M1CC 4WFFD 4FTVB 3QI9D 5HVGB 1KPUA 1N4XH 2F8OA 1RK0A 4QRTA 1CXHA 5FUZL 3RDTA 2FHBA 1AD0B 4Z7UA 3C5JB 4M7KH 3B9KD 4M8QA 1HE7A 2ZWLT 3IDUA 4S1QH 2DJUA 3IDNB 5CS7A 1W8NA 1ITCA 4ODUB 3S96B 2X1WL 1CGTA 4R8WL 1MCDA 5C92A 3LKQB 3GSWB 3ARBD 3STZA 1FL5A 5D2NA 1LP9E 1A3RL 2AEPH 2IH1A 5KSBA 1F3JB 2HTLC 3EOTL 4KJQC 1A2YB 5BVPL 4QXUL 4JGMA 3SE3C 4DVRL 3C5SA 3VFWB 4EN3B 3ARSA 2XQBL 3MROB 4P2RA 5IBUB 2I9LB 3OKEB 3L5JA 1T3FB 3MUHL 1EGJA 4JFYA 1A6UH 1INDH 5CKAA 4S1RH 5FDYA 3T0WA 4OZIE 4NQEE 2X89A 3B8SA 5DFTA 2X6MA 4N9GA 3O2DA 4PFEA 2ZP0T 2C3WA 4OCXH 5EU3A 4P99A 5BOPA 1OAUH 3D2UA 1I3RA 2VZOA 4ERSH 3T3MF 2AV7A 3LQAH 4FMKA 4IS6B 2VL5B 4NCDA 1RI8A 3QIBD 3X14B 4M1GL 4KQ4H 5BO1H 3S8WA 4UBDD 4KAQL 1P9MC 2QHRH 2XOTA 1A1NB 1JPGB 3DVFA 4KK8C 3V0WL 2A1WL 5IVXB 1MWAL 1WVZA 3EYOA 2R69L 5JXAL 2IJ0C 4HJJH 3TBSB 2CDFA 5D1QA 1G6RA 3MZTA 4N68A 4PV8A 5DGQA 3R8BB 3AGVA 1I7TA 1X5ZA 3QA3B 4JFDB 3WFEL 2BVUA 1A7NL 4TUJA 1KJ2B 4K3EL 1A3QA 1ZT4B 1TTFA 1C16B 4J3WA 4OAWB 1LO3L 2RFXA 3EFFA 4X9IA 5FFLA 4OCNC 2DBJA 4R0LB 1S9VA 5E99L 3L3JA 4WI4A 3VFUA 4XAWH 4XVUC 3WIHH 1A4JB 5DFWH 5I8OL 3MA7A 4NBZB 1NBVL 1F3DJ 3MBEC 1HHIA 4RBPK 4PY8J 1SYVA 1DFBH 1CFVH 1D5XB 1FYTE 5HDBF 3HG1E 4HKZB 3RHWF 4HIJB 2DBLH 4ZO6A 4MHHG 2NY3B 4KJYA 1LILA 3EJYD 4TVSa 4PGZA 3VFNB 4M6NL 4PYGA 1NGYB 4OJFL 1BD2B 4P4KA 3GBLA 1F13A 4OZGF 3ZSTA 3BGAA 1DUYB 4D9RD 2GK2A 4JKKA 1F4XH 3BVNB 1G7PB 2P8MA 1NEZA 5IEKB 3TO4B 4X98A 2FX9L 1LNUA 4JFZL 2VKWA 2EEAA 3U0TB 2E7BA 1LHZA 3LH2L 1J1XH 3SE4A 5IK3A 1FFNB 2FR4B 4B50A 1LE5A 5LGKA 1CU4H 1U58B 1MFEL 1AQDB 3IXTA 3VXQA 1CXFA 5MENE 1OSPH 1HCVA 1JHKL 2AJYH 2BJML 4U1SB 3BE1H 3MRKB 4X8JB 5JXEC 1QA9A 1Z0NA 4KK5C 3SKJL 5EO9B 4UQ3B 3H3PH 4JHAH 2W9DL 4EVNB 1HIMH 4NO5A 4HUVB 3VXSB 1IAII 3ARDD 4POZD 1EJ6A 3AREC 4OZGB 4TRPH 5D7SH 3KR3L 4Y5VC 4X6EB 1RIHL 2A0LD 4P2QD 1NBYA 2AEIT 3IYLW 5BQ7A 4HKBB 2CK0H 2P46B 3BQUA 4AY0A 5J11B 5DUMH 2L4OA 1N5AA 4IRJB 3MV7E 5IMMA 1O5DT 1B2WH 5ADPH 4BQ6A 3OKOA 4I4WA 4LAJH 3ZKXB 4BKLB 5JO5A 1QSFE 1AY1H 1NKOA 2DQHL 1UM6H 2D9QB 1N5YL 3NZ8A 2XV6B 4TUOB 1UCTA 2MOVA 4LDEB 4KI1A 5C07B 3G5ZA 5FA4B 4G8EA 3O4OB 5FHAH 1JF1B 1WBZA 3KPRE 2CIKB 5FKAB 1YQVH 1G7QB 4XT1C 4YAQB 4PUBH 4PRNA 3MO1A 1DEDA 5HGGS 4OIBA 3MRMB 2ZSVB 2DLTA 4HKXB 4JZJB 1MCBA 3HS0A 1WFUA 2JCCF 4H88L 1JGDA 4N1HB 3FRPG 1X4XA 4OUUB 1LO2H 4OB5L 4ZS6D 2G5RA 1DCLA 2DQTL 3T4YB 1X5HA 2C3HA 3DXAB 4XMLL 4HXAH 3GGWB 2E8YA 5IQ7L 3F62A 1OARL 4PY8I 1I7RA 2HG5A 4ZODA 2YPLE 3C08L 1FL6B 3W5MA 2OR7A 4G6KH 2I5YH 5GS1C 1L6XA 2VDOL 5I9QC 4GQ9L 3CFEB 4MD0B 4HX1A 5BRZA 1BQLH 3MV9A 5DD6B 3VFPB 3GSOA 3FQNA 1D3CA 3V6OC 3IB4A 1S7WB 2XQYG 4K3HA 4ODWA 3T77B 3GMMB 4R97C 1JPST 3KPLA 4J4PC 3MODH 4MCYA 4DW2L 3LN4B 4GXVL 4M7ZC 2VH5H 4ZXBB 2VWEC 3OAUH 4FQQB 2FNBA 4FZEH 1U3HC 4NZDA 5D1ZB 1ZA3A 3EYUH 3VFTA 4CL7A 3LEVL 4LCYA 1L0QA 3RWGA 3LQAC 4LKXB 5FHBH 4BZ2L 1RZ7L 5LGHH 4K94H 2X4OA 4LOUC 5BCAA 2X4TA 3K2UL 1IE5A 2X4UB 2G5BA 4QTHB 3RZCC 3EFDL 1UG9A 2BFVH 4Q9CA 3IJSA 2ZCLL 2I9TB 2VUOA 3JUYA 1YPZE 1HINL 1HQ4B 4CW1A 1BQHG 2BCKA 2NXZB 5EU6E 1OW0C 2E9WA 3HPLA 4JE4B 1DL7L 3L3HA 3BPNC 3OAYH 1MJ8H 4G43B 1GXEA 4DK3A 2E9BA 5DJ2B 2VISA 4XGZB 2A9NH 5FYJU 1K4DA 2BVOA 4YEEA 4R9HA 1XGQB 4HUXB 3RWHB 1RJYB 2VL4A 1Y0LB 3CUPA 1KACB 1KJ3L 3QI9A 1ZLUH 5GGQH 4O4YH 2B7DT 2ZCHH 4BQCA 5CD3B 5CWSA 2DM2A 1QPXA 4UT9L 1T7WA 5CP3A 3B9KA 1OD7A 1NLBH 3GMQA 4N0UE 3V5HB 4FQJL 1KJMA 1BECA 5DJDB 3LKPA 3BKCH 1GL4B 1F45A 4MB3A 5DK0A 5HGDA 4MAYC 3QG6B 1QR1B 2Z4QB 2P8PA 2NY1D 3UDWA 1NGWB 5I75C 4JDVB 2AJVH 4J2XA 1JI1A 3AC0A 3CX2A 3GHBL 5GJSL 1WWAX 4RA3A 3S37H 3AU1B 4YZFF 5E5MB 3GB7B 1GVIA 3MGOB 3CH8A 2X42A 1V05A 3MJ8A 4GMSL 4MJ6B 1BP3B 3T0VA 3UTPE 5CJ5A 5DQJA 5CLTA 4EUPH 2IPKB 5F6HJ 1J1PL 1NKRA 1VKXA 1OGAD 4Y4FB 3GI9H 4FQXD 4JZOB 4UU9B 5DR5H 3CDFA 4XC3H 1HH6A 3KG5A 3MXWH 2ARWA 2DWDA 5E8PB 3VFGH 3UTSE 3HTLX 4ZMAT 4NYLB 5D7IF 1UZ6E 2EDDA 1Z6JT 4Y4KC 3QIBA 2EO9A 1EK3A 3LMJH 2PUQT 4TNVF 3D48R 4J23A 4PRHD 1I1AB 4G3YH 1OSZB 5E6IC 1YEFL 4QNPE 43CAB 5IR1B 1QLRA 1RFDH 5FYKU 5I71B 1IM9B 3RWIA 5L2KD 5HGAA 4C59B 1U3ZA 5IM7A 4ZFZA 2NY7L 4U2ZA 1D7FA 5KVEH 3VWJB 2N7AA 3EZ8A 2OSLA 5ERWA 1IEAA 2AEQL 4OLYL 3B43A 4G8GD 4NNXB 4NO2B 3MRLB 4LIQL 4Z0XB 4FQIL 4ZFGL 4E5XA 2DDQH 3IRZA 5HDQL 3MRRB 2EDTA 1RMFH 4TSBL 2A6KA 4D8PA 5M7QA 1A0QL 2Y07H 4OD2A 1JHLH 4QRQA 1AGEA 5D7IB 3VXPB 4PLJC 5DT1H 4M7LH 2DQDL 5D9SA 1S7VA 3JWOH 4HUUB 4DGVH 1X4YA 2ADGA 5GGTH 4D0DA 2XA3A 4H1LA 1QACA 3U1SH 5BV7B 2FD6L 2X4PB 2OP4H 4XP9H 1MVUB 4HIIB 3DX8B 3FAXA 5GGVY 1YN7B 1KCSH 5E9DE 4BQBA 1HHGA 2CLRA 3MUGB 5K9KA 4NM4H 3ZTNL 1ZMYA 3QXAA 4U0RC 4FZ8H 4M02A 1Z0MA 4I9WD 2DQJH 2R15A 4CBPA 5IMKB 4KPHH 2BRRL 3V5KA 3MA9H 4IBLT 2R9HD 2R4RL 4PP2A 4NO0B 2DQFA 2FHCA 4YHNA 4XPBL 3FTGB 3L3GB 4XI5C 3LAFA 4PJIF 3EUUA 1QSEE 1IEBA 5CHNA 3I84A 4KKAC 4PJGE 5ADOL 2VDQL 1JPFA 3TNNA 5J4MA 4OQ1A 4WW2C 3MRGA 3K8KA 4LVNC 2AABH 4ZOEA 1JRHI 2D7TH 1KLUA 3EHBD 2VLKD 2PXYC 2EDQA 2XYCA 3CLFL 2ATKB 3AS3A 4XVSH 1FG2A 1KIQA 3KS0H 1PLGH 5BZWA 1JF5A 1KIUA 4KHTL 3AM8A 5F6HI 4ZPTA 2R0LH 5LAXB 35C8H 4S2SA 5D7LB 4APQC 3ARDA 1BZQK 1DBBH 4RNRA 5K9OA 1JV5B 5TGBB 4Y1AE 1IAKA 5F7EH 1VFAB 2XTJE 3P0GB 4P2QA 1FE8H 2MPAH 1QKZH 4HIEB 5I1GL 1CK0L 4PJIB 2Y72A 4P57B 4NNYB 4NRXB 1TCRA 3BDXA 4E41D 4BSWA 3H6JA 3MRIA 1FZKB 4OIAA 4X99A 2EYSB 4MNQA 1T21B 1QZ1A 2LFGA 1ZT7A 3EYQC 4JG1H 4RSVA 1M4KA 3HB3D 5MP6L 4RISL 1ZLSH 4XP6H 1P6FA 3MRQB 1T1XB 5BZDA 1DQTA 5E56A 2DB8A 5AD0A 3LQZB 4UB0H 4XP5L 1QFWH 3AAZA 1QQDB 1MFCL 5EUOA 2VDPL 4AM0A 2RB8A 4OKVB 5KW9H 4NQDE 4JRYD 3PWVB 1HNFA 5IJKA 1OQXA 2J6EH 3TCXA 3PP3H 4OCMC 5DK2B 2DQUH 4HC1H 1HILA 3VGDA 4EXKA 2AI0L 4FFYL 4HEME 4KY1L 4GW1A 4OT1H 4NZTH 4NKQB 4KVNH 1GSMA 1GRWA 3G9VA 4M62L 3TO2A 4NQCB 5HHNB 1JPSL 4JFXB 1RZ8A 4NKOB 2CLVA 4LQFL 3DSFL 4AK1A 3U2SB 3SY0A 1SJEA 5KS9A 1SJXA 4NHCH 2MHAA 3OJVC 1RUAH 3MLRL 1IM3A 1FORL 5A16B 1A7RH 3TP4A 1A64A 1AO7B 3UTZA 4PJCF 4HAFA 1FPTL 1HWGB 3F6IA 1T1YB 4GRWF 1H3VA 2AJSL 1KFAL 3ARGB 4LCCC 4LKCA 3UROR 3D9AH 1OAZH 3O3EB 4NNPH 3KAAA 4P2OB 3C09B 3HC3L 1HHHB 4NN5B 4WUKL 1J05B 2HFFB 1CFTA 4WO4B 4NQTA 1FBIH 2F54B 1Q9KA 1ZVYA 5JLZB 4MJ5A 1VGKB 1KB5H 4YPGB 1L9MA 1CR9L 5BS0D 3D0LB 1L7IL 3BKJH 4Z0BL 3P0VH 3LKOA 2HMIC 4IDLA 5J56B 1DVFC 1DQDH 4WW1B 4ENED 5EU5B 2AW2A 4PJCB 3WFCH 3QDJE 3HKFA 1FZOA 5T33H 4LVOC 4Q6IB 4L4VB 4JR9L 1H0DA 3IETA 4R4ND 4GRWB 4P59H 1Q9OB 3UTTD 4C83B 2FJGA 3U9UA 4Z7QF 4AIOA 1XF4B 4QTIL 1JPTH 3TYFA 5TDOB 4CKVX 1AKJB 3JWOC 4LCWD 3MRFB 5L9DH 1P2CA 2Z92A 4ZFOB 5ITFA 3AXLB 3SHSA 4OFYD 3GK8L 4QRUB 1U8KB 5F7YC 4ZAKB 3QFDB 3TBVA 4F7TA 1PZ5A 1TXKA 3KLHC 3F7QA 5ANME 4FP8L 4O58H 2J88L 5CZXC 4K3JL 3NACL 2OL3B 3V6OE 4JRXB 3SCMD 1I8IB 4C4KT 3NN8B 4NN7C 4UIKL 5GHWL 1OHQA 3LN5B 1YEDA 2VWEE 2X4NB 3PGDB 1IT9H 5D7JC 4X80H 3CLEH 4MMZC 1NEZG 3PWJA 1MQ8A 1UACL 3HR6A 4M5ZH 2JK5B 5A2KH 3QCTH 3F12B 3HE7B 2DYPB 1IC5H 3DROB 4IMLB 3J8F7 5LGJB 4WUUD 4U3XA 4YHYC 2OR9H 2EZ0C 1VEPA 1U36A 2HRPL 2UWEF 3OR6B 3TN0C 3GRWL 4F8QA 1Y6NR 4OFIA 1CIUA 1MF2L 4UT7H 1OGAA 2IGFL 3FQWB 4Y2DC 4NQED 4I3RL 4NOFA 3KPQA 1QLFA 4FQXA 3L7FA 3RWJB 4R26L 4ZD3L 4G7VL 4ISVA 4O2CB 5DK3A 1TVBB 2XXCB 2XZQH 4IRSA 2YD2A 2QSQA 1YY8B 5HGBB 1RVFL 3V5DA 1X7QB 1CXLA 1ZANL 1NBZA 1ULVA 2YEZB 5H35A 4C55A 2R4SH 2QBWA 3NFNA 2CJUL 3PGCA 2AGJL 2P45B 3MCKA 1LEKB 5ELIA 1QP1A 1SEQL 1CLZL 5L2KA 4P9HL 1RJCA 1I9JH 2UWEB 5I74B 4A6YA 1IAIH 5JW3L 2JJTC 3D5OF 1BJ1J 4R3SA 3VXUD 2R2CA 4PJDB 3IDXH 5DD5H 5DLML 4G8GA 3BAEH 3RY6C 3RTQB 3DX9A 5CP7B 1ZHBA 2CRZA 4IM8A 3SE9H 5B3JF 4M5YH 4ZSOE 2F5BH 4OLWL 4NO3A 5F89A 3ULUF 4YDIL 3V7AE 3IFOA 3WJLA 5J8OA 3X11A 5CJXA 2BP3A 5F1NB 3REWA 5B39A 2YN5A 5ISZD 5DMIL 4H8WH 3SO5A 5BXFB 5GRJH 3I2CH 4A2MA 1ZSDA 3QNZA 4I8DA 4WNQA 4MSWA 3L1OH 3L7EB 3PNWA 4L4TA 1CGYA 4L5FH 1E4XL 2ESVE 1NMCC 4K7PL 3QIUB 4JY5L 2PKDA 4M3JA 1KTLA 4QYOB 3TZVB 3HE6A 5EOCL 2IBBA 4M00A 2VDKL 1CICB 5DUBB 5FO7B 4B5EA 1OM3L 5HPMA 1F3DH 1R5IA 1TJHH 3CNKA 3KJ4B 5HI5D 5GGVH 1NGZA 1XF5A 4XNUH 1F90L 1U6AH 4Z76A 3TV3L 3ZYZA 1RUPL 2NXYC 1YJDH 5ACZA 5J6GA 1J87A 2VDNH 2VLKA 3GM8A 5EFIB 2HA1A 2P1YA 3QB7C 4MD5A 1ETZA 3GSNB 1FNFA 3VW3H 4D0CA 1XGUB 4X4MA 2NX5B 4X0KA 1MJUL 4G8IB 1RURL 5JPNA 2F19L 2YPKA 2PTUA 1S5HA 3MJ9H 2HKHH 2Q8BH 3MNZB 4K71C 3GNML 4G9FB 2A6JB 2GUOB 1B0WA 1F6FB 3WS3B 5KVGL 4I18B 4ZOCA 4DUWA 4ODXA 4DKDC 5ICYA 1YEGH 1CLOL 3WO4C 4WV1A 3IJYA 5JW4Q 3UBXG 3UZQA 5CINH 2FJHA 3O3UN 1FVDB 3QFJB 3PL6B 1CDGA 1RUML 2IFFL 4TYUA 3DX7A 4WEBL 1QSFD 3KPNA 4XMKH 4LNVA 5DHVA 2H26B 4JFPA 3G6JA 1DBKH 2KDGA 3C2AL 1T0NA 1CD1B 1FVCB 4P5TC 3PIQA 4DN3H 3CD4A 3QEQE 4HFWB 1Q72L 3RPIA 3T65B 1I4FB 4X6DA 3U6RB 1BQHB 2QL1A 1S7UA 1LVEA 1W0YT 3KPTA 1NCAL 2A9ML 2FJFA 4V2CB 1BZ9B 2J8UA 2JB6B 2WNGA 4ALAH 4U49A 1MI5E 4JRYA 3U4EB 5C1MB 4R2GB 1N4XL 5GPRA 3O6FB 5J6HA 2F5AH 4RZCA 3FQRB 3IDMA 5SWZE 3BEVB 2PO6D 4WTWA 4DCQB 2VLLA 1IC7L 3F5WA 4PP1D 3SBWA 3SN6N 3BYYA 3JV6A 3VWKB 3ZO0A 2HFGH 1TZHA 2C26A 2YPLD 2R0WH 3QAZC 4FNLH 1BIIA 3SGJC 2ZNXA 3D69A 4G80A 4YDKH 3Q6FA 3ZE2F 3T1WA 2AEPL 2DLHA 3CFKB 1FNEB 3BMVA 3DARA 1N6QH 4I0PA 5HGHA 2D7OA 3HMXA 1V7ML 1EFQA 2WUCH 3C6LD 3REVA 1LO5A 2QADD 3WS6C 5DEFB 5ECJE 4KROD 1ORSA 4U05A 4F7MA 4XZUA 2Q76A 3DETD 4YXHH 1ZEAH 2XG5A 3TBYA 2WWMC 2E7CA 2WBWB 3NGBC 1IZKA 5L8KB 1EDQA 4HULB 4FHBD 5D7KD 1CL7L 4HPOH 5A2FA 3SDAD 4N90E 1Q0YH 4LMQE 1CDCA 5IHUL 1JWMB 3N9GL 2W0KA 3V4UH 2P24A 5B38A 1NC4B 3VXRD 3W0WD 2DI7A 4ERSL 1VENA 4N0RA 3LQAL 3WSQH 1DBMH 3BP6B 3O9WC 3P4MB 2D0FA 5TE4L 1GYAA 1BLNA 3P9MA 1P4BL 4JN1H 4HDIB 1T0MB 4U1JB 3BUYA 4KQ4L 1CFSB 1UC6A 4WHDA 4WWKD 3IXAA 3DMMC 3VU2A 2GJZB 4WU7A 5E7BA 1G7JB 5EU6D 3KPSE 5EBWA 5MEQA 5IB1B 3P0YL 4RMQA 1YMHB 4HV8A 3W9EB 1CF8H 4MXWL 3UTTA 5C0DA 4PGBB 1BBJA 1J7VR 2CO6B 1CXKA 1OTSC 3LV3A 2EH8H 3FT2A 2OR8A 1KSRA 2HVKB 2GAZA 4LCWA 2DKSA 3NPSC 2LQRA 5E6YA 4H1LG 4LARH 1JN6A 4H8WC 5CAYB 4KRPB 2FB4H 1KCRH 3UJTL 3GI8L 1I7ZA 3U46B 3X3FH 1BEYH 1FQ9C 1HI6A 3I6LE 3M07A 4OTXH 5IHBA 5K93A 1I8MB 1ZHNB 3H3BC 3O3DA 5HHOB 5FGRA 4QHNB 6FABL 3R1GH 3X12A 1OP9A 4TSCL 4J8RB 4LAQL 4GBXD 1LP9A 1YECL 1AGBA 1RZKH 1UB5A 1UEYA 1YZZA 3OBAA 5FUOH 2P5WE 5I8CB 2BSTB 5IIEB 1FO0L 4D0BB 2R0ZH 4JFHE 3CK0H 3K3QA 2BK8A 3L5IA 3A0OA 1IGCH 2VDMH 4HSQA 1YJDC 2D7MA 2XY1A 4M8VA 4OZFH 3UTPD 1U8HB 4LCUA 4WDIA 2N7BA 3S36L 2FATH 4OZIA 1J1XL 3MJGX 4NQEA 1EERB 2X44D 1AQKH 1UWXH 4M1DL 5CIPH 1OP5H 1XGRA 3DUSB 4KQ3L 2BSSB 1PJ9A 1ZHKB 4LCIH 4PJ5B 5C71A 5HYJE 5F6IB 5SX4H 4PJEA 3N1FC 4Z5RB 1UJ3B 3Q5YA 1CLYH 3M17A 1XCQB 1IGJB 4WU5B 1NCBH 3U7WH 3TYGL 1JRHH 3VD7A 1T2JA 1I8KA 1TTGA 3BH9B 1EEZB 1F4YH 2YR3A 3MYJB 4KTDH 4LL9A 4YHKH 4PR5A 1NC2B 3E8UH 4WI3A 1EEYB 5D7SL 3HA0A 4JPIB 3HNSH 1B6DA 2YD7A 1EEQA 1WZKA 5J0BA 2PYEB 1TQBB 4NQUA 4GUPB 4Z7UF 3OKDA 4EQ2A 3QQ3A 2QJDA 1QG3A 5FUCE 4CGTA 3VFOA 1Y6MR 5J3HC 2OTWA 4G9DB 4WFEE 2VXSH 3RVWC 3Q6GH 3F58L 5I1AB 3W2DH 1BM3H 4G6AD 1U8OB 3GSUA 2NY2B 3WHXB 2VXTL 1KCLA 3QISA 1XIWD 1X5FA 4GT7A 1D5IL 4GOSA 2B1AH 4W68A 1MFDL 3H0TB 5KSBF 3RIFF 3FAWA 1FFPA 1OCWL 2VLRB 3I3DA 4PJHB 1YQVL 2Y06L 3RVTC 3PWNB 3ZDYE 1CCZA 2QQNH 3HG1A 3I50L 4WCYL 1KPUB 5T5FL 2ICES 3FN0H 4NRYA 5FYLL 4HUWA 1RK0B 2SEBA 1M05A 3RDTB 4Z7UB 1J8KA 4M8QB 1SBBA 1XZ0A 1LE9A 3RVVC 3ZKMD 1DQLH 3DX6A 3LSOA 5GQBA 4K23L 4OLVH 4XVJL 3EOYG 5D2LE 5DMKA 2H6PA 4U2YA 3STZB 1CXEA 2AJUL 3MOAL 1FL5B 3G6DH 3NTCL 1T22B 2VQ1A 2IQ9H 1BQLL 1CFNA 1R3LA 3JZ7A 4IOFC 2X9XA 4KTYA 2IH1B 3QUXD 5KSBB 3CVIL 4Q9QH 5KZCB 3ZL4L 3C5SB 5GS0D 4KZEH 5MENA 4MS8D 3BOVA 4HQQL 4P2RB 1BFVL 1WIUA 3WUZA 4JFYB 3MBXL 3OKMA 1V7NL 4KKCD 1PG7H 1ITBB 4N9GB 3O45A 5EU3B 5DRXA 2HJFA 5F88A 3D2UB 4HPYH 4LPCA 1I3RB 2XTJD 5IESL 2OX5A 3T08A 3JWDH 1A9BA 3B83A 2AV7B 2APBA 4HF5H 1REIA 3SQOH 3H3KA 1L6ZA 2HFEA 2YUZA 4FQPA 2X05A 3IFNH 4JPKH 5F9DC 3LS5H 2APFA 1QFUH 2VZ3A 1T4KA 1MCWW 1QSFA 3EYOB 2O61A 1CDHA 2CDFB 3T0AA 3QJHA 5D1QB 1G6RB 4ESKA 2EDNA 4PV8B 1I7TB 2YUXA 2EECA 1D5ZA 4MYWB 3BP7A 4TUJB 4DOHB 3FHAA 4EN3C 2YA1A 3QQ4A 2ZOKA 4NBYB 1CGSL 2MWCA 1YYLH 2NY4B 2V17L 3F8UB 3EFFB 5DDHA 3IJHA 4X4YA 2C4FT 4O4YL 1S9VB 3L3JB 4H20L 3VFUB 2X9YA 2ZOLA 4XNZB 3ME0A 4KMLB 1JL8A 1QLEH 3KYKH 3MA7B 5HHXH 2PO6A 1Q0XL 3DVGA 5AUMA 5C0EA 1HHIB 3QUML 3B5GA 1SYVB 2GTZA 3K0WA 4JM4H 5J06A 1YN6A 2VZSA 2YPLA 3T1FA 4L8SA 5CEZH 5C0RL 1IKNC 1U8PA 1U8NA 1JIBA 1E6OL 4HMCA 4KJYB 4TULH 4PGJA 4P4KB 5C3LD 12E8L 1G7IA 2WBJD 1U3JA 5ALBL 1QBLL 4HLZH 2UUDK 2P8MB 5SV4A 1MCNA 3ILQC 1NEZB 4K8RC 3BN9C 4X98B 1LNUB 2X7LA 5A3IC 2CPCA 5CUSL 1AGFA 3HR5A 5IK3B 3SDAA 2UVFA 1LE5B 1S9WA 1NGPH 3IXTB 3VXQB 2Y7QA 3TT1H 3VD9A 1TZIA 4HWEH 3JV4A 1WFOA 2DMKA 1ES0B 2YPVH 4BYHA 3QCVL 4ZNEE 1QA9B 2R1WA 2ED7A 2I07A 3LKRA 3MRJB 3C5ZD 3PP4L 1O7VA 1MCHA 4W70A 1SY6A 4X7DC 3QPQC 1SBSH 3S35H 2EO1A 5JUEH 1KLFA 1YPZA 1UH3A 1NBYB 5EU6A 3M8OL 5BQ7B 1YYMH 3BQUB 1K5NA 1ZLWK 5HD8C 3MXVL 5BMFL 1V5JA 1RJLA 1N5AB 1INEL 3L3DA 3OKOB 4S1SH 2MQCA 3ZKNC 3OB8A 4P9MH 2BC4A 5JO5B 5FB8A 2Y07L 5B39G 3TO4C 3NZ8B 3HAEA 1TETL 2VAAA 2NCMA 5AWNL 1CE1H 3G5ZB 5CSGA 5TF0A 1JWSA 3JWOL 4G8EB 2ICWJ 3D0VA 4AJ0A 2A83A 1WBZB 4ZO8A 1A6TA 1UEMA 3NIDF 4Z8FH 1MJ7H 2Y5TA 2NY3D 2HTKD 4PRNB 3MO1B 4PGCA 4MA3A 3GHEH 1KTDA 4AEHH 1BD2D 4PIRF 4MB5A 5FDWA 4GBXA 5DQDH 4UV4L 3WJJC 1JGDB 1N64H 1UH4A 1V3MA 1UM5H 5AYUH 3FO0H 3BPLC 1I7RB 1F58H 1QFWM 2HG5B 3C2SA 5L7XH 5J11C 1JTOA 2H2PC 3PWLA 2FLRT 4XVTH 4IRJC 4ONGL 2V7HA 3TJEH 2G2RA 3ZHDA 3ET9F 2DQCL 2AS5M 4HX1B 5BRZB 3MV9B 3GSOB 3FQNB 4KUCF 1QRKA 5F71A 3T2NL 4ODWB 5F8RC 3ZKXC 1AI1L 3KPLB 4CN4A 1I3UA 1NMBL 1HQRA 2W9LA 4MCYB 1MAKA 4YXKL 4G6FB 4JDTH 2J7LA 4XC1L 3UTSA 2JLLA 4XVSL 4QT5A 2GQHA 1KEGH 1DQQA 1ZA3B 3VFTB 1R3JA 4LCYB 1BOYA 5GGRY 1L7TL 35C8L 3RWGB 4JO3L 4LRNL 4OFKA 1MRCL 4YWGL 3EOAA 2W65A 2CUHA 1UH2A 2X4OB 5I6XC 4KVCL 4JZJC 3PV6A 5GZOC 2X4TB 5BV7H 1NAML 2G5BB 4DQOL 3BKMH 1K9TA 1XF3A 4XWGL 3VGHA 1UB6A 3GSQA 2JJSA 4A2LA 3OPZL 5E8OA 3ARRA 5C0AE 3IJSB 3UMTA 3O2VL 1MOEA 2MCG1 4CW1B 2AV1A 2BCKB 4AEFA 3HPLB 1X5KA 4PRDA 3L3HB 1XIWA 1QR4A 4RMSA 4GAGH 2DQEH 3O4LE 2NW2A 2VISB 3U7YH 4ZXBC 1K4DB 2BVOB 4EIZC 5KW9L 4Y88A 5GGSY 3TJHC 1BJ1H 1MNUH 1RUKL 3SDYL 4M4PA 3QDGB 2NR6D 3QI9B 3DO3A 4YBLB 1OAKH 3RVXD 4JFFE 2WANA 5TE6L 2W60A 4PRID 5CWSB 3BD3A 2Y1VA 3B9KB 2ESVD 3GMQB 3TFKC 4F7PA 2ICWI 1KJMB 5CZVL 4J1UA 5DK0B 2PR4L 5E0QA 5HGDB 5I18L 4HH9A 2GFBA 3MNWA 2D2OA 1Q1JH 2P8PB 3DNKA 4KVNL 3MCLL 4XPFL 3LD8B 3GMRA 5I1CL 3LKSA 2J3SA 3T4AA 2Q7YA 4RGNE 2HT4D 4PJGA 3QUXA 5CSBA 3E3QC 4N0YL 3DPBA 4UV7H 3NBNA 4NHCL 2NXZC 4PLKD 5D1ZD 1IGFH 1DUZA 3BP4A 5DJ6A 1JNLL 2D7PA 3DBXA 2CK2A 5I0ZA 2B5IB 5DQJB 4TUKH 1JK8A 3FT4A 5B38G 4LFHD 4MAUH 4BH8B 2NNAA 1VEMA 1NGQL 1VKXB 2EDEA 3IAQA 4MZ3A 5EORH 4I1NB 4LSDA 1HH6B 1Q38A 3ARTA 3MLWH 1ADQA 2DWDB 1PX4A 4HMEA 2FGWL 3OAZK 4OUOA 3OXSA 3OG6B 2QQLH 3QIBB 1KB5L 5JORA 4U1NA 4JJ5A 4R90L 5A43C 3KPPA 3N1GC 2A2QT 1DSFH 4V2BA 1JGVH 3TA3D 3DYOA 3TT3H 1MRDL 2Q87A 3WN5B 5DTFA 4S0SD 1QLRB 3TIDA 3FFDA 3RWIB 4ZO7A 1H8OA 2FEEL 4XWOC 5IM7B 5D5MA 5HXMA 4ZFZB 3CVHL 1RZJL 4GS7C 5E70A 2OSLB 4N1CA 5D1XD 1IEAB 2B0SH 5ERWB 2AEWA 4Z7NF 1OP3H 3MX0A 5HI3D 5E8EA 4E5XB 5IP4A 3QNYA 1T5WA 1I85C 2AK1H 2E6QA 2KBGA 1KCVL 2ORBH 2A6KB 4D8PB 4LBEA 3TC9A 4OD2B 4QRQB 1AGEB 1I7UA 2D4FA 3C60A 5FGBA 3G5XA 4XCYA 4Y4FC 5D9SB 1S7VB 3QHFL 1IAIM 5HY9A 5SWZD 3GSWA 2E7LC 2ADGB 4D0DB 4OBRA 2DLGA 4H1LB 4N8VA 3AY4C 1UXSA 5E2WH 5F1KC 5A1AA 3QWQB 4TQEH 3IDJA 4LDOB 1HHGB 2CLRB 3BWUC 3VFWA 5K9KB 5B4MD 3QXAB 5JPMA 5EZIH 2ADFL 5ESQA 5I71C 2YWYA 2CMRL 4LSVL 2WBJA 3V5KB 2GSGA 1GGIL 3GMOA 4PP2B 5IVZA 2VRAA 3VWJC 2DQFB 4YHNB 1VDGA 1MAMH 5CHNB 3NZHL 1IEBB 1NDGA 2MQ0A 4KWUA 4PS4H 3MV11 2DWEA 4BSJA 2XA8L 1KN2H 1CGWA 1JPFB 3TNNB 5E8DH 4J3XA 1KN4H 3MRGB 1P4IL 1MFBH 3HMWH 1KLUB 4U31A 5DJXA 1MCRA 5F9WC 4DFIA 3SPVA 4GMTH 2APVA 4PJ8C 2H1PL 4GH7B 4NBXB 3RVUC 1FG2B 1KIQB 3P11L 1I1AD 2UYLA 3PDOB 3QHZH 4JCLA 2XRAL 3C5ZA 5F96L 5BZWB 1UWEH 1DBAH 2R2BA 3OGCA 4QRRE 5BV7C 4ZPTB 5HI4C 5HBBA 1Z9MA 3B2VH 4S2SB 3ARDB 4RNRB 5K9OB 5EUOF 1IAKB 2FBJL 1H8SA 4NZRH 4P2QB 1W72H 5I16A 3KPSD 1IAIL 3QDJA 3EYSL 1JF6A 1TCRB 4BSWB 3AUVA 3MRIB 5DVOA 1YDPA 1H8NA 5D72H 4X99B 4MNQB 2DMBA 4OKDA 4Y89A 1ZT7B 3RIAK 4OLXH 4GLRI 1P7KA 5JR1H 4JFQA 2ICEA 3IU4H 2HT2C 5DWUH 3EO9H 5E2VL 1KIPA 5CSZA 3DURA 3MRNA 5BZDB 5TQ2H 5ANMA 5AD0B 1IQWH 3MV8E 5KS9F 3AAZB 5FCUL 5E2UH 1G9NH 4AIZA 3I6LD 1JGUL 4NGHH 4P48A 5EUOB 4AM0B 4WFHE 4MGXA 1KXVC 1QFPA 1C5CH 4J4PA 4CRPA 5FOJA 4KHXH 4S11A 1FLTX 2VLJD 4LQ1A 5T3XH 1RSFA 4IIQA 5JHDE 3WL9A 4IRZL 2CH8A 1HILB 1E4WL 1RZGA 3UJJL 2AP2A 3NA4A 3O2WL 4JFHD 1IFHH 4GW1B 3NCBB 3MFFA 3W39A 1U92B 3T3ME 3TO2B 2W0FA 1RZ8B 2CLVB 5EA0H 3SY0B 2NY5H 4YH6A 1KPVA 2CKBH 5KS9B 1VEOA 5H37G 3O6KH 2MHAB 3GFUA 5EO9A 4FFZH 4NHUA 5HYJD 4OCYL 1IM3B 2YD3A 3FB8A 3UTZB 4N5EC 5IFAH 1VFMA 5D7LD 2QQKH 3KLSA 1LWRA 2D3VA 3FONA 4LKCB 1F3RB 1NCDL 4RFEA 4W6XB 5IFJA 4HKBA 1JFQH 2Q8BL 4NP4H 3RBGA 4QRSA 4FFVC 5HHME 1CFTB 4QOKE 1CFQA 2IH3B 4YBQC 4Y19E 4BM7A 2P47B 1YEGL 3WIHA 1Q9KB 4MJ5B 5FYJH 5JQ6H 3QEHA 5CINL 1IILE 4RGOH 3O8XD 4NZUL 4X7EC 2NY6D 3LKOB 2MFNA 4RAUA 5DHXB 1U3YA 3WFBH 4ZSOA 5C0GA 4OIIL 3U48A 1FZOB 2I25N 2ZG2A 4LVEA 3GO1H 3DI3B 1CDUA 3IETB 3QUKA 4GSDH 4ODTH 1TZGH 2FJGB 1BMGA 3U9UB 2XN9E 2V5TA 5EUKA 3MRDA 4OV6F 3TYFB 5FUZH 5C0ND 4OZGE 1P2CB 5J1AA 5C0BE 2Z92B 4U6TA 1AH1A 3ARGC 5ITFB 1AXSA 1DR9A 5IVNA 2AQ1A 1T5XA 2F5AL 4PRIA 3TBVB 4F7TB 3T0EC 1PZ5B 2ESVA 3C09C 4R8WH 4NN5C 5GS0L 2NTFA 4WO4C 1WZLA 5K59F 1A3RH 4NQCD 2YUWA 1Z2KA 1N0LA 3EOTH 1QOKA 1A3LL 2FHFA 2NY1B 1KIRA 5BVPH 4QXUH 1YEDB 4XTRC 4DVRH 1N26A 1QYGL 4F7CA 5GS2D 2EDBA 3DLQR 2XQBH 4L8BA 3FT3A 3PWJB 4BZ1L 2Z8SA 3BGFB 3UBXI 4AQOA 4D2NA 2YK1L 1MEXL 5E6IA 1BVLA 4P2OD 5KANG 4JPWH 1JZ7A 4EI5C 4XXDA 1OGAB 3GJFH 4NJAL 5F9OL 4GG6E 3KPQB 1QLFB 3B9EA 3L7FB 4FQXB 4QTHA 3DXAE 3E6HA 4ISVB 3UCRA 4IRSB 4M1GH 2RHEA 4ZAKC 3VFVA 3V5DB 2EDYA 4KAQH 1WIOA 1NBZB 3V0WH 2A1WH 5H35B 2DD8L 3F6LA 5C6PB 1F6AA 2Y4SA 4OF0A 5JXAH 1H5BA 1X5GA 3WIIL 3NFNB 1EUTA 3TA3A 3PGCB 3HNVL 1HHKA 3MCKB 1BZ7A 1H3GA 3WFEH 4KXZI 4BFEA 5L2KB 5IMLA 2VITA 1A7NH 4PBVC 4I3SL 4A6YB 1I9EA 3BSZL 2H8PA 4R3SB 5IEHA 5I1HL 1LO3H 1RV6X 5JIIA 2JCCE 1RJYA 3HAEG 3QEQA 3NFSL 5D1XA 3BI9X 4WJ5A 3HE7C 4G8GB 5EOCJ 3DX9B 2EH8L 4DAGL 5E99H 5CEZE 4N5UA 2IBGA 1ZHBB 1PBYA 5I8OH 1NBVH 3WCYA 4J3TA 4NO3B 5F89B 1OF2A 3SEPA 2VIRA 1J0JA 3IFOB 5I17A 4QKXB 5SWZA 3J7HA 3REWB 5B39B 5T5NG 4OTXL 1MVFA 5J13B 1ZSDB 4HD9A 3QNZB 4ZUWA 1J1OL 1HCFX 4WNQB 4MSWB 1MHEA 3ULVD 4IOSD 4M6NH 3PNWB 4OCLC 4OJFH 4L4TB 4X9FA 3TBTA 4UIMA 1MLBA 4HS3A 1KTLB 4GG8A 4N8PA 1GGUA 3HE6B 3S3JA 2FX9H 5I74C 4JFZH 2IPUK 4OCWH 5CMAA 4X7CC 3LH2H 5HPMB 1R5IB 4WHCA 2JIXD 1NGXA 1XF5B 1NGZB 4JY4A 5J89A 1MFEH 3RTQC 1XGYL 4P3WA 4Z76B 1BX2A 1JHKH 2BJMH 3QXTA 4I0KA 3NIGF 1PSKL 1WFTA 4LPYA 2CXGA 4CVUA 5DVLA 4K8RL 3SKJH 5ACZB 1KJ2L 5J6GB 3C6SA 2VLKB 2G60L 3G6JF 4PGEA 3BJ91 3MUJA 4MD5B 2W9DH 1ETZB 5E4EB 4OFPA 2J8OA 2FO1A 3WFHA 4BUHA 3EDDA 4D0CB 1EAPA 1SJVA 3VI3F 4X0KB 1JJUA 3K1DA 3KR3H 4X6DF 1RIHH 2HVJA 5JPNB 2YPKB 2XICA 3FOLA 1S5HB 2AJZA 3L3IA 2J8UF 3KXFB 3SGDI 2IALA 3KPSA 5CCKL 1K6QL 3QIUC 1D6VL 3AS0A 1YEKH 4WV1B 4JREB 3TZVC 3IJYB 2DQHH 1DBJL 5GRWA 3G5YA 2QR0B 1JNNL 2FJHB 1X5LA 1N5YH 1BAFL 1CICC 2BHUA 2UVEA 4YHOL 3DX7B 5INCB 3ZDXE 3K46A 4DWHA 4P5MA 2V2WA 4U1LA 3KPNB 5DHVB 2V7NA 4JFPB 3ULUC 3KJ4C 2IC2A 1U8QA 3G6JB 1T0NB 3PIQB 5GGUA 2X1QA 5IF0A 4P0DA 1E4XI 3RPIB 2EXYC 3FFCE 3BUTA 4X6DB 1GC1C 5LVEA 3P30L 4NC1E 1S7UB 4XPTL 4MWFA 1OQOA 4JM2D 2FJFB 4H88H 2J8UB 2NYYC 3RY4A 4JRYB 5JA8B 4OB5H 2DQTH 3WBDA 4XMLH 2COQA 4EUPA 1MFNA 2VLJA 5J6HB 4RZCB 3IDMB 4XX1E 3U4BL 3F5WB 3PUCA 1MLCA 2VDOH 4UNVA 2P5WA 4GQ9H 4HS8H 3JV6B 4I18C 3ULUD 1TZHB 4NRZA 3CFJA 4WFGE 3BH8A 3OQ3B 4LPVA 1ZWIA 1BIIB 4JRWA 5IHLB 2E7HA 4G80B 4ZDHA 4DW2H 3MOBL 2HT3D 3Q6FB 4GXVH 1OB1A 1F11B 3OJ2C 2LABA 1CDBA 1SEBA 4I0PB 5HGHB 4JN2A 4XNMA 5HYJA 3REVB 4UOJA 1LO5B 3LEVH 1IVLA 2B2XH 1ORSB 4F7MB 4XZUB 2Q76B 2NZ9D 1B9ZA 3TBYB 3B6SA 4BZ2H 4G9FD 5HPOA 3ZE1E 3RFZC 1KC5L 3V8CA 4O02L 4R2GC 3WNPA 5C70A 3EFDH 4HPYL 4CDGC 3O6FC 2P24B 3V0VA 5B38B 1M7DA 1EV2E 4JQIL 1MHPL 3PL6D 3QFJD 3WUWA 1BLNB 3P9MB 1TFHA 4GW5A 4KH2A 2EDWA 1U93A 4GRLC 2O26U 1HINH 2OXHA 5KSUA 1OLLA 3BUYB 4OCSL 5GGTA 3VWKC 5D6DA 1ZS8A 2AJXH 3O8XA 1DL7H 5IHZA 2AKRA 3IFNL 4QRPE 5DZOA 1GJIA 3O3AA 1FIGL 3IXAB 2CIIA 3UJIL 4WU7B 5F7DA 5EBWB 1A1MA 3OAYK 1GZQA 5MEQB 5CEXA 2PTTA 1LP9F 4JJHA 4HV8B 1EX0A 3DGGA 3UTTB 1KEML 1ROWA 2VLMD 5C0DB 1S7SA 1BBJB 1TNMA 2MKWA 2EH7L 1KJ3H 4XBGA 4OLUL 2VC2L 4KI5E 3LV3B 3FT2B 4Y0GA 1RJZA 2GAZB 4LCWB 3IKKA 4UT9H 5IW1A 5DK2A 4ELKA 2H2SD 2DQIL 4FQJH 1BOGA 4N8VG 1ZLUK 1JN6B 1VFBA 4JFFD 4OZ4A 4XCEA 4ZS7L 4UDTA 4OZIF 5DEZA 4NJ9L 1I7ZB 1Y18A 1HI6B 4TVPL 2N1KA 3O3DB 3GHBH 3GUTA 1S3KL 1U8JA 3O3BA 4PJEF 4Y2DA 5D2LA 1HHJA 3X12B 2BY3A 4KK9C 1OGTA 1LP9B 1AGBB 2DLFL 1UB5B 4RGND 1CL7I 3WXWL 3EAKA 3ESUF 4GMSH 5I1LA 5DFVD 2DAVA 3JV0A 1EHNA 1CLCA 2EE9A 2GIYA 4WHYH 1J1PH 5B21A 5MHSE 4OV5A 4H25A 4LCUB 4WDIB 3KWWA 4P4RA 4OZIB 2EXWD 4NQEB 2E6JA 4PJFE 3QCUL 4JG0H 4P46D 3B9VA 1YUHA 2VSDA 2DTML 4PJEB 3H9ZA 2C4XA 2YPVL 4JHWL 3M17B 2W1NA 1NFDA 3FQXA 3RKDC 1MPAL 1YEFH 5ABDE 1I8KB 1TVHA 3QUZD 1LMKA 4QWWD 5E4IA 5JOFA 4M6OL 4PR5B 1UQSA 2Q6WA 4Q6IA 5E1HB 2NY7H 2N56A 3QRGL 3SKOA 2WQRA 4OLYH 2AEQH 1KPRA 3EYVA 2J6EA 4PBWD 2BVPA 3AB0B 4LIQH 2VABA 4FQIH 4ZFGH 4MVBC 2P43B 4HC1A 5KOMC 5IWLC 3OKDB 1TPXC 1UT9A 5HDQH 3QQ3B 4TSBH 3N06B 2EE3A 1A0QH 3TGXA 3VFOB 4L8DA 2OTWB 1U9KA 3T0EE 1NANH 2DQDH 4KRPD 2YA2A 4HBCL 2P5EE 1A21A 4KKLC 3GMPA 1YA5A 2CXKA 3GSUB 1G7MA 4CJ0A 1KYOK 2FD6H 3GM0A 2OTUA 1NFKA 4QEGA 3GBNL 1IZJA 5A40E 4OM1L 1FFPB 4GLRH 1X5JA 3ALXA 4Z8FL 1UJ3C 3V8OA 1FYTB 3QQNA 4LVHB 2PYFA 3HI6L 4Y5YC 3QXUA 3HG1B 4RIRA 4NRYB 1WWWX 3TIEA 4KJPC 4HUWB 2BRRH 2SEBB 2YD4A 1M05B 4MNGE 4L4VE 4ZNCD 3ABZA 4GRWE 1K4CA 3OV6A 4MQTB 1YEEL 1XZ0B 1LE9B 4G6JH 2R4RH 3DX6B 1KGCE 3LSOB 4XPBH 4BA8A 4IHOA 1F58L 5D70L 1TQBC 5DMKB 2H6PB 3FMGL 3QO0A 2Q20A 4LLUA 2VQ1B 3SOBH 2JIXA 1CFNB 1R3LB 2FIRT 4U0QB 5CEYA 4YR6A 4TOYL 5DVMA 3QHTC 4PRBA 25C8L 4U3CA 4X6CF 5MENB 4KHTH 1K3IA 3U0PA 4ZNEA 2QHLA 5IW6A 4OLZL 4X7SL 4XXCC 3OKMB 1URLA 3EDFA 5DZLA 2DLIA 4KZDL 4QRRD 2JJWA 1A7QL 5IOPA 1X9QA 1RD6A 3O45B 4CNIA 5DRXB 5C0FA 1ZGLM 1CK0H 2HJFB 5F88B 5C86A 4PJDA 5E2TL 2AERT 3RDTC 1AC0A 5BV7L 3ISWA 5F9AC 4DEPB 1A9BB 2Y6SC 2IAMD 5EU7E 1FFOA 5AG8A 3B2UD 2X4SA 4LLYB 4JB9L 2NY2D 4MJ2A 2HFEB 1FFQA 5MP6H 4RISH 5CILL 4PJAE 3ZT5A 2NY0C 4XNQA 5D2NC 1T4KB 1QSFB 4KV5E 5T3XE 2IPUG 4XP5H 1G9EA 1JZ3A 1MFCH 2VDPH 2DQEL 4L3EE 4KK6D 1D5ZB 4MMXC 3BP7B 3O81A 5DC0A 4NQXA 3MV8D 3QQ4B 2ZOKB 2GJJA 1CDYA 4JM2A 5IKCA 2C1OA 5DDHB 4WFHD 3IJHB 4X4YB 2Y36L 4K2UL 4HWBL 1PZUB 2R39A 2IMNA 3I75A 1OWWA 2AI0H 1Q9LA 2ZOLB 4FFYH 3PP3K 1AGCA 2RAMA 1P4LA 5JHDD 3V4VL 2DS4A 2PO6B 3DVGB 5AUMB 5C0EB 3AS1A 2BDNL 5CBEA 2GTZB 4M62H 1JPSH 1YN6B 2YPLB 5IROC 1S78C 4PREA 3T1FB 4L8SB 4LQFH 3DSFH 4PG9A 1MFAL 4BJLA 1U8PB 1U8NB 4JVWA 4L1HA 4E42A 3MLRH 2O5ZL 1FORH 4Y8DC 4M7JL 3VXME 4UV7L 4P2RD 4XCFL 4OM0L 1FPTH 1G7IB 4LFHG 3LEYL 5IV2A 2QADB 1KFAH 3DV4A 2XTLA 4KROB 2EC9U 2X89D 4WI7A 1R3IL 3HC3H 4M93B 1X5AA 4MAUL 2X7LB 3D2UD 3MUZ1 4WUKH 1FAIL 3HR5B 1EMTL 3SDAB 3UYOD 2NY4C 1S9WB 3U4AA 4OF6A 4Q74A 1X5XA 2VXQL 2Y7QB 4I3GA 1TZIB 2MCPL 1CR9H 3JV4B 1LO4H 4QOKD 4XMPL 4XNZC 3UXFA 1L7IH 2R1WB 1T7XA 4Y19D 3QFJA 4Z0BH 2I07B 4ODBD 3LKRB 3DHMA 4P3CL 4PBXA 3FKUS 4UT6L 4XP4L 2FX8L 5C0AA 3PHQA 4MA7H 5D1QD 1P84J 4PGDA 4JR9H 2H32H 1YPZB 5EU6B 1NCWL 1HXYA 1K5NB 1RJLB 3D3VE 4QTIH 3U36A 5T5NF 3TWCH 3IS1X 2K1MA 3L3DB 2NX5E 1MY7A 3QO1A 3MREA 2XN9D 4YHIA 3V2AR 1WIPA 2VSCA 2P8LA 5IBLD 1T20A 3GK8H 2BC4B 3CXDL 3BN3B 2Z31D 5FB8B 3HAEB 4FP8H 4WI8A 2VAAB 5J9PA 2J88H 1MREL 3S6CA 3SE4C 3NACH 4JFFA 1JWSB 4DN4L 3D0VB 5KSVA 3RGVD 4AG4L 2A83B 4UIKH 4D94A 5GHWH 1A6TB 2P7TA 4NWUL 2Y5TB 4PGCB 7FABL 4MA3B 3SO3B 5C0IA 1KTDB 1UACH 5GS3A 4P4KD 5C09D 2M26A 1UZ6F 5FDWB 1UWGL 4GBXB 3VH8A 3MMEA 2AXGA 2OYPA 2WQ8A 3MJ9A 1A6WH 1WT5A 3D18A 2HRPH 5JMOC 3CDCA 2OI9B 3BQUC 3GRWH 3Q0HA 3PWLB 1MF2H 1UFUA 2IGFH 2V7HB 4B53A 1UZ8A 1ZT1A 4I3RH 1DQJA 2G2RB 4RMUA 4R26H 2ARJQ 4ZD3H 4G7VH 4LRIA 5EZOL 3SGKA 3BZEA 1A7OL 1RVFH 1HQRB 4HMDA 5GRVK 1MUJB 1ZANH 5L8LB 4P46A 5I19L 3V9FA 5FO8A 5T1KD 3UTSB 4NDMA 5EWIL 3MLXL 4J3OC 4RWYL 4QT5B 1BFTA 2CJUH 1DQQB 4HCRL 4X5LA 4ZFOL 1R3JB 2AGJH 1GZPA 2W07A 4HT1H 3QUZA 1SEQH 1CLZH 4GKOA 1FNSH 4P9HH 3EOAB 4RMTA 2W65B 2Z8VC 1T2XA 8FABA 3INUL 4I77L 2X4QA 4EBQH 3JSSA 1Z9LA 2D31A 2OL3L 3PV6B 4H1LH 5DLMH 1N0XL 5ID0A 2FBOJ 1XF3B 4Q2ZA 5DSCA 2HVKA 1UB6B 3GSQB 3SGDH 2OK0H 1NFIA 5E8OB 4S1DD 5AG9A 3EJZC 5F72S 3ULVL 4YDIH 3S37X 2AV1B 2D03H 5EO0A 5JW4M 3RJQB 4CAGA 4PRPE 2E7MA 1WITA 4PRDB 1T66C 1XIWB 4DJMA 5DMIH 3MLUL 4PJGF 3WDHA 1WISA 2NW2B 1XCTA 4M3KB 4EUPG 2IANE 4PB9L 3R06A 5FAAA 3NCJL 3GKWL 3BXNA 1E4XH 3EJJX 4QY8A 3V52L 4K7PH 4JY5H 4HS6A 2JF1A 1C5CL 5HVWA 1AC6A 1GGTA 2W60B 3GMNA 5EOCH 2GCYA 2VDKH 4F7PB 2C9AA 1CZ8L 1KCUL 3FN9A 4J1UB 4U6HA 5DS8A 4RQQA 3L5XL 5CJOL 3MV9D 3GIZL 4H0GA 1OTUC 4HH9B 3HLAA 2GFBB 1F90H 4PTTA 3MNWB 1FFRA 2HJLA 1RUPH 3GMRB 3DUSA 3LKSB 4HIHB 3T4AB 2Q7YB 3LIZL 4G6FD 4PJGB 3QUXB 3BPCA 2Y25A 3GSRA 2BMKA 3O6KL 1A47A 1DUZB 4YFLF 3BP4B 4WTZA 5DJ6B 3BZFA 1AIFA 3A6BL 4E9LA 3ZYIA 1MAJA 3DBXB 5LKNA 1MJUH 1RURH 5D5MF 3KPMA 3U0WL 2F19H 1JK8B 3FT4B 3GNMH 2NNAB 3WKNA 2KUTA 3X3GL 3HI1A 4QRRA 5KVGH 3WUWG 1P53A 1CLOH 3SJVD 3QI9C 2HLFD 4YBLC 1MCLA 1EH9A 3ILPA 2XTJB 4H0IA 4NKIL 3B9KC 5FIEA 3OXSB 1RUMH 4G9DA 5JORB 4U1NB 4JJ5B 4WEBH 4LSTL 2IAMA 4F15C 4GO6B 3KPPB 2MKLC 4QGYA 3C2AH 4WENB 3ARBC 3UDWC 5DTFB 1N6VA 1GGYA 3LD8C 3TIDB 1Q72H 3FFDB 3CX5J 1H3UA 4PJ7E 5D5MB 1GIGL 1T03L 3VDAA 4PJHA 1A02N 1FNLA 1NCAH 4XNYL 2A9MH 1A14H 3FFCD 4F9LA 3ULUL 3QDGD 1SVCP 3MV8A 5E8EB 1BVKA 2BNQE 3MSPA 3QNYB 1T5WB 2CDEA 2B5IC 3LKNA 4NM8L 3ZDZE 4LBEB 4OZFA 1GC1L 3IAGC 5DMGD 5DJZA 1IC7H 1I7UB 3K7UA 3C60B 2ADJA 2PYEE 5J12C 1N2RA 3BZ4A 3G5XB 4XCYB 5MI0B 5HY9B 2OZ4L 5I1KL 5JHDA 5CIPA 3GSNL 3O0RL 5C08E 5BW7A 1OAYL 3ARQA 3F7RA 1T22A 1K3ZA 4N8VB 1UXSB 1CN4A 3PV7A 3QIBC 2LU7A 1WTGT 4EQ3A 1RULL 1ZTXL 1ZK9A 3IDJB 1VFUA 5FV1L 3PWUB 5IVXF 4OD3L 4AZ8A 1V7MH 4UBDC 5JPMB 3MLYL 2FGZA 3IGAA 5ESQB 3QYCA 2P44B 2WBJB 2VLRE 4M48L 3W5NA 2GSGB 4JO2L 5JZ7D 3GMOB 1CL7H 5IVZB 3RL2A 5FV2A 4GFTB 1NDGB 2HKFL 4JPWL 5IHUH 2DWEB 1HKLL 3N9GH 4HXBL 1MCSA 3TEUA 1JZ6A 5TE4H 3SKMA 5DJXB 3A6CL 1P4BH 1T7ZA 1KT2A 1TMCB 4HGWA 3TPUA 1XR8A 3SPVB 4FS0A 4P9HC 2ZKHL 4ZUSA 2FEEI 4QOKA 4Y19A 5D2NE 2LU3A 2VZTA 2UYLB 3C5ZB 2R2BB 5FO9A 3OGCB 1G7HA 4U1KB 5DJ0A 3RJDA 3SDCD 5KTEL 1IGML 4OQTL 2R56L 3P0YH 2EE6A 4MXWH 4MZ2A 2GW5A 5I16B 2K9UA 3EJYC 5KSAD 3QDJB 2AK4D 4Y2OA 3DRQA 1SYSA 3VA2C 2YMXL 3WLWD 3HFMH 5GRUL 5D93B 3VRIA 1EO8H 1YDPB 2XN9A 2VXUL 3HRZA 4KI5D 4P3DA 4QLRA 2Z31A 3FB6A 3UJTH 1P7KB 3GI8H 5C0BA 5CD5D 4JFQB 4X7TA 2ICEB 2ZG3A 2IMMA 1KIPB 5CSZB 1AR2A 4XHJD 3DURB 3MRNB 5GS1B 2UZIL 5CJQL 5ANMB 3PQYE 6FABH 3RGVA 4YGVA 3MLZL 3B9AA 4TSCH 3D39E 5KANI 4AIZB 4LAQH 3IAPA 1YECH 3BIBX 4MB4A 3BP5A 1I1RA 5C09A 2LVCA 3AM8C 1FO0H 3AMKA 4IIQB 3ARDC 3WL9B 4POZC 1NAKL 2OBGA 2YA0A 1XEDA 1RZGB 2A0LC 4IMKA 3S36H 1G0YR 2YS4A 3L9RA 5F1OB 4JQXA 1JYWA 4OCWL 2R29L 3X17A 3MFFB 1NUDA 5AYQA 3W39B 2Z8WC 3SDXA 4M1DH 1IC1A 4JHZA 3QDHA 4KQ3H 4KDTA 3CGTA 2WZPD 3VI4E 2W0FB 4Z77B 2BY2A 4D9QE 4TNWK 3FQUA 1KOAA 1ES0A 4M03A 5AEAA 1KPVB 1UWXK 1OP5K 4GG6A 5I76A 3MRJA 3TYGH 4NHUB 3PHOA 2ZJSL 4PJ9D 4LIQE 4I2XE 3DUUA 1FG9C 3FB8B 3NCYS 5T1KA 4G42A 2EDHA 1WGOA 3V6ZA 1S8DA 4NFDA 3FONB 1CTNA 4BUGA 1K2DA 4RFEB 5A2JH 5IFJB 4QRSB 5IJKC 1X3DA 3QNXA 1CFQB 2YKLL 4YDVA 2ITDA 4MNQD 1YEKL 1FJ1A 2QSVA 3QQ9D 1EO7A 1QUNA 4MJIE 4ZS6C 5F7HA 3VRLF 1J0IA 5K9JL 3QEHB 2JCCA 3F58H 1NCTA 3QPXL 5D4QA 3Q5TA 2VXTH 4EIGB 1PX3A 5T3ZL 4NQVA 1D5IH 4RAUB 2L0DA 3PHSA 1LEIA 1MFDH 2P5ED 4Q58C 2ZUQC 4ZSOB 5C0GB 4MA1B 1OCWH 1VGEL 3QUKB 2Y06H 2Z91A 1X5IA 2HFTA 3I50H 4WCYH 5T5FH 5EUKB 3MRDB 1JHTA 1R5VA 2WM0A 5FYLH 4UNUA 4HZAA 3PJSA 5CGYD 3HCVA 5J1AB 1EJOL 3IDGA 4YX2L 1AXSB 4LPWA 5DA4A 1T5XB 4PRIB 4K23H 5FEBA 2ESVB 4XVJH 3OZ9L 3R4DA 1N8ZA 2AJUH 3MOAH 4XCCH 4HS8L 2NTFB 4GRMA 3NTCH 3MLSL 1NCCL 5TDNB 3ZE0E 1ED3A 4JEGB 4NSKA 5HHPA 5JDJA 3CVIH 5LQBL 4HGMA 1KIRB 1I1YA 3ZL4H 4F7CB 3UAJD 3C8KA 5LCVL 4L8BB 1FDLL 3FT3B 5C2UB 5HTSA 4HQQH 4MXQD 4UAOB 1BFVH 1FL3A 1E4JA 4AEIL 2VOTA 1JGLL 3MBXH 1V7NH 2B2XL 1YMME 5E6IB 3MLTA 1BVLB 4U7SA 2GK0A 3G5VA 4LU5L 1NH6A 4XXDB 2JE8A 5IB5A 5DJ8A 9CGTA 5GZND 5IESH 4AMKL 2IWGA 5I30L 3SJVA 3E6HB 3CMOL 1I1FA 3RRQA 2HP4A 1MCIA 4U6VL 5EU4A 3VFVB 43C9A 4DKAA 3U9PL 1RAMA 5BRZE 1TJIL 3KYOB 3ZTJH 1F6AB 2AJXL 1H5BB 3QDAA 1F00I 4IJ3B 1A1OA 2YZ1A 3TA3B 2BNRD 4LSRL 2MMXA 3IDYB 3ARVA 1HHKB 2NY1C 5TH2A 1OTTD 4XPGH 1BZ7B 4MD4A 1BGXH 5IMLB 1F4WL 2VITB 1OAQL 5DVKA 3MJ7A 3LRSA 1CGSH 2H8PB 4JFEE 4U1HA 5IEHB 2EYRA 1ONQA 3QEQB 2V17H 3FFCA 4L3ED 5D1XB 3BGFC 4WJ5B 3QDGA 3FB5A 3OKYA 1HN1A 4U0RB 1MCOL 4H20H 3WEXA 4I0CC 2DRUA 2NQCA 1Q0XH 3JWNC 4CDHA 3BZDA 3QUMH 5I73B 1OF2B 2KPNA 2VIRB 4FQXC 5I17B 3BFOA 1XMWA 1EGJL 2P42B 4FN0A 5SWZB 2X70A 4YHZH 5C0RH 4RX4D 2XKSA 4H5SA 3VH8G 4AT6B 1E6OH 4Z18A 2WK2A 3UP1A 5F7NC 3C9NA 4ZUWB 3F7YA 3O2DL 1MHEB 1PFCA 3QEGL 2YRPA 1LO0L 5E5RB 1BWWA 4CMMA 12E8H 1H9VA 5ALBH 3TBTB 4UIMB 1QBLH 1Z3GL 4PJ8A 1MLBB 4DTGL 4YQXL 4HS3B 1AD9A 2Z35A 4GG8B 4YFLI 3QEUA 3ALPA 1EBPA 1NBQA 3BKYL 5DC4B 1I9IL 4BH8A 5TE7L 1A4KA 2FL5A 2R2HA 4NN6B 5CUSH 5CMAB 1NMAH 4XNXL 3L95A 5FYJD 1NGXB 4JY4B 4HJ0D 4Y5XA 1JP5A 5GRYA 3UC0L 4IRSD 1G6RL 1BX2B 5KOVC 3QCVH 1Y6KR 3Q1SL 4JG0L 3HZMA 3PP4H 3C6SB 1NUNB 1HYRC 4PGEB 2R8SL 3RX5A 5DF0A 3WJLC 4KRMB 2KZWA 3WFHB 5L88H 5E08L 1EAPB 3WN5A 4L9LA 2K3TA 1ORQA 3SDCA 2HVJB 3M8OH 3L3IB 3FOLB 2AJZB 4FOMA 4QRPA 3MXVH 4U4BA 5BMFH 1INEH 1UM4L 1X4ZA 2IALB 2X1OA 4OSUH 3KPSB 5KSAA 3HRPA 5I15L 1OOAA 2AK4A 2EEBA 3D3VD 4TPRL 1CQKA 1RZIB 1GOGA 1EFXA 3G5YB 3IF1A 2KH2B 1TETH 2R9HC 5AWNH 3SE8H 4P5MB 2V2WB 4U1LB 5JIPA 4FQ2L 1T80A 2V7NB 1U8QB 1RPQA 5EN2A 4PD4K 3ZYJA 5GGUB 4X6BA 5IF0B 1VADA 3QUYD 15C8L 3MCG1 3UTQA 1ZGLA 3EHBC 3OXRA 3N85L 4FQ1L 4L4TD 4MWFB 2GEEA 5E4EC 3SDDD 4UV4H 4NUGL 1GCFA 3RWFA 5DD0L 1W8OA 4KKBD 5EIIA 5DRWA 3FO2A 3BX7C 2YXFA 4EUPB 4AH2A 3HE6D 2VLJB 5LBSL 4RRPA 2V5MA 4KDWA 1OWRM 1OPGL 2WWKT 4PLOB 5FYKD 4ONGH 4G6JL 1MLCB 2P5WB 3UEZA 2DQCH 4ELME 3LHPL 4MXVE 4NRZB 3CFJB 4YHPA 1PYWA 3BH8B 3T2NH 1ZWIB 2ZSWA 1I8LA 3CIQA 4WV1C 1AI1H 1MY5A 2XNAA 4ZDHB 1NMBH 4WTZG 3SOBL 2JTDA 1OB1B 4J6RL 4YXKH 1JGEB 1AHWA 1CWVA 1SEBB 3MZGB 4XC1H 2F58L 5EG6C 4PJFA 2AJ3A 4JN2B 4XNMB 3CDYA 4Y8AA 4F3FA 3PDOA 3HB3C 1LEGA 1YEJL 2PW2A 5HYJB 1XF2A 4PJ9A 1L7TH 4JO3H 2CR6A 4LRNH 1MRCH 4YWGH 3B6SB 4O9HL 3ARPA 3KXFD 3L5HA 4KVCH 4Z7NE 1NAMH 4DQOH 3P9LA 4DZBA 4XWGH 5H94A 2FEDD 3CFBA 2X4RA 4XCNA 3V0VB 1M7DB 3N1PC 1CT8A 2E9IA 3OPZH 5JHLL 2KL6A 2Z93A 3WUWB 5EZLA 4GW5B 3O2VH 3SBWC 1U93B 5KSUB 5HVHC 2Q7NA 1HSAA 1ZS8B 3O8XB 5IHZB 2AKRB 5EZJA 3T0XA 2NY6B 4J3SA 3T0EA 4OFDA 3O3AB 4O00A 3IRPX 4Q9BA 3U30B 2CIIB 2P5EA 3FO9A 5F7DB 2A73A 3ALWA 4PRPD 1A1MB 1T7YA 1GZQB 4HEPG 3LQMA 5CEXB 2PTTB 3C8DA 3QT2A 1WV7T 3CFCL 3FZUD 1H3WM 4UILL 4GKNA 3DGGB 4I0PC 1MCWM 4OZFG 2ZG1A 5I66A 1S7SB 1RUKH 3SDYH 4XH2A 4XBGB 5HHVL 2IAND 3GSVA 2F9BT 2VZVA 4DVBA 2WP3O 1RJZB 5TE6H 4B7LA 5IW1B 5DD3L 3VMOA 4ELKB 5IGXL 4P2QE 1BOGB 5CZVH 1VFBB 2PW1A 3TM6A 4OZ4B 4XCEB 4MNGA 2PR4H 1QBAA 3QIWD 4JHBA 4UDTB 1BREA 1F6LL 5I18H 1QRNE 2DJSA 2EKJA 1Y18B 1YEHL 4EEEA 1U92A 3MCLH 4XPFH 5I1CH 2EE2A 3GUTB 1U8JB 1I3GL 3O3BB 4Y2DB 5D2LB 1HHJB 3MGAA 4N0YH 2CGRL 4I0PD 1OGTB 4OF7A 1NFDF 5ALCL 1WBYA 3VG0L 1GAFL 1II4E 3VG9B 1CG9A 4UQ2A 1JNLH 5KAQG 4X6FA 5I1LB 1GPOL 4ENEC 1W72A 1KLGA 2R23A 1T2QL 1NGQH 4R4NC 3MNVB 3KHOA 4OV5B 2BX5A 4H25B 3KWWB 4P4RB 4JVPA 3NH7L 2IH3A 3V95A 2FGWH 4R7NA 2F15A 1EAJA 1IRAY 1LDPL 1S7XA 1YUHB 4R90H 1KXQE 2WAHA 5KBNC 1LO4L 3P2TA 3AS2A 4Z6AT 5TQ0L 1NFDB 3FQXB 1MRDH 4OGAD 1GHFH 2FYYA 5T1LD 1R24A 2Y5EA 2CDGA 2C5DC 5C0CE 1KUMA 1TVHB 3W11D 4DUVA 1H15A 5JOFB 3SCMC 4MA7L 5KS9E 1UQSB 2Q6WB 2BNRA 4PJAA 3CVHH 1RZJH 2ED8A 4X9GA 3SKOB 5GSRA 1BFOA 4Y4HD 3ULVF 1KPRB 3EYVB 4JFOA 2BVPB 3CSBA 2VABB 6CGTA 1KB9J 3JTSB 3TWCL 3VXTA 1AR1D 4L3EA 1KCVH 1IAOB 1OP3K 4L8DB 1HYSD 2CUMA 3TCLA 3KNBA 5KJRL 1JE6A 2BNQD 3G9AB 3RA7H 3QHFH 5SWSE 1IC4L 3GMPB 1G7MB 4FG6D 3B8YA 4NCC2 2OTUB 3CAFA 2CKBA 2BSRA 5C08D 4RX4A 4W4OA 4PY7A 1DJSA 4XBEL 2PYFB 4FQCL 1PG7X 4RIRB 2ED9A 2ADFH 3TIEB 4L8CA 1SMAA 3LCYA 4GAFB 4W81A 2V5YA 2CMRH 2LV4A 4LSVH 2VMFA 5DRZA 1EEUA 3UYRL 1K4CB 1A6WL 1GGIH 3VXMA 5AZEL 1VACA 4IHOB 4M4RA 3NZHH 2WLYA 5J1SC 2P49B 3AB0C 2XA8H 4PJDF 2ZUTA 3QO0B 4LLUB 4DZ8A 1P4IH 4K71B 5FCSH 2JIXB 4YXLL 1E0OB 4GW4A 5GGRA 5CEYB 4YR6B 2H1PH 1FGVL 2DF3A 1BJMA 3I85A 3P11H 2XRAH 4PRBB 5F96H 2C7UA 4EDWL 4P5KA 3U0PB 3UPAA 5IW6B 2E6PA 4RGMB 3BDBA 2W38A 3S7GA 3BIKA 3HAEH 3K1KC 4HT1L 3S98A 3MRCA 2FBJH 4EOWL 1J11A 1A6AA 1FNSL 3STLA 3OX8A 4MQXD 5IOPB 4LVHC 4WEMB 1UJTA 5HYQA 4CNIB 3OR7A 5C0FB 4JM2F 3EYSH 4EBQL 1D9KD 1WBXA 4M6AA 4TTDD 3UPCA 1SQ2N 1CD8A 2RCSL 4N0CD 3D3VA 2VDRH 1FFOB 1O7SA 3S3PA 2OK0L 1HOCA 3LY6A 1QO3A 2X4SB 1N7MH 2MTPA 2DL2A 3TVMD 1KULA 5EIQA 1KENL 2W9EL 4XNQB 5E2VH 2D03L 4R7DA 5GGSA 2ZUXA 5HI5C 3ULSA 4HLZG 3RWCA 4ETQA 3DV6A 5FCUH 5DHYA 4HUKB 1JGUH 1FYTD 1HXMA 3QUYA 2V5RA 3HG1D 4MX7B 5CBAA 4NQXB 3V6BR 4UINL 2ENYA 4PRHE 3D39D 3LPWA 4JM2B 3SDDA 2GT9A 3D1MC 3ESVF 3QWRD 4YBHA 5IKCB 2C1OB 1ZHLA 4IRZH 4DGYL 2WMPA 3F7VA 1E4WH 3I75B 3UJJH 1Q9LB 3GJFA 1AGCB 3O2WH 1YY9D 1P4LB 1CFBA 4LNRA 3D25A 1KELH 3TBWA 5CBEB 4ZUUA 3NGBB 3RUGA 4AENA 5EDXA 4DEPC 5IJVA 3QP3A 1KNOA 1O0VA 4PREB 3S3SA 4PG9B 1LK3L 3S35X 1WCBA 1MWAA 4LLMA 2AAVA 1JZ5A 2ENSA 4E42B 1TENA 3MYZA 4OCYH 5MEND 3HN3A 3RP1A 1EZVY 2O5YL 4LHUA 4GRLA 3MTRA 2I26N 5IV2B 3S4SA 3CSYA 3DV4B 5I8KL 5MERA 2O5XL 2UZXB 3BESR 4ORGA 1NCDH 4X9BA 1U8MA 1QBMH 2EIEA 2JELL 4ZUVA 4KTEL 3S34L 2J12B 1GOFA 3KXFA 2DI9A 4Y16D 1YC7A 4I9WE 1GH7A 3VFMA 1T83A 1ZA6A 5KN5A 3MV7D 4NQSA 3E6FA 2QR0A 2W92A 4NZUH 1E28A 4OF8A 1RU9L 4KJWD 5INCA 1OT1A 2PO6C 1RZJC 3V79C 1FZJA 4KU1A 4MJID 4PP1C 1NDMA 2HJKA 4UOW1 2AQ3A 5FYLE 5HYEA 1MJJA 2R0KL 3NIFF 5C0AB 3PHQB 4OIIH 4L8SC 2EC8A 5C9JA 4PGDB 1U41A 4OI8A 1BF8A 1PKQE 3PWPE 4PRPA 4YC2C 4C58B 1HXYB 5I2IA 4F33A 3U36B 3NCMA 1V3LA 3KPRD 3E2HC 1A14L 3D85D 2EDLA 1E6JL 3QDME 5JNYA 3QO1B 3MREB 4JO1L 4YHIB 3C6LC 2QADC 2IANA 2P8LB 1T20B 4KROC 4NKMA 2W91A 1ZE3C 1FH5L 3DETC 4YFDB 3Q48A 3VGBA 4M93C 4WIQA 5GS0H 5J9PB 1VFOA 2M8XA 3IVKA 4JFFB 3SDAC 2X5PA 3QIWA 1F4AA 3O11A 4E41E 3FRUA 5TF1L 5KSVB 7CGTA 1F2QA 1A3LH 2E9JA 3NIGE 2P7TB 1QYGH 2JB5L 2YZ8A 1YNKL 1F11A 5C6TL 5C0IB 1LD9A 1RIUL 4BZ1H 3JVGA 2IBZY 3NCFB 1UYWL 3VH8B 4YDJB 4WWKC 4PJBE 4RGNB 3MMEB 2AXGB 3D18B 1IGYA 2YK1H 1MEXH 3NFPA 4ACPA 5DA0B 4HIXL 1E4KA 1YNTA 5ESAA 1UKQA 3DJ9A 2J8UE 2DM4A 4ZTOL 1YMMD 4NJAH 1A22B 1UZ8B 1ZT1B 1DQJB 5F9OH 1WUNT 3FB7A 3GJFK 4WI5A 1P1ZA 3BZEB 3H9SE 5IUSA 4K3DL 1T1ZA 5FOBA 4P46B 3P4NA 3CPLA 2DD8H 5FO8B 1H3PL 4NDMB 3WIIH 5I8EA 2W59A 5T1LA 3HNVH 5DO2D 3ARFD 1GZPB 5D96B 3QUZB 1C5BL 2GI7A 3HPJA 5E7FA 4QXWA 4GKSA 4I3SH 3T3PE 2YD6A 3SO3C 3K81A 8FABB 3BSZH 2X4QB 5I1HH 4S0TD 4GBXC 2D31B 3I6GA 3NFSH 4Y4HA 5ID0B 4PJ7A 2F53E 3OWEA 4Q2ZB 4DAGH 3ECBA 1VA9A 2J8HA 4JFED 3HFML 4Y5YA 5DSCB 5CFHA 5B8CA 5CKGA 1NFIB 1EO8L 2OI9C 1D5BA 2BNQA 3TLRA 2ICWA 5EO0B 5GRZA 1P5UA 1S5IL 2YBRA 2YD9A 1PG7W 4KMTL 1CS6A 5F1SA 5TDPA 2X1XR 5F9JA 1J1OH 5F70A 5BS0E 1XCTB 2Q8AL 5C08A 4RRPG 3R06B 4P23D 5DC9B 1FRGL 1JZ2A 3IFLH 3BXNB 4QY8B 1PAMA 1HZHH 3D6GA 4HS6B 3UO1L 3VE0A 1A8JH 1CTOA 1QFHA 1YNLH 3OMZA 3GMNB 4GKZA 1RK1A 2GCYB 2QSCH 1EPFA 1KJVA 1MCKA 4U6HB 5DS8B 1CGVA 3P4OA 4RQQB 4ZFFA 5IB3A 4YDLC 2D7NA 3HLAB 1XGYH 4PTTB 2HJLB 3JTTA 4CU8A 1PSKH 2JJSC 2FH8A 2DQGL 1G84A 4K8RH 1KJ2H 2IF7A 4JQVA 3THML 4A6YL 3BPCB 2G60H 3OG4B 3UTSD 3VFRA 3DTXA 3GSRB 4G6AC 2BMKB 3BRDA 1FLRL 1B90A 1XIWC 1F42A 3BZFB 1AIFB 1QBBA 3HC4L 3MPCA 1G9MC 5IB4A 3C8HA 3KPMB 4PJHF 3B5TA 2B39A 3HI1B 2A6DA 4QRRB 5D71H 5E00A 3IFPA 5CCKH 1K6QH 2ILLA 1D6VH 4K9EC 3NCYP 4M1CD 3ROLA 1D9KA 1DBJH 2VXVL 3ILPB 4X5WA 3VCLA 4WUUE 1JNNH 1BAFH 4MHHI 4QF1A 4YHOH 1WCQA 4LGSB 4TNWF 1L9NA 3ZKMC 4QXGH 2IAMB 5IFHL 1A7PL 3TVMA 5C9KA 1ERNA 4CVXA 4UTBL 3LPFA 3GBML 4PJEE 5FM5M 1PEZA 4Z7WE 4V1DE 3P30H 3QUXC 5FYKL 4XPTH 1UA6L 5IROA 1FYTA 2HTLD 3A67L 3C87A 4KJQD 3X13A 5HDOA 5GS0C 3W9DA 3PQYA 3MV8B 1BVKB 5E9DD 4MS8C 3D39A 4U7MA 2CDEB 3QWRA 3DIFA 3LKNB 3BD5A 4MCZA 3U4BH 4OZFB 5DJZB 4KKCC 1F2XK 2ADJB 5KAQF 3MJ6A 1N2RB 1VHPA 3BZ4B 5E2JA 3VXUE 4B0MM 4O5LL 5JHDB 5CIPB 1FZMA 1U8LA 3FQTB 4XCCL 2XTJC 1PW3A 1QSED 3MOBH 3MLVL 5DUPL 4L29A 1GGCL 2L7JA 3ZZ1A 3NA9L 1SVZA 3CFIC 2XKUA 3IGAB 3G04A 1ACYL 4EJ1C 4KK8D 1KBGL 5F8QC 5L0QB 5ISZE 1K8DA 2MQ3A 1NSNL 4I2XA 3RL2B 1KC5H 4O02H 2VYRE 1EHLL 4Y1AD 2V9QA 4Y16A 1SM3L 4JQIH 1TDQA 1MHPH 3MRHA 3SKMB 4HGWB 1KT2B 1J8HE 3KJ6L 1T1WA 3TPUB 3C60C 1XR8B 5FGBC 3MV7A 5HHMB 4OCSH 4ZUSB 4QOKB 5MI0C 4LLYA 3RX7A 4Z7VE 3WNOA 4Y19B 4XVUD 2NZIA 5HHQA 4MJIA 3SQBA 5J1TC 1FIGH 5FO9B 3RNQA 2YC1B 3UJIH 1G7HB 3MBED 5DJ0B 1A6PA 2IQAA 4Z7OF 3ZMRA 1IGIL 3QXDA 4XPGL 3CMGA 1BGXL 1KEMH 5T1MA 4D9LL 1RUQL 1ZLVH 2EH7H 4LSSL 1IJ9A 4OLUH 2VC2H 3DRQB 1SYSB 2LTQB 3KPRA 1VCAA 3O6ML 3LVEA 1FCCA 3D85A 3VRIB 2WBJC 3QZWA 5DRNA 4NQDD 1HDMA 2XN9B 2DQIH 3CDGA 3OJMB 3HRZB 4I48A 4ETYA 3C60D 4HWZA 3S88L 4UTAL 3BGMA 3BEWA 4P3DB 3RIFK 4ZS7H 2Z31B 2R1XA 5HYSA 3FB6B 5C0BB 3PF2A 4NJ9H 3HMXL 4X7TB 3SDXF 3BPLB 4PG2A 1T89A 4LP5A 4TVPH 1DANT 4RDQG 4YE4H 1S3KH 2B20A 3V6FA 4YHZL 1QRND 1I9RL 4R4FH 4U1GB 3RGVB 4YGVB 3WFDL 4GG6F 1QSZA 3MC0A 4YIQA 4G5ZL 2DLFH 3BP5B 5JXED 4PJXE 1R3HA 2QTEA 4X6CE 1Z5LA 3C5ZC 3WXWH 4JKMA 4KK5D 5C09B 2GY7B 4ZUTA 2EIBA 3FOMA 4QHUA 4QHKJ 4YUEL 1ZXQA 1V8HA 3WMSA 3MACL 5CJBA 5HJ3A 4IDJL 2GJ6E 3ARED 4DKEH 1FAKT 3L9RB 3QJFA 3WKML 2VR4A 3LDBB 1NMAL 1AP2A 4LSPL 1YMMA 3MR9A 5D93C 3SDXB 2ZUYA 1R0AL 3QCUH 2YN3A 5FXCH 5I6XB 4LHQB 5IMOA 4RFNB 1BQSA 3WLBA 4R0LC 1QFOA 2DTMH 3FQUB 5CZKA 1NEUA 1CI5A 4JHWH 4GG6B 5I76B 3OF6D 3EO1A 3PHOB 2W0PA 3WD5H 4Z95L 1MPAH 2ARJA 3DUUB 5T1KB 4G42B 3V6ZB 4XRCA 1S8DB 4M6OH 5L88L 5AZ2L 4RAHA 3ARFA 3T04D 3ES6A 3QRGH 5C0CD 1K2DB 3EGSA 2NY3C 2HTKC 1J9CT 3QDJD 4KUZL 3RU8L 1IKFL 4QHMA 3HI5L 5TFSL 1P5VA 2BNUB 4YHLH 1C08A 1DN2A 3P77A 3QNXB 4OSUL 5K9QG 1IQDA 4YDVB 2ITDB 4IIQC 1FJ1B 2DLEA 2J5LB 1YQ2A 4O2FA 4DKFH 4JFEA 4HBCH 2JCCB 4WHTA 3LZFL 1PDKA 4U1IA 4WI9A 5D7KE 1RIVL 4Q0XL 1BPVA 5MEPA 5EULV 2Q86A 3F7PC 3SE8L 4NQVB 1NCUA 1LEIB 2CLZA 5EBMA 5SWSD 2WV3A 4N0UA 3H42L 3GBNH 4OM1H 4ZG1A 3VXRE 3W0WE 4ZYKA 2FDBP 4CVZA 3NABL 2H9GA 4JKPL 2Z91B 5JDSB 3HI6H 4J4PD 1L4IA 2QSTA 1JHTB 1R5VB 3KPOA 4P23A 4FQLL 3PJSB 1DN0A 3HCVB 4OZHE 1U3HD 1YEEH 5GISL 3IDGB 5IT2L 5CJ8A 2BXYA 3UBXA 5ILTL 5D70H 1WAAE 4OF3A 3FMGH 4NIKB 1J5OL 4JGUA 1N8ZB 1DLHA 4OGYL 3ZHLA 1B0RA 4GRMB 3HUJE 2YWZA 4LOUD 1ED3B 2WIIA 5I1IL 3BT2L 4NSKB 2VZUA 5HHPB 1MCEA 3BISA 3P73A 4LHUG 3W82A 1CBVL 1QVOA 2A77H 4HKJA 1I1YB 3S4SG 4TOYH 3RZCD 1MUJA 5EPMA 3C8KB 4G6ML 4QHKI 25C8H 2Y9RT 1LDSA 1A6VL 3RWDA 2WLZA 5L8JB 5EOQH 3MRBA 2H32A 3O4OC 4OLZH 3ZDXF 1FL3B 4X7SH 4AL8L 2WINA 1RZFL 4MA1C 5EC2A 3DVIA 4KZDH 3ARWA 2A6IA 1A7QH 3ARBA 3MLTB 2FZ3A 2GK0B 4LSUL 3G5VB 5SX5H 5IB5B 5DJ8B 4LF3A 5E2TH 4FQHA 5BOZG 4JPVL 3AROA 1S7RB 3SKNA 3SJVB 2NR6C 1FN4A 4GS7B 4MLIA 3RVXC 1I1FB 4W6YB 3RI5K 5EU4B 43C9B 2BY1A 4JB9H 2FO4A 4OD1L 5CILH 2CRIA 2D9CA 1CE6A 5C2BL 3HZYA 4HH8A 2CSPA 4QXTA 1A1OB 5L2JA 1EHXA 5TH2B 4MAYD 2J4WL 5FGCE 4MD4<