3IFPB

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12b4) complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12B4 FAB antibody heavy chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 218
sequence length 218
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifpB01
4WW2C 5DVMA 3G9VA 4TULL 3QIUD 5F3HB 4OFKA 5BW7A 3OKKA 3CFBB 5D6DA 5IMKB 1CLYH 4UUJA 3TH4T 3UTSB 3T0VA 3MV9A 3HRZA 5DJCA 3HI1B 3QCUH 3BZFB 4PJFB 5J4MA 5F7DA 4AL8L 3X11A 4MB4A 1JF1B 2ZCKL 2Q1EA 5BRZB 1CTOA 1WZKA 4KJQD 2VLKB 1T21B 5TE7H 4L9LC 4M5YH 1SJEB 3B3IB 4WV1C 2E27H 1NFDB 4GAYB 3ZHKA 1G9NC 2UV3A 4E42A 3S6CA 1F4AA 5JDJA 1I7UA 1G7HB 3OB8A 4MNHB 3TBWB 2PW1A 4OLXH 4ZAKA 2DB8A 2Z91B 4J7RA 4HS3B 3BEWA 3HMXA 5DHVH 1NANI 2DMCA 1RZKC 2CH8A 3GIZH 2IC2A 5LKNA 3X17A 5I71C 1JI2A 3VFMB 5BS0E 1RUQH 4EOWH 5D2NC 4U1HB 4X6FA 1WEJL 1KPRA 1WLHA 2WW8A 4RWYH 4K3JH 4K9EL 2DAVA 3JWOC 4X99B 5JNYA 5DJ8A 4HK3N 3VGGA 4XPTH 3T2OA 4F58L 4P23D 4WGWB 5DWUH 4IM8A 3ZHDA 4WHCA 2CIIB 5FM5M 3FQNA 1PZUB 3WFEL 2YD9A 5HGBB 1CLCA 3MRPA 1LEKA 4IRZH 3RDTA 1IEHA 3F5WA 4OT1H 5F1IB 4HMDA 5HGAB 1QKZH 2GUOB 3BHBB 3MROA 4JFOB 1BD2E 4Y4FB 3F12B 1FGNL 1WVZA 1TZGL 2O26U 1I3RB 5I8OL 3V52H 1U8IB 5BS0A 3NCFB 2V9QA 4PRPB 3TT3H 5T1DH 5JPMB 3RY6A 2VL4A 2BDNH 1TXKA 1UADC 4XPGH 4FQXA 4UT9L 5D71L 4QRQB 2YHGA 4CNIB 5IMOB 1LO4H 5DT1L 2I9LB 1VEPA 3ESVF 1YEEL 1DQDL 4H1LA 4WNQA 5JO5A 4CVZB 2CGRL 1ITCA 1SY6L 1U42A 5C0CB 4AEFA 3H9HB 1LNUB 4CN1A 2ZOKB 1IAIH 3WKMH 3GBLA 1BD2A 1UZ6E 5C71A 2FX7H 4CJ0A 1NMCC 5F72S 2FYYB 2PR4H 3EO1A 3O2DH 5CZVH 4LARL 4L9LB 4W68A 2VJXA 4NSKB 3VXTA 4XNXH 1UKSA 5GRZA 1IARB 3ARFD 1BQHB 1V5JA 4PP2B 5DVNA 3FB5A 3U7WL 2YD2A 3UMTA 1WV7T 2E8YA 1QSFB 5MERB 1M7XA 5DSCB 3W11C 5CHNB 2C3HA 1KB5B 3HZVA 2F53E 4MSWB 3IDMB 4Q6YA 4QKXB 2R0WL 2FZ3A 5GS0L 1N6UA 1H15B 4DUXA 3PIQA 3U0WH 1LE5A 3L5IA 4ODBD 4KKCC 1NGXA 5HHNB 1NCAL 4KROC 4HCRL 1EH9A 4ODHL 2G2RB 1NGPL 3B6SA 1S5IH 5FA3B 4QRPB 5AZ2H 5GS2D 1AI1H 5LGHH 1PBYA 1QFWL 1V8HA 4GRLD 1JIBA 3LZFH 1AGFA 3MJ8A 1X5ZA 4R8WL 4KC3B 5EBMB 4FRWA 4H0GA 2BVQB 4ZNEA 5I73C 3STLA 4WW2F 2F53A 3WJJC 2G9HB 5L8KB 4HXAL 4MJ6A 4XPHL 1XGRA 1CL7H 3ARXA 3DETD 4MD4A 5DA0B 3IAGC 4WJ5A 5T3XD 3DI3B 1ZHNB 4X6EB 1OCWH 1FH5H 2V2TA 4PTTA 2R39A 4LBEA 2DQEL 2A77H 1MCIA 3BPCB 2AJVH 1QO3A 2DYPA 3CMOH 1G7MB 1HSBB 4HFUL 3BRGC 2MMXA 1QLEL 1GGYA 1HHIB 4MVBD 1I9JH 4QHKJ 2Z35A 4APQA 3SPVB 1NCBH 3OWEA 1BGXL 4JFEE 5EFIB 4CUCA 4OZGF 4UAOC 4PJHB 5GS3A 5CUSL 2FECL 2BVUA 2XFXA 3KPQA 3QEQD 1UWEH 5HYJD 5DD0L 5GGQL 3FONB 4OKVB 1F5WA 1NMCB 3E6HA 1J10A 4P2OA 4JVUA 5D2LE 2R2HA 3REVB 4BFIA 1S9YB 3IFLL 2IFGA 4PG9A 5A3ID 2NY0B 4MCYA 4NQEB 4JPWL 1DP0A 2K9UA 5ID0B 5TQ2H 2DKMA 3MRHA 2WBJC 3BP4A 3P77B 1U8MB 5KSBB 1LE9B 2V7NB 4Z7UB 2CJUL 1MQKH 3DMMC 3OR6A 5AYUL 3ZTJH 3CVHA 1RUML 3MRDA 1EXUB 4UBDD 3U1SL 2NY4D 5LCVL 1T1YB 4JFEA 5IKCB 2ZP0T 2LFGA 3QFJE 2R29H 2CUMA 3D85D 1E4KA 1OHQA 3EYUH 3V7MA 1P4LB 4QHUA 4GQ9H 5AAMA 4KROB 5GZND 1HSAB 35C8H 5C08D 3ZSTA 1FVDB 3GKWL 4FFVD 1DANT 4I18C 4TNVK 3A67H 1WSST 4JRYD 5F93C 3SKOB 2C3VB 2ICWA 4LPXA 3DV4B 5I73B 5LJYH 4QRTB 3ZDZE 1OF2B 2FGZA 2W9DL 5DJ2B 3O4LB 3HI5H 4H88H 1N59A 1Z3GH 5IV2A 3CSYA 1I8KA 2NW2B 4HG4J 4Y16A 2HRPL 1XF3A 3QFJA 4JO2L 3GSUB 1Y18A 4WWKA 3MLVH 3MLWH 3CFCH 4CVWA 2Y06L 4JFQA 4Y88A 2O5XL 3UO1L 2L4OA 3KAAA 3EKCA 4NOFA 5F9WC 5FB8A 3REWA 4MNGE 1AC6A 5DUBA 1BWWA 3Q6FB 3DHJA 2F8OA 3HCVB 4S1SH 5AD0A 4O2FA 5E2JA 3D3VD 4OI9A 15C8L 1MAMH 3MRGA 4GG6F 2ADJA 2X70A 4AG4H 2XQYG 3W9EA 1V3KA 3MBXH 2XQBL 4GMSL 4UAOB 1LO3L 3BH8B 4P4RB 1OQOA 1FFRA 2PYFA 4K2UH 1I7RB 2BRRH 5AWNH 1FBIL 1RIUH 4BQ9A 3SE3A 1FGVH 2FEEL 3BWAA 2DQHL 5ID1B 5LGJA 5GGVH 3T65A 3L5XH 2G5RA 4X9FA 1CZ8H 2DJ4A 2WBJB 4D9RD 3KPLA 1A6ZB 5F44A 1EFXB 5HJ3B 4PGZA 1D6EB 1SYVA 4DWHA 3ULSB 5E2UH 1F90H 4IMKC 4S10A 2Q20A 4KY1L 3DMMB 4ZSOE 4OCWL 4YNYB 1QR4A 4KDTC 3HUJE 3EYSL 3LS5H 5DO2C 4G6FB 3QIUA 1S9XA 2YPKB 2X89D 5E6IC 5JW5A 1A2YA 1IGJB 4NC2B 1CXLA 1Q9KB 3I9GL 3WYRA 2EKSB 2GTWB 1DUZA 3U79A 3O9WC 2C3WA 3H3BC 4I18B 1VEMA 3V4VH 1IBGL 3TPUB 1NCCH 1BQLL 2HT2C 4KVNL 4B7LA 1BFTA 3KNBA 4KK9C 3JXAA 4PB9L 4PJDF 4Y1AD 2V17H 2GK0B 1U92A 4RCAA 4JRWA 1AGDB 1NSNH 3QIWC 4Y8DC 3BYTA 4ZSOA 1F02I 5IQ7L 1JGVL 3BO8A 2OMBA 4QWWD 12E8L 3HUJA 2B1HH 1MFDL 2CKNA 1NEUA 1QG3A 4JY4A 3R1GL 5EA0H 1IC7L 4M1CC 3PWNA 3MLSH 2VZ1A 2BJMH 4P3DB 4HFWA 1RJYA 3FB6A 1A4KA 5KW9H 2DMKA 4P5MB 2QSQA 1A7RL 4TVSa 5B39A 4O02H 1DVFB 4LEOA 3ARQA 4F7TA 4XBGB 3RHWK 1F3JA 4UT7H 4CMMB 1JGDB 1NMBL 4U3CA 4C83A 1MREH 1J1PH 3A6BL 4OLYH 4PRID 4HBCL 4PV8A 3GGWA 4H5SB 4JFXB 5DK3A 4G8IA 4UOW1 3I3DA 4P23A 3VI4F 1AXSB 4H26B 3VFSB 3CCHA 5IP4A 1QHPA 4FHBD 3O0RL 1A4JB 3MSPA 5KOMC 2ZSWA 5ITBL 4LSTH 1OTTD 5FO8A 1OAZH 2VDNL 3KJ4C 4Y19B 4KVCH 3O4OC 3DX6A 1YN7B 2ZJSH 4K3DH 1G7IA 3ROLB 1MHPL 5INDB 2R0LH 5CILH 5DA4A 2P43B 3VH8A 2PO6C 5DJAA 5E56A 3K8MA 4AM0B 4ZPTB 1WBYA 3C60D 1IZJA 4J6RH 1NLDL 1MJJB 1MCPL 5J8OA 1U58B 2MFNA 2QSCL 1FV1A 5EOTA 4PRAB 2VDMH 3QUML 2PNDA 4FG6C 4BJLA 1MFBH 5CP7B 4KHTH 3WLWC 3UTQB 3EFFA 1EPFA 4M4PA 3WFBL 2CK0H 1YYML 3MV8D 1G6RL 3O9WB 1A7PH 3MOBH 2QQLL 4JPVH 1KIRB 5ITFB 1IAMA 5GRVK 3P30L 1A6AB 3TYGL 4IOSD 4NCC2 2ARWA 2B39A 4N8VB 3RWCB 2HWZH 1NDGB 3GKZA 2C1PA 2NZIA 3QIWB 5SWZB 3GI8L 5K9JH 1MFCL 3PHOB 5D1XC 3WFZA 4NO3B 1QD0A 1Z2KA 5FO7A 2JJTA 3WN5C 1P84J 3WMSA 1K4DA 4ZDHB 3AMKA 1NDMB 4K8RL 5FHAL 3PWVB 3LN4A 2MWCA 1NC4D 4OQTH 5GISH 4DFIA 4Z95L 2DL2A 1JPTL 3BT2H 4M6NL 5D6DC 4ZO9A 1F4XH 3WEXA 5I66B 3O3DB 4OAWA 3VFNB 3GBNH 4Y4HD 4ZOEA 2VDLL 4S1DC 1CDIA 5B3JE 2J6EA 2GCYB 1P4IH 2OJEA 5J13B 2HFGL 3CZFB 2QQKL 1KOAA 1KGCE 4OI7A 2DQJH 4GRLA 3CSBA 4RA0C 5IVZA 3UPRA 2H32H 4JFPA 2KDGA 5E94A 3KPRD 4EJ1C 1JPGB 2QL1A 3LV3B 3WIFA 3QEGH 4RRPA 1WGOA 5HHOD 5L6YH 1IGCH 5J1SC 3VG0H 4XCCH 1P1ZB 3TNNA 4NKIH 1Q72H 2PO6B 4HXBL 4G6KL 1QBML 5BO1H 3K46A 5IB1A 2Y23A 3TEUA 1BBJB 4MA8L 1FFPB 1S9WB 4ESKA 3MV7B 5MEQA 5DD3H 5E95B 5CGYC 4PR5B 1MUJB 2Z9TA 4GLRH 4RMRA 3EZ8A 3SE8L 1GPOH 3QAZB 5HI3C 3FN9A 4O2CB 5I1CH 1YNTA 5GRVL 2QTEA 2AK4B 4WI6A 5K93A 1YMHB 3I6KA 1WZLA 1ORQA 3RDTC 2D31B 1X7QA 4N90E 5C08E 2EKJA 2FIRT 3MRLA 1XCTA 1XCQA 4L3ED 1OP9A 2ADIA 4XX1G 4ZFOA 4G6AC 3VXQB 5D1XB 5DTFB 1FG9C 4FN0A 3QHZH 3SCMB 4FMFA 5FGCB 5B8CC 5CINH 3WN5B 2J8OA 4HPOL 4L8BB 2ZUTA 1E6OL 1N6QH 2CMRH 4NQCD 1OPGL 4FQXC 2F5AH 2JCCE 1KJ3L 4M43L 5B22A 4X4ME 1GOGA 2WUBL 4UUJB 1MOEA 1WIUA 5I16A 1S7TA 3HRZB 3D85A 5DJCB 3T0XA 1QLFA 2V5TA 2CO7B 1IT9H 2AJZA 1SBBA 5F7DB 4HUNB 5C08A 5GSRA 1MPAH 3X11B 1NBQA 4PBVC 4M7LH 3VCLA 4YHZH 1PSKL 5IFHH 4QGTA 3TM6A 4JRYA 1PKQE 3D3VE 2DN7A 1G1CA 3LHPL 4POZC 4G3YL 5HGDA 2Z93A 3RL2A 4E42B 1WT5A 1MI5D 1AIFA 1RU9H 2VXUL 4YHLL 4Y5YC 3FTGA 2PW1B 2AW2A 4X4MA 5EOQH 1NCWH 2KZWA 1DN0A 1ZLVH 2HP4A 4J4PA 4Q0XH 1WZ1L 2D03H 3VD4A 4U6VH 1RK1B 2OTWA 2YUXA 1XR8A 4D9RE 1Q94A 4OLZL 4HS8L 5TF1L 2ZCHL 3OAZK 1UENA 3WS3A 4X6FB 4RGMB 3OKDA 3VFUB 1PKQA 3D3VA 4ETQA 2AEQH 3IF1A 5JNYB 5DJ8B 2FHFA 2BC4A 4LLQA 3JWDL 3VXUD 1YEHH 5EBGA 1NANH 2NY5C 1L0XA 3FRPG 5C6TL 1LEKB 3SGDI 3RDTB 4ODTH 2P5WE 4DQOH 1OP3K 3F5WB 1ACYH 5A2IH 5KVFL 2NYYC 2EDKA 4FXKA 1KBGH 4JN1L 1IMHC 3MROB 5FFLA 2A1WH 4C4KT 1IILE 1MJ7L 1BP3B 3V5DA 1BEYL 1KSRA 4S2SB 1JVKA 5B8CB 4Y5VC 5E99H 1BVLB 4YDKL 4Y1AE 4DKDC 3F58H 3NZHH 4XBEL 4FQXB 1P4BH 4HH8A 1YY9D 4I13B 1FRGH 3B2VH 1H3PH 1FFOA 3EDKA 3DOSA 4H1LB 4WHDA 2X89A 4WNQB 5JO5B 1NCNA 1BZQK 2BVYA 5GGTH 4APQC 2P5WA 1I85A 5CCKH 1YEKH 5C86A 1RUAL 4FABH 2AABL 5TE6H 3GSWA 3G5VA 3S4SA 1BD2B 2ZG1A 4XT1C 1ZLWK 2FD6L 3RA7H 4X7SL 4JHZA 4D3CL 3SQBA 2HT4C 3ULVL 4Y1AA 4PRIE 1UH3A 4KUCF 3FB5B 4JG1L 4MA7L 1QFWI 3TA3A 3V2AR 4QTHA 4Y5YB 4LPCA 3B8YA 3SE9L 5FGBC 1YPZF 5I1GL 3OXRA 3MLXL 4P9HH 4AIOA 2FGWH 2FZ3B 4OF5A 1TCRA 4M93C 5L2KB 3ULUL 3PIQB 3F65A 3HS0A 1JNLH 4QRSB 2IWGA 3QQ9D 4HC1L 1E4KC 3IAQA 3UTZA 3JV5A 1NGXB 4LNVA 5CZKA 1DBJH 4LSPL 3UEZA 5KVGL 2UZYB 2BY1A 3B6SB 4HF5L 2DD8H 5DZLA 3ZT7A 4Z7NE 1H0DA 4M9PA 3GI9L 1AGFB 3MJ8B 4PRIA 1FZOB 1YMMD 2KQMA 4LVEA 3RY4A 4OZIE 4GKNA 5MI0C 4XTRD 3MV8E 4MCZA 3OBAA 2F53B 4I77H 1UCBH 4MJ6B 1XGRB 1AE6L 4MD4B 3QWQB 4WJ5B 4Y16C 3F7QA 5J7CC 4K3GA 3V5KA 5IEKA 1A7QH 2V2TB 5E4EC 4PTTB 4LBEB 4BZYA 4WWKC 1H3GA 4BFEA 4AT6A 2E7LA 2DYPB 3C60A 4EXPX 2VDKL 5ISZD 4FQLH 5E5RB 1J0JA 3AMLA 4WO4A 3BE1L 1QYGH 3K1DA 4NQSA 3S9DB 1PLGL 2D0GA 3QFDA 1OARL 3NCJL 4APQB 2RIKA 1YUHA 4PJCF 4OZIA 2HH0L 1JRHL 1M4KA 3VFTB 3NIFE 5CP3H 3BGMA 4PLKD 5AZEL 3MV8A 2GI7A 2XFXB 4WU5A 2OZ4H 3G6AA 5FAAA 4C58B 2NY6B 3QCVL 4PJXF 4HQQH 3M1BA 3E6HB 3Q5TA 2R2HB 4BFIB 4FNLL 2Y25A 3SE3C 2J88L 1BVZA 4PG9B 3K2MC 4MCYB 1UT9A 1E28A 3VWKA 1IE5A 4ZS6D 4LKCA 4YXKL 3BP4B 1YA5A 3P0VL 4MXVE 1EJOH 3QH3B 5I1EH 1FAIL 2HKFH 1CFSA 3OR6B 3CVHB 4ISVA 4RA3A 4H25A 3MRDB 4LASH 3PWJA 4PRHD 5L7XH 1C12A 4JFEB 5HTSA 5HHOE 4M93B 1INDL 3DO3A 1RUPH 5JHLH 1NC4A 1K5NA 4QHUB 5C9JA 1VGEH 4Y4HA 4H8WL 3QZWA 4U1IA 4KDVA 1NGWA 4XXDA 5D7IF 4R3SA 1WTLA 1LEGA 3MJ6A 5SX5H 2FJHA 2ICWB 4EI6A 2AI0L 4LNRA 4CU8A 3O6KL 4CKVX 4DTGL 3KPRA 4MMXC 4UQ3A 3JBG7 1N59B 2W0FA 5IV2B 3CSYB 1I8KB 4Y16B 1E4XI 1XIWD 3NCEB 5IHLB 3ZDYF 1XF3B 5HHOA 3FQWA 1UACH 4Z7OF 3QFJB 4ODSH 5E4EB 2XV6B 1Y18B 2DLTA 4WWKB 1T89C 5DRNA 1IRAY 3VDCA 1F8TL 1VPOH 3BKMH 4OM0H 2O93L 4L3EE 5FB8B 3REWB 1VENA 2HFFA 5DUBB 3AC0A 5T33L 2Y5EA 1IKNA 3MCG1 1JN6A 2FEDD 4FQQA 3BZ4A 3S37L 5AD0B 2NY1C 5IB3B 3MRGB 4G6ML 3MJ9L 4OD1L 2ADJB 2EDXA 2X70B 1LILA 2MSPA 3W9EB 3BD5A 4NQCE 3WFDL 4HPYH 5ICYA 3X3GH 2PN5A 5TFSH 4N8PA 3AXLA 2XZQL 5CD5D 4XNMA 3PP4H 4P23C 2PYFB 4JY5H 3L5WA 5J0BA 2AV1B 5MP6L 1V3JA 4FQ1L 3RX8A 4ALAH 3GUTA 1GYAA 1RV6X 1KELL 5FYKL 5FF6B 4NGHL 3FZUD 1K3IA 3T65B 4L3AA 1BVKA 4XNUL 1B9ZA 4L3EA 2FX8H 1GC1C 1PD6A 3KPLB 1M6OA 3CLEL 1SYVB 4BZ1L 4TYUA 3UJIH 4EIGB 3IXAA 1S8DA 4WY7H 4NQCA 4JO3L 2X1WL 3QIUB 4G8FA 3MLYH 4NUJB 1A2YB 1Z9SA 5JW5B 2DQDL 1OSZA 3BESR 3IJSA 5T5FL 1IC5H 1DUZB 4Q9CA 5CEYA 5F89A 1H3UA 3N1QC 4PB0H 1F2QA 2MOVA 4LEXH 3KNBB 3UYOD 5EZIH 2OJZL 2P1YA 1HQRA 1U92B 3IVKA 4XWOD 3VGFA 4HKZA 2AXHA 1HHHA 2AK1H 3MA9H 2IANE 4KJYA 4JFDD 4ZSOB 3NFSH 4PY7A 3QHTC 3VXUE 5JXED 3VFRA 3ARFC 3BO8B 43CAA 3HUJB 1MI5A 1L7TL 1VKXA 1CD8A 2JJTC 5DDHA 1UJTA 3PWNB 1K85A 2EC9T 4HFWB 3WXWL 3L3OA 4NKMA 1RJYB 4OZHB 3FB6B 1A4KB 4U31A 4D0DA 4NZRL 5DFTA 1BQSA 1EVTC 4P2CG 4HUKB 3D6GA 4NKQB 3J8F7 4EN3D 2VAAA 5B39B 3U9UA 4LEOB 4F7TB 4NRZA 5F7NC 4BFBD 4UINL 1F3JB 5I8CA 3SDDD 1B6UA 4C83B 4HWZA 4HHAB 4YHML 4PV8B 4R90H 1P7QD 3GGWB 3H9SD 5EBWA 1KENH 4ZD3H 1ZHKA 2VUYA 5GJSL 4OGAD 4N0CD 4WUKH 4KI5D 4P23B 3VXUA 1BBDL 3CCHB 5IQ9A 1K3ZA 4JM4L 1LK3L 4NZUL 4M8QA 2ZSWB 2VSCA 2ORBH 5F21B 1T6VN 2VISA 3DUUA 4NNXA 1T2QH 2Z92B 1FNGA 1G7IB 4U4BA 2R9HD 1R3JA 4OTXL 3VH8B 3T0ED 2B7DT 4MAYD 3MLZH 2C3XA 1ZV5A 5DJAB 4NO2B 2IMMA 1OLLA 1WBYB 2GW5A 5AYQA 4NFCA 2B1AH 2JIXD 4A6YH 2BERA 1DBAL 1FV1B 1P9MC 3W2DL 3NA4A 3RZWA 4E0RA 2AV7A 4MVBC 3EFFB 1GL4B 4YDIL 2PTTA 3PGFL 4LU5H 3MX0A 4L8DA 3UBXA 1W72L 5IMMA 4LKXA 1O7SA 5SV3A 3T09A 1FVEA 2PXYD 3K81A 3ZE2F 3BH9B 3QDGD 1WBXA 5CSZB 2M2DA 1PFCA 5BXFA 3UPAA 2XN9E 5A3IC 4IRSD 3CFEA 3H3KA 3ARFB 5CEXA 1NKRA 4LVNC 3TJEH 3LEVH 5EU3A 5E2TH 3NIGE 4YPGA 2NY7L 5TJWK 4HIXL 1VADA 4GG8A 1E4WH 3G5XA 2YSSA 4MYWB 4UBDC 2NY4C 4JFZL 2UYLA 5IROA 5HHXH 4MAUL 3WEXB 4I2XB 4OAWB 2WNGA 2DLIA 2OJEB 5DJ6A 5GZNC 3FFCD 1HZHL 4FFVC 4U0RC 1KCVH 4GRLB 5ISZE 3U4EA 4M03A 5IVZB 3U0PA 3UPRB 1I9RL 4JFPB 2X1QA 5E94B 1N4XL 5AUMA 2ZKHL 3WIFB 1I3GL 4M61A 3O2VL 1R0AH 2FBOJ 4GXVH 5DS8A 5J89A 4DVRL 1FLRL 2JELH 3AY4A 3S36L 3B9VA 4FS0A 4GAJL 1ZMYA 3TNNB 1NAKH 3WS6A 4O51A 1ZSDA 1YEFL 4FFZH 3ET9F 1NGZA 3L6FB 2BOCA 3BPLB 4L29A 1J05A 5IB1B 1G9MC 5MEQB 1FO0A 3HR6A 3EJZD 2JKXA 3IYLW 2GJ6D 5ISZA 3N9GL 2VYRE 2WIMA 3R8BB 2ESVD 4PRHE 3DVNA 5DVKA 4OQTA 3VG9C 3BRDA 3I6KB 3VFWA 5I8KL 4KGJA 4N0RA 2VN7A 1ORQB 3QEQB 4BQCA 4LIQE 5C0JA 1S78D 5JMOC 5I6XC 3DX8A 1OT2A 4XAWH 2EEBA 3MRLB 3GBML 5ETUB 2NTSP 1XCTB 5KBNC 1XCQB 2WM0A 4KTEH 1MCWM 4NCC1 2AJ3A 4ZFOB 5IGXL 1FPTL 2VTFA 5GS1A 3G08A 4NQTA 2DRUA 4TRPL 4TULH 4YDLC 4OF3A 3O3AA 1QVOA 1OTSD 4BK4A 4PJBE 3OJDA 4HBQA 5LG1A 2NY4B 4PRHA 5ESAA 5LXGL 5E08L 2WMPA 1TJGL 5I16B 1S7TB 4AL8H 3C8HA 5EPMA 4LLVA 3D85B 3HE6D 3K4AA 1QLFB 1UM4L 1I85C 2ZCKH 3O6FD 2AJZB 5C08B 1JZ6A 3VCLB 2VSDA 4KKBD 5F70A 4JRYB 3DSNA 1GRWA 1T1ZA 1KTKE 2CDEA 1MFNA 1U2HA 5HGDB 2Z93B 3RL2B 1NCTA 3GZKA 1AIFB 4C55A 4PJBA 4OFIA 2EDQA 4AH2A 3L5JA 3FTGB 4QWWC 3MACL 1XIWA 4NO0D 1DN0B 3FB7A 3F7RA 4NHUB 1BJ8A 5EC1A 3TLRA 4UV4L 1U3ZA 1WEJH 1XR8B 1Q94B 5BVJA 4IOIA 5F6IC 1EJ6A 4K9EH 1UA6L 3EOYG 1S7VB 2BNRD 3WS3B 5IVOA 2XKNA 3OKDB 4F58H 1DCLA 1PKQB 3D3VB 4M1GL 5DJYB 1KB5L 5E00A 5F71A 3IF1B 3VGEA 3WFEH 1MWAA 1U8LA 2BC4B 5B21A 3CU7A 4LLQB 6FABL 1QFPA 3RWEB 3QNXA 4X83A 3MUGA 2E9BA 1ITBB 5I6XB 2Y7QA 1TZGH 5I1JL 4FXKB 1REIA 1U9KA 4Q6IC 5I8OH 2LABA 5FYLL 1OTTC 5JW3L 1BFOA 3SDXE 1I7ZA 3JWOL 3V5DB 3HLAA 1RIVL 3GRWL 4JE4B 4UT9H 5D71H 2E7LC 3EHBD 3DGCR 1BREA 3R0MA 5MEOA 5DT1H 3K2UL 4JFDE 3C60C 5SX4I 1YEEH 1DQDH 3LDBB 4JR9L 1I1CA 2CGRH 5DJXA 1FFOB 1SY6H 3O11B 3KR3L 4JY6A 1HH9A 2ZUXA 1IGFL 1O0VA 2H1PH 2HMID 5IB2A 2X7LA 2B2XL 2UWEF 1CE1L 1TQCB 3WIHL 2VZVA 2GYSA 1NEZG 3GSWB 4XGZA 4LARH 3G5VB 3S4SB 4ZYKA 5IT2L 4BUGA 3X3FL 3SDXA 1CDGA 4JKPL 1X6LA 3EYQD 3V9FA 1S5HA 4Y1AB 1FNAA 2OQJA 2Y4SA 4UTBL 3I3EA 2NTFB 1Z0MA 3H9SE 2VDRL 5F7HA 4JFDA 3DRQA 5TGBB 4NM4L 5JXEA 2DTML 4KKAD 1MCEA 3ILPA 2R0WH 2AXGB 4XHQA 5GS0H 3OXRB 4HX1B 5IVXB 1CXIA 1TCRB 3TWCL 1NCAH 1GZQA 4HCRH 3EOTL 4ODHH 1NGPH 3UTZB 3NA9L 2R1WA 5DR5L 1QFWH 4ODWA 4K3HA 2B4CL 3WBDA 4R8WH 5DYOA 3S97C 2RBLA 4KV5F 3DVGA 3WHE0 1H0DB 1OM3L 3BYYA 4PRIB 1FSKC 1P7QA 3E2HC 2GK2A 3H9SA 4PJ5D 2HJKA 4HXAH 4OIBA 4XPHH 5GGTA 3CDCA 1MNUL 4MCZB 4Q6IB 2DQEH 3SN6N 3EOBA 5CEZE 3V5KB 5IEKB 1G0XA 3DGGA 3SOBL 1N7ML 2PTVA 4RMQA 4AT6B 4U2YA 3QDGE 3BKYL 4HFUH 4MAYA 1QLEH 1FNEA 3C60B 5J56B 3TN0C 1IKNC 2JIXA 4FZEL 3ZO0A 1BGXH 4CN4A 1G6VK 4NQSB 8FABA 5AG9A 3QFDB 1GGUA 4IMLA 3C87A 1T2XA 1YUHB 4D9LL 4OZIB 5DD0H 5GGQH 2OL3H 3BGMB 3MV8B 1JZ5A 4LPWA 4WU5B 2LVEA 2IPUG 2NZ9D 5IB5A 3IFLH 3QWOB 1S7UA 1J7VR 1CGUA 4JPWH 1HYSD 2DQIL 2PXYA 3FFCE 4CL7A 3DHMA 1E28B 1GOFA 3QDGA 4LKCB 1MH5A 2CJUH 1CGVA 4IRSA 4NOBA 5AYUH 4BQ8A 3P2TA 1RUMH 1A8JH 3U1SH 1U3YA 3MZTA 3IFPB 3UC0L 4Z5RA 5HVHC 1A6VL 1CFSB 5ESVA 3S34L 3F7YA 1EEZA 2Q7NA 4ISVB 2X40A 5FV2A 4H25B 1CXKA 4R9HA 3PWJB 1X4XA 1FAKT 1KTLA 1C12B 3B9EA 3JV4A 5IBLD 4G6JL 4X0KB 1NC4B 1A9BA 3WD5L 1V7ML 1ND0A 3GKWH 2I24N 1K5NB 5C9JB 1I7TA 2WQ8A 2VDPL 1A6WH 2B5IC 4Y4HB 3QZWB 3L3HA 3JWNC 4U1IB 3FL7A 4HIEA 3L1OL 4OF8A 1NGWB 4XXDB 2MPAL 3FFCA 1FSKB 3E2HB 1LEGB 2AXJA 2FJHB 2GJ6E 2W9DH 5D5MA 4EI6B 3INUL 3LQZB 4LNRB 2M1KA 2X42A 3RIAK 4P59L 3KPRB 2ESVE 2HRPH 1FZMA 3CPLA 5DGRA 2HLFD 5FKAA 5T3ZL 1G84A 1U8PA 2W0FB 4JO2H 3VXNA 1EERB 1HIML 5HHOB 1FLTX 2Y06H 3FQWB 2O5XH 3UO1H 4MX7B 1PW3A 5DRNB 1L9NA 1MSPA 4D94A 4JFFD 2NNAA 3LEXA 2F9BT 1CGWA 1DTUA 2HFFB 2UZIL 3DWTA 15C8H 3AM8C 5I1KL 4FQQB 3BZ4B 4POUB 1OGAE 1C5DB 4M5ZL 5DZOA 1S7XA 2XQBH 4GMSH 4LHJB 3WFHB 2I5YL 2NX5D 1LO3H 2GJ6A 3TC9A 3NACL 3H7BA 4XP4L 5ICYB 3GSOA 5LWYL 1FBIH 2ESVA 4LSVL 4XNMB 4PRDA 1D5MA 3MQIA 2VB5A 3L5WB 3ZTNL 5DJ0A 2DQHH 1LWRA 4YE4L 3GUTB 2DF3A 3RGVD 4N5EC 3GSNL 1YC8A 4I0CC 3QJHA 4YHKL 1BVKB 4UIKL 1YYLL 4OZ4A 4KRNA 4L3EB 1NUFA 1M6OB 2BK8A 4PJEA 4OCWH 4YXLL 3DRTA 1OGAA 1YN6A 5DC4B 5HVHB 3QO1A 5E1AA 1BQUA 4HJGA 5I9QC 1Z9MA 2IFFL 2WK2A 3IXAB 4QCIB 4YUEL 2XA3A 2DDQL 4NQCB 1N26A 3RJDA 1I9EA 4U3XA 3I9GH 4M02A 1DDHA 4G8FB 1HE7A 5FUOL 1YY9C 1OSZB 3IJSB 2QSVA 5DRXA 3MRRA 1IBGH 3HE6A 2DWEA 1BQLH 4KVNH 5CEYB 2HTLD 1EZVY 3O6FA 3DNKA 4PB9H 2VKWA 5F89B 5LGKA 4QHLA 1FFQA 4HDIA 1RHFA 2BNRE 3O3EA 4TSBL 1M7IB 3ARED 1HQRB 3IVKB 5IQ7H 4HKZB 1JGVH 12E8H 3EDEA 1MFDH 4KJYB 3NCBB 1O7VA 4PY7B 3P4MB 3WV0A 3VFRB 1Q9OA 2QLVB 3R1GH 1IC7H 3MA7A 43CAB 1MI5B 4HUUA 1VKXB 3ARRA 1EAPA 3NAAL 5DHYA 1FNFA 3DO7A 1A7RH 1DQJA 1OT1A 3L3OB 4N9OB 4NKMB 4NO0A 4KI1A 4D0DB 2YN5A 4Z9KB 1MIEL 3IRZA 4W6XB 5F7MC 3OZ9L 2WP3O 2VAAB 1F13A 3U9UB 1NMBH 4KK8D 4YHIA 4NRZB 2YZ1A 3A6BH 4XVTL 4HBCH 5I8CB 1KLUA 5E8OA 2BNRA 5I1HL 2X4QA 1CU4L 5EBWB 1ZHKB 1QUNA 3X14A 3O0RH 4O58L 4POYA 5FO9A 3CXDL 5EULV 3VXUB 4ETYA 1PY9A 5ITBH 1R5VA 2VDNH 3NGBC 5IQ9B 1NH6A 4P3CL 4XNZB 3IXTA 2EYSA 2GY7B 4AIZA 3OKNB 5F8RC 4M8QB 1OW0C 3I6GA 1MHPH 2VISB 3D2UD 3DUUB 4NNXB 4XTRC 5CFHA 2ZUQC 1MAJA 1FNGB 2Y5TA 3OJMB 2LAGB 3A6OA 1R3JB 3RKDD 1FL3A 5DGQA 4YGVB 1L7IL 3WS6C 1NLDH 1UC6A 4C57C 1MCPH 4RFOL 5I9QB 1KUMA 5IG7A 2QSCH 4F9PA 3QUMH 1KJMB 3C8DA 4I3SL 4M7ZC 4BKLA 1VERA 3OF6D 4ONHA 1UKTA 3WFBH 1WFTA 1YYMH 4E0RB 2AV7B 1G6RH 4M7LT 2QQLH 2YD5A 5J06A 3SDCC 2YOCA 2E6JA 3JUZA 3P30H 4ELMF 3TYGH 2PTTB 1VACA 5BVPL 5HD8C 5CD3A 5SWQA 3VFVA 4PLKC 3UBXB 5IMMB 4LKXB 1FVEB 2JLLA 3MUHL 4PLOB 1LD9A 3RWHA 3GI8H 4P9ML 3H9ZA 1WBXB 1MFCH 5CEXB 5GS1C 4ZS6C 4LPVA 4K8RH 1HQ4A 2E6PA 1WICA 4YPGB 5FHAH 3E0GA 2F54D 4M6NH 1JPTH 4Z95H 1VADB 4GG8B 3G5XB 3D9AL 3HB3C 2VDLH 4HGWA 5D72L 3K7UA 2HFGH 5IBTL 1T83A 5BCAA 4LAQL 2QQKH 3PABA 5DJ6B 4Q9QL 3S35L 1GCFA 1R3IL 1JE6A 3U4EB 3LKSA 3KYKL 4PJ5A 3NGBB 5FHBH 3CZJA 5KANG 3MRCA 5D96B 1JCKA 4NO5A 4GAFB 5AUMB 4TVPD 4M61B 3SGEH 1SEBA 2ZUQB 3D39D 5DS8B 2ERJB 2XT1B 4TTGA 1CK0L 3GJFA 2F74A 4HXBH 2WQRA 4G6KH 4TPRL 1MCDA 1CICC 1KIQA 3ILQC 3QB7C 5KVDL 2A2QT 3RNQA 1RZ7L 1NGZB 1RY7B 2BOCB 4XP6L 4L29B 1J05B 4UU9A 1YEDA 3V95A 2EEAA 2VLMD 1RHHA 4EEEA 2EDHA 1T7YA 4Y5XA 1FO0B 3SE8H 5JIPA 4HUXA 3C6LD 5ISZB 3PP3K 2FEDC 3S36X 4KKNA 5I1DA 4AEEA 2WWMD 5KANI 3RWGA 3DVNB 3HMXL 4URTB 1N3NA 3V0VA 1TITA 2AJUL 2BVEA 5CD5C 2R0ZL 3VFWB 1N0XL 5C0JB 3MUJA 3LKRA 5ENWA 3DX8B 3QA3A 1XGTA 2VLJD 3QEUB 4UNUA 1J1XL 1XF4A 1AD9A 3FZUC 4HPOH 3ZYIA 5DF0A 5GS1B 3G08B 1E6OH 1GGCL 5H37H 4X8JA 5D7SH 1OPGH 2H32B 3MTRA 4XBPA 3ZKQD 3L3KA 3HZYB 1A14L 3O3AB 1QVOB 4M43H 5E8EA 2WUBH 3OJDB 1EO7A 1IM3B 3KLAA 2YD6A 1G7QB 4N0YL 4PRHB 5ESAB 4YFEA 5FKPB 1KT2B 3MXWL 4PJ7A 2WIIA 3E3QE 5EPMB 3PXJA 1OD9A 1KCKA 4JFFE 1PSKH 5KS9F 4G9FD 2YKLL 1T1XA 5IWLA 4HLZH 1CR9L 3KYNA 4DVBB 3LHPH 2W60A 1DZBA 4G3YH 4FXGA 3WDIA 1Q8MA 5EOCJ 4OCMC 2CDEB 2ED9A 5CJBA 2YS4A 5AEAA 5JXEC 5GPRA 3WIIL 4JFYA 1R5IA 1XIWB 4N1HB 1WZ1H 3FB7B 4XWGL 1HHKA 4FQ2L 1Y0LA 5EC1B 2VXSL 4OLZH 4HS8H 1TZHA 3GSVA 2J7LA 5TF1H 2ZCHH 3S98A 2ATPA 4JFFA 4EI5A 3OX8A 4EN3C 5BVJB 1P5VA 3N1GC 3EJJX 3UZQA 3UJJL 4EUPH 2AEPL 4NKOA 3JWDH 1S7SA 4D2NA 2PF6A 1LHZA 2ZUUA 3AUVA 1YJDL 3SDDC 1A0QL 2YPLE 4N5UA 1MWAB 1U8LB 3KPPA 4YO0A 2QADD 4RAHA 5C6TH 4DZ8A 5GRUL 1CTNA 3QNXB 5FDWB 1LDSA 4F9LC 5KVFH 3MUGB 4OGAC 2CDGA 4N0CC 1HEZA 4JN1H 2GSGA 4KI5C 4OV6F 1F4WL 4XX1E 1SM3L 2Y7QB 3UTPD 5DQDL 1MJ7H 3RIFK 4ENED 4JVWA 1BEYH 4OGZA 1BFOB 3BDBA 1WITA 4ZPVA 5FCUL 3RGVA 1TNNA 1I7ZB 3C2AL 4YDKH 4RQQB 3HLAB 3L7EA 2R9HC 1BIHA 2Q7YA 1AQDA 4XBEH 3T0WA 1T7ZA 1F4YL 1QQDA 2NY5L 5DMKA 1F6AA 2NY2D 3T0EC 5MEOB 3RL1A 2CRYA 4FP8L 1KYOK 2YPLA 4NT6B 1CFQA 3GHEL 5DJXB 3FRUA 2YA2A 5EZLA 1AQKL 4JY6B 3DI2B 3OKYA 1HH9B 2CLZA 1RUAH 4L5FL 1VHPA 1H8SA 4P9HC 5IB2B 2X7LB 1JHLL 2DWDA 2FD6H 2XY1A 4X7SH 5EO1A 4ZYKB 3FT2A 3VDAA 5ERWA 1XF2A 2XNAA 4D3CH 5DLML 2FBJL 3ULVH 2Z8VC 1UWXH 2ID5A 1AP2A 4WFHE 2XWJA 2X4RA 1S5HB 4EBQL 4MA7H 4JG1H 4NQUA 2PXYC 3MYJA 3AREA 5F1KC 4L1HA 2OQJB 2ZNXA 3SE9H 4S1RL 5FXCH 4JFDB 5I1GH 4IRSC 3DRQB 3JTTA 3MLXH 1XGUA 5FYKU 3DARA 3T08A 5CAYB 5I15L 2ZSVA 3B5TA 3ILPB 3SKJL 3GMNA 3PUCA 5DFVD 5BZDA 3ULUH 4NIKB 1V3MA 2EXWC 2FH6A 4K7FA 3WNKA 1PKOA 3OAZH 4HC1H 1GZQB 4LSPH 5KVGH 2HVKA 2ARJA 1CIDA 5D2LF 4EN3B 5C0BD 4HF5H 2CKBA 2R1WB 4PJGF 4ODWB 4UB0L 3GI9H 4GSDL 5IM7A 4HWNA 1ED3B 5CIPH 5DYOB 1P6FA 4ZOBA 3DVGB 1FQ9C 3HPLA 4L4TD 3P40A 3CVHL 1P7QB 4EVNA 3H9SB 4JDTL 4UT6L 3D87B 4JZJA 3LPGA 4N0FB 25C8L 5GZOD 1A5FL 1AE6H 3WFCL 1HN1A 3L95A 2LV4A 4N0UB 1EEYA 3TVMD 3KLHD 3RI5K 2X09A 3D2UA 5JLZB 5HY9B 2A74A 3EOBB 1AHWC 3LOWA 3HFML 3DGGB 5FV1L 1JFQL 2XTJC 1RJCA 2VDKH 4GKZA 3KWWA 3T0EB 3TESA 4MAYB 4XI5C 3FHQA 1FNEB 4AZ8A 4KTDL 3BE1H 1EFQA 3FRPA 4IHOA 3O45A 4J3WA 4GAYA 1PLGH 1EO5A 1OARH 2JIXB 3MPCA 3DECA 1IGTA 3RAJL 3OF6A 4ZUSA 2HH0H 1JRHH 8FABB 3MOQA 5AZEH 1GGTA 4IMLB 5M7QA 4RFEA 5F6HI 5FOBA 1ZLWH 4OB5L 3QCVH 1MHEA 1N64L 5GRXG 4YWGL 4FNLH 5IB5B 2N1KA 2YUWA 2J88H 4M48L 4DJMA 1S7UB 1UFUA 1A7BA 4PRPE 3RJQB 4X6CF 4Z7WF 4U1HA 2EDTA 2PXYB 1S78C 4YXKH 3P0VH 3QDGB 1IVLA 2VNCA 1OL0A 3R8QA 1FAIH 1MH5B 3N50A 3AAZB 2A9NL 4IRSB 3Q5OA 2EDNA 4BZ2L 2EDEA 1HWGB 3BD4A 5ESVB 4LPTA 3MGOA 3OPZL 1EEZB 4OLVL 5CBAA 4L3CA 1OTSC 4TVPE 3Q48A 2F54A 2AAVA 3JV6A 3JV4B 4AIXA 3D39E 3CU1A 3KPSD 1ND0B 1I3RA 3G04A 2WBWB 3L3HB 1IAII 4HIEB 4OZGE 2WBKA 1B2WH 3O6FC 2VLME 3FFCB 4WW2A 2AI0H 1IC1A 3O6KH 3RPIA 5E6ID 3U4BL 4DTGH 5D5MB 4OLEA 4KKBC 2I9LA 1KEML 4UDTA 1U3JA 5IR1B 4LCCC 3BKJL 2EIZA 1FZMB 2OL3A 1U8PB 3I75A 4P5TC 1LNUA 1GGBL 1AFVL 2DM7A 2X9YA 3VXNB 2EE2A 1AHWB 2E5EA 3D39A 1P7HL 1RVFL 2V7HA 4KZDL 1F8TH 5D2NE 1I1YA 1ES0A 3UCRA 2KBGA 4KPHL 3HRPA 4WWID 5T33H 2BSTA 2VUOA 1SEQH 3S37H 2VLJE 3LEXB 1EEUA 4DZBB 4WV1A 1NFKA 5C0FA 4G6MH 2Q76A 1EBPA 2G5BA 3MJ9H 3PWLA 1BLNA 4OD1H 4OZGA 2DM3A 3WFDH 2NQCA 1S7XB 4OCSH 3LCYA 2GJ6B 2XZQH 4WHYH 2CPCA 3GSOB 5MP6H 2QEJA 5F7WC 5J6GA 2ESVB 4FQ1H 4PRDB 4O4YL 2Y07L 1D5MB 1KELH 4WRLA 4XPFL 5FYKH 3P9WB 1N5YL 4NGHH 3QQ4A 4KZEL 1OLZA 3NVQA 4XNUH 5D2NA 3OAYK 5HHNA 1CL7I 3CLEH 3QJHB 5JUEL 2NW3A 4BZ1H 1DQML 4G9FE 4ZFGL 4OZ4B 2VLJA 3FT4A 4OSUL 5JOPD 4O00A 4PJEB 5DURD 4K3EL 2LAAA 5MENE 4ZFZA 2VZOA 3DRTB 4HIHA 1YN6B 1IAIM 2F5BL 3QO1B 5E1AB 4HJGB 4JO3H 3SKNA 1QOKA 4JDZA 3HE7D 3D0LA 2DQDH 2WUCL 4PLJD 5T5FH 4ZOCA 1DDHB 2B0SL 3ZTJG 5F7EL 4LSUL 3IB4A 2A6DB 2VL5A 1GC1L 1T7WA 3R06A 3MRRB 4OIIL 4YEFA 3HE6B 2HMIC 4GG6E 3SKMA 4QHNA 3G9AB 3B43A 3O6FB 2YBRB 2OJZH 3EBAA 4I5BA 1ZHLB 2J8UF 1I1RA 4LSQL 4G9FA 4YJZL 2OX5A 4QHLB 3MNVA 1K9TA 1OTUD 5C07D 3C8KA 3O3EB 2MCG1 3VXMD 2LU7A 5MENA 1U41A 1J0KA 3EYQC 5IBUG 1L7TH 1Q9OB 2DIBA 1YNLL 2IAMD 3MA7B 1EIBA 5ACMA 4HUUB 3WXWH 4Y89A 3TBYA 1EAPB 5DHYB 4KKAC 3DO7B 4FFWD 1DQJB 2CDFA 2OP4H 3UTPE 4NO0B 3REVA 1MAKA 5JW4Q 4U1SA 4J2XA 4GG6A 4HJ0D 3I50L 1J86A 2XWBB 1KYOJ 3PJSA 3QDJD 4WFFE 3H3PL 4YHIB 1LO2L 1LP9F 1OQXA 2CLRA 4YHMH 1CCZA 5L8JB 2YN3A 1LE9A 1GIGL 1UWGL 1KLUB 1NKOA 2JB6A 4I3GA 5E8OB 4KQ3L 2BNRB 1WWBX 2V7NA 5GJSH 2X4QB 4S1QL 4Z6AT 1BBDH 3HTLX 4PY8J 3B9DA 1UH4A 3X14B 5I17A 4JM4H 3O41A 5FO9B 5DQ9A 1LK3H 4NZUH 1R5WB 1R5VB 5EU6D 3IXTB 2EYSB 5EO9A 5EU4A 4AIZB 4PJDE 3N06B 1AD0B 4WI7A 3I6GB 2FX9L 3FQRA 5F88A 4YX2L 1UJ3A 1EVUA 1YNKL 2J6EL 2P8MA 4IOFC 1ZA3A 2Y5TB 1INQA 1FL3B 3NTCL 4I9WE 4NJAL 3SKOA 4OZFG 5IG7B 7CGTA 1DBAH 5I0DA 3QJFA 3W2DH 2AVGA 5KG9A 3QQ3A 4W6YB 4BYHA 4BKLB 4ZTOL 5A2KH 4ONHB 1HCVA 2NW2A 1FC1A 4YDIH 5DZNA 3IDUA 4NDMA 5D7LD 3F8UB 3PGFH 3KDMB 4KH2A 3GNML 1VACB 4PJDA 1W72H 2VABB 2DLHA 5CD3B 4KUCD 1D7FA 5SWQB 3VFVB 1II4E 3HAEH 5C0BE 2ADFL 1HHGA 4X4XA 1CLZL 3QUKA 3VI4E 3ZE1F 4H0IA 3HCVA 1LD9B 3RWHB 1U3HD 4X5WA 1NJ9A 4L8SC 1HYSC 3DROB 1RQ5A 2LQRA 1RJLA 3VD9A 5ECJE 4HD9A 2NY7H 3F6IA 4X80L 4A2MA 1RUKL 3G6JF 4JQIL 1F58L 4UZGA 4HIXH 4QXWA 4XNYL 1MF2L 1DQQA 4N1EA 4I0PD 4X9IA 4ODXA 1PZ5A 4JFZH 1A22B 3T4YA 4MAUH 4NJ9L 1X5GA 4G80A 5IBLC 1ZHBB 4G6AD 4HGWB 2HLAA 1FNLA 2P49B 4LRIC 1HZHH 1EFXA 1I3UA 1BMGA 5C0BA 4ZFOL 1TJHL 1MCNA 1DBKL 3NZ8A 2C26A 1KC5L 3VGBA 3UBXG 2IEPA 1I9RH 1SYSA 4MDJA 5IWLC 1N4XH 1NL0L 3LKSB 4DK3A 2R8SL 4R4ND 2ZKHH 4PJ5B 1G6RA 2RCSL 3BN3B 4GRWE 3O2VH 4U6YA 1IKFL 4E41D 1B6DA 2X4PA 3MRCB 4NO5B 1FLRH 4DVRH 3S36H 1ERNA 2N7BA 2JCCF 4GAJH 4JREB 1SEBB 2HLFC 4WCYL 3S35X 1JZ8A 1VFBA 2F74B 4RDQF 1YEFH 3MZGB 5ACLA 4JAMA 1BWMA 1N5AA 1G7LA 3E3QC 2OXGA 1YZZA 2GK0A 2ZG2A 4UU9B 3TH2T 1YEDB 3UBXI 1RHHB 1AGDA 2UVFA 4DCQA 3N9GH 2XACC 1TDQA 1NBZA 3BOVA 2Q87A 3P0YL 4HUXB 1A02N 5EWIL 5FUCC 2B20A 3ARWA 2G60L 3U0TA 4S11A 5I1DB 4UI2A 4FQHA 1U6AH 5I8KH 1EHNA 2DBLL 5F7LB 5CJQL 1N3NB 2Y6SD 1OSPL 3KPSE 5ACZA 5KJRL 2D2OA 4CVUA 3GBMH 1G9ML 2XRAL 1MHCA 3V6BR 5ENWB 2A83A 2ZNWA 3QA3B 1KCSL 3JV0A 5IGXH 1XGTB 1FPTH 1JK8A 1WZMA 2CQVA 4I1NB 1QEWA 5C8JB 4TRPH 1XF4B 5KSVA 5EUKB 4X8JB 5GRWA 1GZPA 4XBPB 1Z6JT 3L3KB 1JF5A 1SBSH 1UM6L 3IDYB 2AS5M 5E8EB 5LXGH 5E08H 2W0KA 3ALWA 3KLAB 4NNPL 2VQTA 1UM4H 1ZAGA 3KPSA 4PJ7B 2WIIB 1XGQB 1U0QA 4IMKA 5TE4L 4PP1D 4JB9L 1BF8A 5SWZE 4YC2C 1C5BL 2HTLC 4YDVA 1JMZA 1K4CA 3KYNB 4K9EC 2W60B 4FXGB 5F7FA 5E6IA 5GXBB 4YK4C 3T3ME 4IBLT 2J5LC 5CP7A 2P48B 2M8XA 2H26A 1A1OA 3MACH 4YQXL 3I2CL 5FYKD 1KIRA 1T4KA 3QEHB 4ZUUA 3OR7A 4YH6A 4JFYB 1R5IB 5B4MD 1HHKB 1WQVT 2HT3D 4MNQD 1Y0LB 4UV4H 4DOHB 1FIEA 2C7UA 4R7NB 4KUZL 3LVEA 3GSVB 1UA6H 3FAWA 4JFFB 4XCFL 3DXAD 3LQAL 3OX8B 4PJ8C 4M1GH 1KB5H 4NKOB 4CU6A 2D7TH 2CXGA 2NX5B 4R4BA 4JLRB 4XVUC 2V6HA 5E8NA 2UUDK 3KPPB 4OFPA 4YO0B 4YFLF 4CVXB 4GW1A 1QKZL 3RU8L 5I1JH 4JZJC 2CDGB 1HEZB 3WCYA 2GSGB 2JK5A 1JNHA 5FYLH 5JW3H 2FL5A 3VFNA 3JWOH 1J12A 2XKSA 4YGAB 5LBSL 2XI9A 1RIVH 2KH2B 3GRWH 4ZPVB 3RGVB 4EDWL 2BDNL 3FO0L 3MV7E 5CKGA 5IFJA 3L7EB 4J3VA 4LHUD 5I19L 5C07E 2Q7YB 1AQDB 4PREA 3RKDC 2UVEA 3BWUC 3KXFD 4MMZC 3VXME 1QQDB 4JR9H 5DMKB 1F6AB 4Z7NF 2X44D 3RL1B 5FYJE 3KR3H 7FABL 1CIUA 1IGFH 1YQ2A 2AK4E 4NP4L 3PV7A 1CFQB 3FRUB 5EZLB 1ETZA 1AXIB 2CLZB 1D5ZA 1CE1H 3GMRA 3WIHH 1D9KD 3KPOB 1X3DA 2FX7L 2EDRA 5IT2H 4U3HA 3X3FH 4UV7H 1IGML 2DWDB 1HKLL 4JKPH 5EO1B 4XNXL 3QDJE 5ERWB 1XF2B 2XNAB 1WTGT 1KXTB 1S9WA 3QDMD 5FGCE 2BY2A 1AP2B 2X4RB 5DMJB 4YK4B 4Q9RH 1G0YR 5C07A 2VDRH 1EX0A 4I3RL 4LLMA 2J5LB 3AREB 1B4JL 3VXMA 2DTMH 4JANA 4H0HB 5JOFB 3QULA 4O2CA 2YZ8A 4HS6A 3JTTB 1XGUB 2MHAA 4YHNB 2IAMA 2ZSVB 4G7YL 4MLIA 1YMHA 2R2EA 5EU6E 3GMNB 3TWCH 5GHWL 1YEJL 5BZDB 1NMAL 4K7FB 3EOTH 2W38A 2C1OA 5IVNA 3QISA 1GHFL 4CW1A 3ARGD 3NA9H 5DR5H 5ILTL 1S5IL 2W59A 2XXCB 3K4DA 4C54A 2HVKB 2B4CH 2A38A 3LZFL 3BD3A 3LPWA 3QDJA 1T66D 3T3PF 2HRLA 1OM3H 3BFOA 5IM7B 3QXAA 3ZDXF 4BUHA 3WSQL 3ZLQC 4Y8AA 3HPLB 5E7BA 4KDWA 3V7AG 4CAGA 4EVNB 1R3KA 4JZJB 1MNUH 3OAUL 5D7LE 3STZA 1FORL 2A6JA 4D9QD 3QXDB 5EU6A 1KULA 3ELAT 3L95B 3HHRB 4TSCL 1ZVSA 3TT1L 1EEYB 4G7VL 3SOBH 1N7MH 3D2UB 4IJ3C 2A74B 1ZEAL 3BKYH 3MGAA 1S9VA 2Z31C 1YPZE 4GKZB 2HJLA 3KWWB 5DK2A 5IUSA 1J8HD 3QUYD 4FZEH 4IHOB 3O45B 3UAJD 3V4UL 3DUSB 4C59B 4X4ZA 4YPJA 3ZHLA 1HWHB 1IGTB 3K74B 1JPSL 4D9LH 4ZUSB 2GHWB 3ZKND 5AAWA 4HT1L 5JQ6L 4PGBA 3C6LC 2R15A 4Z7QF 4RFEB 5FGSA 4NQVA 5D7LA 1LO0L 5FOBB 3FOLA 3JTSA 1DSFL 2WWMC 5IJKA 1MHEB 3HZMA 1QFUL 3NMEA 1VEOA 4M3KB 2DQIH 1RK1A 1DUYA 3L5HA 4JKLA 2NY1D 5DMIH 2EH8L 1QRND 2R4RL 1YPZA 2F8XC 1U3HA 3VFUA 2XXMB 4HWBA 2LU4A 3UC0H 1A6VH 4M7KL 3S34H 1E6JL 4E41E 4G6JH 1NEZA 3MGOB 4I0PA 5CBAB 4L3CB 3WD5H 1V7MH 2F54B 2N7AA 3JV6B 3ZSSA 4Z76A 1XGPA 1AKJD 2VDPH 5A2LH 2VR9A 3RWDA 1H8OA 1TJIL 3G04B 3L1OH 5F6HJ 4S2SA 2MPAH 5B8CA 1BVLA 1MELA 1O5DT 3VGDA 2D3VA 3BGFC 4PJCE 4WW2B 3INUH 2FNBA 4P59H 3RPIB 4Y2DD 5T3ZH 1A1NB 4PJXE 2FO4A 4UDTB 4OLUL 2I9TA 1UXSA 2P8LA 3TIDA 2EIZB 4FTVD 4E41A 1HIMH 3DX9A 2OL3B 3I75B 3TJHC 5EU7E 1K6QL 5L2KE 4ZS7L 4IJ3B 1XT5A 5D7JD 1N8ZA 5BOPA 3D39B 2BVOA 2V7HB 2WZPD 1I1YB 1ES0B 3WNMA 2MKLC 4F33A 3T1FA 2UZIH 2V2XA 3KYAA 4LDOB 4PFEA 2BSTB 4G5ZL 5I1KH 4HLJA 2V5YA 4M5ZH 4P3WA 4WV1B 1EZVX 1MCFA 1WAAF 5C0FB 2I5YH 4KFZC 1BECA 3T2PA 2Q76B 4PJCA 5I0ZA 2G5BB 4OZGB 3PWLB 1BLNB 1U2CA 3NACH 4XP4H 4LCIL 4Y5YA 3J7HA 4ZNEE 1JUFA 1BZ9A 3K3QA 5LWYH 5T1MA 4LSVH 2BRRL 3E1F1 4PJXA 4LVHC 2HJFA 4PJAF 2ZUVA 1A3RL 2IH3B 3ZTNH 5J6GB 3HN3A 4MB5A 5D7IE 5HVGB 2QADC 2GKIA 1B0RA 5I71B 5L2KA 4HK0A 3QQ4B 5JHDD 3GSNH 4QRSA 3WNPA 4YHKH 1UCTA 4OGXL 4UIKH 4OUUA 3LN5A 5D2NB 3CFKA 3RVWC 2RB8A 4A2LA 2NW3B 4Z18A 3EGSA 4YXLH 1UJ3C 4MS8C 4ENEC 1RZJC 1UZ8A 3V6FB 3D18A 2VLJB 3FT4B 2VIRA 1Y6KR 3ZDYE 1FZOA 2AJXL 4ZFZB 4HIHB 4YUEH 3BDYL 4Z7OE 4QRUA 1MVUB 4UNTA 3W0WD 2DDQH 1MHHA 1K8IA 2ICEA 3SKNB 5FUOH 4JDZB 4YBLC 3NIDF 3D0LB 1F97A 2NY2C 5IJVA 2K3TA 4JRXD 5HHQA 3PGDA 1OAUH 3MLTA 2IG2L 5D7IA 3Q3GA 3D48R 1AJ7L 2VL5B 2BOBA 1X5AA 5GJTL 3R06B 1P84K 5I8EA 4Y5VA 1X5LA 4WHTA 3QUZD 3SKMB 3E8UL 3MRFA 4QHNB 3BGFB 2C4XA 3BEVA 3DXAE 4TSBH 1KACB 4I5BB 3DTXA 4G9FB 3MJ9A 2EDJA 3MNVB 4JCMA 3WLBA 3C8KB 1BFVL 1WIOA 3QCTH 5MENB 3SKUD 4K71C 3TFKD 1CGYA 2OR8A 3NAAH 2H3NA 3VFTA 1BHGA 4M6ML 4LCWD 1RURL 5KSUA 3TBYB 3JZ7A 2XIDA 1I3VA 1MIEH 3OZ9H 5ICXA 2CDFB 1ZS8A 4LPUA 5DFVC 3IAPA 3BJLA 4U1SB 4GG6B 1FIGL 2VDQL 3PJSB 4QO1A 3DXAA 2CLRB 5I1HH 4P0DA 3RQ3A 1I4FB 1CU4H 3KXFE 1CFTA 4X9HA 2JB6B 4ORZC 3QH3A 4KRLB 4GRMA 4O58H 5FGBA 3CXDH 3EAKA 4LVHB 1KIUA 4PGJA 3AS1A 5I17B 3O41B 4P3CH 2QADB 4N8CL 1KCUL 5DQ9B 3NIGF 1QPXA 5JPNA 4K3DL 5EDXA 3MNZA 4QLRA 2V9TA 5EU4B 5EO9B 4LSSL 5GZOC 3FQRB 5F88B 5I1IL 1UJ3B 1XAUA 4Z0BL 2P8MB 3HKFA 1L7IH 2JJUA 1DR9A 4FQJL 1ZA3B 1INQB 3TVMC 1NAMA 3KLHC 4WI8A 4RFOH 1YEGL 1BOGA 3RP1A 3FT3A 4LHUA 3W5MA 4I3SH 1HH6A 4U1NB 3KXFA 4YXHL 2DJUA 1PQZA 3QJFB 4YBLB 3VRIB 5KG9B 2NY2B 3QQ3B 4RFNC 1A7PL 5B38G 4K8RC 2FHBA 4R7DB 5BVPH 4NDMB 4JDVA 1D9KA 5GQBA 4PJDB 5J6HA 3GMPA 1A9EA 2YXFA 1T0PB 4M1DL 3NPZB 2BX5A 4P9MH 1HHGB 4X4XB 1FP5A 3QUKB 1FO0L 5IB3A 2GTZB 4X5WB 4K71B 1NJ9B 1Q9WA 3NFNB 2V5MA 1RJLB 3T8XA 1CDJA 4JVPA 1P7KB 2ITCA 4G8GD 5E0QA 2YWZA 3RVUC 3M8OL 3U6RA 4OQTL 4XB8A 1DQQB 1HDMA 4DGIL 2AV1A 3DJ9A 3L3JA 4ODXB 3D9AH 4WFED 1PZ5B 1FYTD 3T4YB 2WP3T 5D72H 5J3HC 1JNNL 4KXZH 4RDQG 5FF6A 2Z0BA 5IBTH 1MCBA 4LAQH 4OZFH 4HAGA 3QHFL 4G80B 5J1TC 3ARGA 3RFZC 3OKOA 2HLAB 1X4ZA 4OF0A 4Q9QH 4TNVF 3S35H 5C0BB 4I48B 1KJ2A 3NZ8B 4MA1C 1J8HE 1KTDA 3KYKH 3QUMB 3H42L 3ARBD 1SYSB 2ATKB 1HNGA 4MDJB 4O5LL 4L4TB 2VWEE 2JE8A 1G6RB 1TTUA 4NUJA 4U6YB 3VG0L 4PJBF 2X4PB 4GMTL 4OZHE 2X2YA 2X1XR 3NCYP 1CK0H 3HR5A 4NKIL 4TPRH 1ZLVK 4LIQL 5E1HB 2IJ0C 43C9A 2P45B 3TVMB 3NBNA 1VFBB 4MA3A 1RZ7H 4M7JL 4XP6H 1UB5A 5FGRA 3RX7A 5T1LD 4JAMB 2R56L 1N5AB 1G7LB 2OYPA 3UP1A 2P24A 3D69A 3CFDB 1YY8A 1TTFA 3B5HA 3GMMA 2H45A 1J8HA 3QUYA 4RFNB 4DCQB 1NBZB 3H7LA 2D9CA 4V1DD 4QRRD 3T4AA 3HMXH 3U0TB 4FQHB 1T1WA 1ZVHA 5HHMD 4GRWB 2AJUH 2R0ZH 1T89A 3HG1D 4OZHA 3ISWA 4KMLB 5K9OB 1N0XH 3V4PL 5F9WB 5ACZB 2D4DA 3HA0A 1CD1B 1MHCB 2A83B 2QQNL 1J1XH 3EUUA 5CZXC 5KTEH 3RUGF 4P2RD 1QRNA 2A9ML 1JK8B 4JGUA 1GGCH 4HHAA 5IFAL 3VGHA 1S9KC 1QEWB 4KTYA 3TO4C 4CGTA 1A14H 1MWAL 5T3ZD 5KSVB 4NZJA 3CIQA 4CDHA 1GZPB 4P4KD 1QNZL 4XCEB 2BP3A 2VITA 4N0YH 2OMNA 2MCPL 4FTVE 5KZCD 3WHXA 4K7PL 5DQJA 4WFGD 3MXWH 3HE7C 5FCSH 1KXQE 2Z92A 4PLJC 1AKJA 2APFA 3KPSB 1X5KA 2YKLH 1SHMA 4RBPK 4TSAL 4QTIL 5DD6A 2EDLA 4BH7A 1CR9H 4MA1B 3SDXF 4M00A 4NO2A 1QSZA 1HK6A 1QBLL 1AR1D 4YDVB 1ZTXL 4I0KA 1K4CB 5IW6A 4H1LH 5CGTA 1CQYA 5E6IB 4KAQL 4Y2DA 1FZJA 1OTUC 2PYED 3JWDC 5F9OL 5SWSD 2NXYD 2ITDA 2H26B 2XZZA 1A1OB 5D4QA 3WIIH 4FTVA 1T4KB 4XWGH 1IM9D 3HC4H 4FQ2H 4YDJA 4HJJL 4ZUUB 4I2XE 2IAMC 3OR7B 5D7JA 2VXSH 3EDJA 5LQBL 3ARZA 5J12C 4D0BA 5GGRB 4FFWC 3RHWF 5C9KA 2C7UB 3S5LG 2L7JA 4P46D 3BH9A 5CSZA 3UJJH 2AEPH 2AEQL 4HJ0C 4X98A 4AQOA 4QXUL 3HNSL 4KRPD 4UTAL 3ARFA 1YJDH 1A0QH 3W0WE 4C56D 2FR4A 5GRUH 4U33A 4R4BB 4ZODA 1L6ZA 5E8NB 1E27A 4YFLI 2G75A 2KZ1B 4LGSB 4JFHD 4GW1B 1F4WH 1SM3H 3FN0H 5DQDH 5C0GA 4LFHG 4WGVB 1JZ2A 5T3XE 2JK5B 1W0VA 1JNHB 3CDGA 4I2XA 2MTPA 4U1MA 5JHDA 2FL5B 5FCUH 3C2AH 5HBBA 1XF5A 4Y0GA 3FQUA 3F58L 1F11B 1J87A 4HWEL 5I75C 3HI6L 2EDYA 4M4RA 1DBML 3NZHL 1F4YH 5IFJB 2NY5H 3ULVC 3UTTD 4O2EA 4PREB 3ZL4L 5DURB 3VW3L 4FP8H 2O5YL 3IRPX 3ZKXC 5T1KD 1A21A 3GHEH 3W0WA 5BV7C 5C7XL 1AQKH 5GGTL 1A6UL 3MLUL 4HUWA 1IQWL 3HE7B 4L5FH 3KJ4B 4WI5A 5EORL 3O4OB 4L4VD 1ETZB 3DSFL 4IIQA 4AY0A 3QEQE 1D5ZB 1JHLH 3ARDC 5HYJE 3GMRB 4TOYL 1Y6MR 5I18H 4JHAL 5D93C 2ADGA 3ULUC 5DLMH 2FBJH 5C0RL 3C6SA 3LB6C 2C4FU 5IJKC 3L6FA 3QUZA 1S7RA 5FUZL 2DICA 3TN0D 4EBQH 4DUVA 2YEZB 4X5XA 5KSAD 5C6PB 2IADA 3QI9C 1P9MA 3BZDA 2R2CA 4EUPB 1ZE3C 5C07B 4LLMB 3VXMB 1U3HC 4JANB 5I15H 3SKJH 3QULB 4HS6B 3MOAL 2YRZA 3WNLA 4HV8B 2MHAB 1NBVL 3BDXA 2EDOA 2IAMB 4YZFE 2R2EB 4LCWA 2E7BA 1P5UA 3CSPA 3QEQA 5J12B 5HYJA 4I0PC 4QHKI 5CEZL 2C1OB 3IDJA 4TNWK 2R69L 3ZE0F 5ETUA 4CW1B 1GGIL 4UB0H 4GSDH 4JKKA 4XCYA 1ZLUK 1B88A 1B3JA 1GVIA 3QDJB 4JRYE 4UIMB 4MJ4A 3CVHH 4G42A 1A64A 3OGOE 3QXAB 4P57B 1M71A 4JDTH 1J0YA 3BXNA 4JN2A 4UT6H 2UWEE 3MRNA 3VFPA 2ZG3A 3N0PB 1MLCB 25C8H 2IBBA 3TBTB 5JW4N 1A5FH 1HINL 1R3KB 3WFCH 2VO5A 1ZOXA 2Y1VA 3STZB 2BVPA 2A6JB 4XMPH 1EHXA 4R4NC 5JA9A 2YC1A 4LHQB 5EU6B 3EO0A 1ZVSB 2RQ8A 3HFMH 3QQNA 4ZNCD 2YUVA 4AJ0A 1JFQH 2ENYA 4QT5A 1S9VB 1MIML 4K55A 1C16A 4KTDH 1RD6A 2NPLX 1AGCA 2HJLB 3ZKXB 5DK2B 4JM2F 5BV7B 3RAJH 2BNQD 1T5WA 1KPUA 2ZPKL 2UWEA 3EYVA 4G8GE 2XG4A 1RK0A 4OB5H 3MXVL 1HI6A 4HH9B 1CF8L 4PGBB 4HIJB 5H35A 5E70A 1N64H 4WFEE 4YWGH 4NQVB 5D7LB 1FYTE 5D93B 3FOLB 4NHUA 3JTSB 3FCTA 4M48H 5FEBA 3Q1SL 4TNWF 3DURA 3HZMB 2ZUWA 5EU7C 1DUYB 3U4AA 2Y6SC 4X6BB 4EDXA 1CDCA 4XVJL 1RZ8A 1S7VA 2VZ3A 2A9NH 3GB7A 1YPZB 1U3HB 1B90A 5FM8A 3U48A 3TV3L 5DJYA 1HYRC 4BZ2H 2XPGA 3UX9B 3MV9D 1A7OL 2AEIT 4F8QA 3MRMA 3OPZH 3RWEA 3WXVL 3F62A 3GO1L 3FMGL 4G8GA 2LTQC 4XPAL 5DXWA 1NEZB 1OWRM 1H5BC 4I0PB 4N5ED 3P11L 4Z76B 1FYTA 1XGPB 2OSLA 3HZKA 4ONOA 2RHEA 3CD4A 3RWDB 4KKLD 3RPKA 3I84A 1DQLL 3CAFA 3G5YA 4UDUA 1W0WA 4OFVA 1CGTA 2XQYK 1HNFA 2OBGA 3U4BH 3EJYD 4BH8B 4PP1C 1JGUH 1C7SA 3K4ZA 3MCKA 4ZAKD 1KEMH 2IMNA 4LRNL 3ULVF 4AQ1B 3ARBA 1YEIL 4XH2A 2E9WA 4QRRE 4V1DE 3BKJH 5IF0A 2FJFA 2J12B 3O11A 2FO4B 1GGBH 2A6IA 1AFVH 2I9TB 3B9KD 1UXSB 5HHME 2P8LB 3TIDB 4E41B 5IVXE 5IHBA 4BELD 3DX9B 5DHVA 4KZDH 2PCPA 5ABDE 1UXWB 4KPHH 1N8ZB 2EDBA 2BVOB 4F33B 3T1FB 3O6MH 3F6LA 5J11C 3ULUF 2V2XB 5B4MC 5T1LA 2VH5L 1T7XA 4LK4A 2HT3C 4ZO8A 2NTFA 4PJCB 4W4OA 1BJ1J 4K07A 4OBRA 3IJYB 2W0PA 5TGBA 5EU5A 1TNMA 3GK8H 4V1DA 1JUFB 1BZ9B 4G8EA 4QRRA 5T1MB 1N2RA 2AXGA 2D7OA 4O4YH 3DVFA 4PJXB 5HSFA 2Y07H 2HJFB 4YFDB 1EUUA 1N5YH 3RGHA 2D4FA 4WFGE 5E6YA 4KZEH 4HX1A 5IVXA 4X6DF 5BS0D 1B0RB 5DEZA 4HK0B 1KCLA 3ALPA 4XVSL 1MRDL 1DQMH 4OUUB 3LN5B 1J1OH 1MCCA 2BZDA 3CFKB 3QIBD 4ZFGH 3EGSB 5K59E 4K3EH 1UZ8B 3D18B 4KK6D 4LOUD 2F5BH 2MQ0A 1PEWA 2VIRB 1MCLA 2FB4L 2PYEE 4QRUB 5D6CA 3TF7C 3DV6A 4P4KA 1MHHB 1K8IB 1AGEA 2ICEB 1H5BB 3QXTA 2B0SH 3OKEA 5F7EH 4JEGB 4LSUH 1QR1A 4Q6IA 1OY3B 5IJVB 1GC1H 2IALA 1CXEA 3PGDB 5HHQB 3MLTB 4OIIH 5D7IB 2HTKC 3Q3GB 2FECI 3BI9X 4F37K 4JO4L 2BOBB 3GJEA 3GJFK 2PUQT 2E9JA 4LGPB 5CJOL 3O2DA 1H3VA 2VQUA 4Y5VB 5I8EB 4K94L 1D9KC 4WHTB 3MRFB 2HVJA 4LSQH 5EZIL 2RAMA 3PV6A 3BEVB 4PV9A 3D25A 3DTXB 3WLBB 1H3XA 4C56E 1ORSB 5JR1L 1YNLH 3SDCD 2PYEA 2WWKO 2OK0L 2D7MA 3BUTA 1MFAL 1QFWM 5HD8D 2X4TB 2FH8A 4JFHE 1ZGLP 2H3NB 5KSUB 4J3UA 3GSNA 2H8PA 3QWOA 1TTGA 5ICXB 3I50H 5J11B 4X4YA 1ZS8B 4NBYB 3H3PH 4MNQB 1LO2H 4ERSL 1X4YA 1ADQH 3ARGC 4KQ3H 4R90L 3DXAB 3UTTE 4E5XA 1U36A 4NQDD 4S1QH 2P44B 2R1XA 5K9QG 1CFTB 1VB9A 1T66C 4GRMB 3KPRE 3IFPA 4C56A 1ZGLA 3V6OE 4OUOA 2IBZY 1I9IL 2R0KL 4CU7A 3HB3D 3OAYH 4F80A 4L4VE 5JPNB 4X0KA 2FX9H 3VJ6A 3MNZB 4YX2H 1YNKH 2J6EH 2H6PA 5JZ7D 4NRYA 3NTCH 4YIQB 3LAFA 4NJAH 1B4RA 3IS1X 1FJ1A 1ZXQA 1NAMB 1OAQL 5DC0A 3EDFA 1CDYA 1A3LL 1BOGB 3UTTA 3FT3B 4LHUB 5K9QI 1HH6B 2P4AB 4ZTOH 3LQZA 3KXFB 2W1NA 1PQZB 4JG0L 5MI0B 2GITA 5T1KA 3QUYC 3V6OA 1AY1L 4P2OD 4D8PB 3UAJC 4YBQD 1HKFA 3U36A 3NFPA 3GNMH 2YD3A 1CICD 2DOCA 3ILQD 4L4VA 3KPNA 2VWEC 3ZKNC 3EFDL 5D7KD 5DRWA 4JDVB 4MX7A 2KPNA 1D9KB 4LCUA 1RZGA 1U8JB 1U8KA 2ADFH 1CLZH 5J6HB 3GMPB 1A9EB 1MEXL 2FEEI 4R0LC 1HILA 2WANA 5C92A 5EZJB 2P7TA 4IEFB 3TN0A 2W92A 1C5DA 3QDMB 3WFHA 2X9XA 4X80H 3KS0J 5E2TL 1Q9WB 1RUKH 4JQIH 1F58H 3T8XB 1T22A 4XNYH 1KXVC 3ARVA 1MF2H 2ITCB 5F9JA 2L0DA 1ZA6A 3U6RB 1EBAA 4Z78B 1HDMB 2AQ2A 2J4WL 2VE6A 3HPJA 4JZNA 4NJ9H 3L3JB 3VFGL 1MFEL 2JF1A 2AQ3A 4PTUB 3BVNA 5HVFB 1TJHH 3ARGB 1DBKH 1Q0YL 3OKOB 3CMGA 4YLQT 1KC5H 1KJ2B 2H41A 5F96L 4ELME 3PDGA 1NL0H 4BQBA 1KTDB 2R8SH 2BNQE 4CMHC 5TDNA 1P69B 3VD5A 3FOMA 1P2CA 2RCSH 4QCIA 5HI5D 1IKFH 1IEBA 1MI5E 2W9EL 3ZT6A 1SJXA 5LAXA 5DUML 4Y2DC 4KHXL 1HXYA 4PRBA 4XP1L 2ILLA 1URLA 2F58H 4WCYH 1OOAA 3HR5B 1A7NL 5A1AA 3W39A 3V8CA 43C9B 3HAEB 4MA3B 3A6CH 1MRFL 5D7JC 1UB5B 4FQPA 3PWUA 2IQAA 1X5XA 1NGYA 1EMTL 2P24B 1F42A 1M7IA 3D69B 1EUTA 3P0YH 1JYXA 1YY8B 2APXA 4XZUA 5EWIH 3GMMB 1J8HB 3QUYB 4ELMA 1X5FA 2G60H 2BNQA 3P4MA 3UPCA 2J2ZA 2R4SL 2RFXA 2AGJL 2ICCA 4PRNB 3T4AB 4AK1A 2DBLH 5CJQH 1T1WB 3PDOA 3DIFB 2DBJA 5KJRH 1WFUA 3CLFL 2XRAH 4J8RA 1CLOH 3UDWA 4OZFA 4FQCL 1KCSH 3ESUF 3AM8A 4Z0XA 2IPTL 2NY1B 1WBZA 4N9GA 1TMCB 4PJIF 1QRNB 1V3LA 4XMKL 3IFNL 3GDBA 3S3PA 3MJGX 1UM6H 4WU7A 1C08A 1I1AD 4Q2ZA 3ZMRA 5TDOA 4JJ5A 4NNPH 1PAMA 2VITB 4M9OA 4ZO6A 2MNUA 3WHXB 3OKNA 1CFVL 1F3DJ 2JB5L 1NBYB 5BMFL 5DQJB 4HSQA 4MJ2A 1AKJB 5BJTA 4IIQC 5TE4H 4JB9H 3U83A 1GAFL 1T5XB 3BAEL 2FATL 4YGVA 1C5BH 1AXTL 4NC1C 5DD6B 4BH7B 5I1LA 1KB9K 4GW4B 3W9DA 3QUZC 4CMHB 5JQHC 1U95A 5IW6B 1KJMA 4LMQI 4K7PX 2DIJA 2EECA 3VXRD 1WFOA 5DFWH 1CI5A 4Y2DB 1FZJB 1DLHA 4YQXH 4NFBA 3I2CH 3VA2C 4NRXA 2ITDB 4J3XA 3LH2L 3B9KA 2PW2A 4FTVB 5BQ7A 1U8OB 3TFKC 5C0EA 32C2A 4HKBA 4YDJB 4LF3A 3KLDA 5D7JB 2ZZUT 4KUZH 1W8OA 3OB0H 4XCFH 4D0BB 3LQAH 2VDOL 5C2BL 2CRZA 3SJVD 4PS4L 3QPXL 3FO9A 4X98B 5GGRY 4X9BA 3OL2A 4Z7VF 1YMME 3BJ91 2FR4B 3LPFA 5E2WH 4WTWA 3VXOB 3ROOA 3T1WA 2EXWD 4U6XA 3Q5YA 4U7MA 1E27B 5HHVL 3RU8H 2NY3D 2G75B 5KS9E 1S7WA 3QYCA 1NPUA 1J88A 4NFDA 2BHUA 3FAXA 5C0GB 2E6QA 1W0VB 3L3GA 4JKMA 5LBSH 3CDGB 4PJFF 4U1MB 5JHDB 2CKBL 4EDWH 3SGEI 4F57L 1LK2A 4B41A 3FO0H 1XF5B 3FQUB 3QIBA 2MQ3A 5I19H 1WISA 5FECA 4TQEL 4O2EB 3I85A 3CGTA 2Z4QA 7FABH 1NFDF 4NP4H 1YMMA 3W0WB 1IZKA 2H1PL 3LEYL 4NPYA 5KVMC 2EC8A 2D0HA 1OW0A 5INCA 5H37G 4HUWB 5IIEA 4AEIL 5KS9A 1F6FB 4IIQB 4PD4K 4JRXB 1IGMH 3EZJB 1HKLH 2XTJD 4LLDA 1DBBL 3KHOA 2ADGB 2NY0C 1D6VL 4XI5D 1VGKA 2BVTA 3C6SB 3QUZB 1S7RB 1IFHL 1LDPL 1CD9B 2B4CC 4I3RH 4PLNC 4X5XB 1B4JH 4NQDE 4OJFL 4XMLL 2IADB 3QXUA 1T2JA 4HLZG 3SDCA 4G7YH 4R4FH 4FZ8L 5GHWH 1YEJH 1NMAH 4OCLC 4LCWB 5AG8A 2GEEA 1GHFH 3P4NB 5ILTH 5HYJB 1OAXL 2BRQA 2EIDA 1R3LA 3IDJB 1CVSC 1RPQA 3L3DA 1BJMA 3RZCD 5TQ0L 4XCYB 3QEUA 2OR7A 1YDPA 2UUDH 4RISL 3WSQH 1WFNA 1XF1A 4LVNB 4NQDA 5J9PA 5L9DL 4G42B 2H32A 1CD0A 3EDDA 3HZYA 1M71B 3BXNB 4JN2B 5IESL 2F8VA 3MRNB 3VFPB 2JTDA 1X44A 3OAUH 4EUPG 1FORH 1IM3A 3IT8D 2Y36L 3ARBC 3IDGA 5M94B 1G7QA 5HDLA 4ZMAT 3B9AA 4TSCH 3SGKC 3QP3A 4GUPA 4MJ5A 2BVPB 3TT1H 4G7VH 5FKPA 1KT2A 2DLFL 5D7KE 2YC1B 1BFSA 4U1KA 1ZEAH 3EO0B 1TVHA 5E24E 1BAFL 1AC0A 4MXWL 1KGCD 2EDFA 1FDLL 4EQ2A 4U0RB 3VRJA 4QT5B 3I6LD 3O2WL 2MKWA 4DVBA 1C16B 1J18A 4BK5A 1B0GA 4MQ7A 3V4UH 1AGCB 5EN2A 5DMGC 5E9DD 4M62L 1JPSH 4P5TD 1T5WB 4ELKA 4WUUD 1KPUB 4HT1H 4U7KA 5JQ6H 2UWEB 3EYVB 3KVQA 4W4OC 2OL3L 1D5XA 3N1FC 5F1NA 2FWOA 1LO0H 1RK0B 4TVPL 1HI6B 1DSFH 3MUY1 5H35B 4PJGE 3GSRA 3T77A 1UVQA 4U1LA 4NQXB 1QFUH 1CICA 3FCTB 2ZUYA 2XG5A 3DURB 4XNQA 1CGSL 2EH8H 1FVCA 2R4RH 4HKXA 4EDXB 1G9NL 3V6ZA 1RAMA 1RZ8B 3IKCB 3GB7B 4M7KH 5EUOE 4D0CA 3D5OF 1ZLSL 2XPGB 1E6JH 1ONQB 4QNPF 1CGXA 2ENSA 3MRMB 2FLBT 4F2MB 1LGVA 3VG9B 1RZKL 5FDWA 4G8GB 5CKAA 4N90D 3N1PC 5E7FA 5D2LA 4P4KC 2YR3A 1OGTB 4PJGA 1UM5L 1FGNH 1FYTB 1TJIH 1A6WL 2OSLB 4RIRB 3HZKB 1RMFL 2GT9A 3H9YA 3HC3L 4RQQA 3V7AE 1MJ8L 1IAKA 3G5YB 4UDUB 1W0WB 3CDYA 4YDLB 1BX2A 3EW3B 3JVGC 4XRCA 1UQSA 4NUGL 2CIKB 5EUOA 3MCKB 3ARBB 4OLUH 4XH2B 1AR1C 5C70A 4NT6A 5IF0B 5JDSA 2FJFB 4X7DC 3MGTA 4J4PD 3KYOA 2A6IB 1K6QH 4X6CE 4Z7WE 4ZS7H 4PJHF 1KV3A 5DHVB 2NXYC 2PCPB 2BNUA 3EYFB 2WLZA 1DVFC 1KCRL 3CH1A 1PG7L 4PGDA 4DEPC 1TPXC 1OWWA 5FDYA 4G5ZH 4KJPC 4WEBL 5L88L 4HZAA 5D1ZD 1JI1A 5T1LB 4U1JA 1UH2A 3U7WH 5I2IA 5DD5L 4Q9BA 4BSJA 1E4XL 4GT7A 4LCIH 4P46C 5KSBF 2JJWA 2DI8A 1PEZA 4Z7UF 5DD1L 4KI5E 4KRPC 5EU5B 5JXAL 1A3RH 4V1DB 4QRRB 4G8EB 1N2RB 3N85L 1DFBL 3U46A 3GMQA 3C9NA 4N0UE 4X6CA 4Z7WA 5HHMB 1KB9J 2EE6A 3HG1B 4X7CC 4OCYL 4OGXH 4MNGA 4OM1L 4B53A 2AXFA 5GGSA 2FIKA 3OKLA 1VFAA 4EN3A 5F6IB 3KYMB 2K7PA 2APVA 3T0EE 4RGND 1X5IA 1ED3A 1KLGB 2AJXH 2BFVL 4OF7A 4P2RB 3SDDA 5GIRA 3BDYH 3MV11 2N4IA 5FM5O 3VXRE 4OD3L 4F9LA 2P5WD 5D6CB 5J57B 4P48A 3DV6B 4P4KB 1I1AA 4DKFL 1AGEB 2EYRA 4N0FA 4OI8A 1TVBA 1JZ7A 2IG2H 3OKEB 3MREA 1JZ4A 1QR1B 5KZCB 1Q1JL 1AJ7H 4IOFD 3V6OC 5HYSG 4H20L 2IALB 4N0UA 4ONGL 5GJTH 1JRHI 5JLZA 1E4JA 5HY9A 1RZJL 2FHCA 3E8UH 5HDBF 2GSIB 3GJEB 3TCLA 1QACA 4JO1L 2DQFA 5C3LD 3UYPA 5HI4D 2HVJB 2ZCLL 3TA3D 4FXLA 1EEQA 3PV6B 4LQ1A 2BXYA 4DW2L 4PV9B 3T0EA 1CE6A 4HUVA 3SJVE 2AP2A 3D25B 1BFVH 4YR6A 2VOTA 5IK3A 4NM8L 5IHUL 5DJDA 3KPTA 5KSAC 3VXRA 1XZ0A 4OCRL 2PYEB 1MCQA 4M6MH 5CUSH 3VXSD 1RURH 1I8LC 2OXHA 4MD0A 4OQ1A 4R96B 5SWSB 2NXYB 4DEPB 1TPXB 2A73A 1QSVA 1IM9B 4KMQA 3GSNB 4AMKL 3MYZA 1X5JA 2YPVL 2H8PB 5J13C 4X4YB 1FIGH 2VDQH 4KJWD 4JQVC 2K1MA 4P46B 1NUDA 8CGTA 2GFBA 4E5XB 3SJVA 5D5ME 3AAZA 2R1XB 4KRPB 4PD4J 4NWTL 1PGRB 5LCVH 1K2DA 4C56B 4OLWL 4N8CH 1KCUH 4OKDA 1ZGLB 3BKCL 2FCBA 1HOCA 5ICZA 3IDNA 4IRJD 4WENB 3LKPA 4CADB 4JPIA 2J8UE 4LSSH 4WHYG 3RBGA 2QV2A 1XGYL 3VJ6B 4CRPA 5I1IH 4Z0BH 2XTJE 4FQJH 2H6PB 1I8IA 4NRYB 3ARSA 1OAYL 4R26L 5LVEA 4NCDA 4WO4D 1FJ1B 3SBWC 2HN7B 1YEGH 4MDIA 1MJUL 5FIEA 4YXHH 3CX5K 4NBXB 3UTTB 3MRQA 3QAZC 3NN8A 4LFHD 1L0YA 3LQMA 5IR1A 2GITB 3LRGA 5T1KB 2CLVA 1FNSL 4NZTL 3O3BB 5CP3A