4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
2IBZX 3VFWB 4X6CA 1YMHB 2FH6A 4RQQA 5IW6B 4KDTA 1QQDA 4XBGB 3T0EC 3G08A 2QHRL 4QXTB 4MA1C 4G43B 3GSNL 4LHQB 3QJFA 3GKWL 3TPUB 4XBPA 1R0AL 1TTFA 3O2DL 5HYJE 1PAMA 4JFED 1OT2A 2VR5A 1U8KA 4LLQB 1HEZA 1NMBH 4PS4L 4PG2A 4ODVL 1XR8A 5TE6L 4Q2ZB 4MQTB 3MMEA 2XI9A 3D9AL 5GJSL 4U31A 1YEDB 3X14B 2A9MH 4IEFB 5DF0A 5E94A 5IM7A 4XNQB 3PQYA 2DYPA 2XZQH 4BQ9A 3VG0L 4DUVA 3FL7A 2O61B 5IHLB 1TZHB 2GHWB 1O7VA 1ADQL 2G5BA 4JGMA 2BSSB 4JQXC 4N90D 2V5SA 1LMKA 4MJID 2IQ9H 4PJ9B 3FZUC 3GSWB 4PRNA 3EYFA 4YR6B 4LMQI 3ZDZF 4RGMB 4FTVA 4DWHA 4APQC 1UCBL 1ONQB 3MUY1 4NO0D 3WL9A 5F1IB 1MFEH 3G6JA 3D69B 4ODTL 3CFDB 4H5SB 2VDOH 4QRUB 2VERN 5DRZB 4NWTH 5D7JD 2OX5A 3UXFA 1CXLA 4JRWA 3LQAL 1WLHA 3H42H 5D7SH 1KN2L 4O58H 2Y36H 3LMJL 4U1HA 3DGCR 3RPKA 4UBDD 2KQNA 1JGDB 2ADIB 4RIRB 4HJGA 1VENA 1WZLA 3ZL4L 1TZGL 3GRWA 3ROOA 3LEVL 3Q6GH 1EAPB 4OJFL 4HAFA 5DGRA 3RWEB 5CZXC 1ZLVH 4XWOC 2XWTA 2FH8A 3MRIB 3QPQC 4HH9B 5CGMA 4PJ5E 5ICZB 4YO0A 3SGKC 2Z92B 5L7XH 4L3CB 2VXVL 3TGXA 2B4CC 1LK2A 3MRMB 3DUSA 4NKMA 4WO4C 4L4VE 3VXPB 4OZHA 1F2QA 5T1LA 2IPUK 4MWFB 4L1HA 1ZAGA 4H20L 2ZSVB 5BMFH 2BY3A 5GGQL 4NO2B 3VGDA 1EMTH 3DVGA 3OGOE 3DROB 3UTTB 1R3IH 4GBXA 3HE7C 1U3HC 2GY5A 1IAMA 2UVFA 4FFWC 2IFFL 3MV9E 4M43L 4GKSB 3LS5H 1HXMA 1J8HA 1GAFH 3MBXL 2Z31C 5CWSB 3QZWA 4XX1E 2FEDD 2XWBB 3EDJA 1U8QB 2UYLA 3HI6L 1UADC 5D7KD 4I5BA 5DFWH 3TO4D 5IVNA 4PRPE 1HSAB 4U49A 3QEHA 1HYRC 4OLUL 1QSED 5HGDB 4B7LA 2Y06H 1CGUA 5GRWA 5C08E 3S37L 4QRSB 3T65A 1CTNA 5E5MB 3K3QA 1UVQB 1KJ2L 3O2VH 1EK3A 1AD0A 2WUBH 4YDJB 1FIGL 5HYQB 4MJ5B 3OAYK 3BP7A 3SHSA 3FJTA 2YRZA 1S7WB 4MYWB 1MFDH 2FGZA 1MEXL 3DX8B 5EORH 4YPGB 5FUZL 3DX6A 5J11C 5HVHC 1F02I 1FRGH 4RDQF 4J1UB 5GRUL 5HGAB 5E00A 1J1OH 3IDIB 1OVZA 4IDLA 2J5LC 2IH3A 4X8XA 4PJHF 1SJXA 1IEAA 1U8LB 1T80A 3BEWA 1G7PA 4OCLC 1XR9B 2R56H 4KI5D 3IJHB 3TZVC 1YEEL 2EEBA 4LSTH 4PJFB 2WANA 1JNJA 2FEEI 1KYOJ 5TQ2L 3VRJA 1L9MA 4HGWB 2OI9B 1CDIA 1WFNA 1I7RA 1J8KA 4JO3L 1YNTA 1U41A 2ICCA 5I16A 3WXVH 2XN9A 4HDIA 5JHDA 4OTXH 4Y16C 1HH9A 1FZKA 3MLTB 5FCSH 3WS3A 3QI9B 2P8LB 1KLFA 3PJSA 5D7LE 1CR9H 2D7TL 3ME0A 2AXHA 3LDBB 2XQYG 4ZYKA 2GUOB 4NRZB 4DKFH 2F8VA 1CK0H 1NMCC 5MENE 3ULSA 2XIDA 3BE1H 2QSTA 4TUKH 4RDQG 2A6IA 4WCYH 1ITCA 1SYVA 4HWUA 5E99L 2J12B 4P5KA 4POYA 3MUHL 4P4KC 4ZPTB 4JQIL 4K3DL 3DSNA 1JPFB 5C7XH 5I1IL 3BXNB 2OBGA 2PW1B 2HFTA 4W6WB 2VZUA 5IMLB 2Y5EA 2Y23A 2OXGA 3FQWB 3GIZH 2NY6B 3D85D 3FFCE 3TNMB 5JOPE 3ZE1F 3VG9C 3GSQA 2H2PD 2QSCL 2MCG1 2X4OA 5JORB 3CX5K 4G5ZH 3MV7E 3GSNB 1SJHB 3QUKA 5L8KB 2OZ4H 2QHLA 4LQFH 3TIDB 5HI5D 4Z7NF 3SDDC 2VZTA 4P4RB 1VPOH 4NYLB 2B2XL 2OR7A 2ATPB 3C8DA 3MQIA 2Q6WA 4FQPA 2DLGA 5I73B 1YN7A 3HRZB 3MRHB 4FP8L 5E2WH 3PWLA 1DUYA 5CEZL 2XA8H 5TDOA 1AGCB 1LE5A 1A14H 2NXYD 4FXLA 4PY8I 3W81A 4K3EH 3RWGA 4GMSL 3T4YA 4OB5H 3D0LA 4ZO6A 5M94B 2OLDA 3ZT6A 1T83C 3QRGH 3WUZA 1FAIL 1MHHB 2ZUYA 5FYLE 1KIQB 4MD4A 3L3JA 5T3XE 1DL7H 1KTKE 4MDJA 3V6OC 5EUOE 3IS0X 1FORH 4GXVL 1CDCA 3D2UA 3K8KA 3L3DA 3GSUA 5FGCE 1R5VB 5HYEA 5HHME 1UB5B 3O6FA 3WIHH 4HKXB 3VH8B 5E9DE 3BQUD 4L8SA 4LHUG 1FJ1A 5E8EA 2KDGA 3MLRH 1IILE 3WE6B 4JFHD 3F8UB 4PJDF 1RUQL 3U9PH 1X5GA 1N7MH 3BEVB 4JFDB 1ACYL 5H94A 2R1XA 5GSVB 5EU3B 3L7EB 5FA3A 3DLQR 3I50L 4M8VA 3G5YA 3GSRB 4JANB 4XPHH 3B5HA 4XPTL 2ID5A 2EYSB 2FIKB 1JHLH 4G8EB 1F90H 4QRQA 1NCBL 3HI5H 3U7YH 5CCKL 3LKOA 3RA7H 3QFJD 2R1YA 3OKKB 3ROLA 2L4OA 4Q9RL 2NY4B 2Z8VC 3V0VA 2ZUXA 3FOLA 5D93B 1P4LA 3ZLQC 3OV6A 5LXGL 3MV8E 1NGYA 4YHZL 5IG7A 1MSPA 3MRBB 5I1CH 1GRWA 1IL1B 1PW3A 1OM3H 2EH8L 4YEEA 3KYNB 1KSRA 2O5ZH 3RVXD 1GC1H 2LU4A 3BGFB 1JWSA 4HUXA 3PWUB 1MLBB 3S3JA 3GMOA 2LAGB 4PLNC 1GOGA 2N4IA 1C5CH 4AQ1B 1P4BH 3SGEI 2DBLH 4HWZB 4JJHA 1X5ZA 1P9MA 1A7QH 4OF7A 1ND0B 2D03L 1WC7A 1ZMYA 3MODL 1RZ8B 4BK4A 2AJZA 3LB6D 2RIKA 1U8NA 3MRKA 3QUZC 4TUJB 2NR6D 4WWKD 1MIEH 4XNXH 1NFDB 1NCDH 3HLAB 3KXFA 5EU5A 4NBXB 1WWCA 2VLJD 4JY5H 1T5XB 2ZCKL 3EDDA 5EOCL 2FLRT 5T3ZD 1UJ3C 2HVJB 3ZT5A 2X2YA 1CU4L 2IAND 4R7DA 4JDZA 3RUGE 1VB9A 5C07E 4N5ED 1RU9H 4EDXB 1A4JB 1KJ2B 2ZPKH 1S3KL 4KZEH 4Y1AA 5HDBE 3WDJA 1N5YL 4JDVB 2NLJB 3VXUA 5TFSL 4XPBL 5FOBA 4KU1A 1A6AA 4BELD 4CADA 1QBAA 4X80H 1UH4A 1MCPL 5E8NB 4XI5D 4Z0BL 3FCTA 3MJ9A 1OD9A 4QRRB 2H32B 3TWCL 3JSSA 1KOAA 3ZTJG 2VC2H 2Z35B 3EOAB 1RIVL 4PRIE 4LCUA 1TJHH 4NFCA 4LAQL 2IG2H 3QIWC 1UM6L 5JMOC 2F53E 4ZOAA 2W38A 1LNUB 1NC4B 3UTZA 2Z93B 2FATL 2YD4A 2ICWJ 2FWOB 2BOBB 2VZ1A 1OGTB 1B3JA 2ZUQC 3LEXB 4GW1A 1NMAH 1V7MH 1HHGB 1SM3L 1IQDB 2YXFA 4XNYH 1ZLWH 1MH5A 1PD6A 4LPYA 2A74A 4TYUA 3KPQB 1A1NA 4GKNB 4F7CA 4MA7H 2GTWA 3GSVB 3N9GL 3BZEB 3DRTA 5FYJD 1EO8L 2D0GA 5J4MA 1HSBA 4YDLB 1OCWH 4ONGL 3MRJB 3O4LA 1NAKH 3I02B 1TDQA 4C4KO 2EE3A 4HKBB 5K59F 1X44A 1RHHA 4ZTPH 3QEUA 5AAMA 2Y6SD 1BECA 2VTFA 3ARGB 1CICD 3BKYL 2WWKT 3FRUA 2A38A 4LCCC 1PKQE 3PGDB 1FNHA 3LKQA 4HJ0D 4RGND 4QOKB 1X5FA 2A77H 4XP9H 3DETC 1A3RH 3DVIA 3QUYC 1RZJC 3V4VL 5E8OA 3HUJE 4GW4B 5EN2A 3SCMB 4QHMA 3OXRA 2V7NB 2W0PA 3H2WA 4LHUD 1I1AD 1A3LL 4QEGA 1FGVL 4S1RH 3TH2T 4LMQE 5DQ9B 4GH7B 1ORSA 4OIBA 5L6YH 4Q9QH 2NY5H 3H9SB 3DIFA 1Q9OA 4FFYH 3N0PB 3O8XB 3VI4E 5CLWA 4HWBH 2ED9A 2XKNA 3RNKB 2IAMC 3KPSA 1YMMA 5HGHB 5EZOH 4LNRB 4H1LB 4BUHA 1UWGH 3FO2A 5J1AA 5AAWA 2RFXA 5BO1L 5FDWA 1JPSH 4HS8H 4WFGD 4WWKB 3F7QA 4WGWB 4LLWA 2OTWA 3RPIB 5C3TA 1FVCB 2J6EL 1Q9LB 3OJVC 1XF4A 4P9HL 4G42A 4JZOA 2ZUUA 4BH7A 15C8H 3SO3B 3OKEA 1MI5B 2VZ3A 1FHGA 4LKCB 1A5FH 1FL6B 1KN4H 3UYOD 4KFZC 4GSDL 1YC7A 3NFNB 4KRPC 4K94L 1H3PL 5D4QA 3B4NA 4F7TA 2XXMB 4NQEE 4Z5RA 1F58L 3OB8A 4WIQA 3LN5A 4HIXL 4WTZG 1TNNA 2P5EB 1ZT1A 2VOTA 3RNQB 3KPRE 2J8UA 1FH5H 4JRXA 3P3YA 4CU8A 1AGDA 3VJ6B 5F6HI 4JM4H 4RAUB 4YHPA 5GRYA 3BRGC 1EZVY 5F9AC 2AJSH 2IF7A 5F89A 5B39A 2WUCL 5KANI 1AIFB 3ARPA 5H8DA 3MGOA 4X4XB 3LN9A 3OX8A 4YXKH 4V1DE 5ANME 4XAKE 4P5TC 3ZHDA 2G2RA 3P4MA 3TBVB 1FNEA 3P4NB 3BAEH 5HJ3A 2JJTC 1G6RB 4X9FA 5DGQA 2XZZA 5L9DH 5AYUH 3HC0B 3F7VA 4OZIE 1JYVA 1TJGL 5DK2B 1G9NC 4AEIL 2X10A 2HG5B 3CFJB 4L8DB 1J9CT 1QFUL 4PLKC 4PJXE 1UQSA 1GCFA 3QCTH 4J3VA 3ARFD 4UV7H 1KB5L 1JPST 1SJEA 1EERB 5DUBB 3A67L 4LLDB 4R96A 5TE4L 1FFRA 4OFIA 4WUKL 3FT4B 4Z8FH 2W0LA 1K4CB 2HVKA 4JN1H 1QEWB 2YSSB 4OF5A 4PJIE 4IRSA 2EICA 4Y4KA 4IHOB 4RRPG 4PLJD 5F7WC 4LKXB 4NOBA 4PG2C 2IQAB 4I2XA 3DMMA 4JREB 4OGYL 1DANT 1RIHL 3IDGA 2NY7H 5JOEA 4AM0B 4KUZH 3PF2A 5EA0L 1RUKL 2ILLA 1FO0L 4BYHA 4XVJH 5GS0C 1J11A 3D3VD 3DI3B 4G9FA 1FAKT 5DD6A 4DQOL 4WFEE 1ZHNB 3RIFK 2VR9A 4XVSH 4BZ1L 5F3BA 5I19H 2D31B 4K7PH 2F5AL 3MRNA 4BQ6A 5J3HD 4JY4B 2BSTA 1TCMA 4I18B 4UIKL 5ESQA 5LCVH 5DQDL 5C0EB 1XIWD 1J05A 1S5IL 1DQJB 5DMKB 5KBNC 1JZ6A 3ARDA 3N1FC 4QCIB 4TNVF 5AD0B 4HFWA 4QHUA 2BNRB 2X4TA 3OR6A 1UACH 1T1ZA 4F58L 5MERA 1JV5A 4D9LH 3KHOA 2VAAB 3WSQH 2ITDB 4R8WH 4NIKB 3VXMA 1YEFH 1N6UA 1UZ8B 4ELMF 2OJZH 1T2XA 3TVMD 4A6YH 5IJVB 1NJ9B 4YBLC 5ISZB 1OAUL 3H3BC 4WU7A 5IEHA 1TNMA 2E8ZA 3ARWA 2WWMD 4TVPD 1BEYH 1P5VA 4ZXBA 3PHQA 1DQLH 4Y2DA 1AO7E 2AJUL 2EH7H 4JRYB 1F4WL 1NUNB 1CVRA 1I8KB 3D18B 1L7IL 4TRPL 1P7QD 2ZOLA 3G9AB 5DEZA 3BKCH 4GRWE 4JFFB 4JO4H 3MRDA 4K23L 4O02H 4UT6H 2QADD 3SDYL 3ULUC 3GM8A 4FQJH 4WW1B 4JPWH 4KAQH 2EDLA 3MFFA 5DI8A 4LP4A 1BQHB 4AEEA 1HZHL 1P84J 4GBXC 2GIYA 3BUTA 3BD5A 2VLRD 2JB6A 1NGZB 1MHCB 2ZCLL 3FHAA 5I8EA 3WFEL 5CSZA 4NQXA 3AREC 4RISH 1R3HA 4XCEA 3STZB 3K7UA 1YQVL 1OW0C 1FVEA 4GAGH 5E2TL 3OJDA 3SDAA 4EOWL 2F19H 2NY1B 4KTYA 1NLBH 4RFEA 1T1YA 5JXED 1HQ4A 1Y0LA 1K3IA 2AJXL 3AAZB 1MVFA 4EZMA 1U6AH 3ARSA 5KS9E 3MC0A 2B5IC 5HHXH 4JDTL 1IGTB 2AV1B 3T0EE 4KPHH 3HS0B 5LQBH 4D94A 1RZFL 5CBEB 1S9XB 2V5TA 4NO5A 1AGFB 4WU5A 2W07A 4QYOB 1WCBB 1CXIA 5D2LA 1I9IL 1JZ4A 3ZYOA 5ESAB 2RR3A 3HB3C 3WFBH 2FBOJ 1XGQB 1S7RB 1GL4B 2CLVA 2DIAA 1AGBA 1MAJA 2OZ4A 2VXSH 5CIPH 4GG6B 3ILPB 1P6AB 3AS3A 2IGFH 3UO1H 1FN4A 2DLTA 1OAQH 3HNVH 2P46B 1KCKA 3Q1SL 4LVNC 3U0TA 4NQCA 5HPOA 4YDVB 3PXJA 1A6ZB 3LV3A 5KTEL 1JHTA 4MDIB 4JGJA 2WP3T 3HG1A 3IDNA 3NOIA 3GM0A 1YNLL 5HHNB 5C0BB 3HCVA 1M4KA 3FO0L 3ZDXE 4OLXH 4QRTA 1ZHBA 3WO4C 3D39D 4IDJL 1M7IB 1EZVX 5C8JA 3EJYD 1PLGL 2VE6B 5ICYA 1TENA 5DJZA 4PG9A 4HG4K 3BIKB 2J88H 3DO7B 5JIHA 4I48A 5T1DL 5MI0C 4PJHA 1YEKL 3MROA 4PRHE 5KZCD 5EPMA 3G5ZB 1ZTXL 3U2SA 1ZK9A 1NKRA 2MQCA 3MOAH 3BIAX 5I0ZA 3DXAE 2APTA 5DJ8B 5K33A 2YBRB 5JXAL 4ZTOL 1MNUH 1RD6A 2X89A 2ZUWA 4LCWD 3WIHA 4MX7B 5HVFB 1R3JB 1GZQB 3HR5A 5F7MC 1ZLSL 3F7YA 1R24A 1JK8A 4ZOCA 2WW8A 2EIEA 4YE4L 1E4XH 2E27H 1OSZB 4D0CA 1I9JL 4TTDD 3DSFH 4OZFB 3NA4A 5H37G 5B3JE 5DO2D 1HQRA 2PYEA 3UP1A 2CO6B 3TBYA 1REIA 3O6KL 5E70A 1YYLH 5JZ7C 1RVFL 1KEGL 1GGIL 4CVXB 1AC6A 4QXUL 2ZUTA 1KELL 1JWUB 1LEIB 2VMFA 3GGWA 3B9KB 4IBLT 3F7RA 3CFEB 4P46A 3O6MH 4P2CG 2MKLC 2AXJA 4ZUTB 3RWJA 4X4ME 3HC4H 1XZ0A 2DQCH 1FPTL 1EH9A 1KB5B 4K7PX 2ADGA 3I6LE 4XC1L 3BPCB 2VDPL 2AVGA 4R4FL 1MUJB 2DJSA 5DDHB 1NGPL 2X4NA 4U6XA 4MNQB 2MWCA 2C4XA 4XX1G 3P0YL 5C0CE 2FHCA 5KVMC 1WBZA 1R5IB 4NHUA 1I3GL 3M17B 4UTBL 3AB0C 3TP4A 4PJFF 4WNQA 3QO0B 2NW3A 3UPRA 4G6MH 2DQJH 1FO0B 3B83A 5EIQA 2W9DL 1YY8A 5EU6A 2YD6A 5SWSA 5BVJA 5JLZA 1NEZB 4U6YB 5KW9H 3OKMA 2YR3A 1EEZB 1MCFA 4JFOB 4EN3C 3HNTL 2V2XB 1WZ1L 1Q94B 1XGUA 4P3WA 3F58L 1SVCP 2CUIA 5KVEL 1T5WA 4EKXA 5CZVH 5I1AB 5HGBB 1XCTB 3OXSA 5E8PA 4BKLA 2V7HB 3O6FC 1YA5A 1HXYA 1AR1C 3Q5OA 4X5XB 4G8GB 1UKSA 2Z4QB 3S9DB 5J6GA 2X42A 3HHRB 5DEGA 3VFGH 5E6IB 4DJMA 1KB9K 3C6SB 1HINH 5DD0L 1RURH 1OP5K 2BNQE 4YHIA 3L3OA 2CDGB 1UM4L 2RCSL 4OF6A 1I1FA 4MA8L 1OGAB 3LKRA 1A7OH 1T66D 3O4OB 3FT2A 3VI3E 2F54B 3FN9A 4JPVL 5JW5B 4GQ9L 3KPLB 1HHHB 1Z5LB 1X5IA 3UTSB 1AGEA 5GJTH 2R4SL 3L5IA 3GMLB 4MVBC 4LRNH 1SEBA 2C26A 4XP5H 5J12B 1RJZB 1NGXB 2I24N 5I17B 2J3SA 4RFOL 3WNKA 3KPOA 2R1WA 4ETQA 1I7UA 3ZKQD 2AXFB 3QISA 4IRJB 4UNVA 1GGBL 3LZFL 2XZCH 5L0QC 1CLYL 3G5XB 4HFUH 4W70A 3LN4A 3W9EB 2OR8A 3RTQC 5BQ7B 1GIGH 3VXNA 1D7FA 3NIGF 3NIFF 2D7PA 3ILQC 1CQKA 4E5XA 2PO6A 1FNSL 5CFHA 2RB8A 1A47A 4EIGB 4L29A 2MPAL 5D1ZB 3T3ME 4HS6A 1QBBA 5B4MD 4R7NB 1DANU 4WEBH 1J10A 1RZKC 3OKDB 5FB8B 2R0LH 3BSZH 1IT9H 3QDGE 4PJCB 4ENED 1EVUA 3C8KB 5IHZB 1A2YA 1DVFB 3L3KB 4B5EA 4HWBA 2JJUA 3ARZA 4YXLH 5I8OH 3BH9A 2GTZA 4LPUA 3S8WA 2EDRA 1H8NA 2JIXA 1DQMH 4PRAB 2A6KA 4L4VD 3BGAA 2R0WH 3DO3A 4N8CL 5JW4R 4RFNC 1XGTA 4YIQA 4R4BA 3GZKA 2P24B 1BBDL 1U8IB 5JO5A 4HZAA 1A0QL 3ZKXB 4U7KA 4PP2B 3ZHLA 1S7XB 1A6WL 2WZPD 3ZE0E 1RUMH 4U6HB 3U4EB 2FRGP 4LPVA 3ET9F 5MEOB 4C83A 4KKCD 5J8OA 4QF1B 1KPUB 5T1KB 4F57L 4AENA 1BMGA 3HMXL 1JNNH 2HKFH 5IQ9A 3MNWB 4L9LA 1MFBL 4G9DA 2A6DB 4MXWL 1BGXH 3MRQB 5DT1L 3PP3H 3VFVA 3CFKA 3VXOA 4R0LA 4PRPD 4X6EB 5DVKA 2OR9H 1KJMA 1WBYA 3RAJH 5DD3L 3V6OE 5E4EC 5IVZA 4NM8L 4BSVA 5C08D 5HYJB 2DQIL 3GUTB 4UQ3A 1UEMA 1UXWB 2BY2A 4U3HA 1FV1B 1XH3B 3BMWA 1PX4A 2XPGB 2B0SH 3RGVA 3ECBA 1QP1A 4S10A 1FBIH 3VFNB 5BW7A 4JJ5B 5HD8C 3IXTA 3ARVA 2QHRH 3GSNH 1E4WH 1FDLH 2PXYB 4GRLD 4GS7C 3QUMH 4WI9A 1R0AH 3LEYL 1QSFE 3FO9A 4PJEF 1HWHB 1NFDF 1JRHL 1QRNA 4X6DE 1KTDA 3MRRA 2DWDB 4PD4K 1AHWA 4K2UH 4Y4FA 4JHBA 4ZAKB 1F3DH 1W72B 1T89A 3NFPB 2VXTH 5BCAA 5CP7B 3RWIA 3VG0H 2V9TA 4RZCB 1HI6B 1ADQH 3L95A 4XMPH 4WVRA 5I8CA 4AK1A 1RK0A 2DF3A 1BOGB 4OD2A 1FFPB 4KXZI 5CILH 4YHNB 1UCBH 5CMAA 4UDUB 2VXUL 2AK4D 4OLZL 4HUUB 5D7LD 2BX5A 4ODTH 3PDOA 2X1PA 4GKOA 4J4PD 1K8IA 2WBJD 3E3QC 2FEDC 4ZUWA 4PJ5B 3LQAH 1JNHB 5LGJA 4K8RD 5MEND 1KN2H 4KROD 3WS6C 4OKVA 1VACB 5BRZB 3QIUB 1EJOH 4NO3A 1I7ZB 4ZOEA 1D5IL 4MCYA 3SPVB 2YRPA 3ZL4H 3CDGA 4G80A 3VD7A 4FQHA 3LEVH 2ZNXA 1QBLL 2F5BH 2EYRA 3HMWH 1UCTA 4Q7DA 1VSCA 2ENYA 3WN5C 2YZ1A 3OSKA 1CFTB 1FE8L 1NGWB 1G7LB 2X4RB 1X5XA 3HAEB 4ZUSA 3MV9B 2VXVH 5EBWB 1CLZL 2PYFB 1FZJB 2VKXA 4WUUD 4LVOB 5FKAB 2B1HH 2C3VB 3MBEA 5LAXA 3OGCA 3VWKD 3MV7D 3NCYS 3U9UA 5EU4A 4YH6A 3GRWL 1AFVL 1CF8L 1HDMA 2BY1A 4OZGE 4Z7QE 2XRAH 4WJ5B 3QWRD 3S98A 4IJ3C 4YXHL 2NY3B 3LRGA 5HYSB 4M43H 2L7JA 1M1SA 4KHXH 3MO1B 2CH8A 3MBXH 1BFOB 4G6AC 1JVKA 3V4PL 4ETYA 3X3FH 3HI6H 5T33L 5CHNA 3NGBC 2R4RL 1EUTA 3OJ2C 2BXYA 1WCQA 5E6YA 5DJAB 1IEHA 5FYLD 2MQ3A 4HJJL 2GSIA 3DV6A 3MRFA 3CK0L 2XV6B 2XXCB 1KJ2H 4MSWA 5I2IB 2QL1A 3PWVA 4Y4KC 5E2JA 4U1SA 1WAAE 3QHFL 1FIGH 5C2BL 3TBSB 1WITA 4CW1A 4Z77B 3ES6B 5E9DD 2Y7QA 3IS1X 5JUEL 3DMMC 3V8OA 4PJ7A 1QNZH 5BV7L 7FABL 1P4IL 3W82A 4DKAA 2H32H 1GHFL 1MRCL 2HWZL 3GMRA 3R8QA 4ZD3L 3CDFA 2H6PA 2ESVA 2NY2B 5KAQF 2HFGH 4JR9H 3MOBL 1G7MB 2H9GB 1C8PA 1MHPH 1W0VB 5ENWB 4OZ4A 2KUTA 3BUYA 3SBWA 3F62A 3BW9A 3JTSA 3DHMA 3BWUC 3RX7A 1I4FA 1C12A 2VSCA 2W9EL 5F7EH 5GRZA 4QXGL 2AEWA 2VH5L 3M1BB 4Y19E 3REWA 1NDMA 1H3XA 3DPBA 1YEEH 2E7BA 4XB8A 5IB4A 3FKUS 2R23A 1YPZB 3QXDB 4UQ2B 2WIIA 3MUZ1 5D96B 1A21A 3P30H 5HDOA 5TQ2H 3MV8D 4WW2A 1NC2B 1WFUA 5GHWH 3ULVL 1Q9KA 4H0GA 3SDXA 5DK0B 5DMIL 2QQNH 3ARDC 1J1XL 3TJHD 4Q0XH 3MGTB 4JO3H 4E41A 4KROB 5D1XB 2BDNL 2R9HD 3GO1L 5EO9A 3QRFM 2HTLD 1LO5A 3BPLC 4MD0A 3RI5K 43CAA 1HOCB 1T03H 3PWPB 4F33A 4N1HB 3K8MA 4LSPL 3SQOL 3K2MC 4JHWL 5EC1B 3NTCL 4HS3B 2WBKA 5HI4C 5IB1B 4OFYA 4MAYD 3CLFH 3UJIH 5EZJA 4Y5YA 4ZDHA 3SKOA 5KAQG 1EGJL 4ZXBC 2OTUA 3FFCB 1G7HA 3FQRA 4Y2DC 1DBKH 2JCCE 3SJVE 5FUOH 2PTUA 3ESUF 3VFWA 2OK0L 4N68A 1Q0XL 1UT9A 1YMHA 1OAZH 4KUCF 2R2BB 2K7PA 5E99H 5IW6A 2RHEA 4S0SD 2GJ6E 4JB9L 2VXQH 4XP6L 3LIZH 3U36B 4XBGA 5EBMB 5I1IH 2HFEB 3Q6FB 2EDOA 5GRJH 5C07D 3PDGA 4QXTA 4G43A 1XT5A 4FG6D 5AZEH 4H1LH 3TPUA 2C1OB 4I77H 3TFKD 4S0TD 2DQEH 1J0KA 5FV1L 5TDNB 2QSCH 4LLQA 3BZ4B 5AYQA 2Y25A 1BZ7B 3VWJB 3IU4L 4Q2ZA 2VDKL 4P2OB 2EECA 5IGXH 3VW3L 1YEDA 3X14A 4PJAE 3SDAC 4PRID 4XNQA 2CLZB 2JF1A 3I3BA 1GOFA 1RAMA 5EUOB 5J0BA 2O61A 1N8ZB 4HC1H 3SE8L 2EKSB 3CVHL 4PRDB 2Q7NA 1TZHA 4X6CE 1KJVB 1V7NL 2BSSA 2P45B 5FGCB 5HHMB 4PJ9A 3GSWA 4YR6A 1R5WB 1A7RH 4Y4HB 3RIAK 2IPUG 4M6AA 2VDNH 4HXAL 1ONQA 2YA0A 1URLA 3BESR 1LDSA 3RVXC 5CJOL 4F80A 3MXWL 2C4FT 1U8KB 5F1IA 1DQQB 3D69A 5H35B 4KY1L 3CFDA 3BWAB 4H5SA 1ODAA 4QRUA 1X5LA 3CC5B 5I71B 5IESH 5DRZA 35C8L 2V9QA 1N6QL 4RX4D 1WIOA 1H9VA 4HK0B 5CKGA 4XNMB 4HBCH 1P7HL 1JGDA 2ADIA 4RIRA 3EKCA 3NACL 3F12B 5IMKB 2ARJA 1ACYH 1G6RH 1EAPA 2FJFB 3WUWG 3RWEA 1UFUA 3RZCB 3I50H 3GMQB 1S9VB 3GHBL 4LPTA 3MRIA 5IEKB 4HH9A 4KGLA 5FYJH 4R97C 4C56D 1MCDA 3RDTD 5ICZA 2M26A 2VABB 1I1YB 4LVHB 4L4TE 3K2UH 3CX5J 3TH3T 2Z92A 4AQOA 1NCBH 4L3CA 3C6LB 5FCUH 2RBLA 3MRMA 5GS1B 3VXPA 4JG1L 3G6JE 5KSAD 5FUCC 1T7WA 1EBPA 3MLZH 4MWFA 4E42A 5LXGH 5F7DB 3RZWA 4XI5C 2ZSVA 4NO2A 5I6XC 3D87B 4EI5B 3DROA 4JQVA 3UTTA 2X4QB 3OMZA 3H9HB 1ZLVK 4HWEL 3S4SG 4KJWD 1D9KD 1FYTE 4GKSA 4KV5E 2V2WB 3RQ3A 3TYGL 5CWSA 1E6OL 1WFTA 1CS6A 3VGAB 4YLQT 2XWBA 3IGAB 1U8QA 3RUGB 2ORBL 4UDTB 1X5JA 5A2JH 3I6KB 2AS5M 2D03H 1WF5A 3MODH 3C5ZB 1HSAA 5HGDA 2YKLH 3EOTH 4QRSA 2EO9A 4P46C 4OZHE 4BA8A 4NQED 5E5MA 3GDBA 4ZSOE 2B7DT 2R0KH 1FYHB 1H5BC 1UC6A 1UVQA 5I8KH 4OFPA 2NNAB 4LLYB 3ULUE 5IB5B 1LE9B 3H0TB 4YDJA 3RWHB 3WJLC 2Y6SC 3KPRD 3V0WL 3MZTA 5HYQA 1CU4H 3NZHL 3RWCB 4R2GC 4NCDA 4QNPF 5FGBC 2DQTL 1S7WA 3N50A 4HJ0C 3V7AE 3GMMB 2F53B 1G9EA 5HYFA 3DJ9A 3DX8A 1CBVL 4YPGA 2E7CA 1J8HE 4XPAH 5ACMA 5TFSH 4XPBH 1PDKA 5DSCB 1V8HA 2XTLA 4J1UA 1B0WA 5HGAA 4YHML 1MCPH 3K1KC 4XAKD 4Y0GA 3IDIA 3TWCH 3H6JA 1AE6H 4BM7A 3CMOH 3C2SA 1F97A 1U8LA 3U0PB 3C5SB 1XR9A 5I1GL 4ZODA 1U9KA 2QQKL 2GAZB 3DVFA 3IJHA 4LAQH 1UM6H 6CGTA 4PJFA 2Q7YB 5IVXE 4HGWA 2FX9L 5HHPB 4D0BB 4DGYL 4FA8A 5T5FH 5AEAA 2X4UB 1YEJL 3T8XB 3IRZA 2I26N 1SM3H 1E0OB 3L3GB 3GMPB 1VEPA 1KV3A 2VDLL 3C8HA 4DZBB 3MJ9L 5IBTL 3C60D 4M62H 5E7BA 1UKQA 2HT4C 4S2SB 5ADPL 4KJQC 5TH2B 3MLTA 3QI9A 2P8LA 2FO4B 3GBNH 4UNUA 2GJZB 2MCPH 2N1KA 3HZYB 3ZMRA 2ENSA 2GUOA 3JZ7A 4TULL 4NJ9H 4NRZA 1MJ8H 5ID0B 2NX5E 3VFOB 4I0PB 4DGVH 4ZUVB 2D7OA 4IMKA 5LWYL 2BVYA 1C08B 1AY1L 1H8OA 2M8XA 1MCOL 2PR4H 1A6TB 3ZHKA 3V4VH 1BM3L 4ZPTA 4BZ2H 4KDVA 1JPFA 2P48B 3PWJB 3BXNA 2PW1A 1HKLH 5IMLA 2XACC 5ELIA 4OT1H 4JM2F 4NNXB 2B39A 2Z0BA 2XN9E 2MNUA 3FQWA 5JHDE 3TNMA 1K2DB 3PHOB 4L8CB 2AABH 4G8IB 5JORA 1EO5A 3GSNA 1SJHA 5IBUB 4PJ8D 5DMYA 2E6PA 4IOFD 1IMHC 3TIDA 4U1NB 3O2DA 2MTPA 3X17A 4P4RA 4NYLA 3ZTNL 1BFTA 2ATPA 2PO6C 4GLRH 2VNCA 1XGPB 1IGJB 1DR9A 2WLYA 2Y07H 3TNNB 4Z78B 3AMKA 3Q2CA 5CS7A 3HRZA 3MRHA 2J6EH 3TLRA 3P4LA 3IFNL 4HIEB 5EB9A 2CK0L 2NY5C 1AGCA 1JFQH 4I3SL 4J7RA 3WNLA 2DMCA 5I74B 3CVHB 4GSDH 1ADQA 2P44B 5I75B 1MHHA 1W8NA 4K94H 1KIQA 4YX2H 4PTUB 3CH8A 3OF6D 3HE6B 1A1MB 1JI1A 4FQLH 4D8PB 3S88H 1R5VA 4HIXH 4V1DB 5ANMB 3SE9H 2NCMA 1TITA 2A9ML 2YA1A 1UB5A 3RX5A 2EDDA 1BJ1J 5CINL 4ZFGL 4HKXA 3VH8A 1MCBA 2AW2A 2XTJD 4Z76B 3T3PE 3JBG7 3WE6A 4OZIB 3DRQB 3BEVA 4JFDA 3PV6B 3LD8C 5F6HJ 4OZFH 5GSVA 1OD7A 3L7EA 5EU3A 2FGWH 1IC1A 3GSRA 1N0XH 4JANA 4L1DA 3BRFA 4L9LC 2EYSA 2FIKA 4KKNA 3VA2C 1MFEL 4G8EA 4FQXC 2VDOL 1HHKB 2BRQA 2VUYA 3OKKA 1C7TA 5I1LB 1XIWC 4NWTL 1W8OA 4PJIB 2NZIA 1E28B 3T0ED 5D7SL 3G9VA 1KXVC 2Y36L 4JFQB 4NDMB 1IAKB 3MRBA 4U1MB 1IL1A 4OLWH 4MQSB 4ZNEA 5GRVL 1JYWA 3RGVC 3DUHA 4P3CH 4D9QE 3KYNA 3MRGB 5BW7C 2IALB 3T04D 2CO7B 3ARBD 2A73B 3Q6GL 3TT1H 3PWUA 1MLBA 1KGCD 3WLBB 2YPLD 1DUZB 1U95B 4S1SL 1OTUC 5A2IH 5E2VH 4HWZA 3QUXD 4PJCF 3VFTB 5DWUH 1TETH 5L7XL 1ND0A 2FECI 2WWMC 4R26H 5L2KE 1RZ8A 4M1GH 1FC1A 1O5DT 4W4OA 5F44A 3U30C 4G6JH 4JG0H 3T0XA 3D85A 4UMGA 4P99A 4Y4FC 5JPNB 4TUJA 4ONFL 1NFDA 3HLAA 1RUKH 1INQB 4TSCL 1T89C 2CKNA 1T5XA 1CD8A 1EMTL 2P42B 3FZUD 3KG5A 1F4XL 4BZ1H 1R3IL 2LVCA 4CJ0A 4DW2H 2F5AH 3JVGA 4XC3H 4PRHD 1AKJD 2UV3A 3P9MB 4OLVH 4EDXA 1A4JA 5IT2H 1KJ2A 4F9PC 2XY1A 4Z0XB 1GAFL 1GOHA 1L0YA 4JDVA 2NLJA 4L3ED 3DYPA 2C4FU 3NCJH 3G04B 3ARTA 2UWEE 5E8NA 3WO3B 4Q9CA 4QRRA 2H32A 2D4DA 3AM8A 2QQQA 2Y06L 1TCRB 2VQ1B 1AO7B 1BF2A 5JXEC 2NY0C 1VA9A 3EOAA 2Z35A 1DBAL 4TSAL 1WICA 1WV7T 1LNUA 1NC4A 4Z7VE 4F2MB 2Z93A 5JMRA 1IM3B 2FWOA 2BOBA 4XWOD 1OGTA 2R8SH 3LEXA 5J56B 3QPQD 1HHGA 1T22B 4RA0C 1IQDA 3FONB 4OFKA 1YEGL 3FRPG 5DC9B 5KANG 2VLLB 1MFDL 5F96L 3SKUD 5EORL 4PFEA 1IAIL 4JFEE 3KPQA 4GKNA 3GSVA 3VXUE 5CBAB 3BZEA 4JCMA 5I30H 3K4DA 3GHEH 5IFJB 3L5HA 3MRJA 1RFDL 3I02A 9CGTA 4HKBA 2I9LB 1I1CA 3HE7D 3ARGA 2R56L 3SDYH 1U3HD 1MCKA 5EBLB 4KRMB 1ZT4B 2VUOA 1T0MB 3DTXB 4JM2D 3PGDA 4LSTL 2VQUA 1XAUA 4QOKA 1WEJH 3SEPA 3VXSD 5JDJA 1S9WB 1ZLWK 5KS9B 4B41A 3CUPB 4N90E 4M1DH 1NCWL 4Z7WF 4GW4A 3SCMA 4PV9B 3WFEH 2V7NA 3RVWC 3OKLB 1SVZA 2A83B 1YQVH 4OTXL 5E2TH 3U6RB 2HN7B 3B8YA 5LG1A 5DQ9A 3CU1A 3H9SA 3QEQD 1CR9L 5F3HB 3O8XA 3UBXG 3EZJB 4XVTH 3RNKA 2DQHH 2KPNA 4DKFL 5HGHA 4LNRA 4H1LA 3BE1L 3CLEL 4KTEH 4TUKL 5B38G 2P7TB 1LHZA 4TTDC 5K9OB 5E1AB 4EXKA 4KQ3L 1IAIM 1YEHL 3PL6B 2H45A 4WWKA 3U46B 2ZJSH 2APXA 3RPIA 1FVCA 2Q20A 1QFWI 1Q9LA 5C7XL 3O2WH 2BNQD 3QIBB 1MI5A 3KYMB 2YPVL 4LKCA 1FL6A 4APQB 5EUKB 5KTEH 2JK5B 4HC1A 1IM9B 2CRMA 1JWMB 2AAVA 5FYJU 5J1SC 3NFNA 2YUZA 3TZVD 3DXAB 2Q76B 1ZV5A 3H3KA 4G5ZL 4IDJH 2OZ4L 4PYGA 5GS2H 3KLHC 1PLGH 2YC1B 4G7VH 2P5EA 1VPOL 1M6OA 3RNQA 5T1DH 3IAQA 2R2HB 4OIIH 4BZYA 3VJ6A 4N8VB 4RAUA 4Y16D 3FB8B 1A8JH 1OAKH 1G7IB 1PG7W 3RHWF 5F8QC 3BOVA 2XA8L 1A14L 3E3QE 1AIFA 2APFA 4K3EL 4X4XA 5D7KE 3VFMB 5IV2B 4JPKH 5DC4B 4YE4H 4ACPA 3QRGL 4TUOB 3TBVA 5JTWA 4KMQA 3P4NA 3EGSB 4WO4B 2E9WA 4MXVF 1G6RA 4UT7H 1DL7L 1OLLA 5HI3C 1Q38A 3HC0A 2Y4SA 3J8F7 5F70A 5TGBB 5D2NB 5DK2A 3QDGD 2HG5A 3CFJA 4L8DA 1AQKH 1W72H 1XCQB 4JRXE 3MLRL 5HVWA 5DUBA 3WNNA 2CGRH 5F7UA 4LLDA 4OKDA 5C0CB 3U9PL 2P5WB 3HPLB 1XMWA 3FT4A 5SV4A 1K4CA 3OG4B 2Z31B 1QEWA 2YSSA 1QSVA 4K9EH 3ZYIA 3DECA 4XPHL 1IZKA 1DBMH 1FPTH 4IHOA 4RGOH 1DQDH 4FQIH 1JHLL 1F90L 3HI5L 4X8JB 4LKXA 2VDPH 4M7JL 5C9KA 4R4FH 3D48R 2IQAA 1CGVA 2Z91B 2EC8A 1NGPH 3LRHA 4HG4J 3U82B 5H37H 3FMGH 4LCIH 3P0YH 5SX4I 4AM0A 5C0IB 1A7PL 2BVEA 1ZHNA 5I1CL 3CAFA 4UINH 2D31A 4P57B 1YPZF 1K9TA 5L2JB 1AXSB 1OM3L 5BS0B 5EULV 1WWAX 1JJUA 4UOW1 4JY4A 1LP9F 1GC1L 1VHPA 5FM4A 4PJ9C 2W9DH 2DQUH 3KYOB 4I18A 4RGMC 1C5CL 4Q6IB 1P4BL 5C0EA 2DBLL 1CFSB 1T4KB 4G6FB 4EXPX 1DQJA 3K1DA 3JWOL 5DMKA 4U3XA 4OFDA 5HHOB 4AY0A 2C3GA 5GIRB 3HAEH 4QCIA 5IIEB 5AD0A 2BNRA 1MIEL 3LQZB 3TZVB 4XNXL 4HF5H 5I1HL 5FHBL 1MAML 3IDXH 3BDBA 4JY5L 1G0XA 3UPCA 2VAAA 3CSYB 2ITDA 1GGUA 1UZ8A 5IJVA 1UM4H 1NJ9A 1RU9L 5ISZA 1K6QH 3PUCA 4QHNB 3GBMH 3EDFA 4MA8H 2ZPKL 5IR1B 2FZ3B 4NBZB 4WY7H 4JPVH 3SDCB 4JRYA 3RKDD 3V6ZB 4X80L 1EA9C 1L0XA 2AJ3B 1I8KA 3D18A 5KOMC 1HKFA 5DJYB 4JFFA 1EV2E 4O51B 3ZDZE 1DN0B 4U4BA 3ZKNC 3SGJC 2VC2L 3W0WE 1TJHL 1U8JB 4WW1A 4LSVH 1BQHA 5GGUB 4JQVC 3LZFH 1A1OB 2QR0B 3BYTA 4KKCC 1V3KA 3CCHB 3IAPA 4P4KB 1NMAL 4NSKB 1V7ML 3BD4A 4XNYL 1NGZA 1MHCA 1NANI 1BFVH 3MTRA 1QACA 4GQPH 3PGFH 4OCSH 5A3IC 3STZA 2MSPA 3QDJB 2NYYD 3PHSA 1C5BH 1OF2B 3NVQA 3ZE2E 1ZHLB 4MA7L 3QUZD 3G6DL 3VG9B 3AAZA 3QDMB 1I8LC 2BERA 1NAKL 4KKBC 1OLZA 2UY7A 1QHPA 1IGTA 4FRWA 1S9YB 2AV1A 4ZTPL 3HS0A 1GVIA 5CBEA 1S9XA 4X99B 4ZQKB 2EDKA 1Y18B 3P9WB 3SDDB 1RZ7H 1AGFA 3VCLB 4QYOA 1WCBA 4HLZH 1LD9B 4ZFOB 3WNPA 4X5WB 3T0DA 4H8WH 5ESAA 1VEMA 1KB9J 2A77L 4XP9L 2AI0L 1XGQA 5IHUL 1S7RA 1UB6B 1X6NA 1J0ZA 4GG6A 3ILPA 4P2QB 4HGMA 4ALAH 1JMZA 1I3RB 1EEQA 5I1JH 1XF2B 4YDVA 4S1RL 5C6TH 1NBVH 1A6ZA 4WEUD 5L6YL 4MDIA 2CJUL 5A2KH 4FFYL 4C54A 1CZ8L 3QFJE 2J6EA 5HHNA 5C0BA 3QIWD 3MLWH 3CZJA 4HWBL 1MAKA 3VXRD 1M7IA 5EZOL 1UWGL 1L6XA 5GGRY 4F7EB 2VE6A 4ODXB 3BIKA 5BOZG 1EXUB 3HMXH 3DO7A 2IBGA 1JPSL 4HS8L 2CDEB 2ICEB 3G5ZA 1MCWM 2APVA 4MXWH 5DT1H 1X5HA 2NQCA 1IC5H 5DJ8A 5FAAA 2YBRA 5DHVB 1NPUA 1C7SA 1QSFB 4MX7A 15C8L 5C0AD 4HMCA 1R3JA 1GZQA 4MA3B 1KN4L 5FYKL 3OJMB 4XH2B 4NQCE 4J4PC 4X6DB 2WBJC 3LDBC 5C0FB 4LP5A 4OIAA 1OSZA 3HG1E 2X4SB 5I1DB 4OZFA 2F58H 1F6LL 3QUYD 1CD9B 4IMKC 3VRLF 4WDIB 3LEYH 5T3ZE 3MUJA 2ED7A 4RA3A 5DHYB 3HKFA 4JM4L 2HJLB 3MOQA 3LKPB 5F93C 4CVXA 4M7ZB 4PJHE 5T3XH 2AJSL 1JWUA 1LEIA 5J13C 3QA3B 3B9KA 3CFEA 4XAWH 3EYSL 1A9BB 2IAMD 4ZUTA 3IF1B 1KB5A 1BQSA 4QTHB 3W5NA 4OD3L 3BPCA 3BAEL 2R2EB 2G5RA 2APWA 2AEQL 1IJ9A 1MUJA 5L9DL 5DDHA 5AYUL 4P0DA 4MNQA 3UZEA 1HILB 2BNUB 4HW6A 3I6GB 1WIPA 1R5IA 1I1RA 4BQ8A 3M17A 3QXUA 4NKQB 3QCTL 1UJ3B 4OLZH 1UWXH 3QSKB 1DBBH 1MELA 1I8IB 5EOTB 4M7LH 2ADFH 3QO0A 4ODBD 5IROA 1CGYA 1EPFA 1H3TA 1FO0A 4KRPD 2UZXB 3RVUC 5I1EH 4DOHE 5C0JB 1NEZA 4JN1L 4U6YA 4UZGA 3QXAB 5ALCH 1HK6A 1EEZA 4JFOA 1BREA 2V2XA 1C1EH 4JO1H 3ULVF 1QVOB 3K8LA 3KYAA 2EYTB 1Q94A 1TZIB 1KG0B 3I3EA 2GJ6D 4ELKB 5C92A 1BP3B 3IB4A 4JEGB 1HHIB 5I1AA 5HGBA 1XCTA 2V7HA 3QIWB 4KC3B 1RUPH 4OZGB 2Q8BH 3QZWG 2OTPA 4X5XA 4XVJL 4G8GA 1FE8H 2DKUA 1E4XI 4WI3A 4LLMB 3B6SB 1EUUA 1QBML 4N0CD 5D1QB 4XVSL 5E6IA 4LHJB 1CYGA 12E8L 3C6SA 4K7PL 4PD4J 3BIBX 4EQ2A 4UNTA 2NW3B 2CDGA 3LQAC 4X9IA 4M3JA 4P5TD 4Z7NE 3EFFB 1OGAA 5IW1B 2YHGA 5LCVL 2HH0H 2F54A 5SWSE 5EU6E 4JO2H 5JW5A 3KPLA 1HHHA 1Z5LA 1NCUA 2OMNA 3KHQA 3UTSA 3GMLA 4QRPB 5F7LB 1NBZB 3ETBF 5JIKA 4PLKD 1RJZA 1NGXA 5F7YC 2NY4C 3AFLA 4DZ8B 4Z95L 1QLEL 5I17A 2IWGA 1JYNA 4E0RB 5D93C 2O93L 4LU5H 2DWEB 4ZPVB 3TA3B 3V2AR 4LRIC 4LCCB 3V4PH 4EVNB 4CVUA 2JE8A 4D9LL 1MCRA 5J6HB 3X13B 3QQ4B 3WV0A 2AXFA 4IRJA 4WHTB 3WSQL 4R8WL 1PYWB 1YEFL 3ORJA 3G5XA 4MNGE 4A6YL 3W9EA 4PJGB 1NDGB 5J7CC 4UOW0 5DJXB 4M7LT 5BQ7A 3VDBA 2BVPB 3M07A 3FQXB 1DQLL 4M02A 1WSST 1S78D 2V5RA 4EI6B 2EH7L 2X44D 3QHFH 3Q3GB 2I9TB 5C2BH 5D1ZA 1X4XA 4PJDE 2DYPD 3HFMH 4R7NA 4W4OC 4Y19B 3B5GA 7FABH 5F9WC 3BKCL 2OYPA 3OKDA 3P73B 4JO4L 5FB8A 1JZ8A 3QAZB 1IRAY 3N1PC 4O02L 5DJ0B 1JBJA 1MRCH 4O2FB 4ZD3H 4PJCA 4FQJL 3REVB 4JPWL 1KULA 3C8KA 4HH8A 5IHZA 1DVFA 3L3KA 4K3HA 2K9UA 4WGVB 1INEL 2QLVB 4FTVD 2DOCA 3EYVB 2BHYA 1U8HB 4Y8DC 2VITB 4PRAA 2W9EH 3TFKC 4KJPC 1B0RB 4K3JH 1OWRM 4OCRH 3AY4C 5K9KB 4M00A 4P23B 2AQ2A 2P24A 4FQ2H 1U8IA 3ULVH 4PR5B 4PREB 4PP2A 4KRPB 2VSDA 4HPYH 1S7XA 1J1XH 4U6HA 2BMKB 3U4EA 3O6LH 5HHXL 3AM8C 3GO1H 3PP4H 5MEOA 3MLYL 2JCCB 3SJVB 3BH8B 5LQBL 4QF1A 1F3JB 3LKNB 1NUDA 1KPUA 4DVRH 2OL3B 5T1KA 2EDQA 4PJIF 3WYRA 2O5YH 3MNWA 3WFBL 3IDJB 1OQXA 2A6DA 3K74B 3MRQA 2GSGB 2IGFL 3UO1L 1UXSB 4S1QL 4MMXC 1AXTL 4X6EA 4NZUH 3HNVL 3TF7C 3EJZC 5HYJA 1EO7A 4PRBB 3CDCA 4EDWL 3GUTA 5LGKA 4NN7C 1UXWA 5T1LD 3EYUH 1FV1A 1XH3A 1Q0XH 4IMLB 3EOBB 2XPGA 4OLXL 3LAFA 2CXKA 1CDUA 3VFNA 4JJ5A 4PJAB 4YPJA 4GBXD 4EUPB 3QPXL 2PXYA 3DVNB 2BZDA 8FABB 2YN3A 1J8HD 3WLWD 1MFAH 2DWDA 3SCMC 4KGJA 3MOAL 4WI7A 5KSBB 3IU4H 2VDKH 4XRCB 3MV01 3OKOB 1MNUL 3U7WH 3VW3H 2JLLA 4ZAKA 1W72A 2I5YL 3NFPA 5CP7A 4DUWA 3QQ9C 3CXHK 5DA0B 4ZS7H 5BOPA 3O8XC 2E27L 3O3AB 3I9GH 4RZCA 1HI6A 2DM3A 2PCPB 1V7NH 2ZSWB 3DSFL 3HB3D 1CL7I 3NAAH 1PSKH 2IBZY 1FFPA 4YHNA 4JZNB 1I75A 1YYLL 2DQGH 4UDUA 3TV3H 1EFXB 3MXWH 1G84A 1FP5A 4HUUA 3NN8B 1M7DB 5GISH 5K59E 1QRNE 3IVKB 1NL0H 4TVPE 4NZRH 3CFCH 3O6ML 4PJ5A 2NX5D 3LRSB 2VDQH 3SO3C 1JNHA 1OQOA 1CE6B 4L4TB 2P47B 2DQCL 1VACA 5BRZA 3QIUA 3R1GH 3ZDYF 1I7ZA 4OD1L 3SPVA 1BD2B 3O45B 3L5XH 3LKSB 5IBLC 3TCLB 1JPTH 1PEZA 3A6CL 4ZNCD 3GHBH 1CFTA 1NGQH 1NGWA 1G7LA 2X4RA 3M8OH 2XN9D 3S97C 5JHDD 5ABDE 3HAEA 2D7MA 4FHBD 3MV9A 2F9BT 5EBWA 3RI5F 1FYTB 2P1YA 2PYFA 3MR9B 1FZJA 1P2CB 5FKAA 1U91B 2C3VA 1A02N 1CT8B 2DQJL 3ZKMC 3V79C 4H26B 4QGTA 5F8RC 1U8MB 5KW9L 3BZDA 3D5OF 2FHBA 4WJ5A 4RMUA 3IFPB 5JZ7D 1IKFL 4HWEH 4WTWA 5HYSA 3B9VA 4ZSOB 5DRNB 1JL8A 2MHAB 3MO1A 1BFOA 1D5MB 3LPGA 4PGDB 4BFGA 3MGAA 3VFGL 1MCLA 1HINL 1WT5C 1RURL 5DJAA 3ZDXF 1DTUA 3AREB 1WVZA 5FO9B 2IFGA 1A7OL 1T7YA 1FGNH 4HMEA 4D3CH 5I2IA 1WGOA 3FN3A 1F11B 1Z9MA 4QKXB 3UPAA 1C16B 4A6YB 3TBSA 4Z77A 3NZHH 3ES6A 3D39E 3O9WB 4LRNL 5HBBA 2B5IB 2DQFB 4JREC 1CE1L 4LF3B 1MJUH 3GMNB 4J3TA 3QHZL 5IVXB 3CPLB 4N9GB 1DFBH 3BO8B 1G7MA 2H9GA 1ZSDB 1W0VA 1ZEAH 5ENWA 1X7QB 2XZCL 4M5ZL 1IGIL 2A6JB 3SQBA 3RIAF 3RY5A 4GRWH 4PB9L 1HIMH 3M1BA 4I18C 3N85H 1GIGL 5AG9A 1OWWA 1YPZA 3QXDA 4UQ2A 3D2UD 5F7HA 1NC2A 4PJ8C 3OB0H 5DK0A 5BZWB 2NX5B 3O6FD 1YEJH 1AR1D 4KI1A 3WO4B 4R3SB 3MGTA 4WEBL 5D1XA 4D9QD 2R0LL 4GXUN 1EHXA 1IT9L 4LSSL 5C9JB 1HOCA 2H26B 3PWPA 1UYWL 4RSVA 5MI0B 2OXHA 1CD1B 5I8OL 2ESVE 5EC1A 4HS3A 5IB1A 5IK3B 3Q48A 1CGSL 1N3NB 4GXUM 1DQML 4N0YL 4I1NB 2R0WL 5C09B 3HMXA 5HYIA 2E7LA 4MVBD 3FFCA 4XZUB 4WWID 4WI2A 1JMXA 5LWYH 4QO1A 2XICA 1L4IA 5CIPB 5GGVY 3VDCA 1DBJL 1IC4H 2R2BA 3C5JB 3MA7B 5HHVH 1RUML 5HVGB 3U36A 3TN0B 1IGCL 5EBMA 2HFEA 5GGVH 3Q6FA 2CUMA 4E41E 3OBAA 2C1OA 2HKFL 3RTQD 3MLUH 1A22B 3E6HB 5TDNA 3H7BB 1CTOA 2OSLB 3BZ4A 1RK1B 1BZ7A 3VWJA 5CJBA 3ILQD 3PDDA 4P2OA 3FFDB 3RBSA 4HGKC 1UA6H 3EDEA 3CVIH 1N4XH 2COQA 3C2AH 3C08L 2JJVA 1TJIH 3HZMA 1HNFA 2CLZA 3ZTNH 2NY1C 4UI2A 1F00I 2AEPH 3LQMA 3MCLL 3ZSSA 1F45A 3JV6B 5EUOA 4ELME 1N8ZA 2EKSA 4PRDA 3MCKB 4PB0H 2B0SL 4ONOA 2YOCA 4AJ0A 1KJVA 1KCRH 1FBIL 2NXZB 4LEXL 1E27B 1OHQA 1F4YH 2D2OA 2FBJH 4NQDB 2VLKB 3UJJH 2LQRA 3IFNH 2CK0H 1R5WA 4Y4HA 1E4WL 1FDLL 4I3SH 5B39G 3UC0H 3QUML 3S34H 4NN6C 2CMRH 2F15A 3SGEH 4CMHB 3ARBC 4LLVB 2X5PA 3KJ6H 2VZSA 1DQQA 3VD3A 3VXUD 5H35A 1SJVA 1LO2H 3BWAA 3CC5A 3AU1B 2PTTB 3QUXC 4K2UL 4M6NH 2FYYB 1MQ8A 5EU7C 3QEGH 4HK0A 2VXTL 5CINH 4OCXH 4EN3B 4ZFGH 4XNMA 1WTGT 2R69H 4P9HC 3F12A 4XMPL 4WHDA 5IMKA 2WWKO 3GKZA 2B4CH 1RULH 4M1CC 2FB4H 2FJFA 5FV2A 3K81A 3RZCA 5L88H 3GMQA 3HR6A 1S9VA 1B88A 4GAJH 1FNAA 5CILL 4DKDC 5IEKA 3BISA 4K94C 2VABA 2XOTA 1I1YA 4Z7UB 3C6LA 3FOMB 3EO1B 5GS1A 2YPKB 5CAYB 2O26U 4O4YH 1OTTC 4HV8B 1J86A 5F6IB 2OM5A 2ZCHH 3WHE1 3QNZB 4PUBH 4JVUA 5F7DA 3WXWL 3O4LD 2APBA 5B22A 5HD8D 1EJOL 4EI5A 2KBGA 5L2KB 1FFNB 2X4QA 3NABH 3H9HA 4WENB 3VGEA 5B3NA 2ARJB 4FQCL 2F5BL 2V2WA 3HMWL 5EDXA 4S1SH 2X4PB 5IFAH 5KSUB 3NBNA 3IGAA 4PGEB 3RUGA 4UDTA 5DZLA 3I6KA 5LBSH 3C5ZA 2B1HL 1JUFB 3B9KC 3RTQB 4ONFH 4E42B 1N64H 2EE9A 3BDYH 3KPSD 1YMMD 4TSCH 3L7FB 2EDYA 2NNAA 4LLYA 2UWEB 4M5YL 5IB5A 1LE9A 1IKNA 1CVSC 3CZFB 1F4XH 3H0TA 4MNHB 3RWHA 2XRAL 5K9JH 2OQJB 2HFFB 3RWCA 4HBQA 3UTTE 3GIVB 4JM2C 1KIUA 3GMMA 1IAOB 2F53A 4KHXL 2EC9T 4Z7VB 3TYFB 4PTTB 5B8CB 2GEEA 2VKWA 1QR1B 4ZMAT 5DSCA 1QYGH 4Y7MA 3X3FL 2BC4B 2AGJH 5D2LF 1EEUA 5GGTL 5JOFB 4X9HA 2IADB 4UV4H 3EYOB 3U0PA 1MFCH 4GAFB 3O3UN 2DIJA 3C5SA 3F7PC 1BVKB 4XCNB 4JFEB 4TSAH 1WZKA 1DBAH 4RFNB 5DURD 2GAZA 2A0LD 4WTXA 4M93B 1BBJB 2Q7YA 4XCYB 2PKDA 5HHPA 4D0BA 3EO9L 1FLRH 5JQ6H 3DBXB 4XP4H 2VQTA 2X4UA 3T8XA 4NKDB 4LSQL 3PABB 4X6DF 4JRXD 3L3GA 3VGGA 3WDIA 1QNZL 3GMPA 2C1PB 1YEGH 4DZBA 1EHLH 2VISB 1OB1B 1KT2B 3CX2A 3QP3A 5F96H 1IAIH 4S2SA 5DVOA 5TH2A 2DAVA 3MRLB 2HFGL 4JR9L 1MHPL 2FO4A 1MQKH 1X9QA 2GJZA 5EZLB 2H41A 4MJIB 3HZYA 5E6IC 4LSRH 5BJTB 2Y1VA 4O2CB 1MJJB 2HLFC 1RFDH 5DC0A 4J3WA 1EAJA 5ID0A 3WFZA 4HUMB 3O3EB 4P2RE 3VFOA 4I0PA 4NO0B 5F7EL 4ZUVA 5E4EB 1P5UA 3O4OC 2VRAA 5F1OB 3HZKB 1C08A 3P30L 4KK6C 5GHWL 5D7JB 1KC5H 1A6TA 4G6AD 5EIIB 1NCWH 2QQNL 2UVEA 4Q0XL 4LOUC 1EGJA 2FL5B 5FOJA 2YUVA 3PWJA 1QA9B 4ODWB 1JZ5A 4JHAL 1T03L 4GS7B 2AK4E 4NNXA 1QO3B 4K71B 4R90L 1JF1B 1C5DB 2LE9A 3DX7B 3I2CL 1K2DA 3GI8H 3PHOA 5ECJE 3PV7A 4L8CA 4MD5B 4G8IA 3L5WB 4IRSD 4LIQE 1H3GA 4MJ4A 4IIQB 3CLFL 3UJIL 4Y4KD 3ZO0A 1JGVL 4FOMA 4JFPB 4U1NA 3CLEH 2R15A 4OBRA 1DBKL 3DMMD 5TF1H 2DLHA 5FUOL 1M7XA 4KQ3H 4CU6A 1YEHH 1OAZL 1BJ8A 1XGPA 1IGJA 3RFZC 3TNNA 5D1ZC 4Z78A 2VXQL 3LIZL 2ERJB 3ARRA 1KBGH 4G9FD 4UAOB 1E6JL 2O5XH 4F9LA 5GRJL 4HIEA 2RQ8A 3VFSB 5AZEL 2YPVH 4I77L 1DVFC 4X7TB 3CVHA 3U79A 4XVUC 2DQEL 3GJEB 4WUUE 2IMMA 2QTEA 4Z7QF 3L1OH 4UT9H 1T0NB 4PTUA 4URTB 3HE6A 3QUMB 1A1MA 2AJVH 4D8PA 5IGXL 3ARDD 3D0VB 4NPYB 1JNLL 3BX7C 4V1DA 5ANMA 1CDJA 2FJHB 2DD8L 3TO4B 4Z7OF 4O2EB 5DHVH 3MUGB 3W0WD 1MCJA 5KG9B 4BJLA 3OAUH 3H3PH 4HX1B 1QSEB 3ZKXC 1QLFB 3S5LB 1B0GB 4Z76A 1UZ6F 4QY8B 4HC1L 1RZIB 2OS7A 5GRXG 4MLSA 4OZIA 3DRQA 5HI4D 3PV6A 4LAJH 3VXMD 1I3VA 1A7RL 3WN5B 2XT1B 3NIFE 3NIGE 4LBEB 4B0MM 2VDNL 2ITCB 4ORZC 5EZIH 3JTTB 1RZGB 4ZXBD 1D6VH 4Y2DD 1KLUB 4AH2B 3WFHB 1HHKA 2C3WA 5IESL 5I1LA 5F1KC 4PJIA 1E28A 2AJYH 5CD5D 3MREB 4PJGF 2R0ZH 4JFQA 4NDMA 1IAKA 4HBCL 3NA9H 4DKEL 4U1MA 5CJXA 2AQ3A 3MRGA 2IALA 4NC2B 3S35H 2A73A 3T2QA 1G6RL 2XQBL 5FFLA 2H8PB 4JZJB 3WLBA 1OTSD 2GW5A 2PXYC 4JFDE 1SBSL 3TO2B 1DUZA 1U95A 1FCGA 5FYJL 4M6OH 2YEZB 3K2UL 3VFTA 1CDHA 1U42A 1HYSD 3SDAD 3BZFB 4M7JH 5FCUL 1JHKL 3MJ7B 4X9GA 3P11L 1ITBB 5SWQB 2Q3ZA 5IB2B 3RKDC 3MLZL 5JPNA 2EDNA 4ZAKC 2EXYD 2WP3O 5HPMB 1FZMB 1INQA 1G7QB 1A7PH 3B3IB 3KS0H 2LFGA 2RGSA 1F6AB 4NNPH 1E4KC 4N0UE 4ZNEE 3STLB 4TNWF 2RJMA 4MQXD 3P9MA 5C0GB 4Z0XA 2EDXA 4PGCB 5DD1L 2JCCF 2X6MA 5LGHH 5FO8B 4XPGH 3G04A 3JWOH 4NQCD 4GOSA 2NYYC 3WMSA 5CKAA 3I75B 3HG1D 3D85B 2YKLL 1TCRA 2VQ1A 3EOTL 1AO7A 4LGSB 2HT3C 5I1HH 2X9YA 3KAAA 5FHBH 1MAMH 3QWQB 2R0KL 4PJEE 1MCCA 5I8KL 4F2MA 4L9DA 1NFDE 2C9AA 3QIUC 3IXAB 4YFDB 1IM3A 4UTAH 1K8DB 3U1SH 1BHGA 1T22A 1N59B 3FONA 3W0WB 5K9QG 1MVUB 1FNLA 2FLBT 5DRXB 3VFRB 2VLLA 2CIKB 5D5MB 4M7KH 4CJ1A 4XPAL 4HUWB 5JW4Q 2X89D 5CBAA 4NP4L 2BP3A 4NZJA 1BLNB 5IFJA 2NXYB 1AE6L 4LVOC 3CMOL 2M2DA 3MLXH 1RZJH 4QRRE 2I9LA 2OJEB 2X1QA 5MP6H 1OAYL 5EBLA 5KSBF 1ZT4A 1T0MA 3DTXA 2PYED 3QO1B 4PY7B 1S9WA 4WFHE 4YWGH 4AZ8A 4ONHB 5KS9A 3CUPA 3E1F1 5T5FL 4D9RE 1SEQH 4PV9A 4XPFH 1BWWA 3OKLA 4HCRH 3BQUB 2A83A 4M62L 1M71B 3U6RA 2HN7A 1ETZB 2LTQB 3GBNL 4P46D 2MCPL 3G6DH 5F3HA 1T3FB 3EBAA 4ERSH 3RVTC 4NJ9L 3SY0B 1MJ8L 1AC0A 4DGVL 4YZFF 2H3NB 3TJEH 1T2QH 4R2GD 1QFWM 1QTYT 3VD4A 1DSFH 2P7TA 3QFJB 4HUVB 5K9OA 5E1AA 2C3XA 4M9PA 2PR4L 1OL0A 2AI0H 5IHUH 3PL6A 4QOKE 1JGUH 4MCZB 3U46A 2ZP0T 1A7NH 4BZ2L 4LEOB 3CNKA 4JQXA 4MHHI 4XTRD 5CEYB 2EC9U 2IPTH 3QIBA 4Q97A 1HKLL 1S7TB 4HHAB 4N1CA 4OT1L 3G5VB 4POZC 4C56E 3KYMA 4APQA 4NKOB 2NY2C 5EUKA 2W92A 2JK5A 2CJUH 3KDMB 1IM9A 4WEMB 4XBEL 5SWSD 5EU6D 1JWMA 1KENH 2OL3H 1CZ8H 2AABL 5EO1B 2XFXA 3DXAA 4KKAC 2Q76A 2BCKB 2MQ0A 1CG9B 1NFIB 4JFZH 2YC1A 4YEFA 1ZA3B 1UWEL 5D96C 4TOYH 4NQVB 2R2HA 2ZOKB 4N8VA 2Y07L 4I9WE 2CKBB 2HT4D 3FB8A 4KJQD 1G7IA 3OTTA 5HSFA 2VLJB 5INDB 5D1XC 1QRKA 4DFIA 3JWDL 1JE6A 5ITBH 1WQVT 1JFQL 2D4FA 2IANB 3V95A 5FECB 5EH1A 5FYKH 4N1EA 2GCYB 2X1XR 4EUPH 3VFMA 1FNGB 5IV2A 1I9EA 1G9NH 1MI5E 3SGKA 4GFTB 4XCFH 4TUOA 2GQHA 1OAXL 2JB5H 4KKLC 5INCB 5HGGS 3EGSA 4WO4A 5IKCB 3S35X 4YX2L 2QBWA 3RWDB 5CEZE 4X4MA 4FQLL 2E7LC 5TGBA 5D2NA 3S88L 3DYMA 3TC9A 3SE9L 4AL8H 2R29H 4LARH 1M6OB 2P5EE 2W60B 1ZLUH 3S36H 5C6PB 1XCQA 2H2SD 4YBQD 5C0CA 2P5WA 4N0CC 3HPLA 1RPQA 1JTPA 2Z31A 3EYSH 2FGWL 1N0XL 5DJ2B 1J0JA 3T08A 5I1KH 5GS0H 4X8JA 4OD3H 1I3UA 2AEQH 4DOHB 2PO6D 5FK9B 1QKZH 2Z91A 5TE7H 1U3ZA 3IU3B 2HYMA 5DJ6B 1KCUL 5C0IA 1H5BB 2J4WL 4YAQB 2HJFB 1ZVHA 4KDTC 4GG8B 4OLWL 1ZANH 2B20A 2E7MA 1CICB 4LPWA 4P57A 4X7CC 2HA1A 3FB7B 1AXSA 5BS0A 5L2JA 2GFBB 4P3CL 3QJHB 4YQXH 4RGNB 4F15C 3L3HB 2VZVA 4P5MB 3TT1L 1ZVYA 4Y4HC 3KYOA 2BOCB 2BRRH 2JIXD 5I76B 4PJ7F 4Q6IA 2FSEB 4LQ1A 5E2VL 1CFSA 1T4KA 4DTGH 1HCVA 4LHUB 1I1AB 1OY3B 5DWUL 1TETL 3L3IB 1FG9C 2YD2A 5HHOA 2WQRA 4R26L 1BIIB 5GIRA 3UBXI 4M1GL 2VDMH 4K7FB 1FL3B 1S78C 5I71C 4G6JL 4JG0L 5IIEA 2EE2A 5DMGC 5CEXB 3LQZA 3TZVA 4K7PY 1IGYB 3GK8H 5E5RB 1QBMH 3I85A 2W9LA 5D7IB 5DEFB 5K93A 3CSYA 2EDJA 12E8H 3UTQB 4DW2L 4WW2F 4XC3L 3CIQA 3IJYB 3SDXF 2PUQT 3AGVA 1UM5H 4OLVL 4QHNA 5IT2L 1OSPL 5IR1A 2FZ3A 3RZCC 1YN6B 4LSUH 4FQXD 3SDCA 5F7FA 4LPXA 2QEJA 3ULUH 3NCJL 3V6ZA 3BVNB 2AJ3A 4MNGB 1QZ1A 3CFIC 3IDYC 4RAVB 4LLAA 5DJYA 4MAUH 3KJ4B 2IPKB 2IJ0C 4O51A 4Z95H 1DN0A 1QLEH 3RGVD 1U8JA 1UH2A 1YC8A 2GY7B 5ETUB 4F8TA 3RHWK 1Q1JH 5GGUA 4PJDB 4EI5C 2ATKB 1ZA6B 1G0YR 1A1OA 2QR0A 2D9QB 2R8SL 3CCHA 4P4KA 1OTUD 4NSKA 2QQLH 1KLGB 2NW2B 3KPMB 4L3AA 1QRND 4PPTA 5BVPH 2EIDA 5ADOH 2CR6A 3QDJA 1KNOB 1P1ZB 1OF2A 3VGAC 1ZHLA 1L6ZA 4Y4FD 1RIUL 1BF8A 5I30L 1YZZA 3GHEL 4JRYE 3QDMA 2MMXA 2VZOA 5MHSD 1JP5A 2M1KA 3SO5A 3OL2A 4QHKJ 5GZOC 3MNZB 1S9YA 4ZQKA 4X99A 1Y18A 3SDDA 3TT3L 3BDXA 3VCLA 3X11B 2XTJE 1LD9A 1WEJL 4ZFOA 4X5WA 1JI2A 4F7MB 1INEH 5F72S 1UB6A 2IEPA 3RVVC 4QLRA 1CXEA 4QT5B 4M1DL 1QPXA 4FZ8H 1SY6H 4U1GB 4P2QA 1EVTC 1I3RA 2DN7A 4NKIH 1XF2A 4HSQA 2XKSA 3ARFB 4NRYB 3WLWC 1IEBB 2PTVA 5E2UH 1QHOA 2NY0D 1R6VA 1T83A 4HQQH 5BV7C 5DQJB 1ORQB 1EX0A 3OPZH 5IP4A 3DV4B 4XVTL 1VERA 2DQHL 4S1DC 3V6OA 5F9JB 3MLYH 4AG4H 4Z7UF 4F7EA 1JGEB 4KTEL 4RCAA 4ODXA 3FTGB 1ZVSB 1EXUA 4KMTH 4HAGA 1AXIB 2CDEA 3U7AA 2ICEA 1I9RH 2ZJSL 4R4NC 5DZNA 5J9PB 1OARH 4S1QH 3D3VB 1AXTH 1KGCE 4BSWB 2YPLE 3O2WL 5DHVA 2F8XC 4XXDB 5I15H 1QSFA 3A6BH 3ULVC 4EDWH 1G9ML 3MBED 4MA3A 3S36X 4XH2A 5EU7E 4X6DA 3N06B 5C0FA 4FQQB 5A2LH 2AERT 4QNPE 2X4SA 1NAMB 3CSGA 5I1DA 4KZDH 5C0BE 1F8TH 2HTKC 1TQCB 1XIWB 3HZVB 4I0PC 3B2VL 1EEYB 2AV7B 2PNDA 3ELAT 3V5HB 1XF5B 4PP1C 3QPXH 4G7VL 4OF0A 4X6FB 4WDIA 4LNVA 5B21A 3RVWD 4OIIL 4IRZL 5DHYA 4YK4C 3NH7H 2DTMH 2HJLA 3LKPA 1T7ZA 1OAKL 3L9RB 3QA3A 4L3EE 1MWAB 3A6OA 1A9BA 2I5YH 2FR4B 4PBWD 3TVMB 3IF1A 4JPKL 4QTHA 5FDYA 4PYHA 3SOBL 2R2EA 4BFEA 4UT7L 2BSED 3U30B 4U2YA 4C59B 2DICA 3B5TA 1N2RB 1LEKB 1HILA 4LL9A 1UENA 2BNUA 3V0AC 1P7QB 3I6GA 2YMXL 1U93B 3CD4A 1AJ7L 1AQKL 1W72L 1UJ3A 2QADB 1MOEA 3OKYA 3QH3B 2EEAA 3RJQB 1I8IA 2ESVD 5EOTA 3NCBB 2ICWB 2CGRL 5AUMB 4F9LC 1RV6X 1VGEH 5C0JA 2VLRB 3BN3B 4K9EL 2FD6L 1DBML 3QXAA 2DTSA 4KDWA 3KLHD 4RGOL 1DQDL 4FQIL 4OD1H 1QVOA 4GAYB 3VD5A 2EYTA 1TZIA 4GMTH 3B2UD 1KG0A 1SQ2N 3STBA 4ELKA 5F7KC 4U6VH 1HHIA 4M61B 1CFNB 1WJ3A 1NCCH 3A6CH 3FMGL 4I3RH 4LCIL 1UWXK 3VXSE 3QIWA 4NZTH 4OZGA 4E41D 1NBQA 4MNQE 2VDRH 4LLMA 3B6SA 5D1QA 3SGDI 2DLFH 4UINL 1AD9B 2L0DA 3PIQB 1LGVA 3PWNB 3JV5A 1KTLB 4O5LL 5EWIH 3EFFA 4OFYD 2DQUL 5IQ7H 5IW1A 2YD1A 1PJ9A 4Y88A 3QEQE 5HI3D 3CXHJ 2ZG2A 1JRHI 4C55A 2K3TA 4QRPA 3VRIB 1CDGA 1NBZA 4Q9BA 1IKFH 2WK2A 4DZ8A 4E0RA 1TVDA 5DXWA 2DWEA 4ZPVA 3TA3A 4HF5L 4LCCA 3IDXL 4EVNA 3D39B 5J6HA 5E0QA 3X13A 3QQ4A 1A6UH 4L8SC 4U1LB 4WHTA 4ZFZB 4G3YH 2KKQA 1F3DJ 5CJXC 3MNVB 3HNSH 4XMLH 1PYWA 2GT9B 3QDHA 3QWOB 3FT3B 4PJGA 1NDGA 3EO0B 1K6QL 4HT1H 1DLHB 3GBML 5DJXA 1RZKH 3S96B 5KZCB 2BVPA 3HPJB 4WY7L 3FQXA 1OGAE 3IKCB 4EI6A 1LO0L 2NTFB 4WHYG 2F54E 3Q3GA 2I9TA 3X12B 4N0RA 4LCWB 5DVNA 1CDYA 4X6BB 5JA8B 4J6RH 3UYRH 4Y19A 1CE1H 4ODSH 3P73A 5FEBA 4I13B 1Q8MA 5DJ0A 1PY4A 3T0BA 4O2FA 3QHZH 2D3VA 4J3XA 4QGYA 3NPSC 2QJDA 3REVA 3RKPA 4LSVL 1P69B 4GKZB 3O0RL 4RAHA 2EIZB 4PJ9D 4M5ZH 1IGIH 1CFQB 1B6DA 1P7KB 3EYVA 1U8HA 2VITA 1BFVL 3ALPA 4PB9H 1B0RA 4DEPB 3PGFL 4OCSL 4AIOA 2D7NA 1C5BL 4P23A 4BK5A 5K9KA 5KJRH 3T0VA 3MACH 5FYKU 4PREA 4PR5A 4RWYH 1P9MC 3E2HB 2BMKA 3THML 4XMKH 2JELH 2JCCA 2VLMD 3U4AA 3SJVA 3BH8A 4NM4H 5EC2B 4LSSH 1CL7L 1F3JA 3LKNA 4KMLB 3RL2B 1UYWH 1RUAH 1RZ7L 2OL3A 3BKML 1KXQE 4PJCE 4H8WL 1MJ7H 1MCNA 1RQ5A 3IDJA 1PZ5B 1CGSH 1T1WB 3MJ8B 2GSGA 2FJGB 4N0YH 4CDHA 1UXSA 4ALAL 3UZQA 4K8RL 4KI5F 2VO5A 5I1JL 4PRBA 5C6TL 1W0WB 1NBVL 1BJMA 3LS4H 3ZKND 4UUJB 1DBJH 4XP1L 2GYSA 4IMLA 3EOBA 4TPRH 3RJDA 3MLWL 4DN3L 4WHCA 1IGCH 4Y5XB 2I60H 4PJAA 3UTTD 1QUNA 4JHZA 4EUPA 4XNUH 3DVNA 4KK8C 3ZYZA 1GPOH 4ELMB 8FABA 3VE0B 2C3HA 4NN5B 5A3ID 1YY9C 5CJQL 4X98B 2Q86B 1B9ZA 1U3JA 1IGFH 5KSBA 1J1PH 3L6FB 1IC5L 1DEEB 2F74B 2A9NL 4XRCA 4TN9A 1U58B 3OKOA 2EZ0C 3AUVA 3C08H 4KKBD 2VWEC 3MX0A 3NIDF 3RU8L 4P3DB 3VH8G 3OZ9L 4J3UA 3MCLH 2FNBA 1IGMH 5F97E 3O3AA 4MZ3A 3BPOC 2BVTA 2PCPA 5I18H 5EBGA 2ZSWA 4LEXH 1DLFH 2F58L 3NCFB 5ID1B 1V3MA 4KHTH 1SYSA 4TTGA 4JZNA 2CLRB 1K5NB 3WFDH 1EFXA 3U0WH 1LWRA 3IAGC 3PL6C 2QKIB 5KN5B 3NN8A 5FYLL 1M7DA 5HDLA 3V4UH 5T3XL 3IVKA 3IFOB 3QIBC 1NQBA 4P2RD 3LRSA 4XAWL 5GQBA 5JQHC 1CE6A 4L4TA 3E8UH 3P9LB 2HLAA 2KL6A 4Z7WE 1BD2A 2NMSA 2Z9TA 5D5MF 6FABL 1CLOH 5D71H 3O45A 5EFIB 3LKSA 3OKNB 3TCLA 1VFMA 1DZBA 4JKPH 2DS4A 3MLVH 1VFUA 2I27N 3ZE2F 3RY6A 1DBBL 1FYTA 3MR9A 3QI9D 4M7LL 1P2CA 1LEGB 1U91A 2ADFL 4EEEA 2ZUVA 1BX2B 1CT8A 1ZHKB 5IF0B 3FQTB 1ED3B 2B1AH 3WXWH 5I1EL 4H26A 1U8MA 2SEBA 5ALCL 1VEOA 2E6JA 4L4VB 1C1EL 1MRDH 4JO1L 4CVWA 5BRZE 2A0LC 3C87A 3IFPA 5ACZB 2AXGB 2HT2D 4FQCH 4ZSOA 1PFCA 4FXKB 5DRNA 2MHAA 4FS0A 2YXMA 5D2NC 1YECL 1MLCB 1G7JB 2Q8BL 1RUPL 1D5MA 5E8DH 1QLRB 1U3YA 4G7YL 4OCMC 4PGDA 1G1CA 4LLUB 4F37K 1JZ7A 2NY6D 1L9NA 4J23A 1IFHH 4WFFE 3AREA 2X09A 3EHBD 4M48L 5FO9A 1OW0A 2YD3A 5FKPB 2HH0L 4IOIB 4LASH 4JO2L 3QQ3B 4JKKA 5ICXB 4PRPB 4M5YH 1LO4H 1F11A 1C16A 4A6YA 1TIUA 2WV3A 3VXRE 3O9WA 4KK5C 5C08B 1N6VA 3INUL 2DQFA 4LF3A 3SKNB 2CPCA 5JHLH 3P40A 4LU5L 3B9AA 1R3KB 3GMNA 3KPTA 3PGCB 5IVXA 4HEPG 3CPLA 1IQWH 1H3VA 5DRWB 5EIVA 4N9GA 3BO8A 1ZSDA 4A2LA 5CJ5A 3RVUD 1GGCH 2BHZA 4MXVE 4W6YB 1X7QA 4HKJB 4KK9C 3T0AA 2A6JA 5CUSH 3RWFB 4GRLB 5GGTH 2DIBA 5C0AE 4S11A 1VFAB 3FN0L 4H88H 1TVHB 3KPNB 4IRSC 4Q6IC 1F4AA 4EBQH 1KUMA 1U36A 1INDH 3IDUA 1SY6A 3EO9H 5FGRA 1TFHA 4RNRB 5BZWA 3CMGA 2NX5A 4P2RB 2ARWA 3BP5B 4LSQH 3HFML 2KH2B 4R3SA 4AMKH 1K4DB 5C9JA 1Y6MR 3CDYA 4YNYB 2H26A 4AEFA 5DJCB 4QXWA 3DX9B 4JFXB 4JFDD 1MCIA 4JN2B 1B4RA 1CD1A 5IK3A 2HRPH 3H9YA 1N3NA 3KR3L 1WK0A 5CJ8A 5D8JH 4CVZB 4BSJA 4Q58C 4H1LG 2AK4B 5C09A 4K3JL 5SWZE 3OB0K 5D7LB 4OCRL 4XZUA 3SDCC 5EOQH 2BVOB 2NY4D 3HC3L 4FQ2L 2UZIL 2WBJB 5D72L 5CIPA 1YPZE 3C5JA 3MA7A 4HPYL 1A64A 3MRCB 1LP9E 2IMNA 3TN0A 5MENB 3CH1B 3O6LL 3WEXB 3PP4L 2DJ4A 2QSVA 4JHAH 4OV5B 1SHMA 4DVRL 4BH8B 4R90H 3I2CH 3PWPE 2VL4A 1OP9A 2O5YL 3E6HA 4MB4A 1J5OH 3H7BA 2OSLA 3H9ZA 4R9HA 4U3CA 1RK1A 5FO7B 5EOCJ 1JGVH 5J13B 1PG7H 3FFDA 4P2YA 1U8PB 5C0RL 4NZUL 5KOVC 5IB3B 4CN1A 1JN6B 4WV1B 4WUUB 1Z0MA 2X7LB 5F88B 3EYUL 3VWKB 3MV7B 4H25B 32C2B 3JV6A 2V5MA 3MCKA 3GEWB 4OSUH 5CD5C 1RI8A 1PBYA 1E6JH 4YDIH 1E27A 1H3WM 5FA4B 4NQDA 2VLKA 4OM0H 4KJPD 4LLVA 4NZDA 5E24E 1MFAL 2YWYA 1OTSC 5D7IF 2CKBH 2E9BA 3S6CA 3AU1A 2PTTA 1HN1A 4XCCH 2FYYA 3U7WL 1JNLH 4QRRD 1HYSC 2DD8H 3C9NB 3HZMB 1HH6B 3T4AB 4PJBE 3EFDL 5T3ZH 4EN3A 5MEQB 4ZS7L 5GZNC 3I9GL 4WFHD 1FSKB 1RY7B 4U7MA 2EXYC 1J0IA 1NC4D 4D9RD 3ESVF 2VR4A 2W59A 4KH2A 4ZO8A 3KLSA 3NAAL 1PSKL 4KJYB 3QCUL 5E9DB 1D6EB 2IC2A 2DQGL 5D6CB 1DJSA 3TV3L 2GKIA 3S7GA 4MQXC 3EJZD 4FXGB 4AIXA 4FN0A 4Z7UA 3FOMA 5GISL 3EO1A 5CGTA 2YPKA 1NL0L 4OCYL 4HV8A 4NJAH 4NZRL 3CFCL 2YD9A 3TBWB 3QNZA 2VDQL 2X05A 4HXBL 4PGBB 4DK3A 1AR2A 4X7DC 3R1GL 5L2KA 3ARGD 3NZ8B 1X3DA 3PQYE 1FFNA 4DKEH 1TQBB 1CI5A 4QOKD 3L5XL 3MV8B 2PW2B 3OAZH 4F7PB 2XQBH 1JPTL 5SV3A 3SCMD 3W9DB 1SBSH 2DI9A 2X4PA 1Z0NA 5KSUA 1NGQL 4FTVE 1NFKA 4PGEA 3GSXB 3M8OL 4N0UB 4M7ZC 1D5ZB 1JHKH 1RJYB 4FZEH 3H9SD 3P11H 4M6MH 3QQ9D 1JUFA 1J18A 5J89A 1Q0YH 4CBPA 3O8XD 4ODHL 3RTQA 1CFBA 1QSZA 5GRVK 3WKMH 4MAYB 3GJFB 3L7FA 3O3BB 2UWEA 2FEEL 3CZFA 4MNHA 2YK1L 1FFOB 4I3GA 1BIHA 4Y5VB 1VCAA 4ISVB 2OQJA 4YGAB 2HFFA 2RAMA 3QG7H 4I9WD 3GIVA 5F9WB 1KF9B 1IAOA 2FX8L 2E3VA 4PJEB 4N0FB 3TYFA 3VU2A 4Z7VA 1QFPA 1K85A 4PTTA 5B8CA 5DD1H 5GSRB 2CD0A 4CRPA 1QR1A 4ZS6D 4YGVB 4CAGA 2BC4A 3VFUB 5C07B 1YYMH 4HIJB 5FF6B 1MI5D 4CMMB 5JOFA 1PQZB 2IADA 3EYOA 4B50A 4XCNA 1BVKA 1YJDL 4JFEA 3VRLE 4U0RB 4XXCA 4GG6F 5CEZD 5TQ0H 1FGNL 1PGRB 1BBJA 4RBPH 4D3CL 4XCYA 5IBLD 1WBXB 1BQHG 1YNKL 2I25N 5ESVB 1S5HB 2XZAL 1GC1C 2P5ED 3DBXA 4NKDA 3PABA 4OLYH 4PRIB 2C1PA 1QFWH 2VISA 1OB1A 1B2WH 1KT2A 1MJUL 3B9EA 4OBSA 3BP6B 2HJKB 3SKJL 3JWOC 4XNZB 4DAGL 3MRLA 1DFBL 1T20B 5JDSB 5KVGH 5D1QC 4NP4H 4XTRC 5EZLA 3ZKMD 4MJIA 5E08H 1ZEAL 2WMPA 3DGGB 5BJTA 1Z3GL 4C57C