4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
4K3EH 4L3EE 2ARJB 2F9BT 4I77H 3WN5A 1MFEL 1HH9B 5F72S 4PRNB 5IVXB 1CBVH 4NC2B 1A02N 4OV6F 4PGDB 3NMEA 2NY0D 1OSPL 3PGCB 2AW2A 4D0CA 4A6YB 1M6OB 1N5YH 3QP3A 3NCBB 3WL9B 3VCLA 4DJMA 4LMQE 1GPOL 5I76B 3QDGD 1ZGLM 5EWIH 4RQQB 3GMNA 3ZDXE 4GSDL 2X1WL 1MRFH 3QWRA 3EO1A 3VMNA 3MXVH 1NBYA 2D7OA 2F5AH 4MHHG 5EFIB 1Q38A 2XA8L 3MGTB 3RVXD 8FABA 4PYGA 5IB5B 3LPWA 2V2WA 3T2NL 3MUJA 1HHGA 4X4YB 3MJ6A 4LLUB 3MNVA 1OF2B 1QOKA 1Q94A 1QRND 3C5SA 5DWUL 3LIZH 5JOFB 2FX7L 3VA2C 5B3JE 2B4CH 3RBGA 1U3HC 3TJEL 2R1WA 2A77L 4L4JA 5JDJA 3GHEH 4EI5D 2Y5TB 3VRIA 3G5YB 1MY5A 3T3MF 2OP4H 1MJUH 1SY6A 4UUJB 4K7PY 2HH0L 2VABB 4NO2A 4PG9A 4RWHA 5DMIL 3VXPB 1NMCC 3QQ3A 2QBWA 2PCPA 1H8NA 2EE9A 3U9UB 1FFOB 3HNTL 4NC1C 4L4VA 1XF4A 4Z7QF 2YN5A 3TWCH 2Q76B 2I07A 3PE9A 3TESA 1NEZG 1F3DJ 3CK0H 4Z7UA 2IGFL 3F7QA 4RFOL 2ZOLB 4WI9A 4PRID 4HCRH 1JWSA 4JKWA 1I9IL 4O2CA 1II4E 3IGAA 1F3JA 3MOAH 5EDXA 4J4PD 3C2AL 4APQA 3EYFB 4TSCH 2IBGA 3PWPB 4JZNB 1K8IB 1MCOL 2DTSA 5EORH 4HIHA 3TCLB 2Z8WC 2BSSB 4JRXE 3RWJB 1MEXL 4MXQD 4FTVE 2R4SL 4JFHE 3OB8A 7CGTA 4YPGA 4NWUL 5CJBA 1TCMA 5KG9A 2X4OB 2YA2A 2MCPH 3RY6C 3QNYB 4FQHB 4Q2ZB 4I1NB 4X4MA 5E5UB 1KF9B 1F3RB 1MFCH 3QG6B 2NY5H 5I8OH 1JK8B 1M7IA 1M05B 5ICZB 1A3LH 4NM4H 3QEHB 4QHNB 5J6HA 15C8L 3CX5J 4OUUB 2DAVA 5F97E 3VGGA 3R8BB 4PRPD 4MJ5A 3HZKA 5CFHA 5ALBL 4LCWB 1P9MC 5IVXF 4X5WB 5ALBH 2OZ4A 4IRZH 2A77H 5DURB 4OLEA 3SDAC 5EBLA 3HI6L 4GKSA 4LRNL 5C3TA 4J3XA 4X80H 3EHBD 3VI3F 3PJSB 4IJ3C 3KJ6H 2CIKB 5E5MA 5HDBF 3L3HB 3D2UA 1QPXA 1YECH 1WAAE 4P5KA 2X4RB 1BM3H 3GBNH 5EN2B 3BVNA 2Z31C 3DRQA 3FRPG 5I1AA 1KLUB 4H25B 4K8RC 4NQCE 3OKNB 4UDTB 3NAAL 4L4TE 3TIDB 5MEQA 1V7NL 4F3FB 1T5WB 3P73A 2XWBA 3QUXB 4ORGB 2AXJA 4YHPB 1R5VB 2PUQT 4MD5B 4ODXB 3WIHL 2DMKA 4J3WA 1GZQB 3MJ7A 3I6GB 4XPHL 2B0SL 5IV2B 5H35B 1BJ1J 2NY2C 5EA0H 4KTEL 1F02I 1UZ8B 3IDIA 4YH6A 1RU9H 5GXBB 1S7WB 4FQ2H 1MAKA 4PLKD 5IFJA 1INEL 5AZEH 3D39D 1EUUA 1SYSB 1N64L 3EDKA 5CSGA 1S3KL 5LQBH 1JN6B 3R06A 2P5WE 4GXUM 3T77A 3KS0H 4K7PX 3QT2A 4UT7L 4HHAA 4ONGL 1QFWI 4LSRH 4EDWL 4C83A 2GHWB 4KK5D 5EIQA 1EVTC 4I0PB 3MLPA 5F3BA 4LLWB 3S96A 3BP6A 5DGRA 2J8UB 3CD4A 1XR9B 1YYLH 2EKJA 4P46C 1MHCB 3PV6A 5GGQL 1H9VA 1JZ5A 3N0PB 1T21A 4FQQB 1MJ8L 4LEOA 3RTQA 3PWVA 4HAFA 4M03A 4NQVA 3LKPA 4Z7VB 3W2DL 1I1AC 1TVDA 3SO5A 2CD0A 4HKJA 1ES0A 4WHTA 3B9VA 3N85H 3K8LA 4JGUA 1ZA6A 4LKCB 4QXTB 4X7FC 4KTDH 1ZVHA 3MCLH 2DQCL 1J1XL 5D6CA 4HDIA 4PTUB 1RZ8A 2LTQB 4BKLB 1B4JH 1GGUA 3L7EB 2W0KA 1ZXQA 2XOTA 5IGXH 1FN4A 4P5TC 4NN5C 5CZVH 9CGTA 2IANE 1A3RL 4LPWA 5C6WH 1XAUA 1R5VA 4ODXA 1QQDA 5E8EA 4JFDE 3QWQB 3FHAA 3H7BB 3OKMA 2EDXA 4GH7B 4R0LC 1QSFA 1PKOA 1LP9F 1W2KT 4ZODA 3CDGA 4APQB 1BZQK 2X4TA 3T2QA 3V6FB 4N0YH 1DLFH 3WIIL 5EU4A 3ES6A 2XICA 5IFHH 2JB5L 5C8JB 3IDJB 1I3GH 3S5LA 2I60H 3CVIL 3DURA 1DQDL 1S7SB 1D5ZA 4FNLH 4IOIB 2NZ9C 1GC1H 2FLRT 3OGOE 5I8KL 4ZNEE 3HUJA 1CDCA 2E8ZA 3JWDH 3KR3L 4M02A 3DURB 3FL7A 5EZIH 5ALCH 5GZOD 4FQJL 3U1SH 1LO5B 1YMMB 3H0TA 4TUKL 2HLFD 1ZHLB 1FORH 4XX1G 3B9AA 3IFOA 3CSGA 4OIIH 3QH3B 4XH2A 1OM3L 3ZE1F 3QXAA 1KJVB 2F54D 3V0WL 3HZYA 1U8MA 5T3ZH 4JQIH 2FX8H 3H42L 2DD8L 5HTSA 3B9DA 3V5HA 5TPWH 5JIIA 3QEQB 1U58A 3SOBL 1R3IL 4PP2A 4AJ0A 3B3IA 3ETBF 4O58H 4M6ML 1GSMA 3SHSA 4M6MH 4AG4L 1A3QA 4MAYB 4PJ9C 3WNLA 1R3HA 1HHHA 4AIZB 4GXUN 3BWUC 2E3VA 3JVGA 3WE6A 5IJVB 4JKLA 8FABB 3KPRE 3SCMD 1CN4A 2VDKL 4PJEF 3MV8A 4PJHB 1C1EH 3CFCH 5BVPL 4TNVK 4U0RC 2XKSA 4QY8A 2DMCA 4Y16D 2J6EL 5ACLA 2BVOB 1T6WA 1OOAA 2VXQH 2PXYA 4S1SH 4Z95H 4XP5H 5EUOB 4PJAE 5HHOD 3QI9C 1CFSB 1I3VA 2A73B 3P30L 1NAMH 2FATL 4X6BA 4KMLB 2C3VB 4JKPL 3W0WB 3BD3A 4C56B 4P4KD 4PTTA 4YK4C 4ZXBC 4I5BA 4OLZH 3PP4L 1UFUA 1NFDB 2V2XA 5DFVC 5C09E 5I66B 2EDWA 3T1WA 5J56B 1FNEA 1IQWH 1A6AA 4YC2B 1FH5H 5D7JC 4PR5A 1CGSL 4Z6AT 3UO1H 4ZSOB 4ODVL 1IBGH 3QUYA 3NVQA 4G7VH 2VOTA 4QTHB 2FB4L 4JDZA 4L8DA 2Z9TA 1ERNA 3E6HA 5IP4A 3P0YH 3U0TA 4Z7WF 1SMOA 3LCYA 4N8CL 5DRWA 4ORGA 1WZ1L 3ARUA 4LIQH 2OL3A 1XGYH 3MUZ1 3ULVE 1YNLH 4MDIA 2VZSA 5BW7A 5IHZB 1FPTL 4L9LC 4GKOA 3MA9H 3ZE0F 4BK5A 1A0QL 4MJ6B 5JORA 3KPRA 1QR1B 4Y16B 4X98A 1Z0MA 3GMRB 1BREA 4ZQKA 4JZOB 4LQFL 1R5WB 4MVBD 5IBUG 5I1JH 3P11L 4OZFB 3EJJX 3ZMRA 3GHEL 3THMH 4UQ2B 1W0VB 4ZXBD 2CDEB 1FZKB 5DK3A 1A2YB 5DT1L 1V3KA 5EOQL 4DGVL 4PJAA 3F5WA 4Z78A 5I8CA 3KLAB 1D5ZB 3U4BH 4G42B 1FGVL 2OMNA 3SDDB 2JB5H 4GLRH 1WSST 2XV6B 1CLCA 4AM0B 2ED8A 2Y9RT 4K9EC 4Z7UE 3SPVB 5D96C 3VG0H 1IAOB 3TYFA 3C8HA 1NCUA 1U8PB 4GSDH 4M1GH 3WEXB 2DQGL 2DDQH 2JJWA 3L1OH 1FLTX 5HYJD 2ICEB 3VH8G 3QEHA 1A1NA 1RURH 2HG5A 3FFDA 1AIFB 2JJTA 5CEZE 3TC9A 2CXGA 3VFRB 1FNGB 1EH9A 4OI7A 4HKXB 4L9DA 4HUUA 4Y1AB 2P4AB 1IM3B 2NLJA 4GG8B 2B4CL 4PREB 1I9JH 4R2GD 1W8OA 2KBGA 4O9HL 4HK0B 1MCFA 4PGBB 4HXBH 5DUPH 4OZ4A 3TJHC 1NFDF 4JPWL 5HGHA 4ORZC 1WWAX 1TJHL 2ZOLA 4XAWL 1FGVH 4LF3B 3T04D 4EQ2A 1B90A 4OI9A 4LDEB 5ACMA 3BPNB 2EC8A 4XI5D 1LDPH 4QHKJ 1ULVA 2E9WA 3BI9X 4DKEL 5EULV 3MJGX 3P0VL 5TH2B 3QUYB 3WFCH 4C58B 1RK0B 4LVOC 4PRNA 5IVXA 4WWKD 4HPOL 5EBWB 5GIRB 2W38A 5KS9F 2LAAA 3O6FB 4KI5C 3RPKA 3BZEB 1DQJB 1PYWB 4HWZB 1MCWW 2VXVH 4U6XB 1RIUL 1QFHA 2NR6D 1RK0A 2HFGH 2FZ3A 4OD2A 1WAAA 1ZHNA 4PP1C 2ZSWB 1CS6A 1MLBA 1EO8H 5GGSB 3VFPB 4OLZL 3W11C 5F7YC 2XQBH 1JIBA 3SGJA 1JHLL 1MCHA 4DKFL 4Y1AD 1I9RL 4D94A 4U1IB 4PJCF 3LDBB 4XP1H 4XGZB 3ET9F 1FVEA 3N9GL 4MQXC 3T2OA 3D0VB 4LHUA 1KCUH 4CMHB 4LCYA 1WJ3A 5K9OB 2FB4H 3HZVA 1MVUA 1C12B 4CAGA 4XPBH 4RWYH 2C4XA 4Z77B 1HHIB 3BPOC 1IGYA 4P4KC 1U92A 5BXFA 1XH3A 3HMXL 4MHHI 1E4KA 4XMPH 4XPFL 4IRSA 5C0DB 1DUYB 5F7DA 5JQ6H 4LASL 1EEZB 4KVNH 2EEBA 3O2VL 1PLGH 1OP3K 4NO3B 3EYVA 5DR5L 3ZT7A 2AEQL 5KW9H 1UKTA 1WFOA 1ADQA 1T3FA 3H3PL 3IXAA 1BOGA 4HGMA 2NX5A 3ZHKA 1AIFA 1DJSA 1IGJA 2CQVA 3FFDB 3P30H 4L8SA 4WW2B 4KZDH 1FFRA 4Y5XB 1EFXB 1ETZB 6FABL 3C8KB 5CD3A 4QNPE 4A2MA 5KVEL 1F11A 1XIWA 4QRTB 1VFOA 4ZO6A 1MCRA 5I8KH 3TIEB 4H1LG 3BHBA 4JFQB 3C8KA 1A6ZA 2BP3A 5I8EA 1UCBL 5IMLA 3SCMA 4FZEH 2D4DA 2XKNB 4PD4J 2NY4C 2MQCA 1PEZA 5IB3A 1S9KC 4MCYB 5GGVH 1H5BB 4XPGL 5SX4I 1WCBB 4J3VA 4OIAA 3EYQD 1N8ZB 1X9QA 4F33B 1KN2H 5HYQA 1JGVH 4LCUA 1YECL 2KH2B 1H0DB 3SGKC 3SOBH 4I48B 2HT2D 3BE1H 4GAYA 1KTLB 3GMPA 5DJ0A 2MJWA 4PY7B 1QA9A 3BXNA 4YO0A 1T1YB 2CK0L 2YBRA 5E94A 1BWWA 2BXYA 3VE0A 2NY1B 5GRVL 4Y2DB 3U7WL 4YHMH 1AGDA 3GMMA 1TJIH 4P4KA 1IGIL 5B39A 4LIQE 4NNPH 1FBIH 3ZKND 1YZZA 5E8DL 4PJXB 2DQJL 2OR8A 2WBJB 3T08A 4AH2B 2D7PA 2FEEI 5DQ9A 1CI5A 5HVWA 4RA0C 1YPZF 4NBXB 1DN0B 2ZNWA 4XWGH 1FAIL 4UBDC 5HY9A 4KVCH 3B4NA 2CGRL 2DLIA 2WIIB 2G2RA 2CGRH 2R8SL 2F8VA 1FFPA 2CSPA 4GMSL 4EI5B 2AP2A 2MOVA 5DD0H 5GRXG 5D71L 3UC0H 4IHOB 3W2DH 3BSZH 4U1SA 3BIBX 4DUVA 3KG5A 2NY4B 3SGDH 4YNYB 3SQOH 5J1TC 1ZSDA 2R1WB 1I3UA 3CZFA 3F7YB 2WAHA 4P3WA 3BO8B 4LVEA 5GJSL 1U2HA 1D9KC 4M1CD 4JJ5A 3DO7A 4XNXH 4APQC 4ISVB 5KANI 4P23A 2OJZH 3WLWD 4EI5A 5TDPB 2VZ1A 3QPQD 4P57A 4P9ML 1X4XA 3B9KD 3MFGB 4K23L 2PO6B 4UI2A 4JE4B 4OLWL 3M1BA 5AD0B 4WIQA 5HI5C 2X4QB 3VFMA 5FF6B 1JNHB 5D8JH 3MBXH 5BV7C 2RCSH 1N7ML 1T03L 4M7ZB 1CL7I 5FYLE 1T66C 4D0BA 1QACA 5CINH 3HCVA 3QUYD 4MSWB 3I6GA 4QLRA 1NANH 4GG6A 2ZP0T 4MGXA 3QFJE 4JDVB 3CH1A 3V6BR 3RGVA 5CILH 4OF3A 2YRPA 4LKXB 4Y4FA 3BSZL 1F5WA 1G6RA 2FX7H 1OSZA 5T3XH 4BK4A 5E2WL 4XCNA 4GAYB 4NBZB 1NL0H 1OTSD 3A6CL 2NYYC 3S36L 1LO5A 4UMGA 2R4RL 5FYJH 5KS9A 3SKMB 1QTYT 4JZJB 4HH8A 4ODSH 1ORSB 3ISWA 4YBQD 3LQZB 4XMLL 2RHEA 1FG2B 2DKMA 3IKKA 3QPXL 3ZKQD 5C92A 2VXTL 2ZOKB 4WFHD 3IFLL 3QUZB 2EXWC 3MUGB 2EIDA 1IGFH 5SWZE 1OTUC 4JKMA 4R8WL 5ENWB 1MQ8A 5TE4H 1MLCA 3RDTA 3PWPD 1OP3H 2MPAH 2VQUA 4X5WA 5D5MA 5J1AB 1S7VA 4HULB 3RFZC 1VEPA 2NXZD 1U8OB 3U6RA 1ZA3B 5F9WC 1RJZA 1RZFH 3MNZA 4HGKC 4ZTOH 4NHCL 3LV3A 1UZ6F 2PO6D 4OUUA 3GI9L 1VKXB 1U2CA 5FHBL 2ATKA 5IFAH 2B7DT 4JQXC 1YNKH 4MZ3A 4Z7WA 1SY6H 4EXKA 1MCJA 2RFXB 1P5VA 4E5XA 1XIWC 3FQNA 3HC4L 4YFLF 1MFBL 3OAUH 1BJMA 3C09B 4MA1B 3T65A 5IIEA 3X3FH 3OKEA 5F7DB 4NBYB 4M5YL 3S6CA 4HT1L 4PPTA 5GS0L 1A6PA 1YN6B 2AABL 3SJVE 3RVWD 3JTTA 2C3WA 1Z9OA 4L8SC 3P0VH 2E6JA 2GITB 5DMJB 3LRSB 1KN4H 4LLYA 3K3QA 3SDCB 2LTQC 3AREA 4P46D 5E03A 1NCCL 3KPMA 3MUY1 1DTUA 5JDSA 5J3HD 1CT8A 5E2TL 1FGNL 4LSVL 3D9AL 3VFWA 4U1JA 3DGGB 3DO7B 5I1EL 3UTTB 1AGEA 2ADGA 2RBLA 5IB1A 5C2UB 4QT5B 3UTTA 4F9PC 4O58L 5GRWA 3L95A 4C57C 1VEOA 4NDMA 1D5XA 3V9FA 3IKCA 1LE9A 3PWNA 4G6KH 3ZTNH 4U6XA 5FGRA 3MQIA 4JB9L 3M17A 5BRZD 4Y2DD 4Z7NE 1WWBX 4LLYB 2IPKA 4OQ1A 5ICXB 3L3OA 1A7PH 2J1KA 4HPYH 5LXGL 1TVHB 3TO2A 4DZ8B 4MMXC 1FYTA 1RURL 1IFHL 2VLJE 3UDWA 4P2RE 5H35A 3QQ9C 4PJ7A 2X2YA 5HY9B 1XF2B 2MTPA 3LN9A 2JLLA 1A4KB 4N8PA 1YUHA 3LKSB 4G6ML 1FVCA 3TZVC 1R3LB 3DVFA 1AGDB 3GMMB 4P4KB 4AG4H 5L8LB 4UV7H 3KLSA 3SQBA 3WV0A 3C8DA 4JFXA 4KRMB 5TQ0L 2CRYA 2OL3L 5D7JD 1UCTA 1JPTL 3NFNB 3V5HB 4U1MA 3H9SB 5EPMA 3V52H 5JIPA 4P23B 5C6TH 1EEYB 3MO1B 4QHUA 1F42A 1G0DA 4ZS7L 2C4FU 2DM7A 3I50L 4C54A 4WU5A 4JPVL 3D2UB 4I9WD 4MDJB 5GJTL 2A6DB 4NQUA 1G9NL 1RPQA 4OZFG 3MGOB 2OR9L 1JV5B 5CKAA 2X10A 5C0IB 2EH8L 3BOVA 5CMAA 3SDYH 3SKMA 4F15C 1UWEH 1YJDL 1IMHC 3G5ZA 4PRBA 1FZMB 1B4RA 1IZKA 2JCCB 3VMPA 2YKLL 5HGGS 3HPJA 4EUPH 4PGCB 4MJ5B 4HD9A 1E4WH 1FE8L 3F7RA 4LARH 4V1DB 4LARL 2XQBL 4ZAKD 5T5FL 1MJ7H 1MH5B 1RJLA 1BP3B 3SDCA 4U6VH 4OZHF 4I0CC 4ZFGL 4P3CL 3D6GA 2XXMB 4P59L 4ZAKC 1ZEAH 5DD1H 4CDHA 3QNZA 4XP9L 1WFTA 1CR9L 3D39E 3GI8H 5DZOA 4OCMC 5HD8D 1WEJH 3THML 3RWHA 3IDGA 4Q2ZA 4L29B 4JZOA 4OCXH 4IS6A 2D31B 1N2RA 3VFNA 4JCMA 1WZ1H 3C5JA 4M7LL 4P5TD 3AAZB 1YEKH 5CS7A 4W81A 2GFBB 3TCLA 4M61A 4GMSH 3CFBA 4QYOB 1YYML 1IL1A 1IAKB 3ARDB 3JSSA 4DKAA 3JV6B 3RVTD 4OF7A 1XFPA 2HJKA 2JTDA 4XWGL 1INDL 4NQEB 1KPUB 4CADA 1HXMA 4HS3B 2EE6A 4NN7B 4YXKH 5L2KE 5F3BB 2H1PH 3BYTA 3DTXB 2JJSA 4U1SB 4UOJA 1OPGL 1ORSA 5I1HH 2X1QA 2WP3T 3O41B 2WP3O 4BELD 1FRGL 1D3CA 2ADFL 1UXSB 3FONB 3MRMB 3SEPA 1BIIB 3FO1A 4NN6B 4FXLA 1P4BL 5I15L 1OAXH 3O6LL 4M48L 2AJSH 5D7LA 5E8OA 5ETUA 4P2YA 4EKXA 1DN0A 5HDQL 1IGJB 4XPAH 2E6PA 2VABA 3VGEA 5IT2H 4X6BB 1FSKB 4BZ1L 1F6AB 2WBKA 5C0AE 1WIOA 1QEWA 5IMKB 3TF7C 1AC0A 5IB5A 3WXVL 1TETH 2JELL 4L1HA 4I3RL 1P69B 2VZ3A 3KYAA 3RVVC 3DOSA 1A4JA 3LN4A 4U4BA 1OF2A 3T0VA 1FZOA 1S7XA 4F7EB 3WO3B 4GG8A 4PREA 4PP1D 1E0OB 4Y4FC 3MGTA 4M93B 5AD0A 3GSNA 4F7EA 4MNHA 1BLNA 3UTSD 4EOWH 5L2JA 1C1EL 4HAGA 3F6IA 4P57B 3B9KA 1JNNH 4OSUL 2V2TA 4OCSH 5ITFA 3SDAB 3OJMB 3MYJB 3ZYZA 2X70A 5J11B 3LQMA 5DJXA 2EC9U 3O2VH 4NNYA 3PWPE 3IS1X 1RJLB 5F1SA 3L5XH 2C7UB 5FOBB 5IMLB 4S1QH 1RZGB 3NGBB 4M48H 4PRIE 4XPGH 3MRHB 1X6LA 3V95A 2HJLA 5JOPD 5AAMA 4QRSA 3WS3B 4QRTA 4OZHB 4JQIL 5HYSB 3QXAB 3QH3A 4XH2B 4AMKH 2UV3A 4O51B 2OLDA 2Y5EA 1JP5A 4AENB 4KMTL 2BVTA 2PO6C 2E9IA 4KUCD 4PJBE 1OPGH 4OLXL 5DJYA 4GQ9H 2ENSA 4JG1L 1IJ9A 3VXNB 1EEUA 3W9DB 3WHE0 2WWKO 3SGDI 4JHWH 1KPUA 4NQEA 3C6LB 5DTFA 4NQXA 2X42A 1AXSB 4MXWL 1NGQH 3S4SA 3DHMA 2VDPL 4GAGH 4WEMB 1X4ZA 1XGUB 5BZWA 3WJLC 2PR4L 3MFFA 3RKPA 1VB9A 4OIBA 4B0MM 1S7XB 4JQXA 2AEIT 4ELKA 4JM2D 5FEBA 2YMXH 1HQRB 2J6EH 2AXGA 4NZUH 3HR5A 4JFEE 4NZRL 3W9DA 3SKUD 4H1LB 4HZLA 2GEEA 4X7CC 3HE6D 3LIZL 3ZE1E 1NSNL 5I73C 4GRLA 4NQXB 2NY6D 4MA7H 1CXKA 3CAFA 4L8BA 5D1XB 5HYJA 5T3ZD 4X9HA 1UWEL 1YJDH 1V3JA 3ESVF 2MQ3A 3CDYA 1BZ7B 1AXTH 5I66A 5IG7A 4IDLA 3AY4A 3NIDF 3NZHL 2QKIB 1OL0A 2AQ3A 2YRLA 2ZJSL 4MD0A 3ARGB 1Z3GH 4BZ2L 4N0UB 5CEYA 4PJGF 3C9NA 1R24A 3OB0K 5I19H 3EUUA 1A7NH 3TA3D 4G7YL 2ZCHL 3Q3GA 4ZO8A 3DNKA 2YXFA 1NAMB 2ADFH 3FB6A 3MYJA 2FEEL 5TE4L 1WCQA 4G6AC 5HYSG 5DGQA 1N3NB 4ZO7A 5FM4A 3BIKB 3S7GA 2ATPB 3QULB 1AD0B 3MRFA 4PLOB 3RZCB 3SDAA 1OD9A 3WDIA 2EDLA 2IAMB 2ZPKL 2BNRD 5FYKU 1TJGL 3QEQD 4XCEA 2GJ6B 3BD5A 1Q8MA 4S10A 2D31A 4K94H 3WFZA 2AEPL 4WI8A 4FN0A 1RU9L 1TQBB 5KBNC 4UDUB 3MV8E 5LAXB 3I84A 2P47B 1QBAA 1N59A 3OKOB 3IF1A 4I2XE 4RFEB 5GJTH 5FUOH 1HDMA 3PGCA 2Z4QA 2YSSB 1BEYL 4Z0XB 1PGRB 5DMKB 3V79C 3TIDA 1IKNC 3WJLA 3H8NA 3SDCD 2XWJB 1WFNA 2LV4A 3UROR 1I8KA 2BSTA 2R39A 15C8H 1XCQA 3F12B 1KNOB 1H3GA 1U93A 5DJAB 5J06A 3VRJA 1D6EA 1UWXK 1RAMA 2EZ0C 1E6OL 4Q74A 4UV4L 1XCTB 2E9JA 3HZYB 4JY4B 5CJOH 2JIXD 4D3CH 2A38A 4HWEH 3O3EA 2EYTB 3VXUE 1MJ7L 4WTXA 1SEBB 2J5LB 2VB5A 2VLRD 1N26A 2W9DH 2AEWA 1P4LB 3DX9B 1HINL 4TUJB 1KIRB 4K8RD 4UIKH 4LCCC 5EUOA 1NBVL 4WW1B 1HQRA 4YHZH 4W4OC 3BWAA 1AHWC 2ZCHH 3RJDA 1FDLH 2GY5A 2CK0H 3QIBC 4CW1B 2BOBB 4KY1L 1AGFA 4KKNA 3FCTB 5IVOA 4HK0A 3QDGE 1X5GA 1QSFB 2QTEA 5HVHC 4WO4C 4NWUH 2X1XR 1WZLA 4JFPB 2NTFB 2NZIA 4F7PA 1QPPA 1U91B 1VFAA 3A6BH 1CXHA 2BHYA 4M6NH 4QXGH 3O4OC 1MWAA 3VJ6B 1HXYB 4M6NL 4NKDB 5D1QC 5FFLA 4JFPA 1WLHA 4Y4HC 2G5BA 4LSVH 4F2MB 3KNBB 3EJZC 4LASH 1ZA6B 4QXTA 1AO7E 1FV1B 4XNZB 4NO0D 2ENYA 4MX7A 4JM4L 4GW5B 2EDRA 3D25B 3CVHH 1TVHA 3LKQB 3VD4A 5DJ2A 2J2ZA 1E28A 3GSWA 1IEBA 4G5ZL 3R0MA 4ALAH 2V7NB 1MFDH 1T21B 4FQQA 1FNEB 3MV7A 3BW9B 3OXRA 1KTDB 1RZGA 2L7JA 1IBGL 3H9HB 3LKPB 3BDXA 4LLWA 3S96B 4GQPH 4BSWB 4EZMA 1C5CH 5JNYA 2WW8A 1P1ZB 5FB8A 4PGEA 2C1OB 1FFNB 3P9MA 4ZUWB 4XPAL 1QRNA 1MFNA 1EBAA 4OM1H 3QIBD 5HI4C 3R0NA 3T77B 1S78D 5JZ7C 2F74B 4LPVA 3ES6B 5D70H 5E8NB 1DSFH 3ZDZE 4UQ2A 5IWLA 1FFPB 3REWA 4BH7B 4ZS6C 3AMKA 1B6DA 2YD7A 1S78C 2FSEA 2AJ3B 3C60C 1B6UA 3BMWA 4KKAD 5DQ9B 5FYJU 1G7LB 2V9TA 5H2BA 2GUOA 1CE6A 4PRHD 1WVZA 4KAQL 2LU4A 2OS7A 5I71B 1QHPA 3UYRH 3R1GH 3JUZA 2A6KB 2VDOH 2Z92A 2E9BA 3C6SA 1TENA 4KTYA 2NY2B 2BVYA 3EO1B 3IJHA 1RJZB 4GLRI 1MREL 3T1FB 2CR3A 3HE7B 1UQSB 2XZCL 4NQED 1A21A 4PJCE 1GRWA 3QJFB 4LCWD 2HKHH 3DXAA 4LBEA 4MS8D 4KRNA 5F7KC 3AM8A 4WI7A 3CXDH 2QQKL 3UTSA 5IQ7H 1N0XH 1J1OL 1DUZB 2DJUA 3I9GL 4D9QE 4EI6B 5JZ7D 1QBML 2WK2A 3SCMB 3PQYB 4UU9B 1IAII 1AJ7L 4ZG1A 3O4LD 4W68A 3C9NB 4OD3H 5HHXH 4M1GL 1ZGLB 3LRSA 3P4MB 1KLGA 3C60D 4Q6IC 5F88A 1YEFH 5GPRA 4G80B 4IRJD 2H3NA 2ZPKH 4HIJB 4Y4FD 1L6ZA 2HTLC 2IQAB 5L9DL 2LAGB 5MERB 1NMAL 2XACC 4PJFA 4UTBL 2UZIH 4JRXB 5B39G 4YDKH 5HHPB 2YXMA 3JTSA 2JJUA 4IRSB 3CMOH 1KPRA 3MZGB 4FZ8L 4NZUL 5FO8B 1MJUL 4JRXA 1RZKL 1KJ3H 4JN1L 1FBIL 1EAPB 3QFDB 3WIFB 4TTGA 4KK6C 3TJEH 1P2CB 1YEGL 1C12A 3QUYC 3FN9A 1RSFA 1CICD 2EE2A 4HUVA 1BQUA 5J1SC 3LPGA 4CW1A 3TT1H 2ADIB 3W39B 1EERB 1SEQL 3PWPA 3PDDA 5FA3A 3B5TA 1PG7H 1AXSA 1YYLL 3HI6H 5F9DC 4HKBA 3LKOB 4OGAD 3SDAD 5K9JL 4BUHA 1IGMH 5FDWA 1VPOH 3H9SE 5C0GB 2OTUB 3UJJH 2NCMA 4LLQB 2X44D 2HMID 3K4ZA 4LNVA 1UB6A 2QADD 5GJSH 2QQLH 5CEXA 3TVMA 3IFPA 4P5MB 5TQ2L 2I9LB 1G6RH 1FH5L 4MJ2A 3TZVD 4M43L 4RAVA 2NY7H 4IRJB 1UA6L 2OXHA 2XQYK 4IDJH 2XY1A 2HN7A 2IWGA 5DRZB 1NPUA 5EUOF 2W91A 4NM8H 2AK4B 1DVFD 5C0BE 1VGKA 4XPFH 4HV8A 5JO5A 5C08B 2K7PA 3KYOA 1TZHB 4O2EA 2R4SH 35C8H 5TDOA 1CD1B 1ND0A 3ZE2F 1MF2L 4LLDA 3WIHH 5HGHB 3ARVA 5FDYA 1DDHA 4M6AA 3V8CA 3MLTA 4O2FB 2A9ML 1UJ3B 1DCLA 1T83A 1C16B 1S7RB 2W1NA 3G6JF 2OK0H 4PJ8A 2DKUA 2HTKC 2HA1A 2DLFH 2V5SA 2PF6A 4PBVC 1EMTH 4DGIH 1BBDH 1NJ9B 2NY5C 3T4YB 3GMPB 3ARGD 2AXFA 1NC2B 5D7JB 3IKCB 3MX0A 4QWWC 2WIMA 3TWCL 1N3NA 5JHDA 4M5ZL 4XCCH 1U95A 3LY6A 4QCIB 3OXSA 3L95B 3MJ8A 3VFUB 4S1DD 5F1OB 4X8JB 4E42A 4GW4A 4L8CA 1VACB 4UOW0 4Y16C 2XKNA 5IM7B 2GCYB 2VL5B 3UYPA 5C9KA 4NOFA 3QUMA 5I1DA 4OLVL 3VXSB 1AR1C 3GKWL 3UPRA 2JJVA 4R7DA 4JFDD 1LO0H 2ARJA 5J13B 1DANT 2ICCA 3DYMA 3TVMB 1EAJA 4TOYL 5JUEH 4ODVH 4DEPC 5ANMA 3EDDA 1U8JB 4AMKL 2RCSL 1E4XH 2BY3A 5E56A 3S5LG 2H8PB 5EU6A 1J1XH 5ESQA 4GKNB 3LKOA 4NP4H 2E8YA 2XQYG 4MLIA 5B39B 1Q94B 4G6AD 5EZOL 3UTTD 1FL5A 4FXKB 4U1HA 4O4YL 2GYSA 3G9VA 2HMIC 3QAZC 5D1QA 3W39A 2FH6A 2A0LD 4KRLB 5C0AA 1IC7L 2QSQA 4YHNA 5ABDE 1XGTB 1AGFB 4YIQB 1IARB 3O3BA 5C0AB 3KDMB 3ZHDA 3T8XB 4JM2C 2DL2A 4Y7MA 3TBSB 2YHGA 4OM0H 5DD5H 3BWAB 2HH0H 5DXWA 4MWFA 5E9DE 4OIIL 1OM3H 1OGTA 4XPTH 3VI4F 3QIBA 4Z9KB 4X9FA 4KI1A 1KIRA 3G6AA 1GL4B 2HKHL 3O2DA 1AQDA 4LSRL 2I27N 4RAUA 2ICEA 3K1DA 1U41A 3L3HA 3PGFH 4ZTPH 4J7RA 5E95B 1MCLA 3RQ3A 1NDMA 5ELIA 4FFZL 1F11B 2A6IA 3NPSC 1JPSL 1U6AL 4Q9RL 5C3LD 3QO0B 4QF1B 3UTPE 2CJUH 1OAZL 4HIIA 4CVZB 2LABA 1MI5B 4NO0A 3U9UA 4ODTH 4PRHA 4P2OC 1W72A 3HC3H 3UJIH 1HYSC 5DQDL 3WNMA 5D72L 3RWGA 3Q2CA 4JEGB 1ADQH 5HPOA 4W6WB 1SJEA 3V6OA 4H8WH 4IM8A 4KI5D 5CINL 2IH1A 3KLHC 4X8JA 1AGBB 1KJMB 1LK2A 1B4JL 1I7TA 1WC7A 2OM5A 3QG7L 1SJHA 3G6DL 4UINL 5MENA 3MRNB 1RI8A 1G7IB 1BJ1H 5F1KC 1EEYA 3ZE0E 2YA1A 2VXUL 3DXAD 4Z77A 5FUOL 3KPRB 4OFKA 1QR1A 2B1HH 2YD4A 4WEBL 5IJKA 2GSIA 1SMAA 4CU6A 5BZDA 5HBBA 4YHNB 1ED3B 2Z93A 4NIKB 3U36B 5TQ0H 3HMXA 2IPTL 1I8MB 3GSQB 4ZUVA 3NZ8B 2C3GA 1K2DB 5EA0L 4YXLL 5K9OA 4YEFA 2GJZA 2QADB 1IKFL 4XP4L 1HI6A 5B21A 5A40E 3KYKL 3ULUD 1JF5A 3REVB 3LEYL 2VH5L 4IRJA 3LOWA 2KZWA 3MA7B 2Q8BH 3HC3L 3UJIL 4YK4B 3MRBA 3G6JB 1A14H 4UILL 1XF5A 1UB6B 1J88A 2FECL 1LEIB 2EDFA 4KROD 2DKSA 3PGFL 4ZTPL 1MFAH 4RIRB 1QYGL 3EO0B 1U3YA 2MKWA 1CDUA 3VI3E 4HF5L 5ID1A 4KXZI 3W9EB 4G6MH 3QXWA 4PBXA 3PWJB 5E8DH 3TA3B 2IJ0C 5FUZL 5E4IA 1CICA 3EJYC 4WFFE 1CDJA 4WUUD 3QNXB 1T4KA 2GFBA 5FCUH 3SJVB 3N1QC 1TTFA 5DT1H 2ESVA 5DK0A 3O0RL 3DHJA 4GAJL 2BNQB 2EYSB 3D1MC 2PKDA 3WJJA 4IS6B 1BQLL 3RIFK 1NBZB 1EA9C 3D85B 1AI1H 4EUPA 1CFQB 3OAZK 2BZDA 2BVUA 1XZ0A 1S7QB 1SVCP 4FQCL 4LFHG 5D6DC 4OCYH 4F33A 5C07E 3BKYH 2BNUB 1E6OH 3CU7A 5BRZE 1NCNA 3MJ9H 2UY6A 5EU6B 3T3ME 2IH1B 2DN7A 3RJQB 3U2SA 4J4PA 4NJAH 1CIUA 1FGNH 1ZT4B 3EYSH 2QADC 3IDUA 3WLBB 4H0IA 1I8IA 5C86A 2QEJA 5AZ2H 5L0QB 3TV3L 2X6MA 3L3GA 4JFFA 5IMMB 5I6XB 4GW1A 1MCOH 4LEXH 3T09A 1FZMA 1FHGA 4KJQC 4PJBB 3HE7D 3QFJB 4PY8I 3QUMB 5T3ZE 4HIIB 1U8HB 3DX9A 4XVUC 4WCYL 2KQMA 2C3VA 4JB9H 4JM2A 3HNSL 1U36A 3G04A 2RB8A 3LB6C 4K07A 5ILTL 4PLKC 4KPHH 2BNQD 1W0WA 4BFIB 4TSAL 4WNQA 4IDJL 4LAQH 4OCXL 3GMLA 4K7PL 3D3VB 5EORL 1MAMH 1R3KB 5C0BB 1IGYB 4J1UB 1YPZB 4JFXB 3RL1B 5EB9A 2A6KA 3GB7B 3RGVB 3RWDA 4FG6C 1YMHB 3MPCA 3QHZL 2VXSL 3ULVD 1QQDB 3RWCB 1KCLA 2D4FA 4HBCL 1JWMB 5LGJA 5IQ9B 4WI2A 4TNWK 3G08A 1T2QL 5INDB 5ALCL 2ARWA 1DVFA 1ZLWK 3JZ7A 1CDYA 3QZWG 4FMKA 4ODSL 1G6VK 2LVCA 3E6HB 2JCCE 4NWTL 4XI5C 2IAMC 5IF0B 4HW6A 2KZ1B 3DRQB 3CVHA 1RJYA 1GCFA 1QRNB 4JO1L 1LE9B 4RNRB 5DMGD 3UJJL 1B0RB 1J5OH 5D2LA 2E5EA 2WBJD 1UEMA 1QLEL 3BP4B 1MPAL 3D18B 3UX9B 3MLSL 3DWTA 3LVEA 4GRLD 3F65A 4PGEB 5MEOA 3BW9A 5J12B 3IAQA 1I1FA 1AR1D 1NUFA 2A9NL 4EEEA 2NXZC 3ARTA 3VWKB 3ARDA 4TQEL 3VFWB 1NMBL 3FQTB 3BPCB 5DJZB 1KBGL 1T5XB 4MXQC 4TTDC 1T2QH 2GY7B 4NP4L 4QRPD 4WUUE 1T2XA 3H7LA 1XIWD 5F7MC 1KCRL 4UAOC 2CRMA 5I1LA 5HDOA 2QLVB 2K1MA 5EZLA 1JZ4A 2HAZA 4BQBA 1ZE3C 1XZ0B 5IB4A 2AAVA 5EZLB 5L2KB 4DKEH 2W0LA 3QRGL 1KEML 3AUVA 3RWJA 1G7LA 3CXDL 3MNZB 1ZA3A 5D6CB 5SWSE 2BVPA 3E6FB 4GRMA 4YFDB 5E9DB 2YD5A 4PJBF 2E7CA 3BUYB 5TF0A 3GMLB 5JIKA 5B38G 4YUEL 3RY6A 4CMHC 2F54E 2KPNA 2OR7A 4AM0A 4NKIL 2V9QA 5I1CL 3ZYOA 2JCCA 3MCLL 4Q6IA 1QVOA 1XF3B 3MLZH 2YR3A 5CHNA 2NTSP 5I2IA 5MEND 1HHJA 4CU7A 4EI6A 4DAGL 1BJ8A 4ZD3L 1RD6A 5D2LB 3Q1SL 4U6TA 2NXZB 5CUSL 4GKSB 5E2UL 1MIMH 2LU3A 2EIZB 4NRZA 3HA0A 4DKDC 1IEBB 4WU7B 4ONFL 1E27B 3SJVD 4Y5YA 3NA9H 4Y4FB 2C5DC 1GOHA 2UY7A 3H7BA 3KWWA 4FFWC 4XCNB 4JDVA 1CE1H 4ZFFA 4DW2L 5J57B 3NA4A 1L7IH 1HCVA 4QRRE 4D0BB 5ITBL 1CDIA 1J05A 3K4AA 4XWOD 4JVPA 5DRWB 2E7MA 3HAEH 4PLJD 5ITFB 3RWFB 2YA0A 5DR5H 5FYLH 3RI5F 3N50A 2P7TA 4URTB 4L8DB 1LE5B 2RJMA 4M7JL 4QXWA 5DI8A 4LRNH 3AMLA 5LCVH 4LLVA 5I71C 4JZNA 5F1IA 5J11C 1C08A 1BF2A 1UH3A 2BY0A 4HMEA 4OD1L 5E6ID 4XNYL 4Q9CA 4HWEL 5JW5B 1JNJA 3SE4C 1CQYA 1HHKB 3IYLW 4MJID 4WGWB 5HXMA 1BVKA 1J87A 4YNYA 2LQRA 4RA3A 3N9GH 5GS0D 4L1DA 3RTQB 1PKQA 2ESVD 4U0RB 2JK5B 1WZMA 4RNRA 1SEBA 3CLEL 1Y6NR 5D7LB 4I3GA 1BX2A 3BDYL 4JO4L 4YXHL 1NGQL 1MRCH 4YXHH 4KPHL 4C56E 5B3JF 5EBLB 3LKNB 3I02B 4LSPL 4HK3N 4H88L 3CUPB 1QSZA 4WFED 4PJ5B 4GRWB 5IHBA 2DS4A 4NO2B 4PG9B 3VXPA 4MXVF 1WT5A 4P2OD 3O8XB 1R5IA 1T7ZA 2E7BA 3O0RH 4PY8J 5I75C 3QDJB 4RAUB 2AEPH 3HRPA 1G7JA 2EDNA 5ID0A 3P4NB 5MENE 3W11D 5IR1A 3QUKB 3I3EA 2NY4D 5I16B 4X4XB 2DQTH 2JB6A 4K3DL 1CXIA 5AUMB 5LAXA 3CFBB 4LSQL 1BAFH 3HR5B 4XAWH 5EIIA 3MJ9L 5EU3B 4JANA 4PP2B 4J23A 1RVFL 2DM3A 3ZDXF 1S7TB 1KIQA 4HGWA 3DX8A 4Q9QL 1E27A 5JQ6L 2Q8AL 4PJIB 1G1YA 1FIEA 3T0WA 2WWMD 2X9YA 3SKOB 1XR8B 1HWGB 3BIKA 1O7VA 3KYKH 3MV9A 5C0EA 4EUPG 1XGRB 1AGBA 1KJMA 2VH5H 5D71H 1VPOL 1KCVL 3FQXB 3FTGB 4JREB 3GK8H 4MCYA 1Z2KA 2DBLL 1MCNA 4HKZB 4L4TB 3WKML 4KTDL 3RX8A 4MA8H 4JFFB 4LOUD 5C9JB 3GSNH 2G75A 3H9SD 1E4WL 1FE8H 2DTML 1TJGH 4UINH 3BUYA 1BBJA 2WUCL 4LCWA 5J4MA 3LZFL 4X8XA 1MSPA 2F58L 3PABB 3JV0A 3GO1H 3OBAA 4NT6B 3SE8L 1NFIA 1WZKA 4PLNC 1EEZA 3ULSB 3I85A 3O9WB 3I75B 3F6LA 1T20A 4K7PH 2EC9T 4Z7QE 5BO1L 1U91A 4YAQA 1UWGL 5CBAB 2N7AA 3H9YA 3QNYA 2OX5A 3MXWH 3I2CH 3OJDA 4HEPG 4RBPH 2DQTL 4N0FB 5E00A 2AGJH 3QUXC 4LCYB 3LH2H 3LN5B 5BRZA 3TBVB 2CDFA 3D48R 3FOMB 3LN4B 5E4EB 4DK3A 4YZFF 3ROLB 5E2TH 1MHCA 3QUKA 4WO4D 5GZOC 1UYWH 4ONOA 3DMMA 4M93C 4U33A 5FUCC 1IC5L 3NCYP 1LEIA 1HWHB 4MA3B 2MQ0A 2VN7A 3PP4H 2P49B 4QRPA 5FV1L 3Q6GH 3E8UL 4ACPA 1MJ8H 2PW2A 5FGBC 3CX2A 4F7TA 1DVFC 4WDIA 1EFQA 4M4RA 3WS6A 5HYSA 2FHCA 3DVNA 5D2NE 1JWUB 2EDQA 5J8OA 4K9EL 4X6FA 4ELMB 2YPLB 4I2XB 4JRWA 2OL3H 2ITCA 5DA0B 1MCEA 5D1XA 1ZTXH 2CIIB 4TVPH 3PHQA 3I6KB 4JFZL 3HLAB 1AI1L 5CJ5A 5IV2A 4XHJC 4WV1C 4U1JB 3JWNC 1WAAF 4JHWL 4KJWD 2WBJA 1MWAL 5ADOH 1IGIH 4Z7OF 1HH6B 4S0TD 1LO4L 1I1AB 1BGXH 4M5ZH 1N6QL 2PYED 1LMKA 3LRGA 4LVOB 4Y2DA 5FYLL 1YQVH 1U3JA 1YEIL 1I8MA 2BVOA 3R8QA 5D7SH 5FKPB 2NW3A 4QO1A 3LB6D 1NCAL 4EVNA 2VO5A 1T7YA 4MQ7B 5GGVY 4ZAKA 2OTWB 2CO6B 5ECJE 1GZPB 3DGCR 5IJVA 2BJML 1OTTC 3VGAC 4FA8A 1G7PA 3TO4A 1AD0A 5DS8A 3FQNB 5F21B 25C8H 3ULSA 4B50A 4Z7WB 3LEXA 4QHLB 2OZ4H 2GTWA 3ZKSD 3NIGE 1CLZL 5GGSY 1QRKA 3TYFB 3VDBA 2DQUL 5EZJB 4WFFD 3QQ9D 5GS2D 3OWEA 1U42A 1MUJA 1T1XA 5DHYA 2XZZA 3VXMD 4PJAB 4F9PA 4NC0B 1MWAH 4P99A 2OXGA 3BQUC 4Y5XA 2D7NA 1A7PL 5A16B 5FUCE 1AD9B 3Q1SH 4RX4D 5C09D 4K94L 4XP1L 3UP1A 4GS7B 3DUUB 1VSCA 2AEQH 2HFEB 5KW9L 4J8RA 3WSQH 4ZNCD 1XF3A 2X70B 3IDNA 5I17A 3EYVB 3QDAA 5F9OL 4R4FH 3RUGB 3HNSH 2X4UA 4KZDL 1LK3H 2WBJC 4NQDD 4PJFE 1OTUD 1JGDB 3WYRA 3CDGB 4B7IA 5GRUH 3V0VB 4AK1A 5F7WC 1G6RB 1S9WA 1N5AA 3LKRA 2IFFH 1CL7L 2XYCA 1IGCL 4Z95L 1MHPL 3FZUC 1Z9SA 4YJZL 2Y4SA 4GXVL 4O2CB 2XPGB 4AQOA 3HCVB 2EZ0D 2VAAB 3JTSB 5CKGA 2BNRE 3QDGA 4FTVB 3HLAA 4W4OA 1NDGB 2SEBA 4JR9L 1INDH 4TSBH 1NGYA 1OWRM 3EHBC 2VKWA 5C0AD 3V4VL 4KZEL 3BN9D 1X6NA 3KXFB 4KZEH 1Q9WB 5F7UA 1KT2A 4S2SA 2QR0B 3DI2B 5EO9A 2H26A 4P2QD 2VXVL 2R2HA 4ODWA 3CFJB 2JCCF 4M7LT 3RTQC 5EOCJ 1ZGLA 1D9KB 5FHBH 3PWVB 2PYFB 4LHQB 5TPWL 3CPLB 4KC3B 1T0MB 1LD9B 5KSBE 4MVBC 4RGMB 1CZ8L 3MJ8B 5FA4A 1RUAL 1JGEA 2UZIL 1MIML 3GO1L 4U2ZA 4GW4B 2UUDK 3NIFF 2IAMD 2Y72A 4MDJA 2V7NA 5DD1L 2YUZA 3NZ8A 3CFIC 3B6SA 1FIGH 3GEWB 2AJXL 4OLYH 3VD3A 2A74A 2Z93B 4QY8B 4YR6B 4NN7C 1MY7A 2EIEA 2H26B 5C1MB 5D1ZB 5EZOH 1FLRH 3DVGB 3MRIB 2PXYB 5DZLA 3RZCC 1W8NA 4I0PC 3C6SB 43C9A 1YY8A 5T1KA 4OBSA 3T65B 3ECBB 1J8HB 3SY0A 4YUEH 5AEAA 4P2OA 2ZSVB 4O2EB 5DLMH 2BC4B 5GRUL 3GSVA 3TBYA 1TZIA 2D3VA 4Z7VE 2Y36H 2HN7B 2VR9A 2Y36L 1OLLA 2AJ3A 3AS2A 2Q8AH 1AFVH 3DUSB 4HV8B 5JO5B 2HVKB 1VGKB 3DETD 4OM1L 4J1UA 3FRPA 4WI5A 1J86A 4RMQA 1BWMA 1CG9B 1G9ML 1GYAA 3PWNB 5IB2B 5C7XH 5GRVK 3VFOA 4QF1A 1YMMA 3H0TB 4ZMAT 2VZUA 4ZFGH 2YD6A 5KSAC 3UTPD 1NFKA 4OTXL 3FQWB 2BCKA 5DD6B 3N85L 2D9CA 4LSDA 4LVHC 2OR9H 5F3HB 3BEVB 4FQIL 4UU9A 4GBXB 1BM3L 4KDVA 5F89B 2FJHA 3GFUA 1YNTB 5D5MF 2BOCB 5DD6A 2Y6SC 1A1OB 4E41A 3DV4B 4Q97A 3DBXA 2YRZA 2R56H 3DJ9A 3S88H 2HT2C 5KSBA 1INQB 3QJFA 3FN0H 4LGPB 2H32A 5IMMA 1TZGH 3BPOB 3MNWA 3QFDA 5GSRA 4PJHF 5IMOA 4KDTA 4WENB 3CJJA 1P4IH 5C07B 4PB9H 4K7FA 4XNMB 1XEDA 1M71A 1Y18A 3Q6FB 4L5FH 4QRQA 2R8SH 1FVCB 1UM6L 2BERA 1Y18B 3A6BL 3TPUB 1GZPA 4O5LL 5KG9B 4OCYL 4CVXA 4KK6D 3DMMC 2VDOL 2ATKB 1QFWM 1U8JA 1Q0XH 3GJFB 1R5IB 4JFOA 2P5WD 2A74B 1VADA 3QUMH 2Q7YB 3VFSB 3QUML 4ZD3H 4Z7VA 4J3SA 1ACYH 1NCWL 4N1EA 4DN3L 4PR5B 1ACYL 1NCWH 4DN3H 4HKJB 3SE3A 3PV6B 3EYSL 3V8OA 3D0LB 3F58H 1ZSDB 4X6CE 1CXEA 3QCTH 5I1CH 3P4LA 5HVGB 4F80A 1HCFX 3FOLA 3CC5B 3D5OF 3EDJA 1TTGA 3VXRE 2R69H 4RAHA 1L7IL 5DD3H 5KVFH 1BFOB 2EECA 3KPPA 1UQSA 5E7BA 4WHYH 2A6DA 4KY1H 3CLEH 5D9SB 3DXAB 1RZKH 3BP7A 3J7HA 4LOUC 5EUKA 4Y5VB 2IC2A 4HIEA 3CVHB 3NFPA 1RUMH 4OCWH 2R2HB 4ZFOA 4HQQL 2HFFA 3S88L 3BESR 5KS9E 1V3LA 1CFTA 1MCPH 3TN0B 3WMSA 1N7MH 2AK4D 4XVJH 2VJXA 5J7CC 1S7WA 2UVEA 4U49A 3FQUA 1HXYA 3RTQD 1AE6H 4NCC1 4KHTL 3L5XL 1M71B 3C2SA 3PHSA 2YBRB 4UT9H 5F6IC 5FF6A 2CLZB 4QHMA 2GJ6A 1FL6B 1OWWA 3KWWB 1H0DA 4DVBB 3A6CH 4UILH 1JNNL 4OGYH 1U8MB 3UBXB 1QA9B 3BP5A 5DJ0B 1R3JB 1ZT7B 3EFDH 3M17B 3NTCL 1QSVA 1GAFH 1IAIH 3O9WA 2HJFB 2VDLL 4DVRL 3CDCA 2NQCA 5JNYB 3CZFB 4NOBA 4KJPC 5IEKB 2W59A 2ZUQC 3QIWC 1KXTB 1Y0LB 3CPLA 4G7YH 4NUGL 4DUWA 4WI3A 4HK3J 3KJ4B 2OCFD 2R0WL 1KB5H 1HKFA 4NC1E 43CAB 3ZTJH 5T3XD 4R96A 4YBLB 2CLVA 1YNLL 1FC1A 2NNAA 5DFVD 2B1HL 3B5HA 3V4UL 1RHFA 4XBGB 3BH9B 2BSTB 4GRMB 1UA6H 3QWOB 2MMXA 5EO1B 1PW3A 2VXSH 3KPOA 4IRSC 5KVGL 3MODH 4PV9A 4R0LA 1UB5B 5IW6A 4CBPA 1ZGLP 4YDKL 2R2BA 12E8H 2COQA 4PJDA 4RX4A 5IBLC 5C09A 4QRRD 3SY0B 5AWNL 4PJIA 1MIEH 3O81A 4O00A 1A9EA 3WFDL 3O8XD 3VFMB 2XWTA 1Z5LA 4PRPB 3T8XA 2D7TL 5IHUL 5D7KD 5DUBA 5F1NB 4RSVA 2EDJA 2W9LA 1D6VH 4XVTL 1D6VL 4Y2OA 5FECB 1EHNA 3BH8A 3SJVA 1KGCD 1NSNH 5AAWA 3HG1A 4PJ9D 3SE4A 3UTZB 4CL7A 2Z8VC 2QL1A 2L0DA 4R6UA 3HB3D 1ZVYA 3MUGA 4OLUH 2EDHA 4HS6A 4X6FB 1EXUB 1CGWA 1T1ZB 1ZT1A 5ACZB 4GBXA 5F89A 3F62A 3BEVA 2R23A 2D0FA 2DQDL 3AXLB 4AQ1B 5KVGH 3JWOL 3KPLB 3NBNA 1SVZA 4XXDB 1BD2A 4XNUH 4YLQT 2AJUH 1DQJA 1HSBA 4OZGF 4EIZC 2MCPL 4QTIH 3X11B 4JPKL 5MHSD 3HAEG 4R4FL 4U1GB 5BVJA 1NLDH 3QA3A 5E7FA 3LEVH 2Q86B 3ULVH 3QIWA 5B8CC 1WISA 3ULUC 3JBG7 2BRRH 4MJIA 5C0DA 1K2DA 1MCPL 4RISH 1OAKL 2I24N 1NCCH 3GMQB 1J1OH 3I9GH 3O4LA 4C55A 1MVFA 4RMVA 3VXUB 1RZIB 2NW3B 4F7MA 3EO9H 1Q0XL 4JPIA 4U7SA 3RIAK 1SQ2N 4E41D 1Z6JT 5DD5L 2YUWA 4I18A 2AJSL 2B39A 2FECI 4LLDB 4D0CB 4ZUTB 3IDNB 4HXAL 4PJ9B 3IDXH 2ZZUT 3OMZA 5T1KD 5I9QB 4KKLD 2IEPA 4NKIH 5IB3B 4ZUSB 3OR7B 1NGXA 4RGMC 1F4YL 3FB6B 4PJCA 4X7SH 4OKVA 4IOFD 3E3QC 3G5XA 3JV4A 4I2XA 3QCUL 3KPRD 1F13A 3S4SG 3L3JB 4P2CG 5HSFA 2DI9A 1IC5H 5IEHB 2FWOA 2D03H 3VW3H 2I9TB 2H9GA 5EZJA 4ONFH 4U31A 2QKIA 3FN0L 1BGXL 3QRFM 3OAYK 4GFTB 1YQVL 3DTXA 3QI9B 2R56L 3U2SB 3NN8A 4U1GC 3X13B 3MBXL 1HKLH 3HUJB 3VFTB 1IQDB 1QHOA 2VWEE 4FXGA 1J0KA 3VXQA 2XFXA 2YEZB 4KRPB 5B8CB 3ARBA 4BQCA 3JV6A 5CP3H 3GMRA 1IT9H 1FVDB 4F7CA 3D87B 3C60A 3JVGC 3RGVC 3V5DA 4HEME 3BUTA 4NNXB 1FC2D 1QLRA 4R97C 4PJFF 3C60B 5T3XL 4UBDD 5D7LE 1L0XA 2X9WA 1MVUB 3QXUA 3W81A 4HBQA 1FORL 1MIEL 1VCAA 1I9IH 3VD7A 2FR4B 1B3JA 3QIUD 3IFLH 3D0VA 3VFTA 4OB5H 4PGZA 3MC0A 1HK6A 2ICES 4YXLH 4PV9B 4LVHB 3O9WC 1DQLH 5H94B 1KXQE 4GKNA 2QSVA 1IKNA 1NQBA 2XKUA 1WBZB 2A9NH 1IAOA 3H9ZA 2XY2A 5FUZH 1ZLWH 4JY4A 2HFGL 3UPRB 1CF8H 5L7XL 3RDTC 4HXBL 1D6EB 4PJ8D 1YNKL 4G8IA 4PRPE 3QQ3B 4JGJA 3GMOB 4PJEB 2B0SH 2EKSA 3S9DB 3CUPA 3O6LH 4KRPD 1FYHB 5IEHA 4ZTOL 3E0GA 5J12C 4I18C 2KL6A 3GI8L 3U9PL 5CD3B 5CMAB 4M43H 4A6YL 2CRIA 5TE6L 4NQTA 1OT1A 2GJ6D 1VGEH 2ZNXA 3UTZA 3B9KB 4ZUSA 2F58H 4LBEB 1YEEH 1F4WH 3TVMD 3GUTB 3MLWL 3WFCL 1FPTH 4JDTL 4X6DB 4EDXB 1KCRH 1K8DB 1U9KA 4UT6H 3ZYJA 3EDFA 2DLTA 1WWWX 1LO2L 1A5FL 1ZVSB 3ZTJG 2R4RH 1TJHH 4WHDA 3U4BL 1PAMA 4Y1AA 3ARDC 1UEYA 3DIFB 3PXJA 1FL3B 1WC7B 1A6WH 3R1GL 4X4XA 4O2FA 3I3DA 5KAQF 2W60B 1IAIL 3E2HC 1JMZA 2AK4A 2W9EL 2ZKHH 3OR6A 3UO1L 1G9NH 4BQ9A 2C1PA 4I4WA 4IRZL 4OCRH 2F8OA 4OCRL 4XGZA 3KXFD 1L4IA 3MNWB 2HT4D 4ENEC 2GAZA 4TSAH 2VISA 2BNRA 1WTLA 5FYKE 3ARGA 4KK9D 1MLCB 3RDTB 3VFPA 3CDFA 3QEQA 2P1YA 5T1DH 1RIVL 2FRGP 2VLMD 5JHDD 3EKCA 3CGTA 1GOFA 3V4UH 4N0RA 3QPQC 4XBPB 4GUPB 3KPTA 4NQCB 2VLRE 3FTGA 1VESA 1CGTA 5FO7B 5FA3B 1HXMB 4CADB 3TO4D 4XPBL 2OK0L 4XVSL 1RUML 4OCWL 3LDBC 2ID5A 1ZT7A 5F7HA 5I8OL 3AS0A 5E8PB 2BSED 2VQ1B 1DEEA 2Y07L 3VDAA 4M1CC 3O3BB 4NQEE 5DJ6B 4XC3H 4HJ0C 2GK0B 4WHYG 1GHFH 4GT7A 1WUNT 4ZS7H 3U4EA 4DFHA 1Z5LB 5C08E 3QR2A 1B9ZA 4GBXD 5FIEA 4WI6A 2OJEA 1S8DB 1RQ5A 5GGVL 3HE6B 1R3HB 1UJ3C 4JKPH 3SGEH 3VD5A 1JNHA 43C9B 3OKLB 4TSBL 1K3ZA 3OAYH 2BHZA 1A9BB 3BIAX 5IW6B 2BRQA 1BFVH 3MOBL 5E5RB 2YD1A 1A1NB 1F58L 3E8UH 3T2PA 4MNGA 4XCFL 4ZSOA 1EX0A 5B22A 4LCCA 5JPNA 4LKCA 4X7EC 3K2MC 1MH5A 2HLAA 4LLMB 2FJFA 3LKNA 3L3JA 2NXYD 3IB4A 2G75B 4KHXH 3HAEA 4Y8DC 5HPMB 5CJQL 4K8RH 1NGPH 1WK0A 1YMME 2FGWL 3PQYA 4ESKA 4FP8H 4I9WE 2MWCA 4NKMB 5KSVA 5ISZB 2FO1A 2O93L 4DWHA 1GHFL 1UWGH 4S2SB 1XGRA 3GDBA 1KEMH 5AYUL 4E41E 4D9RE 5IOPA 1MOEA 3S37H 5E99H 4KJPD 3RVUD 2AV1A 3VXME 3IDIB 3L5IA 1UZ8A 2B8OT 5E2VL 5CP3A 4P2QA 3U1SL 3P4OB 2R1YA 4Q6YA 4ZFOL 4YXKL 1M7DA 1MF2H 3TEUA 3VA6A 5IB4B 5K9JH 1RULL 4XBEH 3QIWB 1LEGA 4YHPA 4QRQB 5KVMC 4PJ7B 3EFFB 1XT5A 3L7EA 4LHUG 1F6AA 4PJ5E 3STLB 1JPSH 4NQDA 1NL0L 2AJYL 2DYPA 3DVGA 3MRIA 3GB7A 1ES0B 3IXTB 5FOJA 3OG6B 4F9LC 3BPCA 5DJZA 1Q1JH 4Y4KA 2DLGA 3MRNA 3MLUL 2DICA 4NM8L 4FFYL 5LVEA 2AJXH 1T1WB 5I15H 1N6VA 4LPTA 2VNCA 2PXYC 5FDWB 1M4KA 5E0QA 1TXKA 3WUZA 4R8WH 1KFAL 3BHBB 3W0WA 4JLRA 4JY5L 2WQ8A 3H9HA 5JW5A 5B4MC 4NKOB 1MI5A 4OQTH 4MNGB 4DTGH 3BISA 1A22B 4OQTA 1LVEA 3DX6B 3I2CL 5C0CB 2W0FB 2Z8RA 1KBGH 4WFGD 1M7IB 3NFSH 3DUSA 1QR4A 1QFOA 4HIXH 1YEJH 3OKEB 1DBBL 2VDNH 2AJVL 1MWAB 4N1HB 3VJ6A 3JV5A 1DLFL 4JHAL 4ELMF 1G9EA 3WXWH 4ZYKA 4HQQH 3OGCB 5INDA 3KNBA 1YMMD 4OFIA 4ZAKB 2ZSVA 4M7LH 5SWZD 4YQXL 2Q8BL 2ORBL 1IC7H 1PD6A 3UC0L 2FHFA 2AI0H 2BVQB 4ZOBA 3MLUH 1K3IA 3FRUA 1IKFH 2BNQA 4IIQA 4XP4H 1NCTA 2PO6A 4PY7A 5EIVA 4ODTL 3K2UL 1VHPA 5ENWA 3QNXA 2AJZA 2P5EE 5GSRB 4BM7A 1G9MC 5IMOB 3S3SA 1ZLUH 1T04A 1U0QA 4G8GA 2O5XL 3LPFA 1GGYA 1AO7A 1EGJL 2MNUA 4RBPK 1JGVL 3INUL 4TNWF 1EK3A 4XNYH 3GNML 5D7IF 3WFBL 1H15B 3VXTA 4NO5B 4V1DE 2Q1EA 4FABH 2JJSC 5F3HA 4NSKB 3ZT6A 4PJGA 2XN9D 4JRXD 5K9KA 3IJYB 5I30H 3QHZH 4I0PA 3G6DH 2NY3D 3VFGL 1Q9OA 2EYRB 4FFYH 5EBMB 3I6LD 1J10A 4LQFH 5GIRA 3EOTL 1I8KB 5F44A 3TA3C 1A6UL 3CFEA 3IXTA 4DGYH 1KENL 4U1MB 3EYOA 3VRJB 5C0CD 2G2RB 4R90H 5HHOE 3S34H 2H41A 2P5WA 3SO3C 3WNNA 1X3DA 5ICZA 5DEGA 1K5NB 1NGXB 3PDGA 1KTRL 1N59B 3RZCD 4DW2H 4UUJA 5ESAB 2NX5B 5I18H 3PXHA 3HR6A 3MLVL 1MCIA 1T89A 1KJ2H 2Z4QB 2CDFB 4Y4HB 3LN5A 5BRZB 3DVIA 2IBZX 1M7DB 3O4OB 2FBOJ 2R0KL 2X4QA 3GSXA 5KVDL 1CFBA 2GI7A 2N4IA 4YHLL 3U30C 4PJ7E 4AT6A 4KGLA 4YR6A 4OF8A 2HT4C 4ENED 5EFIA 3MRFB 2DWDB 4JJ5B 1I9RH 5FO9A 1IQWL 2J8UE 5EU5A 4E0RB 3DX7A 1LP9B 3QDME 5KSVB 5DHVH 5DJ8A 5E6IB 2FBJH 4X6DA 1LEKA 3A6OA 3GSUB 3X17A 2DWEB 5C7XL 1KTKE 3BQUB 3JXAA 2CIKA 5D93B 4Z7UB 5E5MB 3EOTH 3EO0A 1UM4H 4UV7L 1SYVA 2OI9B 3HAEB 5IFAL 3DGGA 4GG6E 3VGHA 3DXAE 3B9KC 5ILTH 1IZJA 3MV7B 3MCKA 1EMTL 3MZTA 4WI4A 4DGIL 5CJXA 5J6GB 1ZT1B 5ACZA 5JMOC 3WLBA 1J18A 4U1NA 1KPVA 5GS0H 4LLQA 1T0PB 1KIUA 4HS3A 1F2XK 1QUNA 3LH2L 4BA8A 1IC4H 3V6OC 4XMKL 3ULVF 3VXTB 4L5FL 2XNAA 3ZL4L 1R5WA 1J1PL 2YWZA 3Q6FA 4ELKB 2O61B 1V05A 2XPGA 4Y5XC 1GXEA 1PZ5A 2FCBA 3FQRA 2XXCB 3Q5TA 3R4DA 3MLRL 1A14L 1E4JA 2BSSA 4JGMA 5GGQH 4V1DD 5GZND 2XA3A 1D5BB 3FRUB 2BFVH 1PX4A 4PBWD 1FL5B 5D5ME 4GRWH 5MENB 4F8TA 2AI0L 1WBXA 4DZBA 1HH6A 3BKML 1T20B 1KUMA 1CGXA 2X4UB 2VE6B 5I1AB 1H3TA 2HG5B 5A43C 1IGML 3RI5K 4GRWE 3B2UC 1KB5B 2V17L 2CLRA 4M6OH 1NLBH 3IFNL 3WEXA 1WIUA 2XIDA 2AK1L 1EGJH 4X6DE 1O0VA 1HINH 1KFAH 2FL5B 3FJTA 3BPLC 4DKFH 3ZSSA 2D7QA 4I5BB 4PS4L 4N9GB 4KK8C 4O9HH 4PJCB 2APVA 1XIWB 4M8QB 3G5ZB 4PRBB 1KB5L 4L8CB 2OBGA 3EGSA 1AP2B 5E6IA 1UADC 3TBWB 4GKZA 3OKDA 2O26U 1DL7L 3OKOA 4HH9A 2WUBH 2ZG2A 1I7UB 3KPSD 4FQLL 3MV01 5E99L 4P2OB 1TPXB 1I85C 3PQYD 1QRNE 3NPSB 4LRIC 5DI8B 1S7QA 3MRPB 1KIQB 4HGWB 1ZVSA 2CLZA 2AJYH 4P49A 1FO0A 3S36H 3KVQA 4RGNB 3SKNB 4DGVH 1I4FA 1JRHI 3QA3B 1I1AA 2E27H 5SWSD 3FQUB 1BMGA 2CIIA 1UXWA 4GKZB 4XXCA 2IMMA 5JR1H 1HSBB 4ZS6D 2ZCKH 1CBVL 2GTZA 4XZUB 5BVJB 4XXDA 1PY4A 1KELH 5BOZG 4M3KB 2P5WB 3ALWA 1KJVA 1PJ9A 5HGBA 4BH7A 1GOGA 5CEZH 1U3HA 5L8KB 2EYRA 1Q9OB 5F9AC 2FL5A 4LAQL 4WTZA 3LS4H 5LGHL 1NCBH 5IM7A 4YHYC 4NQSA 5I74B 1NGYB 5DUML 4Z78B 5I8CB 4C56A 3GIZH 1T89C 4P3DB 1A7QH 2XN9E 2J12B 3MV9D 1A1MA 5GS1A 2B2XH 5D2LE 2UUDH 4G9FA 4YDVB 5GSVA 3RAJL 1EV2E 5BOPA 4OM0L 1KC5L 5BV7H 1LO4H 4Y8AA 2R0KH 3RNQB 3ZDZF 4ALAL 2CDGB 5FECA 4IMKA 2YPLE 1KN4L 3UZEA 4ZPTA 1IM3A 1Y6MR 4AT6B 5F1NA 3HFMH 5EU7E 1QNZH 1N0LA 4BSVB 1GGCL 5D1QB 5SV3A 1I1YA 3QNZB 1UB5A 2FNBA 2F53A 2XFXB 2YEZA 4ZO9A 5I75B 4N0CC 4I8DA 4HH9B 5ID0B 1KGCE 2VDPH 4GAGL 5C0CA 2VLKA 5IESH 2K7QA 4I13B 4AIXA 2AK4E 4N8CH 1YC7A 3L3IB 5DFWH 5C9JA 2NR6C 1HOCB 5MHSE 1I75A 5JR1L 4Y19B 4UTAH 3SDDA 4FABL 1INQA 4I3SH 3PIQB 4YHKL 4X0KA 3MLZL 5IROC 5EBMA 2DIBA 1A3LL 2L4OA 4NM4L 3RAJH 1BPVA 1A2YA 1CXLA 3FQXA 3ALPA 4KKBC 3TT3L 5A2JH 4HF5H 1AO7D 3PHOA 4JZJA 4KKAC 2HRLA 2EYTA 2WLZA 1YEGH 3IRZA 2W0PA 5GGUA 1MQKL 2FX9L 1P4IL 5FYJD 3H9SA 1GC1C 1QD0A 1X5IA 1KJ3L 2WANA 3ARXA 3CCHA 5HGDA 4JFFD 2FATH 4HC1H 1SHMA 4HC1A 2YS4A 1DL7H 4C4KO 1JL8A 1E6JL 3KPNA 5FYJE 3VXUA 4R26H 3Q6GL 3IJSA 4OCSL 5CSBA 2VSDA 3MR9A 3WNOA 3FB7A 3GSOB 3QAZB 3QQ4A 2DOCA 3GSVB 2QSCL 5F7EL 4FQJH 3FB7B 3GSOA 5B38B 3VG0L 2ZUWA 4FMFA 2Q86A 5BJTB 4XWOC 3V5KB 1R3LA 3QDJA 3OKYA 4YC2C 1GH7A 4JO3H 1CE6B 4BFBD 1ROWA 5IR1B 4NGHH 1ZLVH 2QQNL 3NIGF 1D9KD 4OGZA 3CCHB 5HGDB 5LWYL 4QTHA 2DBLH 2IBBA 2I9LA 3VGDA 5F88B 1ODAA 1NC2D 1X4YA 5C0CE 2CR6A 1RHHB 5EBWA 3GHBH 2V6HA 3TO4C 4QRPE 3RHWF 1UENA 3QIUA 5D2NB 2M8XA 3MJ9A 5CBEA 3P40A 5DEZA 3NA9L 4F37K 1HHJB 3IDYB 4PTTB 1KTDA 2I25N 3QIUB 2R15A 5D2NA 4N0UA 5CEYB 2WMPA 3EW3B 3WDHA 2NY1D 1T04B 5IG7B 5ICYB 2E7HA 5L9DH 1MHEA 3GIZL 3FO2A 5DDHB 3AS1A 4GW5A 1GC1L 4YHIA 3AB0B 4HFUL 3PGDB 3KXFA 3DO3A 3UBXI 4Q0XH 2DQJH 3RRQA 1E28B 1IM9D 4UNTA 4OQTL 4DTGL 4WWKB 2G5BB 1HEZB 4UT6L 2M26A 1MHHB 3MRRA 1YYMH 3ZZ1A 3RWFA 1WFUA 2BVQA 4QXUL 4XVTH 2EH8H 4MJIE 4H20L 4LPXA 3HMWH 3VXMA 2BHUA 4OUOA 4WY7H 3U7AA 3P77B 3WE6B 1X5ZA 4JHAH 4YDLB 1OSPH 4EDWH 1TFHA 3ARDD 4NRXB 4RRPG 4ZDHA 3QWOA 3O6KH 3GHBL 2B5IC 1U8PA 1B0GB 1CXFA 5D5MB 5J1AA 5C07A 2AV1B 3SCMC 3NZHH 4NNXA 5I73B 5BZWB 4RAVB 4JY5H 5GHWL 4JO3L 1BHGA 2A83B 2XZQL 4NUGH 5FO7A 3WN5C 1QSED 1U8IA 3O2DH 4D0DA 4KQ4H 5LBSL 1VFUA 2UYLB 3O2WH 1VDGA 1T22A 1XGQB 3L9RB 3NIFE 4XPHH 2CXKA 1F4WL 2DLFL 1IFHH 4HX1A 5GGRY 1CG9A 2WWKT 1AQKL 1OAKH 1BIHA 1JPFB 4HT1H 1X5FA 1HIMH 4KFZC 4LSUH 1H5BC 2YD3A 3MACL 3OKMB 1T83C 2C9AA 3G5YA 3ULVL 2G60L 5DA4A 1S7TA 3LMJL 3F8UB 3ROOA 1U8LA 1MQKH 2GJZB 1BQSA 3ARBC 4LCIH 4Q9QH 1DANU 3L3KB 3DIFA 1FG9C 2NY3C 2OJEB 4GMTH 3MJ7B 3H42H 4I18B 1U3HD 1RUKH 4G7VL 1I7ZB 4M62H 3CSPA 4EUPB 4L3EA 3MRPA 2HFFB 4W70A 1JUFB 2V5YA 2VIRB 2IAMA 1W72H 4ZFOB 5I1LB 1UKQA 5C0FB 4S11A 1LNUA 1A7OL 2FGZA 4FRWA 4W6YB 5ICYA 5F7EH 2IANB 2ESVB 3ZTNL 3VW3L 4NUJA 3W5NA 4POUB 3BO8A 4H25A 5DMGC 3VGAB 1TQCC 5CD5D 2K3TA 1D5XB 2X4SA 3UTQA 4BZYA 1KB9J 4GS7C 1OLZA 3VI4E 2J8UF 5K59F 3IS0X 4NKMA 1QP1A 1RZJC 3GRWL 3W9EA 3OQ3B 3PWLB 5CLTA 4G8GE 4XNZC 4LGRB 3MGAA 1P6FA 1RFDH 4GUPA 4XBPA 3C5ZC 4IOSD 3S3JA 1YEDB 5KVFL 1DLHA 4FOMA 3QFJA 2DLEA 3P0YL 4UOW1 4M8VA 3GIVA 4LP4A 3MBEC 1SM3H 3OG4B 4JN2A 4HHAB 3GJFH 3G6JA 4OGAC 1CR9H 4HJGB 1DEDA 4PG2C 1U3ZA 4BQ8A 4FQXD 4HS8H 5J6HB 2E7LC 5LGKA 5EC1A 2B2XL 1M1SA 1YN6A 2DYPB 1A6TA 4HZLB 1AHWB 1AKJB 2H1PL 1SJVA 2QV2A 4K3JH 2J4WL 3RY4A 1RUQL 2AGJL 5T5NF 3NIDE 1PQZB 3QEUB 1FJ1B 4JVWA 4Z76B 1G7HA 5A2IH 5C0NC 4OTXH 5HHOB 2B4CC 2DI8A 1I7RA 1NBYB 2X4NB 2Q3ZA 3DI3B 1NAML 1IEAB 4M00A 1VKXA 4TNVF 4HXAH 4N5ED 1MCSA 2RAMA 3VFNB 3BPNC 3RUGA 1I3RA 2WV3A 3MLSH 1VFMA 3BVNB 5C0BA 2F19H 4OZGA 3TNMA 4UIKL 1FFQA 5IQ7L 1Z0NA 1F3JB 1JZ6A 1MCCA 1QKZH 1I7UA 3NTCH 5HYQB 3HC0A 1HNGA 5FM5M 4RZCB 1AD9A 1FDLL 5I74C 4YZFE 3ULVC 4G6JL 2BOCA 5FCUL 3DUUA 2DIAA 4IOFC 2R0ZL 4HMDA 1HNFA 5CLWA 1REIA 4OLWH 5JW3H 4M6OL 5F9JB 2IG2H 2UWEE 4AEHL 3MBEB 5IB2A 4R4ND 1A6ZB 5I8EB 2VR5A 1SYVB 1A5FH 2A6IB 2DIJA 2HLAB 2VLME 5JHDE 4QRSB 3PP3H 3FT4A 1M05A 3L3IA 3VG9C 2FIKA 5IEKA 4RGOL 4B5EA 4JRYE 3QG7H 1PKQE 3MV7E 1HDMB 4RZCA 1ZOXA 4G8GD 1K4DA 2HJFA 3HMWL 4FS0A 5HHNB 1ZWIB 1FL3A 3EOBA 1NC2A 2AJVH 4MNQE 4EVNB 4X5LA 4FHBD 1X5AA 3NABH 3UJTH 1Z3GL 4BZ2H 2OTWA 2C26A 1N4XL 1NFDE 1OARL 4EBQL 1L7TL 3U30B 1L7TH 2CK2A 5I76A 1B0WA 5HVFB 2WNGA 5KSUB 2YOCA 4MJIB 3BKCL 2P8LB 1S9YA 4P4RA 1I9JL 4IBLT 4ERSH 5MEOB 1MPAH 2W65A 4XT1C 1EEQA 1KSRA 5FA4B 1H3PL 3LRHA 4MNQB 4HWUA 4OJFH 2DRUA 2BK8A 3NCJL 1FIGL 3RKDC 4NQCA 1G7QA 3BKJH 1CLOH 3RVVD 1FFOA 3U0WH 3MRCB 3DETC 4G8IB 1PY9A 1NUDA 3BRDA 1A0QH 3L5WA 3OZ9H 4Y5VC 5M95B 5FKAA 5IF0A 3OX8B 3FONA 3NFSL 3ARYA 3VRIB 2HVJB 2Y5TA 4XCCL 4MA7L 3QUXD 4UT7H 4XMKH 4EOWL 2P8LA 4BFEA 4XTRC 2DWEA 4GRLB 4KGJA 4H5SA 1HKLL 1DVFB 3T0AA 3OXSB 3BZ4B 4I0PD 4QKXB 1VERA 1MHPH 4POZC 5I9QC 2V2TB 5EU7C 4XRCA 3U82B 3KPMB 2IBZY 1CLYH 1F4HA 1MCWM 5E6ZA 3WFEL 4R26L 5KZCB 3BH8B 4YFLI 5DUBB 4YWGL 5MEQB 1Q0YH 3TBVA 4X5XA 3ZT5A 5JHLL 3PL6C 5DHVB 3LD8C 4XCEB 2Z31B 1I7ZA 1P7QB 3TH4T 3MLYH 1DP0A 1UVQA 4JM2F 1BFVL 3MOBH 2DQIL 3OKKB 3BGMA 3SBWC 3TBWA 1IE5A 2D0GA 2XNAB 3DSFH 3EAKA 1QBLH 4JG1H 5MERA 3RPIA 5T3ZL 4D9RD 1IQDA 5FYKL 3Q5YA 2CKBH 1RZ7H 2C4FT 4HG4J 3B3IB 4RFNB 3FO0L 1ORQB 3HMXH 3KYMB 4NT6A 4IMLB 4XNQB 5GS2H 3HI5L 2R29L 1MEXH 4PB0H 4QOKB 2FO4B 2NY7L 3KPLA 2P8PA 1HH9A 2QHRL 3GMOA 4PJEA 1OGAE 4Y0GA 2NNAB 1KC5H 5C07D 1ZLUK 3O9WD 1CFVH 4M1DL 5HGAA 3HPJB 3O6FC 3WXVH 4BQ6A 5KSAD 2NY5L 1FG2A 1MFCL 1T22B 2PTVA 5J13C 4WW2A 1J0ZA 3HI1A 1WBZA 4AIOA 3T0EA 1OQOA 3F5WB 4OZFA 5DUMH 4PJ9A 4L3CA 3TN0C 1G7PB 3TO4B 3MO1A 4QHUB 4FFVC 5EOTB 1JNLL 2O5YH 1D5BA 1P5UA 2AXGB 1IM9B 3EO9L 5FO9B 2X9XA 4LVNB 1DBAH 2VZOA 1HHIA 4FFVD 2VLJD 3VH8B 5BV7L 4XXCC 4IIQB 5F6IB 4G3YH 4TVPE 3HPLA 5DRNA 3HUJE 1KCSL 3PNWB 5HI5D 1IRAY 4N8VB 4XCFH 1ND0B 3MRDA 2FEDC 4P9MH 4U1HB 4X6EB 4H5SB 4PS4H 5JW4N 4GAFB 4UZGA 2YUXA 4CNIA 2JB6B 5C08A 1LGVA 5IBTL 4POZD 2D9QB 1U6AH 2R0WH 5TDNB 4FFWD 4FQ1L 4ZPVA 4UB0H 1ZHKA 3QXTA 4TULL 1NCDL 3CNKA 2V7HB 4V1DA 2DQDH 4PJGE 5DC4B 1QLEH 2IPKB 5DC9B 4HWBH 1FFNA 2HJLB 3P9MB 4MA3A 1XR9A 1TZGL 3VFUA 3NACH 4LL9A 1LEKB 3K46A 1ZLVK 5CSZA 2YUVA 2AV7B 1EHAA 5F70A 3RGHA 3ZKMD 5C6TL 5H37G 1AQKH 3HHRB 5TE6H 1VACA 4MMZC 4CUCA 4WGVB 3OF6D 3MREB 1DBAL 1INEH 4LPUA 3RX7A 1U8NB 1C5DB 4JFDB 1IL1B 1IAKA 3ELAT 3U0PB 1CYGA 5EZIL 5DFTA 3U36A 4LLVB 4WEBH 5E1HB 1ZANL 3IU3B 1SYSA 1LO3H 4TPRL 4DFIA 3ZL4H 2VDRH 1LO3L 3NFNA 4TPRH 1C08B 4KWUA 3AU1A 4RGNE 4NQDB 3VFSA 4KJWC 3H3BC 2GSGB 2QQNH 1J12A 1SEQH 5CP7B 1AJ7H 3DPBA 1LWRA 4S1DC 5IBTH 1S8DA 1DBJL 4X6DF 5E1AB 1EGJA 1FCCA 1AC6A 2PTTA 3EFFA 4CVXB 2JE8A 5ESAA 2R2BB 2X09A 4WEUD 4DCQA 1NFIB 2V5RA 2HYMA 5KSAB 2IPUK 4P3CH 3DLQR 3KPOB 4LSPH 2Y7QA 3B9EA 3ARGC 4U3CA 4XAKD 4WFEE 3LSOB 4JO4H 2PW1B 3GBNL 1JPGA 4NRZB 3ZE2E 1F90L 3U4AA 5DRZA 2VDQH 5D9SA 3STZB 3ZKXB 3FO1B 4EXPX 5ISZA 2G5RA 4KKCC 2WUCH 4G42A 4MXWH 2HFEA 4HSQA 1BVLB 1FZJA 1AGEB 2L7UA 2PNDA 3N1FC 1EO7A 3IETB 4Q6IB 2HLFC 3VD9A 3N1GC 2R9HD 4HUWB 1BVLA 1FZJB 3G6AB 5LCVL 3D0LA 5EU4B 3W82A 4XHQA 4NJAL 5DHYB 2F53D 2FJFB 1IGCH 2BY1A 5CJXC 4YHLH 3S5LB 5D6DA 2XT1B 3IDJA 3HE7A 3GSWB 3OAUL 3S35X 2ICWJ 4P9HC 4WFHE 5IBLD 1FL6A 4R97B 2YSSA 4Z0XA 2C1PB 3FZUD 4I4WB 3MRGB 4MX7B 1J8HE 3FQRB 2CRZA 4OF0A 4PJXF 4TN9A 4OV5A 5EIIB 1RZJH 1KPRB 2D7MA 5MP6H 4W4NA 3D69B 4OZIE 4Q9RH 2GW5A 5E8EB 5C2BH 5C70A 3WFHB 4BJLA 1HILB 3UBXG 2GUOB 2X4OA 4YDJB 3O6ML 1CIDA 4U7KA 2OI9C 4OF6A 3MOAL 5I1EH 4K71B 3C08H 5DJ6A 3RUGF 2ED7A 1D5MA 4NYLA 3FMGH 2YZ1A 2PYEE 4K3HA 4JKKA 2AXHA 3QCVH 4D9LH 3EYFA 4B7LA 4I0KA 1TPXC 4Z8FL 3MREA 3MCKB 4NN5B 1F97A 1P7QD 1JTTA 5T1LB 3LS4L 5LGHH 4NFBA 2KDGA 3S97C 4BH8B 2GCYA 2VL5A 1A1MB 3RHWK 3BP6B 3VWKA 4Y19E 3X3GL 5GHWH 4WO4B 3VXUD 5ERWB 4N0YL 5K59E 5AG9A 3FT2B 2VDQL 3QUZC 4JFZH 4BSWA 3K7UA 3EDEA 3QB7C 4O4YH 2HVJA 4ETQB 1HZHL 3S34L 4YEEA 4Y4KB 1BZ7A 4XMPL 1E4XI 4S1SL 5L0QC 3KHOA 3TP4A 1WQVT 3QDJD 3K8KA 4WU5B 3T0XA 2WQRA 3B43A 4MB5A 5DLML 4R7NB 4M7JH 2WLYA 4M62L 32C2B 1W0YT 2HT3C 2J5LC 4RMWA 5KVDH 3IJHB 4MNQA 5DQJB 2UZYB 3TCXA 3VXOB 5J9PB 3ROLA 3TV3H 3B8YA 3QQ4B 6FABH 1NDGA 3RWEB 5IVZB 3CIQA 5IVXE 5TDOB 3HPLB 2IFGA 2I60L 1I4FB 3CVIH 3P73B 4F7PB 3RVUC 1S9WB 4TQEH 1YY8B 4Y1AE 4OZ4B 5HHXL 4UV4H 5BV7B 3DV6B 4OD3L 3P9LB 3BPLB 3VXRB 3V0VA 3OKNA 4TUOA 1FNGA 2NY6B 5EWIL 4I48A 4RGNC 2ILLA 3QJHB 3QO1A 2H2PD 4DAGH 1I9EA 5K93A 2Q7NA 2EO9A 5E2JA 2Y6SD 5K9KB 4QHKI 2EDEA 4P48A 2E7LA 3N1MC 4OFVA 4JQVC 5HI3D 3V52L 5IB1B 5E2UH 5FM5O 2Z35A 5JPMB 3MA9L 4MQXD 4K55A 4X7TA 3SPVA 5I1KL 2J88L 2P24A 4LSQH 3SDXE 1DBKH 3FFCB 4ZOAA 2J88H 3GJEB 4XNQA 2Z31D 4HJJH 1SJXA 2QR0A 2R2EB 5EO9B 4KJYB 3D85D 5JXAL 2P45B 4QOKA 3HZKB 2BY2A 1P2CA 3KLAA 3QG6A 3P9WB 3TT1L 1JZ8A 3RWIA 5DS8B 1ORQA 1WV7T 1PX3A 3RNKA 2A1WL 4HS8L 5GRJH 4G6FD 2DQFB 4NHUA 1DBJH 4BSVA 5KTEL 1QSEA 3TNNA 5HHPA 4L4TD 1RZ8B 2ZCKL 5HVHB 1U92B 4D2NA 4PGJA 2ZKHL 4X98B 1Q1JL 3HN3A 4E9LA 3FFCE 1VENA 2APFA 1FP5A 2GK0A 4YGVA 1V7MH 3RIAF 5ANME 4M7KL 5DRXA 1NCDH 3WUWG 1P4LA 2VQ1A 3OF6A 4JFEB 2O61A 2F5AL 5E70A 4HLZH 3KHQA 1OARH 4JLRB 1UACH 5F7FA 1FYTE