4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
5JUEL 5ICYA 1UZ6E 2YUWA 2JK5A 2R8SL 5GISL 4NNYB 4FABH 1VFUA 3VW3H 3D0LA 3HAEA 1MCRA 2DQCL 4NGHH 4NYLB 5DD0H 4JFFA 4ENED 1KULA 1A4KA 3NFSL 4HS3B 3MREB 5LJYH 4JVUA 4PGDA 3ZT6A 1SVZA 5CBAA 5FAAA 1C7TA 4PJIE 2EXWD 3PUCA 2YK1L 3BXNB 2AQ2A 3PWNB 2RIKA 4MNGB 1JIBA 5E2VH 5C0ND 2AK1H 1CDHA 1R3IH 4D9RD 4DZBA 4NZTL 4HWZB 2NLJB 4MQSB 2B0SH 1K4CB 5D7KE 4YLQT 3GB7B 4XX1G 1J9CT 4X0KA 2Q87A 1ORQB 5HGDB 1EIBA 2FATL 1MCWM 3KYMA 2CIKB 4OCXH 1MIEH 2A74A 5FF6A 3DRQB 4YZFE 2A6DA 1RIUL 3OKOA 3UTTB 1J0IA 5JLZA 2F5AH 4KROD 2E9BA 5D1XD 5C0EB 5JXAL 4EI5A 4NBXB 3H3PL 3U7YH 3K2UL 1VPOH 2P49B 1G7HB 3PGCB 5JDJA 4HUMB 5EU3A 2APFA 4K7FA 3T2OA 3RKDD 2ADFL 3TM6A 3V6OC 1LO4L 1AGFA 5T1MB 2E27H 2GSGA 5IP4A 2CJUH 2PUQT 1A6PA 1MCOH 4LNRA 4OF5A 4P0DA 5IBUG 3WJJC 4FQPA 5KVGL 1WFTA 2IGFL 4MQTB 1RZ8A 3FQNB 4JKPL 4LRIC 3D2UA 3RL1A 3MLRH 1J1XL 5DD1L 1N0XH 1I3UA 2W38A 4QNPF 1FNSL 4A2MA 2UZIH 3PQYD 2ARWA 4I13B 2H8PA 1VADA 1FIGL 5F7LB 5HI4C 3O0RH 2FD6L 3HI6H 5CZXD 5D6CA 5C6WH 5J89A 3PL6D 5KS9E 3H0TA 2IALA 1GZPB 3IXAB 1AH1A 4D9LL 3MACH 2H9GA 4RQQA 4BA8A 2OL3B 4ZPVA 3RWJA 3U9PL 2RHEA 3K8KA 1ZOXA 3CH1A 3I75B 2HJFA 1P1ZB 3BZFA 4D0DA 4PGEA 1YNLH 1H3XA 5TQ2L 5T3ZE 5EOQH 4Z7UF 3ULSA 1ONQA 1S7QB 3SE8H 3VFGH 4W4OA 5BV7L 1FAIH 4OGXH 5ILTH 4HD9A 5A16B 1T20A 4NN7B 5MEPB 1ZGLM 3CGTA 3PNWB 3LN5B 4XPAH 4MJID 2BMKA 4X8JA 4BH8B 3SKUD 3DI2B 3GM0A 2HYMA 1OLLA 3RL2B 2IAMC 3VXQA 4FQXA 2G60L 3K46A 1QG3A 1LP9E 3QEGL 8FABB 1JPGB 2VQTA 4NN7C 5JHDA 2XWTA 1RK1B 2HTLC 4JLRB 4NT6A 2G9HA 3OKMA 3U46B 3ME0A 4WEBL 1MHEA 1P69B 3O6FD 1PLGL 1W0WA 4WTZA 4ZOAA 1A2YA 1Z0NA 4Q74A 5EBGA 1MUJA 5C0GB 4QRSA 4UQ2B 4JHAH 3AMKA 1HIML 3X11B 1ZA6A 5HDBE 2GY7B 3K1DA 4PJGF 5CMAA 5DRWB 1CG9A 3ARBD 5TFSH 3SE3C 2PTTA 4OI9A 2XKSA 4YIQA 1XZ0B 4OTXH 5BS0B 1HQRB 1IEAB 1BD2E 2NXYC 4RA0C 2AI0L 3KPPA 4DVRL 4NM8L 1FSKB 4G8FB 4KWUA 3UTSD 1MY5A 3VGDA 2N7BA 2D0HA 4K71B 1ERNA 2P5ED 4HKZB 4WFGE 2ESVB 3CZJA 5FKPB 3T4AB 3PQYE 3BUYB 4BK5A 1EO5A 3FFCD 2G2RA 4XVTH 4PRID 1B4RA 3D48R 4JY6B 4N0YH 1LQSR 4XP5L 1AY1H 1IAMA 2V2WA 4M5YL 5C9JB 5IFJA 4MNQE 3STLB 3DVGA 4PJXA 3RWEA 1CE6B 1T04A 2NZIA 2VC2L 1NANI 4ZO8A 5B21A 3AM8C 4QHKJ 3LV3A 4P4KB 4UINH 3RP1A 1PG7W 1QBAA 3HG1B 5BW7C 3IU3B 1FORL 3O6KL 1LDPH 1JF6A 1RZ7L 1UYWH 3BHBB 1DJSA 1KNOA 5AZEL 2VZ3A 3SDAD 4PG9A 4O4YH 1ADQA 1TQCB 4F2MA 4I5BB 3NIFF 4PRNA 2Z93A 3GMLB 3HS0B 1ZT1A 3GIZL 1KB5L 3VXSD 1RUPL 4U6XB 1MJ7H 3EOAA 2BVQA 3Q1SL 1AR1C 5FHAH 3U83A 4JJ5B 2P24A 3WNKA 3QWQB 1C1EL 3WMSA 3C5ZC 25C8H 4KHTL 3VG9B 1EFXD 5DYOB 5CLTA 1FFOB 5E08H 2ITDB 4S1SH 1ZANH 2FBJL 4O5LH 3RBSA 1NAMB 3BE1L 1P84K 5DVOA 1ZTXL 2VB5A 3UC0L 5GS2H 1FE8L 3NTCH 3RTQA 4PJGB 4DQOL 5DQJB 3DHMA 3AGVA 5ID1B 1AI1L 4A6YB 5IBLD 5FDWB 4L8CB 1JMZA 3SKOA 2PKDA 5DDHA 2C7UB 3IS0X 4BSWB 1T89A 3ISWA 4P3WA 4XMKL 4NO0A 1NEUA 4BM7A 2EYRA 4HEME 2WWMC 3NZHH 2EC8A 5CINL 1N64L 3X14B 1DEEB 3ZYOA 3LRSB 2GFBB 1DEDA 2HH0H 1JGLH 1XGPA 1QBLH 4OD2B 1K6QL 2VSDA 4M3KB 3CX5J 1UVQA 1OF2A 4I4WA 2XKNA 5BCAA 1FGNL 1NBYB 1QBMH 3MRCA 1MREH 3T3PE 3DARA 1JP5A 4DVBA 4EQ3A 1U8KA 3KS0J 5IHUH 1IGMH 3L3HB 5I66A 2LVEA 2BRRL 1PZ5A 1R0AH 4EI6A 5EWIH 4YQXH 1KC5L 4KUZL 1MAJA 4ZTPL 5ECJE 4LOUD 4Y5YA 1CFVH 4LFHD 3PDOB 4BSVB 3EHBD 3G5VA 3QUKB 1F90H 3S8WA 3G5ZB 3GSRB 3BSZL 4M6NH 2VLJD 4FTVD 5DLML 4FQHA 1QSFD 1MCLA 4Z78B 1BP3B 1FNGB 5CKAA 3WS3A 4IHOB 1JGDA 5DJDB 4KK8D 4JB9L 5IGXL 2XWJB 3ELAT 3GSVB 1AGCB 3BKYH 4RDQF 1CZ8L 3F12B 3RVTC 3CUPA 3EO1B 5DK2A 1GGBH 1DTUA 5IESL 2YHGA 3UXFA 4QTIH 5JOPD 3ORJA 1W72A 1KJ2H 3VGGA 2IQAA 2V2TA 3BMWA 3CFBA 2AJXH 4LQFH 2H2SC 4GBXD 4EQ2A 1JNLH 5MEND 3R06B 1QLFB 4PJFF 1BECA 3OJVC 1ETZA 4HC1A 3BRGC 1BWMA 3ZL4L 1JWMB 3B9VA 4PJCF 3E0GA 3FB5A 4L4TA 2HLAB 3VFPA 3ETBF 3IT8D 4Z7QF 4LSQH 4DOHB 15C8H 5TDOA 2OR9L 3BN9C 5DD3H 2PYFA 1ULVA 4QNPE 5GZNC 2ESVE 3AMLA 2DLFL 4PREA 1SM3L 3MRRA 2F8VA 1QBBA 1LMKA 4M6AA 3ECBB 3UJJL 2KPNA 1YY8A 1NCTA 3R1GH 4MNHA 5C0IA 4HUUA 4RCAA 1U3HD 5ID0A 4U1NB 3S4SG 5T1KB 2PR4L 5IUSA 1R5WB 2BERA 4P23A 1PX4A 3O2DL 1RK0B 3UDWC 5JMOC 1HHIA 2ILLA 2NCMA 2N1KA 2FIRT 1JWUB 1HDMB 2I07B 4HHAB 4GOSA 5FCUH 1SMAA 5B38G 3OKEA 4NQSA 4ZXBA 4XXDB 3OJDB 2HVJA 4HWNA 4R97B 4OGAC 1TVBB 3S34H 4WFFE 2I5YL 3DI3B 2O93L 3I6LE 1NSNL 3NFPB 4AL8L 4JR9H 4QWWC 5GRJH 5C6PB 1Y0LA 4OFDA 4S1QL 5FUZL 5T3XE 1UM6H 3EYOA 2Z35A 4M62L 2JLLA 3S5LG 4R97C 3CDFA 2WUBL 4AY0A 1F58L 3LEVH 3WIHA 1IC4L 5DQDH 1T1ZA 4IRSD 3QIWB 2DF3A 3CU7A 4GMTH 4UIKH 3KYKH 3WUWB 1NDMB 4RAUA 5LCVL 3WXVH 1ZHLA 5JZ7C 5BOPA 2DQUL 2GSIA 2OZ4H 2R29H 5GSVA 3LN4A 4LGRB 1P4IL 1ZMYA 3VFVB 4AIZB 3IETB 1FFPB 3MNWA 3I50H 1S9VA 3HR5B 3MMEA 4PJGE 5MENE 3LD8B 5ESAB 3MOAH 3QIWC 1KEGH 3TLRA 2XFXB 1U36A 1IC5L 1OGAB 2JCCA 3EYVA 3VXRA 4X6DF 4EDXA 1XF3B 3L3DA 3QPQC 1HZHH 4XBPB 4PY8J 5LVEA 1CR9H 5C0DB 5FXCH 1NLBL 1DR9A 1T3FB 4NWTL 4X7TB 3TO4A 4WHTA 2Z4QB 2NY2B 3EJYD 4JJHA 4PJAF 3PHQA 1A3QA 2DAVA 2GJ6A 2ENYA 4JFPB 4G80B 1JI1A 4NQVA 4NSKB 4HXAH 4WHDA 2F53E 1WIUA 5EU6B 4YHML 2DQEL 1TJIH 1R3HB 1VSCA 1WZ1H 4HWBH 1FL6A 1KXVC 4NZRH 4ZFGL 1T2QH 2OXGA 5BRZA 4LLYB 2XG5A 3MUGB 4U1GC 1EEYB 4CW1B 3O3UN 1ZV5A 3TN0A 3BRFA 1J0YA 5K33A 2ICWB 5I1IL 2UY6A 1X6LA 2PO6A 1FIEA 4TUJA 3OKNB 3IFNL 1DQML 2AQ1A 3NIFE 4GQ9H 4BZ2H 1IM9A 3DROA 3MV8B 2VR9A 1SJXA 2V7NB 3DUSA 3QDMB 3QIUA 4Y16D 1WUNT 4LDOB 1AP2B 1X5IA 1AKJB 3VXPA 3TBVA 5I8CA 1GGIH 2OTWB 1PG7L 4CJ1A 5F6IB 3WFCL 4JO3L 3L3KA 5EBWB 1G0YR 1FVCB 4J23A 4WO4C 1KIPA 3WO4B 1GOHA 4X7SL 4H20H 2J8HA 4YHPA 4X5XA 2A9ML 5FOJA 4NYLA 1PKQE 2X5PA 5KSVA 2J88L 3JWOH 2JJTC 4P2QD 5F6IC 1QP1A 3U6RA 4LCCB 3Q0HA 5BVPL 1RULH 4LRNH 1CLZL 4U1LA 1NCBH 3WO4C 2NY1B 1J87A 3T2NL 1XGTB 4M1CC 1A47A 3TJHC 4O58H 3U7WH 3C87A 2BRQA 1QSVA 1MFDH 2VABA 2DICA 5K9JH 3MRLB 1SBSL 2YBRB 5DRXA 2FEDC 5D8JL 5K9OB 4EN3B 4X6DB 3K0WA 3GUTA 5DJZA 3B43A 2QQKH 4FFZH 1FBIL 2NY1C 1A6AA 2A73A 3V8CA 4CU7A 3MLVH 3LHPL 2H6PA 5HI3D 3GSNL 4MCYB 1A7PL 5I8EB 4XNUL 2YN3A 2CDEB 4EN3C 4K7PX 1UWGL 3EBAA 2BOCA 3QUMH 4N90E 2WBWB 4CBPA 1NKRA 1WC7B 1EVTC 4WGVB 3B9DA 4J3OC 3FB6A 5C08B 1A3RL 3MSPA 1MVUA 2K1MA 4AJ0A 5E70A 1IKFL 3CDYA 1MFAH 4MA8L 4QOKA 1M71A 3A67H 3I85A 1YEEL 2CUMA 1IAOA 3N1GC 4NQXB 5E7BA 1UCBH 2DJSA 4OQ1A 2R1YB 3FT3B 5T3XL 3TVMA 2CK2A 2Z0BA 3GK8L 4I3RL 4L4VB 4O2EA 3O45B 3VD7A 4XTRC 4NRXA 4O02H 5LKNA 1A22B 3FRUA 4ZG1A 5DD6A 3HC0B 4IDJL 5EU4A 4ODHL 2OJZH 4NBZB 2R23A 5MP6H 2CK0H 5CP3A 3D39B 4H5SA 4KZDH 2R9HD 2ZCHL 1GGUA 5CJOH 3QJFA 5DJ2A 5HY9B 3V95A 3IDNB 4XX1E 4C56B 1S7QA 1TPXB 2LQRA 2IAMA 2JIXB 5HI5C 3S88L 1F00I 3HFMH 3QUZC 2NY6D 4NNXB 5KVEH 3KPRE 3O3BA 1JE6A 3VXMD 4XCCH 9CGTA 2ZPKH 2MCPH 4A6YL 5I17A 1CFTA 1WBXB 1X5FA 5INCB 4H0IA 4PJFE 5DUPL 1BLNA 4KKLC 3THML 3MROB 1RJZA 4JCMA 1PSKL 3QCVL 5CJQL 3C6LA 1MWAL 1TPXC 4PJCE 3IDIB 4YH6A 1CDYA 5GGRY 4YX2H 3MCKA 4YO0B 2B8OT 4Z7QE 1P2CB 3L3GA 4JG1L 1KJ2B 5CZKA 2R4RL 1QVOA 4C57C 1AQKH 1I3GH 5JNYB 2FRGP 2VLRD 3HI1B 3P0YL 2YD9A 1QYGH 1DUZB 4U33A 1NC2B 2Z31D 2COQA 4HT1L 2E6PA 4X9IA 5D7LA 3CVHA 1E0OB 2A1WH 2E7CA 4OFIA 4R4FH 2OM5A 3VFRA 1CICD 3NAAH 1MCSA 4E42B 5IROC 5EU6E 4QHNB 1YZZA 4OM0H 4G43A 4X9GA 5CEZE 4E41E 5DJYB 1FAKT 4PGZA 4GH7B 1WZMA 3RFZC 4K3HA 4R2GC 3LKQB 5H35B 4UQ3A 2SEBB 2BSTB 2OXHA 2E8YA 4Q0XH 1KGCD 1CU4L 1ZHKA 2VLMD 2IAND 4K2UL 4QYOA 3SGEI 1SYSB 1BVKA 5TH2B 1Q0XL 2OI9B 2X4UA 3MV8E 3UTZA 3AREA 1IMHC 4D0BA 1M7IA 2AEPL 1QFUH 4WNQB 4WUKH 3L3OA 4HFWB 4JFEA 1TMCB 3ULUF 3OR6A 4XZUB 4XVUD 5EO9A 4LSVH 5D7SL 2DTML 2DQHL 3QP3A 3V6FB 2OI9C 1MRDL 3ARDD 4UMGA 3PP4H 1JPFA 4HZLA 2Q8BH 4KKCC 2AK1L 1PAMA 5HYFA 1I8MB 2VXSL 3AXLA 3LS4L 5B4MC 4PP1C 2H1PH 4U1MA 2ZUYA 1HILA 5F9OH 4DGVL 5T33L 1EJOL 3SE9H 5B3NA 3VXME 1RUAL 1ES0B 1Z9OA 1QRND 2XZCL 3C5ZA 1QLEL 4UTAL 1YEDA 2FL5B 5GSRA 3BH8B 3QG7L 1KIQB 1YN7B 1FYHB 1YEIL 4ELMA 1FFNB 1G0DA 1VHPA 3U4AA 1MHPH 3T0WA 3WE6B 4MA7H 4N5UA 4X6DE 1WCBA 2VZSA 4WEMB 5AEAA 2D7TH 1DSFH 5FHBH 3MLTB 4O2FA 2XKUA 3RWCB 3ARQA 3VFMB 4U1JA 2VLRE 4KK5D 4H25A 3PHOA 1H3PH 3D85D 3Q3GB 1CXEA 1T7WA 1FFOA 3G5XB 3PXJA 5DTFA 1FNEB 2KQNA 1KIRB 1NGQL 4PJAE 5DJ8A 3GHEL 3H8NA 3FOMA 1D9KB 5TQ0L 3WO3B 4QT5B 2V7HA 4X80H 5ITFA 5SWSB 3ARRA 3HHRB 4KPHL 4RISL 3DMMB 2YXMA 1CGUA 1YQVL 1G6VK 3CX2A 4KVCL 3SEPA 4DAGL 1D6EB 5C08E 4U05A 4OZFA 3W2DH 4XAWH 3S4SB 4KMTL 4HZAA 3KAAA 3MRPA 1DZBA 1D9KC 1ZT7A 1RHFA 1HSAB 1B3JA 4GRWF 1QSED 3DMMC 1BQLH 3TNMA 1TXKA 4OZHF 5K9KA 3GKWL 1AHWC 1J0HA 1AXTH 4KDWA 4Q6IB 1ZHNA 3RGVA 5DVLA 4X6FA 5HGAB 4KRPD 4L4VE 5F8RC 4QRRB 4K3GA 2QADB 1S3KH 2BC4A 4XB8A 3EJZC 3TA3A 1OQOA 5DT1H 1S7UB 3ZHLA 1IAKB 2W60A 2Q6WB 4OB5H 3FQRA 4NC0B 5EC2A 3UAJD 4Q6IC 4F7TA 1XEDA 4FZ8H 3V0VB 4P2OB 1NAKL 3QH3A 2QADC 4GG8B 3E3QC 3ZKMC 5I0ZA 2GCYB 3CMOH 3MRIB 4OD3L 4ZS7H 5DD5L 5HHOA 1CGXA 5LGJB 3QI9C 2NY3B 2VZUA 4XCYB 2AJ3A 2X1QA 4JO1H 3V6ZB 1D5ZA 2AJUL 4PJ5A 1T5WA 3TPKA 3GJFK 3GO1L 3H9SB 2E9JA 3PWPD 3QUXD 2DKSA 3WIIH 4ZQKA 3VH8G 5CBEA 3VFSB 3O4LB 4MVBD 3HNTL 2W9DH 2NY3C 3DOSA 1FC1A 3GMPB 1A7QL 4TUKL 3MXWL 5J3HD 1WBYA 2FO1A 1REIA 3BGFB 1NCAH 5D1ZD 4KQ3L 2F5BL 4HIHB 5D7JC 1KENL 2QV2A 3J8F7 3FB8A 3SCMD 2Y23A 1LWRA 2DBLL 4OCRL 5CEZL 5TE7H 4ETQA 3JWOC 3T1FA 4LVOB 3TBYA 4PLJC 3SGEH 1JNNL 4HLZG 4QRQA 4ZSOE 2YRLA 1RMFL 3OL2A 3DYOA 2O5YH 4ELKB 4XP4L 1F4XL 3MV9B 4V1DE 2UWEA 3CPLB 3C08H 5B39A 3QUMB 5HGHA 3KXFA 2BHUA 3CK0L 3H9HB 5I75B 4L3CB 4GKZB 1FDLL 2E8ZA 4PUBL 4POYA 1OGTA 1T03L 1MCDA 4F80A 1U8QB 1INQA 5ICZA 3VWKA 2GT9B 2I27N 4UT7H 5CD3B 1JTOA 5H2BB 3FO1A 2BJMH 5I75C 2ZCKL 4L3EA 2R0WL 5JQ6L 4ODXB 1MCWW 2B39A 5D7IA 3ARGD 3B9EA 3QNZB 2I07A 2VDLL 5E8NB 3EYQD 1J0JA 4ENEC 4LCWA 5EZLA 4RWYL 5GJSH 1P5VA 1LO0L 4C55A 3C60B 5ALCL 3L7FB 5IIEB 4Y4KD 5ADOL 4EUPG 5H94A 4ZFFB 4JFQA 3EDJA 3KWWB 4WUUB 4ZODA 2EXWC 1I7UB 2HG5A 2KL6A 1S7XB 1A8JH 5C0NC 3VRJB 5L6YL 4KTDH 2AQ3A 3OAYH 4KROB 1P9MC 4RMUA 5D1XB 4QCIA 5D72L 3C60C 2EIEA 1HH6A 1TCRB 1ZA3B 3ABZA 3FQTA 1N3NA 1HWGB 2EIBA 3D87B 3A6OA 3EO9H 3MNVA 2V17H 2AV1A 4WI8A 2GI7A 3VXTA 1UGNA 3FZUD 5MEOA 3QAZB 2XN9D 4KROC 3MV01 5D1XC 4HLZH 4S0TD 4M7ZB 3QG6B 3DURB 1K8DA 5IBTH 2YUVA 5L2KD 3SDCB 5SWSE 5FGRA 2WP3T 3HR5A 4N0FA 4U6TA 4P3DB 3WKML 1ZSDB 1P7QB 3RKDC 4F15B 1XCQA 3LQAH 2Q8AH 2FX7L 4XH2A 3QAZC 1T4KB 4C4KT 3MGOA 4I48A 4M7ZC 4FHBD 3X3GL 4DW2H 3KPOA 3SDCC 1KTDB 1UQSB 4XP9L 2NZ9C 3BP6B 4AM0B 2YEZA 4BFIA 3WFEH 1QQDB 4F15C 3EIFA 1LNUA 3KPLB 2FGZA 1G9MH 5DUBB 3EW3B 3ULUE 5CS7A 5CZXC 1RZFH 1FN4A 4LPYA 2DQGL 3PL6C 4AEEA 4RIRB 1IAII 4HMDA 4D0CA 3ZT7A 5JPMB 1Z3GH 2QSCH 1F02I 3VFTA 1HHGA 2IPTH 3FONB 1JL8A 2L7JA 1FZKA 2AKRA 1V5JA 4I8DA 3IDMA 1WJ3A 4JFOA 1S8DA 2OMNA 4H88H 5E9DE 3PV7A 5F8QC 2EIZA 1NGWB 3MRFB 5MHSE 5ACLA 4HKJB 4G6FD 1M7DA 3TGXA 1D5IL 4WO4A 5F1SA 4NRYA 1F45A 1AXIB 3BPCA 1E4WH 4M61B 1BWWA 4WHYH 3UJIH 1I1RA 5EU5A 1NPUA 3H7LA 3QDJB 1HNGA 3H9SE 4KQ4H 1I4FA 3O6FB 4JKKA 1ZHBB 3O4LE 3F7RA 5LGHH 3QO1A 4YDVB 1YPZA 5I16B 4NQCD 5D93B 2Y07L 1I9IL 4IMLA 4JANB 1CDJA 3OXRA 1OARH 4NQTA 5C07D 5E7FA 5E6ID 3VXOB 4CGTA 1UACL 4PGBA 4P59H 2ZZUT 5MEQB 1J1OH 3O6FC 1EFQA 4RFEB 3WEXA 1WWCA 2GITB 3FCTB 3MOBH 3CFDA 4G3YH 1AGEA 1BREA 4JRXB 1RV6X 5D93C 2AJYH 3QFJE 4GAJH 1FO0H 1YDPB 1VEPA 2HFFB 4NKQB 1K85A 2P5EB 2PYEB 3GBMH 1FVDB 5KN5B 2DWDB 3QDGB 1SEQH 4GRLA 4X99B 4PRIB 1G7IB 3NA4A 4JRYD 4X4YA 5L7XL 1X5ZA 4B7IA 3GNML 5DUML 3VXUA 5IQ7L 1BZ7A 4GRWE 4TRPH 1A6ZB 4HCRH 3BWAA 3TF7C 4OZHE 1NBQA 4XGZA 3WDIA 3GMRB 4Z0XB 2ICWJ 4OKDA 4WW1B 1MRFL 5GGRB 4MD0B 3ESUF 1HKLH 2NYYD 1A7BA 2CDEA 4IOFD 3QEHB 1QEWA 3SOBL 4LLDA 4RRPG 3N85H 3QT2A 1AR2A 4HWEL 5IW6B 4U7KA 4UNVA 3SDAB 1P6FA 3QCTL 3V9FA 5E2TL 4M5ZH 1WQVT 2BVPA 5KJRL 1SBBA 2JE8A 1CD8A 3DSFH 2EC9T 1T7VA 1U58A 2GJZB 1KJVA 3IFPA 2VDRH 1PQZB 3QQ9D 2EDHA 3RNKB 2EEBA 4Z6AT 3SGKC 3UJTL 2HLFD 5E2WL 3SDAC 1E6OH 4C59B 3TYGH 1BF8A 1LO2L 2A0LD 4WUUE 3EZJB 3PIQA 2LU4A 4IOSD 1NGYA 4CN4A 3GMOA 3QUZA 4JFDA 2FWOA 5CHNB 4FG6D 5DC4B 3HC0A 5CP7A 4XVJL 1NMAL 4ERSL 3L7EA 2FJHA 3JZ7A 4I3SH 4LGPB 1JTTA 4P2RB 1NGXB 3MBEA 4AENA 1KOAA 5DMJB 3GI8H 5HY9A 5FO7B 3EOBB 2NY7H 5ICXB 3O3EB 4AIOA 4LASL 4UDUB 4EVNB 2C3HA 2VR5A 2P5WE 3QEQA 3O81A 4D8PA 4MX7A 3VFNB 2A83A 3WFZA 5C0CB 3MJ9L 4QGTA 1JHLH 1YEFL 1NFDF 3B83A 5BVJA 1GC1H 2IFFL 2X4SB 1IGYB 4Z76B 4PLKD 2VR4A 1FHGA 3A6CH 3WNOA 1CBVL 4PP2B 3D2UD 5IB1A 5IBLC 4G6KL 3U36B 1KACB 3F5WA 3BZEB 1IL1B 4XT1C 1CD9B 43C9B 5C0RL 4NIKB 5IQ9A 1KJ2A 5EZJA 5HDQL 4JHWH 1IAIH 5FKAA 1DE4B 2GAZB 3ULUL 1U92B 1CGTA 2R4SL 4DKFH 4MA1C 5E6YA 1ZVYA 4OGYH 2OTUB 1A3LH 1DVFA 1KEMH 3U0PB 3PP3K 4PY7B 3BP5B 1S7SA 1EHAA 5DQ9B 1BQHG 4P46B 1T7XA 4ONFL 3KDMB 3I2CH 4RGOL 1CLOL 2BXZA 2VLKA 2ATKA 3P0VL 3DXAD 1G6RH 4BK4A 3OGCA 1BIIB 1VEOA 3Q5TA 4LOUC 1DFBH 4MHHI 4WI3A 4ODVH 4QXUL 5F1NB 4P46C 5ENWB 4P4RA 3QDJE 1GIGL 4BUHA 3MRDB 4AEFA 1VFAB 3HUJF 1LEKB 3KPNA 4PB0L 4HV8A 3K2MC 2G75A 1ZS8A 4G9DA 5KAQG 3VWJA 3TZVD 4GBXB 1T80A 1OW0A 3VG0H 1Q72L 4YUEH 2W0PA 1FVEA 2I60L 3AY4A 4PBWD 1EEZA 1YMMA 5I1HL 4NCC2 2VERN 1KT2B 1I7RA 4K3DL 2VDML 4NO3A 4L29A 4JRXE 2DQIH 3ARFB 2VXQH 1NUNB 2QQNL 4MD4B 5A40E 3RZCB 3UBXG 4GBXC 1CVSC 1HYSD 3QNYB 1FJ1A 4TN9A 1NGZA 3FTGA 2PYEE 5AD0A 3QDGE 1KN4H 1B2WH 4YFLI 4IS6A 3IFLH 4ODUB 5CEXB 5I73B 5MERB 5BXFB 4Z7WA 3UYRL 3JBG7 3ARFC 4HUNB 3FT2A 1S7VB 3IDGA 4WU5B 3WFHA 3TYFB 3SO5A 1P84J 4G8GA 1U3HB 4UV7H 4ZDHB 4BJLA 4XCFH 5FYLH 1JUFB 1M6OB 1XH3B 4J6RL 3ZKSD 3D69A 1IQDA 1W0YT 2HFEA 5I73C 4PRDA 5HPMA 3KLSA 1C5BH 2DLHA 1GAFH 5DSCB 3V4PL 3TBWB 3BT2H 5E94A 2KQMA 3L5HA 2FLBT 3RNQA 5T1LB 1U3HC 3MLSL 5C0BA 3F7YB 3N1PC 5AYUL 6FABH 2XQBH 3RVXD 4W6XB 4LKCB 1AHWA 1I1YB 1LEGB 1EGJH 3FHQA 1INDH 3LQMA 4PLOB 4ZOEA 1OAXH 1MFNA 4ZOBA 3STBA 5ITBH 1TZIB 3N50A 3T0ED 2BVEA 3ARUA 3DXAE 3JV0A 5D5MA 4DN3H 4YHYB 1TETL 5GRXG 4UT6L 5IVXA 1J11A 3CSYB 2XTJE 3SBWA 4MDJA 1KCLA 4LARH 2VMFA 4HWBA 3EYUL 4YXKL 5IMKA 2ZOLA 2FYYA 1G9MC 1G1YA 3AVEA 5F3BB 5IOPB 1VACA 1BBJB 2OLDA 4HPOH 4YHYC 4QHLB 5HDLA 3QI9A 4S1RH 2AEQH 4P2RE 2AV7A 2XWBA 3QHTC 2Z91B 2CO6B 4JY4A 4XNXL 1D6VL 2VDQL 2X4QB 3TT3H 4IRSC 4KUCF 1AO7B 4G5ZL 1KPUB 1TZHA 2UV3A 1AQDA 3VGEA 1KB5A 1FZOA 4BQCA 3B5GA 2X09A 2O26U 3HPJA 4J4PD 3O4OB 1FLTX 5AUMA 5C0CE 4CDHA 3RVVD 1ACYH 1CE1L 3BDXA 3PV6B 3HZVA 4M43H 2AAVA 3TV3L 1F4YH 2RAMA 3OKKB 4OSUL 1DLHA 2H3NA 4X9BA 3D9AH 2HWZH 3MA7B 3HPLB 4PG2C 5D7JA 4F7PB 3P4LA 4GXVH 4K07A 4MAUH 2QSQA 3BH9A 2EDLA 4KV5F 3K8LA 1EV2E 3O4OC 1K2DA 3REVB 3WSQH 5TE4L 1FO0B 2QJDA 1Q9KA 4XBGA 4CVUA 5BQ7B 4QLRA 2VKWA 4F33A 5CGMA 3ZTNH 4CKVX 2J6EL 3INUH 5I1KL 4QRPA 2LTQB 1BQUA 1QKZH 2X9XA 1MPAL 3VRLF 3D3VA 1R3JB 1MLCB 3N06B 4KTEH 5EN2B 4N5ED 2F54E 1BFSA 1EXUB 1X44A 3SQOH 2PETA 5I71B 5HGBA 1CFNB 2LTQC 3PWVB 4MQ7B 3AROA 1TVHB 2FSEB 5HVFB 3GSWB 2XPGA 3QUYD 2ZNXA 1S7TA 2X4OA 2VRAA 4KKAD 5F44A 5ISZD 2I26N 1RY7B 2AXGA 2WMPA 1JK8A 1NL0H 2R69L 4HSQA 4AEHL 3KYAA 4IIQB 5I71C 4JG0H 3HE6B 1I8KA 1MQ8A 1RURL 2RQ8A 4YXLH 1WT5C 3HMXH 3OQ3B 5JW3L 3JTSA 3BN3B 1RJLA 4FZEH 5E00B 3CH8A 1GL4B 2OSLA 4ZO7A 1I9RL 4FFYH 5JR1L 2Y5TA 3L9RB 4IIQC 3HE6C 3OR7B 4M7JH 3BGMB 4PBVC 5J1AA 3G6JF 1U0QA 4JREB 4BH7B 3LIZL 1EMTL 3P73A 1UM5H 3KLAB 3BIBX 5L8KB 1HSBB 4YHIB 4FP8L 2ERJB 1A7OH 4X9FA 2YKLH 1A5FH 4LLVB 5JXEA 3SJVD 2DQJL 2NX5E 3FRPA 4XNQB 2BDNL 5E8EB 4KAQL 5INDA 3I9GL 1DQTA 3RWDA 5EBLA 3CFKA 4JREC 4YC2B 3DLQR 5ERWB 1JGUL 4OLYL 2M8XA 3DRTB 3Q48A 2GYSA 5CUSH 3FN0H 4X5WB 2IG2H 3QG6A 2C4XA 4HDIB 1UB5B 1U6AH 2GK0A 1I8IB 1UWXK 3JTTA 1T7YA 4OLUL 4Q9CA 4OCYH 3UTQB 1RJYA 2ZSVA 3V5KB 1T5XA 1T2XA 1GC1C 1DBAH 4K3EL 4LEXH 3PQYA 5I76A 4YAQA 4PV8A 5JW4N 1K5NA 1JGEB 5C09B 3PL6A 2EYSB 2VXVH 4S10A 5CZVL 1Z5LA 4QHUA 2BNUB 1KTLB 4MNQA 2BNQB 2RB8A 3EFFA 3NCJL 1I1AD 3CCHB 3X17A 1VEMA 3WHE0 1QD0A 1WLHA 5LWYH 5IHZB 4DJMA 3RZWA 4DZ8A 5HHQB 5LQBL 1U95B 3HUJE 1DDHA 3O2DA 4OZGB 3QIBD 3QCUL 1SEBA 32C2A 4KY1H 4DKAA 2QQLH 1MHHA 1FZJB 4NN5B 4G8EA 1G6RB 5IJKC 3DV4A 5DURB 1TZGL 4G9FB 4HQQH 4PTTB 3ILPA 4FQ2L 4Z95L 4MJIA 1VFBB 1P7KB 3IJHB 4YHNB 2X70A 1MNUH 1AO7E 1T22A 3RWFB 5KAQF 3DX8A 2DDQH 3OAUL 1MH5A 3K3QA 1NGWA 3LAFA 4FQ1H 4IM8A 1YMHA 4EBQH 1E4XL 4M7KL 4K94H 3QYCA 4NN5C 2NY6C 4NJ9L 3E6HB 1I9EA 4L9LC 3G6JB 3MRHA 4H1LH 1CD1A 3LEXA 3CLEL 4JPKH 1P4BH 3SGJC 4PJDF 1JWSA 2HT3D 4RA3A 2R0LL 1P7HL 3GSUA 5F9JB 5E8OB 3FO2B 4YGAB 2Q7YB 4NC1E 1CFBA 1FYTD 3VGBA 3ARBA 3OWEA 4HPYH 3S96B 4R96A 1WFUA 3JV4B 5IF0B 2EE6A 2R2EB 4G6JL 4QRTA 4YDIH 2WIIB 5IMOA 1KPVB 2JELL 1NEZG 2AGJH 1JZ3A 2IANB 3WFDL 1HHKB 1V7ML 3ARYA 4F9PC 3UTSA 3QWOA 4LVNB 5C8JB 5BRZD 4AT6A 5I1JL 4APQA 3EYFB 3GI9L 3ZE1F 1F2QA 3FFCA 1ZT4A 2PO6D 4FFWD 4PRIA 3HAEG 4IOIB 1KLGB 5I19H 1CLCA 5C86A 3DX7B 1U91B 3ZKND 4S0SD 3CJJA 1MIML 4R7NA 2W9LA 1FG9C 3W0WE 4HBCH 1A1OB 4PB9L 4Z0XA 3RWGA 3NA9H 5BMFL 3ARDB 4XCNA 5F6HI 5IV2B 3N9GH 1YYML 2APXA 3MJ8B 1U8NB 4J1UA 3QEHA 4WDIB 4OQTH 4UBDD 4M9PA 1XIWB 1HH9A 3O8XD 3NZ8A 4QXTB 4HX1A 4XPHL 3SGKA 1KCRH 3V0WH 1IFHH 4WV1C 4XCEA 4MCZB 5DI8B 1NBZA 3ARDC 3O3DB 3P4OA 1Q9WB 2YC1A 1HHHA 1Q1JL 2A6JA 4NUJA 3VXSA 4UUJB 5SWQA 3NH7L 5IB2B 1MEXL 2RFXB 3U30B 1AC0A 5SX5H 4Y4HD 3TPUA 4ZAKB 5FM4A 1N5AA 4HUWB 3WHE1 2VISA 3PJSA 3KHOA 3U7AA 5FYKD 4F9LA 5CILH 4HH9A 4L8BA 4BFGA 3BI9X 1EFXA 3KPSD 5TF1L 2W07A 1QHOA 5HYJB 1XGQA 4PJDB 3SPVA 3K4DA 1A7RH 3U30C 5FO8A 2CDFB 5DMIH 3U82B 1E4XI 4KV5E 5F96L 2D31B 5GRYA 1HEZB 2Y06H 5IJVB 4ZAKC 4X7EC 2IMNA 2OP4H 4OV6F 5KW9L 4F57H 1IT9L 5E1AA 3VJ6A 4KK5C 1U3JA 3JUZA 2EO1A 7FABL 3OX8B 2DIJA 1UM4L 5JW4R 1JYWA 2W59A 1NFIA 5D9SB 1FGVH 2EYTA 1A4JB 4JPWH 1JHTB 4UILH 4RAVA 3STZB 3BWUC 4X6BB 5J13B 3VRLE 3EGSB 4Y19B 3LEYL 4X6EA 2EDJA 4R4BB 4LSRH 3QPXH 3U36A 2FECL 4KRPB 2CKBL 1IL1A 1INEH 2ICES 3DHJA 3Q6FB 5C09E 4DUVA 3GSNA 3DGCR 4K9EH 5IFHL 3G6AB 4N0UA 4TVPD 1IVLA 1UB6A 5BZWB 4JKLA 4NKDB 3CZFA 1RFDH 1KJ3H 2AK4D 2VXUL 4F7EB 1T0PB 3CIQA 5GHWL 3BVNB 3ULVF 1CIDA 4B5EA 4NKIH 1F8TL 4KRPC 4Z7UA 3O6MH 1HXMB 2FHBA 1QR1A 2GKIA 3DVIA 1YEGH 3IXTA 4G9FE 4OZIA 4UIMB 4WU7A 1LO3L 4KI5D 5C0AD 3UPRA 1R5VB 2VDKH 1JMXA 3FN9A 1KCVL 2VLJA 2YR3A 4FTVA 2DM7A 1QSFA 3QUXB 1YEJL 2X1PA 1D5MB 1SJVA 5B8CB 4LKXA 5KZCD 1E28B 4PV9A 2QTEA 5DMGD 1UXWA 1N0LA 4WTWA 4Q9BA 3O3AB 5EOTB 1NMCB 3BIKA 3G6JE 2FX8H 3MXVH 2B1HH 3IB4A 3D0VA 2VAAB 1LK3H 2A77L 1AC6A 4HGWA 3T2QA 3U0WH 4KZEH 1T21B 3P9LB 1WFNA 5CEYA 3QUXC 4OFKA 5F70A 3ZDYF 3QR2A 5B8CC 2OMBA 3TIDA 4BUGA 1GSMA 1Y18A 4MVBC 2GIYA 3SCMB 3GSXA 5E2UH 4CL7A 3KNBB 3G5YB 1F4WL 4IJ3B 1NMCC 5D2LA 5J3HC 2Q86B 2ATPB 1FL5B 2DQDL 5MENA 4C58B 1EAPA 1JZ2A 5F3HB 1NCDL 4KK6D 3ZE2F 5J57B 1YQ2A 4XHJC 1LILA 3ROLB 3P11H 1ZWIB 3MODL 2ADGB 3SCMC 4ZYKB 4ONHA 1MWAA 4LHUG 4IJ3C 4NQED 4TSCH 5EA0L 4JDZB 3IU4L 5FYLE 2MQ0A 5EBMA 3QZWG 2BK8A 4FQCL 4OZ4B 5MERA 1HK6A 2PXYB 5AYQA 1RUKH 1I85A 2EECA 3R0NA 2P43B 1VGEH 2F53A 3NCYS 2HKFL 5IW1A 2VITA 3E1F1 1U8JB 2YD2A 1OCWL 4YBLB 3CFCH 5J1TC 3CD4A 1QO3A 5C7XH 3FQXB 4K7PH 2FECI 4K3JH 5DFWH 5DSCA 5DFTA 2EH7L 4JN1L 1R3LB 4LIQL 1J0ZA 1YC7A 4NKOA 5E4IA 2X4NB 4UDTB 3SDYL 5JO5B 1IGJA 3B4NA 5IEKB 4JDTL 2VE6B 1I1YA 4YBLC 5HHPA 5C0AE 4PJ8D 1JPTL 4CNIB 1TZIA 1CI5A 3ARGC 43CAA 3VRIA 4XMPH 2HJKA 3EYQC 4NQDD 2CDGA 1X3DA 2B1AH 4HMEA 1H0DA 1MRCL 2K3TA 4Q7DA 1ZEAL 1BFVL 4W4NA 3FT4A 3BQUB 4I0PD 4ZPTA 1RZKL 5IR1B 2DI9A 5BO1H 4OUUB 3MJGX 3QRFM 5ACZB 2BSSA 4IRSA 1T1YA 5HYJE 1FG2A 4PJDE 4WRLA 1PKQA 1DBML 1ZE3C 4HKBA 1QSZA 4U1HB 5KSUA 1G0XA 2H26A 4WWKB 3LSOB 1DN0B 1EVUA 3BQUC 5I2IB 5GPRA 4H8WL 5ADPH 2FEEI 5E8PB 2FIKB 4MXQD 2NY5H 3IKCA 3NOIA 1P5UA 3L5WA 4H1LB 4PG2A 5IT2L 4HIEB 1RIVL 2OJEA 2AXHA 4YEFA 3FZUC 3HE7A 4Y88A 3ALXA 1IM3B 3BPOB 4LCYB 2YPLD 4K94C 3AB0B 3L1OL 4NQUA 3RWIA 3PABB 3BKMH 5GGUA 3VFWA 4Y19E 2EDNA 3ZE1E 1B6DA 3T0AA 2ADJA 3SO3B 3MLWL 4UV4H 1BX2A 2MPAH 3MRGB 1VKXA 1K8IA 1KFAL 4BQ9A 5IB4B 4IRJD 4U49A 3BPOC 3VFUA 1IILE 5C0FA 3QXVA 1JPSL 3AB0C 5JORA 3IYLW 2ZUTA 2DOCA 3RY6A 4O9HL 3BZDA 2NNAB 4GAGH 1X6NA 3SO3C 2EDKA 1KJMA 2X4PB 1MCJA 4XRCB 1J8HB 2HVKA 4LSUL 2FR4A 5TE6L 5HYSG 3ZDXF 2JB6A 1SQ2N 4FQQB 5F1IA 3SKNA 3BP7B 4OCWH 1GYAA 5FUCC 3K4ZA 2X4TA 4WJ5B 4DWHA 4Y16A 1DQDL 3MLYL 1DBBH 1WVZA 4GW5A 4FQIH 3X3FL 2NY4D 4PRPE 4OV5B 4PBXA 1XCTA 3U1SH 3T0DA 2CSPA 2NXZD 3MRNA 1AD0B 2WQRA 4NQCB 2YA0A 1OSZB 4DCQA 1RIHL 1NBVL 3GMQA 1KXTB 1AD9A 5GJTH 5C07B 2X7LB 1HHJA 1BJ1H 5FB8A 5E6IB 3DUUB 2F74B 5SWZD 4PJ9D 1DQQA 4KMQA 4GW4B 5DR5H 2X10A 4Y2DB 4GJTB 4ZUWB 4P2QA 5E8DH 1HINH 3MR9B 3KPRA 2FCBA 2ARJB 5BZDB 2DLTA 3NPZB 1FNFA 4XC3H 4PJFA 5E6IC 3S35L 2QLVB 3VGHA 1O7SA 1Z2KA 4R3SB 4Y2DC 1MFBH 1OAZL 2MFNA 4PJCA 4U2ZA 4HWUA 5DVKA 1KPRA 3C8KB 1VCAA 1WISA 1N6QL 1Q0YL 4KDTA 5D70L 1OLZA 1BVLB 1K4DB 5DJ6B 5F7EH 2YD5A 4FQJL 2D03H 2DYPD 2WM0A 4B41A 4M7LL 3HNVL 2J7LA 4YHIA 3H3BC 3VU2A 1A9EB 5TGBB 3KJ6L 1D3CA 1MAMH 3KXFD 5ICYB 4YGVA 4R0LC 4O2CA 2JK5B 2WIMA 2QSTA 1KG0A 2R0KL 5GS1B 3D0LB 4E41A 3HAEB 5EUKA 5I8KH 5I15H 5IWLA 4HEPG 3ULVE 2FHFA 4JFFB 1A4KB 4I77H 2NYYC 4IOFC 2CRZA 4PGDB 4F3FA 5CBAB 5SV4A 4X8XA 4KGLA 2Q3ZA 4ORGA 5GS1C 5FK9A 1YN6B 3WN5A 2YPVL 4ZFOL 3MBXH 4LCWD 4DZBB 4OJFL 4YE4L 5GGVL 4HFUL 5AZ2L 4G42A 5IG7A 3IDXH 4X0KB 4GAYA 4XPTH 3MRJA 4K9EC 3CAFA 4HC1H 3KYMB 5IJKA 3B2VL 1WIOA 2A74B 2VDOL 5FF6B 2HLFC 2ZJSH 3LS5L 2A6DB 3N1QC 3OKOB 4X98A 5JLZB 3H3KA 4JM4L 5T5FL 4M6OL 4EI5B 1EHNA 4DUWA 2YMXL 4K23L 3ZDYE 4OLWL 3T04D 1SJHA 1OT1A 2P42B 1MFEL 2XNAA 5EU3B 3S3JA 2XZZA 4K7FB 4XPFH 4RZCA 5IB5A 1Q9LA 3VXMA 4L9LA 2W9EH 2H2PD 1CF8H 2GSGB 3DJ9A 4D9QE 2CGRL 3FMGH 4LNRB 4YDJA 3MLZL 1MCPH 5DA0B 4GKSA 3HLAA 3ZE2E 1RZ8B 4NBYB 3D2UB 4HJGA 2DIAA 3RL1B 4QO1A 4B50A 2DWEA 1OP5K 1I3VA 3K81A 3OG4B 3RGHA 2H8PB 1TJGL 1VADB 2VLRA 1T1WA 5D6CB 1B4JL 4XWOD 1L7IH 3H0TB 4PLKC 3DETD 2Z31A 4PJAA 2VZOA 4RQQB 2H9GB 2WV3A 4PJXF 1CICA 3I84A 4NFDA 4U0QB 4ZPVB 1X5JA 3RWJB 4JM2D 3IVKA 2IPKA 2FJGA 3BDYH 4NP4H 3BZFB 4D0DB 4PGEB 1A0QL 4IMKA 4HIJA 2XRAL 3ULSB 1VA9A 1ONQB 3ZDZF 5DHVA 1ITBB 1J8HE 4HF5H 3JV4A 2QHRL 1MY7A 1ZLSL 2IANA 5HHMD 3SKJH 3WIHH 1T20B 4M6ML 4OFYD 1XGYL 5DMKA 4HK3J 2BMKB 4X8JB 3ZTJH 4G6ML 1S9XA 4YNYA 3O2WH 2N7AA 2P8PA 3E2HB 4FQXB 3VXQB 4JY5H 4S1DD 4NHCH 5L9DH 5CCKL 4IRZH 5JHDB 2XWTB 1HOCA 4NT6B 2G9HB 3QWRD 5IVZA 3OKMB 3L5JA 4XBEL 4WV1A 3ARDA 3BO8A 4H26A 3S37H 3K7UA 1A2YB 5EZOL 1MUJB 4FQXC 4QRSB 4HUVA 1DBKL 2X4RA 4AMKL 3G04A 1ZA6B 5FGSA 3P77A 4S2SA 2R2CA 4TPRL 5CMAB 4A2LA 4Y1AD 1CG9B 2EDEA 5DFVD 3KYNA 1QRNA 3M17A 4P3CL 2PTTB 3RPIA 4YIQB 4LHJB 1HCVA 1N4XH 4P5TA 3KPPB 1BGXH 5CFHA 4XPGL 3TH3T 2J2ZA 5A2JH 1FH5L 3GSOA 4NM4L 5GGTL 5KTEH 4OFVA 3FO0H 1RJCA 3BZ4A 3F58L 2G2RB 3S9DB 2FDBP 4XB7A 5FOBA 3M8OH 4JFXA 1A7NH 4Z0BH 3D85A 1R24A 4UU9A 3T3MF 3W9EA 4R7DA 5IFJB 2V2WB 4WI6A 1KIUA 1J0KA 3DVGB 12E8H 4PJXB 3RWEB 5IJVA 1T04B 1KELL 4FQLH 4PJHF 1KTKE 1EBPA 3ULVL 4Q58C 5E5MA 2XIDA 4XXCA 1RZJH 5IHLB 1OWWA 5GGVY 5KVFH 3LV3B 4JFFE 3JWDL 4ZSOA 5L0QB 1OP5H 2NY5C 1BAFH 2IQ9L 4L8SC 1H5BC 2DQTH 4GLRH 4PRHD 4HIXL 3ALPA 3ZDXE 1KNOB 5DJXA 4PYGA 1ED3A 4PG9B 4F2MB 5JW5B 4AG4L 4PRNB 2CUIA 2Z93B 4V1DA 4Z7VF 3QULA 1ZT1B 1QSEA 2F58H 4KHXL 2XZAL 2HP4A 3EGSA 3EOAB 2BVQB 5L0QC 2XYCA 1NUDA 4JQIL 1GPOH 4R4BA 3MV7D 4WTXA 3V4UL 5FYJH 4NZUL 5EB9A 3P9MA 5HJ3A 1KTRL 5EZIL 3WLWD 4GSDH 5C3TA 5FYKH 3FO9A 1V7NL 1O7VA 2LFGA 3FJTA 4FFVD 3WD5H 4OCSL 1X5GA 3V79C 4WFEE 4YHZL 2X1XR 2Z8WC 4JFDD 2CLRA 3F7VA 2CLZA 3QXDA 5EORH 3BKJH 3SY0A 5I30H 3V52L 3MBED 2IBZY 3RTQB 4QXWA 1UWEH 3RA7L 3MA9L 2UVFA 4NJAH 1T66D 1L0QA 1CD0A 4OF3A 1F97A 4JE4B 1QA9A 2AJVL 3QEQD 4LF3A 3SKOB 3ZYJA 5DDHB 3QUXA 3PWPA 3VXNA 3MUY1 4JKWA 4MDIA 4YPJA 1MFCL 1J5OL 5KOMC 2EYRB 4G6AD 3C6SA 4QXGH 1EBAA 4XNMA 2VAAA 4NNPH 3U4EA 4NUGH 1ZLUH 1XGPB 5D1ZA 1H8OA 4LHUD 1J05A 1UVQB 1OF2B 3OB0K 2XKNB 4I4WB 5GS3A 4PS4H 2GJJA 1JVKA 2O61A 1GXEA 2Y9RT 1IGCL 3MRCB 3QSKB 4JO2L 3OAZK 3IRZA 2FGWH 4TVPH 5K9QI 5ELIA 1U8KB 4LSPL 5I9QB 4DN4L 5F71A 5I66B 3QRGL 4JGUA 1PZ5B 1YECH 4EI6B 1WWWX 1QUNA 1UCTA 3MJ9A 3BJ91 1DVFD 2C26A 2VWEE 1NCCH 2Z8SA 4Y5YB 1UEMA 4ZYKA 1JRHI 2DN7A 1NCNA 3G5VB 5I9QC 5CP3H 1DBJH 4N9GA 3UEZA 5GRVK 2B4CL 4FQHB 5EC1A 5B38A 2DJUA 5KS9F 3PWUA 3UYPA 2Y6SC 3WS3B 4XPBH 1XF4A 1JGDB 4N5EC 1WEJL 4Y5YC 3HMWL 1NC4D 2R2HA 2RCSH 3CUPB 4JFHE 3PWJA 2MQCA 5JHDE 1KCSL 4KVNH 3CDCA 3VCLA 3OKLA 2C4FU 3SDXA 4KKAC 4ZO6A 1W72B 3VI3F 3ARGA 3S5LA 2IQAB 4LSTH 2V2TB 5E9DA 1A6WL 3CFBB 1G7LA 1KN2H 1P53A 3BD3A 5ACMA 3NPSC 1YA5A 1EO8H 4KC3B 4YFDB 4P57A 4Y4KA 3OZ9L 3L5IA 5I1LB 3TH2T 2H32A 3AC0A 1EPFA 2BNRD 2YZ8A 3MRMA 4N8CL 2JCCF 3FB5B 1GZQA 4L4TB 3VFPB 4XVSL 2OK0H 5TDOB 4K55A 5I6XC 2GK2A 3CSPA 5K93A 2PYFB 2F19H 1A64A 3M1BB 2EEAA 4PREB 2CXKA 3MRRB 2AEIT 2AVGA 2EDRA 3ZSTA 1XT5A 2UUDK 4XNYH 2ZSWA 1YY8B 2BFVL 1CN4A 4MNHB 5C0IB 4DTGH 4HUUB 1GGYA 1XR9A 4U1HA 2XN9A 5ID0B 3TFKD 4Z8FH 4PJXE 4TSBH 1TQBB 5HDBF 4GMSL 3QFJA 4P23B 5L2KA 3EDDA 3DGGA 1HHIB 4I0KA 2NR6C 1BOGB 4U6HA 1ZLVH 3IAGC 3ZDZE 3WXWL 5CSZA 4RMSA 4TULH 3OKEB 4NQSB 4U4BA 4ZXBB 5ESQA 3BAEH 4OM1H 1FNHA 2HVJB 5CAYB 4LU5L 3CLFH 3RUGA 1UH4A 2R0ZH 2ORBL 1HI6A 3MX0A 2DLGA 1Y0LB 1CDGA 3TNNA 4RGND 4OZHA 2D7OA 1JHKL 1TIUA 4W81A 5EFIA 3BX7C 3O2VH 3RX8A 5I8OL 4ZXBC 4UOW1 3EYOB 5M95B 1CIUA 1A6UL 2Z35B 3EOTL 1LE9A 4YK4B 3V5DA 4M3JA 4KK9D 5DZLA 4M1DL 3ROOA 2QSVA 4LCIH 2FZ3A 4YXHH 3RAJL 5F88A 2P8MA 1T1ZB 4TNWK 5TPWH 3BPNB 1XGRA 4Q9RL 3OPZL 1S9WA 5A3ID 2VDPL 5LBSL 3TWCH 1KLUA 3LDBB 3CXDL 4RAUB 3ARSA 1ZHLB 3MGTA 2GSIB 5GSVB 5IK3A 3LN4B 1C5DA 1IKNC 3S6CA 1VGKB 3MNWB 4BQ6A 1ZGLA 1S9VB 3MMEB 5EO0A 2B2XH 1NCWH 1DP0A 4I2XE 2WBJD 3DECA 5HYIA 1C16A 2JCCB 2VSCA 1AJ7H 3VXRB 4EDXB 3L3DB 4MAYD 4P9HH 4C83A 5D7KD 1JPST 3NGBB 3ILQD 4OQTA 1UC6A 2DLEA 1SJEA 3ZKQD 3G6DH 4NQCA 4YHKL 4OZFH 5HVHB 5I1GH 3TO4B 4R8WL 5IVOA 2V5YA 4WHTB 3U2SA 1QZ1A 5C07A 2BVOA 5E6IA 5AWNH 3LH2L 3PHQB 1UT9A 2XY1A 2GJ6B 4X7FC 4GW4A 3T3ME 1BMGA 1FYTB 4NQVB 2W0FA 5LXGH 2FX9H 1G7QA 3NGBC 1F2XK 4NWUL 4LLQA 5HHVL 4L5FL 5DO2D 1JRHH 5HVHC 4PJHE 2HT3C 5BZDA 1FL6B 5T1DH 5HHXH 3B6SA 3GJEA 3WFBH 3DPBA 1S5IL 5BRZB 1MJ8H 5CLWA 3TN0B 4ALAL 4LAQL 1N8ZA 3RWHA 2PO6B 2HRPL 1MF2H 4JRYA 4UTBL 4TUJB 5ANMA 3E8UH 4EOWH 4R0LA 2UUDH 1IM9B 3DROB 5I1EL 4Z7VE 1MJUL 3MRBA 3QIUB 3DUSB 1MLBA 3H7BA 4RGNE 3TCLA 2D7NA 5F7KC 3VXPB 1SY6L 4RMQA 1GJIA 3Q5YA 2EH8H 3TBVB 5HHNA 1CFQA 4JZJA 4GRMB 2PO6C 3L3KB 4FFWC 3U4BL 4G7VH 3KR3H 1RU9L 1KIPB 1A6TA 3EOYG 4AEIH 3ZKNC 3MLXH 3QIUC 5GS1A 3UO1H 5T3ZD 4YHPB 2J6EA 1K3ZA 1JBJA 4K8RD 4KKBD 4X5XB 1RZJC 4DGIH 5KSVB 4CVZA 3U6RB 1OTSD 2B1AL 3ARPA 4UBDC 1CQYA 4U1LB 4CMMA 1L0XA 1OD9A 5J9PA 1IGFH 1YJDH 35C8L 4RDQG 5C2BL 4M7LT 2BSRA 1RZGB 3OKDA 1YN6A 2VABB 4WI5A 4L4TE 5DRXB 4WCYL 2ZCLL 3LKOA 3KPSB 3OGOE 3GUTB 1A1MA 2MMXA 5DJZB 2BVUA 3WUWG 4V2CB 1A6VH 3I6KA 5GRUH 4HAGA 5D2NC 2BZDA 4Y4HC 1A6AB 2A73B 3UTPE 4QY8A 2H6PB 4XP1H 1I7TA 3IAQA 3T4YA 2E7LA 2EE3A 1N7ML 1HYRC 3B9KD 3G08A 4N1HB 1BQSA 4WI7A 3LMJL 5JXED 4HJ0C 1JF1A 4JFZH 2BOCB 4LLUA 1NGPL 3T09A 1KBGL 4YPGA 5KG9A 2AERT 2YPKA 4OI7A 2HTKD 2BXYA 1BPVA 1JFQH 2D4FA 3ES6A 3AFLA 3O6LH 3FB6B 2ZKHH 1S9KC 4JPVL 1MVUB 3A6BL 1FQ9C 5DGQA 1BD2D 1ADQL 2AJSH 2VH5L 1G9NL 7CGTA 5JHLL 1DQLL 4QOKB 3QHFL 1N2RB 2BP3A 1M71B 1T83A 2DRUA 4PR5A 2HMIC 1RUML 4D3CH 1IAOB 4PLNC 4WFGD 1KF9B 5JOFA 1EEUA 3TVMB 1PY9A 1IZJA 3P4NA 4X83A 1UA6H 4O2EB 1IQWL 3EFDH 5IEHA 1U93A 4NRXB 4LSDA 5D71H 3B3IA 3C2AH 4MNQD 3FRUB 5DD6B 3LB6C 5EU4B 1DANU 1EHLL 3LQZA 2LAAA 2Q76A 3EYSL 4CRPA 1QFWI 2R23B 1A1NA 4OKVA 3D18A 4HXBH 5A2KH 3TVMC 4F58L 3HC4L 3QEUA 4H5SB 4PJ7A 1YEHL 5DJ2B 2J1KA 3QJFB 3P30L 1UG9A 1KCUH 2AABL 3KJ4B 2IAMB 3VI3E 1HNFA 4QHKI 3W82A 4Z7OF 4LMQE 2HJLA 2P46B 3O3BB 3DXAA 3L5XL 2MHAA 1CTNA 1C5CH 5KZCB 5I17B 1CFTB 3WYRA 2GTWA 4U0RB 1BLNB 5I18L 3P4MA 4YFEA 1RJZB 1TTGA 3PDGA 3CC5A 4OD1L 3C6LB 3KJ4C 4ELMF 3VA6A 1JGVH 4KI5C 2JCCE 3VXRE 3MCKB 3L3GB 4OLVL 1FL3A 1QVOB 3GBNH 4EDWH 1CDIA 4U0RC 1F6LL 1QNZH 1MI5E 1IGIL 3TZVA 4TQEL 2NY0D 3C6LC 5D7LB 3CVHB 2J4WL 3MPCA 2GJ6E 1CDBA 3VFRB 4OLXH 2NXYB 4EEEA 3TT1L 2N4IA 5I1CH 4YBHA 4R4NC 4G43B 2O5XH 1CFSA 3FB7B 2ICCA 2PTVA 5FO9A 4U1KA 3FQWA 4M48H 1L4IA 5HI4D 1OY3B 3DO7A 1CK0L 5KVDL 4UQ3B 4L8DA 1SMOA 2XV6B 3HZKA 3LKRA 2Y25A 2YD1A 5GRWA 1ZHKB 4WFHE 4QYOB 4KK6C 5L88L 5GS0L 1BVKB 1CYGA 3QA3A 3CVIH 1EAJA 2X4UB 3UTZB 4APQD 1YEKH 2BY0A 3AREB 3GDBA 4D0BB 1M7IB 1G7MA 4BZ1H 3L3OB 4JFEB 3HNSL 1H8NA 2HN7A 2UY7A 3OR6B 2YD4A 2CLVA 5E5UB 5EO9B 4L8SA 1H5BA 3GRWL 4YHLH 3N1FC 4OT1L 3MTRA 4PD4K 4UB0H 3DO3A 1CDCA 4X7DC 4LSSH 1OPGL 2Z9TA 3AREC 3MCLL 1F4HA 2I9LA 5T5NG 1L9MA 1JPFB 4HZLB 1W72L 4RFOH 1PKOA 3AXLB 1MHCA 4U1MB 2IMMA 3T08A 2F54A 1HILB 4YHOL 3T0EA 5JW5A 2D7MA 4R26H 2HTLD 1XF5A 5DWUH 3C5ZB 2G5BA 2VUOA 1YEDB 2HAZA 5GSRB 4MNGE 2CMRL 5JW4M 3HN3A 4P49A 4ELMB 1NUFA 1S5HA 2UYLA 3S36H 3MYJA 1E6JH 1IEBA 4HKXA 1WCBB 3HCVA 1GVIA 4N68A 4O2FB 5DJ0A 2R56L 3LKSA 4GKNB 4U1JB 4OCNC 3V6OE 4YWGL 1IC7L 3PHOB 4H25B 3UTTE 4YDKL 2IF7A 1MSPA 5DTFB 5DJ8B 4GG6B 3RDTA 1GHFH 5J7CC 5A1AA 4HH8A 3FOMB 1FLRL 2XT1B 4MWFA 2V7HB 3DV6A 5C70A 5ITFB 2I9TA 2EDYA 4TNWF 1H3VA 4J4PA 3ZE0F 1F11A 4I0CC 1DLFL 1NFDA 1BOYA 5IFAL 1I9JL 3UROR 1P4LA 4OZFB 4F7MA 1BVZA 1YYLH 4Y8DC 4MXQC 4M93B 4WY7H 1BEYH 3MRPB 3TC9A 4CMHB 1ZT7B 5DGRA 4P9HC 2UWEF 5GGSY 2ESVD 2VXTL 3TNMB 3QHZL 2YD6A 5K9KB 2NX5A 4L1DA 1CGYA 3GJFA 4P5MA 1QFWH 1ZHNB 3HC3H 3RGVB 3T8XA 4X6FB 4M93C 1DL7H 2HFTA 1A14H 2BC4B 2E9WA 4CMHC 1KB9K 2JB5H 3TA3B 4DGYL 4HS8H 1NLDL 2W60B 5GGQH 1GH7A 5T3ZL 1B0RA 1KCKA 2ZWLT 3FQRB 4K8RL 5JUEH 3NACL 5EC2B 3H42L 2R8SH 3RGVC 4F7TB 4UT9L 5GISH 5D7IF 4WENB 4P4KD 3HA0A 2E6QA 4WGWB 2DQCH 3QH3B 1C08A 1BZ9A 3QXAA 3TA3C 1EA9C 5HHOB 2VO5A 3NFSH 5FA4A 5AAWA 4WFFD 3I6LD 2AJ3B 3VD3A 1D5ZB 2CKBA 4PJ5B 5CD5C 1T5WB 2YK1H 3QUYA 4ODTL 4OIIL 5T3XD 4ZQKB 5CBEB 3MLUL 5ISZA 4TTDD 1U8LA 4NZTH 3HUJA 1S7RA 2V2XA 3MUZ1 1OM3L 1WBYB 3AS3A 4XI5D 2XA3A 5J12C 2NXZC 4I9WE 1GCFA 4CDGC 3ZZ1A 2LAGB 2FATH 5LG1A 3ESVF 5ESVA 1Y6MR 1AFVL 1RIUH 1W0VA 5E99L 4N8VA 3FB8B 2VQ1A 1QFPA 4PJ9C 5JXAH 4ETQB 1CTOA 3T1FB 4NHUA 3TBYB 4GXUN 3H3PH 2WUCL 3K2UH 4LPCA 1ZVHA 4QRQB 1YJDC 3HI5L 5I1LA 2ADFH 4OFPA 1LO4H 2HKHL 2DYPB 4KXZI 4H0GA 5BS0E 1AE6L 5DEFB 3GMMA 1U9KA 3W9DA 5C6TL 5KVGH 2IGFH 3V2AR 4WI2A 4JKPH 2UWEB 3M1BA 3SE4C 4PY8I 5B39B 5HGHB 3SJVA 2E3VA 1J1XH 3KXFB 5DD1H 2HT4D 3WUZA 1FNSH 4FMKA 1Q94A 3TBTA 3PE9A 4JFEE 5F7WC 4R90L 1NANH 3RJQB 1OGTB 1FIGH 1LK2B 3RHWK 2FD6H 5FA3A 5DC9B 4ZFZA 4ESKA 1INQB 5ICZB 4B7LA 2F53D 3VWKB 2K7PA 3KLDA 1NDGA 1ZGLP 4D9LH 4FNLL 4HJJL 3FO1B 3U9PH 1JCKA 1LGVA 4L3EB 1BOGA 5D7IB 4J8RA 4M1GL 3WIFA 1GGCL 5TQ2H 5FUOL 1J1PL 3HG1E 1CGSL 4LCWB 5EZLB 2HFGL 4J3SA 3VWKC 4Z7OE 4QGYA 2KZ1B 4NPYA 5BV7H 3MGAA 4IDLA 3B2UD 5H94B 2ZOKA 4JFQB 4CADA 2QQQA 3W0WA 2HG5B 4ZTOL 4LP4A 2RBLA 1I1AA 4ELME 1Z0MA 1U8HA 4NO5A 4ONGL 3IF1A 4EKXA 3HKFA 3IJYA 4FRWA 4QCIB 1OAUL 2B4CC 5DMYA 4LDLB 4PJBA 1IKNA 3QIBA 2XZQL 1HH6B 4JO4L 2G60H 4G7YL 1GGTA 1G7PA 3FQTB 1N3NB 2E7MA 3QEGH 5F7FA 4WEBH 3MNVB 5MEOB 2AV1B 3VXTB 5IKCA 4MXWL 2P48B 1PLGH 2QEJA 5J4MA 5F89A 3IDJA 1K8DB 1X5XA 1VGKA 3BN9D 1UEYA 5SX4I 1X5YA 5GZND 4L1HA 3B8SA 4N0FB 1HIMH 4ONOA 1XCQB 3NIGE 4ZUVA 1C8PA 4GW1A 2GUOA 3HE7D 4XH2B 2XA8L 3NN8A 3MGOB 4I48B 4RFNB 3KPOB 1I1FA 2AI0H 4KRLB 5F7UA 1RVFL 4OAWA 4DVRH 4NM8H 1B90A 2YEZB 5D1QA 4BFIB 3IKKA 2MJWA 3PXHA 1IBGL 1LNUB 1Q8MA 2EEDA 1DQJA 2J8UB 3TO2A 1U8OA 4JZNA 4U1GB 2OL3L 1FN4B 1FYTA 3T77A 3U0TA 4XWOC 1G1CA 1OSPL 1CT8A 4RFNC 2W0KA 4D0CB 2E9IA 4N90D 4XP5H 4M5YH 3VFTB 1HHGB 4HW6A 4XC1L 1G84A 4JM2C 5HHMB 1R5IA 1FZKB 2AKRB 1YC8A 1YNKL 3IDMB 2VC2H 4MB5A 4JFOB 1S8DB 2IADA 2OR8A 1XR8A 2DL9A 5LAXA 4RRPA 4ZUTA 2EIZB 3LY6A 1OAKL 5BJTA 5T5NF 1FORH 1M7DB 3OXSA 3O6KH 5EO1A 1OAQL 4WO4B 4NRYB 1RZ7H 3BPCB 5AZEH 5J1SC 4XMLL 4PJ5E 3MUHL 2VNCA 5EU5B 2H45A 4JEGB 3KVQA 2Y7QA 1N5YL 3RU8L 1I4FB 3GIZH 1KB5H 1RUPH 4TSAL 4Z5RA 5JZ7D 2P7TA 3PWLA 4GRMA 3QO1B 3BEWA 1YPZB 2ICEA 3GHBL 3Q1SH 4HS6A 2ZUQB 4S1DC 5JDSA 4IMLB 2IBBA 1U8MA 3OXRB 3O8XA 3CVHL 1C1EH 4PGBB 5DA4A 3QIWD 4AIXA 1HQ4A 4KHTH 5HVGB 1FPTL 3WEXB 2QR0A 2A9NL 3TJEL 3CFDB 1AGEB 2FBJH 2ZUQC 4JHBA 3KPRD 2OS7A 5ALBL 2VDNL 1JNHB 3BE1H 3MNZA 3L3IA 1U8PA 1ZTXH 5D2NA 4Y4HA 3ZE0E 3UC0H 1FE8H 3FRPG 1RZGA 4DQOH 4GRLB 5DFVC 4Y7MA 3BKCL 1BM3L 1OGAD 4LBEA 1AI1H 4X4YB 1MOEA 3KPSA 4DOHE 3VXUB 1ORSA 2UWEE 1BZ7B 2V9RA 2CR6A 3MZTA 5IM7A 3JV5A 3BWAB 5JMRA 4XMKH 1EDQA 4XGZB 2M2DA 1BBDL 5CGYD 5CINH 2NY2D 1AIFA 4GRLC 1CL7L 1N64H 2XQYK 1PD6A 2DQFA 1QEWB 4LLDB 2EXYC 3BISA 1MQKL 1K6QH 5EU6D 4U3CA 1FGNH 3GSQA 3RRQA 5CEZD 4E41D 3LKPB 2RR3A 4L3EE 4NKMA 1AXSA 2GEEA 3DVNA 4R9HA 5D7IE 2BVPB 2BRRH 1D5BA 3RQ3A 3NABL 3L6FA 3V7MA 2FB4L 1N2RA 1KC5H 1U58B 3IFPB 1KJVB 4KUZH 4KJYB 2APWA 4ZTPH 3MV8D 3O9WA 2ITCA 4Y89A 1BQHA 3JUYA 2VL4A 3M07A 1WK0A 3U9UA 4E0RA 2EZ0D 3PIQB 2Y36L 2AK4A 4LL9A 1T0NA 1YNTA 1AKJD 3BSZH 2XQYG 5DLMH 2CKNA 1NGYB 4Z9KB 3NFNA 3GMOB 4LAJH 3QUZB 4JFDB 2FWOB 4U6VL 4YBQD 5EU7C 3X12A 3TESA 5CP7B 1I3RA 3L7EB 2FJHB 4JB9H 5IGXH 4POUB 3MBEB 1TTFA 3WLWC 3F62A 1CZ8H 4AENB 4ZD3L 3PGFL 3Q6GL 5D96B 1NAML 3BGAA 5C0AA 4KH2A 5IESH 1RUQL 2FEDD 1FP5A 4GUPA 1OQXA 3QEQB 4D8PB 3RVUD 4MX7B 4ZFOA 2A83B 2VIRA 3BJLA 2NY1D 5BVJB 3MBEC 4P9ML 1T66C 3O11A 5D96C 5DHYA 5IMMA 4MSWA 1OGAE 2K7QA 5IB1B 4WI9A 4EN3D 5KSBA 3VD5A 2XXCB 3F5WB 3ZL4H 1FRGL 5IQ9B 3KG5A 5EZJB 4RNRA 1L7TL 5JIKA 4GO6B 2D0GA 4ODSL 4KJPD 4QRUA 2OR9H 4XAKE 4MS8C 5GS2D 1JI2A 4G6AC 1OAYL 5FKAB 1TFHA 1QLRA 2DLFH 1TJHL 2C1PA 4R2GB 2ZUVA 1SM3H 4YDLB 1G7JA 3HTLX 2CO7B 3UJJH 1PYWA 3T0XA 1AGBA 2ZG1A 1DVFB 5EOCL 1CLYL 1ZLWK 3GZKA 3DTXB 3FB7A 1JN6A 1S7SB 3HZMA 3TH4T 2O5ZH 5C08D 3IDYC 4Q9QL 2PR4H 3F6IA 4KJQD 3V4VL 4FXGA 4NQEA 3O2DH 4XWGL 1CL7I 4YDLC 4FA8A 1Q9OA 1IAIM 2VLKB 2ATKB 4XTRD 4LLAA 4XP6L 1DVFC 5D5MF 5F97E 1NMBL 4GT7A 3CU1A 2APVA 4ZUUA 3OGCB 1B0GA 4ZNEA 4FABL 5IVXF 4QEGA 3VW3L 3QDME 2I5YH 3V5HA 4NGHL 2NTFA 1NSNH 4X7CC 5DD0L 4P4RB 4L4VD 4AL8H 1T6VN 1QRKA 1H9VA 1VFMA 5HD8D 4S1QH 3KPNB 1MVFA 5FUZH 4B53A 1TLKA 4HV8B 2G75B 1ZS8B 4G9DB 3VWJB 4M62H 1N59A 4MJ5A 2WUBH 5BV7B 3F6LA 5E2VL 4DEPB 4R6UA 1R3IL 1F58H 1FVEB 1IC4H 3T0VA 4J7RA 1VENA 4U6YA 1EEZB 2IH1A 1YMMB 4PJ8A 1I7RB 2B0SL 4NO3B 2BY1A 4L29B 2ZUWA 5LCVH 3TCXA 3VWJC 2DQUH 4NQDA 1P4IH 5ETUA 4OCXL 1MIEL 4Y4FA 5BV7C 3LN9A 1FJ1B 2YWYA 1OW0C 1NGZB 3FTGB 2ZUSA 4DEPC 1RHHA 4P99A 5AD0B 2F5AL 4DFHA 4I0PA 1TNNA 3AY4C 4P5TD 4IS6B 1BFOA 3U7YL 4Z7WB 1VPOL 1IC5H 3FT2B 3IDGB 3IAPA 3VXUE 5JPNA 3WFHB 4GKNA 3ZYIA 4G8GB 3KYOA 1NLBH 2E27L 2CJUL 1MCOL 4NWTH 3D69B 1IQDB 3NMEA 2HFEB 4WW2C 3RIAK 4GG6A 3SQBA 1RPQA 3LRGA 4PRDB 5HPMB 1MCIA 1MELA 4J12A 5JQHC 3MLRL 1N0XL 2EKSA 5E94B 3RNQB 5C0BB 2UZIL 3SGDI 2EDBA 2YPLA 1AHWB 4YHMH 2DQEH 3MQIA 1WZLA 3O0RL 3HI6L 1J12A 4ZFGH 3U48A 5GGTA 2AXFA 1PEZA 4HGKC 3MACL 5D5MB 3OHXA 4V1DD 4JZOA 5EU7E 3IJSA 4IRJA 5I1IH 1DUYA 1YNLL 5IVXB 2J3SA 3IFNH 4MDJB 1DQMH 3MC0A 5EOQL 5IHBA 1ZLWH 5IMKB 4LFHG 3SE8L 2ZOLB 2FYYB 3VFGL 3AS2A 1H8SA 1OVZA 3DX9A 3NCCB 2X1WL 1FAIL 4OGXL 5ILTL 1VACB 4UNUA 3TIEA 3QI9B 1PG7H 3MRQA 3WFCH 2VL5A 4JO3H 1URLA 1EO7A 2AV7B 2XWBB 3OAYK 4XPAL 4W6YB 3SBWC 3QNXA 4CUCA 3D39E 4JY4B 1WTLA 4PJEA 4HBQA 4X7SH 3IS1X 3OB8A 4C56E 1TZHB 2A9MH 1AQDB 5A3IC 3MRKA 4N0CC 1KB5B 1FZOB 1RD6A 2ADIA 2J88H 3HPJB 5AUMB 4WI4A 5BVPH 1CLZH 3HZVB 3ARXA 3T2NH 2CIIA 3DX6A 1DLHB 2H3NB 5D7JB 4KDVA 4GS7C 3C9NB 3V0AC 5SWZA 3BH9B 4JHAL 4PJ9A 4E5XA 1SBSH 5F1OB 1K2DB 4MAYC 5D8JH 4ISVA 1W2KT 3G9AB 3TP4A 2IWGA 1FBIH 4JGMA 5TFSL 5L2JA 2APTA 1Q9KB 3LHPH 4XBGB 1TITA 1U3ZA 1FV1A 3GSNH 4OTXL 4OLEA 5FECA 1ZVSA 1A7PH 4TVSa 1WBZA 1D9KD 4XNUH 4F33B 4FXKA 5SWSD 5JA9A 1UWGH 4QRPB 3T0BA 3SE4A 5HXMA 4XVTL 1IC1A 2BHZA 5DO2C 1E27A 3D3VB 3L3JA 4N0YL 5EOCJ 1A3RH 2DYPA 2VLKE 4BYHA 4N1EA 1AY1L 4OCLC 5DEFA 5CIPA 1IKFH 5B3JF 2B5IC 5HGBB 1LEIA 4JDVB 4OBSA 2YD3A 1J8KA 1YEEH 2XPGB 1S7TB 2X4OB 4UINL 3QQ4A 4HUXA 2AXGB 4JHZA 1JK8B 5T3XH 3ULUD 1UZ8B 1LK2A 3S37X 2V5SA 4FS0A 1LDPL 2QADD 3DSNA 1UYWL 3GK8H 4I3RH 3OKYA 3WL9A 4O4YL 1I8KB 3HR6A 3VMNA 1WSST 3RX5A 4IDJH 4Y2OA 3JTSB 4ODHH 5DRNA 1MJ7L 1RJLB 4P2OD 3KHQA 5DS8A 4IEFB 5E9DD 4K8RC 1FZMA 4KKBC 1YMME 2OSLB 4NDMA 2ZCHH 5MHSD 5FHAL 2Y5TB 5EIVA 8CGTA 2NY3D 4MJ4A 3S88H 3T65B 25C8L 5J1AB 4MB3A 4O51A 5E08L 3H9SD 4A6YH 3P73B 2PW1A 4S1SL 1ZANL 1GRWA 4LLMA 1KUMA 2VZ1A 5DUPH 4EZMA 3THMH 4O5LL 3O4LD 1PSKH 3QCVH 5CJQH 4DUXA 4WHYG 2NW2A 4GQPH 3VDCA 3OSKA 1MWAH 1F3JA 3NTCL 4PLJD 5F7DB 4G8GE 4JG1H 2R1XA 2R4RH 3CFJA 3RWDB 5INDB 1AGDA 5EBLB 5SV3A 3CFKB 4LCUA 3JVGC 3P0YH 4GFTB 2NQCA 3SGDH 3NBNA 3SKMA 1F6AA 1ITCA 3B9KC 4HT1H 5JXEC 3VFOA 2GK0B 3JTTB 3QFJD 2X2YA 4AZ8A 3NZHL 4JN2A 3F7PC 1RJYB 2ZSVB 3S97C 1T5XB 2HTKC 2HH0L 1JGLL 3PQYB 3TEUA 5I76B 1QBLL 1OD7A 2YD8A 4YAQB 4PV8B 1NEZA 3MV9D 1K5NB 1QBML 3PL6B 1MREL 5D5ME 2YSSA 4BELD 1EUTA 1Z5LB 1CU4H 4K2UH 4QHUB 3OG6B 4JGJA 4MNQB 5IHUL 1IGML 5IVXE 3BESR 1FNAA 3EFFB 4BFEA 1R0AL 5EWIL 4JM2A 1Q0XH 4YQXL 5J06A 3D25A 5FGBA 1WWAX 5DRZA 3QFDA 2AEPH 2J8UA 3C5SA 2ICWI 2AJZA 4DZ8B 1DDHB 3EDEA 4PTUB 4QRRE 3E3QE 1SEBB 32C2B 4JQVC 1U42A 1CFVL 5CJXC 1MHHB 2V5TA 3W39A 1F90L 5D7SH 5J8OA 2DTMH 4G8EB 2DQHH 2XXMB 4HG4J 3DV4B 4M6NL 4OFYA 4RGMB 1MRDH 3WBDA 3ILPB 4MJIB 5K59F 2X70B 1T22B 5TDNA 3DX8B 1MH5B 2VXSH 1YMHB 2YWZA 3LVEA 1LE5A 3LS4H 2A6KA 3C60D 2BY2A 3BKYL 3S35X 2BOBA 2WLYA 5JTWA 1GGBL 1Z9SA 4DGVH 5T33H 1EJOH 4J3VA 4WUUD 4FMFA 1JV5A 3MRHB 4Y5XA 4RGMC 1RUAH 2XZCH 3W5MA 1CD1B 3QWRA 3LEXB 1QLEH 4UTAH 4QTIL 3C09B 5J56B 1KJ2L 3QG7H 4JPIA 2NY0B 1YUHA 1YEIH 2AJXL 4ZUSA 3I6GA 3KPQA 4LQFL 1JWSB 4QTHA 1JNLL 1C12A 4CVXA 3GSUB 4OF8A 3VMPA 1O0VA 2D4DA 5C0JA 1BFTA 3NVQA 3GFUA 4Y1AA 4F7CA 3ARBB 3C09C 2NY0C 2FH8A 4FN0A 5E1HB 4R96B 3P0GB 4LSQL 5IVNA 15C8L 5IMOB 1NGQH 4QRTB 2P5WD 5HPOA 3GHEH 5DD3L 3SDCD 2IEPA 4QRPE 1JNHA 5TQ0H 2NZ9D 3UTSB 3QWOB 1P7QD 4KPHH 4RISH 1RAMA 4AT6B 5JIPA 5EUOA 4APQB 3D3VE 1YQVH 2DMKA 3ARBC 4KVCH 4DAGH 3FFCB 1ZT4B 3R1GL 1L6ZA 5F9WB 2OQJB 3MV9E 4AH2A 4KMTH 2WINA 4R7NB 3NCYP 2DM3A 2X1OA 2IBGA 5FGCB 3FKUS 3RWGB 2X9WA 4APQC 4RMVA 4XCNB 3GKWH 5FCUL 4JAMA 4J1UB 1XF2A 5F9WC 4HK0A 1HH9B 3MO1A 3S34L 3NZ8B 4PRHA 4HX1B 3WCYA 3LKPA 4JR9L 5GRJL 3FFDA 4OZIF 3DIFA 2DMBA 4XCEB 4TNVK 1NBZB 3RIAF 4P48A 1KLFA 3CXHK 1F42A 5DJAA 1A02N 3P4OB 2YZ1A 2YC1B 1HHHB 1UM6L 2A6JB 4NUJB 3VXSB 5JA8B 4D9RE 5SWQB 1IRAY 3MV7A 1H15A 1NAKH 4KJYA 2C9AA 1SY6A 4OD3H 3TPUB 5C2UB 5DD5H 3LEVL 1N5AB 2VISB 3PJSB 5DQDL 1W8NA 2XG4A 4LEOA 3QDJD 1MCHA 4GMTL 5KANG 4HH9B 2AJUH 4L8BB 3C8DA 3KYKL 4UIKL 4QF1A 4XHQA 1EFXB 2XACC 3GO1H 3SDDA 3WXVL 1XGQB 3SPVB 2R29L 2IBZX 2OZ4L 3I02A 3L95A 1NKOA 5FO8B 2W91A 5D6DC 1WICA 2LE9A 2LV4A 3HNTH 3I50L 2D3VA 5D2LF 1A7QH 4TUKH 3MXWH 3UYOD 3MOAL 4F9LC 1KEGL 3VJ6B 5E1AB 3KLHD 5DEGB 3IGAB 1UXSA 4KQ3H 2F5BH 4FXLA 2QKIA 1HZHL 4JRXD 1KENH 4ODWA 1CR9L 1NFIB 2DBLH 4OCRH 1MCEA 2EYTB 5CEZH 2D2OA 2DM4A 4RAVB 2PYED 1JNNH 3QDGD 4X6EB 3S7GA 2A6IA 5HSFA 2VKXA 4QHMA 3VDBA 4MA1B 1RMFH 4HXAL 3GSNB 4LHUA 5B3JE 4XP4H 1F4XH 4N0UB 1UB6B 1FSKC 1DN2A 1TJIL 4WVRA 1WZ1L 1CGVA 3CZFB 4HWBL 4K71C 4NZRL 3JV6A 4RAHA 1LD9A 5FIEA 1UKTA 4CVWA 3PGDA 3QZWA 1T2QL 3CK0H 4MQXD 1FDLH 1UH2A 3W11D 4Z7UB 4KI1A 4PUBH 1T03H 1QR1B 3DTXA 3EAKA 4X6CA 3NCEB 5H37G 4GQ9L 4BZ2L 3IXTB 1V3KA 4JFYA 4TOYH 2YA1A 3O41B 4OZIB 4WU7B 5C3LD 3QO0A 3UPRB 4U1IA 4MJIE 2Z92A 2ZCKH 2VLJB 3CFIC 2R0WH 3FQUA 4FTVB 5JQ6H 4P4KC 1GGIL 1QSFB 2VDLH 4LKXB 4DKEH 3WLBA 4PV9B 4O00A 4RWYH 1UXWB 5E5RB 1NC4A 4H20L 1TQCC 2UZXB 1LO0H 4HIIA 5ALCH 4JVWA 3EHBC 1BJ8A 2GW5A 4PD4J 2XTJD 1XFPA 3BIKB 5ADOH 3D0VB 1WV7T 2EIDA 4HGWB 1WAAF 1NJ9A 4I18A 3JWOL 4Z18A 5CEYB 4JVPA 4N9OB 5GGSA 1RULL 4LRNL 3TIDB 5L6YH 4TTDC 1NCBL 1Y18B 2EO9A 3GSXB 4KK8C 5D72H 4O58L 4P2RD 3U7WL 1T0MA 5D2LB 4XI5C 1MFDL 4KKNA 3VG9C 5MENB 1EAPB 5K9JL 1OTTD 4I2XA 2BNRA 1UJ3A 2QQKL 4FFZL 2VYRE 3I3BA 5C0CD 4ONHB 1MWAB 3LOWA 3MLVL 3UTSE 3WV0A 2P5EE 2W65A 4NC2B 2C3VA 5DHVH 3BW9A 3WKMH 1I7ZA 4MA3A 5EBMB 3FFCE 4WW2A 4PRIE 1M05A 2FX7H 4TUOA 1HCFX 3QUML 3ZMRA 4UI2A 2Y1VA 4X4MA 4PRBA 2RJMA 2F53B 3X3GH 3QXUA 1ND0A 5IW1B 2VITB 3IRPX 4XP9H 5FGCE 5KSAD 4UOJA 5H37H 3PF2A 4PJHA 2HT4C 1QO3B 3GGWA 3PDDA 1MFAL 3H6JA 2AP2A 1J86A 1I85C 3A67L 4NO2A 3RJDA 2DQGH 4NKOB 2DJ4A 1IGJB 1UCBL 4LPTA 3VDAA 4Z7VA 4P46D 5HHPB 4ZO9A 1CGWA 3C2SA 3DBXA 5DEZA 5EPMA 3VXSE 5K59E 2F54D 43CAB 1A9BA 4O02L 3VRIB 5HYSA 2YRZA 2EDXA 2HJKB 4U7SA 2CDGB 1H0DB 3Q2CA 3REWA 2BCKA 2OJZL 4MHHG 3VE0A 1KB9J 5MP6L 5GZOD 3FT4B 2CK0L 3GRWA 1D5IH 4ZPTB 3B2UC 4KZDL 4U1SA 5CJOL 3D6GA 3CDGA 2VTFA 1J10A 2BSSB 1MJJA 4IRSB 1T1YB 1FG2B 3HFML 1PKQB 3DYPA 1RQ5A 5KVEL 4HKBB 4OF7A 2L7UA 2X9YA 3HRZA 3LKNA 5KSUB 2H26B 4XCCL 5CWSA 5IMLA 2ZPKL 4JKMA 2MCPL 1TTUA 3FOLA 2NW3A 2Y07H 1I9IH 1L9NA 4PJIA 2EDQA 2J8OA 2PCPA 3RDTD 3IKCB 2R1WB 3WHXA 1D5XB 3L5WB 1UACH 2M26A 4YX2L 5GIRA 2OJEB 4NRZA 2WBJA 3HE7B 3ARFD 3B9AA 3ZLQC 1AQKL 1I3GL 1VFOA 4MAYA 4MD5A 4G8IB 3RZCD 2C1OA 3C5JA 3RWIB 1QYGL 1L6XA 5GGUB 3VFWB 1LO5B 5J6HA 2A1WL 4R4FL 2ADJB 4W6WB 5DZNA 1BX2B 3NAAL 1VKXB 3J7HA 3HE7C 1K8IB 3C9NA 3OF6D 4OF0A 2C5DC 1UJTA 1CS6A 3VFUB 2DB8A 2R2BA 5C0FB 4P5KA 4N0UE 2EDTA