4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
5FGCE 3ROOA 4DKFL 2GK0B 1CQKA 4XNZB 5IEHA 4XMPH 4HKJA 4XC1L 2XG4A 2GI7A 2CGRH 3WFEH 5LGJB 3AREA 3OHXB 1GOFA 1XF5B 3N1PC 5D1XD 3WO4C 3WIFB 2DIBA 2OI9B 5I6XC 1AHWC 3MV9D 1B4JL 3O6KL 4V2BA 1JF1A 2R9HC 3QG7H 3KVQA 5DWUH 3QA3A 5I6XB 1AHWB 1E4WH 4OJFH 4R90L 2YPKA 4ODXB 3GSRA 3GK8H 3LSOA 3PHSA 3O41A 5D4QA 4L3CB 5BVJA 1SJEA 3RWJB 2VLKA 4KC3B 4L4TA 2A0LC 43C9A 1J8HB 4WWKC 3ZTNH 1JNJA 1I7UB 3O45A 2DQGL 5DRNA 5EC2A 5I76A 2R69H 1OAXL 4PRHE 5HJ3B 3PWPB 2ZJSL 3S35X 4PJ9D 3WXWL 4OI8A 5E4IA 1IFHL 4K3HA 5D1QC 2H3NB 1OTSD 2GY7B 4HUWA 5EG6C 3U7AA 1S7UB 2OJZL 4MDJA 3KS0J 4LNRB 2O5ZL 2UZIL 5KSVA 2AEQH 4NO2B 5D7SL 5ITBL 3QIBC 3QUXA 2EDYA 3OKMB 3TF7C 3IDYB 1U3JA 1KNOB 3GSOB 3MJ9A 5H2BB 4Z77A 3QPQC 5KOVC 1T1WA 4MJ6B 5IBLD 1A5FH 1TJGH 4NQEE 2DQCH 3H3KA 4MLSA 2OXGA 1IC5H 1FNSH 1WCQA 4LSTL 5JA8B 1XGQA 3HN3A 4KXZH 1PQZB 5CINH 1YN6A 2YBRB 4N0YL 3TT1H 3V9FA 1FFQA 3MRCA 2EDHA 3WIHH 1BQHG 3ARSA 3MLTB 2VC2L 5ABDE 5FO7B 3FTGA 1IJ9A 4W70A 1CFNA 2ADFH 3HPLA 4YDKL 3NGBC 3RDTA 3RFZC 2Y5EA 4Q9QL 4IEFB 1AGBA 3HPJB 4OD1L 2NW3A 2UWEB 3VXUE 4ODWA 1DANU 4RX4D 5DHYA 4PBWD 4Y5VB 1TNMA 4Q74A 1VEOA 4DGYL 5D7IA 4G9FD 4Y16D 2DMBA 4OZFA 3RUGF 4UBDD 1ZK9A 4X6EB 3L3DA 3QUYC 1MAKA 4AZ8A 3NN8B 4NQVB 1G7PB 4OZGA 5CGYD 4L3EE 4ZAKA 4OLWL 4PRDA 1L6ZA 2E6PA 4JHWH 2HJKB 4BQBA 4XC3L 5CIPB 1MF2H 1L7IL 5JW4R 3MJGX 2X9WA 3DPBA 4U31A 2AXJA 1F4AA 5TFSH 4NFDA 3SCMA 3L3IA 1JBJA 4X7DC 4JFPA 5ERWB 3LMJL 3UTSA 3OKKA 1QFUH 4PP1C 5BZWA 1HNGA 3D0LA 3OR7A 5HHPB 2DI7A 1ND0A 3LEVL 2W59A 4HK0B 5CEYB 5IMMA 2YUZA 2HP4A 4P5MB 1HQRA 4ZO8A 1I85A 2BNUA 2VKXA 4FXKA 3WYRA 5IIEA 4XCNA 5DRXA 3HZYA 1NDMB 3OKLB 5AZ2H 4F9LA 1T4KB 4I3RH 1C08B 4KJQC 1QR1B 5ACZA 1CGSL 4EI5D 2VLRD 1JWMB 1OAZH 5JHDB 4HH9B 1IAIM 2X05A 5I73B 4MS8C 3MBEA 1QSZA 5D71L 3RUGE 2NNAB 4FQXB 2FECL 3ARDC 1W0YT 5C0AE 4FQQB 1GOGA 3U30C 1ZT1A 5GGSA 3WFCL 3FB8B 1RZIA 4HIXL 3VA2C 1QEWB 3U30B 4U33A 4Y0GA 1VFMA 3GB7A 4NM8H 5GGVY 4TRPL 4OIIL 4OZIA 2O5YL 2MCPL 1YYLH 2V17H 1C5DA 4KI5F 3VDAA 1N4XH 3GBNH 4I3SH 4GH7B 3BPLC 1TVHB 4QT5B 1NC4A 3GSQB 4EEEA 3TJEL 1NAMB 1T5XA 5IKCB 4E41A 3BPLB 1IAOB 1QSEA 1UWEL 4XCYB 3Q6GH 4Y19D 1DUYA 3SDYH 1MRCH 1B2WL 4KAQH 4GAJH 4NHUA 4RGOL 4PJ9B 5F3HA 3RZCD 4J8RB 4XTRC 2JKXA 4Z7OF 1CL7I 1ZLUH 4IRJA 4UIKL 1MIMH 1BBDH 4MXWH 4HEME 4HLJA 1IKNC 1DEEB 3NIFF 4M93C 5JORB 1PY9A 5B8CA 2H26B 2BOCB 1T21B 4NZJA 5M7QA 1VESA 4KZDL 4G5ZH 2FJGB 2G75B 5GRXG 1Z5LA 5FF6B 4M43H 3P77A 4M1DL 3A67L 5E0QA 3ZKMC 4KUCD 3UBXB 1QRNE 5IQ9A 4G43B 2C7UB 5ALCL 1J12A 3TPKA 5I16A 2J6EA 5I74B 2H45A 3C6SB 4WV1C 4CMHB 4LIQE 5D1ZA 3T4YB 3I02B 3VWJD 2VH5H 4KI5E 1XCTA 5HVHC 1ZMYA 5IB3A 4ZD3H 1CG9B 4WW2C 5EC1A 1P5UA 4BZ2H 4OF3A 2QBWA 4F7PB 3LRGA 3ARWA 5K9JL 3GHEL 1HH9A 2WWMC 3KYOA 4J1UB 3R8QA 4WWID 3AS3A 3GMRB 4TOYH 4X4YA 3DSNA 3VCLA 1FV1B 3QT2A 2KZ1B 1R5IB 4XPHH 1HSAA 4JFHE 2OK0H 2FX7H 3UDWA 2BY1A 1R3HB 2K7PA 4P59L 1MVUB 1UCTA 5M95B 1DLHB 1SYVA 3BXNB 4Z7OE 4Y16B 2Y1VA 3ZTJH 4NRYA 4RZCA 1ADQA 1DZBA 5C71A 4GKSB 4O58H 3ULSB 3O4LA 2PW1B 3SHSA 4Z8FH 3NIFE 1IAIL 1NBYB 3IJYA 4X6FA 1YECH 1M4KA 5EFIB 4QXWA 2E8ZA 3WDIA 4P23A 5F3BB 2IADB 1LO5B 25C8H 2VABA 4TUOA 2V2XA 2Z35A 4R26L 4JDZA 1FDLL 4HF5H 2P47B 1U58B 1AI1H 3B9KA 2P49B 3DARA 3U7YL 4PGBB 4QXTA 3IFNH 3T0XA 2HFFA 1RZKH 2VUOA 5DJYA 2JIXA 3O3AB 4N5ED 2WK2A 2VZOA 2PXYA 5H94A 1TLKA 1QQDA 2H6PA 5GGRA 5SWSA 4KK8D 1ROWA 1FYTE 4N68A 4ZUVB 43CAA 5L8JB 1T83A 2ADJB 1J11A 4CVUA 1WICA 3DROA 3HNSL 4ZYKB 4NYLB 2UV3A 4NN5B 3M17B 3VFOB 32C2A 5SWQB 5F7MC 5BV7C 5E03A 3D0VA 4PLOB 2FH6A 1DE4B 3JV6B 3L3JB 2FLRT 2X40A 4ZXBD 4K8RD 7CGTA 1OLZA 1C5CH 5J11C 4QTHA 2VLRB 2JJWA 3SQOH 3JVGA 4YE4H 5C0IA 5CZKA 1XCQB 2WZPD 3QXAA 5C07A 3WXVH 1KSRA 3G08A 4TPRH 3KYMB 4FOMA 1FFPB 3OAZK 4I0PC 1K85A 3QUMA 4E5XA 3LH2L 2PKDA 3DX6A 4ODHH 1OAYH 2AV1B 3O4OC 3BVNA 5E56A 5DD5L 3QFDA 4H1LB 1KTDA 4I0PB 3WIIH 3OV6A 1H8NA 4XMKH 1FBIH 1NMAH 2R2HA 3BT2L 4RDQF 5EBWA 5CGMA 4P3CH 5IESH 1NCCL 3CXHJ 1HWHB 4RGNE 4LLDB 4W68A 5DK0A 4OUOA 3CLEL 3ULUF 1F58H 1VGEH 1M1SA 5C8JA 4IOFD 2JK5A 1DBBL 4HWEL 1Q1JH 4PGEA 3KPSD 2AJZA 1CLYL 5DEGA 1ZSDA 2JELH 4IMLA 4BKLA 4RFOL 3KLAB 1CF8L 2LAAA 1BVKB 2R29L 4MWFA 4R8WL 1S7SB 2FH8A 3DHJA 2FR4A 2CLRA 3WDHA 4K07A 4GMSL 1OY3B 4G8GA 3C08L 3QDME 1D6EB 3DHMA 4XNUL 4LRNL 4Y19B 9CGTA 3LKRB 2VISA 3MRNB 1U92B 3P9LA 2X10A 2KUTA 3S35L 2ORBH 1T3FB 2VE6B 4Y2DC 1YEIH 3RZCB 3DO7B 3MFFB 3VFNA 2X4QA 1C1EL 3G04A 1XF2A 4RRPG 3BRDA 1JHKH 1F2QA 1NUGA 2X4PB 4C56A 4D9QE 1FZMA 3CVHA 5FOJA 5IMKA 3P11L 5K9KA 1S7WA 4YHIB 2CKNA 2ZPKL 3B5GA 4RGMB 4X83A 4KH2A 2JF1A 2R2EA 4KVNL 4GMTL 5MP6L 4IMKC 3MJ7B 1RPQA 4AEIH 3HAEH 1QSFA 5LGKA 5GRUH 3T0WA 3H3PL 1MCBA 2R2CA 3AXLB 4QRQB 3SGKA 2CRMA 5EU5B 1OL0A 4U2ZA 5EOCJ 4HWUA 4RAUB 3BN9D 3VFUA 4PY8J 3EHBC 2ZSWA 1KBGH 2EEAA 3VWJB 4Y4KA 3MRKA 4UV7H 4B5EA 5F88B 1I1FB 1HN1A 1MHEB 2Z31C 3CLFH 2R4SL 4UOW1 5JQ6H 1UQSA 3JV0A 2W0FA 5D7JA 1K2DA 1CE6A 4OB5H 4GBXC 3IT8D 3LIZH 3NFPA 4KQ3H 1FJ1B 5KTEL 2V7HA 2ARWA 3AU1A 5D72L 3V4PH 1NLDL 1KIRA 1CL7L 5T3XL 1CGTA 3S8WA 3DMMB 3O6LH 5B22A 1P7HL 5HDBF 5TE4L 5L2KA 3BP6B 3VFVA 4HDIB 3UTZB 4M4PA 4Z7UB 3BH9A 3A6OA 3O6KH 4YHKH 2X41A 1YC7A 5D96B 2G9HB 1D9KD 3GJEA 4EN3C 4L4VB 5EOTA 5EORH 2X1WL 1WFNA 2FX9L 3RWHA 4EN3B 2FEDD 4QXGL 4BUHA 2LVEA 5MENE 3BZEB 1T6VN 4GG6A 1FL6B 4PJDB 5EBGA 1N0XL 1U8NA 3VFRB 4KY1H 2EIDA 2EC8A 2PR4H 2DQGH 5DJ2B 2QQLH 4HFWA 1S9VA 1OAXH 3EO1A 5KSAD 4OF0A 5DQ9A 4LK4A 1IFHH 4WFGE 5TF1L 5F96L 5DURD 1SEQH 3BQUC 3KNBB 4JDTH 3GGWB 2OJZH 1BQHB 1KG0B 2M8XA 4LSUL 4RWYH 5JIHA 3MCG1 2BDNL 3ULUH 1HYSD 2QR0A 5AWNL 4U1GB 2OTUA 4LCIL 4ZFFA 4S1QL 2XNAB 4X4XB 3U9PL 2DQDL 3DX7A 5HDBE 2B1AL 4M7ZB 5E8OA 4QRRD 35C8L 5B4MC 1QLRB 4JFXA 3ZYIA 4UAOB 2ADGA 1ZVSB 3FQXB 2EZ0C 3HZVA 4UOW0 4QOKE 1A3LL 4NHCL 2VRAA 4PREB 3HUJB 4YBLB 5J57B 2DM2A 4PFEA 4JQIH 2YA0A 2XN9E 3SJVA 1MWAA 5BS0A 4PRBB 4M6AA 3BAEH 1I1CA 1NFDA 3KPSB 1ORQA 3F6LA 3CMOL 1Y18A 1P2CA 1M7XA 2CRZA 4DZ8A 3MLYH 5EUOB 2VL5A 4Q9RH 2NY4C 2ERJB 4M6ML 5BQ7B 4X9IA 4PRHD 3TCLB 4MQ7A 2GK0A 2BVOB 4IDJL 4URTB 5CUSH 2A1WL 4HWZB 2EIBA 1IGFH 3H42H 4BELD 4RMSA 4QNPF 3TC9A 5LGJA 3OHXA 4OGAC 1XF5A 1H3WM 3AM8C 4IRSB 1PLGH 2J7LA 4JO2L 4M3JA 3U36B 4CN6A 4CRPA 1JZ8A 3WIFA 3V7AG 3IDMB 4LCCB 1I8IB 1DVFC 2IBZX 3MCKB 3T08A 2HFGL 1AHWA 2AJUL 4JCLA 4NNYB 4N5UA 1FO0L 2B5IB 3U9UB 5CP7B 3K2MC 4OLWH 1UKQA 3HE6C 3O11B 3GO1L 4ODXA 2BXZA 4LSQH 3PDGA 3VRIB 1L7IH 3HE6B 4L3CA 3RWJA 3QRGL 4I1NB 2HT3D 3NCYP 2HT2D 1J8HA 5CMAB 1I7UA 3ARRA 3RHWK 3LMJH 2SEBB 4MJIE 3AMLA 1A4JB 4OT1L 5I1LB 3NCEB 5HJ3A 3PWPA 4HZAA 1VDGA 2J5LB 2H3NA 1SY6A 3RVXC 3S96B 3X14B 1FZJB 4NQCE 5B39G 4LNRA 3VXUD 1Q72L 3NCFB 1XGYH 4NO2A 1Q0YL 4FFWD 3PWNB 4OQ1A 3OKMA 1MAML 3UYRL 3KYNB 2H32H 3E3QE 4QNPE 3HKFA 1K5NB 5KVDL 4ODUB 1T1YB 5JHLH 1KNOA 3GSOA 5H2BA 3LQZB 2NQCA 3AGVA 2V5MA 4MJ6A 5D71H 1CI5A 3BKCL 4JREC 4NGHL 4D0CB 1OT1A 4WI5A 4L3ED 4LPCA 4Q0XH 1FG9C 2QJDA 4NWTL 4M8QB 1PQZA 2YBRA 5AD0B 4JAMB 4OLVH 4ZNEA 1U3ZA 3MLTA 5FO7A 12E8L 4O2EB 1D9KB 4HKZB 2WNGA 4TRPH 5T1DH 1A21A 4GAYB 4DUWA 2O5YH 3HPJA 2UWEA 1X6NA 3RY5A 4Y5VA 5FYJE 3T4AB 3GRWA 4XP5L 3TJEH 2CQVA 4WUKL 4WTZG 4X6EA 2JJVA 3ABZA 2WSKA 5KSAB 2XOTA 3NN8A 3QXWA 5CJ5A 3IVKB 1B88A 1G7PA 2HA1A 1O7SA 4IIQB 4NUGH 5DURB 4RQQB 4WUUE 3QJHB 5C86A 5L88H 4NZDA 2HJKA 5CIPA 5I66B 3PNWB 1UGNA 1GYAA 1WISA 5C0AD 2MKWA 1ACYL 4XCCH 5CCKL 2V5YA 2QHRH 5GGTA 4XBEL 5ERWA 4ZG1A 4ZFOL 3BI9X 4KZDH 4QRRB 3IDIB 1JNHB 1CLOL 4L5FL 5HHPA 3RI5K 4BZ1L 2I24N 4HK0A 4KI1A 5CEYA 4P5MA 5ALCH 3WJJA 4X7CC 3CK0L 3OWEA 4AEHL 3K46A 4M4RA 1EGJA 1NDMA 1PD6A 2I9LB 2JB5L 3ESUF 3OKLA 4NKIL 4F3FB 1T4KA 5KZCD 1C08A 5IGXL 1QR1A 5HYFA 4GSDL 3EOTL 5LG1A 3TJHD 4F9PA 2X42A 1ETZB 1JWMA 4OZHE 4PBVC 3GHEH 3LPGA 5AYUL 5JHDA 3TCXA 4HH9A 2ICWB 2C26A 4PRHB 5HI4D 2NNAA 4MD0B 4KDVA 4FQXA 5JQHC 1MFAH 1AGCB 2Q20A 4LLAA 2CXKA 2LVCA 3VGDA 4RIRB 5E99H 4FQQA 3UPCA 2G60H 5E2VH 4X4MA 4XVUD 3FB8A 5FCSH 4NQXB 1TQBC 1VEPA 1QEWA 3LDBC 1OP5K 2AK1H 1JNLL 4JHAH 1IAIH 3VGAC 1LNUB 1TQBB 1CXKA 3EYSH 3MXWH 3MOAL 1O0VA 1U8JB 1PKQE 5GRVK 5DRZB 3KPQB 4WO4D 3SE4A 4QO1A 4Y5YC 4R26H 1H3UA 1BD2E 4UNVA 1TVHA 4QT5A 3GSQA 5E24E 1NAMA 2QLVB 1KT2B 4OTXL 3MXVL 4ONGL 4TSCL 4ZNCD 5IKCA 1IAOA 3MOBL 4XCYA 4YR6B 4Q6YA 2Y72A 4KI5D 4KMTL 4DKAA 4O9HH 4C4KO 2VAAB 2YKLL 2VDOH 4PJ9A 2D9QB 4UU9B 4JO3H 5IG7B 4J8RA 3AVEA 1DCLA 3KPTA 2WAHA 1KIQB 3EIFA 1WVZA 2FBJH 3VXSE 3X3GH 2CDEB 1YEFL 1DEEA 4MDIA 1M7IB 5SWZE 4JFHD 1IVLA 4QHNB 5JORA 2H26A 2F74B 1F6FB 1CIDA 1FE8H 2BOCA 1T21A 1E6OL 4YGAB 1XIWC 2GEEA 4G80B 2FJGA 2G75A 5FF6A 5IVZB 1YEHL 3UBXA 3LH2H 1XZ0B 4XNYH 2V6HA 4G43A 2C7UA 5A2IH 5DD5H 2R0LL 4UT7H 3BT2H 3C6SA 2QEJA 2Q8AL 5L6YH 4U3HA 3T4YA 5DUMH 2DQIH 3I02A 4Y4HC 4Y88A 5A2LH 4HXBL 3GI8L 2D7TL 1CG9A 1UWXK 3VD3A 4F7PA 1HIMH 4HPYL 4A6YH 4KK6D 4YHOH 4J1UA 5GISL 1CXIA 4HWEH 5F9AC 3GMRA 2NY0D 1CLYH 4H20L 1G9MC 3RRQA 1FV1A 5TQ2H 1R5IA 4RX4A 1CICD 2VDQL 5J6GB 3P2TA 2R29H 1R3HA 1MVUA 3ORJA 1DLHA 2DQJL 3BXNA 3LB6C 4Y16A 4GMSH 3HMXL 1LO3H 3SE9H 1YEKH 3C08H 3TO4D 4EKXA 5EBLB 4LRNH 3FFCE 4GKSA 1FNLA 4K94C 3ULSA 3EDDA 2PW1A 4GXVL 4DAGL 1PVHA 4LBEB 4O4YH 1ONQB 1NBYA 5DC9B 1KEGH 5A3IC 2WV3A 4JPVL 5EFIA 3FOMB 4ZSOB 5F3BA 2IADA 1LO5A 2IH1B 3GMLB 1U58A 4JFZL 2P4AB 2KL6A 2ZPKH 1R5WB 1HXYB 1BIHA 4PGBA 4XHJD 4IJ3C 1RZJL 4LPYA 3MGOB 4YK4B 3O2DA 4S0TD 1G6RH 3O3AA 1KC5H 4U1LB 3ZKSD 4RGND 4ZO7A 4V1DE 2F9BT 4G7VL 4ZUVA 3DVNB 2AAVA 4HIHB 1RZGB 2ADJA 5GS2D 3PABB 4ZYKA 4JE4B 4YEEA 4NYLA 4KROC 3M17A 2P7TB 5CP3H 3VFOA 5SWQA 4R7DB 2VR4A 3JV6A 1DE4A 5KZCB 3L3JA 5D8JL 3RY6A 4NRZB 3QWOB 2M2DA 3A6CL 4M03A 2VLRA 3VGBA 2R4SH 1TJHH 5C09E 1RI8A 1XCQA 4ISVB 2IPTH 5I1KL 1X9QA 3KYMA 5E8DL 1FFPA 4YWGL 4P48A 5L0QC 1RZKC 5F93C 3TVMC 5T3ZE 2FGWH 2AV1A 3U1SL 4I0PA 4H1LA 4LRIC 5LBSL 2G5RA 3W9DB 1MJUL 3DSFL 1FGNL 4LOUD 3U4EB 4LLDA 4HJ0C 3T77B 1A6VH 1UXWB 5ISZD 4CW1B 4OQTA 4WO4B 3KLAA 4KPHL 2FX9H 3D25B 1BVKA 1S7SA 1OWRM 2LV4A 3ULUD 1M6OB 2CO6B 3MMEB 2E7MA 3IS0X 3WNNA 2MHAB 1Q9LB 4YDLC 1QTYT 1D6EA 3CZFB 1N0XH 3L3KB 4Y19A 3LKRA 3MRNA 1U92A 3DLQR 3V6OA 1T3FA 5JOPE 2VE6A 3EW3B 4YDLB 2ZUXA 4KDTC 3RZCA 3DO7A 3MFFA 4PR5B 2HTKD 1CDUA 1R3KA 1LVEA 2X4PA 5TF1H 2F8XC 4YHIA 4XNXL 1UM5L 4PJBF 3Q5TA 3BISA 2FWOB 3C6LB 1QNZH 1G1YA 3LEXB 3MJ7A 3I50H 5FK9B 4S1QH 5CBEB 4JB9H 4LVHC 3REWB 4IMKA 3QUKB 4KFZC 3EFDL 3AXLA 3QSKB 4QRQA 4DZBB 4BSWB 2IAMD 1NC2D 2DL9A 35C8H 3OAUL 4KRPD 5EU5A 1RAMA 3BD4A 4HH8A 4LVHB 4XPGH 3SGEI 2Y7QB 3INUH 5C0CB 4CU7A 2F5AH 4RAUA 5E4EC 1DBAL 4NT6B 4JGJA 1LO4H 4NQTA 5TPWL 5FUCC 3VWJA 4AJ0A 5F88A 5I1HH 1I1FA 5J89A 2D0HA 1MHEA 3Q2CA 3PP3H 4K7PY 3CMOH 1QKZH 4F8QA 3NTCH 1CICB 3HG1E 4PJIF 1FJ1A 4FG6C 1DBJL 4K71C 3MGAA 3PDOB 3FZUC 2R1XB 5ACLA 2DIAA 1TCMA 5DD3L 5F70A 3DMMA 3HAEB 3B43A 3TO4B 3VD5A 4Z95L 1ED3B 3BP6A 4JFYB 4PJHB 3CFCL 7FABL 4HDIA 3UTZA 4JKPL 4R4NC 4G8EB 1CD9B 4Z7UA 2VXQL 1KCRL 4P3DB 4HAFA 4PJBE 5FHAL 1Q9OB 1TFHA 4LSDA 2G9HA 1VFAB 1NCNA 4PY7B 4L4VA 4XPFH 4FTVB 4J3SA 4NUJB 1E28B 1UH2A 4PJXF 3WNOA 4EN3A 3GO1H 2IGFL 3SBWA 1ZLSL 3BZEA 4Q97A 1FL6A 2APVA 4PJDA 5GQBA 3PDDA 4QOKD 3VXRE 3QRGH 4LSRL 4JY5H 5E6IC 3KLHC 4ONFL 3VFRA 1WEJL 1NUNB 3SGJA 1H3TA 2XN9D 5DJ2A 2R56L 2FEEI 2W92A 5E6IB 5A1AA 2BVPB 5C2BH 2C3VB 1IKFL 5JXAL 3HC3L 4EDWL 3MLUH 3KNBA 3GGWA 1BQHA 1KG0A 3S34H 2ATKB 4KWUA 3VDCA 4E9LA 5TGBB 4PJIE 5BMFL 5J4MA 3B8YA 3MRBB 3UYRH 2XNAA 4X4XA 2VXSL 3ZE0F 3QHZH 1RSFA 1QLRA 1RVFL 3OAYH 3D6GA 5KJRL 1ZVSA 3FQXA 2X9XA 4XRCB 3VWKC 3ARVA 4LLUB 4PREA 1JPFB 3HUJA 5DO2C 4PJXE 5E94B 5EZOL 1CXEA 1CDIA 1YYML 5ISZB 4PRBA 2ED8A 5I1GL 3KPSA 1AFVL 5D2NE 1MI5E 3IRZA 5EUOA 3SGDH 4XPAH 3X13B 5BQ7A 3TCLA 5KN5B 3S36L 1EA9C 4HQQL 1BFOB 2BVOA 4POYA 1F13A 4HWZA 3TV3L 4MHHG 4HC1A 4U1HB 3UX9B 2XG5A 4ZFZB 1KEMH 1NGZB 5D6DA 3A6BL 3HFML 4G6FD 4IRSA 1A6AB 3U36A 3EDKA 3V0VB 5K9QI 3SDCD 3IDMA 4LCCA 1I8IA 4QRPE 4JO4L 5EB9A 4CVWA 2NY6D 3R1GL 3HMWL 2OZ4L 1MCFA 3MCKA 1DDHB 4NNYA 3U9UA 4FZEH 4QF1B 5CP7A 1HZHH 2O93L 5FYLH 3O11A 2DQUL 1AGEB 3LOWA 4Z76B 3LHPL 1IZJA 3K2UL 3VRIA 3ZE0E 4CMMB 2V9TA 1A7RL 1V3JA 1YY9C 1RV6X 4DCQB 3B2VL 3BIKB 4TULH 3HE6A 1KN2L 5CMAA 1UXSB 1Y6KR 1OAKH 2SEBA 3I6KB 1NC2B 1A4JA 1YEGH 4KRPB 5I1LA 4L5FH 5JW4Q 1BECA 1OTUD 1YNLH 3W81A 2X1PA 1I7TB 3S96A 3VFPB 3X14A 4RBPK 2XZAL 1FZJA 2PF6A 1EZVY 3RX5A 4NKIH 4MNGB 3ZKND 5FYJD 3PWNA 3TYFB 3LKSB 3KYNA 1S3KH 1J88A 4LASL 1CU4L 1K5NA 4ODUA 5HHNA 1T1YA 2X7LB 1T2QL 1EHLH 3LQZA 5F6HI 5HGGS 4PB0H 4DOHB 3ARYA 4RMTA 4DW2L 4M5YH 3P73B 1BJMA 1FLRH 4D0CA 1RD6A 4EQ2A 4M8QA 1MFEH 4XBPB 1BM3L 4UINL 4DK6A 5J7CC 3RPIB 3O6ML 5AD0A 4JRYD 4JAMA 1OTSC 4AQOA 4PRIB 3FO2B 3C87A 3MLPA 4O2EA 1D9KA 4HKZA 5D70H 5F7NC 4GAYA 2YUXA 1I8LC 3MOAH 1J5OL 5C6TH 5I0ZA 3CMGA 1RUMH 2IWGA 1E6JL 4OLXH 5FA3B 1J0JA 1MCLA 3T4AA 5ESAB 4G7YL 2ZUTA 1UB6B 4QOKB 3HI1B 2H32B 4DVRL 4OCWL 3G6JE 1AGDB 1MELA 4KRMB 4WI4A 4AL8H 3MA9H 5KSAA 2VXUL 4KMTH 1UZ8B 3IVKA 3MLWH 3G6DL 1JI2A 4X9GA 4PJ8D 3V52L 4IIQA 1KB5H 4RQQA 4LLWB 3QJHA 3U2SB 4OD3H 4JG1L 4PJGB 2OMNA 5EN2B 1ZANH 2H41A 5I66A 3PNWA 3WIHA 1IT9L 3DV4B 1TPXC 3Q5YA 5T5FH 4EZMA 5FHBL 4JM2C 5DMGC 3R4DA 4QRRA 4Y4FC 3IDIA 1JNHA 2XA8H 1TPXB 1F11B 2NY3D 4R4BB 4XAKE 5I75B 1DQDL 1NSNH 4HS6B 4OM1L 1YEHH 1NEZG 3HNTH 4Y4FB 3SDDC 2B1HH 2BVQB 3CFJB 3Q6FB 4F58H 4P9HL 1L4IA 2XI9A 3SDDB 2I9LA 1BD2D 4F3FA 4P4RB 2VWEE 3GI8H 2I07B 3PL6C 5HDQH 4ZS7H 3P0YH 3ES6B 1ETZA 1BGXH 2UVEA 5DFVD 1RFDH 1EK3A 2C5DC 2QSCL 2H1PL 2ICWA 2IPUG 1QVOB 5DJ8B 4PRHA 3BRFA 4Z7VB 4MD0A 4KKNA 2KPNA 2FEEL 2VLKE 4L4TE 1AGCA 2NTSP 4X5XB 1JHTB 3O9WD 4RIRA 2AW2A 4G9DB 2DQJH 3VXSD 4XI5D 1LDPL 4MA7L 4G6FB 3HMXH 4NQXA 5D7IF 3W11D 4GXVH 4DAGH 3SKJH 1OP3H 2NY6B 2R4RH 1LNUA 1MFDL 4X99B 4UV4L 1U8JA 3DIFB 3KS0H 5DRZA 2C1OB 3KPQA 1GCFA 4OZGF 1EMTH 1GZQB 2WUBL 2IQ9H 5C0ND 5HTSA 4JFZH 2DDQL 1ZLUK 1KN4L 1KT2A 1OD7A 3LD8C 1AE6H 3MX0A 5JMOC 1E27B 1I7ZB 4YR6A 4DKDC 5I8KH 5KAQF 3LD8B 4NC2B 1IC7H 4QRUB 2E7LC 3DETC 2VAAA 4UU9A 3GSWB 5IG7A 3LN4B 1UH4A 3I6LE 1QPXA 1KIQA 3VXME 3NPSB 3CFIC 2QSVA 4QXUL 2Q8BL 2CDEA 4XXCC 1HKLH 2DQTL 4UILL 1M7IA 4MXQD 4QHNA 4AMKL 1IM9D 5J0BA 3W9EB 1RUQL 5DEZA 2F74A 3WSQL 5H8DA 4IOIB 1MLBB 3A6CH 2RB8A 5CJBA 2V7NB 3SEPA 3C9NB 5EBMB 3FFCD 4G80A 5ID0B 5TQ0L 4PBXA 5IVZA 2J88H 4YWGH 5D7IE 4KQ4H 2IMMA 1XZ0A 4WDIB 4YHYC 5ICXB 3OTTA 2Q6WB 4G6AC 3U7WH 1J1PH 2FSEB 3UCRA 2I5YL 3WD5L 3FN3A 1T03L 5LBSH 2VZTA 3E6FB 4JRYB 1RMFL 1MJUH 1ZTXH 2YD3A 2AK4B 4OZGE 1GIGL 4PPTA 5D93C 5EU3B 1M05B 4RRPA 5AUMB 1A1NB 3U4BL 1MHPH 3MRIB 4V1DD 2WBKA 5JW5B 5J6GA 3DRTB 1A6UL 4YXKH 3UTSE 3PG2A 4AM0B 4QTIL 2Y6SC 3WO3B 4YDJB 1QFWI 5EBLA 5I1JL 2MNUA 2DOCA 4LBEA 1ONQA 3ULVF 3MODL 2Q1EA 4S11A 5J1TC 4PJ8B 3FOMA 5C09D 1N59B 4ZSOA 1XH3B 3MLSL 5AZEH 2IH1A 3MJ8B 3GMLA 5BW7A 5T3ZD 3UEZA 1DLFH 4TSBH 4XNXH 1UM5H 3FKUS 3RA7H 1R5WA 2D2OA 1HXYA 3QH3B 4A6YB 3QXVA 3MGOA 3RVUC 2H2SD 3GM0A 2OR9H 4U1LA 2NY3B 3KG5A 3GDBA 3DVNA 1PG7H 2AJSH 3QIUC 4HIHA 1RZGA 3BPNC 3D2UB 3PABA 1KACB 2P7TA 1R3IH 1OLLA 4R7DA 3T1FB 4JFEB 4N0UB 1K3ZA 3DYMA 4OLYL 4NRZA 3QWOA 5EWIL 4H25B 3HB3D 2V5SA 4ISVA 1V7NL 3HE7C 3Q1SL 1VGKB 1PSKH 5JOPD 3ARZA 4ZUTB 1OAQL 4S1RL 1Q0XL 3ULVE 15C8L 1CYGA 2VDMH 3GBML 3VXSB 1AR1D 2PCPB 5FO8B 1G6RB 3W9DA 3CFKB 3VH8G 5D6CB 1XR9B 3CFCH 7FABH 1ES0B 2F58H 3U4EA 1WWWX 1II4E 1MFCL 3UJIH 3WLWC 1KCRH 3T77A 1RJZB 3ZKQD 1UXWA 1U6AL 3LQMA 2DQHL 2RCSL 4JM4H 3CPLB 4P5TC 1FGVL 4CW1A 2F5BH 4WO4A 2WM0A 1U3HC 1I1AC 1P53A 1FN4B 3D25A 1I4FB 1LO0L 5LWYL 4RNRB 1MAJA 3LQAL 5JLZB 2XTJE 1ZLSH 1M6OA 3MMEA 1JI1A 4XX1E 4J12A 2MHAA 1Q9LA 1E4XH 5DQDL 3CZFA 3L3KA 1KB9K 1WEJH 1G7IB 5HDOA 5I9QC 5I18L 3BWUC 1AY1L 3MUY1 1QOKA 4PR5A 1U91B 4CKVX 4DJMA 2YMXL 2L0DA 4YC2C 5JXAH 4N8CL 3ARGD 2CO7B 3O6FD 1UFUA 1JNNH 3CVIL 1YPZB 1I3RB 2FWOA 3C6LA 3LEXA 5BXFB 3LS5H 5BMFH 4YHNB 5J13B 2WQ8A 4HIJB 1U8OB 3OBAA 5CBEA 4GRLD 3REWA 3QUKA 1FFOB 1RUKL 4DZBA 1GXEA 4BSWA 3UPRB 4HCRH 3I2CH 3L5HA 5DS8B 2Y7QA 4OCRL 5C0CA 3ARFD 2NZIA 3QCUL 1F45A 3O4LE 4AEFA 4NT6A 4GS7C 1TNNA 1MHCB 2Y36L 3JXAA 1A1OB 3EYUH 4S1DD 1EV2E 1IQWH 1UACH 4MYWB 1WCBB 3VXRD 4J3OC 2A9ML 5DVOA 3EYQD 4V1DB 5FYLD 2EE2A 3MNVB 1CICA 4EQ3A 5CEZE 3GMPB 3PQYE 1WWAX 4AIXA 3AY4A 3PDOA 2R1XA 3TV3H 3BSZH 4F2MB 1U36A 1TMCB 4GRMB 3JWOH 3CGTA 5SWSE 4YDIH 1G6VK 3HAEA 3TO4A 1ED3A 5CFHA 4PJHA 4JFYA 1B6DA 3S88L 2V2WB 1LQSR 3HFMH 4G8EA 1VPOL 3FFDB 4OM0L 4JFQB 4RFNB 4WEUD 4P3DA 2E7BA 5MEQB 1A22B 1Q9OA 1VFAA 4PY7A 3HMWH 2OZ4H 4FTVA 3U0WH 4NUJA 2HJFB 2NXYC 4MA1B 1E28A 5DA4A 4K2UH 2IF7A 5LCVH 4LVNC 3BGAA 3NIGF 4UDUB 3MREB 1A7RH 3E8UL 1MFBL 4HEPG 5C07E 1N6QL 2W60B 5KVFH 3CDCA 2AEWA 1KN2H 4PJ5B 3QCVH 4YXLL 5F9OH 1MEXL 3HI5L 5CZVL 2OTWB 5E6IA 1RUAL 1DBML 2BVPA 5GZOD 4XVJH 3Q0HA 2C3VA 4FQJL 1G0XA 2ATKA 2DM4A 1CD8A 4P4KB 1FPTL 5IFAL 2WUCL 3PHQB 3G9AB 3ZT7A 3HZMB 1IC4H 3MRBA 4NO0D 4CGTA 4L8DB 4LASH 5LGHL 1FHGA 3IFLL 3MUGB 3NH7L 4QRPD 3IAGC 4TTGA 4G8GE 2CIIB 5IF0B 4P9MH 4FQ1L 5IHUL 5CHNB 5IHLB 4XRCA 3ZDZF 4WTZA 1BM3H 4LLUA 5E08H 1JPFA 1RZ7L 5E94A 2DIJA 1NGQL 2AKRB 2BSED 3GKWH 3KYAA 4GRWH 3RVTD 1IGCL 1RHHB 2HRPL 3NIGE 1MCWM 5ISZA 1FSKB 4NNXB 2EXYC 1CFVL 5C0JB 1Q9KB 3DXAD 4J4PC 1X5ZA 3BDXA 1KENL 3X13A 1J5OH 5KN5A 1BFOA 1N5YL 2HMIC 1E6JH 1J1OL 4WVRA 3HC4L 4G7YH 4U1HA 4TTDC 4FMFA 4ZFZA 3FCTB 3QHFH 1NGZA 4DVRH 4X80H 2YA1A 2GJ6D 1UT9A 1A6AA 3DV6B 2PO6B 3V0VA 2WBJC 3EO0B 1T04B 5EOCH 3MRRB 2VERN 4CADB 4JQXC 4H26B 1Z9OA 4NO5B 1BOYA 2YK1L 3G6DH 2WBJB 4LU5H 1DDHA 2YRLA 4I13B 4BFBD 4QF1A 4PLJC 3O2VH 1CDYA 4G3YH 3ARGB 4Z76A 1AGEA 4JG1H 3O6FB 2VLME 3D69B 4CMMA 2E9IA 3PXHA 3OZ9L 4DCQA 3BIKA 4BQCA 5CD3B 4D2NA 3ZT5A 4GRLB 2X1OA 1UXSA 3ZDZE 2D03L 1XGUB 3I6KA 2P5WD 1NC2A 4PJBB 5GHWL 3T65B 3K1DA 2AJYL 2YEZB 1C16B 3ARFB 1GC1C 4OM1H 3MRQB 5L2KE 4JJ5B 1I7TA 2HVJB 1OSPL 3ZSSA 5C0GB 5E1HB 3VFPA 2VQ1B 3WNKA 4AT6B 3GSNL 2B0SL 4P2OD 2EIEA 3DGGB 4WENB 3RU8H 1PKOA 1WFTA 3ZDXF 3KR3L 4MNGA 4K55A 3RVWC 5F7FA 2HT4D 3B5TA 3TYFA 3LKSA 3ZLQC 4MQXD 4M6OH 2X7LA 3RWCB 1NMCB 1S78C 2G2RB 1NFDF 3TFKD 4O00A 3B2UC 4DN3L 1X5LA 3VXQB 1UM6L 1UH3A 1EO8L 4S10A 3P73A 4AH2B 1ZHKA 1KTLB 2JJTA 3DUHA 3OAZH 3TO2B 4XBPA 3OJVC 3WJLC 2WLYA 4MA7H 4ZFOB 1UCBH 3RPIA 2D7MA 5C0RL 6FABL 3ETBF 4OCXH 2WINB 4P2YA 3FO2A 4PRIA 4DUXA 3C2AH 5BO1L 5BOZG 4FRWA 1IGYB 4S1SH 2LU3A 3QO0B 3MC0A 4ODSH 4ZOEA 3LVEA 5GSVB 1JGUL 2HLFD 4WEMB 1OPGL 5JIPA 5IMLB 5DMKB 2EKSB 3ARED 4XAKD 3QAZB 3KJ6H 5FA3A 2FB4L 5ESAA 1UB6A 4QOKA 3HI1A 2H32A 1G84A 4PYGA 3ZL4L 1AGDA 3TBTB 5B38B 4OLUH 1Z2KA 5C0BB 3O0RH 2HKHL 1UZ8A 3D3VB 1OHQA 3ZDXE 1HH6B 5GSRB 2YN3A 3X17A 4YX2L 4LLWA 2F54D 5EUKB 3QPXL 3U2SA 3SJVE 4QXUH 4PJGA 5EN2A 3JWNC 5HVWA 5BS0E 4QGYA 1NFDE 4HGMA 1OF2B 1NANH 3ARBB 3DV4A 4NO0B 5IT2H 3WSQH 1PX3A 4IDLA 1KJ3L 3MJ6A 4PG2C 1INEH 3RPKA 4MXVF 5C0FB 4K9EL 2NY7L 1F11A 4R4BA 2DLIA 3N9GH 4GW1B 1RIUH 4HS6A 3KDMB 3QFJE 4Y4FA 1J1XH 2BVQA 1U8MB 3CFJA 2NY2C 3Q6FA 4ZTOL 1HINL 3WHXB 3CNKA 4HGKC 1DL7L 3SDDA 1EVUA 4P4RA 2JJSA 2X9YA 1QBLH 2I07A 2DKMA 1TQCB 1OQXA 3ES6A 3FHAA 4M7KL 5L7XH 3DXAB 3FO1B 1KB5B 3CXDL 3C8HA 3V6FB 1WWCA 3WFBL 3L3OB 2YR3A 1QVOA 5DJ8A 3RJDA 4Z7VA 5F7EH 1A0QL 3SO5A 4XWGL 4X5XA 1J8HE 1K4DB 1JHTA 1A6UH 4H88L 4JY4B 1CDCA 5ALBL 2UWEF 3RHWF 1CGWA 3I6LD 4OGYH 4G9DA 1M71B 3VXMD 1G0DA 1DSFL 2GJ6B 3PWPE 3OB8A 4L1DA 1S5IH 5I1JH 4LSVH 3FQRB 1OCWL 3RDTD 1UYWL 4PRPB 3AC0A 1GGYA 2UUDH 4X99A 2E5EA 5TE6H 1D5IH 2VDNL 3EAKA 3DIFA 3P4NB 2C1OA 5A40E 3MLSH 4MXVE 5MI0C 1GZQA 2IEPA 4HPOL 2VZVA 1XT5A 1TZGH 4G6MH 5IMOB 1JRHH 3WFDL 5C9JB 2AABL 1D6VH 3V0WL 1E27A 1I7ZA 2E9JA 2P5WB 1DQLH 1NQBA 4HHAB 5DDHB 1CTOA 4QRUA 3QDJB 4ZAKD 4MNQE 1G1CA 3GSWA 2AXHA 3LN4A 1YEDB 4XMLH 3CFBB 1WIUA 2KZWA 3WS6C 1KIUA 2X4RB 3RVVD 1T0NB 3OL2A 3ALWA 5IJKC 3O8XD 3PWVB 1FIEA 2NXZC 3W9EA 5ADPH 4XXCA 2ICEB 1MLBA 4IOIA 4M62L 2UWEE 5EWIH 2V7NA 3RKPA 2NXZB 4FFYL 3C9NA 5EBMA 4HUXB 5ID0A 3JWDL 4HULB 4KHXL 4KKAC 3Q1SH 3D9AH 4DK3A 1F4WH 1RZJC 4NM4H 4G6JL 3BUYB 1OAQH 4OIBA 3BGMB 4WDIA 3OG4B 1Q0XH 4IM8A 4OCSH 4MZ2A 5ICXA 2Q6WA 1HK6A 2FSEA 1A7PH 5JXED 3JUYA 1H5BC 1JN6B 1S7QB 3J7HA 5GGQL 2LTQB 5CKAA 2I26N 1IAKB 4KK9C 3S4SG 3E6FA 4JRYA 5I71C 1NGPH 1NCAH 3S37X 2AK4A 2YPVH 2GTZB 1H5BB 3MV7B 5HHXH 2BK8A 1MQ8A 5EU3A 1M05A 3MJ9L 4X8XA 5AUMA 2FRGP 1A1NA 3RGVC 1U6AH 3WDJA 2RCSH 2K3TA 4D9RE 1JFQH 2CRYA 3G5YB 3RGVB 2EKJA 3MRIA 1P69B 3V5KB 1PEZA 5JW5A 3DRTA 5IB2B 1KCVL 1LO0H 2BY0A 4ODVH 3LQAH 3P9WB 2DYPB 1VKXB 1L7TL 4AM0A 3ME0A 4YDJA 2W9EH 5C2UB 4P46D 3F7RA 3SKUD 3X11B 3RI5F 2CJUL 4JG0L 5I18H 2FYYB 1KGCE 3HNVL 4PJ8A 1QBML 3GMOB 1N59A 4K3DH 4X7SH 3O3EB 1XH3A 2F54B 4LSSL 1GAFH 1NKOA 4NNPH 2YMXH 4FABL 1A64A 3MJ8A 4GW4B 4N8CH 4HFUL 2KKQA 4PD4K 5GIRB 3QH3A 4A6YA 1ZHBB 1X44A 2MFNA 3FQNB 3U46B 1HNFA 2XZQH 4XVSL 4E42B 2VQUA 2VN7A 1HXMB 1IGMH 5DZLA 3BO8B 1EBPA 4NKDB 5K9QG 4X4ME 5IFHL 3IDXH 2BNRE 2XRAL 1I9IH 2YRZA 3D2UA 1OGTB 2EDLA 5F7LB 4DUVA 1WAAF 4TUJB 2R8SH 1ZEAH 3QCUH 5I8EB 4HIEB 1Z9LA 2EDXA 4FXGB 3T1FA 2XTJD 4JFEA 4N0UA 4FZ8H 4H25A 1R0AH 1QLEH 5FYKL 4TSAL 2YZ1A 2A74B 2J4WH 3T3PF 1VGKA 4NZTL 4XHJC 2APBA 4ZUTA 1U8LB 2J3SA 5J8OA 4NPYB 1B0RB 2A9NL 4U1NB 4EUPH 3VXMB 3X3FL 4RGNC 1BHGA 3TBSB 3VXSA 2PCPA 2MQCA 5FO8A 1G6RA 4ZS6D 4M1CC 4PS4L 3WMSA 3CFKA 5DD1H 5D6CA 1XR9A 1ES0A 1GH7A 4QYOB 4WEBH 4P99A 5TDPB 1RJZA 2R15A 3CPLA 5CP3A 3TH2T 3O2WH 3F7VB 4FQIL 4JKMA 4YFLF 4M7LH 2R0KL 1FN4A 1I4FA 5FGBC 4CN4A 3KWWB 3GI9H 5T5NF 4RNRA 2FX8H 5JLZA 1NBZB 3CX5J 3E8UH 3MRJB 4U1JB 3O4LD 2IG2L 4TVPL 1WAAE 2CKBH 2XY2A 1G7IA 1X4YA 2P43B 5E2UH 4Y8DC 4P23D 4PLKD 4L8CB 4TYUA 1DBMH 1U91A 3LZFH 4LFHG 2ED9A 1INDL 1RJYB 3IF1B 1NCBH 1AD9B 2HH0H 2OJEB 4UOJA 3O8XB 1HE7A 2DI8A 5CEZD 3ZKXC 3PQYD 4JQVC 1UJ3C 1QYGL 1YPZA 1I3RA 4AYFA 3VW3L 3ULVL 5IFAH 2P48B 2WUCH 5BXFA 2OSLB 4YHNA 4HIJA 5H37G 1U8OA 4K7PX 1B9ZA 2BXYA 4BA8A 5LGHH 5C0DB 1ZE3C 1DBKH 1FFOA 1GHFL 1ODAA 2A6KB 1JMXA 2JLLA 3UPRA 5DS8A 1P6FA 3MQIA 1PAMA 4X9FA 3BIBX 5IHUH 1CR9L 3F58L 4NJAH 3VFSB 1RZFL 1H3GA 1FH5H 1MHCA 4J7RA 1F4YH 2JJUA 1A1OA 1RZ7H 4LGSB 1U8HB 4Z0XB 3WKML 4XGZB 5C07D 1F3JB 3MACH 3SOBL 1IGCH 2HRPH 5JZ7D 2Q76B 1WCBA 4Y89A 1BIIB 1NAKH 1NL0H 1CFVH 5JR1H 4V1DA 4MA3B 4XPTL 3MNVA 3GMPA 3MLXL 2IC2A 3QDGB 5KS9B 3C2SA 2EE6A 4F2MA 3E0GA 2MOVA 4GRMA 3BOVA 2IAMC 4DGIH 4P46B 1DR9A 3HCVB 1T66C 2V2WA 4R4FL 3FFDA 4JFQA 5MEQA 4NBZB 4HMEA 1FAKT 1JZ4A 3MSPA 1JPSL 2ZZUT 2HJFA 2AGJL 2YPLD 2ARJB 5HGAB 5FYKU 2AQ2A 3H9ZA 4UDUA 4D8PB 3MREA 3NA4A 3BJLA 4KVCH 5SX4H 1FZKB 3OZ9H 4B53A 2W60A 2ITCB 3F7PC 1K8DB 3KPOB 3IFOB 4PJ5A 4NKMB 4NN7C 2XACC 2RJMA 4N9GB 3SO3B 2OTWA 2DLFH 4OF8A 4PJFB 1BOGB 1IBGL 4TUKH 3BKJH 1Q8MA 1J0YA 3RIAF 4KUCF 1T7VA 3AS1A 3PWJB 4M61B 3QEGL 1OSPH 3TEUA 3SE8H 5T33H 5AAMA 2VJXA 2ZUQC 1F6LL 2D7PA 4P4KA 3ILQC 2FZ3B 1QA9B 1JP5A 3PHQA 5F72S 3HZMA 4Y5XB 5L9DH 4JN1L 4L8DA 3IU3B 4Z6AT 4PB9H 4I77H 4XP9L 3MUGA 5I1IL 4DN3H 2CIIA 5IF0A 1UM6H 4CUCA 4BQ8A 5IHZB 3MRFB 1ITBB 4Y19E 4O2FB 4WI6A 5CHNA 5LXGH 1V3MA 2PTVA 3WHE1 3TZVC 3N85H 1V7MH 2NR6C 5JW3L 4PGDB 3WNLA 1T7WA 3IFPB 1HHKB 2AKRA 2EYTA 2Z8VC 3TZVB 1RHHA 5BO1H 4NNXA 1JMZA 2FHCA 3UAJC 4KUZL 5C0JA 1Q9KA 4X4ZA 1C7SA 3HLAB 4MJ5B 1OPGH 3NZHL 5F71A 4FQHB 3QIWD 3ZE2F 2EDKA 5FCUL 2QQKH 4M6NL 2DMCA 3PGFL 3FCTA 2J2ZA 2MTPA 5BV7H 1BEYH 3DV6A 1JCKA 2PO6A 3EO0A 1A6TB 1CBVL 1T04A 1JZ7A 4DQOH 3MRRA 1OM3L 4CADA 5C7XH 1CVRA 3ARUA 4DKEL 4H26A 4NO5A 2WBJA 4YHZL 4DGVL 4WU7B 1XF4B 1Z6JT 2E7CA 1K6QH 4PGCB 3QPXH 2IFGA 3PQYB 3D69A 2YHGA 4GRWB 4UZGA 4JR9H 5CD3A 1X5YA 1SQ2N 4YBQC 5E5RB 1HHHB 5EU7E 4K3EL 1YZZA 3H3BC 4GRLA 5D2LB 2P46B 1KJ3H 1XGUA 3THMH 1BWWA 4PJBA 1MCSA 4HBCH 5FM5O 5CJXA 2AJVL 2YEZA 1C16A 3ARFA 3MRQA 4JJ5A 3RKDD 4U1IB 3L5XH 2HVJA 5C0GA 5DLMH 3S37L 2AI0H 1JIBA 1W72L 2VQ1A 3W2DH 2LFGA 4AT6A 1K3IA 2VXTH 3L6FB 4UB0H 2A6IB 3E3QC 4OZ4B 2COQA 1YJDL 3B9EA 4L4VE 4HLZG 5FB8B 2W65B 1JWSB 3FT2B 5E7FA 1MHHB 4FFZH 3ZE2E 1RURH 3WHE0 3F65A 8FABB 4HUMB 2I60L 2EDNA 1LDSA 3RWCA 2G2RA 3WFBH 1GGCH 1SMOA 3ZE1F 3KLDA 1TVDA 4PJDE 5EZIL 3TYGL 3VXQA 4EIGB 2R2HB 3RP1A 4XXDB 2ZG1A 2IQAB 4AH2A 3TN0C 3TA3C 4U6VH 4H88H 1KTLA 3FO0L 3TO2A 3KPRB 5F1NB 1AKJD 5CWSB 4ZFOA 3GSXB 1XFPA 4WJ5B 3RL2B 1OQOA 2WINA 2R1YB 5MEOB 1Y0LB 3QI9C 4RMRA 3JTSB 1IGYA 1E4KC 1KELH 2VSCA 4CJ0A 1F6AB 3QO0A 4P9HC 4JO1L 5GSVA 2YPLB 3L9RB 4J6RL 3VGHA 1KYOJ 2VDNH 4I18B 5IMLA 5DMKA 2EKSA 3MBXL 4XAWH 3NZ8B 3QFJD 5MHSE 4U3XA 2E8YA 4OD2B 3K4DA 3HRPA 3JZ7A 3UZQA 4LARL 4JN2B 3VRLF 3V0WH 3TBTA 5B38A 1T2XA 2B20A 4ONHB 2BVTA 5LAXB 3DX8B 5C0BA 2R9HD 3D3VA 1HH6A 2ICWJ 3HUJE 5GSRA 4QRTB 3S4SB 3VG9B 2QSTA 4GQ9L 1Z9SA 4MA8L 4NN6C 5CBAB 5EUKA 2GCYB 4PUBL 4X6DB 3TNNB 1UB5B 4YXHH 3QEUB 5INDB 5E2TH 1OF2A 4KK5C 3KPSE 1DTUA 4LHUG 3ARBA 5EUOE 4NOBA 4NO0A 5TDOB 3QRFM 1CQYA 2A0LD 3TT3L 5HHQB 1WGOA 4WWKD 1N0LA 5C0FA 4RCAA 2DBLL 1JYNA 3EYVB 5HHVH 1G7QB 2BFVL 4PP2B 4GW1A 1BQLH 3KDMA 4YPGB 5D1QD 2X4OB 5F1KC 2CRIA 2Y07H 4PJEB 2E27L 1U8MA 3B8SA 3OKOB 1I9JH 4U6YB 5IWLA 2CD0A 5A16B 1EUUA 3K80A 1GZPB 3WHXA 1MY5A 5DRWB 2EDBA 3H6JA 3QIBD 1ZXQA 2P8MB 3RJQB 1G9NL 4LMQE 3FMGL 2MKLC 1I3VA 2HRLA 3V4VL 3ZYJA 3DXAA 3FO1A 1KB5A 5BRZD 3V6FA 3L3OA 3LCYA 3QPQD 1TJIL 3SDAC 4MVBC 4F7EB 3QIWB 4U4BA 4MNQD 4NC1E 1K4DA 4JY4A 2CMRL 4HUUB 1M71A 5DA0B 5GS0L 1MWAL 4Z5RB 2GJ6A 2A83B 2O26U 2ZCKH 1AJ7L 3S9DB 1DQJB 3FQRA 4ZDHB 5ILTL 2CJUH 4UDTB 5HHOE 4CN1A 4PRPA 5I0DA 3ALPA 1AR2A 3GZKA 1ZGLP 4L8SB 1QBMH 4XP4L 3QUZC 4LSSH 1RUPL 4EOWL 4OSUL 1A7OH 4FABH 1OW0C 5DMIH 3OJ2C 5DFVC 5IMOA 3VXTB 1PW3A 4H0GA 5C9JA 3FN0H 3RGHA 3UBXI 1IGIL 1CZ8L 4FNLL 2V5TA 5HYQB 2P5WA 4HHAA 4XVSH 3P4MB 1AXTH 4HAGA 3QUYD 5DDHA 3KPLB 2YN5A 3QDJA 4AENB 4BK5A 5JOFB 4KKLC 1YEDA 5DI8B 1G9EA 3CFBA 5IFHH 2XRAH 2X4RA 1T0NA 2BHYA 3HMXA 1QPPA 2PW2B 2VZ1A 3PWVA 1QSVA 1DUZB 2V9QA 5FM5M 3WS6A 5FEBA 2M26A 2HAZA 1F97A 5GZNC 3CFEB 2ICEA 2A2QT 5C0NC 1ZAGA 5DD0H 4HUXA 1J0ZA 5FYKH 3VJ6B 5J12B 4PP1D 2AJXH 2VB5A 1SY6L 3B4NA 2HWZL 4JPIB 3BUYA 2WQRA 1FCGA 3BGMA 2GFBB 1S7RB 2A9NH 4U1KB 2MMXA 3X3FH 2GITB 4TQEL 1AKJB 5F9WC 2HG5B 1JN6A 1S7QA 3PE9A 1MREL 1IAKA 2A38A 4YFLI 4NJ9H 4ZFGL 4LHJB 5I17B 2GTZA 3UJJL 1H5BA 3D1MC 3MV7A 4KJQD 4U1MB 1R3JB 2V2TB 3O3DB 4FQXD 3VU2A 2YD1A 5GS1C 3G5YA 3MLVL 4MS8D 3RGVA 1JPTH 1E0OB 3V5KA 2OXHA 3GIZH 3QFJB 2F8VA 5IB2A 2RFXB 3HHRB 1KCUL 4KMQA 2BNRD 2VDLH 4WU5B 5GS1B 4JKWA 3ARDD 5F1SA 4QRRE 1VKXA 2DYPA 1CLCA 3BRGC 1CGXA 1EFXD 2IG2H 4WI2A 4TVPH 4HD9A 3WO4B 3X11A 1UEMA 4HUNB 4L8BB 3RAJL 1FG2B 2FYYA 1YC8A 1N7ML 1A7NL 1GPOH 3GMOA 4YH6A 3GMQB 3O3EA 2F54A 5DJ0B 4GJTB 4YJZL 4GW4A 5T1KB 4F37K 1C5BH 2AP2A 3MUZ1 4KJPC 1UENA 4R0LC 5GIRA 4OLZL 4LAQL 2V5RA 4N0CC 3TBYB 4WWKB 1ZHBA 3FQNA 3U46A 4APQC 2NMSA 4E42A 3LQAC 5E8EB 1GHFH 1HXMA 1MJ8L 3BO8A 4NKDA 5D1QB 1Q94B 3ILPB 1GGUA 4XTRD 5F9JB 5FO9B 1OGTA 4ORGB 5KW9L 4TUJA 2W9DL 1CR9H 3F58H 5I8EA 4HIEA 4FQPA 2WLZA 4FXGA 4IRZL 1BZ7B 1S9YB 3QIBB 4X8JB 2VMFA 4JCMA 5IQ7L 2X1XR 4DTGL 1SM3H 4RBPH 3CSYB 3VXPB 2ZCLL 5BRZB 3KPNB 2X1QA 3W5MA 2A74A 3FB5B 4KZEL 5FAAA 4MNQB 1U8LA 3ZKMD 4NPYA 1B0RA 1OAUL 4L1HA 2NY1C 4U1NA 1EGJL 3VXMA 4P2RE 3TBSA 4R6UA 3R0NA 4UNTA 1P4IL 4FQCL 4O5LL 5GRJH 3QCTL 5LKNA 1GGIH 4QYOA 4LPWA 4MB5A 5TDPA 2XZCL 1EAJA 3EDFA 4DFHA 4ZOCA 3NGBB 4LVEA 3BE1L 5HHMB 4AG4L 1H9VA 2WWMD 3T0BA 1JPSH 3F7VA 3LKPB 4K3GA 3KWWA 4I2XB 4LCYB 2YRPA 1NBZA 3MRJA 4OZFG 4U1JA 5FGBA 3K4AA 3KPMB 3VFWB 4YUEL 3BYYA 4NSKB 3GHBL 1KXQE 3L7FB 4OFVA 3QUYB 5JMRA 1MCHA 5HI5C 5KOMC 5EOQL 4L8CA 4LL9A 2EC9T 4FQLL 2CR3A 4EUPB 1J7VR 4QHUB 1OTTC 1RJYA 1FFRA 1NKRA 3IF1A 1AD9A 2OJEA 1NAML 3O8XA 1WZMA 1W0WB 5I8OH 1T1XB 4D94A 1LK2B 2IH3A 1KCSH 3LS4L 3M1BB 2OSLA 5GJSH 4JPKL 5KSUB 2PETA 4NFCA 1HWGB 2FO1A 5C0DA 4KDWA 3DVGB 3AS2A 2CPCA 5E6ZA 2A6KA 4YHML 2VR9A 5I1IH 4F7TB 1JVKA 3VXNB 1IRAY 4UTBH 1QD0A 5JXEA 3VFSA 3AMKA 2FBOJ 1WIPA 5D5MB 2CKBB 5I19H 1U8HA 4NIKB 4Z0XA 3UO1H 4XGZA 4RSVA 4ZSOE 1RIVL 2OR8A 2YD4A 1F3JA 1WZ1H 5IVNA 4LDLB 2Q76A 3EO9H 1BIIA 3HI6L 4KUZH 1M7DB 4WI8A 4ERSH 4MA3A 4I0PD 3FOLB 2VXVH 2BNRB 3QDGA 3OB0H 5KS9A 1PG7W 3ARDB 4JRXD 1V3LA 2B2XL 4LP4A 1EFXB 5FDWB 3WLBB 1MNUL 4P46A 4NQUA 1J8KA 3PGFH 3HCVA 1F02I 1Z3GL 3CU7A 5EU6D 3T2NL 4FA8A 2N7BA 3AAZB 4YBHA 4M48L 3EKCA 4HCRA 3BH8B 1QO3B 3G6AB 4DKEH 2D4FA 1A6WH 3FN9A 2J12B 2PYFB 5CJQH 2LU7A 5HGAA 2ARJA 4HXAL 4S1DC 4B7LA 1MRDH 2F53D 2BRQA 2XFXB 1RULL 4ZO9A 1GGTA 4D8PA 1C8PA 1FZKA 4LDOB 3EOYG 5EIVA 2ITCA 2UZYB 4XWOC 1K8DA 3KPOA 3CXHK 1HQ4B 3IFOA 3EJZC 4NKMA 2ZUYA 4WCYH 4Y2DD 4N9GA 4PJFA 3C5ZC 4MD4B 1BOGA 2OP4H 3P9MB 4R96B 5DMYA 5F8QC 4MDIB 2VLJD 1E4JA 1TETL 1FRGL 1L6XA 4AEEA 4M61A 3PWJA 5EO0B 4C59B 1G9MH 1W72H 4G6KL 5T1MB 5HYJB 1A6ZB 4M93B 3O2DL 5HGDA 3BX7C 4XNQB 2FZ3A 1QA9A 3MYJB 2VDRL 4Y5XA 4YQXL 2OZ4A 2EH7H 1EH9A 3IU3A 1MJ7L 4K94H 5FGRA 1CWVA 2I60H 4CVXB 1WV7T 2QHLA 3UC0L 4D9LL 1BFVH 1MPAL 5EZIH 3TYGH 3NCYS 4F57H 5A43C 5IHZA 3MRFA 1FZOB 4O2FA 3QXUA 5FECB 4PYHA 3WNPA 3EHBD 1D5BB 3ZSTA 2ADIB 2FLBT 4WV1B 4PGDA 1I9RH 3IFPA 1HHKA 2FIKB 2F8OA 2FHFA 5D2NC 5HVHB 3TZVA 5DZOA 4WW2B 4PJHF 2Z31D 4CNIB 3NACL 3MUJA 5A2KH 2XQBH 1EUTA 4Z78B 1S9KC 3HLAA 4GBXD 4MJ5A 5F89B 2Q86B 1KIPB 3DMMD 4FQHA 3MBXH 5EO9B 1HHGB 1KFAL 5I15H 3VGGA 2NYYD 4LF3B 4GQPH 2F19L 4I4WB 3LEYH 3QNYB 1INQB 2OL3H 3D18B 4LARH 5C0CE 1A6TA 4L4VD 1I1RA 3VD4A 3L5IA 4OQTL 4RISH 5IROC 4WY7L 2MJWA 4Z7QF 4W4OA 3V7AE 4EN3D 4WU7A 1XGTB 1MOEA 1RZ8B 1XF4A 2DQEH 2B4CL 4PGCA 3PQYA 4P57B 1BX2B 4OGXL 1HHHA 3DWTA 5D2LA 4LQFL 1J0KA 4K3JH 3H7BB 2LAGB 4M1GL 4ALAL 4OIAA 5CJ8A 3CH1B 4UTAH 1U8PB 3G5ZB 3PV6B 4PJHE 4K23H 4U1IA 3OKDB 3CFDB 4FP8H 3QP3A 3QISA 2Q87A 3BQUD 5BV7B 3L6FA 3WN5C 2A6IA 3C60C 1MUJB 4OZ4A 2Q3ZA 1WBXB 4FTVE 4NZUH 5MHSD 2YUWA 3FQTB 5J11B 1DQQB 5FB8A 4P2CG 3UZEA 2W65A 1JWSA 3FT2A 3WUZA 1MHHA 1I7RB 3T0EC 3WN5B 1OVZA 3C60B 2D3VA 3GEWB 3K8MA 3QEQD 3V4VH 1NMBH 2FO4B 8FABA 4JDVB 2X89A 3K8KA 1H3PL 1T89C 2VL4A 3V5DB 5B4MD 4XCFL 5KSBA 4QWWC 5MERB 4XXDA 2IQAA 3O4OB 4JRXB 4TN9A 1SJXA 4K9EC 2IANB 3KPRA 2EZ0D 4RMUA 1A14L 5F1NA 5GS0H 5AG9A 1MRFH 5CWSA 2MQ0A 3GSXA 5JUEH 4OCYH 5EU6B 4WJ5A 2YD9A 2FGZA 4DN4H 1X3DA 3RL2A 4NP4H 2R1YA 4KXZI 1Y0LA 4JFDE 4KKBC 5MEOA 3JTSA 2J8UB 2HKFH 4P2OC 1F6AA 5C70A 1JHLL 2YPLA 3L9RA 4P5KB 4I18A 4GO6B 2NY4D 3UTOA 2F53B 1RUPH 5DUPH 4OSUH 3NZ8A 4IRSD 2FD6L 3Q48A 4OD2A 5J3HC 4HT1L 1N2RB 3EJYC 4OGAD 1QP1A 4JN2A 4KTDL 1R3KB 4MAYC 5IW3A 3CDFA 4Y2DB 4ONHA 5LAXA 3DX8A 3KXFE 3RWGB 1DVFD 1CFSB 5L8KB 2VLJB 4MAYB 4F7MB 5CILL 3H8NA 1EEZB 4QRTA 3VFMB 3S4SA 3W39B 1P5VA 5CBAA 2GCYA 4X6DA 4LGPB 3TNNA 1UB5A 3HE6D 1P4BH 5ISZE 3QEUA 5INDA 3WL9B 3DBXB 1VACB 3OPZL 4OBRA 1N64L 2ICWI 5TDOA 3WKNA 1EEYB 5HHQA 1EFQA 5ANMB 4LEXL 3ULUE 3EYVA 3QO1B 5GJTL 5HHOD 1G7QA 4GG8B 3P0VL 4PP2A 3DUUB 3KJ4C 4YPGA 5FKAA 1GL4B 1X5XA 1BP3B 2X4OA 5C6PB 5JW4M 3RVXD 1PX4A 2GYSA 4O02L 2VWEC 1F4XL 4PJEA 4K8RL 4U6YA 3OKOA 3MZGB 5A16A 3EBAA 1GZPA 5DRWA 1BAFL 3UJJH 2H2PC 2ICES 2P8MA 2Z31B 2EDTA 2MWCA 4JVUA 3T04D 1MCPL 4LGRB 1LE5B 4MGXA 3MUHL 2APFA 4DKFH 4XC1H 4GBXB 3B3IB 4F7EA 3QIWA 1LK3L 2HTLC 5DK2B 1KCUH 2UUDK 3JWDC 4HUUA 3NCCB 4Y8AA 5TE7L 1B4JH 4OV6F 3STLB 3U6RB 4Z5RA 2A77L 2A83A 5JA9A 3P0GB 5SX5K 1DQJA 4ZDHA 2NTFB 4UDTA 4Q9CA 3QUXC 4R90H 1HHIB 3BZ4B 2IFFL 1A7NH 2P44B 3ZO0A 4L8SA 3L5WB 4WTWA 4MNGE 3RIFK 5CSGA 3WNMA 4HC1L 5I1DB 1BJ8A 4TVSa 4PJGF 4KGJA 5DC4B 4MJ4A 4HV8B 3VXTA 3A0OA 4QKXB 5LQBL 1URLA 3MA7B 5F9DC 4DOHE 1CFQB 2ZJSH 3SE3A 3DOSA 5HYQA 3WXWH 3P4MA 3KPLA 3N1GC 2NY5L 4AENA 2DM7A 3OJMB 1A3QA 5BVPL 5EPMB 5JOFA 4HJJL 5DI8A 1I9EA 1UWGL 2O5ZH 2UZIH 3E2HC 4JVPA 2VO5A 5D7SH 3RDTC 5ITBH 4JM2F 4PRIE 3BQUB 3FRPG 2PW2A 2BVUA 1JJUA 1FAIL 1DUZA 5DUBB 1N5AB 3DO3A 2NX5D 3CFEA 2EYSB 3QEQB 2KBGA 3QG6B 4GKOA 4R2GC 4XMPL 3NAAL 1NLBL 3VJ6A 5EDXA 4WFHD 3WFEL 3EFFB 2GKIA 3KHQA 4G8IB 2VDKL 1LILA 4LSTH 4JPIA 1WT5A 2D31B 3LN5B 5HBBA 2GFBA 3TLRA 5F7WC 1S7RA 4N0YH 4Z7VF 4U1KA 5IBUG 1HI6B 2GITA 1AKJA 2HG5A 2CK2A 1MCJA 4ZAKC 2VC2H 5DK3A 1E4WL 4MQSB 4YDKH 5I17A 2EO1A 1MFNA 5F1OB 5FXCH 2D0GA 4U1MA 4Q9QH 4I3GA 3JTTB 1R3JA 4OD1H 4PJGE 2V2TA 3O3DA 3SCMC 3LKQB 3GK8L 1XF1A 4PRAB 3I85A 2NY4B 1TCRB 3SN6N 3BUTA 4DGYH 1CD1B 1FVEB 3QFJA 3ZTNL 2RFXA 1CTNA 5GS1A 4WU5A 2R69L 2ED7A 3DECA 1QFOA 1KJ2L 2Y9RT 1I85C 1A02N 1FL5B 5DHVH 3UTPE 4F9LC 3C09C 4L8BA 1DVFB 1FG2A 3WE6B 5EOQH 1T20B 1RIHL 4XC3H 4N90E 3BZDA 3GMQA 3NVQA 5DJ0A 3NOIA 1CD0A 3NCJL 3MBEC 3WS3B 3IYLW 5T1KA 1J9CT 4U0RC 3N1QC 4ODTL 4Q2ZB 4P2RD 1V5JA 3TBYA 4Z7VE 4WWKA 5ADOL 2DQCL 1AP2B 2YXFA 4JPKH 5D7LB 3LEVH 1FNSL 5E8EA 5HHOB 3H9SD 3MO1B 3VI4F 2MCG1 4YHMH 5D1QA 1Q94A 3ILPA 5F9JA 5FO9A 3TT1L 4P3WA 4ORGA 3ET9F 3FO9B 3WIHL 5F6HJ 1TTUA 3AROA 4HS8L 4H5SB 1CGSH 1NDGB 2ADFL 5EO1B 1BZ7A 1MLCB 1S9YA 2CXGA 1H0DB 3QIBA 4X8JA 4PJCB 5HHNB 5KANI 1O7VA 3CSYA 3VXPA 2RQ8A 1XIWD 4HX1B 1ZS8B 1YN7A 3KPNA 5BRZA 1HILB 3OG6B 3HI6H 4C57C 3FB5A 1OGAD 1AQDB 3ULVC 4MNQA 4JREB 3WFCH 1LEKB 2XWBB 4HIXH 3FHQA 4IRJC 2JCCB 3BD5A 4OIIH 4Y4HD 5B8CC 2MCPH 1UG9A 1MF2L 5KBNC 1JTOA 3P30L 5JNYB 1K4CB 5TFSL 3LKPA 3OR6B 3IXTB 3UYPA 1R5VB 4I2XA 1GC1L 1JTPA 4LCYA 3VI4E 1QFUL 1UWEH 1A7BA 2BCKB 1X5JA 2BP3A 5CKGA 3KPMA 3LB6D 3W0WD 3MPCA 3VFWA 1B2WH 4RGOH 1HCVA 1T2JA 4NSKA 3L7FA 3QUYA 5C08E 5D1ZC 4XPBL 2RIKA 2Y5TB 5F7YC 4UIKH 5A3ID 4WHDA 4EUPA 2PN5A 3RTQC 5AZ2L 4MCZB 4JRYE 4QHUA 4RAHA 4I3RL 2AK4E 1Z0MA 4LCUB 3TNMB 3RTQB 2NX5B 1QACA 1OAZL 1W0WA 1HHJB 1T1XA 1LK2A 3M1BA 1VSCA 4M1DH 1FC1A 5KSUA 3A67H 2RHEA 5IJVB 4JPWL 3CU1A 3DVGA 1MCOL 1MPAH 4F7TA 3L3GB 1GGBL 3VXNA 3GMMB 4KROD 2Z8SA 4NM8L 5D5MA 4P23C 2CKBA 5K9JH 2DTML 2D7OA 3B9KC 2V17L 1B90A 3VMOA 1N4XL 3GBNL 3FJTA 1CFTB 4I3SL 3NACH 4IS6B 3CX2A 1EEQA 2ITDB 4M5ZL 3VG0L 1M7DA 1EX0A 4P59H 2PXYC 4ENED 3FOLA 1MCNA 5B21A 3T8XB 3TVMD 3QWRD 3Q6GL 2BNRA 2FJFB 3BGFC 3ARDA 1T83C 1MRCL 4U49A 1R3LB 1KFAH 1EFXA 5FDWA 3WLBA 1G7LB 4GAJL 3BESR 4CJ1A 3FT4B 3LDBB 5L2JB 3AAZA 1MIML 1BBDL 3RQ3A 4WGWB 4MXWL 2C4FT 2YSSB 5IBTL 3VGAB 4HJ0D 3BH8A 1LP9B 1QO3A 3G6AA 1FFNB 1FDLH 2PYFA 3JVGC 3VFGL 2XYCA 1K8IB 3IAPA 3U7YH 4JFEE 4N0UE 2A6JB 4Y5YB 2XFXA 3QBTB 4G5ZL 1TVBB 4Z7WB 3OXSB 4P2RB 1CGUA 4M43L 2APXA 4WRLA 2OYPA 2MPAL 4OGXH 1JV5B 1TITA 1YPZF 2DWEB 1HQ4A 3DJ9A 4LLQB 1CVSC 3HNSH 4HG4K 1UZ6F 3H9SB 5JW4N 3GKZA 4MD4A 3P9MA 4R96A 2BNQD 1P6AB 1IC1A 3CJJA 2VH5L 3BP4B 4ZD3L 1IKNA 5EO0A 5GXBB 3C6LD 5HYJA 5T1MA 4X0KB 5HI3C 1A6ZA 4XNQA 3MYJA 4MMZC 1XIWB 4XPHL 1WAAA 2OK0L 1HYRC 1OGAB 4J3WA 4F15C 5C0CD 4CVXA 1H3PH 1S7XB 4KGLA 1SEBB 5FV2A 4HBQA 4O58L 4F15B 4MNHB 5IVXB 1FZOA 1NCCH 2PYEB 5FECA 1D5BA 2ADIA 3CLEH 4WV1A 1YECL 4Y4HB 2FIKA 1DBBH 5DTFB 1ZA3B 5T3XE 4WW2A 2P5ED 4RFOH 4CNIA 4HF5L 1RY7B 1AI1L 5JIKA 1CF8H 3JV5A 1YJDC 4N1HB 3DURB 4R8WH 3DI3B 1W72B 1YPZE 4Z78A 1N6VA 3DX9B 3IFNL 4RFEB 5F89A 2Q86A 3K8LA 4UT9L 1KIPA 3SGKC 1UZ6E 4B0MM 4FG6D 4NO3B 4XNUH 5EO9A 1HHGA 3MRGB 1HEZB 4QLRA 3S35H 3W0WB 4LF3A 4I4WA 3QNYA 1INQA 3D18A 2ZG2A 4KKCC 2P1YA 4R4ND 1C1EH 4Y4KC 4FTVD 1G7MB 1I3GL 3P11H 1XGTA 1RZ8A 5D7JC 5CLWA 4KVNH 4GMTH 4LP5A 3SQOL 5MP6H 4YE4L 4P57A 3BMWA 4WI9A 5F1IB 4LIQL 1BX2A 3WXVL 4QCIB 4TPRL 4IJ3B 3H3PH 1FNHA 3RX7A 2BMKB 5DJZB 4D0BB 5E6ID 3KLHD 4ODHL 3F7QA 1OAYL 4FFVC 3R06B 4PRNB 3H7BA 4XMKL 1FBIL 1NMAL 4JFDD 4P3CL 5IESL 2C3WA 3CH1A 1U8PA 3G5ZA 3PV6A 1NFIB 3OKDA 4KROB 1QG3A 3CFDA 3ZYZA 1F4XH 2BRRL 2OL3B 3QQ9D 3ZZ1A 4EXPX 1MUJA 1WBXA 2JELL 3FQTA 1DQQA 4Z9KB 1Y6MR 1I7RA 3UTTD 3WN5A 3C60A 5E5UB 3QZWG 1F42A 1EO5A 3BP5B 2FO4A 3GJFK 3FB7B 5KTEH 4JDVA 5D72H 3JBG7 1L0QA 1NLDH 3V5DA 1CL7H 4YNYB 3KXFD 5T3XH 5L0QB 3TVMB 3MRMB 4LPUA 2YWZA 5ICYB 5MERA 1LK3H 5TE4H 1KJMA 1T89A 2ORBL 4JRXA 4PJ5E 3LN9A 2IANA 5DGQA 1YEIL 3IS1X 3VWKD 3N06B 4HG4J 5TE7H 4LEOB 3K1KC 4YHPB 1IEBB 5DO2D 3MRPB 5EU6A 1MH5B 2A77H 1JHKL 3CH8A 4P2QD 5SV3A 2J8UA 4YFDB 5GS3A 2IFFH 4QXGH 4W6WB 2QADC 4P5KA 2APTA 1IZKA 2F53A 1G9NC 2IJ0C 4AEIL 5GRUL 3HR6A 3IXAB 1N2RA 4F80A 1H15B 5LQBH 2CDGB 3EDJA 4BFEA 4Y2DA 2IBBA 3RWGA 1DJSA 5F96H 4X9HA 5GS0C 1CFSA 2NY5H 1KBGL 2BNQB 1BF8A 2VLJA 4MAYA 4F7MA 4MX7B 3P40A 2OMBA 5BVPH 4UV7L 5KG9B 2VAJA 1EEZA 4LSUH 4ELMB 2J1KA 3VFMA 3W39A 3NFSL 3CLFL 2BDNH 5DVNA 5AWNH 3WL9A 4LCIH 3DBXA 4PV9B 1VACA 1YY9D 2OTPA 3EUUA 4XNZC 3U9PH 2DQDH 4OB5L 2B1AH 2GJJA 3KPPB 2VN4A 4KQ3L 1EEYA 5ANMA 3V4PL 1MCIA 2GJZB 3RBSA 3NAAH 1NUFA 2D7QA 1NLBH 3QO1A 3ARXA 1YQ2A 1MCWW 3O6LL 2OI9C 2VDKH 3I75B 4GG8A 3IJSB 4L9LC 5E2WL 3DUUA 1A3LH 4NHCH 5DXWA 5E4EB 1BFSA 4YHKL 4L9LB 1P9MC 4NQDB 1PZ5B 2N7AA 4PJ7B 5EORL 2P5EB 2Z31A 1SJHB 1LE5A 2EXWC 3B9AA 4Z7NF 4M6MH 4JZOB 4IDJH 4CU8A 2A1WH 2O5XL 4GBXA 3B3IA 1CDJA 4PJAF 4K71B 3BZFB 4KY1L 5DK2A 1B0GB 2PR4L 4JO2H 1MJJB 1KXVC 2QQLL 3U6RA 3STLA 4PRID 5TH2B 1KJ2H 2HFGH 2AJUH 3TWCL 2NTFA 3WFHB 1FO0H 5B39B 1SEQL 3MRHB 4JDTL 1HHIA 1OARL 3BZ4A 4RWYL 4C54A 1RIHH 2ZSVB 3L5WA 5CD5C 3IDYC 2DS4A 3ULUL 1IAII 2G5BB 2GAZB 5I1DA 3NCJH 2WIIB 4GAFB 4HUVB 4ODTH 4HV8A 5FYLE 3SDXB 5EZJB 1ZGLB 3BN3B 4OT1H 3MA7A 5ADOH 3CC5B 1CFQA 4PV8B 4WI7A 3P4OB 4JFDB 2DN7A 4I0KA 3PWUB 5EPMA 5HD8C 4JQIL 1NCWL 1Q72H 4N0FB 4DFIA 4JFOB 1P1ZB 1Q0YH 4Z7NE 4LCWB 3BQUA 1QFHA 1QBBA 4L3AA 4QHKJ 3BAEL 4HS8H 5DQJB 1MAMH 5DUBA 1N5AA 3MLYL 4Q9RL 5KVDH 4PJAE 4Y5VC 3UTTB 1DFBL 2K1MA 2GW5A 2EYSA 3QEQA 4UIMB 3QG6A 5CUSL 2WWKT 3JV4B 1RJLB 1IGFL 3H42L 4JM2D 3UTPD 3BKCH 5DMGD 3D39B 4NGHH 4Y4FD 3EFFA 3KXFB 4G8IA 1J87A 1ZVYA 1LGVA 4CDGC 4NWTH 4KJWC 1PLGL 2D31A 3ECBB 3LN5A 2MQ3A 1T5WB 3ZDYF 4N90D 3SDDD 1HI6A 3OKEB 3VWKB 5C0BE 12E8H 2WP3O 3D3VE 2XKSA 4HZLB 5KVEL 4KHTL 3HS0B 4P2QB 3GMNB 3O3BB 3PL6D 3JTTA 2BSRB 4BSJA 3IETB 4LSQL 4XBGB 4BSVB 2X4SB 3LKQA 3P30H 4PRAA 3IJHB 5HPOA 1TCRA 4XP5H 5CZXD 1DANT 2UY6A 3TIEB 1CD1A 1FVEA 5IK3B 1GC1H 3MRLB 2CH8A 4OGZA 4WUKH 3VFTB 3WJJC 2O61B 3AM8A 1JPGB 1FL5A 1DVFA 4XPBH 3WE6A 1WBYB 1VHPA 4OLEA 1T20A 4F9PC 1XGYL 5T1LB 1AO7D 3PGCB 1XEDA 1SVCP 3D85B 3L7EB 1N26A 4Z0BL 5I73C 1ACYH 3WS3A 5CCKH 3IU4L 4FQXC 4XBEH 3DXAE 4OFKA 4Q2ZA 5JHLL 3K81A 1D5XB 2XICA 1CLOH 3ZDYE 4D0DB 4OCMC 1AP2A 3O3UN 5D7LA 4HKXB 5D1XC 5DYOB 4DEPC 5HHOA 4Q0XL 4BZ1H 2Z9TA 3MGTB 3OF6D 4JPWH 2EO9A 5ENWB 3MO1A 1MCOH 3DETD 5K93A 1DN2A 3CK0H 5D1XB 4AEHH 2VOTA 2GJ6E 4DEPB 1GGBH 3U48A 4OLVL 5IW1B 3MV9B 2JB5H 3FO9A 3REVB 5EH1A 4OV5B 5IGXH 5DHVB 4H5SA 3VD9A 1NDGA 4GSDH 1A3RL 3EOTH 4PRPE 1QFPA 5EO1A 1S8DB 5T1DL 1MLCA 3SE4C 1H0DA 4JVWA 2DTMH 4PJCA 4K7FB 5AYUH 5DT1L 4HX1A 1ZS8A 3EOAB 1HILA 2GSIB 1CE1L 4M5ZH 3VG0H 1WWBX 1ZHKB 5C08D 1AQDA 3DVIA 3IKCB 1IEHA 4CBPA 3VE0B 2XQYK 3BDYL 3G5XB 4PJ9C 1LEKA 4G6AD 2P5WE 2XWBA 2AK4D 5ESQB 1JNLH 3QDJE 3C8KB 3CCHB 3UJTL 1VFBB 2JCCA 2VLLB 5DHXB 3DUSB 4NUGL 5L88L 2QQNL 5IBTH 2KH2B 4J3XA 2CUMA 4C58B 5JNYA 2DLTA 1K4CA 1WC7B 4L9DA 3VFGH 1BBJB 3EGSB 3OR6A 1TZHB 3IXTA 4XCCL 1XF3B 3VMNA 2QHRL 4OTXH 3MXVH 1EHNA 2DLHA 1PFCA 1R5VA 4ONGH 4TSCH 5IBLC 3MOBH 2BCKA 4GFTB 3SKOB 4X6CF 2MPAH 5JTWA 4UT6L 2Y6SD 2YKLH 4MHHI 5I74C 3RBGA 5DJCB 2DBJA 4CMHC 5JDJA 2Y5TA 3QQ3B 1CGYA 4JRWA 1W0VB 1YEFH 2BY3A 4MCZA 2L7JA 4CAGA 2DICA 2EYRB 4LCUA 3MV7E 3TNMA 1NCUA 1ZHNB 3RTQA 1E6OH 2NX5A 4BM7A 1HHJA 4U7SA 2YC1B 5C92A 4ZPTB 1MFAL 3RVUD 4ESKA 4Y16C 4OUUB 4JM2B 5IJVA 5BCAA 4UBDC 5FKPB 5E99L 3D2UD 4LLVB 1CXLA 2G60L 2R0LH 4G9FB 5E2VL 3QIUD 3L3GA 2Q8AH 5CGYC 3GMMA 5D9SB 5IB5B 2XV6B 5J06A 2AK1L 5FYJL 1IILE 4HXBH 1IEAB 5I1AB 4JHAL 4JFED 2D7TH 5HGHB 4QGTA 3MV8D 3EYSL 4HPYH 3MXWL 5GISH 3OB0K 4Y1AD 3PL6B 4H20H 2F54E 4WHTB 4X6BB 5F44A 1CFTA 2LU4A 1FC2D 3QQ4B 4IS6A 1OSZB 2VDQH 2ITDA 4X6CE 2BOBB 3HE7D 1B3JA 4F37F 3QXDB 5B3NA 1VEMA 3T8XA 4UT9H 4YO0B 4BH7B 3K0WA 2FJFA 3AFLA 2A73B 3UROR 1R3LA 4O9HL 3CIQA 1G7LA 1GRWA 2VDOL 3CSBA 4NN5C 4JO3L 3BEWB 2AS5M 3FT4A 4JPVH 5L2JA 2DQFB 2Z92B 2FBJL 2YD8A 3X3GL 2YSSA 3WLWD 2EEDA 1LP9A 4EI5C 1FFNA 3RY6C 1AO7B 1I3GH 1IGJB 4P5TD 1BZ9B 5F6IC 1K8IA 3F5WB 1FE8L 3GUTB 1U3HD 2A6JA 1I1AD 2BJML 4EI5B 1YEJL 4Y5YA 1RZJH 2CK0L 5F6IB 1TVBA 4Z7WA 3OXSA 4LIQH 4P2RA 3QZWB 1JV5A 1WBZB 1CN4A 2DWEA 4G7VH 4XNYL 1JGDB 4LLQA 2GTWB 2HFEB 3H9SA 5T3XD 3TH3T 3VMPA 4UT7L 5L6YL 1U2CA 2XPGB 5DUML 2DQIL 3BHBB 5DJDB 3BP4A 3NIDF 1HSBB 4DWHA 2BRRH 4X0KA 1HIML 5D8JH 4A6YL 4YHOL 1NJ9B 2Q7YB 4OAWB 2KDGA 1JZ6A 1PDKA 2X6MA 1XIWA 5TQ2L 5I1KH 5E8DH 2B4CC 3V5HB 1T0MB 4XP6L 5B3JF 5C08B 1OGAA 3F12B 5ICZB 3V6OC 3U1SH 1S7XA 3QHTC 1LO3L 1SEBA 3SE9L 1YEKL 3DYPA 4YHYB 3RZCC 5J56B 3DSFH 4MNHA 5IVXA 2PYEA 1FGNH 4O4YL 2CSPA 1KEGL 1UEYA 3K74B 3GBLA 4LSPL 3IDGB 5KS9F 1ZLVK 4Y4HA 4RGMC 5DTFA 1ZA3A 5D93B 1CXFA 4KPHH 1V05A 3BEVB 3DURA 1W72A 3DX9A 4RFEA 1G6RL 1U8KB 4NO3A 1KC5L 2CR6A 3RWFB 3SGDI 3MRGA 1T1ZB 1HEZA 4U3CA 3ELAT 3W0WA 5C6WH 3WV0A 1WTLA 1G7HB 4HWBL 1IMHC 3NIDE 1ACZA 4LLYB 5FYJU 3VWJC 4O2CB 3C5JB 5E8NB 1G7MA 2AV7B 3HRZB 4PJFF 1TIUA 2NXYD 5AYQA 3ZYOA 4NBYB 4PTUB 2AXGB 3NFSH 5B3JE 5EU7C 1TJHL 5F1IA 1U9KA 5HY9B 2IPTL 4QCIA 4PJ5D 3EFDH 2BMKA 5DJZA 4D0BA 2FGWL 2W07A 3DMMC 3OAUH 4LLMB 4LPTA 3R06A 5GS2H 3QDGE 5KS9E 4PRNA 3PXJA 2QSQA 4IHOB 3QIUB 1DBAH 2NYYC 3BPNB 3ZTJG 5E2WH 1NFIA 2JB6B