4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
1TQBC 2NY6C 3EZ8A 4KK9D 3UTQA 4DUXA 3W2DL 4Z7VE 3CFEB 3MV8B 1XF2B 4HT1L 2HFFA 5DC0A 1NUDA 1QP1A 2DQHL 5F89A 1BOGA 4JEGB 4QRUA 4LNRB 5CIPH 5DJ8A 5GHWL 1JUFB 3U36B 5IUSA 1KJMB 1YUHB 3N06B 4EBQH 4NC1C 1X7QA 4QRRD 3FB6B 5D2LE 3CSGA 3AXLA 4LCCA 2XTJE 5GRJL 2Q7NA 4Z7UA 3RTQB 5SWQA 3TFKD 5CHNB 2DTSA 2ZOKA 4L4VA 5KSAB 1NMCB 3MO1A 1CDIA 1KB9J 4Z7NF 4JKWA 1Q72L 3I75A 2YPLD 1UXWB 1YNLL 4GW1A 5J6GA 3WYRA 1FH5H 4H25B 2P45B 2HJLB 3CFJB 4EUPH 3RIAK 5EBLA 1RK1A 4URTB 2VRAA 1XZ0A 1PX4A 4RBPH 3W0WB 3HUJA 5KTEH 3IDGA 3EYOA 5IVXE 1BQHG 1OP3H 5IHUL 4OGXH 3RJQB 1CL7L 4G9FA 1MRCH 1IVLA 5FHAH 3L7FB 2JK5B 4MNGE 3TBYB 3L3KA 4P2QE 2R1YB 4UOJA 4CN6A 2RBLA 1SYSA 1AHWC 4R90H 3IVKA 2RCSL 4M03A 4RMWA 5FUOH 1N59B 1U6AL 2E6PA 1KC5L 4UQ3B 4YXHH 3SQOL 1ZOXA 1NCBL 4Y1AB 4JZNB 1R5VB 2PO6B 4NWTH 1SBSH 1QYGL 3PNWA 4ZUTA 1IGCL 4KDVA 3Q2CA 2Z91B 4P9ML 3FFCD 4XCEB 3QR2A 3UJTH 4JB9L 1DQDL 4R26L 4OM0L 4X4MA 1SEBA 2F53B 2WQRA 4PJAB 2VXUH 2YZ1A 1GGCH 4U1LA 1OAZL 4KV5F 1A14H 1MHEB 3KYMA 3CDGA 3WNNA 5D2NE 1L9MA 3S4SB 1KENL 2EZ0C 4YDJB 4M00A 4YBLB 4MQTB 3BKYH 2WIIA 5IWLA 1HIML 4BK5A 2EDRA 2GI7A 1TNMA 4PTUA 3S88L 4PJ7A 3JVGC 1ZMYA 4Z8FL 3MRQA 1UACL 4UB0H 1BIIB 3WXWL 2PYFB 1G84A 2DTML 1ZEAL 4OKVB 2AJYH 3WS6C 3WFEL 2R1XB 3UJIL 4HG4K 2QHLA 4OBRA 4EJ1C 4ZQKB 2LU3A 3RX8A 1D3CA 5EA0H 3KS0H 4N8VA 3EOAA 2XWBB 3A6BH 4JFOA 4S0SD 2OR8A 1A1OB 4NYLA 3C2AH 3MNVA 1HQ4A 1HSBB 4EQ2A 4S1SH 5HGAA 3QRGH 3KHQA 5EUOB 3OKOB 4GFTB 4WO4B 3BXNA 3ARED 5BV7B 3KPQA 3C9NA 1KCRH 4TTDD 1NGXA 1TVBA 1R5WB 1DBKL 3KPSE 1DN2A 4XMPH 1NGZA 5TE4H 3NIDF 4POUB 4JO4L 4J6RH 2JELL 4PJ5A 2Z35A 1I1FA 5IB3A 4FQIL 2BRQA 2C1PB 5IVOA 2YBRA 3H9SE 4OV5A 4UILL 3QA3A 1RJYA 3EOYG 3B43A 1MY5A 2VN4A 1NSNH 1A3QA 3GRWA 4LCUA 5SWZA 4J7RA 4YR6A 3FZUC 4HK0B 2GCYB 4IDJH 5D1ZC 2AQ1A 4K3EL 4GRWB 4TVPH 4PV9B 5CJQH 3LN4A 1P4LA 3MCLL 4GKOA 2XY1A 3W82A 5JPNB 4YBLC 4YEFA 3HC0B 2P8PB 4H88L 4JO1L 1MLBB 4WCYL 1T0PB 3O41B 1KCVH 4M8QA 4AEIH 2YRZA 2VDRH 1G0DA 1AHWA 2O5XL 3BJ91 4P9HC 2NQCA 2VE6B 3CFEA 3FMGL 5C3TA 3MV8A 1EHXA 2X41A 3WFCL 4NHCL 3N1FC 15C8L 4UIMB 2A9NH 1JUFA 3U36A 5CD5D 1KJMA 1YUHA 1WV7T 2UZXB 1ZKAA 3UEZA 4HLZH 2WNGA 3FB6A 1I9RH 4TVPE 2G2RB 2VWEC 2L7UA 5E2TH 4K8RC 3JTSB 5D5MF 4WO4C 4IMKC 3WL9B 4K71C 4U7SA 1S9KC 3VFSB 3RTQA 2H32A 2VLJB 5CHNA 3MX0A 1F2QA 5KSAA 3WNMA 5GS0C 2C3GA 2EDQA 2FBOJ 1E6JL 3SOBH 4P3WA 5KS9B 4S1QH 4YHIB 5SWSB 3J7HA 1T4KB 1HHIB 3EJZD 1UXWA 3IU4L 5GGTH 5MENB 1BFVH 4DUWA 3OXSB 4H25A 1EBAA 1E27B 2HJLA 3CFJA 5L2KD 3QUXB 4RFEB 5DZNA 3V6ZB 4G3YH 4I9WD 4NKOB 5E24E 5C0JB 3W0WA 3N1QC 4KJYB 2OXHA 3WEXB 3SGDI 1J8HB 3GZKA 3MV7B 3L7FA 2JK5A 3Q1SL 3TBYA 2EDTA 5T1DH 3B5GA 2FH8A 2G5BB 1OT2A 4U7KA 3U9PH 1JPTH 2G5RA 5EO0B 5GPRA 2R1YA 1VKXB 4JVUA 3EO1B 2MPAH 1IEBB 1N59A 1TJGH 4LHUG 4UQ3A 4Y1AA 2OBGA 4Q9CA 5HYJD 3RVVD 4FQXD 1R5VA 2PO6A 4JZNA 3C6SB 5D7JC 5HD8C 3O0RH 1HH6B 2I60L 3AROA 1RMFH 4YBQC 4YHNB 3ZKMC 5FGBA 2Z91A 5CSBA 4XCEA 3QEQB 2F53A 4PJAA 3G6AB 5CGMA 1MCBA 4WFHE 2WBJD 2PR4H 5D7SL 1MHEA 4OLUH 2WP3T 1ZHBB 1SM3H 3S4SA 5B38G 4OZFG 4ZS6C 1F3JB 5SV3A 2UZIL 4YDJA 2AAVA 3GDBA 3RGVD 2LE9A 1JBJA 2NX5D 2DQFB 4GH7B 2HFGL 1BIIA 2PYFA 1A21A 4M8VA 5IK3B 2PW1B 4OKVA 1CD8A 3GMPB 2R1XA 2VLKB 2D7MA 3U0WL 4ZQKA 1MCWM 3OAYH 2XOTA 3A67L 2XWBA 2OK0L 4MXQC 1NEUA 1A1OA 3ZZ1A 1HSBA 4YWGH 1A7QL 3W39B 4ZXBC 4JR9H 2VZSA 3CXDL 5EUOA 3OKOA 1J18A 3VI3F 4WO4A 4H5SB 5D7LE 4M7LH 3G04B 3GKZA 1PY4A 1R5WA 1ITBB 3RHWK 2EYTB 4DGYL 5CJ8A 2X44D 3MUY1 5DWUH 1XGRB 5ANME 4XMLL 1N64H 1D9KB 2C1PA 5GS1B 4U1MB 5IESL 5HDLA 4RRPG 1NANH 1E4XH 1A7RL 3TO4C 4FP8H 3BH9B 3GSNL 5IMLB 3IDYC 4QHNB 4U6YB 5DMJB 4ONFL 4DGVL 4HK0A 4PJDF 1A3RL 2GCYA 4Z7VB 2GEEA 4PV9A 3VW3L 5IHZB 5JPNA 1IEAB 5FA3A 1TLKA 3HC0A 2P8PA 4K9EL 1MLBA 3O41A 4PG9B 5T5NG 3NIGF 2OM5A 3C5JB 2FEEI 2HT3D 5E6IB 4MGXA 1B3JA 2NZ9D 2VE6A 1RAMA 4XVJL 5D2LB 2BVOB 3EDDA 3KAAA 2XTJB 1KLUB 3FRPG 4I0PB 4Y8AA 3CH1A 1G7IB 4KI5C 5I1IH 4P49A 1OTSC 1S5IH 3JWNC 3S35X 1MEXH 1FNSH 5J13B 3S3PA 2DYPD 4AH2B 3IKCB 3JTSA 4HK3J 3KYKH 3WL9A 4KDWA 4YHKL 3HI1A 2R2HB 5I74C 3ZKNC 3DVNB 3VFSA 2VLJA 2EEBA 3RGHA 3V8CA 1QFWM 3IETB 4F57H 3D2UB 4LOUD 5IVXB 5KS9A 2FECI 5SWSA 5CINL 1T4KA 5CJXA 5C0EB 3AB0B 1HHIA 4MNGB 3RVTC 5MENA 3OXSA 1GGBH 4LMQI 1E27A 4JM2F 4P2QB 4XP1H 2BC4B 3IAGC 1E4WL 3QUXA 4RFEA 3QPXL 1Q9KB 1YEFL 3V6ZA 2XQBH 4PRID 4NKOA 5C0JA 1SY6A 2IC2A 4JPKH 1F4WL 1F3DH 4KJYA 3WEXA 3MA9L 3TIDB 1F8TL 1MCPL 3D5OF 5TDNB 3FAXA 3MV7A 4TSBH 4Y4HC 5M95B 4R97C 4QTHA 4U1GB 2Q3AA 1XCQB 3O2VL 2G5BA 2IH3B 2IPUK 3BUTA 5EO0A 1VKXA 1LE5B 1UZ6E 3AAZB 4F9LC 3P77B 1DSFH 4K3GA 3P4MB 3CFBB 4R9HA 3EO1A 1A7PL 1IEBA 1OLLA 2XTJC 2HT2C 4MS8C 4HXAL 3C6SA 3H7LA 4N0CC 1JZ5A 3T3ME 4TSAL 4FRWA 4YHNA 3CMOH 3MJ9H 1HXMB 4K2UL 4KZEH 3QEQA 3G6AA 3BD3A 4ZO9A 5JR1H 3SY0B 2NLJB 4WW2C 1ZHBA 2YXFA 2D7TL 3DETC 2EYSB 5HGDB 3MV11 4OLZH 1F3JA 4CUCA 4XVSL 4U3HA 2R4SL 5C6TL 4M61B 2DQFA 4I2XA 2HP4A 4S1DD 3D87B 4A2MA 4X4YB 4JG0L 5IK3A 2AEIT 2PW1A 1NCWL 3GMPA 4XWOC 3TT3L 2VLKA 2UYLB 3CFKB 1CLZL 3KPSB 4F7CB 5IW3A 1GL4B 1MAMH 1WITA 4I18C 2N1KA 5C2UB 5DR5H 1OWRM 4O51B 3H9SB 2HWZL 4RWHA 4XVUC 4Q9RL 1CE1H 5B39B 3W39A 4ZO7A 2BFVL 5DUPL 3OR6B 4H5SA 5DHXB 2VUOA 3TBTB 5L8KB 3T2PA 1GXEA 1IC5L 3G04A 4ISVB 4JG1L 3UPAA 1J8KA 3SKOB 2EYTA 5DD3H 4HFUL 5D2NC 4WUUD 5DJ2B 1XGRA 3BKJL 2MMXA 1D9KA 4Y19E 5GS1A 3NFNB 4U1MA 3HR5B 1TXKA 4IJ3C 4U7MA 3GK8L 4M7LT 2VXSL 2B4CC 3E8UH 3BH9A 3OKMB 4J3UA 5IMLA 3RA7H 1KPVB 1QBAA 4QHNA 3OXRB 1P7HL 4PG2C 4U6YA 3BGFB 3V5DB 1NCNA 3BQUC 4L9LB 4Z7VA 1S9YB 4X80H 3OX8B 3VWJD 3FTGB 1GOFA 4Z7OE 4LLDB 1YEGH 1S7RB 1U8QB 3FO0H 2CMRH 5IHZA 4BQBA 1RZ8B 1JRHH 2ADJB 1IEAA 3BDYL 5E2VL 3D3VD 2IQ9H 4DZ8B 4PG9A 1OM3L 4F8QA 3TN0B 4FTVD 1NPUA 4NC2B 4AJ0A 3EBAA 4PRNB 1Z9MA 2WMPA 3C5JA 6FABL 1DVFC 5E6IA 3FB8B 5I1GH 2ICWJ 1DTUA 5D2LA 3ZKXC 2BVOA 1LP9F 1KLUA 1TVHB 3ARBC 3WJLA 4YZFE 3X3GH 2CRIA 4UINH 1KPRB 4LEXH 1LK3L 4I0PA 5JTWA 3G9AB 1A9BB 2AI0L 3JWOH 1CFVL 2DLEA 3MV01 2VDNH 1PZUB 4AH2A 3IKCA 4NNYB 2VL5B 2PN5A 4JRXE 1EX0A 2R2HA 1LO0H 3DVNA 3F8UB 2BJMH 4U1JB 3U30B 4F9PC 3IETA 4YJZL 2Z93B 4MAUL 4K3DL 1CBVH 3D2UA 3T0EE 5IVXA 3PHSA 2AXGB 4X6DF 1CTNA 1E4KC 4XBEH 5C0EA 3THML 4MNGA 2Z31D 1AO7D 3TPUB 1EEYA 3ULUC 4P4KB 4P2QA 5E5RB 2BC4A 2CGRL 3QISA 4Z77B 1F6FB 1B0GB 3L3HB 2YUWA 1JYWA 4GOSA 1KPUB 3TIDA 3ZTNH 3WLBB 5TDNA 3C08L 1X4YA 3C6LC 2H1PH 5CLWA 3QG6B 4JKLA 1IL1B 1J88A 1XCQA 4C4KT 1LGVA 4PJFE 1QR1B 4OD1L 3MRJB 12E8H 2NY4B 4HBCH 1LE5A 3B4NA 3AAZA 1VDGA 2N7AA 3P77A 3ETBF 4OCNC 3P4MA 3CFBA 1KIQB 4LSUL 4M93C 4MJ2A 3LPWA 4WW1B 5GRWA 4Y2DC 1BF2A 1T7ZA 4G7VL 5D2NA 5IG7A 3EYFB 4NRXB 5L88H 4HS8L 3VDAA 5F7YC 1NC2B 1KT2B 1HXMA 1NCUA 4ZUSA 4U6VH 3VD3A 5LG1A 1CF8H 1DL7L 4NIKB 2HJFB 1WAAF 2NLJA 3BQUA 4LPYA 5E6YA 3SY0A 4KZDL 1PD6A 4P2RE 2EYSA 5HGDA 4FHBD 1H3GA 2DLFL 5IQ9B 4RIRB 3SGKC 1PLGH 4M61A 1U3HB 3I9GH 3RUGE 4X4YA 1BFSA 4YHYC 2ZKHL 3VXUE 3RKPA 1RULL 1OPGL 3KYAA 2UYLA 2UZYB 3CFKA 4ZMAT 2V7NB 1YMHB 1MELA 3KPSA 3IJYB 3ZSTA 4HQQL 3SKJL 4R3SB 2YD3A 3N1GC 1C5CL 3W2DH 5ANMB 3S3SA 4KK8C 3H9SA 4HT1H 2DQHH 5B39A 2B7DT 4AM0B 2WLZA 3OR6A 2Z0BA 3TBTA 5GHWH 2ARJB 2ZSWB 4ISVA 2Q8AL 4ODVL 3SKOA 4XAKD 3MMEB 5DJ2A 2ZG1A 4X99B 1MJJB 1K4DB 1GHFL 3MLPA 1OVZA 3HR5A 3SDYL 5IJKC 5GRJH 3QQNA 5K59F 1CK0L 3OKMA 1KPVA 3OXRA 43C9B 4APQB 3V5DA 2J88L 3ARGD 1Q72H 4L9LA 4X9IA 1EGJL 1FQ9C 1S9YA 1YNLH 1YJDL 3OX8A 4OFIA 3FTGA 2Q86B 2CUIA 4LLDA 1S7RA 1U8QA 1RZ8A 3K4DA 2ADJA 2A1WL 4DZ8A 1LK2B 3GSOB 3TN0A 1QD0A 4HW6A 4PRNA 4DTGL 5IHUH 4LASL 5DMGC 1CL7H 3UTZB 3GO1L 3DIFB 3FB8A 1N6QL 3O4LD 2XTLA 4HKBB 1AKJB 3DUSB 1TNNA 1KPRA 3EZJB 4YHZL 2H2SC 4KV5E 1I3VA 1U6AH 1NEZB 2XXMB 1KC5H 4C83B 2YN3A 3FRUB 3SQOH 3MLXL 4IOSD 5D1QB 5E8DL 2PCPB 1L6ZA 1QYGH 2FATL 4RNRB 4HZLB 4NNYA 1MUJB 2VL5A 1IGCH 4U1JA 2HYMA 4P9MH 3BPCB 2Z93A 3EGSB 4XH2B 4JB9H 1DQDH 3QIBB 4OM0H 1MI5B 4R26H 2D0GA 2AXGA 3BP6B 1OAZH 1ZWIB 4MDJB 3TPUA 4K7PX 3VXRD 5F9OL 4P4KA 5IMOB 1GC1C 1HIMH 4Z77A 1B0GA 4OI7A 4APQC 1O7SA 5FIEA 3S88H 4BQ6A 3L3HA 1OW0A 4OCXL 4Z8FH 1ND0B 1UACH 1JNJA 1KPUA 3WLBA 2XZQL 3WXWH 2DTMH 1ZEAH 2DWDB 3QG6A 1IL1A 3WFEH 3B8SA 3UJIH 3LB6C 2M8XA 3MRJA 2X4SB 4JHAL 4W4OA 4OIBA 1KIQA 3S37X 2JF1A 3ZHDA 5AAWA 4WW1A 4TUKL 3H9ZA 3VGEA 4XP6L 3MGOB 3M8OL 4EVNB 5AYUL 3EYFA 4NRXA 5CP7B 1WZ1L 1HNFA 1NC2A 3TZVC 1EO7A 1KT2A 1WTGT 1DBKH 3SE9L 1Q38A 3TGXA 4PJ9D 4AT6B 4JO4H 2JELH 2J6EH 2HJFA 3QPQD 1EO5A 2NR6D 3F65A 4FQIH 4ZS7L 5DF0A 4UILH 3LEVL 1D5IL 4OLWL 2YPVL 4NQCE 2C5DC 2NTSP 2NXYD 5IQ9A 4RIRA 2E9JA 4YHML 4GS7C 3RWJB 1BREA 1U3HA 3K8MA 4JFYB 5JORB 2JB5L 4K3EH 4NDMB 32C2B 4CADB 2OX5A 4WJ5B 4EXPX 4NNPL 3MCLH 1U92B 2IMNA 4H88H 4JO1H 4NCC1 4WCYH 5BOZG 4X5XB 4H26B 2V7NA 3VI4F 5DURB 1YMHA 2BVYA 2O5XH 3K2MC 3IJYA 1JGVL 1SYVB 4R3SA 4XVTL 4L1HA 4PLKC 4LCWE 5ANMA 3FMGH 1WGOA 1FO0L 5D5ME 4Y19B 1RHFA 3LKRB 3WFCH 4NHCH 2BNQE 4FA8A 15C8H 2ADFL 5CMAB 3W9EB 4AM0A 1JK8B 4P2OC 3ZYJA 2ARJA 2ZSWA 5C0FB 3B9DA 1TPXC 3NPSC 1IC4L 3T4YB 3MMEA 1U3JA 2FO4B 1MJJA 1NCDL 1UJTA 1K4DA 1S9XB 4WFGD 1UFUA 3N9GL 3LDBB 5HHMD 4GKSB 4KMTL 4N68A 5IVZB 4GMTL 2FO1A 2W0PA 1MCQA 4ORZC 4RGOL 1E6JH 43C9A 4APQA 1RV6X 2VKWA 2N56A 3IU4H 4N90E 2Q86A 4QOKE 4WTZG 3UTSD 3TESA 2ZUTA 4EI5C 1Q8MA 1LK2A 3QYCA 3ZE0F 3GSOA 5DJXB 5T5FL 1A8JH 3F6IA 4EN3B 2VSCA 2EDDA 3UTZA 3DIFA 3GJFK 3T77B 2ORBL 3Q1SH 2PXYB 3C09B 5J12B 4ZAKD 2E7LC 4HKBA 1AKJA 3DUSA 3BDXA 4YDKL 1BEYL 2C3WA 4W81A 4HLJA 2FLRT 4F3FB 2F8VA 3Q6FB 1NEZA 1I7TB 4C83A 3FRUA 3IJHB 1QSFD 3VFWB 5FUZL 5D1QA 2PCPA 4RNRA 4CJ1A 2WIMA 4HZLA 2I60H 5C0DB 1MUJA 3WKNA 3HNTL 3TJHD 3BPCA 3T3PF 3EGSA 4XH2A 4FXLA 1Q9OB 4BM7A 3QIBA 3QIUD 2V2WB 4XNZB 2Q7YB 3BP6A 5D7SH 1ZWIA 3JV4B 4MDJA 5SX5H 4RFNB 5D6DC 1RIHL 2E6QA 2EIZB 5FAAA 5IMOA 4PJFB 4W6YB 5GISH 3HI5L 2UZIH 4I3RL 3ARRA 3NCEB 3TBVB 3MRHB 5EU3B 1RUQL 1T2JA 1T7WA 4WNQB 3HC3H 1XCTB 1ND0A 5GS2H 3WCYA 2HFGH 3EDJA 4Z9KB 2DWDA 3VI3E 4I3GA 3B3IB 3G08B 3U0WH 2X4SA 2ENYA 1U8PB 4WU5B 1GGIH 1L0YA 4ZDHB 1QSVA 3A67H 4WV1C 4IIQC 1N0XL 2OK0H 2ICES 3NPZB 3C09C 4JY5L 3MGOA 2F74B 4ZD3L 4EVNA 1A7QH 4HJ0C 3CXDH 4HAFA 3MBEC 5CP7A 2PTTA 4C59B 3WD5H 5C09D 1AXTL 3HNVL 3T0EC 5JOEA 1BWMA 4Z95L 3ELAT 1RQ5A 1KULA 2P47B 4AT6A 1PSKL 1W72L 3RUGB 2YRLA 4NBYB 4XMLH 3VXUB 5IESH 3HFML 4WI7A 1A7RH 3WFBL 4D9LL 1J0ZA 4FQ2L 3NIGE 3SKUD 3GSNH 3HE7D 5E6ZA 4ONFH 1EEQA 3EO0B 4DGVH 3CMGA 3RWJA 1A3RH 4JFYA 1UB6B 5JORA 3RDTD 4NDMA 2X5PA 4I77L 32C2A 4CADA 3S6CA 3VW3H 1FPTL 4QYOB 4WHYH 1U92A 4K9EH 3L1OL 4LPWA 4X5XA 4H26A 4JQIL 5GS3A 4NO3B 3EUUA 3FL7A 1SYVA 4U2YA 4XVJH 1RJZB 4OFVA 4Y19A 3LKRA 3W9EA 5CMAA 3IRZA 2NY1D 1NFIB 1NBVL 1WBXB 1BD2E 1JK8A 3KJ4B 4PPTA 2ED9A 1X5IA 5F1SA 5C0FA 1PBYA 3A6CL 4WWID 1KIRB 3T4YA 5FCSH 2YOCA 2R69L 3I3EA 2FO4A 1NBQA 1S9XA 4ZPTB 5D6DA 4DVBB 4XT1C 4GKSA 4YHKH 5IVZA 1U8HB 3OF6A 1IEHA 5KW9L 5F6IB 3IYLW 2WLYA 1KCUH 2GK2A 5CINH 1PG7L 5EG6C 3VA2C 4PTTB 1V3MA 4XNUL 4J3VA 4BZ1L 1TDQA 4K07A 3TT1L 1E4WH 3QPXH 1OQOA 3ARDD 4PJIF 4QHKJ 1M6OB 5DJXA 3QAZC 2VXVL 4EN3A 1F4WH 1LMKA 2HLFC 3MA9H 1ADQL 1F8TH 4PFEA 3TPKA 1MCPH 4MNQE 5D96B 3T77A 3D39D 2PXYA 1FAKT 5D1XB 5FF6B 3O2VH 4JRXA 2DM7A 2IBGA 1G7MB 4F3FA 4EUPG 1A7PH 5GZNC 3Q6FA 5HHOE 3EAKA 1I7TA 3GNML 3IJHA 1AXIB 1FZMB 3VFWA 4HXAH 3FN0L 3HNSL 4QRPD 4JY6B 5C0DA 4OD2B 1RJLA 4R2GC 4TSAH 4ZPVB 3QHFL 4H8WC 3ULVD 2W9LA 3DURB 1Q9OA 1FLRL 2V2WA 2Q7YA 5J4MA 5B8CB 3JV4A 4PJXF 2D7TH 2EIZA 5BJTB 3NA4A 4LIQL 5F7DB 4PJFA 1CL7I 4XVSH 1NDGB 2R4SH 2YKLL 3TBVA 5C6TH 3MRHA 5EU3A 4PJ8D 4YBHA 3GHBH 4WNQA 1WISA 5B4MC 1XCTA 3QNXB 2W0FB 3RL2A 3K3QA 4JG0H 2IF7A 1GAFH 1PDKA 3B3IA 5EFIB 1NCWH 3G08A 3TT3H 4R8WL 3VXTB 4BFBD 5HDQL 5IJVB 4LHQB 1UQSB 1U8PA 2VZ3A 1CLZH 4WU5A 3MRFA 4ZDHA 4G43B 4YHLH 1OGAE 3P73B 1FLTX 4DEPB 3GMRB 3QFJD 4NN7C 4LLVB 5FYJU 1JYNA 4K3JL 1C5BL 2HWZH 2V2TB 4Q9RH 4P2RA 2F74A 4NQCB 1S7UB 2BFVH 4LDEB 5DUPH 4F7PB 1UKSA 3UX9B 1IC5H 1W8NA 4ZOEA 4JG1H 1NFKA 4WHCA 3IT8D 2FWOB 4HFUH 3RUGA 3MV9E 4KGLA 1AP2B 3VXUA 5C0ND 1LD9A 1U91B 2YPKB 3L3OB 1FYTE 3L5WB 3QZWB 3GK8H 2DJUA 2OP4L 2VXSH 3KWWB 4LHUD 5IFJB 2J8UF 4HWZB 1KCLA 1Z3GL 5B8CC 1A6UL 1UB6A 5D5MB 1VESA 2XRAL 1R5IB 3PJSB 1F11B 5C07D 1ZS8B 1D7FA 4Q9QL 3BDYH 5E2VH 4GRLB 1P7QB 3PP3K 5ESQA 1OM3H 4OD3L 2DN7A 3CU1A 3ZKSD 1Y6NR 4RAHA 4NO3A 4WEMB 5AZ2L 4Y88A 1RJZA 1ONQB 5JOPD 5C08D 1JL8A 3IXTA 5GSVB 5H37H 4P5TC 1NFIA 1WBXA 4LCIL 2ADIB 3LD8C 1LK3H 2AI0H 3R0NA 3DWTA 1JHTB 2G60L 1KIRA 1CFVH 3QEGL 5CGYD 4X83A 4M7KL 4QOKB 4JFHE 4CGTA 4ZPTA 4KROC 4LEOB 3WDHA 3I6LE 1K6QL 2FLBT 4DVBA 1U8HA 3ILPB 5TDPB 5JZ7D 5CBAB 3K0WA 3UZVB 4MAUH 2FDBP 1WUNT 4K3DH 3GJFB 3HE6C 5ELIA 3V0VA 1P84J 4F15B 3P9LB 1HOCB 5DLML 3THMH 3O45B 3VFUB 1A6ZB 1OCWL 2DL2A 1CICB 1D6EB 1JHKL 1BQUA 5MI0B 1VEPA 3CVIL 2CGRH 4HLZG 4GAFB 5HYFA 1ORQB 5I1KL 4Y4FD 1QLRB 1M6OA 1Z0MA 4KRNA 4YH6A 5DGQA 5F71A 3KLSA 4LHJB 3C08H 4UUJB 5IIEB 1KSRA 1WT5A 5FM4A 4NO0D 5D1XA 4P59L 5FF6A 4YAQB 4RX4A 4OD1H 5I1DB 5TQ0L 1G9ML 1OL0A 1G7MA 3LRHA 1NFDF 3RVUC 4LSUH 3I85A 2HTKC 1QFWL 2YR3A 4CN4A 3RZCB 1FZMA 1JPSL 4G7VH 1EUUA 2JIXB 5T33L 3HKFA 4BFEA 4HS8H 4JY6A 4OD2A 4ZPVA 5F8QC 4TN9A 3DURA 1UWXK 2PUQT 5E95B 1DL7H 5B8CA 4KZDH 1IRAY 5IROC 1RUML 3MLUL 1HYSD 2V9TA 5BJTA 5F7DA 5BRZD 2DLFH 1CXFA 5MEQB 1INDL 1XGYL 1TMCB 4U2ZA 4OFKA 5EBGA 3AMLA 3QNXA 2W0FA 4RA3A 2WUBL 2ZKHH 1RULH 2XG4A 5EFIA 1OPGH 3VWKD 3H6JA 5IJVA 1FVEB 3VXTA 5C6WH 4W68A 3SDDD 1UQSA 1KEGL 5E9DD 4PR5B 4UT7L 5EZLB 1CVSC 4G43A 4HQQH 4WFED 2EE6A 3SKJH 2IQAA 3GMRA 1C5CH 2CD0A 4MVBD 1Z9OA 2CK2A 1AY1L 4LLVA 2V2TA 3TM6A 4ERSL 1EVUA 4BK4A 5K59E 3OG6B 4LFHD 4NQCA 3AS1A 1S7UA 4F7PA 5I17B 2WZPD 3B9KD 2Q8AH 3RWHB 4ODVH 3VGAB 2KQNA 1R3HB 5GRZA 2FWOA 4H20L 1X9QA 2V2XA 4X8XA 1QQDB 5F8RC 1GHFH 3WUWB 1AP2A 4LRNL 2B0SL 1U91A 2YPKA 3SDYH 3CDFA 3L3OA 3DBXB 3L5WA 3QZWA 1QSEE 1CK0H 1T7YA 1HKLL 4OFDA 3KWWA 4Y16C 3QUKA 5IFJA 4HWZA 1QLEL 2J6EA 2J88H 4LCWA 1EGJH 1JMXA 1YJDH 1UM5L 3HB3D 4K7PY 4M02A 5D5MA 3UTTE 2BNQA 3TA3D 1R5IA 2VXQL 3VU2A 1F11A 1M7XA 1ZS8A 1WICA 5L6YL 2OTUB 3HR6A 2A1WH 4GRLA 1P7QA 5KAQF 5LVEA 1BD2B 4HUWB 2ZNWA 2BVEA 4DFHA 4DTGH 2WWKO 4LASH 4KKLD 3PWPD 3GO1H 4JQVC 1N6QH 4WVRA 4JM2B 1ONQA 1CXIA 4WENB 5GSVA 1RHHA 4W70A 5E99L 4W6WB 3O6FD 1YEHL 2Q3ZA 3F7QA 1GPOH 1J7VR 1G6VK 2DLHA 4GXUN 2DKUA 2VXTL 5FYLL 2ADIA 2C4XA 3SDAD 4YHZH 3UTOA 2XZCL 4QXTB 1JHTA 2AEPL 3BGMB 3MLXH 2P8MB 4QOKA 1YEIL 5E8DH 1P6AB 1NUFA 3RPKA 1RFDL 2FATH 4LEOA 3WN5C 4B7IA 2BXZA 5JPMB 5DJ6B 1WFOA 2J12B 3ILPA 5TDPA 5K33A 5CBAA 3SO3C 3GJFA 1EZVY 3QDJE 2D0FA 4YO0B 2HN7B 4MNQB 3P9LA 1HOCA 1WBZB 2F54E 3O45A 3VFUA 1A6ZA 2IAMC 1CICA 1D6EA 3FB7B 5E7FA 5F9OH 5F6HJ 3P0YL 3OQ3B 1BGXL 1ORQA 4Y5VB 3G9VA 1QLRA 5HHOB 4OCXH 2OZ4A 5HYEA 4EIZC 2XZQH 4YPJA 4PJEF 2X89A 4UUJA 5IIEA 4JRYE 1IAKB 4YAQA 2AEQL 3MLSL 3P4NB 5I1DA 1I1CA 5CS7A 1AI1L 4JHAH 1FBIL 5I1HL 2UVFA 4DWHA 4L4VD 4AG4L 3MQIA 4TUKH 1GZPA 4UT6L 1IQWL 3RZCA 3SCMB 4XP6H 3UTPE 2JIXA 2BHUA 3FAWA 3M8OH 1JZ2A 5AYUH 1MCJA 3CU7A 5FYLD 4L1DA 1TQCB 1WCBB 4ZTOL 3SE9H 1C1EL 3PGCB 4J3WA 4XTRC 2A6IB 4ZS7H 2R2EB 3LEVH 4G9FD 4M7ZC 1D5IH 1F6AB 4OLWH 2YPVH 4U0RC 3QUYD 3S96B 3VI4E 1YMME 1OP9A 1RURL 5MEQA 1S7XB 3WO4B 1IQDB 1OGAB 1V3JA 1YQVL 4YHMH 2CO7B 2X1QA 2JB5H 4JQVA 5ICYB 4OUUB 2QQKL 4NNPH 5J3HC 5HGGS 4BA8A 5HGHB 1FVEA 4Y5VC 4PR5A 4R4BB 1CLYL 2L7JA 1DFBL 5EZLA 1JGVH 4XVTH 3MV9B 1BZ7B 1MFDL 2EE9A 1FO0H 3RVXC 1UVQB 3SKMB 2ESVE 1FYTB 1C5DB 1CDUA 3BI9X 4AEEA 5I17A 4X7SL 3TP4A 3FQXB 3RWHA 5KOVC 1VENA 1L7IL 1IC4H 1R3HA 2DBLL 4CVXB 1NCDH 3WUWA 1MAKA 3N9GH 4OF8A 3X12B 1T80A 3ZE0E 4KMTH 3DBXA 2D7NA 3S98A 3O8XB 1RJCA 4HWUA 2UUDK 1CZ8L 4GMTH 4RGOH 1NLBL 1YNTB 1F00I 1XF5B 5HTSA 4YX2L 3U4EB 5JA9A 4JVWA 1IILE 4P23B 4J4PC 2BX5A 2OTUA 3RBSA 3NCYP 1BD2A 3BN3B 4HUWA 3E3QC 3RWFB 5T5FH 3HMXL 4MAYB 3WJJC 1MCNA 4K94H 4JM2A 1B4RA 2ORBH 3QEUB 4PD4J 4PJ5D 2OCFD 1FV1B 4D0CB 5KSBF 2EDHA 4YDKH 1BEYH 3T3PE 4QKXB 5I6XB 4UAOB 4X8JB 2AJSL 4CMMB 3ZO0A 4YFLI 5SWZD 4HIEB 4QXTA 1PW3A 2HT4D 3MFFB 3BGMA 3L3GB 4XNQB 2P8MA 5FUZH 4PGDB 4RDQG 4G8GE 3W11D 3EYSL 5F7FA 3FKUS 3P11L 2JLLA 5JPMA 3HNTH 5DJ6A 4WDIB 5HVWA 1REIA 3SE4C 4E0RB 3I84A 4MJ6B 4GG6E 4NZTL 3WIIL 3UPCA 3AGVA 1RZFL 5CZXC 5JQ6L 4YO0A 4NP4L 2HN7A 4MNQA 3M07A 1PG7W 1WBZA 3QXDB 3MJ6A 1RIHH 5C9JB 2JJSC 5FUCC 3FB7A 3HI5H 3MV8D 3FQTB 4I3RH 1RPQA 4IRSB 3K80A 5GGVL 4Y5VA 1RUQH 3ZDYF 1IBGL 1MOEA 3T1WA 3F5WB 2BZDA 5HHOA 5DSCB 4U05A 2VLRE 3MLZL 1CXHA 4PRBB 1IAKA 1YECL 5C6PB 3K4AA 2K7QA 3DX7B 3ARYA 3P4NA 1ETZB 4PLJD 2XKNB 1KCSL 1KF9B 1T3FB 2EZ0D 3RTQD 1N0XH 4MQ7B 5KSAD 4IMLB 5DC4B 3WNKA 3SCMA 4JY5H 2H6PB 4ZD3H 3HRZB 3Q5TA 4P9HL 5I6XC 2VR9A 1J12A 2JJWA 1AXTH 3HNVH 1WCBA 1QG3A 3I50L 4Z95H 5IBUB 3CLFL 3MCKB 4ETQB 5EIVA 1PSKH 1W72H 2DQIH 1T2QH 4O2EB 3PGCA 2A6IA 3W0WD 4G6JL 2R2EA 2AJVL 1JGUL 1F6AA 3HFMH 2H8PB 4X6BB 3WFBH 1S8DB 4JDTL 4FQ2H 3SE3C 3S96A 4MZ2A 4YGAB 1S7XA 1IQDA 1OGAA 4K8RL 2VC2L 5B22A 5BV7L 4I77H 4UV7L 4OUUA 5FYKU 5GS0L 5HGHA 1FPTH 2G9HB 2FX7L 2R4RL 2VITB 1JZ8A 4Y1AD 1S78C 3L1OH 2PO6D 5JW3L 4P2YA 4JQIH 3SQBA 4R4BA 1HHKB 1KLGB 3WIFB 3S36L 1UWEL 3QUZB 3MV9A 1BZ7A 4KJQC 2AJUL 1UVQA 2ADGB 2F53D 2MKWA 3LCYA 3SKMA 5LGJB 1FYTA 1C5DA 1QSEB 1NBVH 2DIAA 5D8JL 2XKSA 4EQ3A 4GT7A 4YDLC 4KTDH 1X4ZA 3FQXA 1A6TB 3SE4A 3A6CH 2GY5A 1FIEA 5IBLD 1IT9L 1XH3B 2P49B 1XGUB 1J0YA 2R69H 3UTTB 4CVXA 2NY5C 4CL7A 1I7UA 3KPPA 2X40A 3HZKB 4WIQA 4K55A 1QO3B 1VFBB 4PJIE 4CDGC 2IEPA 3O8XA 1IAIH 4HGWB 1TZHA 4LSQL 5HVGB 5KW9H 3TBWA 1A1NB 5L0QB 1C12B 1YNTA 4OBSA 1II4E 1J0JA 1X5HA 1PG7H 1XF5A 1MCWW 2DF3A 3HN3A 1JZ7A 3U4EA 4MXVF 4XNUH 4BZ1H 3WBDA 2YEZA 4P23A 2RAMA 3TT1H 1IE5A 4HMCA 4O9HL 1SQ2N 5F1KC 1NL0L 3RWFA 3QIWB 2AQ3A 2HVJB 2VXVH 4MAYA 4G42B 1ZLWH 4X0KA 1ADQH 3TIEB 4ZFZB 4G8EB 3QEUA 2A6JB 2GJZB 3PHQB 1FV1A 1AGDB 4D0CA 5I1EL 5IMMB 2EDLA 5DEZA 3UAJC 3GM8A 2DS4A 3AS3A 4GKNB 4LGRB 4X8JA 1J9CT 1F6LL 4CMMA 4GUPB 2B8OT 3QUZC 4PJXE 5DFWH 4HIEA 5IVNA 1T7XA 3GNMH 3MFFA 4AIOA 1UWGL 2F54B 3L3GA 4XNQA 2OJZL 3FN0H 1QSZA 4PGDA 5T3ZL 3HNSH 4PJHF 1SY6L 1OP5H 2QADB 5IOPB 3PL6C 4WDIA 2WBKA 3QHFH 2EDBA 4XCYB 3P9WB 4E0RA 4LSRL 4H1LH 1FLRH 4IRJB 1J10A 1AE6L 1D5ZB 3BESR 4G6ML 2IWGA 1QVOB 2VR5A 3QXDA 5C9JA 4JRYB 5AUMB 4HD9A 4LGSB 2WWMC 4LIQH 3PGFL 3V2AR 3FQTA 4R96B 3DMMB 4JGJA 2YKLH 1NQBA 3WMSA 5L0QC 1EMTL 4XB8A 3F5WA 1DE4B 3VD4A 5FKPB 4YBQD 5DSCA 5D70L 4PRBA 4KDTC 5IP4A 3GM0A 4R8WH 5HDQH 5I71C 3DX7A 1ETZA 3O3EB 2XKNA 3G5XB 4KUZL 4LLAA 1T3FA 1Y0LB 2VLJD 5LGKA 4M4PA 1TIUA 4MQ7A 4J23A 4CU7A 4IMLA 1YYLL 5DJAB 4K3JH 1C5BH 3B9AA 5SWSD 3DUUB 2H6PA 2D3VA 3HRZA 2UV3A 5E94B 4LRIC 1YMMB 5MEND 5AAMA 1PQZB 5DVOA 3U7WL 2J8UE 3WV0A 4WY7L 2H9GB 1F4HA 1N26A 3MCKA 4ETQA 3QUXD 3F7PC 3HI6L 4U4BA 4O2EA 4NUGH 5E4EC 5T3ZD 4MNHB 2QADC 3VRLF 4AEFA 3T8XA 4X6BA 2H8PA 1J8HD 1S8DA 3MV7D 1H3WM 2OP4H 2CDGA 4KAQL 5FV2A 3QNZB 1OGTB 1Z3GH 1A6UH 4DVRL 1QBML 3P9MB 2XRAH 2ESVB 2G9HA 4XC1L 4Q9QH 2VITA 3MR9B 4M1GL 1MPAL 1M1SA 4OD3H 3QUMH 3NZ8B 1HHKA 1KLGA 3WIFA 2V5RA 5AZ2H 4DK6A 3KG5A 3QUZA 5JHLH 1WCQA 2CLZB 3QEQD 4FQPA 2ADGA 1IC7L 4D2NA 5LGJA 1QSEA 1JGLL 2JJVA 3MOAL 4LCIH 5LGHL 2E7BA 2ICWB 1A6TA 4NQXB 4D9RD 1JF1B 2BSTB 2G60H 1MWAH 4Z7WE 1XH3A 3QEGH 1XGUA 4KVNL 1FO0B 1WC7B 3UTTA 4M7KH 3EYVB 3JWDC 3HZKA 1K6QH 1QO3A 1VFBA 2X4UB 4HEME 1CXKA 2NNAB 4KI5F 4HGWA 2UY7A 1TTGA 2HLAB 4JREC 1A1NA 1UM4L 1C12A 4OCRL 1UM6L 4PYHA 2VLKD 2O5ZL 1JWSB 3C60B 5EU5B 5DLMH 1OCWH 3RWEB 1JHKH 4NQSB 4GMSL 4X9FA 3QHTC 1NFDE 2O61B 1U8KB 5I1KH 4PUBL 3QIWA 4KTEL 2HVJA 4AK1A 1W0YT 3UPRB 4G42A 3SBWA 3TIEA 1EGJA 5JIKA 1MY7A 3GSVB 2X4OB 4G8GB 4ZFZA 1OAYL 4G8EA 2JJTA 1MH5B 2A6JA 2GJZA 3O2DH 3PHQA 1AGDA 5IMMA 1D9KD 5TQ0H 1G9MH 1K2DB 2H45A 2EEDA 4GKNA 4F7TA 4GG6B 3OGCB 4GUPA 4KKBD 4M1CD 3VGBA 3WDJA 3K8LA 2F54A 5T33H 5DO2C 5DFVC 3IDXL 1MREL 3H42L 4U6TA 5ALCL 5IOPA 3MGTB 1HH9B 3KPMB 5JXEA 4IRJA 3FHAA 1ZE3C 1D5ZA 2VLRB 3VRJB 2YUZA 4N1EA 1RUMH 3MLUH 1D5BB 4JRYA 5AUMA 3U9UB 5E6ID 4OGXL 5EC1B 2GYSA 5A2IH 5DFTA 2Q8BL 4R96A 3DMMA 3KPOB 3VXQB 4HXBL 4KK5D 1INDH 1XGYH 3PWLB 4LP5A 5GJSL 2FGZA 1LEIB 4XNYL 1DE4A 1XF3B 1NAML 5FKPA 2YHGA 4CNIA 4I0PD 2WUBH 3BVNB 4NN6B 4WWKD 2EXWD 2B4CL 1KIUA 3NFPB 4BZYA 4LLUB 4ETYA 4UIKL 3O3EA 5HJ3A 3VH8G 3DRQB 1KEGH 2LABA 2MJWA 3M1BB 3HMWL 3G5XA 3TNNB 4UT7H 1Y0LA 4HDIA 5LCVL 2QR0B 4PJCF 5DJAA 1AY1H 1FZOB 3D2UD 4ERSH 3DUUA 4LSTL 2F8XC 1CLCA 2VXUL 3AU1B 2JJUA 4JHWL 5E94A 5EIQA 1YMMA 5JW5B 4JKPL 4EIGB 1PQZA 3QDHA 4OLEA 4P2QD 3BW9A 2H9GA 1U8IB 3S3JA 4GQ9L 1XIWC 2OXGA 4XWOD 4H20H 1FC2D 5T1KD 4OZIF 3MODH 2K3TA 4MNHA 4HPYL 1FGVL 4LRNH 3UCRA 3ZT7A 1J1XL 2K9UA 1V5JA 2B0SH 2YUXA 5HHVL 1HKLH 3TV3L 4XVUD 2AJYL 2XFXB 1W72B 1Z6JT 1QLEH 3QNZA 5FM5O 1I1AB 1UM5H 3P9MA 4LGPB 4IHOB 2VXQH 5HYSB 2ESVA 1KCKA 3MR9A 5L6YH 4I3SL 5B3JF 5DEFB 1EHNA 1T6WA 5KSUB 2GHWB 5H2BB 3NZ8A 3GSRB 3ZL4L 3ULUL 5IGXL 4CBPA 4OM1L 4QHLB 4NN6C 5I76B 1KCRL 1FAIL 5ALBL 2CLZA 1FFNB 2AXFB 4NKDB 5E99H 1YEHH 4KK9C 4PJIB 5DJDB 2VXTH 2ICWA 1U8JB 4NQXA 2X4RB 1JF1A 2XZCH 4OCWL 1NGQL 2BSTA 4OQ1A 4KJPD 4PY8I 5FYJL 2AEPH 2DQDL 5CZVL 1I8IB 1HCVA 2DJ4A 1FO0A 1WC7A 3MYJB 1YEIH 3EYVA 5JHDE 1RFDH 4NRZB 1ZK9A 1QFUL 2X4UA 3GJEB 2NNAA 2AK1L 4TPRL 4LVOC 1IM9A 4WUKL 4DKAA 2HLAA 3WFZA 1ZA6B 4PJEE 3TFKC 1JWSA 2CIIB 5EU5A 4PBWD 4FFWD 3FOLB 4ZOBA 4NQSA 4CVZB 4NN5B 3P0YH 1EEUA 2P42B 2R0WL 2O61A 3H9SD 1U8KA 5ACMA 1BGXH 3TVMB 4CKVX 4M6ML 4PBXA 3CGTA 3RPIA 1CDGA 5IFAL 4LU5L 1YZZA 4PJXB 1YY9D 3UPRA 1MCHA 3ULUF 3BIKA 3E0GA 3IFLL 3GSVA 2BHZA 2X4OA 4G8GA 4S11A 3JZ7A 1MH5A 4RGMB 2AEQH 3MLSH 1NKOA 1DQML 1K2DA 5E2TL 1FBIH 4NQEE 1LNUB 2FHCA 3FQUB 3QT2A 3OGCA 4GG6A 4HULB 4AG4H 5F72S 2NXZB 1GH7A 1IQWH 1FSKC 4X98B 4U33A 3FFDB 4XXCC 3D85B 3MGTA 1MCRA 1HH9A 4ZTOH 3KPMA 3STZB 1C16B 1WF5A 1C1EH 3ABZA 5C71A 1NC4B 5D4QA 3TN0D 1TENA 2VLRA 3VRJA 1BWWA 1F97A 1JGDA 1D5BA 1WEJL 3U9UA 1X5GA 5EC1A 4TVPD 3CZFB 5F7LB 1A7NL 1RURH 3KPOA 3VXQA 3PWLA 1YQVH 4H1LB 1R0AL 1LEIA 2XWTB 1XF3A 1GGTA 4WGVB 1N6UA 1PX3A 1X5LA 4L5FL 3SJVE 3BVNA 1G6RB 3NFPA 5IM7B 3DUHA 4LLUA 2J8UB 3DRQA 3DXAE 3M1BA 4HGKC 3TNNA 1CLYH 1DFBH 1P1ZB 2DI7A 2QR0A 4WI4A 3U1SL 1MFDH 1Q94B 3QO1B 1FZOA 3BKML 3MLYL 2XZZA 3UBXI 4HV8B 2VUYA 1RIUL 3S8WA 2OQJB 3LOWA 3AU1A 1FFPB 1X5ZA 4KHTL 3U0PB 4PGJA 4V1DE 4PB9L 5JW5A 4LPTA 1MRDL 2VB5A 4P4KD 1SM3L 2PYEE 5HVHB 1U8IA 1SJVA 1ZVYA 1L7IH 2NY3B 4PBVC 2DBLH 4JPWL 3AREC 4JFXB 1D5MB 2ZPKL 3VXNB 2HA1A 4QNPF 4M62L 4XGZB 2XKUA 1CZ8H 3MRMB 3MUHL 4WTXA 1NLBH 3JV5A 2XFXA 1LO4L 1W72A 2NY4D 4KUCF 4U0QB 1RZJC 1C7TA 1I1AA 4YX2H 1EJOL 4IHOA 4FFZL 5KSBE 5HYSA 3KLDA 5CP3A 3L5XH 1DANU 5DEFA 4FQ1L 2H2PD 5KVEL 1I8KB 5KSUA 1H3TA 3HMXH 5H2BA 1UJ3B 3GSRA 3KPRE 4Z7WB 1NC2D 2H32H 4QHLA 1KTKE 1XF1A 1GC1L 5I76A 3LS5L 4YK4B 2AXFA 4NKDA 3O9WB 2X09A 4PJIA 5DJDA 3MJGX 5CBEB 5CUSL 3QUMB 3UXFA 4F7EB 1EPFA 2AJSH 1A4JB 1U8JA 4FQXB 2X4RA 1S7VB 3C8DA 4QY8B 1P84K 2BVQB 1FNAA 1I8IA 3MYJA 5CD5C 1U3HD 3EYSH 4ZOCA 2B1HL 4NRZA 3P11H 3BZEB 1NFDB 3DGCR 1GOHA 1VFOA 3GJEA 4MDIB 1U8NB 3ZDYE 2LFGA 4YNYB 3WFHB 5IKCB 2QTEA 3GBML 4NZTH 3WIIH 5L7XL 1MWAB 1RZFH 1ZA6A 1ITCA 2DBJA 1GVIA 4Q2ZB 5JQ6H 4NP4H 2CIIA 2RIKA 4I1NB 1N4XL 2ARWA 3FOLA 3V6OA 4CVZA 2F15A 4BFIB 2WK2A 4MB3A 4ZG1A 3EJZC 5ESVB 5GGVH 3TVMA 5F9AC 4LL9A 1IBGH 3T2NL 3HAEB 4J2XA 4PJXA 3I2CL 5C1MB 1DUYB 5EN2B 3WSQL 5K9KB 3MLZH 1A6AB 1ZGLM 4V2CB 3IXAB 1B88A 1YECH 5T5NF 1A5FL 1FVDB 3WUZA 1FNSL 1U0QA 4UOW1 3IGAB 1LNUA 1KCSH 2MHAA 4O5LH 4AY0A 3NACH 2QEJA 3PGDB 1IZKA 2EC9T 4APQD 3O9WC 4F57L 2R2CA 5HYQB 4X98A 2B20A 4P9HH 3STLB 3FFDA 3D18B 3D85A 3RVVC 4FQXC 3I50H 4ZO8A 3LRSB 3STZA 1C16A 3CLFH 2E9IA 3BPNC 5EC2B 4HIJB 3VJ6B 3X11B 5JNYB 4NBZB 4PP1D 3ARVA 1NC4A 3MRNB 4JDZB 4G6JH 4E5XB 5KG9B 1CQYA 2AJVH 1JGUH 1TITA 4JDTH 2WBJC 3CZFA 4KKCD 1J0KA 3LN9A 2CPCA 5DD6B 1EUTA 8CGTA 1BVZA 3GMMB 1AKJD 3VMPA 4BFGA 4H1LA 4K8RH 2XWTA 4OCSL 2VC2H 5BV7H 2ID5A 4UV7H 4ZUUB 4KFZC 3RGVC 1U3ZA 1G6RA 5GS0H 2FX7H 2R4RH 3IJSB 1QFWI 5IM7A 3MA7B 5D1QD 5JW3H 5FO9A 2BNRB 2J8UA 1A2YB 2QQQA 1P1ZA 2P46B 1XGPB 3IDUA 5DMIL 1UWEH 3S36H 1Q94A 3QO1A 4GLRI 2AJUH 3QIBD 4KRPB 1MI5D 5EZIL 3REVA 2CIKB 4HV8A 2V7HB 3U83A 2OQJA 5D8JH 1FFPA 3U0PA 4GRWH 2EO9A 2RQ8A 2VABB 3FHQA 2VWEE 1T20B 1WIPA 5ADPL 3ARQA 1CDBA 4MXVE 1CYGA 4JFXA 3FT4B 1D5MA 3VXNA 4G5ZL 2CDEB 2DQUL 1TETL 4XGZA 2CR6A 2I27N 3MRMA 4LSQH 2I07B 3UO1L 3U2SA 2VDML 4Y5XC 4OV6F 3VDCA 1PEWA 4DZBB 1MAML 3FN9A 4O9HH 2DWEB 3T0DA 1NL0H 4NZUL 2FEDD 1I8KA 1UJ3A 2QSVA 4YE4L 5JW4N 4Z7WA 4RSVA 4PJHE 3O2WL 5JHDB 3T04D 3O9WA 2HT3C 4K3HA 2NZ9C 5I1EH 1FZJB 3KR3L 2HTLD 3AVEA 5CBEA 2LTQC 3QUMA 4WTWA 3QDME 2APTA 4F7EA 2A6KB 4FZ8L 1A4JA 2N4IA 5C9KA 4FQXA 4ENEC 1S7VA 3X3FL 4PJEB 4QY8A 3WO3B 2BVQA 4ODXB 1UWGH 1U36A 5F9DC 2OJZH 2H41A 1UA6L 5T3ZH 4ZOAA 5KJRL 1EV2E 1SY6H 1YEJL 3BZEA 1NFDA 3PP4L 2EDYA 2ICCA 2Y07L 4MDIA 1U8NA 2Q76B 4YNYA 3WFHA 3QSKB 4LSRH 3HZYB 3N85L 1CGWA 1MWAA 4Q2ZA 1AE6H 5DQJB 4G6MH 4CAGA 2Y1VA 3UDWC 4LOUC 2X4QB 3PGFH 1UCBL 4BFIA 4PRHE 4TNVF 4Y19D 1NJ9B 4NQEB 1EMTH 4LSDA 5EULV 3HAEA 4FMKA 4JHBA 1DUYA 5CGTA 5D70H 5EN2A 5BW7A 5K9KA 4QTIL 4P5KB 1A6AA 4E42B 4O02L 1I8MB 3IXAA 1FVDA 3L7EB 2VDNL 4HUUB 4MA1B 3ARZA 3WIHH 3O81A 2AXHA 4KUZH 3IGAA 4OZ4B 3OB0K 4NJAL 4K9EC 3OF6D 3PGDA 3VRIB 5C0RL 1LO0L 1YYLH 3E2HC 1K9TA 3BIBX 3VRLE 2CRYA 2Y25A 3NGBC 4XHJC 2BERA 1GOGA 5HYQA 3O2DA 1F4XL 1CN4A 1NCAL 1FIGL 4XBEL 3WHE1 3STLA 3D18A 3U7WH 4B0MM 4I8DA 4WY7H 3LRSA 3RVWD 3TCXA 1G1YA 2NZIA 5D7KE 4HIJA 5EC2A 3HI6H 3V7AE 3VJ6A 3X11A 4RQQB 4DKEL 5JNYA 1XT5A 3DV4B 3MRNA 3QI9B 3SJVB 4Y4KB 3ZDXE 3MREB 4EN3D 4E5XA 5KG9A 2I5YL 5SX4H 1EXUB 1TQBB 2NY6B 3MXWL 3VXPB 2CKBB 4P2CG 5DD6A 2PXYD 3DXAB 3S5LG 4KAQH 3GKWL 3GMMA 9CGTA 4KQ3H 5E70A 1JTOA 4HJ0D 3RKDD 1SJXA 3W9DB 4QHMB 4DVRH 1A1MB 3BKCH 4HBCL 1QBMH 3FN3A 5AZEL 4ZUUA 1B0RB 4N8VB 4XC1H 4M1GH 3IJSA 1MPAH 3HG1E 4S1DC 4V1DB 2IGFL 3MA7A 5DVNA 1HQ4B 2PTUA 1A2YA 2PYEB 5JQHC 3UTSE 1ED3B 5I0DA 3VGDA 1XGPA 3QCUL 3HZMB 5DA4A 1TTFA 5FV1L 2F5BH 2CIKA 2DIJA 4KI5E 3Q5OA 2V7HA 1JGLH 5JUEL 3TH4T 1UKQA 3O3DB 5C8JA 2GAZB 4OV5B 4RMRA 4XX1G 2VABA 1EHAA 1T20A 4TUJA 3NBNA 4KVNH 3FT4A 4KHXL 5KSBB 3ALPA 1TFHA 2CDEA 2OI9C 5IF0B 2VSDA 1BVKB 3NCFB 1UM4H 2I07A 4OCRH 1UM6H 4GAJL 2EE2A 3KPRB 3MRIB 2O5ZH 5HHQB 1H8SA 3UC0L 4PD4K 4DZBA 5E1AB 4GMSH 4UTAH 2QL1A 4JZJC 3J8F7 5IB4B 4MCYB 5TF1L 3VWJC 1FL5B 2DWEA 4PUBH 1BBDL 1FVCB 1BX2B 5FK9B 3SKNB 4JFPB 4KTEH 3NCMA 4I4WB 4Q7DA 5ISZE 4MQXD 4OFPA 4X5LA 5GRUL 4PREB 2OS7A 3CAFA 5JHDA 1OAYH 1QFPA 3AMKA 4MJ4A 4XPBL 4QXWA 4MD0B 5HXMA 1FZJA 2DMKA 3GI9L 3QWOB 2EEAA 2A6KA 1T0NB 1N0LA 1AH1A 2K1MA 2H32B 4PJEA 1BBJA 4ODXA 3IDXH 1MREH 5F1IB 3H42H 2EIBA 1XAUA 5ALCH 4RFOL 5BMFL 5AD0B 3T2QA 5E5MB 2VAAA 1EERB 3UJJL 2A9ML 2Q76A 5TH2B 4A6YL 4NCDA 3HZYA 5CLTA 2IFFL 3IU3B 2FX9H 4D94A 5DQJA 1VSCA 4L8SC 2XQYG 4XP9L 2A77L 2X4QA 3IDNB 3MRBB 4XBGB 2Q8BH 1NJ9A 1F4YL 4HXBH 4NQEA 2Z31C 2MQ0A 5GJSH 2ENSA 4PJCE 5J06A 4F2MB 5ITBL 4XNYH 3BP5B 1NAMH 1RSFA 2VISB 1V3KA 4U31A 5ABDE 4P5KA 4WI5A 2B4CH 4XMKL 4E42A 1IGIL 1I8MA 5DUBB 3K81A 1AFVL 2CLVB 1WQVT 1JPGB 3L7EA 4UIKH 4UQ2B 1MFNA 4HUUA 3HMWH 4OZ4A 4OZIE 1LO2L 3VRIA 5LCVH 2FJHB 4L3CB 4IS6B 4LSTH 1AR1C 4HWBA 1A4KB 4JHWH 5D1ZB 4JKPH 2D7QA 3T4AB 3OKLB 2VH5L 4GQ9H 4NKIL 5GGSB 4RQQA 4PGEB 2A2QT 3DV4A 3SJVA 3QI9A 2AS5M 4Y4KA 3VXOB 4HPYH 3MREA 1FGVH 1M4KA 1J1XH 3KGRA 4EDWL 5B3JE 1EXUA 2Q1EA 1R3LB 3VXPA 5HHVH 2CKBA 3DXAA 3TV3H 5L9DL 5D1XD 4RX4D 4O2FB 3W9DA 4XI5D 4Z0XB 2E3VA 2DQEL 4QHMA 1A1MA 4C56E 3ZDZE 1B0RA 4U1SA 3OV6A 3LY6A 5EZOL 3IDMB 3ARXA 1CGXA 4I3SH 4V1DA 2VMFA 4FOMA 3QXVA 4LVHC 4DCQB 2PYEA 3ZL4H 1ED3A 1I8LC 5IGXH 3ULUH 4K71B 3HZMA 4OM1H 2HKHL 3TWCL 1FAIH 5ALBH 4BYHA 3INUL 1EK3A 2J6EL 1FCGA 3O3DA 5GGRB 2GAZA 3RFZC 2P5WE 2ITCB 4OCWH 5FDYA 2X9XA 1NGQH 5ERWB 5FYJH 2DQDH 2B5IC 5CZVH 3ZTJG 5KSBA 5INDB 4XPAL 3DRTB 5AWNL 5IF0A 1QFUH 5ETUB 1H5BC 5F3HB 1XGTB 4R4ND 2AK1H 4TPRH 3WKML 1BVKA 1IAIM 4HKXB 4WUKH 3KPRA 5FA3B 3VD7A 3ULUE 2X4TB 3MRIA 5HHQA 3BGAA 4PJHB 1BIHA 1DQQB 2H26B 5JO5B 4Y89A 4EXKA 5DHVH 5E1AA 1J05B 5K9QG 1G7LB 3ARGC 5CILL 5HI3C 2R0WH 1JPFB 1UKTA 5DEGB 3CDYA 5IB4A 4MCYA 3QDMB 3V0AC 3QNYA 4M6MH 1FL5A 4NQCD 1FVCA 1CFQB 4LQ1A 1BX2A 5FK9A 3SKNA 5D7JB 5IFAH 4JFPA 4LU5H 2OLDA 4I4WA 5FYJE 1KV3A 2ERJC 4YLQT 1PY9A 4KJWD 3CH1B 3IFLH 4BUHA 1L0XA 4PREA 1CS6A 3U6RB 4PYGA 4MD0A 2P5EE 3MRPB 2FL5B 1DQMH 5KBNC 1RUKL 3QWOA 3HMXA 3ALXA 1T0NA 5E2UL 3HI1B 1KJ3L 1BQSA 5F1IA 1AGBB 4PRHB 5J8OA 1RUPL 2OZ4L 3JVGA 2Y36L 1INEL 1URLA 5AD0A 3C8HA 3FQWB 5E5MA 3C5ZB 5TH2A 4MWFB 4GRLD 1OT1A 1OTTD 1KFAL 3HCVB 3WS6A 3IU3A 4F80A 5BS0E 1RZKC 2GY7B 5JA8B 2OYPA 5E0QA 3SEPA 1P2CB 1WEJH 3SGJC 2X7LB 3IDNA 3OPZL 3MRBA 4XBGA 4DOHE 1A7NH 1QLFA 5DD0L 4QTHB 2APVA 1DBBL 4R0LC 1R0AH 1ROWA 4F2MA 3MLRL 3BP5A 4ZXBB 5HI5D 2VISA 4JPIB 5FHBL 3CSBA 4L5FH 3D25B 3UBXG 4PB0L 1XFPA 5DUBA 1JP5A 2CLVA 1JPGA 4N90D 4PRDB 4QOKD 3LVEA 5IQ7L 4UQ2A 2F5AL 3KNBB 2AKRB 2WSKA 5MEOB 2FJHA 3U1SH 5E56A 4L3CA 3TO4B 3BKMH 2V9RA 4QNPE 4IS6A 3MLYH 3IDYB 2ICEB 1RIUH 5DQ9B 1A4KA 4KHTH 1JVKA 3OL2A 4PB9H 3LQAL 2MOVA 5D1ZA 1MRDH 5C92A 1CICD 3T4AA 1ZHKA 2BXYA 3ZT5A 3OKLA 4KQ4L 1E0OB 5GISL 5GGSA 1DQLL 2XXCB 4JPWH 3WNLA 4PGEA 1MFEL 2NY2D 2ZPKH 3VXOA 3MXVL 4I2XB 4PJ9C 3HC3L 2FR4B 3HG1B 4M62H 1R3LA 4XWGL 2X89D 3QPQC 3C5ZC 2NR6C 5HHNB 1AGFB 3UTSB 1LO4H 4FXGB 4O2FA 4Z0XA 2NXYC 4FS0A 1A7OL 4KY1H 1GGIL 1EJOH 4FFZH 2FEEL 3CSPA 4CVUA 3RZCD 3IDMA 3NVQA 2JIXD 3QQ9D 3F7VB 2NCMA 4DCQA 4FQ1H 5C0CE 5KVEH 5CCKL 4HWEL 4M3JA 4OIAA 3KLHD 1BOYA 4IMKA 5I74B 3WD5L 2MTPA 1GC1H 3LS5H 4JCLA 3BEWB 5EOCJ 5CUSH 3DARA 5GGRA 4OCMC 4P3CL 5E1HB 2ITCA 5LXGL 5ERWA 4Q6IC 1OTUD 2EXYD 1AQDB 2BVPB 3C87A 2B1HH 2FECL 5INDA 2BSED 1EFXB 3DRTA 3SGJA 5I16B 5ETUA 2C26A 2Y23A 3EYQD 4P99A 5F3HA 4Y0GA 5HDBF 1XGTA 1HK6A 2NY0D 1VEMA 4G8FB 4HKXA 4Y4HB 3GBMH 4R97B 4FQJL 5FECA 5L7XH 2KL6A 5ISZB 3ZYIA 2X4TA 4MA7L 4PJHA 1DQQA 2H26A 5JO5A 5JIHA 1W0WB 3LSOB 2VLME 1N4XH 2B2XH 5GS2D 1ZLVK 1J05A 5I8KL 1G7LA 3B9VA 1JPFA 3UROR 5F7KC 5DEGA 3LIZL 3QDMA 1LHZA 3MRCB 1CFQA 2XWJB 2GJ6E 3T2NH 5D7JA 3BRFA 3I2CH 3IAQA 3WSQH 4BQ9A 4WI9A 3KJ6L 3U6RA 1A5FH 2YK1L 2WINB 4K23L 3MRPA 2FL5A 1T89C 4Q9BA 5F7HA 1A6WL 2ILLA 4WW2B 3H9YA 4F33B 4ZAKC 1O7VA 3KDMB 3K8KA 5F3BB 4AEHL 2EH8L 5ICZB 1KCUL 1YPZE 5E9DE 4HGMA 1AGBA 4PRHA 1SHMA 4PJ9A 3FQWA 3ARFB 1EEYB 3C5ZA 5TPWL 4MWFA 1X5FA 4PJCB 1EO8L 1BD2D 3HCVA 4JPVL 4LFHG 3TJHC 7CGTA 5IHBA 2QQLL 1MVUB 3PXJA 1P2CA 4GAYB 4NUJB 5FKAB 2X7LA 3QIUC 5EU4B 4I18B 3BAEL 4JM2D 4X4ZA 5JMRA 5FGSA 5J7CC 1BJ1H 4HK3N 4OZIB 4OCSH 3BPLB 4ZXBA 3GUTB 2YD7A 4GRMB 1WFUA 4JPIA 3D25A 1I85C 4R7NB 1X5JA 4PRDA 5D2NB 3IB4A 1YNKH 5D93C 5IG7B 1W0VB 3KNBA 4IJ3B 2AKRA 1NAMB 5MEOA 5DMIH 4DKFL 3TO4A 5EZIH 4ZUSB 3BZDA 4D0DB 2ICEA 2NPLX 4JJHA 7FABL 4MNQD 2WV3A 5DQ9A 3BQUB 3KXFE 3WIHA 1HILB 5J3HD 1P5UA 2VZ1A 5ADPH 2X70A 3SDCD 1CQKA 1ZHNB 4HUKB 5DTFB 3RIFF 4C56B 4ONHB 1ZGLP 2XG5A 1F3DJ 4G5ZH 5HHOD 3GHBL 3DSFL 3KHOA 2DQUH 2FR4A 1TETH 4C4KO 4ACPA 3HG1A 4CN1A 1DVFB 3ARFC 4U6HB 3RBGA 4OJFL 5HHNA 3ZKXB 1GAFL 2Z8WC 2YA1A 2WW8A 3UO1H 1AGFA 3UTSA 3ARBB 2VDMH 4FXGA 4XNXL 5AG8A 2R2BB 3ECBB 5I73C 5LQBL 3HE7C 3SN6N 4YHLL 2VN7A 1UYWL 2OL3B 3SCMD 3RDTC 4WI6A 3F7VA 2CK0H 4NZUH 3ILQC 1T89A 2P5WB 4NZRL 2CRZA 3BPLC 4IOFD 4UDUB 4CU8A 4YE4H 4XCNB 2QV2A 3MTRA 4DKDC 3U48A 3O2WH 1NH6A 1OD7A 2RR3A 3BEWA 4LPXA 3KR3H 5DXWA 3OAZK 2W07A 4HCRA 4Y8DC 1V7ML 2J4WL 4FZ8H 3CX2A 2NY1C 3AM8C 3X3FH 1AQDA 1NUGA 2BVPA 4B7LA 1OGAD 1UA6H 1IMHC 2WUCL 5KJRH 2JCCF 1T22B 1EFXA 1Q1JL 1YEJH 1BQLL 1MJ7L 3PP4H 2ZG3A 5I16A 2Y07H 4TNVK 1M7IA 3C6LB 4G8FA 2EC9U 4Y4HA 3N85H 5KVDL 4HC1A 5ISZA 5GQBA 3LV3B 1L0QA 1R24B 1W0WA 3LSOA 1T04B 4N8PA 4F9LA 4AQOA 1UCBH 3MV9D 2P5EB 4FFVD 4M93B 4NFCA 3IRPX 5DQDL 5M7QA 4Y2DB 5TE6L 4UNVA 3MRCA 4KPHL 1FYTD 2XWJA 3UZEA 4M7JL 3ARDC 4OGYL 4QTIH 4XC3L 4ZTPL 1EFQA 3WNPA 2YD5A 4O02H 5DHVB 2WQ8A 3I6GB 2WINA 2FIRT 3FQNB 5BO1L 3EJYD 1RI8A 1T5XB 4WW2A 4F33A 1A9EB 4NJAH 1B6DA 3O8XD 3K1DA 3KDMA 5C0RH 5BS0B 1DEEB 4JFZL 4M5YL 5F3BA 5GRYA 5ICZA 3S7GA 1F4XH 3BHBB 1NCAH 2VIRB 1FIGH 4DOHB 1ZT7B 4P23D 3H8NA 3ARFA 1G0YR 5GJTL 4YHYB 4PJCA 1IZJA 3OTTA 2Y72A 4DKEH 3ULVC 1MVUA 4QWWD 4MAYD 2I5YH 1VPOL 4GAYA 2VDQL 4NUJA 5FKAA 4LHUB 5EU4A 2E7MA 3MXWH 4I18A 1HHGB 4JFHD 4OZGF 5HPOA 1MSPA 3T08A 3I6LD 2YD1A 1NBZB 2KUTA 3GKWH 4OZIA 2NY5L 4I5BB 4CW1B 4EI6B 3GUTA 4GRMA 5AZEH 4ZUVB 4UNUA 4PJ8C 5EU6E 4KWUA 4R7NA 2IGFH 4OKDA 4YIQB 1W0VA 4N8VG 5B38B 4EKXA 5C0AE 1NAMA 1I3UA 3QCUH 2YA2A 4DFIA 3RWCB 5EOCL 1NGYB 4D0DA 1I7ZB 4PG2A 5DJCB 2BRRH 5JUEH 4ODWB 1HILA 1S7TB 1IARB 2YSSB 1ZHNA 4IRSD 2I26N 5DTFA 5CZKA 1AIFB 2EICA 4C56A 1AC6A 4ONHA 4KHXH 5I1CL 5I15L 4FZEL 4NPYB 3HRPA 3EIFA 1DVFA 3DROA 4U6HA 1KJVB 5C0CB 5C0NC 4GAJH 1MFCL 3ARBA 2APFA 5D7LB 1VGEL 2UVEA 4L8DB 3UC0H 1ZXQA 2FZ3B 2R2BA 3ECBA 4MZ3A 2AJ3B 2PKDA 3IDIA 1R3IL 5D7IF 5E2WL 1KXQE 1NMBL 2OL3A 3OJ2C 5TF1H 1DLFL 1BBDH 1CD0A 4M1DL 2P5WA 5EU7C 4M48H 1R3JB 4UDUA 3VFGL 3UMTA 4XCNA 4NO0B 2LVEA 3RU8L 5GRUH 4XRCB 3VFTB 5FYKH 4UBDD 4Z7NE 5EOQL 4F9PA 4OF3A 2DJSA 3NA9L 4IEFB 3O3BB 4XPBH 4OF5A 1DR9A 2RGSA 4I0KA 5A3ID 1DDHB 2HVKB 3GI9H 1E4KA 5GRXG 4X7EC 4FMFA 1CDYA 2LAAA 4DK3A 3P40A 3WS3B 3OGOE 2DKMA 1CGSL 2AK4E 1T22A 4RFOH 5BMFH 4RZCB 5FO8B 5CGYC 5JLZB 1PFCA 3UJJH 2A9MH 4A6YH 4R4FL 2GJ6B 3C6LA 1NCCL 2E9WA 2IFFH 2GTWB 3P30L 3AS0A 1JTTA 5JZ7C 3LV3A 4JLRA 5FYKE 1PG7X 2NW3B 3NABL 4XP9H 1R24A 1T04A 2A77H 3QUZD 2GSIB 2P5EA 4RAUB 4Y2DA 1F4YH 2Y7QB 1QSED 4P3DB 5ITBH 3PUCA 1GPOL 1CFBA 5IB1B 2YS4A 1B2WL 4Y4FC 3TZVB 4XMKH 1YPZB 5E9DB 1IGIH 5DHVA 1NANI 1E4XI 1AFVH 3ZYZA 2OJEB 3I6GA 3UTTD 4BZ2L 3AC0A 4QRSB 3FQNA 3TO2B 3NN8B 1T5XA 2C3XA 1A9EA 4ZNCD 5IBTL 1LO2H 5BS0A 1DEEA 1J1OL 4Y1AE 4UTBL 3SGKA 4WHTB 1CCZA 4GS7B 3BN9D 3BHBA 2VIRA 1UEMA 1U58B 1ZT7A 1GSMA 2VH5H 5CD3B 4NKIH 4G7YL 3H9HB 1CI5A 2HMIC 3TYFB 3QIWD 1CIDA 4XCCL 3S4SG 4MD5B 1BHGA 1TZIB 4EDWH 1U8OB 4LHUA 2R0LL 1IM3B 1HHGA 3P3YA 2YC1B 5T3XE 1HE7A 1NBZA 1T1ZB 4XP5L 5L9DH 4NCC2 4NQDE 25C8L 1HYSC 1UENA 4I5BA 1A3LL 1BFOB 4CW1A 2DQEH 4EI6A 3NIDE 1S3KL 4P2OB 4ZUVA 5EZOH 4DUVA 1MQ8A 1TPXB 1JNNL 2F54D 2H3NB 3NPSB 4KMQA 3KXFB 4YIQA 1G9NL 2XZAL 2QADD 5B38A 3PWVB 4OZFA 1JCKA 3VWKC 5ILTL 2KZ1B 5IJKA 2PTTB 2RFXB 2HKHH 3SDDC 3RWCA 3TWCH 5JXED 1NGYA 3DVGB 3INUH 4IRJD 1I7ZA 4MXWL 1WWBX 5DJCA 1KELH 4MVBC 1EZVX 3D48R 4JRYD 3WNOA 4ODWA 1S7TA 4RMUA 1ZLUK 2YSSA 5C70A 3DMMD 1G9MC 1EDQA 4EI5B 5CEZE 1AIFA 1RK0B 3B9KC 3LEXB 4XPAH 3O3AA 4NPYA 5AWNH 3T0XA 4POZD 3UTPD 5H35B 3WKMH 1KJVA 5C0CA 5D71L 5D7LA 1G7PB 4HSQA 4L8DA 4F8TA 1PZ5B 2FZ3A 3MZGB 1U9KA 2AJ3A 2BY1A 4R6UA 3T2OA 5CILH 3SGDH 4KKAD 3TA3C 3DYPA 3LH2L 4RRPA 1LEGB 1T83C 1YMMD 1R3JA 4NO0A 1X5AA 4XRCA 4Z0BL 2AJXL 2BSRB 2R0ZL 3VFTA 4F37F 4XXDB 3GJFH 4YDIL 3LQZB 1JHLL 4LSPL 3O3BA 2B1AL 1DDHA 2HVKA 3V9FA 4PIRF 2GIYA 3O6LL 3B2UD 1RUKH 4OB5L 5E2UH 3ZYOA 3O6FC 2ZUQC 1KJ3H 5HPMB 1CFNB 3WS3A 3SDAC 5F9WC 2IPTL 3QEHB 2CRMA 1DZBA 1RUPH 2OZ4H 2Y36H 1INEH 3HZVB 4RZCA 5FO8A 5JLZA 2ESVD 2GJ6A 1WZLA 5SWSE 3FRPA 1KFAH 2GTWA 5A1AA 1BAFL 3QUYB 5ITFB 3EOTL 2NW3A 1ULVA 5IT2L 4LF3B 4WV1B 1AD0B 1Q9WB 3OPZH 2GSIA 4IIQB 4K94L 4EDXB 1EVTC 4RAUA 4G6AD 2P43B 1NLDL 3O6ML 4G9DB 2A0LD 5DD0H 1DBBH 1Z2KA 5BVPL 2Y7QA 2W65B 4P3DA 4AIXA 4JRXB 2BVTA 3MLRH 5IB1A 1J8HE 5FHBH 3MBEB 4NJ9L 2Q87A 5E08L 3T0EB 3TZVA 4PB0H 1YPZA 5E9DA 4HHAB 2OJEA 4PJGF 4YZFF 4QRSA 3REWB 3TO2A 3V4UL 1LWRA 3BH8B 4NZJA 5IQ7H 3NN8A 2F5AH 4LKCB 4N0UE 5ACZB 2AGJL 1H3PL 1RJLB 5EO9B 4Z78B 5F7UA 5EPMB 3GFUA 2LQRA 4X7DC 5H94B 3C60D 1JRHI 4WHTA 2X1PA 1OD9A 1J5OL 1U58A 3LQAH 1LE9B 1JFQL 2J5LC 4KQ4H 5DJ0B 4IDLA 5F7NC 5CD3A 1T1XB 4RDQF 1DQLH 3H9HA 3TJEL 4GG8B 1QTYT 1MFEH 1P69B 3TYFA 1YEEL 3ES6B 3MXVH 5EU6B 4MD5A 1TZIA 5HYIA 4TNWF 1U8OA 4GBXB 4D9RE 4CMHC 4HIHB 4XWGH 1IM3A 3RL2B 4G8GD 4FFYL 2YC1A 4QF1B 1T1ZA 5M94B 3TA3A 3H0TB 5C0AB 3QUYC 1HHJB 3WLWD 3R4DA 1BFOA 1AD9B 2KPNA 2P7TB 1SMAA 1A7OH 3MRFB 4P2OA 3G5ZA 2IBZX 3HPLB 5EDXA 1VFUA 2H3NA 5LJYH 4YFDB 3KXFA 4JY4B 1MAJA 4P2RB 3H3PL 4QEGA 5CCKH 2RHEA 3PWVA 4HWEH 1N8ZB 1XF4B 5A2JH 2RFXA 3HA0A 5IB5B 3BFOA 2APXA 1ZSDB 4OLYL 4PJDE 3N1MC 3DVGA 3S34L 5HDBE 2DQIL 2VLRD 1T2QL 3VFRA 1JN6B 4L3EE 5IB2B 1I3RB 1LD9B 4P3CH 5C0BE 2ZCKL 5LXGH 4KK6D 4EI5A 1RK0A 1KTDB 4OLVL 2DQCL 1M05B 3LEXA 3QAZB 3IDJB 4PRAB 5IWLC 1CGVA 5H35A 1EJ6A 3LKOB 4FQJH 2EDJA 1QPPA 1GGUA 3E6FB 1QR4A 2E7LA 5ESQB 1G7PA 2A83B 3PE9A 4MA7H 5GGQL 1PZ5A 3RUGF 4F58L 4GBXC 1TVDA 4NKQB 5I8KH 5F44A 5HI4C 2ITDB 3NCCB 3LIZH 3IXTB 4X6EB 3GI8L 3MZTA 1LEGA 3NMEA 3DHJA 1QACA 3QWRA 4R2GB 4KTDL 2BSRA 4YFEA 4M6OL 4XXDA 2O26U 2AK4B 1JZ4A 1ZHLB 3LQZA 3KJ6H 1FNFA 2YK1H 4K23H 1I1YB 5IFHL 2QSCL 1A6WH 4LMQE 4NO2B 3VFVB 1IAIL 3HHRB 5HPMA 1CFTB 1CFNA 2EDNA 4AEHH 3BE1H 2EH8H 3QEHA 4LPVA 3V0VB 3RP1A 3VMOA 1I1AD 2HT4C 3HZVA 5I66B 5TPWH 3IF1B 3W11C 2YXMA 1EO8H 2FRGP 2YN5A 3EFDL 2KH2B 2COQA 4JPVH 2QQLH 3QUYA 5ITFA 4E41E 3JXAA 2W92A 4TYUA 1CVRA 3DVIA 5KVMC 4LF3A 4NM4L 4WV1A 1AD0A 1Q9WA 3BAEH 4IIQA 4EDXA 4NN7B 2CDFB 2R56L 1IKFL 4A6YB 2GKIA 3BISA 4G9DA 3R1GL 3SHSA 1CIUA 2W65A 2LAGB 1R6VA 1DCLA 2C4FU 5J6HB 2OR9L 1RVFL 3MBEA 2DDQL 1F58L 3T0EA 3T1FB 4HHAA 1CG9B 3UYRL 3TYGL 4WI8A 2IANE 3REWA 3T65A 3BH8A 1MCLA 1RZJL 3VFOB 4LKCA 5ACZA 4RBPK 2GITB 3RIFK 1OP3K 2XNAB 4UMGA 5EO9A 4PLJC 4DKFH 4Z78A 1JZ3A 5EPMA 3RTQC 4BSJA 5H94A 7FABH 3K2UL 5KSAC 4M43L 1NMCC 1LE9A 1FNHA 4NQDB 1G6RL 1LILA 3WFDL 1K3ZA 5DJ0A 4WGWB 1T1XA 3TVMD 4GG8A 4OLXL 3BX7C 4ORGB 1ACYL 3ES6A 1WJ3A 5EU6A 3DSFH 3LPFA 4GBXA 4HIHA 1B90A 4XPGL 3LZFL 4QF1A 1HINL 1UZ8B 4OJFH 4D0BB 4C55A 3M17B 3H0TA 5C0AA 1HHJA 4XNXH 3TH3T 4P5TB 1AD9A 4XBPB 2P7TA 2VQUA 3QG7L 3CVHL 3LD8B 5LQBH 3IKKA 3E3QE 1AQKL 2VR4A 2NXZD 2P48B 2IQAB 4MHHI 1UYWH 1WWCA 3HPLA 2Y6SD 4JY4A 4NZRH 3PP3H 4NT6B 4LK4A 1N8ZA 3JUYA 4KROB 3CNKA 1XF4A 3D85D 5AG9A 2PO6C 5IB5A 2JCCE 1ZSDA 4RCAA 5B39G 1DQTA 1NC4D 2F58L 3HE6B 5FGBC 1JN6A 4NUGL 1GIGL 1H3XA 2V2XB 1QRNE 5IB2A 1V7MH 1I3RA 2J4WH 4ZSOE 1X5YA 1KTDA 4UV4L 4KTYA 5EOTB 1UH4A 2WUCH 1Q0XL 1M05A 3QUKB 4OFYA 5IBLC 3D0VB 1Q1JH 3IDJA 1J0IA 4PRAA 1BQLH 1MJ7H 3MBXL 4LCWB 4XPHH 4DW2L 5I30L 1LP9E 5MEPB 3V4VL 2BNQB 3LKOA 1CDHA 4JFDE 5KVDH 2DM4A 5FUCE 3E6FA 2A83A 3MRGB 3QUML 1XF2A 2GQHA 4ODSL 2FCBA 4RGND 4GQPH 3EKCA 4LNRA 4WU7B 2W38A 2ITDA 5DQDH 5JHLL 5TE6H 3WXVL 4KPHH 2ATPB 4L4JA 1RHHB 1DBMH 4X6EA 4RISL 1EIBA 4M7JH 1H0DB 4OGYH 4XC3H 2DQGL 3D6GA 4ZTPH 3ROOB 4X6DE 2NY3D 2AK4A 4EZMA 1ZHLA 5BV7C 4OF7A 1MWAL 4MA8L 5DK0B 3ZE2F 3O11B 5ECJE 3MOBL 1I1YA 2R9HD 5BO1H 1QZ1A 4NO2A 5GGUB 4K7FB 5LKNA 3VFVA 4JFZH 1CFTA 4M5YH 1FGNH 3PWNB 3UYPA 1G7HB 4OZGE 4JO3L 4B41A 5EO1B 1J87A 2M2DA 2W0LA 1NBYB 1OQXA 5I66A 5I1AB 1U2HA 5ID1B 5GJTH 3IF1A 4KC3B 2GW5A 3BZ4B 4OF0A 4X6CF 1T6VN 1UWXH 3MUJA 4X9BA 4N5ED 2O5YL 1VPOH 1KGCE 2VDQH 1ZLSL 2AQ2A 2CDFA 4U6XB 2MWCA 4A6YA 4HJGB 4RA0C 3O9WD 4N0UB 2NY5H 3O2DL 2DL9A 4HJJL 5J6HA 1SJHB 1WAAE 2KQMA 4FQQB 2AEWA 3T1FA 3T0AA 1CG9A 4ZFGL 5K9JL 1GZPB 3NZHL 4JFEE 3VE0B 3VFOA 2GITA 3TF7C 2XNAA 1H9VA 3CJJA 5EOCH 4TSCL 3VXME 5JW4R 4Y16B 1KB5B 2EKSB 4N8CL 1BZQK 2R0KH 4NQDA 5L8JB 5CJXC 5GSRB 4MA3B 4XPTL 4RWYL 5KSVB 4NO5B 1TZGL 4L4TE 5I1CH 2RB8A 5D7IE 3Q3GB 3BYYA 4ORGA 5I15H 3QUXC 4FZEH 1M71B 4LLQB 3RAJL 3VXSE 3MC0A 2DQJL 2VZVA 1Z0NA 1F2XK 3RX5A 1UZ8A 4D0BA 3M17A 5CEXB 1MFCH 2HRLA 1VGEH 3HLAB 4P5TA 2EECA 4XBPA 5GZOD 4PJDB 4NSKB 1K4CB 1R3IH 5E2WH 4L3EB 1NMBH 1Z5LB 4OGAC 3K7UA 1DLFH 5J1AB 4M1DH 5C0BB 5BZDB 5LAXB 2IH1B 4NT6A 3VFGH 5TGBB 3WN5B 2DKSA 3GIVB 3DX8B 3RU8H 4JANB 3S36X 1U42A 4RAVB 5EOQH 4HFWB 3NA9H 3V52L 3BP7B 3SO3B 1S5HB 3HE6A 3CX5J 2QJDA 3MODL 3RY4A 4HUXB 2IAMB 3U4AA 3OAYK 3DX6B 1HN1A 5EOTA 1CGSH 2VLLB 1QFOA 3D0VA 2Y06L 5MEPA 3CXHJ 4I48B 4PRPE 4R4FH 1NCCH 2R39A 2DMBA 2IG2L 3P30H 2FNBA 1K8IB 2BNRD 3MRGA 3NABH 5JMOC 4UIMA 1C08B 3EYUL 4JFFE 4LLYB 4ENED 4WU7A 3RX7A 4KRPD 2AABL 5BQ7B 2ATPA 2DQTL 4WWKB 2FHFA 4Q58C 1B2WH 2G2RA 1H0DA 4AQ1B 1GJIA 3ROOA 4OZHF 1N6VA 1RZ7L 5CIPB 2FIKB 3JBG7 5DK0A 2XN9E 4GW4B 4BZ2H 3O11A 4CDHA 2BY2A 4WTZA 4LNVA 5IROA 4YHIA 4M7ZB 1NEZG 3EW3B 5IBTH 4U0RB 5GGUA 4K7FA 1J1OH 1D9KC 4E41B 5GS1C 2NYYD 2AP2A 3PWNA 4UTBH 1G7HA 4KKBC 1DANT 4M1CC 5EO1A 1WWWX 5T1KB 2J1KA 1NBYA 1LO3L 2FX8L 5I1AA 5ID1A 1MI5E 4G7YH 2YD9A 3BZ4A 5MHSD 1J8HA 1FNLA 4KH2A 5FM5M 3PDDA 4XCCH 2IPUG 3HPJB 4EUPB 4TUOB 1I75A 1MCIA 2R0LH 5I8OL 2IANB 5JHDD 4U6XA 4XHJD 4OTXL 5CKAA 1OAKL 4HJGA 4XP5H 4C58B 2AV1B 4N0UA 4OCYL 4U1IB 25C8H 5E6IC 3JWDH 3CFCL 4HWBL 1A3LH 1P53A 1T66D 1SJHA 4KK5C 1S3KH 3WJLC 1GCFA 1VERA 4O4YL 3EDFA 4FQQA 1HH6A 5E8NB 1VACB 1JNNH 4XB7A 5CKGA 3B9EA 4I0PC 3ZE1F 2XIDA 1HI6B 1G9NH 4WWKC 2EXWC 3VE0A 5F97E 2XZAH 2UY6A 2ZNXA 5ILTH 5J13C 1RUAL 3GIZL 4UOW0 2CKBL 4FN0A 4H0GA 2CSPA 4MJIE 2P8LB 4MXWH 4OI9A 4Y16A 3VG9B 1KB5A 2EKSA 3V95A 3U82B 1QBLL 1A47A 4TOYL 3AB0C 4KXZH 5GSRA 4MA3A 4NQED 1FL6B 1I3GL 5KSVA 4NO5A