4LLDB

Structure of wild-type igg1 antibody heavy chain constant domain 1 and light chain lambda constant domain (igg1 ch1:clambda) at 1.19a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
101
structure length
101
Chain Sequence
b'QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Generation of bispecific IgG antibodies by structure-based design of an orthogonal Fab interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lldB00
3E2HB 4HFUH 4RBPK 4YDJB 1KTDB 4UDUB 2IMNA 3ROOA 2AK1H 4O9HL 1BFOA 1B2WL 1YZZA 2P5WA 5CP3A 2FO4B 3QPXL 2YEZB 3UX9B 3P73A 3WUWG 4FQ1L 5ITBL 1KLFA 5B4MC 4PJ9A 1X5AA 3VWKD 3OMZA 1Z9MA 3LV3B 4L8CB 1A7PH 4FTVD 1U6AH 3U4AA 4RIRA 1F45A 1TCRA 1LP9A 1ONQA 2CKNA 1ZGLP 5D96B 3BIKA 4ONHB 5CBAA 4M61B 1PGRB 4Y2DA 1W72A 3B9EA 1IAIL 5LKNA 3FCTB 3NIGF 1T2XA 4I3RH 3VDAA 4Y8DC 3RHWK 1XIWB 3MYZA 2F74A 5IQ7H 5I1GH 4BZ1L 1S7UA 4EVNA 2V5TA 3B9DA 32C2A 3LKRA 3T0EE 2NLJB 3IS1X 3NFSL 5CSZA 4Y89A 4Z7NE 3P40A 2Q20A 1T89A 2IH1B 1AGDB 1YN7B 1HSAA 2B0SH 4NO5B 3AC0A 4TSAH 5EZIL 4O4YH 5KS9A 1I9JL 4L8SC 5D2LE 4M7ZB 3SDCB 5EOCL 5E9DE 4GG6E 4YBQC 2IGFH 1P6AB 3VWJA 4B50A 2D9QB 3U9UB 4HWEH 3L3HA 1TQBC 4C83B 4U05A 1NDGA 5HY9A 4TNWF 1INDH 4HZLB 3FQWA 3RI5F 1V05A 3Q1SL 4M1GH 5GGTL 1OLZA 3MR9A 4JFEB 4ORGA 1I8MA 3VFWA 2MKWA 3VMOA 4P4KA 4HH8A 2CLVA 3MLZH 3S96A 1GRWA 2F5AL 2JCCF 4PY7A 4NQSB 1XCQB 3W0WE 3L3OA 3HC3L 1DDHB 1P1ZA 3PDOA 3QFDA 3CMOL 4LSPH 4G8GE 1ZLWK 3ELAT 5EO9B 3KG5A 1OAZL 1KV3A 3T0BA 1OHQA 4IIQC 3EYFA 1YY8B 3QIWC 2FHBA 3D85D 1OOAA 4BUHA 2YUVA 5IOPA 3ZTNH 3MODH 1SY6L 3QNXA 5DJAB 2XZCH 1MLCA 3VXMD 1U91B 2M26A 4HS6A 4LCWB 3MPCA 2KQMA 4LOUD 5DC0A 1QBLH 2JB5H 2Y6SC 3PP4L 3QDME 3D39A 4RRPG 4GMSL 5FGCE 4FZEH 1HDMB 4PJEB 2VLKB 4EQ3A 3TPUA 2Y25A 2BCKB 5INDA 3TA3D 5C7XH 2WQ8A 4X5XA 1SYVB 1FZKA 1OAKL 1UJ3C 3P3YA 3QA3B 4U33A 3MJ6A 4IRSA 1CD1A 2DF3A 5K59F 4P46A 3VMPA 4XVUD 1M4KA 1CGUA 3BIBX 1F4YL 3BWUC 3WFBH 5TQ2H 3BXNA 3BOVA 5F7HA 5BZWA 4EN3D 4OF3A 4U6YB 2ZJSH 1KACB 2D03L 5JZ7C 5F71A 3O4LB 4IMKC 2HP4A 2DQTL 5CZXC 1CGWA 3FB6A 3GSNA 1K6QL 2CLRA 4D3CH 5DS8B 4CADB 1HSBA 1S7TA 3TO4D 4F7EA 4O2FB 2DKMA 4RWYL 2DS4A 3L5HA 4YXHL 4MXQC 3RWFB 4DKFL 1PLGL 5F89A 2IANE 5B3JF 4RAUA 2H9GA 1YEFL 2VLRD 4UU9A 3ARDD 3Q48A 4WGWB 1N59A 3SPVB 4LDEB 1DQQA 3E6FB 3VWKA 2PXYA 3QYCA 5BMFL 2I9TA 2F53E 5JR1L 1WFNA 1ZLSH 1UWEH 3K1KC 2AJUH 1EJOL 1V3JA 2JIXB 2WK2A 4OD1L 2ESVE 4OGAC 4X9FA 5D70H 4XP5H 3TC9A 4QRTB 3VG0H 2DQGH 1KEML 2YSSB 2VDML 1UM6L 2AV1B 1MHPH 4C59B 5JLZB 3WNPA 2OXGA 1I3UA 4YHLH 2XA8L 1AO7D 1JGUH 1IM9D 3MV8E 3CFDB 5I66A 1FBIL 5FUOL 4YHNA 2ZG2A 1CFSA 4ZUSA 2AV7A 4PB9H 3PWNB 3WHXA 4G7VL 4YHYC 3V5KB 4WW2F 2X40A 5FUZL 4F80A 3L3IB 2OK0L 1F02I 2OBGA 3ZE0F 5K9OB 5E5MA 1IKNC 1EK3A 4WFGE 4MX7A 2X9YA 5BJTA 3HNSL 1NFIA 5E7FA 2HFGL 3OPZL 4KXZH 3QQ9D 3WD5L 4JFXA 3MRNA 3NAAH 5C2BH 3T0DA 5IFJA 5CJOL 5DI8B 2ZCKL 3MO1A 1T1WA 4DUVA 1B3JA 5JXAH 5MENA 2BX5A 1LQSR 4CN4A 1LDSA 1IGIH 5DJ6A 3BRGC 1XGUB 3PQYA 4OQTH 3IAQA 3LMJH 2J2ZA 2AJVH 3B8YA 4ZUUA 5CEYA 3V6OA 4GOSA 4YHPA 5FV1L 1VADB 4OT1L 3KYNB 1HKLH 4I2XE 1HILA 4LEXL 1BIIB 5CINL 3IFLH 1FH5L 5CMAB 3IDJA 3HC0B 4NQVA 2NY1C 4RZCB 1JNJA 2WBKA 4NT6A 4DFHA 1CDCA 3ZSTA 4KDVA 1O0VA 1XGQA 4PJXF 1QYGL 2H8PA 3T0ED 3SKOA 1C12B 1NQBA 4MSWA 2IFFL 2ICEA 4DUXA 3DO7A 4EJ1C 5I76B 3IDNB 4WI3A 1FGNL 3O45A 1FO0L 4Z7WF 4JDTH 4FXLA 2BVOA 2B2XL 1LEKB 5E9DD 1SVZA 4LSQL 3VFVA 5J6HA 2IPKA 3TN0B 4K3JL 4XHQA 4C58B 1T80A 3L3DA 2WWMD 2A77H 1E6JL 3AY4C 3RU8L 4NM8L 4AY0A 4B0MM 1FGVH 4EN3A 5C0EB 2A73A 3B43A 2LU4A 3WFHB 3UBXA 3VCLA 5F7WC 4W6WB 3QAZC 3W0WD 2AABH 3LS5L 5B39G 1RK0B 5DZLA 5JOPE 4PJDF 3F12B 5HBBA 4JFZL 3TT1L 2Q8AL 2GJZB 1HXMA 3S37H 2GTZB 3P9LA 2GK0A 2H32B 1KB9K 3RGVD 2MQ3A 5DHYB 2MPAH 1ZHKB 1R3LA 5IIEB 1ZANL 1UH4A 2UWEA 1MWAB 2MWCA 1Q9KB 5DK2A 4F9PC 3CLFH 3N85H 4QXTB 5JOFB 1A4JB 2R0KH 4XNQA 4PJ5B 2ZSWA 4HCRH 1YN6B 1BEYL 4M5ZH 1RURL 4R6UA 3SDAB 3W9DA 1BQLL 4ZXBD 2ZP0T 1T0PB 2PYEB 1QOKA 4HMDA 3MFFB 1IFHL 1J8HE 4G3YL 1KFAL 1WTGT 1R3HB 4U7MA 4X98B 4HPOL 1NC4A 4IRSC 3AREC 4E0RA 3OL2A 5JIIA 4S2SB 4I0CC 4QT5A 3MXVH 4WVRA 4KY1L 5JIHA 2BXYA 3EJYD 3O11A 5IF0B 5IBUG 4HKZB 4HG4K 4HC1L 3O3DB 1AGBA 4BQCA 1HHIB 3MLWH 1IM9A 4LHUD 4OCXH 4OSUH 4P9HL 3DYPA 5I17B 1TPXC 3BP5B 3ALWA 4YHIB 3SDDB 2APWA 4K7PY 2E7CA 2ZOLA 5I75C 1DUYA 2HLFD 4E5XA 3UTPE 4K94C 3U7WL 2EE3A 1NGQH 2VSDA 4KDWA 2IALB 3C6SB 2DWEA 5C0CB 2HMID 4YZFE 4MDIB 1UACH 2P8LB 4LLDB 4TRPH 2NQCA 3VGEA 1MEXL 2EE6A 1QLRA 3QDGA 4K71C 3VRLE 1A6AB 1VHPA 5IM7B 5JPMB 5T3ZH 4X6CB 3OZ9L 5AUMB 4ELME 1SEBA 3C87A 3MUGB 1OGAB 3LKNB 5KVFH 4IEFB 5EOTA 3V0WH 4H20L 3VWKC 4WTZG 1MCWM 2F9BT 5HI5D 2VABA 4NYLB 3LS4L 3K80A 3QDAA 2Q1EA 3CLEH 4L8BA 3VFMB 2F53D 3S5LA 3ALPA 1W8NA 3VGGA 5IBTH 4RMVA 1JWSB 4XVJH 1R3JB 4BQ6A 3WFCL 3BE1H 3UBXI 3GMRA 4UTAH 5AZEL 2Q8BL 2PO6A 5EU4A 3M1BB 4GAFB 4JFDA 3RIAK 1GIGL 3UC0H 3NIFE 4UOW0 3RWDA 1FYTD 3H0TA 3ARBB 3BESR 4HAGA 5DGRA 1H3WM 3ZDZE 1VGEL 3QUZA 4UINH 1E27A 1AC6A 5KVEH 4YIQA 5SWZB 3WN5B 2Y06H 3MRHB 2QSQA 5JO5B 3DV4A 3L3JA 1G7IA 4HDIA 2ZUQB 1YEGL 2ZOKA 2V5YA 4NJAL 2PUQT 3EDJA 3IFPA 4XP4L 3D0LA 2HVKA 1BP3B 4YFDB 3DUUB 5E8NA 5A1AA 5DYOA 5L88H 4ZO6A 1LO3L 1I8LA 4AEIL 1FNGB 2QEJA 1UH3A 2P7TB 3R0NA 5IW6B 4NKIH 4F3FB 1GPOL 4YDVB 4DEPB 1CWVA 2IPTL 4NRXA 1Z3GH 3V6OC 1ACZA 2H2SC 3VD9A 2FL5A 5CZVH 1IGYA 1WWAX 4G5ZH 3QZWA 2FSEA 4Q58C 4M3JA 5B21A 3PHOB 4XVTL 4AIZA 4NQEA 2GUOA 1INEL 3J7HA 3AB0C 5HHXL 3PGCB 4LOUC 1XH3A 2HH0H 2DD8H 4G9FB 1D5MB 4Y4HB 4ZXBA 4R4BA 1T4KA 4YDIL 3V4VL 5K9QI 2A6KA 3PUCA 3QXDB 5C07B 1B0RA 4UNVA 4YPGB 4HGKC 1D6EA 3TA3C 1WGOA 3KVQA 1F97A 2YS4A 4LDOB 4WHYH 4OF5A 3DROB 3FO9A 4RGMB 3ZO0A 2NW2A 3CGTA 4KK6D 2QR0A 4XVUC 3V7AG 4PRIA 3GMPA 1CG9B 3DYMA 4U1IB 5I8CA 2XKUA 3NPSC 2CRYA 1MCQA 2GCYA 4PJ7A 3O2WH 4EN3C 3D3VB 4OLXH 1ZEAL 4Y4KB 4LEOB 1BQSA 5IB5A 4P5KB 5TE4L 4M6NL 3TO4C 3OKKB 4JJ5A 2GITA 3ULUH 1XR8A 3HAEB 4NNXB 5AWNH 5D1XD 1ZVHA 4Z8FL 1E6OL 2FYYA 1TQCB 5SX5H 5JOPD 3INUH 4HXAL 2KPNA 4EDWL 3EFFA 4L4VA 3VI3E 4U6XA 1CQKA 3VXOA 4HUMB 2RCSH 2XTJE 3K8KA 5FGBC 3ARDC 2H32H 4FQLL 3QEQE 1RQ5A 4WWKB 1J5OL 1JZ6A 2DRUA 4YHYB 3NACL 2APXA 1X5FA 2VERN 2OTUB 2Y07H 3RWIB 2R15A 2A74A 3PGFH 4Y16D 1A02N 3CFCH 1A6VL 3V6ZB 5I1KL 2ILLA 3ROOB 3GNML 1BFOB 3EYOA 3VFUA 4S1SH 2P5WB 3P0VL 4P5MA 4B7LA 3BJ91 2XN9E 1CL7I 4PJ9B 2D3VA 4O5LL 4BUGA 4MXWH 4NO2A 2R4SH 4RIRB 1EZVY 1TCRB 1LP9B 1ONQB 3BIKB 4HBQA 5I71C 5CBAB 1OAUH 4Y2DB 5CD3A 1MSPA 4AEFA 3GGWA 3VXPA 2Y72A 3EJJX 3PGDA 1M7IA 3NCMA 3S3JA 3P0YH 4F37K 4XAWH 4GKSA 1LO0H 2BHZA 3AFLA 4O00A 2F74B 2NY1B 2DQJH 1FFPA 1S7UB 4EVNB 1YEIL 4FQCH 3LKRB 3UTPD 3P77A 5I1EH 5LWYH 2VISA 3D87B 2YRPA 2VN7A 3T77A 2YN3A 3DBXA 2J8UF 3Q0HA 3QQ9C 5KS9B 3NCJH 2C3WA 4XNUH 5D1QA 4M62L 2KZWA 1JGLH 4V2BA 3BMWA 3HB3D 4KH2A 3VWJB 2CJUH 4F8TA 3L3HB 5HGBA 5IMLA 1NDGB 1MF2L 5HY9B 1KCKA 4AQ1B 1EGJL 1CFVL 2IBBA 3FQWB 3QUKB 3TIDA 1J86A 3QUYD 3MR9B 4X5LA 3VFWB 1I8MB 1URLA 1MCDA 5JIPA 3BP6A 1LE9A 4P4KB 1YEHH 2CLVB 2FBJL 5E8PA 2HYMA 1A9BA 1QKZL 5C09D 3L3OB 3PDOB 3QFDB 4PYHA 4ZTPL 5D7SH 1MLBA 5ALCH 4W68A 4OTXH 3RUGA 4ETQB 3UTTA 4N0CD 4PRDB 4HK3J 1V5JA 2R56L 3BPOC 3G6JF 3EYFB 5D7JA 5C0AD 5L0QB 3A6BH 2JJWA 2R2CA 4HPYH 2GEEA 4JVWA 5L2JA 5IOPB 1WBXA 15C8H 2K3TA 1U8IA 3GZKA 3QNXB 1MLCB 4TSBL 3QEGH 1K2DA 1DQDL 1ZTXL 4HS6B 4LLVA 4ALAH 2OXHA 3S34L 3IKCA 3MBED 3P4LA 1F90H 3BYTA 3D39B 1SBSH 2CR6A 3LKQA 1J1OH 1VFBA 3RKDD 4NFBA 4XPFH 3TPUB 5INDB 2BVEA 3BKML 1DLFL 2OI9C 4X5XB 1FZKB 3DUHA 4NHCH 4PP2A 1CD1B 5F88A 3O8XD 5TPWH 5T3XE 1RVFH 4TUJA 3ULUF 2X1PA 3RX7A 1ORSB 4P46B 5DWUH 2A6IB 1XCTB 1IILE 2DKUA 3PP3H 3MLUL 1GZQA 1ZE3C 2YA2A 1OAYL 3BXNB 5BZWB 3NMEA 4FQQB 4QOKE 5SX4I 1YYML 4IMLA 3B4NA 4KVCH 5FCSH 1JWUB 3FB6B 3GSNB 3MACL 2CLRB 4P2OA 1SMOA 4YWGL 3RGVC 1HSBB 5KANG 4NN5C 1ZHBA 1NAMB 1I8KA 5HVHB 5F89B 1KJ3H 4QHLA 2IQ9H 1MCPL 4JKKA 1A6UL 4MVBD 3L5XH 4ZXBC 4RAUB 4Z6AT 1YC8A 2P8MA 4KKNA 1CXEA 4QRRE 4JKPL 5DK3A 4UU9B 1KENL 3GRWL 2Z31A 1N59B 2HFFB 2VDNH 1DQQB 1BFSA 3HG1E 2EDFA 4LBEA 2NY6B 2PXYB 2R0WL 4LQFL 1OSPH 2R29L 2I9TB 4J23A 3EYUH 4GRMB 2VMFA 1AD0A 3EJYC 3LHPL 4NFDA 1W0YT 2MHAB 3FO2A 3TVMD 2YPLA 1MHHA 4IJ3B 4LSVL 3PWPE 3EYSL 1P9MA 4X5WA 1DBMH 4OZGE 3H9ZA 4TSCL 5ANMB 5T5NF 2HVJA 2HLFC 4OB5L 2VAAA 4N0YH 3HAEH 1VENA 3H42L 4XC3L 5GQBA 2HMIC 5F9OL 4NQCA 2YZ1A 1G1CA 5KJRH 4ODVH 2BVPA 1QSFD 2Y7QA 5I1LA 4X6CF 1A2YA 1II4E 5I66B 1ZVYA 5DMKA 2XTJD 4YHNB 3AS3A 2VIRA 3RIFK 1CFSB 4ZUSB 3S3SA 2AV7B 3WHXB 3C08L 1N7ML 1A14L 5E5MB 4JGMA 5HI5C 4OV5A 1JYNA 2MKLC 2ZWLT 3F6LA 4NQUA 4MX7B 3MV7E 5BJTB 2BRRL 1NFIB 1UCTA 3WEXA 3B5HA 3D48R 2G60H 4BZ2L 1CCZA 4JFXB 3WUWA 3MRNB 2V2XA 5IFJB 4BK4A 3MO1B 1T1WB 5C09A 1OSZA 5MENB 4BFBD 3D6GA 5E1AB 3BW9A 4S1RL 1IAIM 5DJ6B 4P59L 5C6TL 3PQYB 5C08E 3FT4B 3C8KA 1ZK9A 5HDOA 3VXSD 3T0XA 1UYWL 4ZUUB 5CEYB 5DRNA 4HUKB 3U0TA 4OKVA 4YHPB 1W72H 5DLML 3S36L 4MCZA 3NCEB 4K55A 2X09A 2QQNH 4OCYH 4PJHE 5D8JL 1HILB 4WO4D 1H0DA 4JO2L 3ZMRA 3NPZB 2WBJD 3WNOA 3KDMA 4KMQA 3DWTA 3IDJB 4PY8I 3RA7H 4NQVB 4LFHG 3FTGA 4NT6B 4CMHC 2FX8H 3TNMB 2BHUA 1XGQB 2H8PB 1H8NA 2PTTA 3SKOB 3ZYIA 1CGSH 3DOSA 4MSWB 4JY4A 2ICEB 2I07A 5FCUL 3W2DL 3OKMA 3DO7B 1OF2A 2QSVA 2AXFA 2BVQB 3KPSD 5E94A 3O45B 1U8MA 4Z95H 1A7BA 3FAWA 4QRPE 2BVOB 3TGXA 5FHBL 1A7OL 3VFVB 5EBLA 5J6HB 1OTTD 3MRKA 2IPKB 4FS0A 3D5OF 1C5DA 2OR8A 4LSTL 1TENA 4QHKI 5DF0A 2J6EL 4JFFE 3UTQA 3T2NL 2CPCA 2Z92B 1B88A 2A73B 2CRIA 5LBSL 3LB6C 1RSFA 1LWRA 1YECL 3UBXB 3VCLB 1M7DB 4IOIA 5KW9L 2D7TH 1SM3L 1YEEL 4L3EA 3OWEA 5E8EA 1E4XH 1OQOA 4MNHB 2HKHH 3FO1A 5AAWA 5EZLA 4GLRH 1PG7H 1YEJL 3BT2H 3HS0A 2VQ1A 4XXCC 4D9RE 1HXMB 3HRZA 3VFGL 3P9LB 1Z0MA 1CVRA 1FPTH 5DO2D 1R3LB 4QXUL 4X7TA 2UWEB 5DK2B 4JLRB 3HI5H 4XNQB 4XWOD 2BFVL 5M7QA 1J10A 2ZSWB 4P5TD 1W0WA 4ZPTB 1X5IA 3ZDXF 2XZZA 4RRPA 4HIHB 4KK6C 2C7UB 4ODWB 2YD8A 2F5BH 5DJDA 2DICA 4LPWA 5EUOF 3F7QA 1NAKL 1OT2A 4F9LA 3MFGB 2O61B 1BPVA 1KBGH 1NC4B 1EEQA 1NPUA 1ZLUH 2EH8L 4MDJA 4E0RB 1OAXH 5FA3A 5D1XC 3P0GB 5J89A 3O11B 5FO9A 4GKOA 4IBLT 2ZCLL 3RX5A 5HJ3B 3LD8C 1P4IL 3GBNH 4IDJL 4KWUA 4QOKD 4P2OC 2XQYG 3VFNA 3GSNH 3OXSB 5ESQB 4FHBD 1JPSH 4PD4J 4E5XB 3MCLH 5I2IA 2ZKHH 2DWEB 4PB0H 5GXBB 2Y5TB 2JJSA 4Y16C 1EERB 5FK9A 1QLRB 3QDGB 1NFDF 2VN4A 2Z31C 2EDTA 4XCYB 3ZHDA 1HWHB 1SEBB 1VACA 1PDKA 3HG1D 5EOTB 4TOYH 2OL3A 2VABB 1MFEL 2A1WL 5CHNA 4FABL 4GMTH 3LN5B 1JHKL 3L5JA 4L8BB 1C08A 3C5ZD 4ZSOE 3S5LB 1KEGH 1FZOA 5DUBA 2P43B 4Z0BH 4F2MA 5CJQL 1I9RH 4M8QA 3WO4C 4NQDA 3JWOL 3L1OL 3PWPD 2ADJA 3JTTA 3NIDE 5TJWK 1A1OA 4HKXB 5D7LD 2PO6B 3H3KA 4OI8A 4JFDB 1PEWA 2DMCA 4ZNEE 2AK4A 4XBGA 2HKFH 5CBEA 3MRLB 4EUPH 3RWDB 1KCVH 3H0TB 2R0ZL 4I3SH 3CIQA 1F8TL 1FNSL 4ETYA 3QUZB 4XPGL 3RDTA 1S7WA 5KS9F 4YIQB 1IMHC 5F7FA 5F9AC 3KJ4B 1NL0H 1MFCH 3Q6FA 4M6OL 5CLTA 5F7KC 3HB3C 5TFSH 1OPGH 2DQDH 4X7SH 4W4OA 2XICA 4OF8A 2FD6L 4MJIE 3IFPB 3D0LB 2OZ4A 2HVKB 5GRJL 4LSRH 3SDXA 3RWHA 2VZTA 5E8NB 5TDPA 1KLUA 1QACA 5DYOB 3UROR 2ERJB 3G5VA 2ADFH 2EDOA 4S1DD 4J6RL 4FQ2L 1MPAL 4GRLB 3IFNH 3Q6GH 4NQXA 4YHZH 3LY6A 4N0CC 1IEAA 3LQZA 1IM3A 2Z8RA 4P2QA 4NRXB 4PRNA 4O58L 4I18A 2FL5B 3KPPB 2UUDK 3CXDH 2IMMA 2VDRL 1IGYB 2KQNA 2J8HA 1EA9C 1JN6A 1CYGA 4CGTA 1TMCB 2VC2H 5JW4R 3R06A 3GSXA 2A9ML 4NQEB 2WUBL 1E4JA 3GKWL 1XH3B 5EU5B 4R4BB 1T4KB 2HWZL 3QXWA 5J11C 2XWTA 1Q0XH 3RKDC 5IFHL 3PV6A 1MFDH 3LKPB 4Q9RL 1CICA 4LLYA 4QRPD 5B38G 1RZFH 3FO9B 5J9PA 3DECA 4HWBA 5SWSE 1WAAF 2NW2B 4XP9H 1QLEH 5IG7A 1RJZA 2QR0B 4PRIB 3GMPB 4U3CA 4ZO7A 5I8CB 4MA3A 4M7KL 3BJLA 2WWKT 5ID1A 2GCYB 2AJSH 1L0QA 4PJ7B 4WFFD 1MIEL 1XF1A 3L9RA 2BDNH 1KC5L 1N3NA 1Q72L 5L2KA 2VLJE 3OKYA 5MHSD 5IB5B 5DDHA 2XY1A 4JJ5B 4LVOB 4EI6A 5B39A 2GITB 1ZWIA 4NUGL 4DKEL 3TT3H 1XR8B 2E6QA 4XRCA 3NCCB 5AYUH 2VUYA 2ITCA 2JB6A 4I8DA 4N5ED 2CGRH 1T22A 4MVBC 3U30C 3EFFB 3SCMD 4L4VB 1WFUA 4U6XB 5JW4Q 2HFTA 4D9RD 2NXZB 4R2GB 5FHAL 3DHJA 1FCGA 3QQ3A 4DN4H 2ORBH 3HR6A 4OZIB 3MV9D 1UWXH 1YMMD 4MQ7A 4MA8H 4ODSL 4ZAKA 5ETUA 2OSLA 3EOAA 5H35A 2A74B 4U4BA 4YE4L 2ICWI 2NX5E 4A2LA 2X4OB 4KTEH 1KN4L 2D4FA 1H3PH 3KXFE 5C0RH 1AGFA 3EYOB 3U6RA 3TVMC 4Y19E 4JHWL 4OLWL 4P5MB 3RWJB 1L7IL 5BO1H 3DGCR 5BRZE 4P9MH 4CDGC 3CH1A 1OCWL 3DO3A 4OIIL 4NO3A 4D9LH 4IOFC 4ZOEA 5D7LA 3EAKA 5HHNA 5CEZL 3DVGA 3NZ8B 1JRHL 5I1HH 3HUJA 3MUHL 5GRZA 5CD3B 1AQDB 3GGWB 3VXPB 4WEBH 3PGDB 5IJVB 1M7IB 2CMRL 3GM0A 4YQXL 3DARA 4GKSB 2XTJC 5F7NC 4UT6H 2EDXA 3E8UL 2BNQA 1FFPB 4U1SA 3BZEB 1BM3H 2ADGA 4NSKA 3RQ3A 4CMHB 4POUB 3P77B 2JJSC 4MAUL 1EJ6A 2VISB 1DQMH 2MJWA 1TJIH 3T77B 5F96L 3DBXB 1P69B 1ROWA 1UCBL 3NCBB 2BVYA 3T09A 2DKSA 4KJQD 5D1QB 4KVNL 5C8JA 4WTZA 2YMXL 3RZCA 3ULVD 5HGBB 5IMLB 1FVCA 1Y0LA 3MRBA 4IM8A 5HDBF 3DXAA 2V2TA 1VEPA 3R0MA 4I5BA 3TIDB 1CR9H 1A0QL 1KPRA 1I9IL 1JPFA 3BP6B 1G7MB 4RBPH 1Z0NA 3HE6D 4U1NB 5I30H 1LE9B 3NIGE 4G6KH 5E8PB 4WO4C 1A9BB 4KAQH 2WBJC 3D18A 1Q1JL 5CUSL 5DRWA 5GHWH 2EDLA 4JE4B 1MLBB 3UTSA 3UTTB 1J87A 1J1XL 1IQDB 4MNQA 3DSNA 2XG5A 3BHBB 3IXAA 5D7JB 4OLVL 2KKQA 3IFOA 3FOMA 3GBMH 4KHTL 4DVRL 1L7TL 1MY5A 5L2JB 1T83C 3QWRA 1U8IB 4L29B 1I7ZA 5BV7C 4X6DA 5CZKA 3HE7A 1K2DB 1TVHA 4LLVB 3SGEH 4HFWB 1IGFH 4JQXC 3IKCB 2NMSA 4J8RA 1HIML 3TBYA 1UA6L 1DBAL 3MV01 2Y36L 3PABA 4HJGA 4D94A 4G80A 2X4UA 1QPPA 3O41A 3C5JA 2VKWA 3LKQB 4LK4A 1OARH 1VFBB 3G6DL 4K3GA 4MJID 1LDPL 4PYGA 3CVHL 2LVCA 1C5CH 3L5WA 3GHEH 2PTUA 2JCCE 4HW6A 4PP2B 5F88B 3HNTL 3TLRA 3L3GA 4MJ4A 4NQTA 4GQ9L 2ZCHH 3G5YA 1GHFH 5FYKD 5EU3A 2FLBT 2X1OA 3BGFC 5IVXA 3BVNA 1FG2A 3LD8B 4LLMB 3SCMA 1J05A 4O02L 1LK3L 4P2OB 4HJ0D 5DO2C 2VR5A 1ZHBB 1ZMYA 1NANI 2AK1L 3I02A 1D5BA 4A6YL 1YMMA 3SKJL 4YX2H 3OF6A 3KPMB 4LVNC 4XWOC 4P5TC 1ZLWH 3MNVA 1FDLH 4QHLB 1RUKH 3O9WB 4JZJA 5F7EH 1A7PL 4I1NB 3MLTA 1BGXH 1U6AL 2BSSA 3GDBA 2Z31B 5LQBH 1A6ZA 4JCLA 1NLBH 4LBEB 5IMOA 4MWFB 2HJKB 3FONB 4I3RL 4GT7A 1A7RH 5SWSD 4Q97A 1AD0B 2QHRH 5L9DH 5IHUH 4MNGA 4FMKA 3FO2B 5IQ7L 5I1GL 2XQYK 2YPLB 5GPRA 1H15A 1LVEA 2LTQC 4PPTA 1WT5C 4GAJH 3MC0A 2VLJD 3I75A 2BJMH 2B0SL 1CXKA 2HVJB 4TSAL 2IBZX 5T5FH 2VAAB 3IDIA 1H3XA 4C4KT 4JAMA 5B3JE 2C3VA 2IGFL 4UAOB 2BRQA 1TFHA 2LABA 2YC1A 2EDKA 4HWEL 4OZ4A 2BVPB 3U4EB 2GSIA 2Y7QB 3OB8A 5I1LB 5C0ND 1A2YB 2YUZA 3ZSSA 4JHZA 5DMKB 3MLXH 4M1GL 5C0BA 1XR9A 3WSQH 3TP4A 1JNNH 1CDBA 3MLZL 2AXHA 2ENSA 5DFWH 4MB5A 2NY0B 1MJJB 3WEXB 3C5ZC 4LSPL 3KXFD 3V52H 3WUWB 4OKDA 1EX0A 2V2XB 2YKLH 4P3CL 4NN6C 1L0YA 2BOBA 4N1CA 1OSZB 4J3WA 1U3HD 2DLIA 2IADA 4KPHH 1J0JA 3BW9B 5TE6H 2FDBP 3STLA 2XZAH 3ZTNL 3C8KB 3A67H 1FNEB 2XZCL 4HUWA 3U0TB 1EXUA 1J9CT 5FGRA 1JVKA 4O51A 1BJ8A 4MCZB 5D1ZA 1QBLL 2JB5L 4XCCH 1H0DB 2XOTA 2F19H 3KDMB 3QHFL 4FZEL 3RHWF 1QQDA 3FTGB 1P7KA 1R5WA 2RIKA 3WS6C 5C7XL 5EH1A 4HEME 4PRHE 2I07B 2P48B 3OKMB 3TBTA 4NN7B 2AXFB 5J11B 5FYKU 3G04A 1F2QA 4Y4FB 5E94B 1U8MB 3L95B 4L4TE 3SHSA 3V6FA 3WFBL 1F42A 3QDHA 4XPHL 4LAJH 2D7PA 2ZJSL 2Z0BA 4S1DC 5HHQB 4LF3A 5EBLB 5EZJA 2V7NA 1CGVA 3MRKB 1JK8A 1CD0A 1V7MH 2IFGA 1C5DB 4H25A 2A0LD 5E8OA 4D3CL 3B9KA 1BZQK 4C55A 5IR1B 1JYXA 1G9NH 2AEQH 3UTQB 1XGRA 3FQXA 4RWHA 5MI0C 5CEZD 2X1QA 4GG6A 4IOIB 4R26H 2GW5A 1UGNA 3HN3A 5KVMC 5FB8A 3C2SA 5E8EB 2WW8A 3C8DA 2E9BA 3KPRB 3Q5TA 5E6ID 5CILH 1CD8A 5EZLB 2LQRA 5I1AA 3CUPA 3HS0B 3U30B 2JE8A 2V5MA 4NUJA 3HRZB 3D69A 4R97C 3CVIH 1GGTA 4X7TB 4Z7WE 1UWEL 4K2UH 3HE7C 2AJUL 3WE6A 3MV11 1E4KA 2VITA 1JP5A 3PV7A 1BZ9A 4K8RD 1W0WB 2X4PA 3RBGA 2HT4D 4QY8B 5D70L 3D2UA 5JHDE 4XP5L 3VG0L 4PJ7F 5DJDB 4UUJA 1PJ9A 5EZOH 2DQGL 5HHMB 2BNRB 3ZL4H 4DK6A 3UJTH 2B4CL 2D7OA 1MHPL 1PD6A 1MCHA 4X99A 4MDJB 1S7QB 4MXVF 5FA3B 2FEEI 1A9EA 3QDMA 4PJDE 2GQHA 4IRJD 4WV1A 5GGRY 4PB9L 5FO9B 4GG8A 4N5EC 1GAFH 3SCMC 1CF8H 4EDXA 4JN2A 3IGAA 1NBVH 3VFNB 1FN4A 3LEVH 3ET9F 5GGTA 4M1CD 5I2IB 3NAAL 5C2BL 1EFQA 4FFYH 4JZJC 5FK9B 4N0FA 5JXAL 5KZCD 3U1SH 2XZQL 3MXWL 5F44A 4OGXH 4K3HA 4DW2H 1IGIL 5C1MB 4OQTL 1NBQA 4HMEA 3LMJL 4KJYA 3REWA 4RFOH 2AJVL 1ZSDA 4F15C 1T21A 4ORZC 2W0KA 3IU3A 2OL3B 1HKLL 1X5KA 2IANA 5CHNB 4GW4B 1SY6A 4UILL 3WLWC 3IFLL 1D9KA 2E6JA 3DIFB 5E2UL 1C08B 2F8OA 1FZOB 5DUBB 2C5DC 4F2MB 3BQUA 4MQSB 4NQDB 3MROA 1CLYH 2ADJB 3K2UH 2BERA 1OW0A 3GI9H 2DLGA 3G9AB 5FYJD 5BS0A 4F7CA 5BOZG 3FN0H 2Z8SA 2AK4B 2W9EH 4XBGB 3ZKNC 1B0GB 5CBEB 4JDTL 3CFEB 1A3RH 4JO4H 4QRQB 4PRPE 2E7BA 1MNUH 1Q9LB 1FV1A 3W39A 3WKML 4UOJA 1EEUA 3M8OH 2A6JA 3B2UD 1UJTA 4JANA 4LVHB 3RDTB 1S7WB 2A77L 4ZFGH 3U7AA 1SJEA 3WHE1 5BV7B 4KJQC 2R69H 3Q6FB 1IAII 1R24A 3QUXA 5LGHH 4MZ3A 4Y5XC 2ICWB 3QWOA 3ULVC 3KLDA 4N9OB 1SVCP 5GJTH 5I1CH 3QXTA 4JM2A 2AABL 3SDXB 4GUPA 3RWHB 5K9KB 5TDPB 1F13A 1KLUB 2RJMA 3EDEA 3G5VB 3DMMD 3SGJA 1OAQH 1JJUA 1S3KH 3IDXH 3S37L 1EBAA 4NQXB 1GGBL 3RUGF 2G2RA 5J6GA 2W59A 2MPAL 4ZTOH 3V9FA 3LQZB 1IM3B 3MZGB 4CVXA 4PRNB 4I18B 3CLFL 3N85L 4LU5H 5E1HB 2R0KL 5BVPL 4HCRL 2VZOA 4GO6B 3T1WA 4M5ZL 4EKXA 3TJEL 3BZ4B 1JN6B 1LE5A 2NY3B 5EC1B 5KANI 3BGMA 3R06B 2V7HA 5A2LH 4ODTL 5ESVA 1S8DA 3GSXB 1FVEA 1HN1A 5DD5H 4F7PA 2JKXA 4UT9H 5EU6E 3R1GH 4XNYH 1Y6KR 3QEUA 2F8VA 4JFEE 5MP6H 2XWTB 5GS3A 1IT9H 4I2XA 3PV6B 3MXVL 4TVSa 1HQRA 1CICB 2DIAA 4ZYKB 3SDYH 4LLYB 1UXSA 3LDBC 3OKDA 5J9PB 5FYLH 3S37X 5ENWA 1I85A 4OCXL 4OSUL 3B9KC 2UZYB 1VESA 3L6FA 1RZKC 1NMAH 5ID1B 5FFLA 2EEBA 1S9WA 1G7HB 2WUCH 4WDIA 1CLOL 4U1GB 1OVZA 1NGQL 2DQFA 3ECBA 4GFTB 3L9RB 3VXUB 5HYQB 4RGNE 1G84A 1N3NB 1UACL 5L2KB 4TRPL 4HJ0C 5I8KH 1HCFX 2AJXH 1ZWIB 2R39A 2VXVH 5CJXC 1FORH 2EO1A 3UP1A 4XAKE 4XRCB 4Y1AE 2A6DA 2JB6B 5L6YH 1T22B 2C4FU 5KVFL 1KCUH 4TQEH 3QPQD 4EXPX 1VKXA 5D6CA 1UXWA 3QNYA 3VFRA 3QQ3B 3CLEL 3OKNA 2K7PA 1DFBH 1E4KC 3PL6A 5D2NA 4ZAKB 5ETUB 5IBTL 2EDNA 4FOMA 4RDQF 2OSLB 3EOAB 4RFNC 4U49A 5H35B 3C9NA 5DJCA 4XVJL 1XGPA 4F57H 3A0OA 4L1DA 2BZDA 5IB2A 3BE1L 2O93L 4UTAL 1ES0B 3H9HA 3JV6A 4L3CA 1S7XA 1AGFB 5DURB 5FM5O 3U6RB 1WCBB 3UC0L 2NTFA 3O4LE 1WFOA 2CO6B 2XWJA 3MZTA 4DTGH 3PG2A 3CH1B 1ADQH 4NO3B 1D5XB 1FFRA 4PGCA 4U6HA 4UINL 5HHNB 4S11A 5KVEL 5FKAA 1A21A 5IBUB 5J06A 3CSBA 3IDYC 1DZBA 4AK1A 2EXYC 5JNYA 1U3YA 3GI8H 4WNQA 1U8OA 4XNMA 2Y06L 4LKCA 1MCEA 1J8HA 2Q87A 3LEYH 5C0NC 5JW4N 1YQVH 3WJJA 2AEWA 2BNQB 1VA9A 3LN9A 4I0PD 4U1SB 1AI1H 2ADGB 4NSKB 1CTNA 1GGYA 4PD4K 1ZA3A 2DQCH 5L88L 3DX9A 4AT6A 2R8SL 2NY4B 4NKIL 1DUZA 3ZTJG 4JRWA 1MRCH 1HQ4A 1KPUB 1Z3GL 4WW1A 5C8JB 4JRXE 3V95A 3RZCB 1RZ7H 1N5AA 2WANA 5J0BA 1NBZA 3U9PH 5E03A 4CNIA 1T6WA 5FO7A 5CZVL 1Z9LA 1Y0LB 4G5ZL 4U1MA 5DD3H 3DXAB 2V2TB 3VRIA 1HHJA 2BSRA 4I5BB 2P44B 1KPRB 3QUMA 1JPFB 5DJ8A 3GJFB 5KN5A 4HQQH 3AM8A 5KSAB 4P23A 2HH0L 2DD8L 5C0IA 4HULB 4NRZA 3D18B 2YPVL 1RFDH 3UCRA 3VH8G 2F54D 3F7YA 3UTSB 3O6KH 1WFTA 5CEXA 3VW3H 1MCCA 4MNQB 3U83A 4QO1A 5A3ID 3IXAB 3RIAF 5E08H 3DX6A 3IFOB 2J8UE 3VXRB 1RZIA 3VE0A 2BVTA 4XVSH 4DOHB 1I7ZB 4GW1A 1CD9B 3QEHA 4X6DB 1JYVA 3HE7B 1EO5A 5D71H 5BV7H 1FLTX 3O2WL 1JI1A 1TVHB 2AEPH 3FJTA 3OSKA 3QUXC 4LASH 2XI9A 2H26B 4J8RB 4Q7DA 1KB5A 1VDGA 5IGXH 4LCUA 4ZUTA 2FJGA 5BZDB 2A0LC 1G6RA 4HJGB 4JM2C 4G80B 1WVZA 4U2ZA 4J12A 3O41B 3C5JB 4RMTA 1AKJA 3IS0X 4N8PA 2OZ4H 1EPFA 3UPRA 4YXKH 4FG6D 3H9YA 1X5YA 1YC7A 3INUL 1JGDA 3L5WB 1NCNA 3BN9D 3SGJC 5EDXA 3RY6A 1AJ7H 1XIWD 4OZFG 3L3GB 4Z7UE 2RCSL 3MRQA 3G5YB 5E6IC 1GGIH 2DMKA 1X5LA 5JHLH 5IBLC 5EU3B 3BVNB 3G6JE 3QG7H 1FG2B 5DMJB 3AAZA 2O5XH 1FCCA 1J05B 2RHEA 4UZGA 3SKNA 2Y07L 3PGFL 2BMKA 3CFCL 1CE1H 3WNLA 3KYOB 2VZVA 3SDCD 1LO2H 3I02B 1D5BB 2I5YH 4S1SL 3FQTA 3DX8A 4K8RC 4YGVA 3MNVB 2HT4C 5I6XC 2DYPA 3FQRA 4CMMA 4JZJB 5EU6D 2MCPL 2PTVA 1QNZH 3MLTB 4MXWL 2BSSB 2R4SL 1RJLA 3T08A 4JFED 1QRKA 3AU1A 1X6NA 4XMPH 5EIVA 5B38A 2X9XA 1YYLH 4K9EH 3L7FA 3CU7A 4KRMB 1MI5E 3WIIH 1FL5A 1IZJA 1WIUA 3P0YL 3V4UH 4HWBH 3NZHH 4XAWL 1RZ8A 4OI7A 4POZD 1LO0L 4QF1A 3KNBA 4PLNC 4MNGB 2AERT 3MOQA 2DQJL 2FHFA 4HS3A 4KJPD 1F5WA 4NKQB 2AP2A 4LIQH 5AZ2H 5I1EL 5LWYL 5M95B 2BC4A 3U0PA 5I8OH 4PV9A 5EBWA 5INCA 1JGVH 1I1FB 4PJ5E 4D0CA 3IDIB 5EOQH 4M1CC 4XNUL 3CNKA 4JAMB 4YBLC 2C3VB 1U8JA 4HT1H 1JGLL 4YHKH 2CJUL 3F7PC 2YC1B 4K3DH 1X5GA 2M8XA 2OMNA 4OZ4B 3H9SE 3F7RA 4LVEA 5F7YC 2VLKD 3M17A 1N26A 4PJCA 1ZGLM 1G9MH 1E0OB 4PG2A 3WFDH 4LDLB 1MY7A 4M3KB 4RA0C 1XR9B 2CK0H 35C8H 5D2NC 1N6VA 1YEHL 1C1EH 2L7UA 2NY7H 4JN1H 1JF5A 5M94B 2W60B 5D7SL 4OTXL 4J3TA 4NM4H 4ZUVA 5JDJA 5DMYA 4CVWA 3O4LD 4C57C 2BOBB 3A6BL 4HPYL 2IADB 4XNZC 1RUQH 3IAGC 3C2AH 1QR4A 3STLB 15C8L 5IFAH 4XCEB 1FAIH 4Z76B 4HUWB 3T0AA 3QEGL 3ZE2F 4OCLC 4ALAL 4YDJA 5D1ZB 5T3ZD 1FLRH 1F90L 3CK0H 3B2UC 4X6CE 5JXED 4XB8A 1SBSL 4F37F 1Z9SA 3UTOA 1QQDB 2YEZA 4U0RC 4EXKA 2NTSP 1T03H 3WJJC 1J1OL 3WV0A 3RPIA 1P7KB 2QJDA 4XPFL 1R5WB 5CWSB 4L8CA 1TITA 3G5XA 5AG8A 2J3SA 4NHCL 1RPQA 4KKBC 5TPWL 1MAMH 1RVFL 1D7FA 5DT1L 5F9WB 4ONHA 4M61A 4H8WC 4K3EH 3TM6A 3GMNA 3G04B 1UM5H 1YA5A 1Q94B 3V6FB 2JIXD 1CLZL 1OWWA 4N90D 1PZUB 1N8ZB 3DMMC 2VUOA 4JG0H 1XIWA 5EZJB 2V7NB 2FR4A 1F4XH 3EO9H 1JK8B 2WP3T 3T0EB 4KVCL 3EZJB 4H25B 5E8OB 3B9KB 5CKGA 2VXQH 2NZ9D 1XGRB 1BJ1H 4JY6A 3GBLA 3AM8C 3RJQB 1M7XA 2IQ9L 3WFEH 5D6DA 4GG6B 3L5XL 5FB8B 1RHFA 2W92A 2VDNL 4OZHF 4JPVH 1WCQA 4WW2C 4C83A 5I1AB 3CUPB 4D2NA 1D5IL 2VZSA 2DM3A 4NUJB 4HZLA 2VOTA 2W9LA 3D69B 2D7MA 3DI3B 2P24B 1QFWH 1OSPL 5TGBA 4PJIA 4PY8J 3BAEH 3EYUL 5D5ME 3W0WB 1ED3A 1F4WL 1YQ2A 4X7EC 3WE6B 2ZNXA 4G8GB 1BZ9B 4RSVA 5C6PB 5F6IB 1GOFA 2X4PB 4UT7L 3MCG1 1WBZB 1DN2A 3D2UB 4GRWH 4LCCC 3F7VB 4PS4H 2VZ1A 3U4BH 4JREC 4JO3H 1U41A 1ZLVK 3RTQA 4N0YL 5J13C 5IHZB 2C3HA 3RY6C 2FZ3A 5KJRL 5DJAA 4XBEH 4QHKJ 4XCNB 2RQ8A 4HGMA 1A9EB 3QDMB 4PTTA 4LCWA 2NYYD 4ONOA 1DBKH 2PR4H 4WV1B 5FGCB 3ES6A 4GG8B 2DJSA 4UNTA 1CN4A 4NWUH 3OGOE 5DR5H 3WIHL 3T0WA 1KTLB 1MFNA 4EDXB 4XNXH 1OB1B 1FSKC 2WIMA 4GBXA 3W82A 5J3HD 1EGJA 3IGAB 4MLSA 3ZE1F 5LGKA 2VLKA 1FN4B 5DMIH 4M03A 5C0DB 3TH2T 1ND0A 1NKRA 1OP3K 2DWDA 4S1QH 1UB5A 4HGWB 4J4PA 3TN0D 5GS2D 1WUNT 4HMCA 5KSBF 2CRZA 1KTRL 3MLRH 4C56E 1F3JA 1QRNE 5EUOE 4KJYB 4XP6L 3REWB 5BW7A 4OCMC 5F1SA 1ZSDB 4KV5F 3WLBA 1T21B 1W72L 2AEIT 3JVGA 3IU3B 3TF7C 3UTZA 4CADA 5CSGA 4O2FA 3ULUD 4OCYL 4WI4A 1MCRA 3TIEB 4Q6IC 1MAKA 2IANB 1JZ4A 5FUCE 3OJVC 2ED8A 3RWFA 3HUJF 1D9KB 3V5DA 3RA7L 3STBA 4QRRA 3BQUB 4QRUA 3MROB 1Q9OA 4UTBL 1CGSL 4ODHH 2MFNA 5ISZE 1HXYA 4CJ0A 4I0PC 4E41E 5BS0B 1CDYA 1LILA 2CSPA 4Z95L 4LARH 4F7CB 2B1HH 4PJ5D 1Y6NR 2F53B 4APQA 4ZNCD 2P5EE 4G42A 3SDAD 1FV1B 3W39B 5IWLC 1NFDE 2PYED 2P5WE 2A6JB 4JANB 2ESVB 4HXBH 4JZOA 1SJEB 3ROLA 2C4FT 4PG2C 3RIFF 3TH4T 1R24B 3QUXB 5B4MD 3RWEB 3VGHA 3SQBA 1XFPA 3QWOB 1ZT7A 2IAMA 5I9QB 4ZODA 4X6EA 2D7TL 3P30L 1IEHA 4KDTA 1E4XL 3SY0A 2AV1A 4GUPB 3MV8B 4J3VA 5GGSY 2HKHL 3RAJH 2YRZA 5AAMA 1PG7L 3BT2L 3QR2A 1C5BH 5L8KB 3SDDD 5J6GB 1FPTL 5EORH 1P7QD 4NGHH 4XPBH 3L3IA 1AC0A 3FKUS 3MV7A 4M93C 5C0CD 4K07A 2VYRE 4QKXB 3NA9H 4CVXB 2IBZY 3HI5L 1JZ8A 3E2HC 4N5UA 4LCIH 2Q3ZA 3BGMB 5IHLB 2V7HB 5ESVB 1S8DB 2F5BL 1OGAD 1FVEB 2E7LC 4F7PB 4FFWD 2FX7H 5C08A 3BKYH 3MGTB 3LQMA 5I6XB 3BO8A 4GRWF 1KBGL 2W07A 2ID5A 3DGGA 5D96C 2WNGA 2YPKA 1OAXL 4JHAH 1AY1H 4I2XB 1OD7A 4FG6C 1HQRB 1BVLA 1PG7X 3ZKMD 3BN9C 1UXSB 1OWRM 4OFYA 4CVUA 3OKDB 1XIWC 4OGYH 3GBNL 4MCYB 5ENWB 4JFPB 3HMWH 5T1KA 2RB8A 3GSNL 1I3GH 4EBQH 3G5ZA 1NCTA 5IVXF 1JPSL 3A6CH 2PYFA 4WDIB 3MCLL 3IJSA 3ARBD 2DQFB 3ECBB 1SEQH 4M7LH 2ZKHL 5GJSL 4PJFA 4PB0L 3SJVE 4IHOB 3V0AC 3IDNA 3T4AB 2O5YH 5SWZD 2V5SA 4M7ZC 4WUUE 3SDCC 4ZMAT 1FL3A 2K7QA 3EHBD 1LMKA 2L0DA 2A6DB 1EFXB 2EYTB 4JFFA 5DHVA 4TOYL 3VI4F 4AYFA 3PF2A 1VKXB 1OD9A 4HK0A 5D6CB 1TTUA 5C0EA 4ACPA 1UXWB 2UUDH 3BPLB 3QNYB 2GFBA 3VFRB 5FAAA 4GMTL 3OKNB 1KEGL 5HHOA 4HUVA 4FA8A 3WFHA 5A43C 2DQIH 3PL6B 4Z0BL 3RX8A 1RUAH 3SN6N 1I9RL 1WAAE 1KCLA 3TO2A 3C9NB 5DJCB 1MCNA 1XGPB 4POZC 5IB2B 3H9HB 1F58L 3JV6B 1S7XB 3CAFA 1IC1A 4L3CB 2Q7NA 3RTQC 4LPYA 4KJPC 2NTFB 3RBSA 3L7EA 2HKFL 2XWJB 2QV2A 1KCVL 4I3SL 4WI8A 2B39A 5IIEA 4PGCB 4U6HB 5EO0A 2E3VA 1Q9KA 5FKAB 1FO0B 4MXQD 4QXTA 1IE5A 2E7MA 1NL0L 1MFCL 1YN6A 5JNYB 4G9FD 2Z9TA 4Y4HD 1N5YH 1U8OB 5TFSL 2DJ4A 1OPGL 2DQDL 1J8HB 4X7SL 5C07D 4MS8D 2EH7H 1O7SA 1J1PH 2J6EA 4OF0A 3Q1SH 5GGTH 2Z8WC 3SQOH 1R3HA 2XIDA 4LSRL 3LSOA 4OBRA 1RULH 4QTIH 4FTVE 4FXGA 2XV6B 4HIIA 5EC2A 1BOGA 2ADFL 4NZRH 4AT6B 2F8XC 4DKDC 5F9DC 1AHWB 3IFNL 3Q6GL 1DUZB 1RUMH 5CIPB 3VXTA 3D3VD 4YHZL 3O3DA 1HQ4B 4Y4KD 3PHQA 4WW1B 3AS1A 3VFPA 1QSEA 2XRAH 1N5AB 2ICWJ 3UZEA 3EOBB 4HUXA 2M1KA 5DQJA 3V7MA 4CNIB 1IL1A 2BY2A 1CBVH 1HHJB 1A8JH 1CLCA 1SY6H 3C6SA 1WWWX 4LLDA 5DJ8B 4JPWH 2EDJA 4P23B 4ELMB 5IM7A 1MFBH 3PP4H 3T1FA 5JXEC 3NBNA 4NRZB 4WWKD 4TN9A 1Q0XL 1NMCC 3F7YB 3EOYG 4RMRA 5EB9A 1OGAA 5CEXB 4X0KA 2QADB 5EULV 1ITCA 4NYLA 1U8QA 1RZFL 1OAKH 4UV7H 3WCYA 1BVZA 1TNMA 4D0DA 2E8ZA 1RZIB 3FN3A 4XP9L 1QLEL 3VE0B 5GS0C 2P5WD 3JXAA 3FFCA 3S35H 4GW1B 3QEHB 4U7SA 2AJSL 1JWSA 1FYHB 4PJ9D 1KJ2A 4H88H 3KPNB 3GK8H 2BDNL 1KB5B 2DQTH 4LCUB 2Z35B 2IAMC 5HDBE 1NBYA 3HPLA 3V6OE 3TT3L 4Y2DD 1AKJB 2EKJA 3UPRB 3ARBA 2AQ2A 1V7NH 2NZ9C 2YXMA 3QFJA 4XMLH 2RAMA 3WMSA 5AYUL 1VPOH 4GG6F 4G43A 2CGRL 5DD1H 3MBEB 5SWZA 3VXME 1KF9B 1XEDA 3CXHJ 2NY1D 3MRQB 4RFEA 5JUEH 4M8VA 1XF3B 4DN4L 2ORBL 2OS7A 4MA8L 3ZDYF 3AAZB 3E6HA 2DIJA 4U0QB 3X13A 3SKNB 3B6SA 1JV5A 2A9NH 1N64L 2CKBA 5C0RL 1H3PL 2CDGA 1UB6A 5F70A 5JW5A 3FQTB 3VWJD 3DX8B 5GGQH 1FNGA 4YGVB 5IW6A 5BO1L 5GRVK 2DYPB 3FQRB 4P9ML 4CMMB 1S9XA 4D9LL 1CDHA 1RJLB 3CDCA 3AU1B 4MJ6A 5LAXA 1I75A 4P4KD 5I1HL 2C1PA 4UIKL 4WHYG 4WEBL 1FL5B 3QCVH 4PJ8A 2ARJA 1U42A 4DVBA 1F3DJ 5JDSA 1RZ8B 2EDWA 3VD5A 5F8RC 3TJHD 3S9DB 4QF1B 3KNBB 1NMBH 4UT6L 1NC2A 4HKJA 4M1DL 1P4LB 1BAFH 4G7VH 4G9FA 4HS3B 1BM3L 4OLEA 2VLRE 5FUZH 3WHE0 1LO4H 3MOBH 2CRMA 1DQML 5J3HC 1A1MB 4XH2A 1TJIL 3H7BA 3U0PB 2EKSA 2HFGH 4PV9B 5EBWB 5INCB 4Y88A 4XP1H 1NUGA 4D0CB 3I3BA 3X11A 1DVFA 3IYLW 5KOMC 3TN0C 1U8JB 4X4MA 1KTKE 3D39D 2QQQA 2CH8A 1RIHH 5T1DL 2FECL 3RNQA 3MNZA 1GYAA 3M17B 1DR9A 3KHQA 5GGUA 3AGVA 4H5SA 1CR9L 4ZPVA 4G8FA 4HWUA 4P5KA 5I30L 5EO1A 1IAOB 3ULUC 4G6KL 5DQ9A 3VJ6A 4LEXH 4P46D 3GJEA 4KAQL 4NNXA 5ACLA 4PGZA 3T04D 4MD4A 5E2VH 4OI9A 3NFPA 5GHWL 5GISL 5HYJA 4DCQA 1QD0A 1AO7E 3QEQB 2B20A 1H3UA 1HYRC 1ZT1A 2HN7A 3QDJA 1FL6A 3BP7A 4FQJH 3GBML 2UZIH 4KROB 3KLAB 1ZAGA 5HD8D 5FYJH 4WU7A 1FGNH 2NX5A 1LHZA 2AJ3A 3MJ7A 4TPRH 3N1MC 1NCCH 3SDAC 4OCWH 1IGFL 1CFQA 1BHGA 1A5FH 2P8PB 2XN9B 4PJGE 1CI5A 1CBVL 4YK4B 1I7RA 1OARL 2X1WL 3RPIB 1H8OA 4HK3N 4ZFZB 5T5NG 4HLZG 2FJHA 1FP5A 2NY6D 2DBJA 2PXYD 3G5XB 1C5CL 3GHEL 4NHUB 1U8LA 3CD4A 4NC0B 4JM2F 5DMGC 4OFVA 3OKLA 1GH7A 5IJKC 3LS5H 2ZCHL 4JQIH 1X44A 3GMNB 4H8WH 4FZ8H 4XMKH 2QSCH 1I7UA 1KCSH 3TT1H 3MGAA 1DTUA 3CSPA 2FR4B 4L1HA 3X3FH 1NLDH 2Y4SA 3SDDC 4JFDE 4N8VG 1IRAY 3K8LA 3EDKA 4J3OC 5DJ2A 1ZANH 5F72S 2X89A 3O3EA 3OR7A 3QUMH 4YX2L 1ZGLA 4JY6B 1V3LA 1FDLL 4NKDA 2PETA 4CU8A 5F7EL 4XC1H 2B8OT 4YBHA 3VH8A 4H1LG 1IGTA 1BGXL 3JBG7 1ZVSA 2YA0A 1D5ZA 5LQBL 4FFWC 4G3YH 4X7FC 2EC9U 1NLBL 5EWIH 12E8H 4KGJA 5DTFA 3QUKA 3MA7A 3O2VH 5TGBB 3B9VA 4PJIB 5EN2A 5MEPB 2VRAA 2ZUTA 2P1YA 3OXRA 1UH2A 5C2UB 2XA3A 2QHRL 1ED3B 5L9DL 5IHUL 2JK5A 4WHTA 3ZKMC 2RFXA 5MEND 4JO1H 5TQ0H 1KB5H 4ETQA 5KTEH 1IGCH 4GAJL 1JL8A 2ATKB 3S98A 3PQYD 1G6RH 4PRDA 1RZGA 2BJML 2GHWB 3TYFA 5T5FL 3RTQB 4LP4A 2H2SD 5DEFA 3ARBC 1BBDL 4PJBE 3UYRH 1NGWA 4WGVB 4J3XA 5JA9A 4KI5C 1FZJA 1MEXH 1QFPA 2FZ3B 3QJFA 1NCWH 4EI5A 5IK3A 3WN5C 3CDYA 1CGTA 2W1NA 3WXVH 3EHBC 1T04A 3BGAA 4PTTB 3MLXL 43CAA 2CDFA 3ES6B 2WQRA 3I3DA 3IETB 3WSQL 2ZUQC 2GI7A 1JNNL 3K7UA 3BKCH 3UAJD 2J5LB 4GBXB 3GSUB 3VRJB 3LKSB 5DD6A 2JCCA 1J11A 3DURB 3DRQA 1ND0B 3KS0J 3V52L 2DWDB 1MREH 3O4OB 3X3GH 1UB5B 4AL8H 3RPKA 4PRIE 1ORSA 3MLYH 2A6IA 3K4AA 1MCBA 4CW1B 1DANU 1XCTA 5TDOA 3WFCH 3T65B 4DEPC 4NDMA 3BI9X 4PJ7E 5AZEH 5GZNC 4KPHL 4RGOH 4LQ1A 5TE6L 1F3JB 2QHLA 1U8KB 2XZAL 4FQQA 4IOSD 2Y23A 3C6LA 3A67L 3JWDC 4UV4L 3WLBB 3MA9H 1T5XB 3BZFB 3BSZH 2GJJA 1JWUA 3VA2C 3UTZB 4IDLA 4Z7OF 1NAMA 4XCCL 3E3QC 1K4DB 1KELL 2F19L 2X42A 3V5DB 1MVFA 3GMLA 4X6BA 1SJHB 1JF1A 4QRRB 4CN1A 4L4VE 4Y4HC 4QRUB 5IEKA 4P2RA 1Q9OB 4LRNL 4JG1H 4MS8C 3LH2L 3C60A 3KWWB 1T20A 2QKIA 2HFFA 4BM7A 1HXYB 2GJ6A 1NMCB 3IJYA 1O7VA 4L8DA 4KK9D 4RGMC 3UJJH 1DVFC 4APQB 2R0LH 4G42B 1IZKA 1NSNH 4GQPH 5I16B 4AEHH 8CGTA 5IP4A 4GRMA 3PWPB 1V7ML 4BSVB 3UDWA 2MHAA 2E27H 1BLNA 2H3NA 4JZOB 4PFEA 3ROLB 1JRHI 1G9NL 1J88A 4Y4KC 2VZ3A 1NGXB 2AEQL 1CZ8H 5GSVB 1NC4D 1BF8A 3AVEA 4HIXH 3DHMA 5EIIA 2YD4A 5ANMA 1ZT7B 2IAMB 4E9LA 4X6EB 4R26L 3V0VA 5FUCC 3TBSA 1FYTE 1TQCC 3SY0B 4A6YA 4DQOH 5CILL 4YLQT 4DWHA 1JMXA 4L9LA 3LRHA 2LV4A 1HHHB 1BVKA 1M1SA 5CCKH 4WWKC 2DL2A 2X2YA 3CVIL 5BCAA 2VSCA 3WJLA 4EEEA 3SOBH 1TZGH 2K9UA 3MV7B 4K2UL 4OCSH 1YNTA 4S0SD 3ZZ1A 4D9QD 1HKFA 3QDGD 4RX4A 4AM0A 1TETL 5DUMH 1DQLH 3U46A 5MEQA 1KOAA 5EZOL 3HZYA 3ZL4L 4PJ9C 4DGIH 1TLKA 4BFGA 3UJTL 1CS6A 5C08B 5E1AA 1XMWA 3BO8B 2EDQA 3MRJA 5TE4H 3DGGB 4IRZH 3IU4H 2YPKB 3FT4A 1T0MA 4QXGH 3ZDZF 4PJHB 4Y2DC 3OV6A 1F4AA 1BVLB 4JQVA 3BPCA 5DVLA 1GAFL 3MX0A 4G6FB 4KQ4H 1CF8L 2WAHA 4U1HB 3RUGE 2PO6D 4YXLH 4JFDD 2F15A 5T1KB 1NBVL 4PRHA 4QTHA 3G5ZB 3TNMA 2UY7A 2PYFB 5J1SC 5FOJA 3IJSB 5E2JA 4J7RA 3ZT5A 4PJFB 2QTEA 1T89C 4FFYL 4L4TA 4AZ8A 3QUZD 1U0QA 2BVQA 2JJUA 1Y18A 2NY5H 2PW2A 2UYLA 1K8IB 1YDPA 5DRXA 3U1SL 4OGXL 1U8NB 4BFEA 1EMTL 3EW3B 1FL3B 5EOCJ 1PQZA 4DW2L 4ODUA 3VWJC 5F3HA 4RFOL 1GJIA 3MMEA 3PE9A 4JFFB 5DHVB 3KGRA 1R3KA 4HK0B 4HH9B 2Z92A 2GFBB 4P4KC 2PF6A 5HHOB 4HUVB 4ONGH 1M7DA 4GRLD 4BYHA 4PLJD 3SE4A 1CLYL 4DKAA 4MMZC 3K2UL 3TO2B 4MNHA 5JW3H 3TJHC 5F1KC 3GI9L 4G8EA 3SGDI 4PTUB 1NCUA 3T8XB 1UZ6F 4F7MA 3FN0L 5L0QC 2W9EL 3L7EB 3LVEA 4Z7WA 4JO4L 4UI2A 2P42B 1MNUL 4Q9CA 5EO0B 4KTDH 1GZPA 3M8OL 4NQED 4AIOA 4JLRA 3BISA 1TVDA 4ZFGL 4ZPTA 5JHDA 4M62H 2XPGA 4HIHA 1KT2A 2C7UA 4ODWA 5LGHL 4DGYH 1JZ3A 1FZMA 5I0DA 1RU9L 1MF2H 5GJTL 5I1CL 4PJCF 1HHKA 1EGJH 4HX1A 5IVOA 4H0HB 1AH1A 5T3XH 2O61A 3LSOB 4FXGB 1PY9A 4HIIB 5EC2B 1BOGB 4P46C 4PRID 1OAQL 1S3KL 4R8WH 1VFAA 3IDXL 1S9KC 3VXTB 2EC8A 1P5UA 1YJDC 4ZTOL 5HJ3A 4FQXB 3DVNA 4BH8A 3PHQB 3VFPB 1QSEB 2H1PH 1ZHNA 4HUXB 1X5HA 3OXSA 5DQJB 5ESQA 3V6BR 4Y8AA 1IL1B 4PGEA 4PUBH 2DQUH 5HD8C 5IMMB 4LKXB 1G7PA 5HVHC 4NQCE 4HV8A 1DSFH 2Y5TA 5DK0B 4MAYB 5DD5L 4L4VD 2P47B 2GSGA 1XGTA 1R3IH 5ACZB 4Y7MA 4UT9L 3MBXH 2NXZD 1OM3H 4R2GD 3T1FB 3R1GL 5FDYA 4XNYL 1ZOXA 1I1AA 5MP6L 4M5YH 3RVVD 4OM1H 4XCYA 1IT9L 1Y6MR 4WRLA 1T1ZA 4XX1G 2NY6C 2PXYC 4X0KB 1FHGA 3LZFH 3HZKB 1DLFH 1WWCA 3SDYL 4EUPG 1XZ0A 1U8QB 4ZSOB 1MUJB 3HE6B 1YNKH 3BPNB 3EUUA 4TNVK 4LNRA 4D0DB 3LN5A 3N1PC 4YC2C 3UDWC 3QHTC 4I0KA 3AS0A 5GS0H 1ZS8B 3FFCB 4IJ3C 1NMAL 2IQAA 1OAYH 3Q3GB 2CIKA 2WUCL 5C09E 5FDWA 5KAQG 1CXLA 1KJ2B 2I9LA 2APTA 1P53A 2CXGA 4HKXA 1NBYB 3DJ9A 3PXJA 4YWGH 4DAGH 4PRPA 5I8KL 3HPLB 3RVWD 3MRLA 2DI9A 1FORL 5C0AE 2C26A 3CC5B 4JDZA 4KC3B 3QIBA 3QFJB 3HKFA 1KYOJ 3H3PH 4G43B 3ARGA 5L6YL 1G9EA 2X7LA 3O0RH 1KCUL 1L0XA 4TQEL 5H37G 5IV2A 3K46A 3ZYOA 1G7JA 2RGSA 4RFEB 2I60H 3WJLC 4Q9QH 2VL4A 2DIBA 2FEDD 3S6CA 2NXYB 5T1MA 5FKPA 3HFMH 3E6HB 3X13B 4R4FH 3B6SB 1JV5B 4PJIF 5I73B 2R29H 4F57L 4FQIH 2CKBB 2CDGB 4X7CC 5D1QD 3I6LD 1UB6B 1MCWW 2IH3A 3RFZC 2IWGA 3QI9A 5JW5B 1FJ1A 4GRLA 4NJ9H 5DSCA 3P2TA 4DTGL 3TCLA 1NUFA 1CGXA 2Z93A 1ADQL 1CDJA 1XGYL 1S9XB 5MEOA 2VDPH 4WHCA 1IGJA 4M6AA 4MJ6B 3KPPA 5LAXB 3UYPA 2C1PB 3LB6D 3GI8L 4L3EE 4ZD3L 3OB0K 1QBML 4PJ8B 2ARJB 4DVBB 5JDSB 3LEYL 3UTTD 3BWAB 1J12A 2ADIA 1YQVL 1NC2B 4HKJB 1AI1L 1H5BA 5D7JD 3LN4A 5EU5A 1JNLH 3UAJC 4AEEA 5IT2H 2HFEA 2JJVA 4PJEF 4XH2B 1CE6A 3H7BB 1Q9WA 2EKSB 3LKPA 5BOPA 5H8DA 2NZIA 1MRCL 4BZ2H 5SWSB 3IDUA 2ZUXA 4HKBA 3LRSA 5E4EB 3X11B 2YA1A 1DVFB 3B5GA 3KYKL 1B4JH 4OIAA 4HWNA 1RZ7L 5GS2H 3MREA 4I77L 4K7PX 5DHVH 3U9PL 4HS8H 5HHME 3EZ8A 5IEHB 5DD3L 3P4MA 2YD7A 3MNZB 3RNQB 2EC9T 5GGUB 3FOLA 4H5SB 4ZPVB 1WK0A 4G8FB 4EIZC 3LQAH 5DLMH 4HQQL 3S36H 4Y1AA 5HVWA 5EO1B 5KG9B 1M71A 3BH8B 3SE4C 4JFHE 5DQ9B 5EIQA 4PREB 3VJ6B 2JLLA 3GJEB 2BSTB 1NH6A 2OMBA 2GK2A 4Z5RA 4MD4B 1RFDL 3NFPB 2RBLA 5HYJB 1FFQA 4DCQB 5GGVH 3O6KL 3VW3L 4Z7VE 3O2DA 1QSFE 2W9DH 1ZT1B 5E08L 1N0XH 4P2OD 4N68A 2HN7B 3QDJB 1FL6B 3BP7B 1SBBA 5IQ9A 4F33A 4OZIA 4XVSL 1UADC 2NX5B 4WU7B 1MWAH 4R90H 1A1NB 2AJ3B 1HZHH 4KK9C 3MJ7B 4R0LA 3KXFB 5BV7L 1N2RA 5D71L 1MRFH 3O9WD 5J4MA 3FB5A 2X4OA 1CFQB 1JTTA 4Y19B 5IGXL 4LSTH 2Z31D 5BRZB 3FRPG 1GGCL 1I7RB 4EOWH 3QIUA 3RWJA 2J6EH 4Z0XA 3O81A 2QQKH 3T2NH 6CGTA 2OZ4L 4YXKL 2EYSA 3QJHA 2FJHB 1DE4B 1U8LB 4YEFA 1AJ7L 2WLYA 3VXSE 1YEEH 2OR9H 2ATPA 3NZ8A 3OKLB 4TUOA 2NNAA 1GC1C 1AQDA 5J1AA 4NQDE 1GGIL 2YPLD 5JHLL 5HHPA 1JPST 3QWQB 5IJVA 1DANT 5T1LA 1I7UB 8FABA 3EDDA 3QG7L 4HUUA 4U3XA 2DQHL 5HTSA 3GSWA 3HI6H 3FT3B 1KN2H 2O5XL 3CFIC 3BDYH 1CE1L 5DJ2B 3MRPA 3BZEA 4G9DA 5FA4A 1Z9OA 5D7KE 1LO2L 2AJYH 3O3EB 4NQCD 2I5YL 3ZE2E 4X4YB 3CFKB 3OR7B 3O6FA 3FQNA 1CDUA 1ZGLB 2QQLL 5LCVL 1KLGA 4NKDB 4QHNA 2EE2A 3KPSE 4JRXA 3VGDA 1RY7B 1IC7H 3VH8B 1QNZL 4LSSH 1IGTB 1U93A 1KULA 1ZVSB 4YJZL 2CD0A 1D5ZB 4XMPL 3NABH 2EXWD 5I1DB 4K9EL 5DTFB 3WIIL 3MSPA 2NY0D 1EHXA 3MA7B 3V4UL 4HWBL 3SGKA 3NZHL 5EN2B 3OXRB 1BD2A 1G7MA 2W0PA 4U1NA 1QFHA 2JK5B 3TZVA 4WHTB 1F6AA 2RFXB 3N9GH 2EZ0D 1KIQA 2EIEA 1KJ2H 4AG4H 4IDJH 4LIQL 1XF2A 1MRDH 1X9QA 3BUYA 5AZ2L 1IC5H 2PO6C 4BZYA 3E0GA 3D0VA 4NZUH 5IROA 3UJIL 1EHAA 1IQDA 1RZGB 4P2QE 5I8OL 3TYFB 3OJDB 3BHBA 2J88H 5DEFB 3MJGX 3DETD 3QIBC 4PJFF 1NGWB 4QYOB 4HT1L 4WY7H 2R1WA 3QUZC 1ZHLA 4OZFB 1FZJB 1DQJB 4JHBA 4YHKL 4K3DL 1PBYA 4K7FA 3QJFB 4EI5B 4L29A 1EEZB 5IK3B 3KJ4C 3GMQA 3P11L 1LD9B 3ZKXB 4PP1D 1T04B 4XXDB 1FNFA 5LXGH 43CAB 2GTWA 4OZHE 4HFWA 3CXHK 1G9ML 2CDFB 3WFDL 3T4YA 35C8L 4KK8D 4M7JH 5DD0H 2FB4H 5F1NB 1C1EL 4WEMB 2NY7L 4JN1L 5DD6B 2JCCB 2P4AB 2FBOJ 2CKBH 3BIAX 3DRQB 2ERJC 2JJTA 4PLKD 4Z7UA 1FC2D 5FYLD 1I8LC 4NM4L 4R3SA 4GRLC 1RHHA 3JWOH 3QCTH 4PLJC 1OT1A 1RIUH 5TDOB 4KJWD 5HYEA 4NDMB 2VXSH 1RUQL 4PG9A 2D31A 4HIEA 3C2AL 3ZLQC 2VR4A 5IFAL 3QG6B 4LLMA 2Q3AA 1FAIL 3C6LB 2VTFA 3JWDH 2R0ZH 3MOAH 4Z7QF 1ZV5A 4L3ED 3U82B 1FLRL 2DQEH 3ARFB 3CK0L 5HDLA 3KPRD 5DVOA 1T6VN 4LMQE 3SBWA 5F6HI 5ADOH 3KPMA 1T03L 3GMLB 4X6BB 1JF1B 3O9WA 3D1MC 1CTOA 4P2RB 3PWUA 5IEKB 5CJBA 5DFVD 2DAVA 1YMHA 3BDBA 1ZLVH 5DJZA 3ZE1E 1NCBH 3C60B 4LHUG 1T20B 2QKIB 1MAML 4LCYA 4X4XA 4FFZH 1MI5A 5D7IA 2GJ6B 4K3EL 3IJYB 1SHMA 1X4XA 3I6GA 1UM5L 4L8DB 3CVHB 1BFTA 2WMPA 4WENB 4MWFA 1S78D 2HJKA 3FONA 2FGWH 1FNAA 4CRPA 2FH8A 4JG0L 5KSBE 1S5HA 1F4XL 3EO9L 4YDKH 4YC2B 4QNPF 4CU6A 2ED9A 3QXAA 1UVQA 1IBGL 5HHMD 1BLNB 2H3NB 2VXQL 4OM0H 4KV5E 5IESH 3F62A 4WI7A 5C0FA 1JNHA 1RI8A 1CK0H 3F6IA 1EAJA 4H0IA 4IOFD 4LVOC 5D7LE 5EIIB 3WFEL 4OUOA 1OP3H 3TPKA 4ENED 4JFHD 4Y5VA 1PKQE 2VXTH 5FOBA 3HUJE 3TBSB 3V0VB 5EU7C 4A6YB 2FIKA 3H9SA 1VERA 1K5NA 4L9LB 4JPVL 3IDGA 3U4EA 2NXZC 1IKFH 4R2GC 3T2OA 1BVKB 4DZBA 1H3VA 3L3KA 2B5IB 2HWZH 3CH8A 2BNQE 3FQUA 4J1UA 2R1XB 3RVVC 1QFWL 5DA0B 1WBYA 3BAEL 5L8LB 3O3AA 1YNTB 3FMGH 5ILTH 1MJJA 3GJFK 4AM0B 3K81A 3PXHA 5DJYB 3U46B 5MEQB 5CP3H 3NIDF 4KKAC 3ILQD 2FJFA 1G0XA 3DVIA 4PS4L 3U4BL 4JO3L 3HZYB 2NY2B 1KC5H 4YNYA 4I48B 3MRJB 4JB9H 1P6FA 3KJ6H 3ZTJH 3N50A 3RVWC 1T0MB 4NUGH 5IVNA 1FNEA 4XBEL 4NRYB 3OAZK 4YGAB 4RAVA 4OD3L 4L8SA 1DBKL 2PR4L 4NQDD 1K3IA 2VWEE 2VDQH 3BPCB 4Q0XH 1TZHA 4NWUL 4KI5F 3I9GH 4NBYB 2YUXA 3RWGA 4N8VA 3UPAA 5KVGL 4XNXL 5HYSG 4HIJA 3SO3B 1A3LH 4PRHB 5DMIL 4S10A 2XKNB 2AK4D 4QTHB 4U6TA 1MAJA 2FEDC 5C70A 1DLHA 2Z8VC 5T33H 1AGEA 5D7KD 3DVFA 3O6FC 4S1QL 4L4TB 3RDTD 4H1LA 3LAFA 4Y4FA 1Y18B 2PW2B 5DRXB 2UYLB 1N0LA 1YDPB 3L95A 3TBVA 4YAQA 5D1QC 5DHXB 3FB7A 3MLRL 1PQZB 1K4CA 4ODUB 5HHQA 4L4JA 1IGMH 4JHWH 1UENA 1QZ1A 5F3HB 3O6MH 1L7IH 3MMEB 4IIQA 4GRWE 2AI0L 3QIWA 1EDQA 5D93C 1G9NC 1R3KB 3JSSA 4FN0A 5IR1A 4XBPA 1VFUA 2YOCA 4WFFE 4TTDC 3SGKC 3FRUB 1JUFB 1JRHH 5MHSE 1HWGB 1FAKT 4HJJH 4OGZA 3REVA 4D8PA 4ODHL 3KPRA 1MJ8H 5IROC 4G8EB 5IVXE 4P2QD 1QO3B 3RY5A 4ISVA 4W70A 4F7MB 5D7JC 4LARL 4KHXL 2B1HL 2AGJL 5D5MA 2VZUA 4Z7WB 2DLFH 2E9IA 4LHJB 1UJ3A 3IXTA 4HLJA 5HI3D 1J0HA 2NY3D 4NOFA 1AR2A 1C7SA 3MV9E 1YMME 3F8UB 4LRIA 1GZPB 5DRZB 4HXBL 3U48A 2ZPKL 4ZFFA 5JHDB 2O5ZH 4KVNH 2XPGB 1KT2B 2AS5M 4C54A 2HA1A 4HF5H 3R4DA 4QY8A 5IVZB 3VI4E 1ACYH 1FZMB 1X5XA 1EAPB 2LU3A 4GW5B 4IMKA 3ULVL 1C16A 1HHKB 2BNRA 4HX1B 4JJHA 3RZWA 1MQ8A 2H41A 5TF0A 4B53A 1CICD 3ZHKA 1YNLH 1T5WA 5TF1H 2JJTC 2V2WA 1RD6A 3V7AE 3RAJL 1CU4H 2B7DT 4PJDB 3W11C 1RZJC 1S7QA 1VFAB 1CFTA 2E5EA 4F8QA 9CGTA 5EORL 1J1XH 4NGHL 4XPBL 1YJDH 3DVNB 4BH8B 3NA9L 5C9JA 5L2KD 4Q74A 1UEYA 1ZHNB 3KYMB 4PGEB 4LCIL 1KCRL 1NAMH 4UIMB 3OAYK 1G7PB 4HV8B 3O9WC 4C56A 5DEGA 4PJAA 2BY0A 1MCSA 1QRNA 4JRYA 5EUOA 2GSGB 1XGTB 5BQ7A 5H94B 1HIMH 2FX7L 1GSMA 3BKYL 1UA6H 4XI5D 3GSRB 1I1AB 5C0BE 2G75B 2VL5A 4JHAL 1P7HL 4TVPD 1T1ZB 4ZAKD 1LDPH 5E5RB 3ULVE 1ULVA 2DL9A 3BFOA 1I3RA 1XZ0B 1MCOH 1LP9F 4CVZA 4GW4A 1YEKH 4LNRB 4OGYL 1LK2B 3VGAB 3DIFA 5ERWA 3JV0A 2LAGB 1OQXA 3HMWL 1I3GL 4ZFOA 3AXLA 4EBQL 1JPTL 2IQAB 1RZKL 1GL4B 3A6CL 5FYKL 1HINH 2CIKB 4OFKA 1P9MC 5FDWB 3WIHA 2VDKH 4NC1E 1SEQL 2F58H 4M7LL 4E41A 2I9LB 4MA1B 4XGZB 1IKNA 4BH7B 4IS6B 1I1RA 1LK3H 1A4KA 4AENB 2P5EA 4PRPB 3SGDH 1B0GA 2FLRT 1NFDA 3CFEA 4A6YH 4QRQA 4UAOC 3SKJH 4JDZB 3QIBB 4B5EA 1Q9LA 2X4TB 4MJ2A 4Y5YB 3LCYA 5HDQH 4O2CA 3ARGB 2X7LB 3QCUH 1G7LB 1MELA 5IV2B 2EIZA 2BNQD 3U36A 3WS3A 1G7JB 2MQ0A 1NUDA 1VGKB 3PHSA 2ICWA 3NCYP 5T1MB 2EXWC 5J12B 2DQIL 4GS7B 5FKPB 1RUAL 2NY4D 3C09B 2VAJA 2NY0C 4KUZH 3KPLB 1U2HA 5K9KA 3JTSA 4NNPH 5HGAA 4LPCA 5GRYA 2X4SA 1NCAH 5JOEA 2IH3B 3QI9B 2EZ0C 1FJ1B 5TDNA 3RZCD 4KQ3H 5DSCB 2YK1H 3TCLB 2Z93B 5FYKE 3DXAD 5MEOB 2E8YA 4I9WD 4JVPA 1YPZE 5ALBH 3RL2A 1IGJB 1S9YA 3DETC 4U7KA 3UPCA 3HMXL 5KSAD 3BZ4A 1N5YL 5EC1A 3MUY1 2DB8A 3UTSD 5EU6B 1SYSA 2EH7L 3AY4A 3QQ4B 1J1PL 4PP1C 4MNQD 2ADIB 1X3DA 4DN3H 3SQOL 3ZDYE 4TULH 1H5BB 1UKQA 1RULL 3LN4B 4QTIL 1LEIA 4KK8C 4YHML 5LVEA 4NN7C 3VXRD 2HFEB 4NZRL 4Y4FC 3VD4A 1CE6B 1Q9WB 3QWRD 2PW1A 3HE7D 4ZYKA 1RUML 4WI9A 4HKBB 4PLKC 4YPJA 3LRSB 3EO0A 5J57B 1J0YA 1TTGA 1NUNB 3UXFA 1NJ9B 4P3CH 1FFNA 2XRAL 4KJWC 3MREB 1I1YA 1BQHG 3BD5A 2MTPA 1JZ2A 5E70A 4RGNB 3SJVA 1G7HA 3P4MB 2OR7A 3LRGA 4LP5A 3LIZH 3FOLB 5HYQA 1QFUH 2PCPA 3NN8B 3VXUA 3KLHD 2BNUA 4UQ2B 4WUUA 4F9PA 4WCYH 2ZNWA 3MCKA 4JPWL 4Y1AB 1M71B 1MCLA 1MFBL 1DEEA 4CAGA 3O3BA 4N1EA 4Z5RB 3QHFH 4YR6A 4RNRA 4WI2A 3TYGH 1H3GA 2G5RA 4QRSA 1JBJA 4N0UE 3CPLA 2JELH 5DFVC 4UV7L 2XY2A 3NTCH 3AREA 3GB7B 4NNYA 4F33B 4LRIC 5IQ9B 1WAAA 4ZQKA 3GSOA 3OF6D 3S35L 4R0LB 1S78C 1N2RB 4XPHH 4X6FA 3OTTA 3RNKA 3FB5B 3PWVA 4H88L 3SE8H 3EDFA 3EYVA 3GK8L 3WL9B 1ES0A 2OTPA 2X4QA 5GSRA 5FF6A 1WCBA 3I2CH 3NGBB 3BD4A 4F9LC 3QIUB 4TUKH 4Z0XB 1T7XA 4AMKL 2VH5H 1TVBA 5DJ0B 1V7NL 2EYSB 3FT2A 4H26A 3QJHB 4XMLL 3BH9A 1VPOL 2HLAB 1D5XA 4OLYH 5DD1L 4ENEC 1BECA 3WLWD 4V1DA 2ATPB 2VDOH 4TUOB 2NNAB 5SV4A 5J1AB 4HSQA 5JUEL 1GC1H 4JKMA 1WEJH 5HHPB 5IKCA 5T1LB 4M43H 8FABB 4HUUB 3GSWB 4FTVA 5BS0E 2A9NL 4G6JH 1O5DT 3MRCB 3MRPB 4G9DB 5FA4B 3ZKND 4GKZA 3S35X 2HT2C 3H6JA 3ETBF 5JQ6H 3O6FB 3FQNB 2DN7A 5GGQL 2XXMB 1KLGB 4OD2A 4QHNB 1EUTA 4K8RL 5I18H 1PKOA 1DN0B 4JRXB 3C8HA 4R4NC 1U93B 25C8L 1E4XI 1KPUA 3ILQC 4WI5A 5C0BD 5ADPH 3GIZH 5F21B 5BVJA 4EUPA 5FEBA 2B4CH 4GLRI 4F7TA 3ZYZA 5GRUL 4DUWA 3QCVL 5D93B 3BP4B 3QXVA 2ZSVA 3PDGA 3OKOA 3MQIA 1N6QH 1A47A 1JFQL 1BD2B 5EBMB 3GJFA 3EBAA 1NMBL 5CEZE 3TZVB 5KSAA 1BAFL 1F6AB 2NCMA 5E95B 1KIQB 1LO4L 3MOBL 1XF2B 1WIPA 3MRDA 3BUYB 4LLQA 4BFIA 3I50H 2FATH 3D0VB 3QXUA 1I3VA 4KRNA 2P49B 5JORA 4B41A 2J8UB 4XP1L 1OTSD 1INQB 3ARXA 3OG4B 4GJTB 3EOTH 3VG9B 1T2QL 5D1ZD 3VXRA 1HH6A 1B9ZA 2FGZA 2R1WB 1ZHLB 4LVHC 3RDTC 5BXFB 1AGCB 1KYOK 2B1AH 1WWBX 4K7FB 2XZQH 3MXWH 1FG9C 2CUHA 1RIHL 3GMQB 5ELIA 3EFDL 4NKOA 2GTWB 3MJ9L 2H26A 1OTUD 3T4YB 1CT8A 3D9AH 5BZDA 4W4OC 2EECA 3D85A 3F58H 3RL1A 3ZYJA 1DCLA 3HPJA 1MJUH 3QB7C 5TE7H 4UILH 5E2VL 4X83A 5E2UH 4NO0B 3VXMA 3ME0A 4Z7UB 3S4SG 1CL7H 3DRTA 4R3SB 1RHHB 1PEZA 4YHOH 3RRQA 3G6JB 3B9KD 4FQJL 2UZIL 1RUPH 4PG9B 2D31B 4HIEB 4I18C 5FYJL 1QP1A 4TPRL 3TA3A 3KR3H 3SE3A 5GS1B 1OP9A 1NCCL 2KZ1B 3KYAA 5HI3C 4OCWL 2NY3C 3VD3A 1FVDA 4HFUL 2GY7B 2UWEF 3KYOA 3WKMH 1A5FL 1BBJB 4M6MH 4HEPG 1G6VK 3TEUA 3HZVB 3TV3H 3ARQA 2UZXB 4A2MA 3I3EA 4ZO8A 3VXNA 3PWUB 1U36A 4AQOA 1YMHB 5D9SA 1CFNA 1UEMA 5DJZB 3MYJA 3EYQD 4GSDH 3TO4A 4LCYB 4X4XB 2IF7A 1MI5B 4PRAA 1GXEA 4LHQB 2R2EB 5D7IB 4JQIL 1CICC 4K9EC 5D2NE 2G9HA 5DUPH 5ICZB 1S7RA 4G8GD 3I6GB 4H8WL 4FZ8L 4KRPC 5GRWA 4XMKL 5K59E 2QSCL 1EEYA 1KCSL 4HBCH 4ODBD 1QA9A 5KVDH 3BDXA 1S5HB 3D2UD 3X3FL 2VLRA 1NLDL 1GGBH 3WDIA 3QXAB 1UVQB 4LGSB 5E00A 5CGMA 2WSKA 5FGBA 3ARDA 4Z78A 4U1GC 1EHLH 5I0ZA 1BFVH 1IAMA 3QUML 5C0FB 1JNHB 5BVPH 5A2FA 5FYJE 4Z7OE 3NH7H 3CDGA 4JDVA 3TJEH 1I1FA 4Y5VB 4O4YL 2Q86B 4XC1L 5FOBB 3QDMD 4DGVH 1P2CB 4ODTH 2EXYD 2FIKB 1P84J 3H9SB 4HAFA 3VDCA 1K5NB 3V4PH 3B5TA 4Y0GA 3QRFM 3O2DH 3IDGB 5EWIL 4DZBB 12E8L 3L3KB 4XI5C 3HRPA 1INDL 1G9MC 1MHCA 2R23A 3FQUB 4J1UB 1ETZB 3O2VL 5FECA 1WBYB 5EA0H 4ZAKC 5JTWA 5E2TH 3O3AB 4R9HA 2FHCA 5GIRA 4JO1L 2W60A 2DTMH 5TQ0L 1AO7A 1NEUA 1KB5L 3FRPA 5FGSA 1Q0YH 5KTEL 1IGCL 1QLFA 3H8NA 1G6RL 5I1IH 4NZTH 2FJFB 2D0FA 4WI6A 1CLOH 1P7QB 2CLZB 3UZQA 1X4ZA 2FX9H 3UYRL 1I7TA 1NCDH 4YNYB 3ISWA 4M9OA 2IAND 5IW1A 1Q38A 2J1KA 4XCEA 1NCWL 1D9KD 3MODL 4Z76A 2R4RH 3WXVL 4RAVB 2OLDA 5I15H 5MERB 3RWCA 3BQUD 4L8SB 2DM2A 5SX4H 4PJGA 1RK1A 1TZHB 2EO9A 1PFCA 3BKCL