3T4YB

S25-2- kdo monosaccharide complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKANGYTTEYSPSVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDHDGYYERFSYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 FAB (IGG1K) LIGHT CHAIN
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t4yB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t4yB01
4LKCA 4HT1H 2A0LC 3PV7A 4PJCB 3OL2A 4TYUA 3I6GA 4LVEA 3BWAA 2IPKB 2EDHA 1A1NB 4MJIE 2DQCL 2GCYA 4OM1H 3RTQA 4M6NH 4PJIE 1KC5L 4WO4C 3LSOB 3AUVA 3NCMA 3UYRH 5F1KC 2JCCF 2F9BT 3VXSA 1J11A 1KN4L 2XZQH 2MQ0A 2H6PB 1ZHNA 2AVGA 1RMFL 5ERWA 2WQRA 3F65A 4NSKA 4XP5H 2DF3A 4JFDA 3QCUL 3RDTB 5MERA 3QUYB 4NQDD 1ODAA 5I66B 4OCRL 3SHSA 1EHAA 1S9WB 2PNDA 3LV3B 3PE9A 5IBTL 1N0XL 5CIPB 4FNLL 1AKJA 2NXYC 3WFBH 5E9DA 3FT3B 3T77B 5TDNA 4RCAA 4IRSD 3V5DB 4JFEB 3HNSL 3V6OA 1FYTA 3PV6A 4EJ1C 1K2DA 5IHZB 2AJSL 5AUMB 1T66D 2HP4A 4KRPC 1WAAA 3AGVA 3W39B 3HZKA 3U4AA 3DVNA 1A8JH 3D3VE 3I85A 2VZTA 1ZGLP 5CHNA 3MC0A 1ZHKA 1INDH 3QCVH 3H9HB 4HCRL 2IAND 1H5BB 4A6YH 3V4VH 2X4QA 1HOCA 2AJYL 3SDDB 4PLKD 4U7SA 4XXDB 4OJFH 3UPRB 4M6MH 4PRPB 1Z0NA 4F9LA 1SJHA 4QRRD 5FA3B 5IG7A 3LS5H 5I0DA 4XNMA 1FZMA 4X6BA 2EC9U 3MJ8A 4HS3B 4BELD 3KHOA 1IT9H 3VE0A 1BF8A 2XN9D 3NCYS 4G3YH 3NAAH 4HULB 4NYLB 5JDSA 1FL6A 3MNWB 5JZ7D 4PJGA 5DDHA 3VFSA 3B2VH 4XMKL 4JDTH 4XVTH 4G8IB 3C09C 3NIFF 2HT2D 1EO5A 3WKNA 3G5XB 1PG7W 1MCQA 5T1LA 4MD5B 2B4CC 3DSFH 5IROC 1N2RA 4XP6L 3O8XC 4NQDE 4E5XB 4NRZA 2FLBT 1HHHB 4XNYL 2VC2L 1D5ZB 4ZFGH 2ZCKL 2HWZH 5TQ2L 1JIBA 5EU6E 4YFLF 2PYED 2W07A 4NQUA 2HJKB 5F89A 4ZFOL 5LGHL 5T33H 2BVOB 5AG9A 4MB3A 3CMOH 2GFBA 5C3LD 4YX2H 1MCHA 1TCRA 3VRJA 5KSAD 1N5YL 5AD0A 2F54B 2A6JA 3IU4L 3G08A 5CAYB 2NY6D 3WLWC 3WN5A 4CVZB 2OR8A 5HHPA 3CC5A 3X11B 1VEPA 3PHSA 1CU4L 1OWRM 4OQTL 1A6UL 4GW4B 4HS8L 4OTXH 4L9LB 1KNOB 4WNQB 5E2WH 5GGRA 1IGJA 2IANE 5EIIA 1QSEB 2UUDK 2H2SC 2Z31A 3HFML 4M5YL 3ARDD 2EDTA 3RWIA 3CSPA 3B2UC 4OD3L 2NY7L 3O3BA 1HILB 4QRRE 1MJ7H 1EMTL 1TVBB 1CFVL 2HT4D 1QR1B 2X9WA 4HLJA 1P1ZB 4LOUD 4LP4A 4AIXA 1LDPL 1D6EA 4O02L 3AVEA 3BHBA 1NLBL 3R06B 2VXSH 3EFDL 2EYRA 4XPBH 1YY9D 1EZVY 3REVA 5F7DB 1UYWH 1P4LB 2B0SH 4DGIL 4JLRB 3QRGH 2FO4A 3I6LD 5IMKB 5FUOH 1LD9B 1LE9A 3QFDA 1SJVA 4OV5B 3QDJD 1GGBL 1LWRA 4P5TC 1ES0A 3CFIC 2VH5L 4M1CD 1JGLH 3W11C 4HLZG 4U1NA 2R69L 4LFHG 5I16A 2IAMB 1ZHBA 25C8H 3DRTA 5IEHA 1MJUH 1WV7T 3RNKA 3BAEL 1T03H 3VFRA 4Q0XL 4R3SA 5KSUA 5FUZL 4ZUWB 3NMEA 4TSAH 2NY1B 1EHNA 5ALCL 2FBJH 3HKFA 4LU5H 4MD0A 4YQXL 3GSQB 3MGOB 3PL6A 3RGVA 2PO6B 3RUGA 4R0LB 4NC1C 1LO3L 3TYGL 4PYGA 4ONFH 5CZXD 4ZFZB 3VXSD 1PY4A 1A6WH 1I9IH 3RZCB 1KOAA 3FJTA 1FHGA 3RL2B 4AT6A 4JFDD 5F96L 3UTTD 1BF2A 1IKNA 3RVTD 1KCVH 3FO9A 5IGXH 3UPAA 1I7TB 5I1DB 4PJEE 1N4XH 2OTWB 3CFCL 5CGYC 4XCYA 3V6FA 3T4YB 4X4YA 1JPGA 2P46B 4M7KL 4TVPL 2C7UB 4JO1H 2B1HH 5E9DD 2VISA 4P9HL 1J1XL 3OKNB 3PDOB 3VWKB 3DI3B 3DPBA 3NIDF 3QUKA 3WYRA 5IMLA 1UWEH 2NW2A 3B9KC 32C2B 5DO2D 1ZSDA 2CDEB 2DS4A 2Q7NA 5GSVB 4L3EB 3QDJE 3IJYB 1GPOL 3U4BH 2NY3D 3KPOA 4GQ9H 3GKWH 1A3LL 4XPAL 5E99L 3QNXB 4RX4A 3ZHLA 4Z0XB 4QTIH 5EOTB 5I1EL 2G9HA 3JBG7 4QRSA 5IQ9A 5JTWA 5DRWB 2DQJL 3HC0A 3IKCA 3GSXA 1GOFA 1F3JA 2JK5A 5B38A 5T3XL 2HFGL 5I30L 4KROD 4HKJA 4ELMA 4YDVA 3FB5B 2EO1A 4QXUL 4NJ9H 4HF5L 3O2DA 4D0BB 4LCCB 4KDTC 2K3TA 1OAXL 4F37F 3KYKL 5C0ND 3ZT6A 4HHAA 3KPTA 1FG9C 4NUJB 2VLKA 4Y1AB 4TTGA 1FV1A 4XHJD 3UTTE 3D25A 1OGAB 1R3HB 3O6KH 4WHCA 1X5YA 5CEYB 4OGYL 4OF3A 3HC4L 1KGCE 1OT1A 2YK1H 5F3HA 4X9GA 3T4AA 4WFFD 4S10A 4FXLA 4D9QE 2FH6A 3TZVB 3C2AH 3I9GH 3RJDA 3RPKA 2J8UF 3AAZA 2ZSVA 5ACZA 1RJZB 1HI6A 4CU7A 4Z78B 5IBLD 5D93B 3AFLA 5J11C 3ROLA 4KTDH 1XAUA 1JWSB 3TV3L 3EJJX 4NWTL 5FF6B 5FYKU 5K59F 1CL7L 2GKIA 4TUJA 5FB8A 2AK4A 1DFBL 2D7NA 2E7HA 4WHTA 3PWJA 2D4FA 1TTFA 1P7KB 2UY7A 4M8QB 2DKSA 2GSIB 4N0YL 2OZ4A 2F53B 4RGNC 4P59L 2Z31D 1SVCP 4JHWH 5BQ7A 1E27A 4UOW0 5E1AA 4K7FA 4Z7OE 4WDIA 4Y8AA 1RUML 3KYAA 5AEAA 2EC9T 1MRDL 1IE5A 1E4KC 2AXHA 4QHKI 1FVDA 4PR5A 5IMMB 4WIQA 2PW2A 3L7EB 4AEHH 4RA0C 3MUZ1 5HYQA 1BFOB 1TITA 1R5VA 4NKOB 3DX7A 2VSCA 5I1CH 5IB1A 3PNWA 3HA0A 1RZIA 3WUWA 4KHXH 5GISL 1ZGLM 3ZDXF 4GG8B 4Y4KB 3WD5L 4JE4B 1NGQL 1S3KH 4AH2A 2ADGA 3RIAK 4ELKB 8FABA 5LQBH 1FNFA 1QYGH 4KZEH 5DMJB 3V9FA 4NJAH 5E2VL 3LMJH 1MVUB 4Q9QH 1Z9LA 1U3ZA 4KV5F 4H20H 3ZL4H 1C12B 4QRTA 5EN2A 3V52H 4P2QD 5HHMB 3L3OA 3PL6D 5DZLA 4HJ0D 3MLUL 3TCLB 3DXAA 4TSBH 4NQEB 4ODSH 1GH7A 4EDXB 3CNKA 3PWPA 3GMNB 4BKLA 5FECB 1JNNH 4OCWH 2BC4A 2X4NA 4N8VA 4K9EC 1A02N 3S3JA 2QHLA 4AL8L 4YXLL 4JFPB 1ZTXH 3BEWB 1G7QA 3JZ7A 1FCGA 5DR5H 1A5FH 4MAYB 1ZLVK 2HLFD 2VLJE 3UC0L 5I73C 1VSCA 3FFCB 1FL3B 2NYYC 3O3DA 4KH2A 2YSSB 5DHYB 1FN4B 1KB5H 3CK0H 4OIIL 3X13A 4R4NC 4NZTL 2KQNA 3AREA 3VXRD 2QADB 1J9CT 2IPTL 4RBPH 1AD9B 2DYPA 5IK3B 4R2GD 4RWYL 3CCHA 2F8OA 5GGSB 4XVUC 2F5BL 5D7JC 5KAQG 4KK9C 1M05B 5B39A 1ZXQA 2AQ2A 4Y2DC 3SDCA 3GMQB 1QFWM 3FOMB 4NKMB 2CIKA 3SOBL 3IETB 1NFDE 3QWOB 3OJ2C 4ZG1A 5KS9F 1QKZL 1JGUH 3N85H 1B2WL 1MCBA 4XP1L 5IMOA 1CGUA 5I1GL 4JY6B 2C1OB 4M1DL 5HYJD 2A9NH 4P23C 2DTML 3CFJB 1XGTB 4APQA 3QIUB 4P2QE 3GSVA 2DOCA 4NRXB 1U3HB 2DQHH 2GYSA 2EYTA 4W81A 4ZOEA 1H3PL 5I1IH 3HE7B 4ODUA 5HDQL 3OXSB 3QEUB 3TIDB 1KJ3H 5E8NB 2A6KB 2YN3A 3G9VA 3Q1SH 4JB9L 1S7VA 3H42L 3KJ4C 1J18A 3HG1B 1QVOB 4EIZC 3K8LA 2DLGA 1OGTA 3N1FC 4PLOB 3I6KA 4PP1D 4YFEA 1IC5L 3GSNA 3VDAA 4NN6C 4PRDA 3RWJB 4Z5RB 2R1XB 2HKHL 4P4RB 1IC1A 3TM6A 4HKBA 3LEYH 1T7VA 4XRCA 5HGBB 3VWJA 2GW5A 5BZWA 2C3GA 2FJHB 4KI5F 3RRQA 3WFCL 2PXYC 4EUPA 3VXRE 3UJTL 1K4CB 1HIML 5K9KB 5BOZG 1RUQL 1RV6X 3E2HC 4GJTB 2B4CH 4LKXA 3H3BC 5C0FB 2YUZA 4PGDA 1KENH 3TESA 2CRMA 5I1HH 5DS8A 2J5LB 2RR3A 3V6ZB 5J56B 3TBYA 5HHOB 4E42A 2UV3A 1AGFA 5D1ZB 4LPXA 3VXNB 4UTBL 1DSFL 3O2DL 1FL5A 3CVHB 3T0DA 2EH7L 5K9JL 4CW1B 3TBVA 5L0QB 1IGFH 4DWHA 5D1XD 4PJ8C 5MHSD 3ILQC 1T0NB 2P8PB 1VB9A 2PETA 3VFOB 1WICA 4W6XB 1D5IH 4LCUB 2FR4A 1A0QH 3K8KA 4MX7A 1CLYH 5HYJE 1TTUA 1VGEL 4H0HB 4P9ML 1MCWW 4XNQA 2HFFB 5EZLB 1ZEAH 4ZFFA 1B9ZA 3CU7A 1UVQB 3QDAA 3QFJD 4JQIL 1E4XL 4QOKA 3NTCL 1EX0A 4RGOH 1F6AB 4BK5A 3QUXB 4BH8A 2P48B 4K07A 4MXWH 2CUHA 2VXTH 5T5FL 3A6CH 1IZJA 4KUZL 2VLRB 2FEEI 5C3TA 5IKCA 3SKOA 2GI7A 4XWOC 3C8KA 2DM2A 4Q6IC 3EJZD 4HW6A 5LG1A 1F45A 3PJSA 5MP6H 1CDGA 2OZ4L 4JZJB 2Y06H 3HAEB 5H35A 1QHPA 2Z8VC 4ZTOL 4UTAL 2C3XA 1C7TA 2X4RA 3D69A 1NCTA 4P2OD 2JCCE 1HDMB 3WIFB 4YXKL 2NTFA 3U6RB 4HS6B 4MS8C 1R5IA 2Z35A 3CDCA 4LNRB 3PWPD 5F7KC 2FECI 3PP4H 1W72B 4Y8DC 4YDLB 1KJ2H 2O26U 1XR8A 2NPLX 2P8LB 4MVBC 5KVEL 4LEOB 4OZHB 4EI5B 4G8FA 3IDNB 4LSUH 5IB5A 3D0VA 5FKPA 5MHSE 3MMEA 1CFQB 1CZ8L 4YPJA 2NY0C 1UACL 2QQLL 3ILPA 1X5KA 2AV1A 4NHCL 5IESH 1VGKA 1YJDC 4B41A 2IALA 4GUPA 5EU3B 3GUTA 4JAMB 5F6HJ 1IRAY 5CS7A 2I26N 3MRCA 4U1GB 3VD4A 3L3IA 4JFFB 1FO0B 3IU3A 3QJHB 2VDLH 1CK0L 1XF3A 4QRPD 1T2XA 1TENA 2D3VA 3U0PA 4LLUB 5ESAB 4PGBA 4YWGH 2GSGA 3SGDH 3TO2A 3BD4A 1U93A 4LSRH 4IIQA 4YHKL 1AO7B 4L8BA 5EO0B 5D7IA 1K8IA 2CKNA 3EOAA 4U7KA 4QCIA 2R0LH 1N64H 2YMXL 5EBMB 3BD5A 3MRNA 1D9KC 3HI5H 5HI3D 3QQ4A 4P5KB 3K2UL 3MUHL 2ARJQ 2VDOH 5AYUH 5C0CA 4PS4H 1RVFL 2JJSC 3NFSH 4NUGH 2Y36H 3C5ZC 2EE2A 2YPKB 4FTVA 3NIFE 3TO4D 5IJVB 5E8DH 3HI6L 3P4MB 5CUSH 3WFZA 4NT6A 4YDKH 5F3BA 4BZYA 2CDFA 3ESUF 5D7KD 5E95B 4DW2H 2IG2H 4NHUA 4PUBH 4PJDF 5JQ6L 5LAXA 4MDJB 4NNXB 3RX8A 4G5ZL 1V7NH 1TPXC 3ZDYF 1I7UB 2OP4H 3N1PC 4QHMA 3LKRA 5EOQL 1HQ4A 3SDYH 5C7XL 3LEVL 4OLWL 3RVXD 5BRZA 3EYSL 3HMWL 4N5UA 5I8EA 3KNBA 3ARRA 5GS0D 5IW3A 3VWJD 1JBJA 3FQWB 4CGTA 2Q86A 2CRIA 4QHLB 2Y72A 2DQUL 2LVCA 4P57B 3MA7B 3EYOA 3FL7A 4QRPE 3GMPA 4X6DA 15C8L 5KVDH 1UJ3C 1QRNE 2V2XA 3EJYC 2J88H 5CJXC 4FQCL 2HVKB 2E7LA 3E3QE 1AR1D 2DAVA 3LKSB 4HEPG 3IDMB 4YEFA 5I1JL 1S7RB 5KJRH 4P46A 2ARWA 3KYOB 4ONHA 3AU1B 2CK0L 4FRWA 4LPVA 3OQ3B 5JDJA 1RUKH 3IS0X 1CICB 5FGBA 5FO9A 2B1AL 5JOPD 3GSNL 3MZTA 5J9PA 1JHKH 1OAQH 5FM8A 4DKFL 5DD1L 3DRQB 1BPVA 2FSEB 1BFSA 5TE6L 1RUPH 2ZPKL 5GS0L 1B6UA 1BIIB 2O5XH 3DTXB 2GK0B 1H8NA 3X3FH 4S11A 4ZODA 3VJ6B 3RY6C 3KPQA 4C55A 5E4EC 4PJ9C 4Z0BH 3V8CA 1ADQA 1Z5LB 5C9KA 1FE8L 2AV7A 4ZSOA 3TNNA 4POYA 4IJ3C 3ZSTA 3QI9C 3SY0A 2ZG1A 3BO8B 1G6VK 1EGJA 1XR9A 1M7DB 3UPCA 3MRHB 2GJ6E 3M07A 1S8DB 2C1PA 2DQFB 4OZFB 3FRPA 1H3WM 5DHVB 3D39B 2VN4A 2OS7A 4TRPH 3RBSA 3GNML 1U8LB 4IRSC 4H26B 4LPCA 3BKJL 4MD4A 1A7OH 2GUOA 1GIGL 4Y5YA 1SQ2N 3NZHH 4XTRC 1YZZA 1KBGH 4HPYL 4NQXA 1CXKA 1S9VA 2ORBH 3QWRA 2V9RA 4HWBH 5EG6C 2Z91B 3ZMRA 5F1NA 4LLWA 4PRAB 4AEIL 4LSSH 2DBLL 3BISA 4WW1B 1LNUA 1BP3B 3O4LB 3MRDB 4HIJB 5HGHB 4XBGA 3H7BB 2HG5B 4QHNB 5C0BA 1RU9H 2CJUL 3NIDE 3MNVB 3ARGB 1LO0L 1U8QB 1IM3A 1RZGB 1OAUL 1RZJH 1NCDH 5JOPE 4XCFH 3BT2H 4E0RB 4PJXA 1KLFA 2WINB 5EU7C 4MA8L 5ESVA 4K9EH 4UV7H 1W8NA 1FZJB 5TJWK 2AEPL 3N9GL 1HEZA 4G6KL 4G9FA 1QBAA 2EKJA 1FZOA 4X4ME 3GB7B 1A7QL 2R4RL 3QP3A 3QSKB 5BJTB 1HCFX 2A6IB 4CVXA 5CWSB 1F11B 2EH8L 3ZHKA 4C4KO 1EBPA 3L3JA 3L7FB 4WV1A 1SHMA 4R6UA 3BYTA 5T5NF 2BMKB 4QF1B 3FQXA 5HHQB 5F7FA 2IQ9L 4FFWD 1FPTL 4H88L 1ONQB 5FCUL 2P43B 1FVEB 3BVNB 1R3IL 1QNZH 4PJFF 1LO2L 1NC2A 1P4BH 4PTTA 1O5DT 4FQXB 3GMOA 4C56B 4OZGA 4G6AD 4U3CA 4OGAC 4ZDHA 1WBZB 2OJZL 5KSAC 4OM0H 5E6ID 4D0DA 1BOGA 4PY7B 5CEZL 1JUFA 3TBTA 2L0DA 1F2XK 4BUGA 5CBEB 3ARBD 2FZ3B 1TETL 3X14A 1E4WL 3MV8A 1M71B 1A9EA 1NMBH 2IH3B 4JFOA 3NGBC 1X5XA 2DDQL 1Q9LB 3HLAA 1NBZB 5JW4R 3ARDC 4FQHA 4I2XB 1JNLH 2Y6SC 1I8LC 4GRLC 4PJCA 2IPKA 3U9PL 1A1NA 3RIFK 4LOUC 4WGWB 5T3ZD 3LSOA 1OAKL 3GI8L 5K59E 1PSKL 1SY6H 3RIAF 1AHWB 1MOEA 4PBWD 5SWSB 3RVUD 5DRZB 2H6PA 1QFUL 1YY9C 3QH3B 5F7YC 5CD3B 5JMOC 5I15H 2F5AH 4NCC1 1T2JA 4WFHD 3RDTA 1HNFA 3QUYA 2ADJB 4GKZA 1S9WA 3LV3A 1IEAB 3KPRD 1OW0A 2N1KA 5FGCB 3LZFL 1VACB 4P9HC 5CIPA 4M1CC 1NMCB 3N50A 4I4WB 6FABL 4K3HA 4DVRL 3FT3A 3T77A 4WI7A 3V5DA 5EOCH 2VL5B 5JQHC 2HTKD 4JFEA 3A0OA 4L1HA 5D6CB 5IHZA 5K9OB 3H6JA 2PTVA 4X0KB 1RIUH 2B20A 3WDHA 3RTQC 3UZQA 3W39A 4XC1H 1JV5A 3ZDXE 1U3YA 5SX5H 1M1SA 3H9HA 1H5BA 4IRZL 3SDDA 3D9AH 5E4IA 5CMAB 4XXDA 3UPRA 3HPLB 1NCAL 4KFZC 4PRPA 5FUCC 5FA3A 5DGQA 2Y7QB 5HBBA 1SBSL 3G5ZB 3RVTC 4HS3A 1DBJH 3QXAB 4KV5E 3VD9A 3BPOB 4NYLA 1JPTL 5SX4I 1DZBA 2A6DB 5IP4A 1RJYB 5T3ZE 2EYSB 3O0RL 1FRGH 4UNVA 1A7RH 5BVJB 2VXVL 1DLFL 3K1DA 1UKSA 4UIKH 4WFGE 1S7WB 2X2YA 4FZ8L 4JPKL 3DUUB 3V6OC 4G8IA 3BSZL 4GKSB 1RUAH 3G5XA 2R1YB 1REIA 2F19H 1QUNA 2RCSH 4MD5A 3L5IA 4PB0H 3DARA 3SCMB 2NX5B 1L4IA 5GSRB 2IFFH 3QWRD 4IOIB 4E5XA 1INQB 2I9TB 3BN9D 1HHHA 4AZ8A 2NY3C 5GGQL 3KPRE 2JE8A 1SM3L 2Z0BA 3FKUS 4GS7B 1D5ZA 1WIOA 1OM3H 1T5WB 5FYJD 2OXGA 5I75B 1J8HB 4U2YA 5GRUH 1O7VA 3UTSD 3ELAT 1ADQL 4KI5D 1BFTA 2HJKA 3M8OH 4F9LC 1ZANL 4G8EB 2BVOA 1LQSR 5LCVL 4XX1E 4RRPA 3ROOA 4PTUB 3IFPB 2F54A 4OZIB 1GSMA 1EGJL 4OLVL 4KZDH 3WHXB 3X11A 4G9FD 4RAHA 4GW4A 3VXUD 1RY7B 4NN5C 4D2NA 4L9LA 1KNOA 3MXVL 4WNQA 5DRNB 1QSEA 3MROB 4KDVA 4DN3H 5I9QC 1MI5B 3RGHA 5A40E 4TOYL 5HHVL 1MCOL 3JV0A 4O4YL 1HILA 5KS9E 1TVBA 2NZ9D 3OAZK 1QR1A 3MOAH 1P1ZA 3UYOD 3BXNB 4N1EA 4JO4L 3BQUB 1A6PA 4Z7WB 3R06A 3FONA 4D3CH 1U2CA 1SBBA 3S6CA 1A6AA 5FYJL 3OPZL 4ZYKB 1NC2D 4DGVL 4WVRA 4F15B 4FXKB 5M94B 5F7DA 1P4LA 1U8PB 1UWXH 5IBLC 1NCNA 4JLRA 5IMKA 4JO2L 1LD9A 5E6YA 5IVNA 4OV5A 2Z93B 4KJWC 2XT1B 1F4WL 5I8KL 3CUPB 1INEH 4WW2F 7FABL 4I18B 3WN5C 2VXUH 3UX9B 2W9DH 3V5HB 5BMFH 3MV8D 1CDYA 4WUUB 4YXHH 2HVJB 4JN1L 4KHTL 2IAMA 1NANI 1MCJA 4NM8L 3GBNL 4AEFA 4WU7B 1XZ0B 2Z31C 3EOTH 3EDJA 3UTSE 4KI5E 5DJAB 4ZUWA 4XBPB 3SE9H 5C71A 4ODHH 1BQUA 1KIRB 2WWKO 2ZUWA 5H37H 2CXKA 3AS1A 4D8PB 3GSQA 3MGOA 1ERNA 2PO6A 2CSPA 4R0LA 2AJUL 1UZ6F 3WS6A 2A73B 4ZFZA 1UFUA 4MXQD 4UILH 5L88H 1KCUH 1MCPL 3VXUE 2AJZB 5CSZA 3RZCA 2NTSP 3RL2A 1CDBA 1YEIL 4ENEC 5B38G 5IIEB 2DQCH 2W91A 3MODL 3BI9X 4X9BA 1OPGL 3RDTD 4GQPH 4Z7QF 1I7TA 5I1DA 2OTWA 4I48A 1YYML 3T4YA 1ACYH 2C7UA 4OLYL 1RMFH 3OKNA 3PDOA 3VWKA 3DVIA 1IZKA 3PG2A 5DEFB 3DGCR 4JJHA 1OY3B 5EOCJ 5IVZB 3QCUH 4PFEA 3MOQA 3NN8B 3GHEL 32C2A 1OD7A 4LGSB 4OCRH 2XYCA 5IBTH 2HKFH 2CDEA 5GSVA 2XY2A 4K3JL 3RHWF 2I5YL 4L3EA 3KXFB 4FNLH 3VH8B 5AYQA 3ZKMC 3IJYA 4R97B 3PL6C 3RGVC 4HJ0C 4HAFA 3QDMB 1CYGA 1I1YB 3HNSH 3LY6A 2QR0A 3UJJL 3QNXA 4HSQA 5D96C 3LDBC 4Z0XA 5EOTA 2APVA 2IF7A 3QWQB 1U6AL 5DRWA 4IMLB 4PRPD 2VDQH 2MHAB 2BNUB 4OIBA 1IKNC 5B3NA 3GJEB 4PBXA 4FQ2L 43CAB 3FB5A 4OI9A 4PB9L 3BGMB 1NEZG 1I3UA 4JFHD 1SJEB 3CGTA 5KOVC 4D0BA 4LCCA 3ETBF 5F9DC 4XCCL 1T0MB 3GBML 2R4SH 5KSBF 3C6SB 3NH7L 4KKCC 4NUJA 3BIBX 4R2GC 4LSVL 3AXLB 2NNAB 1F97A 1OGAA 1R3HA 4DVBB 3T0BA 5CEYA 5DUBB 4LDEB 1EO8L 4HPOL 2QSVA 4TNVK 4XMKH 1WEJL 1BZ9B 4YO0B 3ZHDA 3NCFB 3V0WH 3TZVA 4UB0L 4GRWF 1F4YL 2BVYA 2X05A 1VFUA 5DVOA 1RJZA 3BMWA 4Z78A 4XP6H 1K3IA 4U1LB 2VR4A 4MQXC 2FJFB 1JWSA 5DD3H 4CMMB 5EO9B 2R56H 3DVGB 5B21A 5ILTL 2VC2H 2F54D 5FF6A 2XG4A 1XF2B 2ICWI 3G6JF 1T1WB 2ZCKH 1NGWB 2C4FU 5BV7H 1QFWH 3UTQB 1DUYB 4L1DA 3FZUD 2D03H 1P7KA 4M8QA 2GSIA 3BKCL 1JZ2A 2VZSA 2P7TB 3F7PC 4YHOH 5EIVA 2F53A 3F7VB 3JV4B 4P2RB 5ISZD 3DBXB 1L0YA 3NFNA 3IU4H 2AAVA 5J6GB 1P4IH 1K6QL 4CN4A 5IVXF 4PP1C 1CU4H 5TH2B 1A6UH 3MGAA 4HS8H 1RULH 5FGSA 4EVNB 4JFHE 5BOPA 1QZ1A 4M5YH 2HLAB 4XVJL 3O4OB 5IMMA 3CFBB 4KMTL 1BFOA 3BZ4B 4R8WL 4TVSa 1EMTH 3EZJB 4NKOA 3W82A 5J13C 3MLSH 2Z9TA 1CFVH 2VE6A 1JI2A 4JG1H 4GG6F 4X4ZA 1G9NL 4BH7B 4PJDE 2ZUQB 3O6MH 4GG8A 4EQ2A 4Y4KA 2CXGA 3ZDYE 3EFDH 5E6ZA 1MHEA 5E5RB 3U7WL 4ELKA 1AIFB 4TVPE 4W68A 4MLIA 3MGTB 3BE1L 1GGBH 1MVUA 5EB9A 1KFAL 4ODTL 2NY1D 1FIGL 3I02B 3U1SL 1A1MB 2GITB 3DVFA 2VH5H 3BIKB 5B39G 5GGRY 5CP7B 3RWHB 2PO6D 3TCLA 4NQEA 4EXPX 2J1KA 3BAEH 4GBXD 4EDXA 2WV3A 3GMNA 5F7WC 5FECA 1F90L 3P4OB 3SEPA 3QAZC 2UUDH 2PYFA 3RZCD 3ZDZF 3BPLC 5ALCH 4KK8C 5EZIH 3MLXL 2OR9L 4JFPA 5ISZE 4XCNB 3BEWA 2P44B 3SQBA 3IAQA 1K9TA 2XKSA 1N6VA 5H2BA 2E7BA 4MAYA 1OL0A 1LO3H 3TYGH 2QEJA 3FFCA 5T1KB 4Z8FL 1IKFH 2H1PL 4GW1B 1FL3A 3STBA 4KRMB 5KVFL 2YSSA 5DHYA 1FN4A 3QQ3B 3IDXL 4G6FB 4IOSD 5F96H 1DQLL 1EEYB 3PWVB 3U79A 5IK3A 4OLZL 3ALPA 2FGZA 3CFCH 4J3WA 4P2OC 4XBEL 5GGSA 4ZTPH 4L3ED 4M93C 1M05A 4TVPH 4K8RL 4P9HH 1J1XH 1B0RB 3T1FB 5DUMH 4YDJB 1OB1B 3GMQA 4MNGB 3S5LG 3FOMA 4NKMA 3KYNB 1QA9B 3IETA 1NJ9B 3QWOA 2XTJE 4D9LL 1F02I 4JY6A 2C1OA 1GPOH 5EWIH 2DICA 1BGXL 3CVIL 3MFFB 3CFJA 1A3LH 1XGTA 5E99H 4KTEL 3QIUA 4NRXA 1U3HA 3RNQB 4AEEA 1RHFA 5EC1B 3AREC 1PVHA 4JFZH 3HE7A 4LP5A 4GXVH 3K4AA 4HGKC 3OXSA 3QEUA 2AI0L 5T3XH 1FGNL 3TIDA 1AXTH 4FMFA 4Y1AD 3ZE2F 5I30H 3DURB 5E8NA 1TJGL 3OAYK 2A6KA 4CU8A 5INDB 3HG1A 1QVOA 4QXUH 1VEOA 2VN7A 1JTPA 2DI8A 2VITB 4Z95L 4HMDA 4Z5RA 3RWJA 1AQDA 2R1XA 4P4RA 3LH2H 1OAXH 3SKNB 4CNIB 1NAKL 4KY1L 3SDCC 3WNKA 3KYKH 3L3KB 4GH7B 5HGBA 3TZVD 4QXWA 3ZO0A 2WIIB 2P42B 1E6OL 3EDKA 2FJHA 4WI4A 5JW3L 4J8RA 3W81A 1K4CA 5K9KA 4LDOB 5I74B 1DBBH 3BZFB 1I1RA 4JQVA 3HC4H 3WIHH 3FB8A 1HNGA 4ZXBD 1RD6A 1ZA3B 4W6WB 5L2KB 4JZNB 2P5WE 3V6ZA 1XF5B 4APQC 1DVFB 5HHOA 4UU9B 3QZWG 5D1ZA 5FIEA 2MKWA 5DJDB 3VXNA 4A6YB 1KCSL 3TA3B 3CVHA 2EDLA 2EXYD 2A1WL 4OCNC 4MJIB 3TV3H 5E0QA 4CW1A 4UNTA 1SYSB 4NWTH 4PJIB 3WXWH 2VDKL 3ZZ1A 4UI2A 2QQKL 1T0NA 3DNKA 2P8PA 1KLGB 1DFBH 4R7NB 3VFOA 3W0WD 3O9WD 2P5EB 4LCUA 4PJFE 1H3XA 4U1HB 3RVXC 1FIEA 1NAMH 2A77H 4N0YH 3M45A 4P59H 5GS0C 2WP3T 3VWJC 4NO0B 2HFFA 5EZLA 1UVQA 4I5BB 2NY2C 4RMVA 3MLPA 1F6AA 1CGYA 4YDIL 3QIBB 5F7HA 1CBVL 1RUMH 1OAYL 3QUXA 5DURB 1MRDH 2E27L 4Y1AE 4Z7UF 2ERJC 4I9WD 4M7LH 4Y4KD 2VLRA 2VWEE 3U30C 1IFHL 3JTTB 3ARXA 4H1LG 4OFKA 1KPVB 3VXQB 1AR1C 4NZRH 4KTYA 3W2DL 4JZJA 1I8MB 5GISH 3D3VB 3WD5H 3WIFA 2FX9H 3L3HB 1NGQH 3MBXL 4G6ML 5ECJE 3O11B 3U6RA 2X6MA 4HS6A 4LMQE 5ID0B 5IW6B 4LGPB 3O3AB 4LNRA 3VI4E 2C4FT 3L5XL 1W72A 1YYLL 5JLZB 5F7MC 2P8LA 1KTRL 4LEOA 5LXGL 4OZHA 4RWHA 2IGFL 4EI5A 1QEWB 1IQDB 3IDNA 1CR9L 1B3JA 1CFQA 4MAYD 3MLUH 5DVNA 4HFUL 3FFCD 3W0WE 1GGCH 4BA8A 3HRZB 5F70A 4ZNCD 1VFAA 5EU3A 3LHPH 3HNTL 3WNNA 4HUUB 4YXLH 1SJXA 4JFFA 5TE7L 4LVNB 5FV1L 3QJHA 4NQDB 3E8UL 2FATL 4WCYH 5T1DL 4LLUA 5ESAA 1PYWB 3WXVH 5JHDD 3UO1L 4WEUD 4B5EA 3E6HB 2YPLE 4I9WE 4XP9H 4KC3B 1U2HA 5EU6B 4OIIH 2BDNH 3MPCA 1AO7A 2IPTH 4F8TA 5EO0A 5CJ8A 1TZIB 1K5NB 3DROB 4LCWB 2AEQL 5EBMA 1IGYB 1P5UA 4P5KA 4Y4HD 4X9HA 4HUVB 4WUKL 2KL6A 1JGDB 2IANB 3T0ED 2DL2A 2YPKA 3CJJA 3ES6B 5IJVA 1J0KA 5GRWA 4ZNEE 3SOBH 3P4MA 3S35X 1EUTA 4YK4C 2FEDD 2ICEB 3HE7D 2YZ8A 1BREA 4G8GE 2BCKB 4TUKL 1B2WH 4X7TB 4XP1H 1YN7B 5I1GH 1BIHA 4M1DH 3JXAA 4MDJA 3UBXG 4NNXA 3WUZA 2LQRA 1IM9D 4EN3D 1G7LB 1I7UA 2H9GB 1ZLVH 5FO8B 4XX1G 3SGJA 4JGMA 4IIQC 2F74B 3DIFB 3HUJF 5KSVB 3FQWA 4NNYB 3FO1B 4JB9H 1KEML 4QHLA 1Q0XL 4P57A 3MA7A 3L95B 5DMGD 2HKHH 4OZIF 5JHDE 4ONGH 2ADFL 5HHOD 3UAJD 2XQYG 4XPGL 3FQUB 1CFTB 2HVKA 3WFCH 2J4WL 1HIMH 1RUQH 4YAQB 3BP5B 2E8YA 3FRPG 1TXKA 3LKSA 5ENWB 3IDMA 1S7RA 3MCKB 4BZ1H 4UINL 3KYOA 3JWOL 3F12B 2NY6B 3AU1A 4XNZB 3ULUL 1CICA 3ZKND 1GOHA 1OSZB 4UTBH 4X5WB 4F80A 3O2DH 3EDEA 4Z7WF 3T0EE 4X6FB 1W0VB 3DRQA 2FSEA 4OBSA 4Z7VF 43C9B 3B8SA 4ZD3L 3ZTNL 1P5VA 1GAFL 3ULVL 3PHOA 3DTXA 4PJEB 2GK0A 2W9EH 2WSKA 3L5JA 4DUWA 3VJ6A 1DN2A 1Z5LA 2GTWB 4LSPL 4MDIB 1G7JB 1UM4L 1U95B 3W9DA 1ED3B 3KPMB 1WT5A 1RPQA 3A67L 5DQDL 3STZB 1E4XH 4MNQD 3BDBA 3BO8A 2E7LC 3RA7H 4P3CL 1OHQA 2A74B 3MRHA 1S8DA 2DQFA 4OZFA 3CVHL 5DHVA 3D39A 3U4EB 4P46C 2YWZA 3SKMB 4PP2B 1U8LA 1YEEL 1CDUA 2CPCA 2VQTA 4H26A 2HTKC 5FOJA 2X4OB 4CN6A 5FGBC 5L9DH 2O5YL 4ZQKB 5DK2B 3JTSB 4ZTOH 4Z7QE 4UTAH 2Z91A 1OP9A 1PDKA 1A7BA 1T7XA 4PRAA 1JYXA 3X3GL 3STLA 4EI5D 5HYEA 4WW1A 5I19H 1CDIA 2XWBB 5J12B 3MRDA 4HIJA 5HGHA 4YHYC 1FFQA 3LEXA 3H7BA 4A2MA 2HG5A 4BUHA 3MNVA 3ARGA 2UWEE 3MJ9A 1U8QA 4UAOC 1RZGA 5KVEH 4E0RA 1DQML 2WINA 3V7AE 2UY6A 3UTTB 4S1DC 3V4UL 4TNVF 5JNYB 1FZJA 3VXPB 5GGTA 3NCCB 3U7YL 1UACH 4X80L 4XI5D 1RIHH 4L3CB 4NHCH 3B5TA 5GZOD 3GB7A 2WLZA 5HI4D 5IW1B 3C08L 1S7UB 1MFAH 2VLLB 4Y5YC 5BJTA 2A6IA 3ZTJG 5CWSA 1F11A 2Q8BH 2ATKA 1AO7D 2FRGP 4X6EB 3L7FA 4MNQE 1CK0H 1B0GB 3BN9C 1W72L 2BMKA 1R5WB 1NGYB 1XF4B 5DD5L 5HHQA 4M02A 3AB0C 3FT4B 1ONQA 3BVNA 4UOJA 2AP2A 4X98B 5HVHB 1M6OB 5BCAA 1NC4D 4FQXA 2W0LA 4C56A 5KSBE 1WBZA 1JFQH 4M3KB 4PY7A 3LS4L 2YMXH 4RFNB 3ZLQC 3LD8B 4ZUSB 3K4ZA 3CAFA 5ABDE 2FZ3A 2XI9A 1NGZB 1M71A 2IH3A 4KROB 5IEKB 2FO1A 4DGYL 4L4TD 4JM2F 4EEEA 2R8SL 1Q9LA 1CL7I 1NBZA 3LKQB 2W60B 1G7IB 3MQIA 1V05A 1DQDL 4I2XA 4GRWE 3HI6H 3R1GL 4N5ED 1MHHB 3VFVB 2EIZB 1DR9A 4WV1C 2JB5L 1CTOA 2H2PC 1WWCA 2NZ9C 5JQ6H 1V7ML 1ITBB 3G6JE 4G5ZH 1AHWA 1S7TB 4YEEA 4FN0A 2K7PA 1WLHA 4X7CC 5C7XH 5DF0A 1T21B 5SWSA 5E2UL 5DRZA 4OLWH 3DGGB 4N8CL 3QH3A 3LRSB 5CD3A 2ENYA 2R23B 3K80A 3WS3A 1VA9A 4CDGC 4YBLC 1KYOK 2ADJA 1GZPB 4G6JL 5IVXE 3RWEB 1IEAA 1I8KB 1FNLA 4ZUUB 1VACA 4I4WA 1PD6A 2DIBA 5INCA 2VL5A 3HRPA 1CICD 4FQCH 5D6CA 2WBWB 2EC8A 5K9OA 1OAZL 4JG0L 4K3EH 4X0KA 4NP4H 4FG6C 2BFVH 4GG6E 5I1JH 1A7PL 5ETUB 4BSWB 2AJ3B 4KJQC 1BJ8A 2VLJB 3LQAH 3RQ3A 2ENSA 4L4TE 2B1AH 4JCLA 4QGTA 3WO3B 4YHPB 3KLDA 5CMAA 5D1QD 3HPLA 4DKFH 5EU4B 3IJHB 4RZCB 5TE6H 2Y7QA 2WBJD 2ZPKH 2FIKA 3G5ZA 3RDTC 3VFGL 4QWWC 3QUYC 3O2WL 1AXSB 3T0VA 2OXHA 1OP5K 3QXAA 1LP9E 4EUPH 5ADOL 1OW0C 3MLWL 1MAML 1JNHB 5DXWA 2A6DA 1RJYA 2R29H 4UT6H 2EYSA 5BVJA 1FE8H 2CK2A 4P2YA 2W59A 2XIDA 1S7WA 3QUZB 5CILL 5IM7B 3DUUA 4X5LA 2JJWA 4S1RL 4GKSA 2R1YA 5E8EB 4PRHD 2L7UA 3ZDZE 5AZ2L 1CGTA 1ORQB 1NFDB 3SCMA 1Q38A 2NX5A 5GSRA 5CGTA 4IOIA 3NZ8B 1INQA 2I9TA 3NA9L 5ACLA 1HXYB 3GNMH 2B8OT 3BKJH 3L5WB 1S9XB 4PLJD 2G2RA 1T5WA 3QG7L 1H5BC 1KTDB 4PJ5D 4Q7DA 3T08A 3BZEB 3O4LD 1GIGH 5FO7B 4P2QB 4MQ7B 1J8HA 3SDDC 4NOBA 3K46A 4M9OA 1S5HB 4BFGA 3MRFB 1Q94B 3BRFA 5JW4N 4G8EA 1MFEH 4HPYH 4ZO9A 3CFEA 4PTUA 3IFPA 4U7MA 3DWTA 4AEIH 4G7YL 2DBLH 4OZIA 5FV2A 4R9HA 4OI8A 3WHXA 4WGVB 1M4KA 2XG5A 3S37X 1IQWL 1GHFL 2CJUH 3S97C 1LO0H 5FA4A 5A2IH 3HI1B 5DRNA 3VGAB 3MROA 1OAUH 2EDRA 1IAIL 1MI5A 1MELA 4MA8H 4OUUB 1AGBB 4E41E 5F6IB 3MNZB 3WSQL 1PZUB 3OZ9H 1T1YB 1CT8B 3BQUA 4Z7WA 3EO0B 4F58L 1A7QH 2R4RH 4ZYKA 1G9NC 4FXKA 1U8PA 4Y16B 1X5GA 4PJAF 4PRHE 3ZE2E 3MJ9L 5B4MD 2XA8L 2ZP0T 2IQ9H 1FPTH 4H88H 3CUPA 1KJ2B 4I18A 4RMSA 3GI9H 3V5HA 1R3IH 4LCIH 2ESVA 1YN6A 2HVJA 5GGTL 2G75B 4L9LC 2KH2B 4PJ5E 4WU7A 1XZ0A 4NC2B 3QCTL 5F9OH 4RMQA 2OJZH 1ZKAA 3DSNA 5CEZH 3MJ7B 5DJAA 4XBPA 2DWEB 4R4FL 4HUWB 4O5LL 1KIRA 4U31A 3FTGB 5CJOH 4D8PA 1ZA6B 3KPLB 3BW9B 1SEQH 4Y5VB 5ELIA 3WLBB 2A73A 3RKPA 3QNZB 4IS6B 5T5NG 5DHXB 4CMHB 2EEBA 2MPAH 2ZUSA 3IGAB 4LRIA 2NR6C 1T2QL 2KKQA 2AJZA 5CCKL 3HR5B 3ULSB 4X6DE 3ZKSD 5IIEA 4V1DE 5GRVK 3NFPB 4J3UA 5JW5B 4MAUL 1E4XI 1E6JL 3GI8H 1PSKH 1PKOA 1X7QB 2N7AA 2JCCB 5D7LD 1HWHB 1QFUH 1L7IL 2IAMC 1DBML 5DQ9B 5IVZA 1S78C 4DK3A 1VDGA 1ZVYA 3NN8A 4OD2A 1QFOA 2NY1C 3QRFM 2YC1B 4K8RC 1A6TB 4HK3J 3LZFH 3WNOA 3KXFA 3VH8A 1BBJB 4Z7UE 4BSJA 5FYJU 1HQRB 3TJHC 1N3NB 5D1XB 4DVRH 2PO6C 4R0LC 1PJ9A 2DMBA 1I1YA 4ZPTB 4HDIB 5GJSH 3WS6C 1I75A 1V3MA 4MA1B 5JUEH 5DJYA 1ZVHA 1KIUA 4RMUA 3RZCC 4IMLA 1YPZF 5IHUL 2MHAA 2XZCH 2BNUA 1GC1L 2HRLA 1BBDL 3GIZL 3ZKXB 4KJPC 3GJEA 5F44A 5I1LB 5D2NE 1I1AD 2VR9A 8CGTA 43CAA 5GRVL 4F33B 3BGMA 1SJEA 2YUVA 3VWKC 4N0CD 3PXHA 4C83B 1CDJA 1JPST 2HT3D 1T0MA 3RWCB 3C6SA 4MJ6B 2E9WA 1WFOA 4I3RL 1ZK9A 3AXLA 2NNAA 3IFLH 4DVBA 2Z8SA 5TE4H 2EEDA 4QXGL 1A2YB 5DUBA 3O0RH 1MIEH 3BJLA 2JKXA 2VXVH 2RQ8A 5D7LE 3H3PH 4FZ8H 1BZ9A 4JPKH 4LSQL 4YO0A 3O41B 3VXTB 1J8HD 4K2UH 2IPUG 5E8OB 4D9RD 4P3WA 4UT7L 1TQBB 4U1LA 5KANI 1FQ9C 2FJFA 5JIHA 4CMMA 5BVPL 5EO9A 3DVGA 5GGQH 4ONOA 1XF2A 1SM3H 3CX5J 1CFSB 1T1WA 1NGWA 5D9SB 1F2QA 4I0CC 4LVHB 3T2QA 1OOAA 1DUYA 3F58L 1ADQH 4JZOB 4LCCC 1YUHB 1ULVA 1ZANH 5GIRB 4N1CA 3F7VA 4HZAA 3JV4A 4HBQA 3VDCA 4P2RA 1WF5A 1IC4L 1MI5D 3DBXA 1A21A 5F8RC 2C5DC 1X5LA 4OQ1A 3TH4T 1EGJH 3OX8B 4HV8B 5DJ0B 4OLVH 5J6GA 1IGTB 2ED7A 1S9YB 1F3DH 1JJUA 4QRPB 5TH2A 4KKBD 3MXWL 1J1OH 3MXVH 1QRNB 4EVNA 3BD3A 2HLAA 3TZVC 2X44D 2MMXA 3CFBA 4FA8A 3G5VB 1RK0A 5HHVH 2D7TH 2QBWA 1UKTA 4NZJA 3BZ4A 4O4YH 3BPNB 1YEKL 5D93C 2HFTA 4PD4K 5F9WB 1BWMA 4JO4H 3FOLA 5LBSL 4TULH 4GRMB 3OPZH 5TPWL 3P30L 4TNWF 4WUUD 5EFIB 4WEBL 1A64A 1AIFA 5GS1B 4LGRB 4EDWL 3HUJE 3P0GB 3MGTA 3TO4B 4JO2H 4OCLC 1DDHB 1HSBB 4ZMAT 2FLRT 4NQCD 2DQTL 4U1SB 3KPPB 2IBZX 1U0QA 3VD7A 1S7QB 1F4WH 4HXAL 3BKMH 1LO4H 5JXAL 1OP3K 2NCMA 1A1MA 2GITA 3BIKA 4JPWL 5JW4Q 5TQ0L 4M62L 5AZEL 4OCSL 1FDLH 4JN1H 4KHTH 5CP7A 1D6VL 1IILE 2D0GA 4DJMA 1NCCL 3NCBB 4KJYB 3DO7B 3NPZB 1RIVL 3P4OA 2X4TB 1JYNA 5IOPB 2GJ6B 2I24N 2VAAB 4LIQE 4XCNA 2PR4H 5MI0B 5GRXG 4U3HA 2JELH 3S5LB 4Y4KC 2DWDB 1LEIA 3OAZH 5T1KA 4YUEH 4GW1A 1MCPH 4O58L 2R0ZH 3CFDB 3NA4A 5A16B 3QQ3A 4I3SL 1YEIH 4MJ5B 4Z7VE 3MODH 1EEYA 3PWVA 2X7LB 4QTHB 4OT1H 3RKDD 2MSPA 1OD9A 1FH5H 1YYMH 3S96B 1D3CA 2AABL 5E2JA 3NCYP 4OLYH 1WZLA 3QDMD 1B0RA 2HN7B 4H8WH 2ZJSL 4WUUE 4YDJA 1OB1A 2C3VB 2J12B 4MNGA 3GHEH 3KYNA 5C2UB 1QA9A 1XIWD 3F7RA 3VCLB 1ZT7B 4K3JH 2I5YH 4LAJH 5D70L 4NIKB 1UJTA 4NQCE 2KQMA 3QPQD 3VGDA 4MAYC 4XAWH 3O2VL 5JXED 1VADB 4WWID 1CLOL 3SBWA 3TBWB 3UJJH 1KPUB 2WLYA 1SEBB 4MMZC 1WCBB 7CGTA 3RNQA 5EC1A 5ADPL 4OKVB 2QADC 2R9HD 5EZOH 4PRNB 3QZWB 1AJ7L 4GAYA 3J8F7 2VZUA 1X5JA 1UGNA 3DURA 4FQ2H 3GIVB 1MQ8A 5INDA 2FB4L 1EEUA 3MRMB 4PB9H 4XCEB 2VABB 3EHBD 2VITA 1F5WA 3SKNA 5FKAB 5K9QG 4CNIA 3V7AG 2GJZB 3GBMH 5F1IA 3L3KA 2ZNWA 1PX3A 2WIIA 2IEPA 4LSVH 4X8JB 4MSWB 5LWYL 3CMGA 1YMMD 5F88B 4P4KB 3BZFA 3L6FB 1F4XH 3C6LB 1EO8H 4CBPA 4DEPC 4FFYH 1ZA3A 2OJEB 1WEJH 2YD4A 4LASL 4Y5XB 5L2KA 4JZNA 1BQSA 1XF5A 1DVFA 3QIUC 4UB0H 4UU9A 1U3HC 1G6RH 2H32B 4HJGB 5DJDA 3QDME 1ZLSL 4LQ1A 1F4YH 4K71C 1KSRA 2LU4A 4YGAB 4A6YA 3HE7C 3TA3A 3HAEG 3HE6D 1JGVL 4JJ5B 4P2RD 5DJCB 3MCG1 3JWOC 1EHXA 1YA5A 4H1LB 2DI7A 4PJIA 3ULUC 5C9JB 5SWQB 1JK8B 1KLGA 3L3DB 1I3GL 4R7NA 3IJSB 1F3DJ 3TT1L 1PZ5B 1Z3GH 3BKCH 4U1HA 4FFVD 4M7JL 4XXCA 3VFMB 5JOFA 1TVHB 3C9NB 4NO0A 3ULVC 3SKJL 1JYWA 1EPFA 4YHZL 4AY0A 3OKMA 4ZS7H 4I5BA 1EFXB 3CIQA 4F7TB 1K6QH 4DK6A 3QIBA 1M7IB 4ZO8A 4JQVC 4DKEH 4RISL 5EUOF 4I0PB 3D48R 3QXVA 3IRZA 2J5LC 4DCQB 3UAJC 2J6EA 3JTTA 5D1ZC 5FEBA 1FFOB 3OF6A 4Z9KB 1RJLB 5IJKA 3FAXA 4R26L 1KPVA 3UYPA 3VXQA 2V5MA 5F21B 1G9NH 5C6PB 5A3ID 2LAAA 2R0WL 4M43L 1I8MA 5L0QC 3P9LB 2VDPH 5M95B 1U58A 3JV5A 1YMME 4QRUB 3CU1A 3D3VA 2ZSWB 3ARBB 3L3HA 4HIHB 3ZKNC 2FNBA 3CLEH 3U7WH 5ID0A 3NCJL 5IW6A 4PJBF 3B9VA 5DSCB 3BE1H 3O3AA 3LPFA 4AK1A 3P11L 3DJ9A 5JLZA 1KFAH 4ODTH 4JM4L 1FIGH 3U1SH 4JCMA 1QEWA 1IQDA 3QUXC 4HIXH 4EKXA 1MEXL 3S34L 3ZSSA 5L7XL 3BKYL 4PIRF 4TUOB 1IGIL 1Z6JT 5E08H 2YS4A 5T1KD 4XPTL 3HRZA 1F90H 5DMIL 1WBYB 1WFTA 2MFNA 1U8NB 4HUUA 3MLXH 2OR9H 2B5IB 1UCBL 4JZJC 2XRAL 4NQDA 3WNPA 4OF7A 3VGHA 3ZT7A 1K3ZA 2V5RA 3KPRB 1PYWA 2H1PH 1YEDB 3E6HA 3DO3A 1QLEL 1TZGL 3IDXH 5EU6A 3UBXB 5AG8A 1DQLH 1MREL 3PGDB 5GZND 2ED8A 4YDLC 3VD3A 3MLRH 4OLZH 1UENA 4PV8B 1TZIA 1K5NA 3DROA 4POUB 4XBEH 1A14H 3KAAA 1VHPA 3BMVA 5E70A 1KT2A 4JRYD 2YKLL 4EI5C 1IGYA 3PWLB 3HMXA 4K8RH 4O9HL 4CU6A 3MRGB 4HUVA 1YEFL 4KK6C 2IANA 4L5FH 3ES6A 1CE1H 1GGUA 4PJHF 1TJHL 4DAGL 2X1PA 4U1GC 1K4DB 2ICEA 5KS9B 4QRRA 4JKPL 4D9LH 4PY8I 2BCKA 4X7TA 1YN7A 4ODWB 1JNJA 1I9RL 4GXUN 2D2OA 3T65B 2WANA 4DQOL 1MPAL 1BGXH 3VMPA 3CVIH 1O7SA 1CG9B 4LHJB 1KTLB 3SQOL 4F9PA 4KTEH 4L4VE 1G7LA 5GZOC 1CWVA 2FGWL 2H9GA 4HXBL 1CXEA 1MHCB 3JVGA 5FO8A 1EV2E 3JUZA 4L8SB 4PV9B 2F74A 3DIFA 2DL9A 2AI0H 1YNKL 5KSVA 1FGNH 2JJTA 4XPHL 4NNYA 5GGSY 3FO1A 1ZV5A 2DJSA 4G80B 2CUIA 2WAHA 3OB8A 5C0RL 4ZUTB 3L95A 4Z95H 5JIIA 1CGVA 3P9MB 4HT1L 3K2MC 3GJFB 3P0VL 1KV3A 3LCYA 4HIIB 3TBSB 4QT5B 4A2LA 4OM1L 3UTSB 1E6OH 3FQUA 3NPSB 1CFTA 5JW3H 1JE6A 2PYEA 2QSQA 1VKXB 3HPJB 4OZFG 4YAQA 3BP5A 5DA0B 4BJLA 1JP5A 5ENWA 2XZQL 3BZDA 4H25B 1OLLA 4MJID 3MCKA 3S37L 4JRYE 4U2ZA 3MREA 2D9QB 3L3GB 2CIIB 3F12A 1I3VA 3H2WA 3REWB 1JZ5A 5D5MF 2WWMD 1WWAX 1HXMB 1QSFB 2P5ED 3SGJC 1OSZA 3VXUB 3BIAX 4X5WA 2VDML 1JHTB 3JV6B 4JO3H 4X6FA 4XHQA 1W0VA 2EICA 4NO0D 2A1WH 3ARDA 4PJAE 43C9A 3D6GA 3MCLL 5C86A 2VDKH 3UTZB 4PJEA 2LU3A 4U6HA 2EE6A 4ZOAA 1YNLL 4XH2B 4OLUH 1QQDB 2EDXA 5DURD 3OAYH 3BYYA 2CLVB 4MDIA 2GTWA 4YFDB 3G9AB 4XNUH 3BEVB 3VRLE 1H3TA 1G7JA 1ACZA 1U95A 3W5NA 1ED3A 3KPMA 1EVTC 1BLNB 1BHGA 4LEXL 3QDGD 3OF6D 2GK2A 2E6JA 4YDIH 2A74A 2EO9A 4ESKA 4A6YL 2VAJA 1ZHLB 1L9MA 3TNMB 3QDJA 3U4EA 3D2UD 2W38A 3KR3H 4OJFL 5ESQB 3D3VD 1L6ZA 2HH0H 3SKMA 4PP2A 1ETZB 2V9QA 2X4OA 1CICC 1OTSD 1IT9L 5C07E 3E0GA 4V2BA 5BV7B 3NAAL 1F42A 4ZQKA 2AEWA 4U0QB 3JTSA 1H8OA 1DANU 2ZUYA 1X4YA 2OBGA 3FRUB 5I71B 5EORL 2L4OA 3B2VL 5KTEL 1WSST 1CLZL 4BQCA 4J4PA 3MBXH 1EK3A 2XWBA 1OWWA 1TJIH 4F7MB 1B88A 3DSFL 1NQBA 5CZVL 3L5XH 1FSKB 1WT5C 4IDLA 3G6AB 1YYLH 2P5EE 2JIXD 2D7OA 1IMHC 5HYSG 2J6EL 3X17A 3RU8L 4YR6B 1PAMA 3JUYA 2WZPD 2IGFH 1MIMH 4ZFGL 1BD2D 3UTTA 5JNYA 2YUWA 2AEIT 3VXPA 2J7LA 5BS0E 3WFDH 5CSGA 3GSOB 3QB7C 4L3CA 5IFJB 1EBAA 3CMOL 4YX2L 4NN7B 3MV11 5IW1A 1G9MH 1S7UA 2VLLA 5EU6D 5C0AD 1D7FA 1YPZE 5TE7H 1U92B 3W5MA 4X6EA 3QDGE 2E5EA 3E8UH 1B0GA 1J88A 4XZUB 5T1DH 1XF4A 5E2WL 2HJFB 4LCWD 1P69B 1QLFB 3K4DA 3MBEB 3FT4A 3H9YA 3TP4A 3UO1H 3EO9L 4HWZB 3C5SA 2QSCH 2P45B 4X98A 2Y5EA 1M6OA 3C60D 1MJ7L 2XZAH 2CUMA 3ARGC 1RZ7L 3HC3H 1ZLUK 5HY9B 4QNPF 3PABB 1R3LB 4GFTB 4FQLL 2NY5L 5C0IB 2OMBA 4ZUSA 2VXSL 2BOCB 1QR4A 1ZT1B 3DV4B 4ODVH 1NGZA 4WUKH 5IEKA 2K7QA 1UYWL 2B0SL 3LKQA 2W60A 1G7IA 3SDXF 5FUOL 1F8TH 4R90L 5D8JH 1W0WB 4KGJA 3OR7A 3R4DA 3OBAA 1U8OB 1BM3H 3VFVA 2EIZA 5DJ6B 1C8PA 4PJDB 1JL8A 25C8L 2ZKHL 1BD2E 1U9KA 3D0LB 1S7TA 4FFZH 1QFHA 1T03L 4RGMB 3PHQB 1T21A 2EZ0C 4S1QH 3HMXL 2V2TA 1VFBB 1EEQA 1BQLH 3DGGA 3LRSA 2R23A 4FQXC 2FBJL 3PWNB 4JRXE 2FHBA 4RFEB 5C0AE 5HDLA 4XNXH 3SDAD 4BFEA 1F3RB 3MLYH 3RFZC 5TFSH 1R0AH 3RWEA 4ONFL 1I8KA 1ZS8B 2YEZB 3PUCA 4ZUUA 3RJQB 1I9IL 4LCWE 4ZS6D 2VKXA 1MRFH 2ADFH 3RP1A 4XPGH 2J4WH 1FAIL 1VERA 1MQKH 1UXSB 1SYVB 3ORJA 5ISZB 4J3SA 5ETUA 4JO1L 4JDVB 4BSWA 2AJ3A 4U6XB 3JWOH 1AHWC 2VLJA 3IFNH 3ULUH 1KCRL 1UWEL 5MERB 1C5CL 2X1QA 4YHPA 5F7EH 4LVOB 4JEGB 1Z9OA 1GC1C 5EU4A 2WW8A 3IJHA 4RZCA 4ZD3H 1AR2A 4F7EA 3ZTNH 1S7XB 4GKNB 1AXSA 2KBGA 4AENB 3ULVH 1H0DB 4HUMB 4GQ9L 3GKWL 4LDLB 3T0XA 1JNHA 4QTIL 5HPMB 1NMCC 4LSPH 1C5DB 4MZ3A 1HHJB 1UM4H 1AQKL 1NCBL 3IDYB 1PKQE 3QUZA 5DQDH 2FX8L 3A67H 4U1MB 2ARJA 5IM7A 4TN9A 5CHNB 5H94B 1F13A 5E8EA 4YNYB 1GGIL 4CL7A 1RAMA 1NFDA 1HSAB 4NQVB 5GS2H 4NJ9L 2X40A 3CVHH 2XTJB 3VDBA 3I75B 3NZ8A 3WJLA 4J6RL 5JA8B 1HXYA 2Y5TB 4N9OB 1NBYB 1YEEH 2O61B 4XNMB 3L5WA 1S9XA 4N9GB 4J4PD 2GT9B 1L7TH 3MJ8B 1KTDA 4O2FB 5FO7A 4P2QA 4MQ7A 4QHKJ 2O5YH 2D7PA 1S5HA 3O6KL 3MRFA 1Q94A 4WI3A 3VFNB 1BFVL 5A2KH 4GBXB 1NAMB 5LKNA 1MF2L 2UZIL 5DDHB 2ITCB 3BPOC 2AJVH 1JF5A 4W6YB 3C2AL 3I9GL 4BK4A 5I1KL 4KQ4L 4KU1A 2Q3AA 1KGCD 2HT3C 2YD9A 1KG0B 3HI1A 4KTDL 4D9QD 4PGJA 4MA7L 1DQMH 1N7MH 4OUUA 3VXRA 4OCMC 3V4UH 3SCMC 1AGBA 3X12B 1JTOA 3NVQA 1CD1B 1G0DA 3F7YB 3EDFA 3VG9B 3WFEL 4RSVA 4X80H 1CT8A 1AH1A 3WBDA 2PTUA 4GS7C 4OKDA 2P5WB 3EO0A 5I75C 4P3DA 4IRJB 3VRJB 3C08H 2A6JB 3HHRB 2Z4QB 5HI5D 4Y16A 1PFCA 1NBQA 1HHGB 1W72H 3O3EA 5EA0L 1EEZB 5DD5H 2BRRH 2PW1B 4NZUL 1KJ2A 4IDJL 1NCWH 5LGKA 1X44A 5FHAL 3UMTA 1DANT 3MV9E 3ZE0F 1R6VA 4WENB 4PJFB 1O0VA 5HYJA 1U42A 2G75A 2PUQT 5I1CL 3UTPD 3CXHK 12E8L 4NKIL 1N59B 1R24A 4RDQF 3CSYB 4CJ0A 4HKZB 1CVSC 3MJ7A 5DMYA 4XT1C 3TT3L 3VH8G 2DWEA 2E9JA 1QG3A 4JREB 4HUWA 5DK0B 3P0YL 4JRWA 3VI3F 2IMNA 1J0YA 4X7SL 1NL0L 3GMRB 1MCSA 1NLDL 1OF2B 1S3KL 1T20B 4DUVA 3FTGA 4DGYH 2R8SH 5LQBL 1ZA6A 3EGSB 3BQUC 1WJ3A 3KPLA 3BW9A 1LE9B 4Y5VA 3WLBA 3P4NB 3QNZA 4IS6A 3LMJL 3R1GH 3IGAA 5DD6B 4YHLH 4PRIE 4F15C 3HR5A 3ULSA 2JB5H 2BSSA 5IHBA 3EBAA 4WJ5B 2NXYD 3V52L 3NFPA 3LAFA 5JW5A 3CPLB 4YH6A 1X7QA 4ODSL 4I18C 2JCCA 1CXHA 3P9WB 1I9EA 4QLRA 1BX2B 2AXGB 4OCWL 5E2UH 4EZMA 2DMCA 4JVPA 4ZXBB 3QHFH 3VXME 1TLKA 4UQ3B 3M1BB 3K74B 4KRPD 3IXAB 2KZ1B 1ZTXL 4KXZH 5C6TL 1NEZA 4LHUB 4FQJH 4I77L 4G6JH 1UB6B 1CXLA 2YC1A 1A6TA 1Q8MA 5EUOE 1HQRA 1N3NA 5D1XA 5ITFB 5F7UA 4GAGH 1NSNH 2VLJD 4ZPTA 1BAFL 3FQNB 4HDIA 3W0WB 3O9WB 4LRIC 2AERT 4WI8A 1OAZH 2ZUVA 3UTPE 3AM8A 4EBQH 4HWEL 4LLMB 2AQ3A 1KELL 5FDYA 3QFJA 5I1LA 4MCYB 5C8JB 4F33A 3VXOB 3KWWB 3BUYB 2CMRL 1L9NA 2CKBH 2NW2B 4NO5B 2YPLB 4PJBE 2NQCA 4C83A 2EDKA 3QUZD 3N85L 3WDIA 4J23A 4JPVH 4M6OL 1VENA 3RWCA 1YQVH 4POZC 4MJ6A 5CD5C 1NUNB 5MEND 3RKDC 2I60L 2CQVA 4JGUA 5ADOH 3MLWH 1NKOA 4PG9B 5FYKE 4IEFB 3QEQE 2G9HB 4R97C 3WEXB 1UB5B 4P2OA 5I1IL 5CILH 5MEQB 4S1RH 3O41A 3VXTA 2VUYA 5AZ2H 2A9ML 5E8OA 4RA3A 2YD1A 1KACB 4G8GB 1PW3A 4UV4L 3NA9H 3S88L 1AD0B 3WCYA 3I50H 2BHUA 4HFWB 5F9JB 1CFSA 3LEYL 5D9SA 4X7FC 1UC6A 3NCEB 3PQYD 2YRPA 1U8IB 5DMKA 2OR7A 4JZOA 1CGSH 1YUHA 3V8OA 4UZGA 1P7HL 3NOIA 1T6WA 5GIRA 2R9HC 4AM0B 1A4JB 4OGXL 4M7ZB 3QIWB 3MLVL 2AGJH 4D94A 3MRIB 3Q0HA 4M4PA 3OX8A 4HV8A 5DJ0A 3AS0A 1IGTA 4ZAKB 1S9YA 1FFNA 3EHBC 2BNQD 1NUFA 4QRPA 1OP5H 3F5WB 1IQWH 3HZVB 2WUBL 1OSPL 3V6BR 5JHDB 1Q72L 1QRNA 4I0KA 3G5VA 4PJHE 3SO5A 5FYKH 1IAMA 4GO6B 4WU5A 1AY1L 5DZOA 1C08A 5IFAL 3SGEH 3PWJB 4F57L 4Y16D 5C09D 3W11D 1D5IL 1G7HB 5MENE 2W65B 2GTZA 2DTSA 4IHOB 5JOEA 4HWBA 4Q9RH 5HJ3B 3SO3B 3N0PB 2V5TA 4Y4HB 4GRMA 5HHNB 4DFIA 2APBA 4DN4L 5JPMB 1MLBB 5EFIA 1U8MB 1HYSD 5FDWA 1XCQB 4LHQB 5GS1A 3EYUH 3QHZL 3T0EB 1ZAGA 3TEUA 3TO4A 1DDHA 1HSBA 3MJ9H 2KPNA 4U1SA 3KPPA 2XA8H 1LE5B 1S7QA 2VDNL 4WW2B 4PR5B 3GO1L 3CDGB 1LMKA 3CSBA 5GGTH 2DBJA 4B7LA 4FFVC 1IM9B 4EN3B 2OK0H 5MP6L 3QCTH 3PQYE 3WUWB 2Y06L 5J8OA 3LQMA 3O4OC 4UBDD 5IVOA 3DO7A 4KJYA 4LRNL 2X4TA 5CGYD 5IOPA 2CD0A 1L6XA 4R4FH 2GJ6A 2VAAA 4O5LH 3LKPB 4GAJL 2ZUQC 5C0JB 8FABB 3S5LA 5D5ME 2DWDA 3S9DB 2XA3A 4AQ1B 1HE7A 1QBBA 1PEZA 1KJ2L 2BNQE 4Y88A 3CFDA 5A16A 5CCKH 1JHLL 4LL9A 4MJ5A 5LGJB 1WIPA 3MRBB 5A3IC 3MOBH 2X7LA 4QTHA 4MAUH 1E6JH 3OKLA 3CDFA 1UH2A 2DQIH 5C09E 2B2XL 3S96A 4RIRB 5IESL 1J1PH 2FWOB 5HVFB 1YECL 1UM6L 1DBMH 2HN7A 3TWCL 2E6QA 2UWEB 3VFPB 1G9EA 4CN1A 2C3VA 4L9DA 1LK2B 1FLRH 2Q3ZA 4YWGL 3VCLA 4XGZB 5DYOB 2G5RA 3O3DB 2VZOA 2XKUA 5K9QI 4PG2A 4NC1E 5CBAB 4Y89A 4LSRL 4OFPA 1RHHA 1JRHL 2F8XC 1VADA 2DYPB 4X4MA 1KPUA 2HRPH 4FABH 4X6CF 1SEBA 5GXBB 4Z76B 1WCBA 4JFYB 2X9YA 4AG4L 4E9LA 3DOSA 3HI5L 4OKVA 5IHUH 1QSZA 3BN3B 2FJGB 1GC1H 1V5JA 4PRNA 4ZO7A 3QZWA 5AYUL 4MNQB 4PS4L 3B5HA 5F72S 2ATPB 3AMKA 2Y36L 3GIVA 5DJ2B 2WM0A 3MRMA 4K94L 1FFRA 2VABA 1KYOJ 3FN3A 3O3UN 5CUSL 2APXA 5FKAA 1T4KB 2GJZA 5GZNC 1Q0YL 2IG2L 4P99A 5KSBB 3TH3T 4X8JA 4MSWA 4Z77B 2QQQA 5B3JE 2DQDH 5F88A 2ZUTA 4P4KA 1OTTC 4NWUL 3L6FA 3C6LA 5DJZB 3H9SE 4LLVB 4ODXB 2OJEA 4RGND 4Y5XA 1QBLH 4LSQH 3SBWC 5DC9B 4O2EB 3IXTB 4S1SH 2H32A 3S36X 4HJGA 5SV3A 4GRWB 2J8UA 2VYRE 1DUZA 4UT7H 3K1KC 5DJCA 4N0FB 2Q76B 3UTOA 5DZNA 5BVPH 4H1LA 4YZFF 4LLYB 3G6JB 2J8HA 5SWQA 5SX4H 1JK8A 1QLRB 2J88L 3L3DA 3IJSA 5IV2B 1WISA 2D31B 5CLWA 4EUPB 1PZ5A 1CGXA 1NGPL 4U33A 1TVHA 3VFMA 1KXTB 1QRND 4LKXB 2LV4A 4QNPE 3C9NA 3NABL 1IC4H 2VERN 3K3QA 3U0WL 1DBKL 1FZKB 1EFXA 2UYLB 2V2WB 2YD2A 3DETD 1NGXB 2AS5M 2D7QA 5I74C 1RUKL 5IVXB 1M7IA 3PGCB 3WMSA 3OG4B 1DBAH 3MXWH 1XGRA 3VFUB 1FL5B 1QSVA 5HGDB 4DCQA 3SDXE 1DVFC 1FNSL 1RUPL 1A6VL 3D5OF 1PY9A 4L3AA 1FFOA 2R0KH 1RJLA 2DQGH 1NC4B 3TA3C 2YD6A 2ZCHL 4GG6B 4KXZI 4Z0BL 1C16B 3SE8L 4UT9H 4Y4FB 5E6IA 5A2JH 4BQBA 4QRUA 1N5AB 5LBSH 1TCMA 2ZSWA 3ARBA 5K33A 2YD7A 4CADB 5TPWH 3P30H 1U41A 4WEBH 3S35H 4L4TB 4XXCC 4RGNE 2V5SA 1GYAA 4PJ7E 1DQTA 5DSCA 4B53A 5DVMA 3LB6C 3GSWA 5C0DB 2YWYA 4LBEB 3MO1B 4TRPL 3SJVE 3IS1X 5DT1H 1Q1JH 5IKCB 4HLZH 3QIBC 2GJ6D 1LP9B 2NYYD 2J3SA 4GLRH 4M62H 5AZEH 2YA1A 5IB2B 1D6VH 3NZHL 4R4ND 3ARVA 4TUOA 1KEGL 2ORBL 4HWBL 5CINH 1MWAB 3ECBA 2D9CA 5IJKC 1WBYA 2C9AA 1U8NA 4YHIB 2KDGA 4XVUD 4KPHL 4DZBB 4KK9D 1FVCA 5F71A 5JPNB 1RK1B 1X5ZA 4XMPH 3OGCB 2ZOLB 1P84K 2B39A 3KPRA 5I8OL 1P6AB 5HDOA 1NCDL 1YEDA 1OTSC 3BT2L 4IMKA 3GK8H 1NANH 4I3SH 3UBXA 3CD4A 1J0HA 3MRPB 2VMFA 3PGDA 1MCLA 3RL1B 1J12A 4PV8A 1NKRA 3RPIA 1KCLA 1FC1A 4P23D 4WY7H 2NY4B 2MQ3A 2WIMA 4NBYB 3PWLA 2AABH 5ALBH 3MRGA 5IHLB 1YDPB 1HN1A 4MJ2A 4Y7MA 3D18B 1OP3H 1T1XB 5GHWH 2DJ4A 2ZJSH 1A4KB 3SPVB 5TDOB 1XCTA 2NY5C 1JZ3A 4HEME 3U0PB 5D1QB 1WAAF 5IR1B 2ZCLL 1K4DA 5KS9A 2WBJB 1CE6B 4TPRH 4E41B 4LVNC 4XC3H 4HQQL 4ODWA 3U83A 1QNZL 3B6SB 2ZWLT 3VGEA 2DLFL 3T65A 1XH3B 2MTPA 1CG9A 1KTLA 2I9LB 4HD9A 1MHCA 1DCLA 4OM0L 3QUMB 4QCIB 4MGXA 4F37K 2PXYD 1JZ4A 2W0FB 2HAZA 5ADPH 4L8SA 4PV9A 4KQ3H 3FO0L 1IARB 2GJJA 1IAII 1NMBL 4PRHB 3WO4B 3G6DH 2RHEA 1T66C 4G80A 2FB4H 3SGEI 4ZUTA 3MRKB 2G60L 4P4KD 3C6LD 4PJGF 1KTKE 2VO5A 3SGKC 3V0VB 2P24B 5DC4B 3P9MA 3CH1B 3OKYA 2P1YA 3GJFA 1NDMB 4HIIA 5GJTL 3TBSA 4PJ5B 4QXTB 4PLKC 3UTSA 4PJ8D 2GY5A 1XGYH 1JPSL 2I25N 1VKXA 2IFGA 3HPJA 2R2BA 4TQEH 2R1WB 5I6XB 4H25A 4RMRA 3N06B 4KVNL 1MJ8H 3S98A 4LASH 2F5AL 3L3GA 3REWA 4F9PC 3WIIL 1HXMA 3UP1A 3JVGC 5JZ7C 1R3JB 1SVZA 1EIBA 1IAOB 3VXUA 1JHTA 2PTTB 3JV6A 1QD0A 1VPOL 2HT2C 4X6DB 4V1DB 2JJTC 3BP6B 3UTZA 1EFXD 2Q8AL 5EOCL 4XH2A 4XWOD 5BXFB 5E7BA 4KMLB 2COQA 1QQDA 3ZE0E 5I18H 2CLVA 3BGFB 3GGWB 4I0PD 4M7JH 1BEYH 3BEVA 1RIUL 3MUY1 3IYLW 3SKJH 1BLNA 3GM0A 2OTUB 4LPWA 5AWNH 4ORGB 2IWGA 3VI3E 1I1FA 4GSDH 4RISH 1ZHLA 3TNMA 4Z7UB 5HYSB 2FD6H 4MS8D 5ESQA 1OVZA 1WZ1H 4Z7NF 2NY6C 4XNZC 1G7PB 1ETZA 1AFVL 2VZVA 4EOWH 4Q58C 3L1OH 3KPSD 1DBJL 1QACA 3CH8A 3P40A 5B8CB 1IEBB 1A3RL 2R0WH 2FDBP 1FRGL 2FX7L 3FRUA 2SEBB 2V9TA 5D2NB 4UIKL 4UIMB 2VTFA 2HT4C 5SWZE 1T83A 3AS3A 1T5XB 2Q1EA 2F19L 3RBGA 3NCJH 2LABA 1CVRA 4YHNB 2Q7YB 4F7MA 4BM7A 4WFGD 3P11H 4YPGB 1T89A 3G6AA 1DLHB 4OSUH 4X9FA 4YR6A 2IH1B 3VI4F 3RUGF 1G84A 4RNRB 5GRUL 3S34H 4Y2OA 5I66A 5F9AC 3GSOA 4XP4L 3IDIB 5D7LB 1IGIH 4PD4J 5IFJA 4XPTH 4OB5L 5KW9H 4FS0A 5DMIH 4LAQL 4JPIB 5C2BL 1I1CA 1D9KD 1UCBH 5ITBH 4KZDL 3A6BH 1U92A 1KN2L 4XBGB 4HMEA 5FXCH 4J2XA 4XZUA 5AUMA 4LQFH 2HJFA 3C5ZD 1QLFA 3MBEA 5FYLE 1IM3B 5EC2B 4BYHA 4J4PC 4DN3L 4HWZA 5J12C 5FK9B 1QLEH 1TZGH 5T3ZL 1B4JH 1JTTA 1MREH 5CZXC 5ANME 5E03A 5HY9A 4Y19D 4ACPA 3PABA 1R3LA 3KPSE 3S4SG 4RFOL 2H26B 2YKLH 2XQYK 5C0IA 4G42B 4BQ8A 2YPVH 3NIGF 4D3CL 2BOCA 1ZT1A 3DV4A 4O9HH 5FGRA 5CKGA 5IB4B 3CLFH 3MLTB 1I1AB 1MY5A 4KKLD 4R4BB 2EDJA 2MCG1 2BNRE 3MNWA 1W0WA 4OLEA 4N0UE 4DAGH 2E9IA 4XAKE 2VXUL 1CI5A 1HKLL 2VXQL 1U8OA 2X4SB 3TC9A 1JVKA 1I9RH 5DJ6A 2KZWA 4PJDA 4ELMF 2IBGA 4YHML 1I4FB 3FMGL 1H8SA 1MPAH 5DO2C 4HK0B 1UM5L 1CDCA 3MYJB 3SQOH 3D0LA 1WFUA 5EPMB 2M2DA 3EOTL 3CFKB 5FCSH 2FGWH 3GJFK 3TN0B 3PHQA 1CCZA 2VL4A 3HR6A 5HVHC 1VFBA 4P0DA 3F62A 5HI5C 2CLRB 3PWNA 3HUJB 4KGLA 2DM7A 4ODHL 4QHUB 1YNKH 4PGCB 3MV7D 4X5XB 4XPHH 2JJVA 4RFEA 5FYLH 1JYVA 4BFBD 1J86A 4RFNC 5CFHA 5C0RH 3LD8C 1ZS8A 2YEZA 2CR3A 1N26A 4KROC 2BVUA 3P0VH 2DD8L 4Q2ZB 2OL3H 4I13B 4CVZA 3V4PH 3WJJA 2CO7B 4WTZG 1H3UA 1OCWL 1QSFD 2ZG2A 2X42A 5AAMA 4Y19E 4ERSH 5C0NC 1ACYL 1UXSA 2GQHA 4PJ9D 1SYVA 5ISZA 1YJDH 4JDVA 3Q6FB 4ZO6A 3S37H 4XHJC 4U6XA 4RMWA 2QHRL 3QXDB 4JFXB 5ICYB 1D5BB 3QI9D 4GLRI 4M8VA 3C8DA 4GKZB 2VDMH 2HKFL 4X9IA 1B0WA 1GRWA 1FBIH 1TFHA 4Z7VB 1IJ9A 5HVWA 3KHQA 3MCLH 1S7XA 4GKNA 2IQAB 4AENA 4OGZA 1H0DA 3T3PF 1L0QA 1MFDL 1YNLH 3OV6A 1EJOL 5HPMA 1C5DA 1IC7L 4BZ2L 2ICWJ 1HHJA 3OXRB 4XTRD 3LIZL 1RZ8B 2VDQL 3WIHA 4U1MA 3LN5B 4LEXH 2D7MA 1JV5B 4W4OA 5H94A 4YNYA 1G6RB 1AGCB 1HSAA 3MV7E 4NQVA 3EOYG 1UH3A 4NQCB 3I75A 2YD8A 5GGVL 1FCCA 2IBZY 2RJMA 2Y5TA 3Q48A 1NBYA 3TPKA 2O61A 4N9GA 2R4SL 5L6YH 2GT9A 4NNPH 3ARQA 4O2FA 2YXFA 2WUCH 4HUXB 3OAUL 3VFNA 4GBXA 3EO1B 4S2SB 1QSFE 2Y07L 3TYFB 3PGFL 1NAMA 3MR9B 3GHBL 5EU5B 1GOGA 5EORH 1PX4A 2ITCA 5KTEH 3TJEL 1Z2KA 1CLZH 5JIKA 3V0WL 4W70A 1KC5H 1X3DA 4C57C 1HK6A 3QPXL 1HINL 5CZVH 2V7HB 3QUZC 1KG0A 1KN4H 3OB0K 5E2TL 3VGFA 5DD3L 2J6EH 3RU8H 2R56L 3MUGB 1MNUL 3X12A 1ORSB 5BV7L 2E3VA 2UWEF 1CD1A 3F7YA 1QFWL 1KJMB 3WJLC 2D03L 2NXZB 2CR6A 4J3XA 2KUTA 1U36A 4YHOL 3MBED 1N0XH 4JHZA 2CLZB 2P5WA 4ISVB 3ROOB 4X6CE 4OGAD 1FNHA 2E7MA 1VCAA 3MRQB 4IRJA 5KVGL 1BJ1H 5I2IB 9CGTA 3P77B 1P4IL 4HIEB 1G0XA 2Z4QA 2DQEL 1HHGA 2AJSH 5CKAA 1RULL 1EEZA 1XIWB 5F7LB 2PW1A 3EO9H 4AQOA 2ZG3A 4DOHE 2EDOA 3GSUB 4JGJA 5ID1B 1C7SA 2HLFC 2Y6SD 1IL1B 4GRLD 4PJFA 4Y0GA 1RZ7H 3MLSL 4HCRH 1ZVSB 4JG1L 5C08D 3VGAC 5JIPA 1N59A 2AJYH 3CSYA 2XN9E 4HKZA 2YZ1A 3O6ML 5EU7E 5J1TC 4FQLH 3J7HA 2NY5H 5DC0A 3FONB 2X89D 5F6IC 1A6AB 5DK0A 1YNTB 1T20A 1OF2A 3DUHA 3GMRA 4Y1AA 4JM2B 4MCZB 1A6ZB 3EGSA 3U36B 1G0YR 2BSRB 4BSVB 4R90H 3P4NA 3BP7B 3FT2B 1VFOA 1QRKA 5DD6A 4TVPD 4JHAL 4Y16C 4WJ5A 3V2AR 3H0TB 3RZWA 4YZFE 3CPLA 2ZKHH 2C3WA 3AC0A 1YMMB 3INUL 1BX2A 2AXGA 2PYEE 4QEGA 5J0BA 3HMXH 3S36L 4XNYH 1UCTA 5CLTA 4ZXBA 3U2SB 2XXCB 1HYSC 3D85B 4UQ3A 5EZIL 3M1BA 3IXAA 3EW3B 1DEDA 5HDBF 3RTQD 1AE6L 2EKSB 5TQ2H 4WWKB 4U0RB 5HGAB 3EZ8A 4LHUA 1ZLUH 5LGHH 5L8KB 1UB6A 3HE6B 1IKFL 3FB6B 3WE6B 1N5YH 5CSZB 3T09A 5ITFA 3QHTC 4OV6F 4L29B 1J0IA 1A3QA 1LO5B 5T3XD 1GXEA 4Y5VC 3FQNA 3OGOE 4KI1A 3W0WA 4UBDC 3O9WA 4OQTH 4U6YB 1KB9K 4CMHC 3FQTB 4I48B 3GRWA 5C08E 1FAIH 4MA3B 1TQCB 4ZTPL 3HFMH 1B90A 1AKJD 4OD3H 4LLMA 3L7EA 2R15A 5D2LE 2NY7H 4V2CB 2AXFB 3P3YA 2FBOJ 4G43B 4MCYA 2P47B 5DUML 1KCRH 1FYTD 5C8JA 3VXOA 1KLUB 3KWWA 1C5CH 1NFKA 3WL9B 3BUYA 1LDPH 4NO5A 5E94B 2YPLA 4O02H 1Y0LB 3I6LE 1NLBH 1Z0MA 1N8ZB 5J6HB 5DLML 4HWUA 4M48L 5EWIL 4QY8B 1QP1A 4K94C 4J3TA 4DGIH 2QR0B 4PG9A 5KZCD 3OKEB 2A2QT 2XTJD 4OUOA 5D1XC 3WEXA 4JANB 1UB5A 1AQKH 1NCBH 4JFZL 1LP9F 4GXVL 2FX8H 1C12A 5MEQA 3DHMA 2DLIA 4MA1C 1AXTL 2BRQA 3C8HA 4U1IB 2R69H 3LKOB 4G9DB 1F4HA 1GGIH 4ZNEA 3AM8C 2UVFA 1UQSB 4G8GA 1TNNA 3ZKXC 4Q0XH 2DRUA 5FUZH 4J6RH 3T04D 1AD0A 3OTTA 4B0MM 3LH2L 4I8DA 4HFWA 1BVLB 5F9JA 3VXSE 4L4VB 4YQXH 4ALAL 5T1LD 1UG9A 1BJMA 1U8IA 2VNCA 4JFDE 5FUCE 1GGYA 4OF5A 5T3XE 2CDGB 4IM8A 1BFVH 1EVUA 1DBBL 4AM0A 1A4JA 3KGRA 1MF2H 2XWTB 3WIHL 3QIWA 2UZIH 3EJZC 2LTQB 3Q3GB 1K8DB 3MRIA 1N6QL 1PG7X 1QTYT 1RSFA 5E9DE 1AD9A 4ZAKA 5I1KH 4KQ4H 3JWDL 3F5WA 2VZ1A 2WP3O 3V6OE 3HZVA 1FYTE 5JHDA 3MLZL 3EKCA 2P5WD 4M7KH 1DQQB 4IRJD 4MA7H 4KJWD 3WXWL 1WAAE 1BJ1J 5DVKA 3T2OA 3Q5OA 1TQBC 1NMAL 1G7HA 3WFEH 2W65A 5J06A 2ED9A 1NAML 2A77L 2BSED 5FM4A 3QXWA 4IHOA 4JRYB 4YBHA 3VFTB 5HJ3A 4LVHC 4Y4HA 1RZKL 5HHNA 5JPMA 3DX9B 1MLBA 3NFNB 4CKVX 1U8MA 3IB4A 1BVKB 1XCQA 4XPAH 3T0EA 1WK0A 5D7IF 5I1EH 3B3IB 4PJAB 5EA0H 4M7LL 1LE5A 2DQJH 1YMHB 4NZUH 1T22B 4IDJH 4WW2A 4KKAD 4PJGE 5FHAH 2H3NB 3CDGA 2HFGH 3BRGC 1RFDL 4JFQB 1IM9A 2VE6B 4OLXL 4ENED 4NZRL 1A1OB 4EN3A 4NKIH 12E8H 1FFPB 4HF5H 1FNEB 3VW3L 3MA9L 4YGVB 2V6HA 3DETC 3LPGA 2QL1A 4MNHB 1PGRB 2FX9L 1P7QB 3BPNC 3E3QC 4U1JB 3TT3H 3FN0L 3P0YH 4X7SH 1MHEB 1NL0H 1NLDH 5F9WC 3LKPA 4WFFE 5C0JA 3B9EA 4JY4B 4QYOB 5MEOB 1H15B 5HI3C 4OGYH 3RX5A 4KKNA 5C0FA 2VRAA 2E9BA 1E28B 2B7DT 2DI9A 3EUUA 5C07B 5GS1C 1T1ZB 2V7NB 4KK5D 5LGJA 3TO4C 3MRBA 3ZKMD 3GMLB 3RGVD 4LK4A 4LHUD 3RIFF 1GZQB 4I1NB 4NDMB 1RZJC 4XVSL 1GGCL 4RIRA 4X6DF 4RDQG 5D71L 3LHPL 2FWOA 5D7SL 2NZIA 2PYFB 2RB8A 1CL7H 3MRLB 3U9UB 5C6TH 2XWJB 2UWEA 3VFPA 5H2BB 2X5PA 4WCYL 3O6FB 4NOFA 1LK2A 4I77H 3WXVL 3PWUB 4XGZA 5DYOA 1I3RB 1U8KB 3W9EB 2IPUK 4XP9L 5MI0C 1U91B 1MCDA 5CBAA 1L0XA 5BS0B 4Z7NE 1HHKB 3BH8B 2BDNL 2YD5A 1BAFH 1EXUB 3IAPA 3LN9A 1FG2B 1C1EL 4KKCD 4Z76A 3PDDA 2YPLD 4JFYA 3S8WA 4YC2B 5JHLL 1YPZB 2FJGA 4HWEH 3OMZA 1KELH 3QDGB 5IF0B 4IBLT 3MX0A 2VSDA 4MNQA 5FM5M