5KJRH

Crystal structure of the adcc-potent antibody n60-i3 fab in complex with hiv-1 clade a/e gp120 w69a/s115w mutant and m48u1.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
223
structure length
218
Chain Sequence
EVQLVESGPGLVKPSQTLSLTCTVSGASISSGGYFWSWIRQHPGKGLEWIGNIYYIGNTYYNPSLKSRLTISVDTTQNQFSLKLTSVTAADTAVYYCARVPRLRGGNYFDSWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system/inhibitor
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title A Highly Conserved gp120 Inner Domain Residue Modulates Env Conformation and Trimer Stability.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 31
structure length 218
sequence length 223
ec nomenclature
pdb deposition date 2016-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kjrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kjrH01
4MXVE 1DBKH 1XGQB 3BPCB 4H1LB 2IQAA 2XWTA 4EUPA 5FGRA 5JUEL 4JFDD 4UUJA 3ARBC 4EJ1C 5JPNB 4KKCC 4NRYA 1RZFL 4LEXL 3G5XA 1MHEB 5JZ7D 1A6TA 3G6DL 4R2GD 4P4KD 2YK1H 1V3KA 4JRYE 1WBYA 3MV9E 4ONFL 4OQTH 1PSKL 1QRNA 1RUPH 1ZTXH 1F4XH 3NIFE 3K4AA 2AEPH 5L2KD 5IHUH 1T7XA 1YC8A 1QFPA 3ILQC 3SGDH 1KOAA 4N1CA 5F7NC 3PWVA 3SE9L 4N8VG 3WJLC 1EHXA 2CDEB 3QCTL 2ADFH 3OKNB 4G8GE 3V52H 5IQ7L 2A9NH 4RWYH 3HZKB 3BPOB 1OLLA 4WFGE 4XWOD 4GBXA 3SDYH 5EIQA 3ZKSD 3WS6A 1CZ8H 5EZJA 4Y1AD 5JO5A 4AEHL 3QFDB 1L9NA 4MXQC 3D85B 3V2AR 3FN0L 2VLJD 4JKKA 1UCBL 1INQA 4KQ3H 2GSGA 4L9DA 4P2YA 2D0HA 4YHMH 2V9QA 4P23D 4OZ4A 4R0LB 5D1ZA 4MZ3A 5E7BA 4Z7WB 3WS3A 5KSAB 5DEGA 1NFDE 4GMSH 2BNQD 3E1F1 2YXFA 4O2FB 2XN9D 3M17B 5C0JB 2CK0H 1S7TB 4JO3L 4O4YH 2C7UA 1G7QA 3ARGD 4NZUH 4R97C 5EWIL 5HVHB 5IWLA 1A9EB 4JGJA 4PREA 1F3JB 3LIZH 3DMMD 5I66A 4GW5A 3GUTB 4MCZA 1JZ4A 3EIFA 1WBXA 4I9WE 1FCCA 3TBVB 3T1FB 2RFXA 1FL5B 3LHPL 4U2YA 1U8OA 2D7QA 3KYNB 4JPVH 3T3MF 1ZWIB 2EH8H 1PX4A 1WITA 3BRDA 4UZGA 4NOBA 3ESUF 3O11B 4X4XB 1EZVX 2NY5C 3UDWA 1MRCL 3PNWB 4PJAE 5MENB 2MPAL 2NLJB 3RUGA 1H5BA 3C60D 3U4AA 3OAZH 2EIBA 4WI8A 1HIMH 5I0DA 3FMGL 3VDAA 1DVFC 3D3VB 3S37L 5JPMB 3MTRA 1MJ8H 2O5ZH 5FYLE 1E4WL 5TPWH 2V2WB 5I8OH 4OLXH 1FLTX 3BPOC 4R7NA 4M1DH 2EH7H 1BIHA 4XMLH 3O0RH 2P8PA 1VHPA 2NY0D 4MB4A 3WMSA 3TH4T 3ZE2F 2IGFL 1U93B 3HG1B 3CUPB 1QRND 4H8WL 2VITA 3HS0B 2HTKD 2R2EB 3Q5OA 5DJAA 4FN0A 3AS3A 4NNPH 1BZ9B 2P8MB 1GJIA 4JQIL 3O4OC 1G6RH 4N8VB 1ACYL 1VENA 1KXTB 5EZLB 5KSAC 3EFFB 1LP9E 3HNSH 3QDJA 5EA0L 5SWZA 3ARFA 3VFOB 2P44B 3QEHA 5DD5L 3KPSB 1AO7E 2DICA 5DRNA 5HDQL 1V3MA 3K3QA 4GBXD 1WFTA 1YEHH 4POZC 5HVHC 5I6XB 4PS4L 4B7LA 4D2NA 2EO9A 2HT3D 3KNBA 3OF6D 3GJFK 2WBWB 5GGTA 4QRRB 5H8DA 2VISB 3DX8A 4H88L 1QFWH 3H7BB 4XMKH 1MFEL 4KDWA 4MJ5A 4TSCL 4K8RH 3UTSA 1XGUB 3F8UB 4M9OA 5D1QB 4I0KA 5E08H 1SBSL 2HN7A 1DDHB 1KB9J 3CXDH 3VH8G 1CL7H 1YEEH 2OMBA 5TQ2L 1FO0B 5DGRA 4M7LL 2YD2A 4OZHA 2VSCA 4QRQB 2GJ6E 1X4ZA 1ZHLA 3QXAA 4FQLH 3ARVA 5IOPA 5D8JL 4JM2F 1M71B 4PRHE 3VXME 3DHMA 3L1OL 3OGCB 1Q0YL 3C6SB 3VMPA 2PR4L 4D9RD 2J12B 5KVGH 1NCCH 3TYFB 2X1PA 1MAJA 3F7VB 3ZE1E 2E7LA 3KPLB 1LEKB 1RJZA 1W8OA 3FB6B 3QCVL 3UTOA 3VFUB 3MRGA 2CUMA 2YPKB 4JQXC 1IBGL 4YGAB 2GCYB 1CFVH 5KVDH 2N7AA 1K3IA 2E5EA 4G8EA 3RTQB 5ESAB 4R4NC 3BW9B 5E99H 1YNLH 4QNPF 4DZBA 4IRSB 4RA3A 3KYOA 1GGYA 5E8OB 2JCCE 3VG0L 1I7UA 3GB7A 3AY4A 3SDAA 1IAOA 4LIQE 2OSLA 3LKNB 2QV2A 5F1KC 4N0YH 4JCMA 4IOIA 5D4QA 4GAFB 1NGXA 2WBJA 5IMOA 2Y07L 3MRCA 2H1PH 4L5FL 4QNPE 4X6EA 3QDJD 3ET9F 3S9DB 3QWOB 1KPRB 3ARFD 3IDXH 5SWZD 2VLME 5D1QC 1WZ1L 2XWBB 2R9HC 4GRLA 4YAQB 2DB8A 1X5FA 5F7DB 2X4NB 3JVGA 2ATPA 2JB5L 5KANG 1J1XL 4RDQF 3CCHA 3VGBA 1PKQE 4OUOA 5ETUB 4ORGB 4TVPL 1G9ML 2J6EH 3LRHA 2OK0H 3ME0A 4NQXB 3D2UD 2CLZA 3FT4B 4OB5H 1AGCB 5GZNC 5KW9H 2OI9B 5DHXB 1I85A 1XR9B 1OSZA 3OX8B 1BF2A 1A0QH 5TJWK 3T0BA 3UTSD 2ESVB 5IHLB 1T3FB 1E27B 3VH8B 5K9JH 2AJUH 1N8ZA 1K8DB 3P0YL 3O6KH 4XHJC 1C12B 1N6QH 5AAMA 1IC5H 5FIEA 4GRWB 4QKXB 3ARPA 4Q9CA 2YEZB 4RMSA 3EYOB 5DRWA 3RTQC 2DLEA 1L6ZA 3HE7B 4UDTA 4RGNE 1FNGB 1VB9A 2FGZA 4ZUVA 1QFUL 2BRRL 2DQUH 3MA7A 2RBLA 3HFML 3G6JF 4FQPA 4X6DE 3T4AB 3MRQB 1ZAGA 1O0VA 3NACL 1NEUA 1R5WA 4R9HA 4YNYB 3GHBH 3NCYS 5EOCL 4G3YL 1IGTA 4DCQA 4PUBL 1KT2B 3VWKA 1VEMA 3FT3A 3GMLB 1HKLL 4NRZA 4QOKA 1RSFA 2QSCL 2NY1B 3GSNA 4LLWB 3QUKB 3MRPB 1I1FB 4I5BB 3J7HA 1CI5A 5FYJH 3RPIA 3SDAD 3HZYA 4X6CA 2H26B 1N7MH 1E4XI 4WW2A 2NX5E 2WBJD 6FABH 3LEYL 1Q9WA 2FB4L 2G2RB 2J5LB 5DSCB 2FECI 5B4MD 4Z7OE 4FQIL 3CX5K 3S3PA 3NH7H 3MREB 4K94C 2ATKA 4MVBC 1AIFA 4JRYB 1IKFL 4EDXB 1JI1A 3I9GH 4KDTC 1H15B 2HFEB 4AM0A 5HHME 1X5JA 1Z0MA 3W2DH 1A7QL 3TNMB 4C57C 1KIQB 3V8CA 2HP4A 4W6YB 3VFWA 4O2EA 4AT6B 2Q8BL 4XP6L 1UWGL 1TQBB 3HE7C 4G8GB 5FB8B 1NGWA 3Q0HA 4ZG1A 5IFAL 3WXVL 4OLYL 4N90E 2FH8A 1HOCA 5ANMB 1BQHA 1J86A 3MJ9A 2IC2A 4RMUA 3V4VH 4MXWH 5D7SH 2X4RB 5T1MA 1VFBB 4LRIC 3I02A 4GXUM 5HDBF 4G8FA 2VL5A 3X14B 4RMWA 4PRIA 4LBEA 5DD0L 3SDYL 4G6AD 1CZ8L 5C1MB 4UBDD 1SM3L 2DWEA 3B9KC 1UM4L 5C09B 4M03A 1MF2L 2NY1C 4YHML 1W72B 3IT8D 5JIKA 4N5EC 5DVNA 3E3QE 3WDHA 2AJXH 1DBJH 3MV7B 4MLSA 1IAMA 3ZSTA 3U9UB 3MGAA 3VD3A 1D9KA 4HPOL 1QUNA 4S1SL 5DQJB 1UH2A 2FNBA 3HKFA 1NDMA 2HKHL 3VWKD 4O51B 2J5LC 1FL3A 3QR2A 5AWNH 4QOKD 1EFXA 5GRZA 4IMKA 1MCBA 3RDTA 2ARJB 4RMVA 3SO3B 1F4YH 3C6LD 3UC0L 4XCEB 4PJAB 2D9CA 1HYSD 2BY2A 5F97E 4HLZH 2EH8L 1TETH 5H35B 5DTFB 3S5LG 4CKVX 2G75A 1MCPH 2B2XH 4NCC1 3EJJX 1OGAB 3ZLQC 4WENB 3WIFA 4CN6A 4MGXA 4X9IA 4DAGL 4N8PA 5J13B 1QBLH 4JG1H 1TQBC 4JCLA 5B39A 4TTGA 3LKPA 4HD9A 4YXHH 4KK5D 4E41A 5TE4H 3DO3A 4NP4H 4PJEE 2YUZA 1X9QA 1MCLA 4J3VA 1ZLVH 3CH8A 1UVQA 3GBNH 2WLZA 2O5ZL 5J3HD 2CKBB 3OKMB 1MFDH 1I8LA 1KJVB 3O3DB 3MBEA 1FGNH 2R39A 4LPXA 5GGVY 1UWEH 1IAII 5C6TH 2YWZA 4KMLB 4JR9H 4KH2A 3P30L 4XP4H 1INEL 1E6OH 3DX9A 4BZ1H 3IDJB 3UPRB 2YKLH 4HWBH 3VFNA 4KJPD 3QUYC 5IMKB 1FYTD 1D5ZB 3SE8H 4GAJH 1J7VR 3RWFB 1BOGA 3MV11 3SJVD 3NFNB 1G7IB 3MC0A 1P7KB 1CXIA 1N5YL 4KMTL 2JJTA 1U8JA 1YEHL 3JUZA 4MNQE 1DUYB 4ZPTA 5KSUB 5IM7B 2W0LA 2PO6A 5GJTH 4MD4A 1AR1C 5H2BB 1A4KA 3FB5B 4PGBA 3U0PB 3SO3C 4O9HL 1T1ZB 4R4BA 4EQ2A 5CBEA 3REVB 4XPGH 5D7LE 4XNUH 4G5ZL 1I7RB 3RGHA 3HRPA 1D9KD 4PJ8A 3U1SL 2IG2L 3OJ2C 4YPGB 2NR6C 1JNLH 3FO1B 4P2QE 5E8DH 4N8CL 4U1KA 5J13C 3MRHA 4XNQB 1KCKA 3B6SB 1AQKL 4K07A 3HZVA 3IVKA 4LU5H 1OTUC 4S0TD 4OZFA 2BMKB 3DXAB 1QLFB 3RDTD 2KZ1B 3REWB 1VGKB 2OP4H 2ZCKH 4PJDB 4C54A 1ETZA 3KR3H 5C2UB 2XTJD 5D7JA 3S5LB 4XBPB 1BREA 2W07A 2H2SD 2W0FB 3FO2A 5FYKU 1CDCA 3KPQB 1AXSA 3BP6A 5BZWA 5BV7H 1OQOA 2JELH 2C1PA 2EEDA 4Y0GA 3SBWC 1CGSL 2EDHA 1J12A 2V17H 4M43L 4E41D 5HI4C 4P0DA 1TZGH 5KVDL 3T2OA 2J8UE 3MRRB 3IFLH 4KFZC 5IB4B 5ALBL 4NC1C 1MI5E 2EDWA 4KI5F 2XFXB 4X5LA 2PETA 3ZDXF 1CGWA 3MXWH 4LLQA 3DV4B 5CGYC 3NPSB 1BLNA 1YPZF 2OZ4A 4JFFE 1H8OA 3NOIA 3FAWA 1J0KA 1DUZA 1SJVA 1U8HA 2YD8A 1TQCB 3PGCA 2Z91A 4GAGH 4ZS6C 1HCFX 4ZAKD 5JTWA 1MCOH 2DKUA 3WHXB 2R56L 1CLOH 4WU5A 5E94A 1SMAA 4FXGB 5I74B 1I8IA 1MFCH 3WLBB 1H3VA 1MREL 2EYRA 4OKVA 2I5YH 3P0VL 1HQRB 4LF3B 1NFIB 4OT1L 2PO6D 3FOLB 3UTTD 1K4CA 1IM3B 2OMNA 1TZHB 4UAOB 1TCRA 1C5BH 2NXZB 2QJDA 3QNXB 5IJVA 1RPQA 2D7PA 2YBRB 1HNFA 4Z5RB 1GC1C 1MLBA 4WEBH 2ZNXA 3RGVA 4HS3B 4XP5H 1EGJA 5LXGL 1T66D 2GTWB 4ZNEE 5K9KA 3KJ4B 3BJ91 3BZFA 2AEIT 3O6KL 3RWEB 1MUJB 1P5UA 3AROA 4JZNB 5F93C 4RGNB 3L5WB 5K9OB 1Q0XH 4ZFOA 5IR1A 1AJ7H 1RUAH 3GMOB 1J05B 4L8SB 2XV6B 1QBBA 4HH9A 3H9HA 3LEXA 2X4TA 5D7JD 3HUJB 5LG1A 5HYSA 4X5WA 3EO1B 3IDIA 4KZDL 2PYFB 1A7NH 5EOQH 3P4OA 2CUIA 2VJXA 3LN9A 3GBLA 4EBQL 1LE9A 3H9SA 3MLWL 1XF1A 2DWDA 3F58L 4M61B 5C9JB 3GIVB 2BC4B 3H42H 1SVZA 1TQCC 2HVKB 5GJSH 3L3DB 5KOVC 4C56B 3DIFB 1KPUB 1H8NA 4PRNB 1YN6A 1G1CA 1FHGA 4H0IA 3O41B 4OM0H 2F54E 5EUOF 1DL7H 3C9NA 4JVUA 4NWTL 4ESKA 3TIDA 5EZIL 2UY6A 3IS1X 4POUB 5I1GH 1A5FH 1TVBB 4WUUE 5EOTA 1EBPA 1SBBA 4Y5VA 1TNNA 2CJUH 4UAOC 5DVOA 6FABL 4JFPA 2EXYC 3CFBB 5SWSD 4M6NH 1ZSDA 2X4QB 2OJZH 5T1KB 2R1XA 3TM6A 4Q6YA 2WQRA 1BF8A 4MQTB 3LB6C 2EO1A 3EFDL 1EEUA 2KUTA 3KJ4C 5GGVH 4EI6B 5DS8B 2XY2A 4DZ8B 1JPFB 2VAJA 3BESR 4RGNC 4XCCL 2B4CC 1ED3B 5E2VH 5E70A 4K71B 3EYSL 1U3HA 1WIOA 4QRUA 1A2YB 1ZVHA 3W0WB 4L8SC 4DTGL 1LHZA 2W65B 3GMNB 5T5FL 5JW3L 3L3HB 4M5YL 4UDUB 2HLAB 3GMRA 2BCKA 3RGVD 4GH7B 1R3HA 1B4JH 1KCVL 2YUWA 1KG0B 3IF1A 4L4VA 1T2QH 3W9EA 5DD3H 3CDCA 2ARWA 2ZUUA 4X9HA 2FEDC 1DBML 5CLWA 2GUOA 1FVEB 1UB5B 3FN9A 3ZO0A 2HLFD 2D31B 2NY2B 1IGFL 4RRPA 2IAMC 3W39A 4U0RB 2J88L 2VR5A 3CFDB 4X6FB 4GG8A 5CSZA 3U4BL 2DL9A 3V0AC 4GSDL 2P24B 4LLYA 5C0CE 4JO1H 1UB6B 5DFTA 3D39D 3VFSB 3H9SD 1RZKH 3TA3A 2DBLH 1CD1A 2NW3B 2C1OB 1MAML 2IANB 1EHLL 4OKDA 1LILA 3KDMB 5HHNB 4LSRH 3MR9A 4U7SA 5D72L 1AGFB 3T0EA 3BEWA 4M6OH 5HPMA 3SEPA 2OR9L 3HCVA 4GG6A 3MLSH 5CIPB 3WDJA 1CFBA 4FFWD 1AE6H 3WIHA 3ES6B 3WE6A 1WSST 5CEZD 2WQ8A 1MCPL 3EO0B 3HAEG 4N0CC 1JWSB 5AEAA 3AMLA 4PRBB 2DQTL 5IUSA 1G7LA 3O3EB 2LTQB 3DNKA 4N1HB 5FO9B 4ONHA 2E8YA 1JF1B 4QT5A 5TE4L 1KB9K 3ZKNC 3E6FB 3GBNL 5EO1A 4XPTL 3B5TA 5J1AA 3JWDH 3N1FC 1MFDL 2O5XL 4DKEL 5JORB 1E28B 4KUZL 1EVUA 1U3HD 5HHXL 1OWRM 4ZPVA 3EYVA 3GSRA 1RZ7H 3EYQC 5GGTL 1XF5A 3OKEB 1GYAA 1KCRH 3B4NA 4BQ6A 2NY2C 3FONB 2R15A 4IOSD 2W59A 3PP3K 2YRLA 3EDEA 1YDPA 3V6BR 4EDWL 4U0RC 5FOJA 4KPHH 3ISWA 2AQ3A 3FJTA 4O00A 4HKJB 5BS0A 3P40A 2G9HA 4JFQB 4L4VD 4NO3B 5D5ME 5L2KE 1K4DB 4CJ0A 1A21A 2E27L 1OWWA 5BZDB 3BZ4B 4NWUH 5I18H 3OJDB 5T3ZD 5KJRL 4HFUL 3OZ9L 1IGYB 3D69B 5D7LB 3GMMB 2A6DB 3LKOA 3SDXB 3H9ZA 2NY3D 4P57A 5EU7E 1U3JA 2EIEA 2EEAA 5C0BE 4Y1AE 1N0XL 4XAKD 3VJ6B 1KELH 3CVHB 4PRAB 4CNIA 2B39A 4FQQA 3TA3D 1VEOA 1QOKA 2LTQC 3UO1H 1T22A 3CFJA 1WCBA 4PJBF 1ZV5A 4LU5L 5KSBF 1KNOA 4QTHB 1KB5A 4X7FC 3SKMB 4XCYB 3VRLF 2BNQE 3T0ED 2XN9E 1IC4L 3BJLA 3KPMA 2OP4L 3WL9B 1RZIA 5HGAA 3QJHA 1RJYA 4FFVC 2C3VB 3HAEB 4Y5YB 5JXEA 4OIIL 1PW3A 3FT2B 1Y6MR 2OZ4H 1H9VA 2J8UB 1UACH 4EQ3A 4F9PA 3MUY1 3VRLE 3MLZH 1LD9B 2V17L 2KKQA 1QSEA 4D0BA 2HTLD 5E0QA 3NBNA 4LLVB 3K1KC 1ES0A 1MCCA 4W68A 1MQKL 1FBIH 2FBJL 3CLEH 1NGZB 2X7LB 2VMFA 3RNQB 3UP1A 5E4IA 4NRXB 1AQDA 2BXYA 2P7TA 3I6GB 3MJ7A 3CSPA 4LHQB 2BNUB 3RIFK 2A74B 1EUTA 5DJYA 2JJWA 3O9WA 1FFOA 2VTFA 4KJQC 3M8OH 2Y23A 4YH6A 5BS0D 1Y6KR 1F02I 4NQCA 3DETC 2Y36H 1M7IA 1T4KB 3DX7A 3DX6A 3WJJC 5E2WL 1OOAA 4YLQT 4NKDA 1YMHB 4U1HA 3G5VA 2VE6B 2R2BB 4G7VL 3L3GB 2VR4A 5CJ5A 5DFWH 5IMMB 1P84J 1CQYA 1YA5A 4PGEA 5L8LB 2C3HA 3V95A 5KAQG 4OZGA 5JOFA 4Y5YC 1R3LB 4WEBL 1E4JA 3MCG1 2OTPA 1AH1A 3FRUA 2FJHA 2A6IB 1JWUA 1OTTC 2RB8A 4JFOB 1IAKB 4XVJL 1K5NB 1EEZA 4NM8L 3AXLA 4TSAL 2AJZB 2N4IA 2Y4SA 4KZEH 1AJ7L 4JKMA 2DD8H 3GSNL 2VKXA 4LLMB 3TWCH 4BQCA 1AD9A 1QVOA 4DFHA 3RWHA 3DJ9A 3WKMH 3QI9A 2Q87A 5GGRB 5JXED 2MHAA 4Z8FL 4XNYL 1I7ZA 4PJ7A 4JRXA 4APQB 5ICXB 1MHCB 3BI9X 2AJSH 1S9VB 5BO1H 5EOQL 1A7NL 2FIKA 3HR5A 5IMLB 4OF7A 4QXTB 1U92B 4LL9A 1A3RL 1EK3A 3PL6B 4AL8L 1LO2H 5HBBA 5DYOA 1OPGH 2LVCA 3QXDB 3D25A 4JN2B 2Z8VC 4WUUB 4DJMA 3HMWH 5I71C 1IQDB 1DQTA 3RUGE 2ID5A 4LVOB 3PDDA 1HHGB 2IBZY 3IKCB 2YMXL 3T77A 5FHBH 3FB7A 1N5AB 3I6KB 4ELKB 1UKQA 5CZXD 1JGLL 2GFBA 4LAQH 3WFEH 2LAGB 4TNWK 2I60H 3JTTA 2WWKT 2OJZL 3MJ9L 1M05B 2E3VA 2VH5H 4LAJH 3SCMB 1NDGA 4ODVL 4OD3H 3WFBH 2WNGA 5EO9A 3QZWG 4NQCD 3RWJB 4M7JH 1RZJL 3VXTB 3BAEH 1QSFA 5IK3A 1U8MA 2F8OA 3QDJE 1X4XA 4QXGH 3TZVB 3MO1B 1ONQA 3I2CH 3HC0A 2ENSA 1FE8L 1OP9A 1WIPA 1UZ8B 3GBMH 5FV1L 3BQUD 1NAMH 3FTGB 1G6RB 3FOMA 3U82B 2X4UA 4HX1A 3L95A 4IDJH 4JKLA 4LSSL 4KK8D 2UZIL 1NBZB 1QEWB 4APQC 2BY1A 3OKOB 1B4JL 5GZOD 5FK9B 1OAXL 2XRAH 1FZKA 4HT1H 2H6PA 2BOCB 4NFDA 4P2OD 1P69B 1Q9OA 3PL6C 4QHNB 5I1LB 2EDOA 2FO4A 5I1AB 3VFPA 3QIBB 3MRFA 2H8PA 3UTSE 1F3DH 3ZE0E 1V3JA 2Y06L 1AXTH 1R6VA 3NTCH 3QI9D 2XIDA 3CU7A 3IGAA 2KPNA 4LVOC 4OAWB 4I77H 3PG2A 3WIHH 3DYPA 4OZHE 5EPMA 3MOQA 4YHYB 3NN8A 4Q9QH 4UV4L 2FH6A 1CFSB 3B3IA 3DURA 3H2WA 3L9RB 4G9FB 1A6VH 3CZFB 4HKXA 4DVRL 4X83A 1AHWA 3OB0K 4F33A 1Q94A 3NFPB 1K6QH 2DM3A 4XVTH 4X0KA 4XXCA 5J6HA 2A6KB 5AYUL 2H3NA 2M1KA 3RZCA 4FQXB 4RGOL 3UYPA 1YQ2A 2M2DA 3RIAK 1M1SA 1RUKH 3OJMB 3NIGE 1D6EB 3V6ZA 5GS1A 1AE6L 4JFHD 4HULB 2EDYA 4PBXA 4NZDA 1BJ1H 1NFKA 2OS7A 2NY6D 1J0YA 4I0PB 4YFLF 5HSFA 1OTSD 3HPJB 1JHTB 3FCTB 2HMIC 1IKNC 25C8L 3P9LB 5TE6H 2O5YH 4L4JA 4MB3A 3EW3B 5JW5A 1A6ZB 3QZWB 3U48A 1BQLL 4PB9L 3EYUL 3GGWB 1AKJA 1IAIM 2D2OA 2R0ZL 2XZQL 4P49A 2P43B 3DHJA 3MQIA 1E4KC 1QSFD 3ZT6A 1MFBL 1NMAL 5D70H 2LAAA 1EMTL 1PQZA 1R3KB 3IJSB 5BQ7B 4C83A 2HWZL 3RL2A 5EORH 2AEQH 4PV8B 3V7AG 1T0NB 3RY6C 5A43C 3VXOB 3PUCA 1U41A 7FABH 4G6KH 1BAFL 2Y5TB 3PWUB 5CWSB 1FH5L 4ERSH 4K8RC 3OJVC 4NGHL 1JV5A 1ZE3C 4WNQA 5IESL 2BSSB 4HEME 3RHWK 1D6VL 1DN0A 5I18L 3QG6A 3PHQA 4DGVH 3F7RA 2BSTB 4FQXC 1NL0L 5F3BB 4Y5XA 2AVGA 5T5NG 1BZ7A 3H9YA 1NBYA 4Y4FA 4XTRD 2PUQT 1Y6NR 4ODHL 1MOEA 3VA2C 4I0PC 2FLRT 5JIIA 2VC2L 2ZUTA 1K8IA 1CICB 4MA3A 3QDAA 1AGEA 5CAYB 4ZO7A 3UYRL 3BUTA 1ZT7A 4PGCB 5C0DB 3RZCD 3ORJA 5C08E 4F7CB 4X4ZA 3EYFB 4IRJB 3D0VB 5ACZB 1JFQH 1DCLA 4OCMC 1EXUB 3QNZB 1GGTA 1OB1A 3LQZA 5DJDB 2P5WA 3DV6A 4HFWB 4HXAL 1EERB 4WW2F 5MEOB 3VXRB 2BXZA 1FL6B 1UACL 4CUCA 1PEWA 3HE6B 3MLZL 3I3DA 1YN7B 3S35L 4Y16A 1YECL 5IB2A 3VXSA 3CMGA 5I16B 2NYYC 3EOAA 4X6CE 5FOBA 4ZFFB 4OUUB 3SOBL 4NZTH 2ARJQ 3BDYL 1AKJD 1KCSH 2HJFA 1HDMA 3E6HB 1B0RB 3ALPA 2L0DA 4WJ5B 3BISA 1GZPA 1FBIL 3CLEL 4MDJA 3H3BC 1YEIH 3ZT5A 4P9HH 3MLYH 2GTZB 1A1NA 3BRGC 4HLZG 1JGEA 3HNVL 5B3JF 4NOFA 5DUBB 4U1NA 1RVFH 4IDLA 1Q72H 1DN2A 5ISZB 2DQIL 3GKZA 1JGUL 3CH1A 4QHKI 3MLXL 5IVOA 4JANB 3BIBX 5GIRB 1J88A 5DK2B 3QA3A 1EGJL 5T1LB 5TQ0H 1OGTA 4AIZA 2VAAB 4NQUA 5BMFH 4QRPB 2P5EB 1MH5A 5IEKB 1CICC 5CJQL 5B3JE 4B41A 4NSKB 1TLKA 3BH9A 3TT3L 3D9AL 4ZTOL 4ZFOL 1A7OH 2ZZUT 3TFKD 5E00A 4IRJC 2QTEA 3O3BB 4J4PA 3VWJA 4WY7L 1JPST 3KLHD 1A02N 1J1OL 2OR8A 4PRIE 3DVFA 1C16B 1ZK9A 2CR6A 1WTGT 4YC2B 4ZD3L 4NKOB 4WI7A 1T5XB 4HUNB 2R2CA 3IDMB 5A1AA 5T3XH 4M00A 1IGIL 2Q76A 1KJ3H 3CFEB 4X7SH 4LPTA 1BFSA 1FG2B 4NM4L 3NABH 1TZIA 3OBAA 4NNXA 1S7UB 4KZEL 5D9SA 2X10A 3LV3A 3MLTB 1XGPB 4PG9B 1QLRB 4LCCB 4YUEH 2F74B 3G5ZB 5GS0D 3K1DA 3GSWB 4O58H 5IIEA 2P5WD 5FUOL 3MMEB 4GUPB 4U1MA 2QQLH 5CEZL 1A1MA 3Q3GB 5ADOL 3BPLB 1I8KA 2XTJE 1LWRA 4Y16D 1LO2L 4P3WA 3SE4C 5CEXB 2UWEE 5CEYB 1GZQA 2DDQH 3ULVH 4LCWB 2PF6A 4TPRL 4HH8A 3N1PC 1JZ5A 4AH2A 2GSIA 1VA9A 2R4SH 3FQWB 3DSFH 1G7PB 3IETB 5JQ6H 5C0IB 5L2JB 3ARBA 3WS6C 2VXQH 3TN0B 2GAZA 2BSED 4OLEA 4J1UB 5DJ2A 3JTSB 2D7MA 2ADGB 4LAQL 5FKAA 3D0LB 1XGRA 5IVXF 3VD5A 5K9QG 3IFPB 3U2SA 4PR5A 1BFOB 1MJJA 3DRTB 3VFRA 2I24N 3VXNB 4OGYH 4OIBA 4RQQA 3IRPX 3JV6A 3WJLA 4DOHE 1OAKH 2HT2D 3PWPD 4J3SA 4KRPB 4ZSOA 2R1YA 5L8KB 2YPLA 1JWMA 3CXHJ 3TPUA 5IWLC 3EGSA 2IH1B 4I3GA 2EDTA 3Q5YA 1PEZA 5T3ZL 3FQUA 4J4PD 4MJIB 2X89A 3VWJD 4LCCC 4W81A 5MEPA 2W9EH 1KGCD 1IT9H 4CADA 3EOBA 5DI8A 2UYLA 2JF1A 3ULSA 5B3NA 1UXSA 1ZLSL 1YEJH 3BPLC 1ZHBA 5BVPH 3DWTA 4B53A 1MRDH 5I76A 1UEYA 4XXDA 5CD5C 2A9MH 1N64H 3H6JA 1N6UA 4NO0B 5KS9B 3BPCA 1XGQA 4H1LA 5I0ZA 3WIHL 5FYKD 1TCMA 5I1CH 3A6BH 5JPNA 4XBGB 1CF8H 1WAAF 3MUZ1 1I7TB 4XPAL 5FM4A 1MHEA 1EEQA 3TN0C 2HG5B 43C9B 2Q3AA 1S78C 3RKDC 2VDMH 3BDBA 3TV3L 1K6QL 1SYVA 4NJ9L 3W82A 1L0YA 1X5YA 2EDDA 3WKNA 1RUKL 2CDEA 3OKNA 4KRPC 3ARBD 4KKCD 1WWWX 5CKGA 3HZKA 1IMHC 1CLYH 2DQEH 3BWUC 1CL7I 1BWMA 1HKFA 4QYOB 1J11A 1WTLA 5ILTH 5BV7B 3M07A 3O45B 1FNFA 1XGTB 3QFDA 1ZKAA 1YEFH 3D85A 3MUGB 5HDLA 2BRQA 4R0LA 3ILQD 3V4PL 4FQCH 2IBBA 1AC6A 2IADA 4Z7WA 5KSAA 3S7GA 4AEEA 4QF1B 1I4FB 4O2FA 2DQCH 3M17A 2YPLD 5C0JA 3HN3A 1S7TA 4FTVB 1I1YB 1DQDL 3E2HB 1A9EA 1FDLH 2X89D 4U1SB 3MODL 1F3JA 1SQ2N 5D70L 3EOTL 3GUTA 3DI2B 4MXQD 1MEXH 2X70B 5EORL 4JDZB 1TJGH 2AEQL 4OLWH 3TBVA 5IROA 3T1FA 1VKXB 3S96B 1FL5A 3S34L 3MROA 3KYNA 4LARL 2EDLA 4P4RB 1ZWIA 4IOFC 4PLJC 4MAYB 5I30L 1HINL 1M6OB 4P5TB 3O11A 1F45A 4KV5E 4X4XA 5GRUL 3PNWA 1KB5L 5MENA 2NLJA 3U6RB 5HGBB 4LPUA 5EG6C 3CSBA 4JFZH 3U0TB 2E9IA 3D3VA 1UZ6F 4U05A 5JPMA 1BD2B 3EDKA 2EICA 3CPLB 3QEQB 5EIIB 2V2WA 1MCKA 3V9FA 1MVUB 1SJHB 4ODBD 5C08B 1A6PA 3AY4C 5BV7C 1F97A 2YR3A 1U93A 3HG1A 3SGKC 3CUPA 5I75B 3HS0A 2R2EA 1MCFA 1BZ9A 2P8MA 2P8LB 5F7WC 1KLFA 4JQXA 5HGHB 5DRZB 1QFOA 4N8VA 1MRFH 1DVFD 5EZLA 4RDQG 3BMVA 4ZUUB 5I15H 1NCWH 2V7HB 3EFFA 5GGSB 4W4OC 4GRLC 1JE6A 3VFOA 3KPSA 1P84K 3S97C 3P11H 1CVSC 2X4SB 3E2HC 2APXA 2ZKHH 1F8TH 4XNXL 4CW1B 3D85D 3ZL4H 2DYPB 1RHFA 4GKSB 3TBTB 5BOPA 4RIRB 4QRRA 4NPYB 5CEZE 4LKXB 1HWGB 3I85A 4LHUD 1M7DB 3CFKB 2VISA 5JLZB 3RU8H 5KSAD 3RBGA 3H7BA 5J06A 3SGEI 1YYML 3IXTA 4MAYC 4O5LH 1T1YB 1NAKH 1T6VN 4KVNH 4P5TC 1XGUA 1YEIL 5D1QA 4YXLH 1CTOA 1DDHA 4POZD 3HC3H 2FHFA 1FO0A 4PJXE 1RIHL 4LGSB 2HFGL 4QRQA 5TDPB 4K7PY 3UTPE 1WCQA 3TP4A 4KU1A 5LQBL 1M71A 4AQ1B 1XH3B 1UKSA 3OGCA 3LN5B 5CP7A 5F1SA 3C6SA 4UT7H 5TQ0L 2VDKL 3TYFA 5DT1L 1JGVL 1TJIL 2I07B 3F7VA 5I75C 4NKQB 1LEKA 1FIGH 3VFUA 3VXQB 1GHFL 1UH3A 2YPKA 5MERB 4QGYA 2GCYA 3KPRB 1WUNT 4J3TA 3SKNB 1KSRA 5I1JH 3D3VD 4HUKB 5IVNA 2W9DH 4L4VE 2YS4A 4D9LL 3RTQA 5ESAA 5F9DC 4ENEC 2XKNB 4GO6B 1P5VA 3BW9A 5FYKH 4ZS7L 4M5ZL 4EZMA 4TOYL 3TPKA 4IRSA 3OXSB 3PF2A 5EZOH 4OFDA 5E8OA 3S36H 4JO2H 4YFDB 1JRHH 9CGTA 4OCYL 2K9UA 4R7DB 4GG6F 1JHKL 1OHQA 1LDPH 1KXQE 1QLEH 3T2QA 4E9LA 4I1NB 3JXAA 1ZEAL 2P47B 5AG9A 3DO7B 1GPOH 3QWOA 1KPRA 1A14L 4R4ND 4HC1H 3KPSD 4GRMB 2XWBA 1MHHB 1EPFA 1J1PH 4YAQA 3QXVA 4LSDA 5F7DA 2X4NA 1YQVL 3T0EE 1U91B 1JPTH 2UWEB 4J23A 4NKMB 4GG6E 5F9JB 3IDGB 3CU1A 2FO1A 3RP1A 5ETUA 2WWKO 5M95B 4ORGA 1JHLL 5F88B 4NQXA 1DANU 2DDQL 2PCPB 3FT4A 1AGCA 2MNUA 4PTTB 1XR9A 3OX8A 2C4XA 1JYWA 2ESVA 5D1QD 2WINB 2R9HD 1T3FA 1E27A 4KDTA 1K8DA 5A2KH 3HC4L 3S3SA 4OCRH 1C12A 5DJZB 2FGWL 3G6JB 2QBWA 4ZO9A 4ZO6A 1U8PB 2YEZA 3EYOA 4GQ9H 2AABL 3VGEA 4DOHB 2VDNL 3HE7A 1J18A 1A8JH 1FNGA 5GZND 8FABA 5HI5C 1DFBH 1T7YA 2V2XB 4BH8B 1OAKL 2APWA 3T4AA 3MRQA 4LRIA 3Q1SH 3K8LA 4LQFL 4XHJD 4YNYA 1FFPB 1HZHL 2PXYB 1KT2A 4O02H 3GMLA 4KK6C 2XQYK 3QAZB 5ITBH 4YHZL 4OCSH 3BKML 3RTQD 4XBEH 4H1LH 4LLWA 2BVQB 2GQHA 3MA9H 3QUKA 4K9EL 1I1FA 4I5BA 1F6FB 1J8HB 1XIWB 4FZEH 1I9JH 1S7RB 5DC9B 3O2DA 4WHYH 1OSPH 4WGWB 4XCFL 5D1XB 2VLKB 1MFNA 1L7TH 1BP3B 1QYGL 2W38A 4I8DA 1D5IH 1S7SB 4LSPH 1NGPH 3SPVB 2BVYA 3K81A 5DK0B 4BZ2L 3P73B 3ZYZA 1RZKC 4NQEB 2H26A 3V5HB 2NY5H 1MIEH 1EO7A 1MRDL 4FQ1H 2G2RA 4X7TB 5DSCA 4BM7A 3MREA 2YPVL 5AD0B 3PDGA 3PP3H 1BJ8A 4JRYA 4F7EB 3BKCL 4EDXA 1H15A 2HFEA 4JE4B 5AZEH 3TVMB 4WEMB 3TNMA 2ZUSA 4QGTA 1GGUA 4NQSA 1KIQA 3FQRB 4AT6A 4ODUB 4S1QH 4FFZH 4G8GA 4JREB 5FB8A 1EX0A 3QIUB 4NUGL 3IDYB 2EKJA 1CIUA 5ANMA 2CIIB 5I1KL 2X2YA 3JWDC 2VUYA 2KBGA 2XA3A 2ESVD 4MVBD 4F3FB 2X4RA 2GJJA 1QSEE 1VFBA 3QCUH 4TYUA 5CCKH 1RZ8B 3X14A 1K2DB 4RFEB 5GISH 2PXYC 2QHLA 1S5IL 1NCBL 2CMRH 4IBLT 3QAZC 3S88H 2VDPL 5D2LF 5LGJB 5C09A 5E24E 1NFDA 2KZWA 4WGVB 1W72A 3GI8H 3GDBA 5DMKB 2RCSH 5J1TC 1XIWC 3P0GB 2RR3A 4XRCB 4NYLB 4U6XB 1I3UA 4OJFH 5D1XC 4YHNB 4PJ8C 5I17B 3MV7A 3V6FA 1U36A 4Y4KB 3U9UA 1PFCA 1AFVH 5L7XL 3MOBH 15C8L 3AREB 4J6RL 5DQJA 5HTSA 4NDMB 4K7PH 4JY5L 5JXAH 3OAUL 4O51A 4YFLI 1NLBH 5TFSL 3B9KD 4NQCE 4HG4K 1TENA 2DQFB 2NY1D 4MHHG 1OAZH 3TF7C 1EIBA 1REIA 2ARJA 4N5ED 4HIXH 3E8UH 1TTGA 2EZ0C 1BGXL 4XCEA 4PJAA 2XPGB 4HWEH 5FHAL 3TVMC 1NUDA 1PG7X 5H35A 4WRLA 5DTFA 5DHYB 4KHXL 1WFOA 1KTLB 1A1OB 3MRMB 4Y4HD 1P6FA 1OGAA 4OZGE 2CIKB 5DD1H 1DSFH 3MUHL 2GHWB 4JREC 3QIUC 3BE1L 3IDYC 2YWYA 3LY6A 4PJ7F 2QQKH 5GS0L 5DMGC 1EVTC 1MJUL 1ZLUK 1YUHB 2CKBA 3MV9D 4JRYD 4I3RL 3CFIC 2K7QA 3UPAA 1KJVA 3O3DA 4U6YB 1BM3H 4QRTA 2ZWLT 5EBMB 3R8BB 3GFUA 3BVNB 1LGVA 5JHLL 4DUVA 1CGXA 2NY4B 5FYJU 1EEYB 4PJ7E 4JRXE 2ZUXA 4G8GD 3HZMB 3HMXH 3IDJA 3UPRA 1QKZL 3BD5A 4NHCL 1VADB 4G8IB 4XB7A 5AAWA 5T3XE 5IMKA 2DI7A 4TNVF 3PE9A 1TVDA 1D5ZA 1LO3L 2BJML 2D7TH 1CE1H 4JDVB 4KJWC 3IFNL 4Y4KC 3RWFA 4QY8B 3VFGH 5IT2H 1CLCA 4NN5B 2FR4B 3NFNA 1G7IA 4Q58C 3AREC 1P7KA 1MHPL 1L7IH 1DUYA 3H3PL 5KSUA 5IM7A 3MCLH 1A9BB 5C09D 3RI5K 5H2BA 5DQDL 1CGVA 3FB5A 3U0PA 3DROB 5CINL 1T1ZA 3QUYD 5KVFL 1KFAL 3REVA 1LE5B 2EYSB 3MV7D 3P3YA 5TF1L 3N0PB 1LO4H 4PJXB 1I7RA 4KVNL 4FA8A 4AY0A 5JHDB 1A4JB 2ZUWA 2HH0L 4I9WD 4YPGA 1FFRA 5GRWA 5GXBB 3FO1A 3ULVE 3MRKB 4XNQA 3B6SA 5H94B 3MZGB 3QPQC 3WD5H 2GK0A 1AR1D 2BMKA 4JFEB 5JR1L 3DXAA 1QLFA 1EO8H 5EO0B 4PJ9D 3VRJB 4DK6A 3REWA 1QSFE 1VGKA 1YJDH 4PJDA 4UT9H 1J5OL 3A6CL 4OLUH 1CYGA 3S5LA 2MQCA 4XBPA 3QUML 5FUCE 5CZVL 1PD6A 2W0FA 4F7PB 3EJYC 2WZPD 3GK8H 4XNZB 4TSBL 3KPQA 3MJGX 1OGAD 5E2TH 1VACB 2NR6D 2NY4C 2XNAA 2ITDB 4HKZB 5FYLD 3KHQA 5C71A 1IGCL 1OF2B 1OTUD 3F12B 1FAIL 5ELIA 3RL1B 1G9NH 4FZ8L 2D0FA 3MRRA 5C0FB 1BQSA 5IB4A 1NAMB 4NN5C 5FYKL 5FO7B 3RWGB 3SHSA 2XFXA 2MCPH 3O4LB 4JAMB 3DV4A 2X4PB 4HQQH 1UM5L 4JO2L 3NCJL 2DM2A 1JRHL 2W0PA 4BSVB 1RI8A 4PRPB 4LVEA 4MNHA 3OKLA 1UT9A 4NKIL 3CXHK 3G9AB 3B2VH 2HFTA 5DFVC 5HI4D 1FGVL 4OM1H 3KYKH 1FZMB 4K94H 1EBAA 3C5SB 1KN2L 3WHXA 5IEHB 2V5SA 4M93B 3GRWH 4FQ2H 3U46B 4OBSA 4FXGA 3WLBA 2Z9TA 4LEOB 3HB3C 4YEEA 1HQRA 5ID0B 5CGYD 2X40A 4LF3A 1NFIA 4GRWH 4Q2ZB 3D48R 3FOLA 4UB0L 2DQJH 5EH1A 1IM3A 3MUJA 1TZHA 2AXGB 4XC3H 3SDCB 1XR8B 3AB0C 3QNXA 5FDWB 3V8OA 1QA9A 2DKMA 4IJ3B 3GJFB 2EXWC 4M48H 3HHRB 5H37G 2YBRA 4JHBA 4LSUH 2FX8H 4Z5RA 3WFZA 5JMOC 4XNZC 2GJ6D 4HS3A 2GTWA 3C5ZC 4NJAH 2PW1B 1Z9OA 1V7ML 4YHOL 3D18B 1CT8B 4PRHD 3RWEA 1MUJA 3BH8B 4JZNA 2I27N 1RMFL 1ADQA 3L5WA 5K9OA 2QHRL 1DLFH 1XCTB 3DXAD 2EC9U 4FP8H 3GMOA 3OB0H 1J05A 4L8SA 3CIQA 3VA6A 3HUJA 3O2DH 4UNUA 4XVUD 3EO1A 5KOMC 3MLRH 5TDOB 4ZUWB 3NAAL 2PYFA 1DBAH 1ZA6B 5EUOB 5LWYL 3ARTA 4MX7B 4WHDA 3BN9C 3UAJC 1MCWM 3LQMA 4M61A 5C9JA 3ZT7A 3BKJH 3GIVA 1R5IA 2BC4A 4QEGA 4LSVH 1IC1A 4K3JH 2HVKA 3L3DA 4C56A 3DIFA 2AQ2A 1KPUA 4L3AA 2YHGA 5KZCB 4M93C 4RNRB 1VFUA 3GHEH 4PRNA 5I1DB 3BPNB 1B9ZA 3H8NA 3SDDB 3MLVL 4L3EB 2R2HB 3JWNC 3O41A 1OSPL 2IAMA 4XP9H 4OV5B 4YBQC 5F70A 1TVBA 1A3QA 1GIGL 2LQRA 5D7IB 2PN5A 3V79C 2NY5L 2ZUVA 5DEFB 3SDCC 1QBMH 4OCWH 4RAVB 3CFBA 4IJ3C 2X4QA 4POYA 5T1KA 3GSUB 3MNVB 3QWQB 2FJGB 1S7VB 3HI5H 3PV7A 1IQWH 1ROWA 2NTSP 4YDKL 5DS8A 4EI6A 4DZ8A 1JPFA 2IPTH 5DC0A 1LK3H 1F58L 1N26A 2IFFH 1ED3A 2ZJSH 5L9DH 4ZFZB 1A6WL 2OYPA 3OG6B 1A2YA 4Z7VF 1QFWM 4XPHL 3W0WA 2P5WE 2W65A 3Q2CA 4Q0XH 2EXYD 3GMNA 4QCIB 2AJ3B 3L3HA 5IHZB 2AP2A 1B2WH 2HLAA 2UVFA 3KYMA 3LB6D 1NANH 5GRJH 5F9AC 4XP1H 1A3LH 4OV6F 4PG2C 2D7OA 3VXSE 2VN4A 5CCKL 4PLKC 1Z3GL 4WWKB 4M6MH 2QLVB 1C7SA 2XKSA 1KG0A 5F72S 4RGND 2YA1A 4R4FL 1KULA 2VWEC 3OB8A 4KXZH 4XAWL 5FGBC 2FL5B 5DGQA 4YO0B 1K85A 1OM3L 3QQ3B 1T04B 3GI9L 2FX7L 2VL4A 1FVEA 1UB5A 3X11B 2D31A 3BPNC 3SDDC 3WXWL 3VFMA 5E1AA 4C55A 4PJCB 3CFDA 1QNZH 2VQTA 4X6FA 2CGRL 1U58B 3HNTH 5F9OL 2R4RH 2P24A 3BOVA 3O2WH 1UB6A 3MOAH 3VFSA 3F7YB 3DUSB 4HV8B 2IALB 3BHBB 3EZ8A 2NW3A 2C1OA 1LNUB 2VERN 3U0WH 2IANA 1NLBL 1OT2A 4C56D 3WIIL 3KDMA 5HHNA 1AGFA 1UJ3B 2CKBH 1L0QA 4CAGA 4L29B 5CIPA 3RY4A 3L5IA 4P46B 3KXFB 3WSQL 2IAMD 2XG4A 3C2AL 3ES6A 1P7QB 4R2GB 2D03H 3EO0A 4JVWA 4PY8J 3QO1B 1P4IH 1KGCE 1JWSA 1NCTA 3QQ4B 3QHTC 2C4FU 4PRBA 5DD1L 3O3EA 5FO9A 3UTQB 1C08B 1JF1A 3IJHB 2BVPA 5HHMD 4MCYB 1JYXA 5T1KD 2QQKL 3E6FA 2KL6A 3FFDB 3GM0A 4FQHB 4F7TB 2C3XA 1F11B 4HXBH 3KGRA 3RAJL 5J6GB 4P5MB 5JORA 4WWKC 1E28A 4HZLB 5MI0C 4ZFGL 3S4SG 4N0CD 3GSOB 3W0WD 1A6AB 5FYKE 2VLJB 4YX2L 1OP3K 1AR2A 4ACPA 4P23B 1RUMH 3M1BB 5JW4N 3FONA 3ZKND 1F6AB 1P2CA 1NH6A 2BNRB 4YE4L 4HKJA 1SY6A 1KENL 4JFQA 4KVCH 4NO3A 2WK2A 4P9HC 1L7IL 1K4DA 4ODWB 3ARGB 3ARWA 1FNSH 5BZDA 1FO0L 3BZ4A 1S7QB 3DMMB 1KBGH 3OJDA 3O81A 4URTB 5I1EH 3EYQD 4OCXL 1IGYA 3D69A 4PJBB 5D7LA 4XX1E 3GMMA 1UJ3C 2A6DA 3SDXA 2R29H 5KSBB 2NY2D 5CP3A 3RA7L 4P46C 4U6TA 2ICCA 4H20H 2DIAA 4NBZB 4S10A 1P4LB 4CVXA 2AI0H 3VJ6A 4JRWA 3CVHA 4PRAA 2VXUH 5EU4B 3IDNB 4X5XB 2NMSA 1J0JA 4S1RH 4K7FB 1PGRB 1Q1JH 1U6AL 1Z9LA 3NZHH 3WJJA 1W0VB 3C60B 4Z7NF 2IAND 1OL0A 4FABH 1JMXA 4QTHA 4B50A 4KQ4H 2NZ9C 2GITB 3SKMA 4XCYA 2YPLE 3D1MC 1UYWH 2B1HL 3WL9A 4M7LT 2LVEA 2DQHL 4XB8A 2C3VA 3HAEA 4Y5YA 5F9WB 1RIVH 3FT2A 2E6PA 1IEAB 1WBYB 1KJ2H 4Z7NE 2F5BH 5CHNB 2J8UA 1WEJH 4MJ6B 3BZEB 1H3PH 1LD9A 4P23C 5FCUL 4OGXL 3HI6H 3UBXB 3GNMH 4BUHA 1S9WB 4LLVA 4NT6A 1MWAH 3BKYL 1A7PH 3TH3T 4FFVD 3S4SB 5C2BH 3AGVA 1NGZA 2ERJB 2C3GA 2X7LA 4GBXB 2UV3A 4XNMB 1P4BL 3ARGC 3RNQA 3O3UN 4NRXA 3DMMC 3I6GA 4LNRB 1MJ7L 4PJHB 4AEIH 2BNUA 5HHOE 3LS4L 2RAMA 4U1IB 2A74A 4MNQD 4RX4D 2Z8WC 3ULVC 3O2VL 4K94L 3V5KB 5TE7H 4FQ2L 3KJ6H 1DBBH 1D5MB 1ULVA 4KAQH 1S9YB 1CGUA 4GW4B 3IU4H 1OW0C 4OLVL 1T4KA 3NIDE 1NSNL 2CXGA 4X99B 4HF5L 3C60C 4G9DB 1JZ6A 5LBSH 1YMHA 2P1YA 1KCUH 5D7LD 2VE6A 1FZOB 4OQTA 4Z7WF 4JKPL 2XZCL 2R2BA 3L3GA 5I19H 1BQUA 4X80L 5IMMA 1X5XA 4ZNEA 1E6JL 3QXUA 3R06B 3TH2T 4KJQD 2NXYB 4LSUL 1R3LA 1NBVL 5FM8A 4HUVB 4GJTB 1PX3A 5C7XL 3UTZB 5T33L 4GLRH 2A6IA 4V2CB 1RK0B 4JFOA 1IAKA 4TUJB 1K5NA 4ALAH 2F19H 2AJZA 4J2XA 3WO4B 4LLMA 2CRZA 4X8JB 3O2DL 2ORBL 2JKXA 2ERJC 5GGRA 3WFHB 4APQA 5ICXA 2ADIB 1MHCA 3IS0X 1S9VA 4WUKH 2ZCHL 3T09A 3FQTB 1NCAH 3EHBC 4AIOA 4QXTA 1U92A 4XPFH 1OTTD 1EFQA 1TPXB 4A6YL 3PL6A 4YZFF 4CDHA 4XXCC 2RJMA 1ZLWK 3BKJL 3LD8B 3U30B 3ZKMC 1HSBB 3B8SA 3ZZ1A 2Q8AH 2WAHA 2E7MA 4JN2A 4PPTA 3GHEL 3MRDB 4WUUA 3WFDL 5MENE 4JFFD 1IQDA 1NJ9B 1HHGA 2VLRB 3IKCA 1IARB 4DN3H 2ZOLB 1QSZA 2R23A 1N5AA 3QPXL 3I6KA 3OHXB 4ELKA 4UIKH 1ZANH 5T1DL 1NEZG 4JN1L 1QBML 4OCWL 3D2UB 3TJHC 4YQXH 4LSQH 1M05A 2NXYC 3SCMA 3HG1E 4EXPX 3MBXL 3LMJH 4OIAA 3IRZA 2AK4E 1IQWL 1QHOA 3RWJA 4LRNL 4M4PA 1K3ZA 3VXTA 4BZYA 1ZHLB 3KLAB 1INDH 3DVNB 1EJOL 1IC7L 1NGQH 1YZZA 4NIKB 3TZVA 4X7EC 3MO1A 3RWDB 3WO4C 1W72L 4NZRH 1IKNA 4S2SB 3VCLA 4HHAB 3X3FL 2BY3A 3FTGA 4R3SB 4JDTH 1G6RA 1FN4A 4G7YL 1NLDL 5E6IB 1NBZA 1QEWA 4YHPA 1BX2B 5E4EB 5EFIB 2DM7A 2A38A 3VI3F 3O8XB 3JSSA 5GGRY 1A3LL 4QRRE 1N6VA 4YHKL 2BOCA 2O93L 1QR1B 1TPXC 1KYOK 4QHNA 1ZHNB 2R0LL 3U30C 5I1LA 3LD8C 5J11B 3WEXA 5I1AA 3QIBA 2B0SH 3VGAB 3OKKB 2X9XA 3OAYK 4UU9B 3UJIL 5CIPH 4RAUB 3VI3E 4Y4FC 1YEKL 3RY6A 3JUYA 1O7VA 1T2JA 4R26H 4OAWA 5AUMA 4UQ2A 3L7EB 2JIXD 4APQD 1IEHA 1FCGA 3SGJC 1CFTB 2JE8A 1P1ZB 2Q7NA 4ODSH 4DN4H 4OBRA 1CFSA 5FYLL 1XF2B 3L9RA 4G9FA 3CZFA 3PL6D 3UEZA 4R8WH 3VDCA 1KIRB 5IMOB 3MJ8B 2F54D 4JQVC 3NFPA 5JOEA 2A6KA 2DQGH 3P9WB 2YD6A 1S3KH 4KRNA 4FQXA 4WUUD 2MKWA 1MSPA 1D6EA 4U2ZA 5DURB 2I25N 1JPSH 2XA8L 3GKWH 3EJZC 1FNEB 1JNNH 1NEZB 4I0PA 3B9VA 2FLBT 5EC2B 5D71L 1N2RB 3HPJA 1JHTA 3FCTA 5F6IB 3P9LA 1PLGL 3CGTA 3NFSH 4UILH 1KEML 4M1CC 4LCUA 1A6ZA 3F6IA 5E6IC 3QZWA 3O8XC 1SEQL 3GGWA 4HXBL 3ZTNH 2LU4A 1W2KT 1T5WB 1T03L 4WFFD 2BERA 5J11C 1DLHB 3IAQA 1DEEB 1WQVT 1BBDH 2HMID 5BQ7A 3IJSA 1KLGB 3RRQA 4PV8A 1T0NA 2G5BB 3CDYA 3VXOA 4OTXL 1V3LA 1DANT 4YHIB 2Y5TA 5L0QB 2VRAA 4CN1A 3PWUA 5CWSA 1A6UH 2LV4A 1GOFA 1H3GA 3GJEB 2BSSA 1BVLB 1OAQH 5E2JA 4I2XE 2G60H 1FORL 5D93B 4QOKB 2ESVE 5FGSA 5C0BA 4LGRB 4DQOH 2BSTA 4OF5A 5C0CD 5F3BA 2NY7H 2J6EA 2XZAH 3U7YL 3C6LB 3MLUH 4ZQKB 5E2UH 5DZNA 4GRWE 1GSMA 1GC1L 2Z35B 3VGGA 2NTFB 4Z95H 2CR3A 2AI0L 3U83A 4K8RD 1KCLA 2H2PC 3GMPB 3SKJL 1JZ8A 1IFHH 1X44A 1A7RL 4L8DA 1Z5LB 2AXFA 4G9FD 5F6IC 1CICA 5JA8B 4FABL 2X09A 4ELME 4KK9C 5C0DA 4HLJA 2EDKA 3C8KB 4F7CA 2QSVA 3EYFA 4FQXD 1I9EA 4HBCH 4IRJA 3D0VA 3RNKB 1YNKH 5ACZA 3F7PC 1GGCH 5F7EH 2WIIB 3N85L 2A77H 1YMME 3WNNA 1F90L 1EXUA 3QNZA 4Z0XB 3QISA 5DJDA 2J2ZA 4HFWA 4MXVF 8CGTA 2R69H 1KIPA 1WF5A 5MEOA 3VXRA 4P5KB 3FO0H 3T08A 4I0PD 1U3ZA 4MB5A 1FL6A 1G1YA 2K1MA 1XT5A 4MNGE 1WEJL 2HRLA 3HE6A 2GY5A 4U6VL 1NGWB 1RHHA 1YN7A 1I3GH 4HJJL 1FYTB 5I16A 1FVCB 3NIFF 4OUUA 4ZFFA 1I9IL 3G5YB 4TQEL 2VDRL 1OAYL 3E6HA 4M62L 5DJ6B 1B0RA 3VW3H 4WJ5A 4PGJA 3SJVB 4JEGB 5HHOB 2GW5A 5FA4A 5GGQH 1CD0A 2UZYB 2GTZA 5D93C 2VXSH 1R24A 3UBXI 3BIKB 4KC3B 5DUBA 3LH2L 2CQVA 5ISZA 4P9ML 3OR7B 5J12B 3SE4A 4LCIL 5I8KH 3C6LC 4FXKB 2EKSB 2NYYD 4IIQC 3LQAH 4JANA 2ED7A 4LLUB 5GIRA 5IJKC 3T2NH 1MFAL 5DK2A 5F71A 1D9KB 5T1LA 3V0VB 2VAAA 2IBZX 1LEIB 1MVFA 4QRPA 2P5EA 5IEKA 2GT9B 4LDEB 3LS5L 1NFDF 5ANME 1NMBH 3T0XA 4NSKA 1ADQL 2B4CL 2L7UA 4JO4L 4KK5C 5C0BD 5CSGA 4GKNB 1YYLH 1RULH 1DQLL 5MHSD 3O3BA 2YA2A 4W70A 4KMQA 1LO0H 3C09B 1C16A 5C0GB 2YXMA 4F8TA 1X5ZA 3CVIL 2A83B 1XEDA 4NKOA 3W11C 1T5XA 5C09E 1XGYH 3IDMA 1RIUH 1YEDB 5HYJB 4EOWH 1CICD 3CFEA 1FG2A 4EN3B 1Z9SA 4W6XB 3MV7E 5E6ZA 1S7UA 4IRJD 1OAUH 3MSPA 4PJAF 3MLTA 1XGPA 1I9RL 2VZUA 4PG9A 1HXMB 1QLRA 4LCCA 3G5ZA 3GSWA 4IRZH 3K2UH 2WUCL 5IVZB 4ZNCD 1EDQA 5GRVL 4G6JL 3VXRD 2O26U 3MMEA 4GUPA 4PFEA 1FQ9C 5FO8B 3Q3GA 4JY4A 1CQKA 1MNUH 4OD1H 3ZKXB 3LZFL 1T20B 3HRZB 3VFNB 5CSBA 1OCWH 5CEXA 4ONGH 2COQA 4I3SH 1R3IH 5CEYA 3BP5B 3IB4A 4ZAKB 4LCWA 1OGAE 5F1NB 2VR9A 3EO9H 4N0RA 1AGBB 3GO1H 2F9BT 3O6LL 4D8PB 4F8QA 5FECB 1WGOA 5IVXB 5BRZE 5EB9A 1CR9H 4Y89A 3FQWA 3QEUB 1G7PA 3IETA 4ZO8A 3KS0J 5C0IA 5L2JA 1LP9F 4XPBH 5FYJD 3TN0A 5C0RH 3TNNB 2H45A 3UTTB 1SYSB 4J1UA 3IYLW 1GAFH 2X1QA 5ISZD 3JTSA 3PV6B 2ADGA 35C8H 3D0LA 2AK4B 4RSVA 3C09C 4R0LC 1T83C 3IFPA 3OSKA 3RX8A 1BFOA 4RGMB 4DGYL 1CLZH 3DRTA 2X1OA 3V4UH 2FD6L 1H3WM 5T1LD 3VXNA 5KTEL 4QRPD 4AYFA 3WFCH 3BO8B 5IG7B 2VZVA 3HZVB 3PXJA 3IVKB 2QSQA 4EN3C 3TO2A 2IH1A 4MA8H 3KLDA 2MFNA 2IQ9L 4LSTL 4NC1E 4GKZB 4MJIA 4NZJA 5EU3B 4Q74A 4YGVB 1Y18B 3FL7A 1GGIH 3QDGB 5IROC 1KC5H 4HUXB 1N4XH 12E8L 5C92A 5D1ZD 4HWBA 1SMOA 1VFAB 3FN3A 5DR5H 3ZTJG 2PYEB 2R8SH 2VB5A 1ZLUH 2EDJA 4D0DB 4J3UA 3STZB 3ZKXC 4NUJB 3BSZL 4CJ1A 3C87A 3ZE1F 2B0SL 3GSXB 3RWIB 5MEQB 4WDIB 4WEUD 5JA9A 4PJFE 1CTNA 4NO0A 1P7HL 5KS9A 3ELAT 3CK0L 2HAZA 3QHZL 4XBGA 3DXAE 4KKAD 3AUVA 1I7TA 5D2NB 2VZ1A 2HG5A 4PJDE 43C9A 5HHPB 5DRXB 3NA4A 4ZDHB 1U8KA 4AMKH 1H0DB 1NPUA 3MACH 2JCCF 4TRPL 4W6WB 2VZOA 5SWSB 4I18B 5HPOA 4HUMB 4LCWD 3LEVL 4RGMC 1CWVA 5CD5D 5LGHL 1KEGL 4OKVB 4WI5A 2E9WA 2V5TA 2BFVH 5I6XC 3F62A 4JFYB 1A22B 1JNNL 2EECA 4OLZH 4D3CL 4QYOA 1DQMH 5I1IH 1S78D 3RKDD 1V8HA 3MV01 2DRUA 3O45A 1TTUA 1XGTA 4Z0BL 3SGKA 3MUGA 4M8VA 5IJVB 3INUH 3NGBB 1RJCA 4UTAH 5CJOH 3CD4A 4WFHD 3QUXB 3CLFH 4JM4L 5EC1B 1SY6L 1KPVB 3ESVF 4QF1A 4W4OA 4KRPD 1I4FA 2DMBA 3H3KA 4RMRA 1FNHA 4RAHA 3QHFL 4P59H 1MCDA 1MCWW 4FTVA 4BQ8A 2HRPH 1I1YA 1QTYT 3PQYB 1U0QA 4XI5C 2ED9A 4MJID 2OTWB 4U1SA 2E9JA 3KVQA 2X70A 3CFCH 4JDZA 4S1DC 1TJHL 1VKXA 3S96A 4YFEA 4OSUH 4UT6L 4I2XB 4RRPG 5D2NC 1A6UL 3CVHL 3JV4B 4P4RA 1ORQB 2HVJB 4MAYA 4C59B 3D39B 2XICA 3H9SB 1RK1B 1M6OA 4HPYL 4P5TA 2H9GB 1JRHI 2EIZB 4QXUH 2DOCA 2PTUA 2G60L 3SO5A 4I18C 4X6DF 3UMTA 4JPWL 5SX5K 3U6RA 3WUZA 5HGBA 3HUJF 4OF0A 5ACLA 2F58H 3U0TA 5DJCB 1D5BB 1F4WL 4U0QB 1YJDC 1BD2A 4XCNB 3CPLA 3QEQA 5EIIA 5F96H 4IRSC 1JMZA 4D94A 2FHBA 3ARQA 4ELMB 1MVUA 1SJHA 4IOFD 4PLJD 5C08A 3VXPB 2SEBB 4DW2L 3LKSB 5GHWH 3HUJE 2WUBH 1G0XA 5F8QC 3P77B 1UA6H 1HHKB 1YMMB 1ZSDB 3NGBC 2P8LA 5IFJB 5HGHA 1G9NC 1WIUA 4GW1B 5DRZA 5TF0A 4HBCL 3UJTL 3QUXC 4IM8A 1TFHA 2VIRB 2F53B 4ZUUA 2WP3O 5ABDE 2V7HA 4MNGB 4Z7OF 5GGSA 3RQ3A 1OARL 3Q6GH 3X12B 3A67H 4C56E 3QEGL 1Y0LB 5DMJB 4WWID 3FO0L 4KY1L 1AI1H 2X4SA 3BGFB 4G6FD 4GKOA 1ZGLB 4EVNB 1RU9L 1CK0L 4CW1A 2DYPA 1BHGA 4GKSA 2AAVA 3TBTA 4RIRA 1X3DA 4NPYA 3GMRB 3PP4H 4K3EH 4LKXA 1M7DA 3CFKA 2OI9C 4F57H 5JLZA 1F00I 1FAKT 2A0LC 4LLDB 1DBKL 2ICWB 4MS8D 5JOPE 4GRLD 1T1YA 1RQ5A 5DHVH 5DLMH 3VRIB 4QTIH 4YXKH 4OZIE 2DQDH 2YK1L 4OQTL 1U8QB 4R90H 1RUPL 1ZTXL 5TDPA 1F4XL 3DRQB 4PJGB 5IV2B 5SV4A 2AEPL 5IHUL 5FUZH 1XH3A 4K3HA 3RWCB 5F89B 3W0WE 4ZOCA 2ADFL 3V52L 4P5TD 2A9NL 2OR7A 4RWYL 2I07A 5HJ3B 4RZCB 4LFHG 3VXQA 2DKSA 1BMGA 2HKFH 5MERA 3KPRA 2JK5B 3SKNA 3QT2A 2D9QB 3C5JB 4KQ3L 3P4LA 2DLTA 1BD2D 3MYJA 3QEQD 4JJHA 4I4WB 2XKNA 5MP6H 1PG7H 2YUVA 4BFIB 5DVMA 5GGSY 2PW2B 3MPCA 5C08D 3OXSA 3BGFC 1RIUL 4GMSL 4NNYB 4Z7QE 2CK0L 4O4YL 3EUUA 3D87B 1K9TA 4NZUL 4R7DA 4FFYH 3BGAA 2X44D 2VDLH 3LIZL 4OGAC 4O2CB 2UVEA 4TULH 3QJFB 3DO7A 3QXWA 4PJEF 4ENED 3K2UL 1R3JB 4RBPH 4RISH 4ZTPH 4Y88A 2IANE 4GRMA 4GMTH 1MHHA 4JPVL 3CSGA 4HIEB 3ULUH 4MAUH 3QDME 1U91A 2UWEA 4NKMA 4HGKC 3BIAX 5ALCH 1TITA 2HJKB 3BGMA 2DYPD 4H26B 5F9JA 4F15B 1BZQK 5BRZB 5JW4Q 3IDGA 3S36X 5IGXH 2C4FT 1HIML 5F88A 2CO7B 1EA9C 4PJIB 2PCPA 3GO1L 1MJ8L 3ARYA 1CXKA 4PTTA 4EKXA 1MAKA 3QDHA 2OL3B 5TPWL 5BS0B 1VESA 4LVNB 5I8OL 4U1GB 4OLXL 2WINA 4M1DL 4MJ4A 4YPJA 2EH7L 5D6DC 4XMLL 4XPBL 3O0RL 5DEZA 5DJZA 3V0WH 5KVEH 1GAFL 1UXWB 2KH2B 1U8PA 4NNPL 1D5XB 1JGDA 1F3RB 1RFDH 4YDIH 1X4YA 4WI3A 1G6RL 1HHJB 2P48B 4YWGH 3L3JB 5AZ2H 5LAXB 3UX9B 4MA7H 2XI9A 1DZBA 3HNSL 4CNIB 1GOGA 3M45A 2V2XA 4BH8A 2YRPA 3GZKA 4PRID 4WHTB 3DPBA 2PXYA 1KTRL 3KPRD 3PWNB 1YY8B 2ICEB 2YD7A 4MD5B 4Q9RH 4LPYA 2J8HA 4CN4A 4PBWD 1IGJB 1I1RA 5C86A 2BVQA 3IU3B 3ARRA 5B38G 1QFWL 4Z7UB 1XIWA 1J8HA 2E7CA 5HI5D 4HIIB 1S7RA 4XMKL 2R0WH 5D1XA 2VLKA 3SDXE 4K8RL 3MGTB 1S7SA 1KTKE 3SPVA 3UROR 5DK0A 4ZXBB 3I3EA 3P73A 5E08L 2VDOH 1VPOH 1KJMB 4L9LB 4F15C 2ICWJ 4NQEA 3CXDL 4PJFB 1CL7L 1YEEL 3NMEA 1EFXD 4KK6D 1CVRA 4X7TA 1OP3H 3DTXB 3PDOA 1PVHA 1ZT4B 4FQLL 2AJVH 4LVNC 5AD0A 4U1GC 3AU1B 5CKAA 1U8LB 3ARXA 2Q1EA 2J8UF 1TVHB 2VXVH 3NA9H 1XFPA 4F7EA 3PGDB 2VXTH 4Q6IB 5KVGL 1NCCL 3D6GA 3TVMA 3MJ7B 1BFVH 3PGFH 2QQNH 3IAPA 1BEYH 5EU6B 4PP1C 1PG7W 5GS2H 3FQRA 3MACL 1CFNB 4ODUA 2D3VA 4G6MH 1CFVL 3QIUA 5D2LB 5HYQA 1UQSB 4PGZA 3DYOA 4F3FA 5E99L 3MBED 5FDYA 1YNLL 3BUYA 1RZ8A 2BFVL 4XHQA 4RFEA 5AYQA 1KJ2B 3ECBB 4GXVH 4N0YL 5LGJA 2XG5A 1J9CT 3X3GH 3W9DB 1T6WA 5EU5B 5HDOA 3BQUB 1VFOA 3ZHLA 5DMKA 2ZCLH 5CJBA 5CJOL 2D0GA 4XRCA 4NYLA 2H1PL 4U6XA 3TC9A 3IDXL 4J3XA 4YHNA 1MWAB 4UTBH 5I17A 1LK2B 4Y4KA 5LVEA 2DTMH 4ZXBC 1MIMH 4P2OB 2E9BA 4KJYB 3TBYB 2YUXA 3DARA 3AREA 2HRPL 4NDMA 5M94B 2PXYD 3KPPB 1SJEB 1GXEA 1AD9B 2X1XR 2DQFA 2CD0A 5B38B 5IB5B 2IJ0C 2J6EL 2OTUB 1FPTH 2OK0L 5B8CB 3SE3C 4L3CB 2JLLA 3BRFA 1NMCB 4HK3J 1XIWD 4OB5L 5KW9L 1I7ZB 3BT2H 4E42B 1A0QL 2XPGA 3GMQB 4XVSH 5E56A 3X17A 4PJ8D 5DHYA 2DLIA 1OD7A 5F7UA 5K9JL 2B1AH 1FLRH 1KTLA 1A1OA 2AJUL 3MRMA 3C08H 1N6QL 2CIKA 3MV8B 3TCLB 4L4TB 1IC5L 4QO1A 1R0AH 1YC7A 4K7PX 5IBUG 3DBXB 3FQNB 1YUHA 2XWJB 2EZ0D 4P3CH 2DQUL 3TVMD 4AG4H 5EBMA 3NPSC 2NY6B 2VLLB 3BVNA 1TDQA 4WV1B 5C07B 3GHBL 1UM6H 4JKWA 1MCEA 3QRFM 1EEYA 3HZMA 3V7MA 3QIUD 5TDNB 3R1GH 1VADA 4KK8C 1U95B 4G8IA 3FKUS 4Y19E 4JB9H 5DMGD 5I74C 5INDB 5ICZB 4QY8A 4HMCA 5JW4M 1T21B 3P4MB 3A67L 2FR4A 1U8MB 3LKQB 1W0WB 5FYJL 5J7CC 2N56A 1UH4A 1JTOA 1A47A 5E8PB 1N7ML 1A9BA 3TEUA 5DF0A 1HK6A 2NXZC 5B8CC 4LIQH 3DROA 3K8KA 4K3EL 1FG9C 4OZIB 3NH7L 4TUKH 1QO3B 4IS6B 3SKUD 1LE5A 2EYSA 4XH2B 4KJWD 4Y4KD 4MDIB 4PJXA 5KN5B 3I9GL 2AK1H 5JHDA 1A4JA 3ARED 3W2DL 3MRKA 1L0XA 3FHAA 5H94A 4PJ5E 4JFEA 4RFOH 4HIHB 4OFPA 3WV0A 3JZ7A 1U9KA 4WFFE 5EO0A 3VRJA 1B6DA 5JUEH 1RZFH 4LEXH 4OFYA 4EIGB 3NN8B 4XMPH 3V4VL 4HJGB 3CDGB 4MXWL 3T4YB 3G6DH 2NY6C 4F7PA 5KANI 5D7SL 4ONFH 3CZJA 4WV1C 1VACA 2AV7B 1PSKH 3C5ZA 2HJLB 4LLAA 2ITDA 4HKZA 1OF2A 3UCRA 3QPQD 1XZ0B 3F12A 3RL1A 3VDBA 1HWHB 3SE9H 2EC8A 1BVZA 5C0FA 2OM5A 3QCTH 5C8JB 5J9PB 1NAMA 1FRGH 1PG7L 4NQDE 5IQ7H 1C8PA 5FO7A 3RWGA 2AJXL 1DBJL 2I9TB 1FZJB 2APBA 3O4LA 3ROOB 3EJYD 3G04B 2X4PA 4G80B 1N59B 4AEHH 1NGYA 5HI3C 2NY4D 4BSVA 2K3TA 1OQXA 4PRPA 1UCBH 3R4DA 2VDLL 1SEBB 3L7FB 5AWNL 2CUHA 4OGZA 1YNTB 1IEBB 3QDMB 1FZMA 4G9FE 3C5SA 5IEHA 5J56B 1F4YL 3U46A 1JPGA 4JO3H 4LEOA 1TETL 5ID0A 5EWIH 2Q7YB 5IQ9B 4K71C 2B2XL 4KXZI 4Q2ZA 3FRPG 4K2UH 1XF4B 1VSCA 2GJZB 1ZT1B 1QBLL 4JG1L 4MA1B 2AXGA 4YXHL 5EN2B 5DFVD 3SDCA 1XR8A 4NP4L 5FDWA 4MJ2A 3GJFA 2OQJB 5D96B 3OL2A 1XCQB 2EDFA 5JHDD 3UTPD 3SKOB 1FGNL 3HB3D 3D18A 1MRCH 1YY9C 1CT8A 1UWEL 3BH8A 3FFCB 5D5MF 5C6TL 1WC7B 4JR9L 5CS7A 1XCTA 2FDBP 4XP4L 5A40E 1E6OL 1NUGA 4BZ1L 2YKLL 4HWBL 4BJLA 3ARSA 2EXWD 4OFYD 5F6HJ 4KKNA 1UADC 3SE8L 2X5PA 3ALXA 4GAJL 4KDVA 4N0UB 5TDOA 2IGFH 3C5ZD 1S8DB 1ZA6A 3P4NB 1BIIB 4H8WH 4PG2A 5EUOA 5I9QB 3RVXC 2GIYA 4MX7A 3BD3A 1QP1A 4JQIH 1ZVYA 1WBZB 5GJTL 5FGBA 4LHJB 1ACYH 1UFUA 4PYHA 3VG9B 4RNRA 5CFHA 5I1DA 5DD5H 3SDDA 4L3EA 2R2HA 5HDQH 5IP4A 4XPGL 2XQYG 4JFXB 4XNUL 5MHSE 1JN6A 1CXLA 4MD0B 4OV5A 4AIXA 1GH7A 1VCAA 3QIWB 1JNLL 2Q20A 5E8DL 5D7IA 2KQNA 3FO9A 4MA1C 1AGDB 2QL1A 2H32B 2NNAB 1B88A 5DEFA 2ZP0T 3UAJD 3B9EA 4RAVA 4H88H 4Z7VB 3T1WA 3GSUA 4LOUC 5D96C 3MNVA 2ZCKL 4TSCH 1HHHB 2FJGA 1S7VA 3KR3L 1G7MB 1SBSH 2X42A 2GI7A 4YBQD 3PHOB 1BFVL 1URLA 3ZMRA 4TUOB 1PY9A 5BV7L 2AKRA 2JELL 4ZFZA 2AV1B 3KLHC 3QFJB 3GM8A 3K74B 3MCKB 1ZGLP 5D8JH 3SDCD 3VXRE 3L1OH 1T1XB 1TZGL 3Q6FB 4QCIA 2AJ3A 5IHZA 1Q0YH 2PR4H 3IFLL 3ZHDA 2IWGA 2ZPKH 2Y6SD 5A2JH 1X5LA 2CLRB 3PWPB 5I9QC 3QCVH 3MXWL 4V1DE 4WWKA 2UZXB 1IBGH 2FL5A 4YO0A 3QQ3A 1T04A 3X3GL 3VG9C 5BJTB 3B5HA 3KHOA 3X11A 4GAGL 5FYJE 2G5RA 2BOBB 1MCOL 3QUMB 1CLOL 3V7AE 2Z4QB 5ISZE 1T89C 4PJCA 1MFCL 1U58A 3QIWC 1U8IB 2I5YL 4PLKD 3LN4B 3F7YA 2DIJA 3DUSA 4HV8A 6CGTA 2IALA 3BHBA 1FVDB 3LV3B 1LNUA 2Y07H 4DK3A 4CL7A 3KPNB 4QRPE 2P5EE 3WDIA 4L5FH 1C5BL 1PBYA 1UJ3A 1AXIB 1MCIA 1WZ1H 3SDDD 4WO4B 4L29A 4L3ED 4ZMAT 4P46A 3QH3B 4BSWB 3KXFA 4LKCB 5E8EB 4XP5L 1P7QA 1RURH 1LEGA 4DVBB 3QO1A 1J1XH 3STLB 1CXEA 3QQ4A 1NC4B 1TMCB 4TVPH 1R0AL 1G9MH 1Q0XL 4LCYB 3UTQA 1C08A 5HYFA 3IJHA 4HUUB 4MCYA 2Y7QB 1RUAL 4BFGA 3BYYA 2C5DC 1IM9B 3FFDA 4FQHA 4OF3A 4F7TA 1F11A 5J6GA 4P5MA 3OWEA 3P0YH 1MQ8A 2V5MA 4HZLA 3RUGF 3O6MH 4UQ3B 4PV9B 4Y19B 4BFBD 3GSOA 5FKAB 1A6AA 2VLJA 1M4KA 1HEZB 5BOZG 1QSED 3H42L 4P23A 3M1BA 4OF6A 4WHCA 5GJSL 1F6AA 2BRRH 1JJUA 4LHUG 3HFMH 2BNRA 3DGGB 3TYGH 4OM0L 5GQBA 1DL7L 3NACH 4WWKD 3IAGC 3MGOB 4LCWE 4LQ1A 2VUOA 4G3YH 3RX7A 4ODWA 5I1GL 3ARGA 1A5FL 4PUBH 4FG6C 1S7QA 3DMMA 1HKLH 4X7DC 3RY5A 2CJUL 2QSCH 4PJBA 1HHIB 3L6FB 5KSBA 1NC2B 5FGCB 4M6NL 4WO4C 2AS5M 3O9WD 3LQAC 5CBAB 3VGDA 4EI5B 1S9XB 2VABB 1I3RB 1P4LA 4PJ5B 5GGVL 2AK1L 5C0AB 3IDNA 4X5XA 5SV3A 1OW0A 3MX0A 4K7FA 4HDIB 4WFHE 5E2VL 3LEYH 2P45B 1AP2B 1W0VA 3C60A 5I76B 4KGJA 2FB4H 3WNKA 4FQIH 2GITA 4GT7A 1DP0A 5JQHC 3I3BA 1W0YT 1IKFH 3ZE0F 5DJXB 4P46D 2Q86B 3KXFD 1NQBA 2WBKA 5D7KE 4MJIE 4XMPL 1PKOA 1P7QD 1NUFA 4XGZB 1A7QH 4CMHB 1IEAA 4OZHF 5IF0A 5CHNA 4J8RA 5AG8A 1T2QL 4XP6H 2Q8BH 4MJ6A 4ZOBA 1JZ2A 3BZEA 1UWGH 5DD3L 1SYVB 5I1HH 1F4HA 4NQDB 3WN5B 4FMFA 5KS9F 5IFAH 3WXVH 4OLYH 2NZ9D 3UBXA 1DVFB 2NCMA 1T80A 1S9WA 5DO2C 3EZJB 2W91A 2OJEB 1FRGL 4MWFB 2CLVB 4JRXD 4M3JA 3S4SA 1H8SA 2APVA 5DD0H 2XTLA 4XNMA 3NIGF 4JO1L 5T3XD 5KS9E 1SM3H 4XC1H 1UM4H 1RZKL 3OF6A 4LNRA 2DBLL 4PJHA 1MF2H 5I73B 3O4OB 3PWLB 4U1IA 3VMNA 3GJFH 4LHUB 4LSRL 2IADB 3SCMC 4M6OL 4EI5C 3V5KA 2BNRD 5DJ8B 4KTDH 3MLSL 1C5DB 4HPOH 3BX7C 1D5MA 1S9YA 3TO4B 4S1SH 1NCUA 4LP5A 4GW4A 3RVVC 1ZS8B 5F7YC 4CU6A 4PTUB 2HKHH 3WYRA 4X99A 4G9DA 4K2UL 3TZVC 4H25B 1MCRA 1FZOA 2XQBH 4JHZA 3MROB 3UC0H 3EBAA 3DVGB 2V6HA 3R06A 3ULVD 5J0BA 3JWDL 2FATH 4CMHC 4HUVA 5E95B 4U33A 4JHWH 3UTZA 1JP5A 1Z6JT 4DAGH 1RK0A 2KDGA 1YEGH 3PABB 3WN5C 3QIBC 4TUJA 1RZ7L 5KBNC 5FM5M 5D6CB 2LU7A 4HBQA 3MFGB 1KCRL 3T3ME 4B5EA 3N1GC 4FTVE 4KTEH 1J10A 4X8JA 2ZG3A 3GSQB 4KPHL 2R0KH 3WFHA 4YHYC 1F13A 2ADIA 3FQTA 3HPLB 4NCC2 3P30H 3HTLX 1INEH 5I73C 4UOJA 3THMH 4NWUL 1HSBA 1PDKA 1T7VA 3MRDA 1I1AB 3TO4C 3ZE2E 4PLNC 2WSKA 1N5YH 4KMTH 4YIQB 1NJ9A 2VLRA 1U2CA 3VE0B 1KTDB 2ZOLA 1KELL 3SGJA 3EHBD 1BD2E 3SN6N 3OHXA 3QEQE 3UO1L 5EBWB 4O9HH 5H37H 3ZKMD 3D2UA 2ZOKB 4JQVA 1UGNA 3NCEB 2DS4A 4LASH 32C2B 3IXTB 3ARDB 4G5ZH 4C4KT 4KHTH 5DK3A 5DUPH 5E6YA 3U1SH 2IG2H 3B2UC 3H7LA 4X6CF 2BP3A 5EIVA 4NQTA 1G0YR 5IW6B 4N8CH 3I75B 5DZLA 1CFQB 1AQKH 1F42A 4UOW0 3AC0A 3NCFB 4HG4J 2OZ4L 2ZSVB 3KLAA 3DVNA 4E5XB 3RWDA 4S2SA 5DJ0B 5SX5H 1X5HA 2E7BA 4HHAA 3SY0B 3TJHD 5CP7B 4R3SA 4V1DB 2NXYD 3RVUC 2ZPKL 5E6IA 3FB8B 4NBYB 1BX2A 5EFIA 3O8XA 3QQ9C 1QQDB 3EDFA 1CGSH 5ESQB 1QR1A 4M43H 2BHYA 1ZHNA 1RZGB 1QD0A 3CSYB 4I48B 2WM0A 2X6MA 3OKKA 5ALBH 3WCYA 1I1AC 4UU9A 4RAUA 3K0WA 3BP4B 3M8OL 2MSPA 1RAMA 3BD4A 3L7EA 3V6OC 4YDJB 4U3XA 3MNZB 1CFTA 1P1ZA 1BVKB 4JLRB 1TNMA 3F5WB 2YSSB 1WZKA 5HD8C 2Y36L 5DHVB 4MZ2A 4X6BB 1XF2A 4Q7DA 1KIRA 5E5RB 3MJ8A 4MYWB 2AEWA 2R56H 3ARDC 1HQ4B 4U3CA 1MREH 2LU3A 4Y4FD 4Z77B 4H5SB 3P0VH 2VLRD 3KPRE 1HXYB 4ZUTA 4OT1H 1RURL 1FNEA 5C3TA 2BHZA 3HE6C 1NEZA 5HVWA 1MCQA 5EC2A 1N2RA 3WNLA 1CDHA 3OKDB 2QR0A 4BKLB 1ZXQA 2DD8L 3SGDI 2MOVA 4Z76B 3TWCL 1WT5C 3WKML 5LXGH 2UWEF 1T5WA 1VEPA 2AJSL 3EJZD 5BO1L 5HGGS 3O6ML 4QHUB 1DLHA 1DEEA 1WZMA 4EIZC 4MSWB 1KLGA 5IBTH 5C70A 3VXSD 1U42A 1OPGL 1UCTA 8FABB 2G5BA 4M1CD 4OI7A 5E6ID 3SGEH 4YHIA 5HY9B 3HMWL 3O8XD 5ICYB 4KZDH 2WV3A 3TYGL 4HC1A 3GJEA 2O61B 4EBQH 1JVKA 3AM8A 3MLWH 5FHBL 2PNDA 3F58H 1BVLA 1S5HB 1U8NB 4H0HB 3FZUC 5FF6B 3B9KB 3O6FB 4PBVC 2J7LA 3WFEL 4EUPH 2I60L 4YC2C 1F5WA 4I13B 3G6JE 2VH5L 2ZSWB 3C6LA 4ZQKA 1ZGLM 3LSOB 1WVZA 4NWTH 4IIQA 2Z35A 2NTFA 4OD3L 5IJKA 5EZIH 3WFBL 1KUMA 4K3DH 3R0NA 4GAYB 5JDJA 3GMPA 4Y4HB 4N0FB 1EAPB 3DUUA 4M7JL 4X8XA 1Z5LA 5KSVB 2CDGB 3BAEL 2CDFB 4A6YB 5SX4H 2JJSA 4QXGL 2YC1B 2Y25A 3I2CL 3C8KA 2XKUA 1MCSA 1Q9KA 2CRMA 3GBML 5F7KC 3RNKA 4BH7B 3EFDH 1ND0B 1NAML 3MV9B 2WIIA 1TIUA 4IDJL 5DURD 4Z0XA 4XCCH 4BUGA 3T8XB 4P5KA 3K2MC 3EYSH 2XRAL 1ZHKB 2H2PD 2NQCA 4NQSB 1GVIA 2QADB 4HT1L 5E03A 4DTGH 1J8HE 3QO0B 5I1HL 4ZOAA 2VLKE 5T5FH 3BP7B 5JW3H 4KK9D 4M5YH 4PP2B 3K4ZA 1FYTA 1AXTL 4TNVK 1FVCA 3NTCL 4NQEE 3AAZB 1KCVH 3G5YA 3AFLA 3FQXB 4I77L 5DJ6A 3SJVA 5K33A 5HHOA 4KRLB 5DD6B 3ULUC 3P2TA 3W81A 4Q9QL 1DBMH 4XC1L 3O6FC 1NFDB 3BIKA 1A6VL 3MRJB 3IFOB 3QNYB 4BK4A 4F9LA 1MCNA 3RVTC 4XVTL 3OR7A 5EBLB 3QUYB 2ITCB 1IGFH 4FXKA 2EKSA 1QFWI 5E9DE 4LLUA 5HDBE 2J88H 3U4BH 4KTDL 3V6FB 2AERT 5J89A 4GSDH 1QHPA 4FHBD 4D9QE 3V0VA 4Y4HC 2HFFB 5CJXC 1DQJB 5BW7C 1LEIA 1TXKA 4HJ0C 2GT9A 3TBSB 5IBLC 3C8DA 1MAMH 2FJFB 1EHLH 3VFTB 2XOTA 4GKNA 5D72H 2XQBL 1N0LA 5TE6L 2O5YL 4PJ9B 2OR9H 5E5MB 1T83A 5C0GA 2PTVA 1T0MB 5C3LD 2A83A 2VDQH 2FATL 2W60B 4JHWL 1LQSR 2QADC 1YEDA 5HYJA 2X9WA 4N9OB 2DQTH