5KJRH

Crystal structure of the adcc-potent antibody n60-i3 fab in complex with hiv-1 clade a/e gp120 w69a/s115w mutant and m48u1.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
223
structure length
218
Chain Sequence
EVQLVESGPGLVKPSQTLSLTCTVSGASISSGGYFWSWIRQHPGKGLEWIGNIYYIGNTYYNPSLKSRLTISVDTTQNQFSLKLTSVTAADTAVYYCARVPRLRGGNYFDSWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Highly Conserved gp120 Inner Domain Residue Modulates Env Conformation and Trimer Stability.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system/inhibitor
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 31
structure length 218
sequence length 223
ec nomenclature
pdb deposition date 2016-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kjrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kjrH01
3PL6B 1GIGH 2XN9E 3OX8B 2VDML 3VE0B 5DLMH 4X5WB 2BVQB 3GJFK 35C8H 5J06A 3ECBA 4H25B 4QRPB 2DB8A 1KPRA 5I15H 4PJDE 2XIDA 3ZE0E 5MENB 5F1SA 4MYWB 4ZD3L 4DN4H 3LEXB 3MOAL 4K7FA 4FFYH 4NUGH 3VFRB 3DO7B 2HFGH 3GRWH 3DX6B 5GGVH 4CRPA 2VLKB 4FOMA 3GK8H 5B39B 4RRPA 3KPTA 1CDUA 3LZFH 3HC3H 2B0SH 3FRPG 3SBWA 2J8UB 2R1XA 4WO4C 4PTTB 1TJHL 3LEVH 4L3ED 2NZ9C 4OIAA 1OVZA 3BKJL 3CH8A 2JK5B 4HH9B 4HBQA 1JZ2A 3KPRA 3RWFA 1AGBB 3QXUA 1S7UB 5FYLE 1L0QA 1B0GB 1EVTC 1YUHA 4RMUA 3JXAA 5CEZE 2ICWA 2ZCLL 3FRUA 1OAZH 2UVEA 1E0OB 1M05B 4YE4L 2C3WA 5GGSA 1JWMB 3E6HB 2ENSA 1I85C 3G5ZA 1D5MA 5GGRB 4H0GA 1RHHA 4NP4H 3O3BB 3W82A 3LRHA 3TO4B 4NJ9H 2FYYB 1MHCA 4L3CA 1QPPA 3IB4A 3QRGH 3ZDZE 2UY7A 4OGXH 1AGEA 3VGAB 5ICZA 3WL9A 1BOGA 4AQ1B 1A1MB 3EYSH 3U2SB 2NY0B 4KQ3L 4QCIB 2ZJSH 4Y2OA 3WFDH 5B8CC 3QI9A 2O93L 4NHUA 1KPUB 2PNDA 4PY8I 2FJHB 1QSVA 2WLZA 5EO9A 4C57C 1HHGA 4U1IB 3PHQB 2WQ8A 5GRZA 2OQJB 3ZYIA 3HNVH 1NFKA 3ZKMC 1T22A 4PJGF 3QEQB 3AROA 2OS7A 5DJ8A 4LSUH 2PF6A 3OKDA 3SCMB 2FL5A 1RZIA 2ZJSL 1C5DA 4CADB 3RL1A 5I1KL 1TQBB 3STBA 1S7VA 2KQNA 3OX8A 1Q9KA 3IDXH 3QRGL 1B0GA 3QDAA 3VXOA 4N0YH 1S7UA 2VLJD 3FB8A 2EC9U 5IM7B 3CCHB 3HRPA 4V2CB 1RFDL 4JRYE 1P2CB 3QCUH 2XG4A 2JLLA 5DJAA 3BFOA 4QO1A 5DRWB 3SDAD 5MI0C 1J8HD 5DJYB 5C0BE 5KANI 3QIWB 2CUHA 2FEDC 3C8KB 3HC3L 3DNKA 3LY6A 4IDLA 1BPVA 2PTVA 2XPGA 5DD5L 4OLZH 4ODSH 3OSKA 3HS0A 5K59E 1IM3A 4WY7L 4CMHC 4NOFA 3P0VL 3MR9B 3SHSA 1JF6A 1NAML 4X7TB 4AENA 1NDMA 4ZUTA 5K93A 1T7WA 4ZUSA 1MWAB 2AK4D 4XVJH 5EUOA 1CLOL 2Q87A 1AE6L 5CJXA 4MAYC 3FL7A 1P9MA 5C71A 3VWJB 4WWKC 5A3ID 1MF2H 1SEBB 1I9RL 2A6KA 2WIMA 4KQ4L 4ZFOB 3VRJB 4XP6L 2GT9B 1A6WL 2ERJC 5C09A 4WV1C 4ODSL 4U3XA 3Q1SH 4U6XB 4EOWH 1AR1C 2ITDA 5DEFB 1UA6H 4F57H 1BP3B 5JNYA 5DR5L 1MWAA 3PXJA 1PKOA 4HKZB 4JPVL 2D03L 1ZVYA 1F3RB 2NMSA 4NJAL 4ZAKC 4ODVH 3N85H 1OARH 2CJUH 1CFBA 3INUH 5KSAB 3F58L 3NACH 1VHPA 2P47B 4GMTH 1Z3GH 4G8IA 4YFDB 2LVEA 1DSFH 1UWXH 2DS4A 4PJXE 4EDXB 5DGRA 4HGKC 1KJVB 3PQYB 1SBSH 2DJUA 3UBXG 5K9QI 5F72S 3D85D 3KYMB 5B21A 3WFCL 2X89D 5CIPH 1GHFL 4P4KB 1F3DH 4HUNB 1X9QA 3LPGA 4OUUA 5ILTL 3ALXA 4OBSA 1IGIL 5I18H 4YO0B 2GSIB 3PE9A 5IMMB 1AD0B 2APXA 3MV8E 2W0FB 5I75C 4LCYA 3U46B 3W11C 1A6VH 2JELH 4TTGA 2WBJC 3NFSH 3Q3GB 4ORZC 1QRNE 3F12A 3O2VH 1NGPH 1QUNA 3IETB 4U2ZA 3RNQA 4PJFE 5HHVL 4IRJD 1MCHA 5ALCL 1ZGLB 1LD9A 1KJ3L 4M1DL 1I4FB 3D9AH 2V5RA 1KEMH 4DFHA 2FR4B 1JNNH 2BVTA 4LAJH 4O9HL 4IS6B 4C59B 3VFVA 5T33H 1IC5H 2YZ1A 2FECL 4G9FB 1IGTA 2BJML 4XBEL 3O11A 2DKUA 1FE8L 1HNGA 3VXNB 5DURB 4G5ZL 1BD2E 4Z7UE 1UKQA 3OKNB 2FO4B 4CW1B 5HI3C 3WIIL 1KB5L 3RTQD 1CG9B 3CK0H 3NAAL 3TLRA 1DQTA 5F9OL 3BPCB 3O8XC 5DUPL 1MREH 4PGBA 3HR5B 1FCCA 4OF7A 2BERA 3S36L 1IZKA 5TQ0H 1PKQB 4X6CA 1C5DB 1MVFA 3T4YA 3OJVC 1JHLH 4CN4A 5CHNA 4O2EA 3EW3B 5TQ2H 2XYCA 4RQQA 1C5CH 3U46A 4YGVA 3FQNB 4Y5YB 4MQ7B 4S1DD 5L9DH 1C1EH 5INCA 2YC1A 3QCTL 2F53E 5CS7A 1UM5H 4UT7L 2YPLB 2J8UA 3SO5A 3LQZA 2A73A 3BO8A 5GIRA 3LN5A 3CLFH 5IMLA 4P2RD 2NY3C 1JPTH 1Q38A 3VWKD 2CLRB 4NSKA 1UCBH 2XZCH 5F7YC 2JCCA 4NNPH 1LE9B 4K9EL 4NRZB 1BEYH 1X4ZA 1UM5L 1WBZA 3ILQC 4X6FA 3QB7C 1OWRM 4Y16D 4YUEH 1FNEB 2D7OA 3T8XA 1I3GH 4PRPA 3TM6A 4P23C 2DI9A 2Y7QA 4WDIA 4LVNC 3P0YH 5KJRL 1F3DJ 1P5UA 2D31A 3U0PA 5KJRH 1QNZL 3FONA 4U1JA 4NHCL 5IVXB 4NZDA 3EJZD 4ZPTA 5DK3A 3UTSB 3T09A 3OB0H 1MAJA 5DRXB 3MRFA 3U30B 5J3HC 1Z9MA 5CUSL 2ATPA 4PJIE 4LLDA 1U8QA 1ZOXA 1FYTD 1FG2B 4D0DB 1PVHA 4BZYA 1DBMH 4CU8A 4LRNL 4ZS6D 5F1NA 4EUPB 4I3GA 4G6ML 1OY3B 1QYGH 4PTTA 4LRIC 4JO2L 5IB4A 1ULVA 4A2LA 3HHRB 3QUZD 2XZQH 4UIMA 3FJTA 3GM8A 3SCMD 4KDWA 2VQ1B 4FZ8H 3TP4A 2UZIH 2W9EH 3NPSC 1JGEB 1BX2B 3VXTB 3DYMA 5HHQA 4M1DH 4OZ4B 3ARED 2JF1A 4ONHA 1MUJB 1JN6B 5TDOB 4NSKB 2OZ4A 8FABB 4GMSL 5L7XH 4OLXH 3WDIA 4X4MA 3N1PC 4QHUA 4X9HA 4WEBH 1RURH 2E6PA 2QL1A 4RX4A 4HIXL 4PJXB 1XZ0B 4OV6F 3FO1B 2AQ2A 1INQA 5JHDD 2ARJQ 3HMXH 3ULUE 1MI5A 3IFPB 1A3LH 4I0PB 1ZLVK 1NCCH 1ETZB 4G42A 4NQCE 1PLGL 3AU1B 1SBSL 1XF5B 2F58L 2QKIA 4PG9A 1T5WB 3OR7B 4R2GC 5J8OA 3H2WA 4FG6D 4ODXA 3PWPE 3QULB 5ID1B 4LVOC 1IGCH 1KJ2B 3S96B 2OP4L 1KIPA 3IXAA 3X3GH 5IMKB 2R4RH 1KJ3H 3W9EA 4B50A 3PJSA 3RJQB 2VIRA 5E2VL 4JFPB 5DGQA 1RUKL 1EUTA 3CLEL 1AI1H 4P3WA 4P5KA 3L95B 5IBTL 1MFDL 2W38A 4M6MH 3RWHA 1H15B 1K4CB 2VDPL 1T83C 4XBGB 1EHAA 3G9AB 5E6IB 32C2A 4OGAC 1AP2B 3WL9B 2PO6B 2HG5B 1U8NA 1IKFL 4OCSL 5IROA 3WBDA 4PGEA 1RZKC 5IFHH 5HDOA 4YHYC 4HPYH 4D8PB 2ZKHH 2VLKD 4KK8C 3OXSA 4XXDA 3KXFE 1T1YB 3SJVE 3TNNB 2AQ3A 3O6LL 4OFKA 4GW5B 3V2AR 3F12B 5BV7B 2FIKB 3L3GB 1GZQB 1FP5A 4H1LA 4HWZB 1MOEA 4LLVA 3RUGB 4GG6A 3QHFL 1SYVA 5I6XC 3E0GA 4P9MH 3WLBB 4AEHL 1HXMA 2E9IA 4OUUB 1RMFH 2JCCF 5DTFB 1LDPH 1BAFH 1BGXH 4JDZB 1PG7H 3CFIC 2BRQA 3VXQA 4OZGB 5D71L 1A1NB 3CK0L 2XN9A 3RIFF 3JV5A 2ARJB 3BSZL 1OP5H 5D96B 2HT3D 4R90H 4MLIA 5FDWA 5KSVA 1HSBB 2UYLB 5IMOA 3D3VD 5ELIA 3HB3C 5GGTA 4OZFG 4PP2A 4XB8A 4JFZL 5ID0A 1NFDE 4Y2DA 5DXWA 2ZG2A 4QLRA 1FAIL 4XHQA 4H26B 5IT2H 4R96A 3F62A 2VDNH 5FOBB 3NCJL 5DJXA 4WI3A 4LMQI 3GZKA 3PP3H 4F15C 3AFLA 3CC5B 5DC9B 3WHE0 4DKFH 3MRGB 3MRQB 4P23B 4KVNL 5E5MA 5D1XD 5DQ9A 5GS0H 3C2SA 3IKCA 5F6IC 1A6VL 5ESVB 3AMLA 5IEHB 1XFPA 1PGRB 1GAFH 1MCQA 4MXVF 3P77A 1KCUL 1U95B 4P3DB 1FNSH 1W72L 5J57B 1JHTB 5F7DA 3TN0B 4X5LA 5TGBA 2EZ0D 4XMLL 3H42L 1R5WB 3VW3H 3DGGB 1KPVB 2E6QA 3V7AG 3VRLE 3GJEA 4ELMF 1E4WH 2D31B 5M94B 4KVNH 5D5MA 4Z77B 2DMCA 3BQUA 5HJ3A 5ERWA 3FT4A 3Q5TA 1HXYA 2J5LC 1PSKL 3B9VA 5KBNC 3N85L 4N1HB 3SQBA 1GAFL 4JZNA 2VLKE 2W9DH 3CVHB 1GGCL 3RUGF 5I1CH 2AJYH 3ARBD 4FFVC 3IVKA 3FQWA 2CLVB 3H9HB 4M61B 1EFQA 4NQCD 1DQQB 2B39A 5DHYA 2OJEA 2FX7L 2RJMA 4ALAL 1RU9H 1W0YT 4HT1L 4NZUH 3WNPA 4WHTB 1YNLL 5EO0A 2DLFL 4NCC1 4KQ4H 2C4XA 3SPVB 5CD3A 2HFGL 3GRWL 4D0BB 4Z7WF 4UNUA 4IRSD 2PYEB 4U3HA 4HK0B 4O2FB 4L1DA 4WFGE 4HS6A 3ZHDA 1T20A 4NHUB 3ZKQD 4K3DH 4BSVB 4U6HA 1KJMA 4XVJL 1MAMH 2QTEA 2AS5M 1WTGT 3FTGB 4JO4L 4OQTH 5IBLD 1GOHA 5I8KH 3AREC 1D9KA 5KW9H 1CXEA 4HXBL 4M6NL 1QVOA 4PGZA 3ULUF 4BSWB 3RWCB 3BSZH 2YPKB 1CR9H 2WBJB 2R0ZH 3V0VA 1YJDH 1I1AD 3U9PL 1R3KB 3CMOL 5GQBA 3LPFA 1WT5C 1XIWD 5BVJA 4MA1B 1G7LA 4HSQA 4P2OC 5K9KA 1EFXB 5E7FA 3MJ8A 3ROOB 1KENL 4HDIB 3EO9L 1UH3A 4ZQKA 3VGFA 2R2HB 4FQHB 2GAZB 4FA8A 4GAFB 3QEQE 5FKAB 1QLRB 4LSUL 1OGAA 4L3EA 2GTWA 4XPHL 2YWYA 3WSQH 3U6RB 3V0AC 3FB6B 1RUKH 4JFDA 4LKCB 3X17A 4L5FL 1K6QL 1MLCB 3HE6C 2OTUA 5IK3A 4ZTOL 5SV4A 1RJCA 4LASH 1QHPA 2BNQE 4WFFE 3MRBA 2DYPA 3ARFB 1KCSL 1AD0A 1A2YA 1CXFA 4W4NA 5DA0B 3C08H 3MLXL 3QIUD 4WWID 2OMBA 3VWJD 4JPIB 4PJDA 3S37X 1CFVL 1JPFA 2R1WB 5TDPA 4OZHA 3ES6A 2BX5A 5IIEA 3QIBD 4ELME 2BCKA 5EBMA 5E2VH 3BIKB 3HR6A 4C56E 4UQ3A 4PRPE 4XP9H 3PUCA 3PL6A 4U7MA 3C9NB 3BVNA 4XNMA 5TFSL 1AR2A 4Y4FD 5JW3L 1DANT 4MQSB 3MLVH 2F58H 1FBIL 1JPGB 4YE4H 3L3KA 3UP1A 4TNVF 1GSMA 1KOAA 1VENA 3H9HA 2NY1D 5JXEC 3EIFA 3SDDA 3RGVD 5IBUG 4YDJB 1MI5B 1ONQA 2IGFH 4TUOB 4Y2DD 2B4CL 1INQB 4XAWH 1MHPL 2X4QA 1VSCA 3V6ZA 2H8PB 3QFJA 3ARGD 2YEZB 4MD0A 2XWTA 4L8SB 3M45A 3IGAB 4M43H 1I9EA 4YXHH 2FIKA 3L3GA 1KN2L 3AUVA 2EYRB 4XCNB 3MV9B 3LEYH 5IB3A 1F4XH 3ZKNC 4XXCC 3GHEH 4U0RB 3MJGX 1DFBL 3ARUA 5CP3H 4YPGB 1CF8H 1YN7A 2UUDH 3O4OC 4RA3A 3SJVA 5TDOA 3G5XA 1XGPB 5DYOB 2EEAA 5HYJE 3QG6B 1RZGA 5E6IA 2HFEB 4OZIA 3MFFB 3UYPA 3QZWB 4JY4B 4YK4C 5IFJB 4F58L 4OT1H 5L2KA 5LGKA 5HGHA 2K9UA 5FYLD 1Z2KA 4LCWB 1DE4A 3IYLW 5DJCB 5L2KE 3DVNA 2W0PA 1NUNB 5A2JH 4KMQA 1QEWA 3IDNB 4PJHA 3GSVB 2ILLA 3KDMB 4XPGH 4WU5B 4PRPD 4XMPL 5DS8A 2EDHA 4QRRB 1KTLB 1JNJA 1XH3B 4KKLD 4MB3A 3BRFA 2BSSB 3H3PH 2NCMA 2HT4D 3UAJD 5GRWA 1WZ1L 2WMPA 4WFED 2DJSA 4GOSA 1BJ8A 2R1WA 1U3HD 1L9MA 3QCTH 2AJ3A 1EMTH 4PJCE 1C5CL 1PZ5A 3JVGA 3W2DH 4MA1C 3ZDYF 3QIUA 5IB5B 2JCCE 1BQUA 3MRBB 1DBAL 2ARJA 1MWAL 3I2CH 4NNYB 4P3CH 4XNYL 1U8NB 4PGEB 4YDKH 4KTDH 3CFJA 4MGXA 3EZJB 1A1NA 4PYHA 3VG9C 2VABB 1MIMH 4PRIB 1S8DB 4YXHL 3KPOA 3RTQB 1NGZB 5J12C 2EICA 4N8CH 3BN9D 5GIRB 4XNUH 4Z7VB 3QPQC 4OLUH 1YEHL 2A73B 5E99L 4G6KH 1HKLL 4WTXA 1KULA 1A4KB 3AB0B 3M1BA 3QEUB 5D9SB 3ZTJG 1L7TH 2VDRH 5H94A 2M26A 3S96A 4HDIA 1LK3L 4Y88A 4MLSA 1ZVSB 2B5IC 2VE6A 2EXYD 3RX5A 4E41A 1CE1H 2I5YH 4XBEH 3EFFA 1P4LB 4JHAH 4IOFD 3P4OA 4OCWL 1RK0B 2LU3A 5EFIB 2DKSA 3HNSH 5EU3A 3SGKC 3VRIA 4J6RL 5B3JE 3UCRA 3PL6D 1WBYB 1AGBA 1F4AA 4XP9L 1IAMA 2Z35B 3ETBF 4AT6A 1D5IH 1UXWB 1P4IH 5FYKL 3O3AB 2PW1A 3C60C 1IEAB 1AY1L 4KGJA 2VL5B 1W72B 5ICYB 3VXMD 2VXSH 4TVPE 2QADB 4OFIA 1NLDL 3OPZH 3O4LD 5DZLA 5EORH 1RY7B 3MGAA 4U1SA 1TTFA 1XCTA 4AIOA 1EIBA 4WUUD 2Q3ZA 1HINL 3EDDA 3GGWB 3WO4B 4M4RA 4JG1H 2XTJE 3U7YH 4WW2C 4EZMA 4K7FB 4LCIH 4M3JA 1P4IL 1E4XI 5FHAL 4C83A 4X6CE 4G8EB 5C07A 5LGHH 4E0RB 4TPRH 3V8OA 4H0HB 3LD8B 5EOTB 2EE2A 3NFPA 3MV8A 4OLYH 3SE4C 1E6JH 1KB5A 1S9YA 1H5BC 1NEZA 1ZTXL 2OCFD 3RGVA 3WFBL 1T2QL 2E7MA 4O2EB 3MJ7A 1X6LA 3BKML 1B4JH 4KXZI 1ED3A 4JG0H 1A14L 5JOFA 43C9A 1B2WL 3WS6A 4HWBL 4AIZA 1QP1A 3CDCA 5KVDL 5FUCC 5L8KB 1CQKA 4M9PA 4X7TA 3D87B 3GMOA 2C3VB 3RDTA 3UBXA 4OQTA 2FZ3A 2Z4QA 1S7XB 3TN0D 4MA3A 4Y4KA 3NN8B 3X14A 1FIGH 4LLYB 4PRDB 4RA0C 4QOKE 2HP4A 1TVBB 2DM3A 1XCTB 1N8ZB 1UZ8B 3FMGL 4RGNC 1JHKH 4WUKL 3QULA 3O2WL 4U6YB 1LE5A 1PX4A 5J1SC 4LSVH 3NCFB 4AL8L 4K94H 1T21A 1AH1A 4NRXB 4EVNB 3H7BA 3GJFH 5J0BA 1XF1A 1Q0YL 5E4EC 4X6DF 2EH7H 4MSWA 4EI6B 4NN7B 4LPCA 1LILA 4KKNA 1A6WH 4MJIA 1CLYH 5DMJB 1CTNA 3D39A 1ACZA 4U49A 3BZEA 4BSJA 1C7TA 1LWRA 3DHJA 1YQVH 5IVXA 4L3EE 2NY2D 4ZOCA 3GMRB 3FB7A 1RULH 4MX7A 3KJ4C 2JKXA 3MV8B 2DQDH 4JN1H 3D2UD 4HUUA 4RMRA 3BGAA 3J7HA 1ZS8B 4JZJA 1BBJB 1IAOB 3SDXB 5I73B 4G7YL 3SGJA 1EBPA 3A6CL 4WWKA 5I19H 3GBLA 1XGTA 1DUYB 5F88A 5GHWL 3VFMB 1VGEH 2PCPB 5F7NC 1IGJB 5GSRA 4TRPL 4JRWA 3HI1A 4X4ME 5ICXA 1FFOB 1V5JA 4XVTL 4AM0A 1TVHA 3U2SA 1BZQK 4C4KO 2Q76B 3CZFA 2HJLA 4J12A 4ELKA 4U1MA 3MLPA 4PRHA 1ZA3B 4QY8A 2HKFH 3F5WA 1HH9A 1D9KD 4GBXB 5BW7C 4PRHE 2E9BA 2VR9A 1J8HB 5GRVK 2K7QA 3W5MA 4ZS7H 4TSCH 3H6JA 2O5ZH 3UO1H 4K8RL 3UTPD 1PQZB 3GUTA 4LPUA 2G5BA 5TE6H 5F9WC 4P48A 1T6VN 1EEZB 3D0VA 3T2QA 3TO4D 4X6DA 1LEKB 2OX5A 5EIIA 2GUOB 2ZUQC 2F5AL 2IH1B 1Q9OB 4Q9QL 1NBZB 3T0BA 3Q48A 4PGCB 5EC1A 4NP4L 1HHIB 4PS4L 3NIFE 1F2XK 4K2UL 4YO0A 1VFAB 3GSWA 4HJJL 4WU7B 3QJHB 1A7QL 2AEIT 3KPOB 4I0PC 2X4NA 2ZCLH 5I66B 1QSEB 1KXVC 1I9IH 1Z9SA 4PRIA 3W9DB 1T04B 3SDCB 4ODHL 1H8SA 1RUPH 4Q2ZA 5DJDA 3HAEG 4U6TA 1BREA 3BPLC 1WTLA 1UXSB 4LARL 1T7VA 4IOFC 2R4SL 1RZ7L 1MCPH 1P7KA 3MV7B 4L4TE 3GI9L 3BQUC 1KNOB 4PJAB 4QTIL 3ECBB 3GO1L 4YBQC 1K6QH 4M6AA 2OTWA 4IRZL 5BMFH 5JHLL 3PWLB 1I8LA 1P2CA 3CSYB 5BJTB 2X4TA 1SJEB 3TBTB 1KT2A 2ZP0T 1A5FH 2I9TA 1JZ6A 5EUKA 1I7TB 5C9JB 3KLDA 4MJIB 3P0GB 4URTB 2NW2A 3DGCR 4JQXC 2RB8A 3ARDB 1AO7A 4GRLA 1IFHH 3DVNB 3FZUD 2VAJA 1KC5H 1SY6L 4LCWA 1FVDA 3DX9A 1MY7A 4A6YB 1G7MA 2IBZY 3CU7A 4HIJA 3VD3A 1FYTE 1CD1A 2XKNA 3EDJA 4YHPA 4W6WB 1H3WM 3MUY1 4Z9KB 2VXVL 4MA3B 1KN4L 4H20H 1S7WA 3SDCA 3FQXB 4LRIA 5HYQB 3TJHC 5MENA 2DMBA 4EUPG 1IQDB 3CX5K 1OB1A 3MZGB 2VZ1A 5I8KL 2DIJA 1JNLH 5JHDB 1VACB 1OTSC 1Q9LA 2X4SB 3LQZB 3V9FA 5I16A 3ZE1E 3ULUD 3WJLC 1LGVA 2IADB 5FB8B 4BQ9A 5L8LB 4PTUA 5JZ7D 4CDHA 1N3NA 1D6VL 4JQVC 3RGVB 5BZDA 2JJUA 5GGTL 1XF4A 3MRLB 4DZBA 4GRMA 2VLJE 2P8MB 4QGTA 4ONFH 4KUCD 2B4CC 1DANU 2V5TA 2X4TB 2XFXA 1J1XH 2ZUUA 5MP6L 4JCMA 4CVXB 4PGBB 1OTTC 1NKOA 4RMVA 4IIQB 4AENB 5SWSE 3KWWB 5D93B 2QJDA 3ZMRA 3ILQD 1I8MB 3CGTA 3DVFA 4KJYB 2A77H 3K8MA 5K9JH 1IAIH 1UADC 3EO0A 3P30H 2W9DL 4OCNC 2ZUWA 5AG9A 3Q2CA 1H3PH 4Z78A 5D1QD 2DWEA 1JV5B 4HD9A 5JW4M 4ENEC 3QNYA 5JIIA 3W0WE 2J88L 2Q86B 3RVUC 1E27B 3O8XB 2F54D 4TQEL 5SWQB 2VLKA 3D6GA 3IXTB 1W72A 3C8DA 4L9DA 1AGEB 5KVDH 2G60H 1KCVL 4AIZB 2GKIA 2Y6SD 1LEIA 1P6AB 2DWDA 2X1PA 4KKCD 1A6UL 1WGOA 1ZTXH 1MLCA 2FEEI 5DJ0A 2BVQA 1FFNB 4UOW1 1A7QH 1EEZA 3D0VB 1QKZH 3ARBC 4FFVD 1NCWL 3MREA 4OV5A 3QUMB 4Y5XA 2AABL 3MGOB 5JORB 3P4MA 1L0XA 4K2UH 3ZSSA 1PZUB 4TPRL 2M1KA 4I8DA 2E7LA 1OAQL 5JMRA 2A83B 2P43B 4KWUA 1P6FA 1V7MH 1NMCB 3JBG7 4EI5C 4RRPG 2R9HD 3NCJH 5C0JB 4X7SH 1L7IL 4ZO6A 4UT9H 4ELKB 1FZJA 3MRNA 1DQLH 3WNKA 3CDGB 1YC8A 3ARDD 3SO3C 4GRWH 4KRPD 4LIQL 1J0HA 2PN5A 4F3FA 2VZ3A 2FLBT 3VGDA 2VLLA 2QADD 4XCCH 1M4KA 3P9LA 4M1GL 4BH7B 3RVUD 5SV3A 4HCRH 4CVUA 3SDXA 5GRJL 5EZOH 2CRYA 3RWEA 3WDJA 5CZKA 4DKDC 2VSDA 5KSBE 3BIBX 2YPLD 1RJYB 5TPWH 4PP1D 3EFFB 3D39E 4WUKH 4GRMB 3RWDB 1MNUH 1FN4B 1LDPL 2VDOH 4HGMA 5IW6B 4W81A 3SJVD 3HUJF 3RPIB 1MHEA 4I77L 4CNIB 3N1QC 4R4FH 1GGIH 1KB5B 1S9YB 1FL6A 3EYVB 5D7LE 1ZA3A 4QY8B 3ZYZA 2IG2L 3HI6H 5EPMA 3OKLA 3QQ3B 4EI6A 4I2XB 3BZ4B 5DUPH 2BNQA 3LN9A 4QXUH 2HA1A 1KEGL 1JUFB 4H8WH 1H3GA 3C09B 3D25B 4Z0XB 2NY5L 4L29A 3HG1B 4WV1B 4JFDE 3VXUB 3ZKXC 4OCYL 4DGVL 4NNYA 1ZLVH 1D5BA 4TSAH 5F6HI 1WAAF 4PJFF 3OAUH 4HMCA 4LL9A 2AEWA 3RFZC 2DIAA 2Z4QB 2BOBB 3C8KA 5E24E 3QWRD 4HXAL 4U1SB 3UX9B 2I07A 5BXFA 1Q9WB 2CO6B 2V2TA 1WZ1H 3WLWC 1P69B 2DL2A 4HKJA 1P84J 1WZLA 2DLEA 5GRUH 1XF3A 1YY8B 2XFXB 2AERT 4HQQL 4I18C 2HRLA 3CD4A 1JCKA 1MJUH 4XX1G 4BUGA 3X3GL 3VI4E 4Z7NE 4PJEA 3ROLA 3C6LB 2JIXD 3SKUD 1ND0A 1DBBH 3P4OB 4YDLC 1EBAA 3C5ZC 3PV6A 4MNQD 3VWJA 1I85A 3H0TB 1ES0B 3L5JA 3QFJE 5L2KB 1PEWA 1X5ZA 1P7KB 4F80A 3ZTNH 1AXTH 4E41E 5HBBA 3MPCA 1FNHA 5FYKH 4LOUD 5E8OA 2CLZA 4OF5A 1A6ZA 5A43C 4JFDD 1CFTB 4AK1A 4MAYD 4X9FA 2XY1A 5HHXL 3VFUB 2X42A 3QI9B 2YXFA 5EN2B 1S78D 3PQYD 2MJWA 3ZKMD 1DFBH 1J05A 3GJFB 4BFIB 5D7LD 1JE6A 3GSWB 1FNFA 1Z9OA 5DMIH 2Q8AL 5GS0C 1AD9A 5I2IB 5KAQG 3SY0B 5I1EL 4NPYA 4NT6B 1DCLA 3SDDD 2P8PA 5B4MD 3TT1H 4X5WA 3EBAA 4OCXL 4LCIL 3DRQA 4GRLB 5CWSB 3GMPB 2YD8A 3U7YL 5IG7B 1G6RL 4P4RB 3LIZL 5HYJA 3NZHH 1FIEA 3U48A 3SKMB 4HKXA 3P4NA 2P5ED 3WE6B 1IKNC 1MIML 3G08A 4GJTB 3SDAC 5IFAH 3O41B 5D2NA 2A6JB 5ESQA 1CICD 4FQHA 1F4YH 4YHIA 4GAGL 2R2CA 3BE1H 1DEEA 1U8MB 1NL0L 3DIFA 4XPAH 1EAPA 3QA3B 4ODXB 4OF3A 3WIFA 3BYTA 4WI4A 1KXTB 4NO5B 5DJCA 4I13B 1IAIL 3GM0A 2WIIB 3QH3B 1D6VH 4PJ8B 2PTTA 3WE6A 1WISA 4JHAL 5H35B 2VR5A 4P57A 4QHNB 2WBJA 4I3SL 4JB9L 2X4NB 3CVHL 3EOYG 3IDGB 3QXDA 1U3YA 5TF0A 2X9YA 3ZLQC 4L8CA 4NUJB 4JFFB 4D2NA 1UVQB 4ODBD 4MNHB 2AVGA 1IAKB 1KCKA 2HJKB 1TJGH 4WO4B 3GJFA 1MCNA 2J6EH 4UQ2A 4AQOA 4GXUN 3BZDA 3LH2H 4KI5E 4B7IA 2Q20A 3SE4A 4FXGB 5LAXA 3O3EA 4EQ2A 4RX4D 1QR1B 2OR8A 3QSKB 5EZOL 3CLFL 2BSTB 1QLRA 1JGLH 3OJDB 4HAGA 4HGWB 1U3HC 2GEEA 1MIEL 1L9NA 3D69B 1GCFA 3ULVE 1JJUA 2A9ML 2XQBH 2PW2A 2JK5A 4HH9A 5AWNH 3BJ91 4U1KA 4XNZB 1WFUA 4YHIB 4JKLA 1L7IH 4HCRL 1CFNB 3MNWA 3NZ8A 2YN5A 3AGVA 5CEXB 4JKKA 3UROR 3MRCA 5JTWA 3HZMA 4P99A 4XAWL 4BK5A 2UVFA 3WIIH 2IGFL 3WUZA 4Z77A 1UM4L 1NCWH 3SY0A 1XR9B 2AJXH 4KQ3H 2NY4C 4WENB 1MCWM 2F54E 3MFGB 1BD2D 4L8DA 4U3CA 4RGMB 2APFA 1FO0L 3VRLF 2OLDA 3HFMH 3C6SA 3PWVA 4Y1AB 4DOHE 2KZWA 4K7PY 2P7TB 3VFOA 1IZJA 12E8H 4P2CG 5T1LA 3VI3F 2BMKB 1JPST 3GKZA 2J6EA 2JB5H 5DJ2A 1XAUA 4IDJL 3DRTA 2EZ0C 1H8NA 3R8QA 3OMZA 4U05A 1RUPL 3B83A 1CF8L 3MRHA 2M8XA 3HFML 4KVCL 1YNLH 4R0LB 3WJJC 3O3DB 5BW7A 2FX7H 2DDQL 3DSFH 1A7OL 2NQCA 5KSAD 3PHOB 1B9ZA 4NKMB 5ANME 1U2HA 5J1TC 1UM4H 1FG2A 3B5TA 4D0DA 2JELL 1TENA 3D69A 4U1GC 2XZAL 4D3CH 4Y2DC 4OI9A 1GGCH 2W92A 3MQIA 2ADIA 4TNWF 4D3CL 2FD6L 3HNTH 4CVWA 2DM2A 3KPPA 3L7FA 1PSKH 3MLWL 1H0DA 1GGBL 3RI5F 5FYJD 4CVZA 3LZFL 5HVHB 4V1DD 3O8XD 1E4WL 5JO5A 1WZMA 3OKEA 3JV4A 1U2CA 1YEKL 4Y4FC 1MCIA 5GGTH 5C6TL 3NCMA 2A6IA 3NCYS 4UUJB 2MMXA 4HWBA 1KENH 5I9QB 5HDQH 5T1DL 4N9GA 5E9DB 1W0WB 4PB0L 2G75B 1OARL 2CJUL 4OJFL 3CVIL 4QXWA 5E2JA 1G6VK 2AXFB 5H2BB 5KVGH 3LN5B 1DQML 2RQ8A 2NY2B 3LDBC 4LNRA 1IGMH 1VADB 3VH8G 2D7PA 3TT3H 1UA6L 3SGEI 4RMQA 5EDXA 3P4MB 3B9KC 2YXMA 1CD8A 2MTPA 4Y5XB 4MJ2A 1BM3L 1X5HA 1I3UA 3E2HC 4HUXA 4L5FH 2P49B 2X4RA 3GMQA 4JB9H 4K7PH 5H2BA 3S37H 5I8EA 2ZOKB 4U7SA 2YKLL 4J3VA 4PB0H 1KC5L 3UTTB 1MAML 4JM2A 2J7LA 2BY2A 3QNZB 3OTTA 2E7BA 4N90E 2PXYA 4Z7QE 4YHOL 3VA2C 4R4ND 4ERSH 1MRFH 3HA0A 5CWSA 4ZAKA 4R90L 5T3ZE 1AP2A 2XNAB 2NY1B 3RZCC 5DJZB 3BXNA 3DMMA 4MQTB 4KROB 3S35L 1WF5A 4EDXA 1BZ7A 4LHQB 4EEEA 1TFHA 2GAZA 1IILE 1CR9L 2HAZA 4ETQB 1BWWA 5GGUA 3ULUH 5J13C 4OLVL 1FNGB 1FPTL 1UQSA 1J8KA 5K9KB 4HK3N 3TZVC 1MVUB 4PRNB 3OR7A 3FO2B 3QHFH 1CLZH 3BT2L 4EN3C 5DT1L 1OSZB 1I8KA 5I8CA 5I1GH 3LN4A 4K7PX 5AD0A 3G6AB 5L0QB 2YD2A 2FO1A 3RUGE 4N8VB 4MA8L 4EDWL 2VAAB 4M4PA 3VW3L 3FQUB 4NKDB 4QEGA 5DK2B 4FQ1L 4DGIH 4HS8L 3VMPA 3ROLB 3EJJX 4Y1AE 4AEIH 4PJ5A 1UVQA 5FB8A 5I71B 5C0IA 3ZTNL 1YN7B 3SJVB 5EU6B 1E6JL 4GRWE 4OCSH 4P2QD 1NC2A 2E7LC 4H1LG 2YD9A 3G5VB 1HHHA 2UYLA 1Q9WA 1MFDH 3EYSL 1WICA 3UMTA 1CFTA 3MMEB 2PTTB 3P9MB 2Z92B 2VXSL 3JTSB 4OD3H 4HEPG 5IVZA 1AC0A 5FM5M 1WWCA 1KIPB 4PRAB 1P7HL 3O45B 5E08L 4YHNB 1QSFA 2J12B 2YMXH 3WCYA 2HKHH 1IMHC 4OIBA 3W11D 2Q7YB 5FA4A 2DQIL 1IAII 4Y8DC 3ISWA 1HHKB 4S1QL 3LQAH 5I30L 3KJ6L 1NCCL 4N5ED 1ND0B 2WUCH 4XZUB 5FDYA 5IHUH 1CE1L 2I5YL 4DTGH 4RWHA 3GSQB 5D6DA 3HMWL 25C8H 4J4PD 1DL7H 3A67L 3MRGA 3MRQA 1FZKB 1F8TH 4OD2A 3WIHA 5DF0A 5E7BA 5BJTA 3O4LB 3QDGA 3FFDA 3VD9A 3F7YA 1U92B 4KZDL 3QFJD 5IVOA 3Q6GL 4GW5A 1OP3H 3C6SB 2AW2A 2X44D 3RWJA 5F71A 4XVTH 5DHVB 1PG7L 1FVCB 5CJXC 4XPTH 2Z8WC 1MELA 5HDBE 1KB9J 4KUZL 4MB4A 3GK8L 2ATKB 2ICCA 3ULUC 1MJUL 4I77H 3O6KH 4FQCL 5T3ZH 3MOAH 3A6OA 3KLAB 4D9QE 1Z0NA 2FATL 4FQQB 1A8JH 1FFPB 5IV2A 1RSFA 4NZJA 5HGDA 3S88L 2XRAL 1ZHLB 3CFCL 3ZYJA 1E28A 1G7JB 5CLTA 3MGTB 4EUPH 3SE9H 3EO1B 5C0JA 4I4WA 4TVPD 1DBML 1OTSD 1G6RB 3BPOB 4L9LC 4YHNA 1NGXB 2ZSWA 5I1IH 3MRFB 3TH4T 5L8JB 1I7RA 1FZOA 1C08A 4S1DC 2IANE 4DEPC 3L5IA 2MFNA 4JN2A 4Y16A 4QGYA 3DSNA 3RA7L 3VXSD 3V7MA 1CXLA 5C08E 1XZ0A 4CU6A 3P9LB 5M7QA 4ZNEA 1QPXA 4PJ7A 4TULH 4P9ML 2XTJD 4K9EC 3TJEH 5C0BD 1QLFA 5IKCA 4MA7L 3FTGA 4PY7A 1F3JB 3L6FA 3VDAA 1RZJL 5KTEL 2R2EB 1E27A 3GHEL 4X99A 3O6LH 3LQAC 1KCRL 3C5ZA 1B4JL 4HUWA 1DUYA 4R4NC 4M1GH 4DFIA 1N7ML 5FUZH 1JFQH 2V2WB 1DL7L 3A67H 3L1OL 3FO9A 2ESVA 3O9WC 3B2VH 2YC1B 5EO0B 1JF1A 5L9DL 1S9VA 1BMGA 2QSCL 5D7JC 4M93C 1CD0A 5DSCA 1CGVA 3MRPB 3W39B 1TQCC 4IRSC 4WJ5A 4N0FA 4X7SL 5DI8A 5H37G 3IFPA 1W0WA 2R23A 2DQEH 3BZEB 2BP3A 4Y0GA 3BMVA 3U7WH 2K1MA 4FG6C 4PJFA 2XNAA 3MC0A 1AGFB 2NY4D 3IDJB 5AYUH 4RDQF 3WXWH 4BSWA 2V17H 3HNSL 2OK0H 2VLRA 4KUCF 1TZHB 1DBJL 4JHWL 1NGQH 4JFXB 1QFPA 2X1QA 5C09D 4LLWB 1LP9B 4OGYH 3STLB 1G7PB 5IWLC 1BF2A 1DEDA 5EUOF 5T1KB 3MRRB 5BV7H 4MJ4A 4R97B 4RFEB 3DROA 3TBYB 2YRLA 3RWGB 1SYSA 1U58A 5AYUL 5SX4I 5DO2D 5E8OB 4LEOA 4FQ2L 3GSOB 4FXKA 4LASL 3QFDA 4UMGA 2YN3A 1J1OL 4M7ZC 1HWHB 4YWGH 2WBKA 3VFPA 4RGOL 4ESKA 3SOBL 43C9B 2P8MA 1EAJA 4OAWB 3T0EC 5FHBH 4MX7B 5FGSA 4Z7VE 2X89A 1EMTL 3K8KA 2Z31A 5GJTH 4JZNB 3PNWB 1HQ4A 4K9EH 5C7XL 4D9RE 2XTLA 1VB9A 2WP3O 1AQKH 4NNPL 5L2JA 3DHMA 5JMOC 1QFUL 5T5FL 5GRJH 4JO2H 3T3PF 2OTWB 1KLFA 2YA0A 2D0GA 4WHYH 3W0WD 4ONFL 4J3SA 2AQ1A 4XCCL 4LF3A 3CZJA 1IGYB 1U8LA 3RPKA 5EOCH 1OAYH 3UXFA 2E3VA 1UB5A 4G8IB 4XMKL 5DMYA 1A4JA 3MLTB 3QJFB 3NIDF 4NHCH 1G7PA 3QDJA 4IMLA 1VFMA 4WI7A 5FF6B 4XNXL 1FV1B 5FGBA 3BGMB 1NCTA 4GS7C 4YDIL 3KS0H 3GIVA 3RHWF 2A0LD 4KAQH 2HT2C 5INDB 4NQDE 1MCPL 3I6GB 1C12B 1TETL 5K9OA 2ORBH 1D5XA 5EU5A 4NQVA 1QSFD 3QDMB 4YFEA 3BD5A 1LEKA 4LOUC 4TTDC 4QWWC 1EZVY 4JO4H 3L5HA 2IADA 1EERB 1UG9A 1TJIL 1MCOL 1T22B 4ZXBC 4KH2A 1T1ZB 4O9HH 5GS1C 1IAKA 4OZFA 1GGUA 3IRPX 1HSAA 4ZUTB 4D8PA 3RHWK 3CFEA 2JB6A 1WCBB 2BC4A 4G9DA 3O0RL 3FQTA 3V79C 3RX7A 1T04A 2DOCA 4PB9H 2R8SL 1J12A 4IRSB 1EEQA 3GHBH 4M43L 3SGKA 3CUPA 4HUMB 3K2UL 4XPBH 2XZAH 4LARH 4LSTL 5DVKA 1BFOA 3QIBB 1ZLUK 1RIVL 2W91A 2OYPA 2CRMA 4YBLB 5E5RB 4DN3L 3MNVB 2UY6A 4N0YL 3CFKB 3LKPB 4XI5C 3CSYA 4APQD 3KAAA 2NXZD 5CILH 1IC5L 5CSZA 4GO6B 4OKVB 3NIFF 3HZVA 5JW3H 5CJQL 3OF6D 5ISZE 5TFSH 4DKFL 2GIYA 3B5GA 3TEUA 3VXUD 2HLAA 4QHUB 5HHMD 3MGTA 1R3LB 1R6VA 3JWDH 3BW9A 1A0QL 4O02L 4NJAH 5DHXB 3TCXA 1IRAY 4FXLA 1UWXK 4GG8B 1U8OA 5FK9B 3FKUS 4NQEA 2QQLH 1EFXD 1YYMH 2AK4E 2R2EA 3P11H 1G1CA 3MCKB 2Z93A 4P57B 4QHNA 3N1FC 1KN4H 3FQTB 4IMKA 1JRHI 1X7QA 1BQSA 4RGND 5HY9A 3VXRA 4KXZH 1IC7H 5BRZE 3QHZL 1DLFL 4W4OC 2VQ1A 1HIML 2VC2H 2APVA 1CBVL 1X5IA 4O51B 1ZGLA 1KJ2A 1JI2A 5C0AB 5DHVA 4TVPL 5LGJA 5F7UA 4XCNA 3LV3A 3L5WB 3P40A 5JXEA 1U9KA 3DETC 3EKCA 3T2OA 1MPAH 1TITA 4BQ8A 5LWYH 1DTUA 4PYGA 5FUCE 1VCAA 3MTRA 1TPXB 3EO9H 4P49A 4EQ3A 3V95A 1F45A 4LPYA 4KKLC 3CFKA 4LSDA 2UWEB 5DJ6B 1LNUB 3WNMA 4MSWB 1LK2A 3S7GA 3TNMB 3VFGH 4PJAE 1SVZA 4IRJC 4EVNA 1RZIB 4K94C 5F89A 4HZLA 4M6OH 3ZT7A 5KN5A 5DQJB 3KHOA 5I2IA 4CN6A 2D2OA 1ORSB 4HWEH 4DCQA 4AH2A 1BGXL 1VGKB 1UWEH 3KPSD 5CJ8A 4TVPH 2CKNA 2IJ0C 2VUYA 4GXUM 3T0EA 2R2BB 5CSGA 4KV5E 1GPOL 1T2QH 4PGJA 2FH8A 4HPYL 2ATKA 5FYLL 4GKSB 1I9IL 3QUXC 4HCRA 4FP8L 1YMMB 3QDJD 3NIGF 4L4JA 5D70L 3AAZA 4PBXA 3U0TA 2NY5C 2WWMC 4XP1H 4P5TA 1LEGA 3UTZA 4XAKD 5F1OB 1J18A 4XP5H 2VRAA 4P5TD 4LGRB 4YGAB 1GIGL 1NEZB 1MRCH 4OD2B 1AGDA 4UDTA 5DEGB 5HHPB 5IB1A 3TH2T 4DK6A 1NCUA 5FKAA 5EZJB 3S9DB 1C08B 2IFGA 2GCYB 3KPRE 5CILL 2QQLL 4AYFA 1I7RB 3O6FA 3OF6A 2Z91B 3NZHL 1AHWB 2BNUA 4HWNA 4NQCB 3UZQA 2C26A 4F7EA 1S9VB 1N6UA 3MA9L 5H94B 5A16B 1ZANL 3WFBH 1CZ8L 4WEBL 4CDGC 4J3TA 5EO9B 4KI1A 3CDGA 2GTZA 3V5HB 2GJJA 1FZJB 1FFPA 2XI9A 3QUZC 1SBBA 2ED8A 5HHXH 3HI1B 1S7TA 3ZDXF 3TVMD 2COQA 2FX8L 1C5BH 3SDXE 1Y6KR 5I76B 4APQB 4RAHA 1VFAA 5I1JH 1A6TA 2D9CA 3VI4F 4Z7WB 4JFEA 1ZT7A 4O58L 1WAAA 2LU7A 2OI9B 4DKEH 5FYJH 3FQUA 3EJZC 4NKDA 5EG6C 2XZQL 1GOFA 4GMSH 5DJ0B 3QDMD 1RJYA 1PD6A 4Y16B 5E70A 5KVMC 2JJWA 3RKDC 1DQJA 2CXGA 3RWIA 3AS1A 5FCUL 1AO7E 1A6TB 3KPQB 1HDMA 4RGNE 1G7QB 2NYYC 3DX8A 4LSRL 2EH7L 5IT2L 1YEJH 1EHNA 5GRUL 2K7PA 3OKYA 4F9LC 2VISB 3I02B 1H9VA 4HC1L 4LU5H 5FKPB 2XXCB 4U6YA 2BDNL 3GMLB 1PJ9A 3O45A 2OZ4L 6FABH 3OAUL 3MJ9A 1IGFH 4XMPH 4YC2B 1P4BL 1N4XL 1HE7A 3E2HB 4OLWH 2LQRA 2AJ3B 1L7TL 2OI9C 4OZGE 3B9KB 4S10A 4V1DA 1SQ2N 2P8LA 4ZXBA 3HRZB 3C5JB 2XWJA 4Y5VB 4HJ0D 2XG5A 1OAYL 5GGSB 4M62L 2PR4H 4OZFB 4Q58C 4KAQL 4MHHI 5KANG 3LDBB 1T1ZA 2NY2C 5EU6A 1INDL 1S7QB 1G0YR 1OQXA 3LS4L 3P0YL 3GSUB 5DD3L 3RY4A 1KJMB 3T65A 1MLBA 4XNXH 2ITDB 4P5MB 4Z7UF 4YDKL 1ED3B 2ZSWB 5GGVL 1QOKA 2NNAA 1IKFH 1IEBB 3OKKB 1K3ZA 2VZUA 5BZWA 5CBAA 5I15L 3QEUA 4QYOA 4KHXL 1J88A 1OF2A 3L9RB 4NC0B 1JGLL 5SWSA 4RGOH 3LEYL 4D9QD 4MXQD 5HVHC 1AGCA 5C07B 2CK2A 3BP7A 1J7VR 1AHWC 3MLZH 1FL5B 4Z0BL 4UU9A 4LVHC 2ZNXA 3PQYA 1UZ8A 3WXVH 1FZMA 1M7IB 4LIQH 4RFEA 2HRPH 4R7DA 3EJYC 4YQXL 4J3XA 3A6BH 1DQLL 4Q6IC 5EORL 5BV7L 1XIWB 1GOGA 5TQ0L 3LKSB 3RVTD 4DAGH 1VDGA 2DLGA 4OFYD 4MS8D 5BVPH 1YEDB 5EU4B 3MRCB 3MLVL 4G9FE 3MODH 4PREA 4WU5A 2UWEA 4Y4KC 1CDYA 1KB5H 1I7TA 5C9JA 2YSSB 2PETA 4YHZL 4P4KD 1KT2B 1FVEA 4HPOL 3UBXI 2HT2D 4JRXA 1NANH 4ORGB 2BVYA 4XRCB 4OAWA 3O2DH 4NO0D 4GLRI 1NGPL 2AJZB 5JUEH 5FM5O 2HLFD 2QQQA 3LKRA 1BQLL 3MCLL 5B38B 2J3SA 2WK2A 3ARPA 3QO0A 1LHZA 4JY4A 3F7VA 1GYAA 1KEML 2XKSA 4HH8A 3T4AB 2CPCA 4NBXB 3KPSB 2OMNA 3QUYB 1XGPA 3KYNA 2GK0B 4Z7VF 3CDFA 5EC2B 5JUEL 3BP5B 4N0CC 3CX5J 1QQDB 2AKRB 3BQUD 4G6FD 1GHFH 3NA4A 3I50H 4GAJH 2DM4A 3KXFA 3EYFB 1EGJA 4JZJC 5DJZA 5ETUA 5DMGC 2EKJA 3ZKSD 5DJYA 4JREB 1JIBA 3O6FD 5JLZB 1CXIA 4YBHA 5F7WC 3SKNB 1EO8H 4GKZB 1ZEAL 3HUJB 4UDUB 1ODAA 4M02A 1UKTA 3MV01 1AQDA 1ZT1B 1OAKH 4DQOH 3SN6N 5F6HJ 1W8NA 2B1HH 5IEKB 1FRGH 4LQFL 1FGNL 1H0DB 4X9IA 4X6EA 5IHZA 4KI5D 1TCRB 4RIRB 3NCBB 4MNQA 5F9DC 3TJEL 1Z3GL 5CGYC 3ULVF 4OLWL 4FQPA 4HXBH 4Y4HC 1YDPA 1T2XA 3TH3T 5L6YH 2A6DB 5D1QB 1UEMA 4Z7VA 1OT2A 4GXVH 3PF2A 4KKBD 1YMHB 7FABL 5IFJA 3RKDD 1D6EA 4ZDHA 4P4RA 5HYJB 4KJPC 5DDHA 3LCYA 3BJLA 3M17A 3HCVB 3K3QA 4YUEL 4X8JA 3EYUH 3SBWC 1MH5B 4JPIA 4Z7WA 2Y07H 4XP4L 4HS3A 3IS0X 3THML 3X3FH 1UB6B 2DJ4A 4NUJA 5TF1H 3KXFD 1ZHNB 4PJAF 1I9RH 3F8UB 3SKOB 4EJ1C 4PJ7B 3LKNB 2C1OA 4XX1E 1NBZA 2AKRA 2DMKA 2XQYG 4M7KL 1JWMA 3E6HA 4XBGA 4F37K 4HLJA 5CZXD 4N8VG 3SDAB 2X4RB 3TFKD 3BD3A 2P5EE 4KDVA 4QRRA 4RAUA 2HTKD 1M6OB 1I8KB 3NABL 2FATH 3PABB 1MI5E 3QDMA 4JCLA 4YHLL 2VDKL 3QCUL 5I1JL 1JHLL 1OP3K 5HHME 5C0DB 1NAKH 2EDLA 1P4BH 3RVXD 4PV9B 5FM4A 1JGDA 3HMWH 1FQ9C 1HEZA 2ICEB 1DVFD 4QTIH 1KIRA 3QXTA 5FO7A 5LWYL 1WIOA 1RZ7H 4PJDF 1NUDA 5IB1B 5FUOL 3QI9C 3GB7B 5L88L 5F1IA 3NN8A 2F74B 1F8TL 2VC2L 4K23H 2BSTA 3HKFA 2YA1A 2XTJC 3CFDB 4ELMB 5I1AA 3BRDA 1YEDA 4O2CA 5C08A 3OKEB 1T0MA 2Z8VC 4M5YH 3IDXL 2J8HA 3DVGB 4WGWB 3TC9A 4MJID 2E8YA 2LTQC 1YMMA 4PJ7F 1C7SA 3N0PB 3D18B 4O58H 5KG9B 1R24B 4MJ5B 3U4EA 3OAYK 4YDLB 1FG9C 5HPOA 1F00I 4GS7B 2E7CA 1HI6A 4ZTOH 3LOWA 1BX2A 1YPZF 2VZVA 4RWYL 2BVUA 4NIKB 5CEXA 3IJYB 1RI8A 2WQRA 3GSXA 2VXUL 3CPLA 5ANMA 4PJ9A 1F02I 2HVKB 5T1MA 2BVOA 1ADQL 1I7UA 4UTBH 5J6GA 2F53A 4LAQL 4NKOA 2DQFB 3EYOA 1RAMA 3BH9B 3QWOA 4NKIH 4PRHD 2OXGA 3JSSA 1FSKC 4M9OA 2UV3A 3DOSA 5BVJB 1EUUA 4PLNC 5IGXH 1IE5A 3CMOH 4KROD 3T65B 2NXYC 4OGAD 4R9HA 2EE3A 3KNBB 2W65A 1R0AH 5I1LA 1TJHH 3OXRA 3V0VB 4HWEL 4L8DB 2XV6B 1QR1A 4MD4A 3O9WA 5GS1A 1AQDB 1ZT1A 3MYZA 3VFGL 2VLLB 4M7ZB 4FZEL 1MRCL 2NY3D 4O51A 1R3JA 2VB5A 5TGBB 1REIA 4Y1AD 3RVTC 1N5YL 1LO3L 1N64L 5EIVA 1XGRA 3BOVA 2NW3A 3MJ7B 5IJKC 2FRGP 3TVMC 5TE4H 1Z0MA 2C1PA 5MENE 1QLEH 3L95A 2JJVA 4R97C 2NX5D 4F57L 4PJIA 2R0LH 3WO3B 1S3KL 1YPZE 4F33B 1DN0B 4PV9A 2A83A 8CGTA 5GGQH 5KSBA 5A3IC 1UC6A 5HI4D 2CKBL 3B3IA 1GZPA 4FZEH 4EI5A 4NQXA 1DQJB 5ACZA 4ALAH 4JKMA 5J11C 2ORBL 5HYIA 3EHBD 1T7XA 3TT3L 3SO3B 5JQ6H 1MLBB 1J10A 1WITA 2H41A 1E6OL 2DQJH 3EYQD 3O2WH 5AZ2L 5IBTH 3RZCA 1AXSA 3DUSB 4YDIH 4FS0A 2N56A 1OAUH 2EYSB 4AEHH 3U7AA 3DV4A 4U2YA 1X4XA 5F8QC 2DQGL 1RUAH 1K2DB 4ZO7A 3O9WB 5EU7C 2OXHA 4OTXH 1DQMH 2Q86A 5IBUB 3VJ6A 2JJSA 4JJHA 1R0AL 4WTZG 2XXMB 3KYKL 4NYLA 3HPJB 2UWEE 2DRUA 5T5FH 4ONHB 4QOKD 1YNTA 1L0YA 1X5AA 3OGCA 4QRRD 4M8QA 1H3XA 4HIXH 1HHJB 3QUMH 4F7EB 3HNTL 2NY0D 1U8MA 3Q5OA 3K2MC 2WV3A 1N5AB 4LFHG 4LPVA 1F2QA 3NGBB 3CFBB 1DN0A 3P9WB 1FYHB 3QEGL 1A7OH 2R8SH 5JHLH 3BP6B 4YWGL 5LGHL 1A0QH 3C6LD 5DD0H 3VFTA 4QHLA 4YAQA 4GKZA 4UDUA 1YPZB 2X1XR 4P9HC 1T1WA 4PRBA 2JJSC 4MCYB 3JWOC 4DEPB 1J05B 1XT5A 1PLGH 1KFAL 2C5DC 5ITFB 4LDEB 5JHDA 4MMXC 3LPWA 3I6LD 3U0PB 1CTOA 3VXME 1JN6A 1MCEA 3TA3D 3QUYA 4W68A 2VH5L 4DN3H 1URLA 4JFPA 1NBYB 2KKQA 4QNPF 1K9TA 3ARSA 3ARBA 1UT9A 4NO5A 3LAFA 3VXUA 3E6FA 4XTRD 5F3HB 1HEZB 1QFWH 2ICEA 4J7RA 5FKPA 4LSSL 2CLRA 3ARXA 2V2XA 3SDYL 2V7NB 5F1NB 1ETZA 4G42B 3BIAX 1J5OH 1D5ZB 2IAMB 2AJXL 2VOTA 2EE6A 3L3IA 3UTQB 3MRIB 2YUXA 3AXLA 1KJ2L 1T0NA 4NM4H 2QSVA 4O5LH 5DO2C 4BM7A 3MGOA 4G6KL 2NLJA 1MFNA 3B9AA 4H1LB 4HWZA 1NCBH 4N8CL 2H1PL 2ZG1A 1U8IB 1V7NH 3SDAA 4ZYKA 4PJ7E 2Y7QB 4LGSB 1JK8A 3FAXA 4MDJA 5LVEA 1JPFB 3VWKC 8FABA 4IOIB 4UNVA 1NPUA 2RBLA 3X3FL 4JFOA 4NUGL 1UYWL 1P1ZB 4LCUA 3BP4A 4KK9C 3G5YB 2A1WH 4I18A 3C87A 3HG1A 2ICES 3QUKB 5SWZB 4YXLH 1D6EB 4ZDHB 1MCFA 2IAMD 3CLEH 3SDCD 3G6JB 3S36H 5AD0B 1FRGL 4LQFH 2AI0H 2ESVE 4S1RL 3QDME 1GRWA 1OCWL 2FYYA 2OL3B 1LP9E 4MCZA 3PWPB 3NAAH 2WUBH 5FM8A 2WSKA 1MCCA 1EO8L 5IM7A 5DD1L 3JTTA 3KWWA 3BMWA 4BZ1L 1FN4A 4MJ6A 4OF0A 4KKBC 4R3SA 1JI1A 4JM4H 1NL0H 3MACH 1CLYL 3RUGA 1X5FA 1FGNH 1FORL 3NFNA 3RNKA 1ZHBA 4U31A 4LDOB 3SDCC 2B1HL 1YUHB 3Q3GA 3CFCH 4B0MM 3O6ML 5F44A 5AYQA 3V5KB 5DJ8B 2FHBA 5FGRA 3QEQA 2V17L 1A3QA 3IFOB 2CH8A 4EN3B 3FCTB 4F37F 1HQRA 4PIRF 3VDCA 1T03L 4GQ9L 2HJLB 3VXRB 2J8OA 1MH5A 1NSNH 3QEHA 3HI5H 3SOBH 1F4YL 2LAAA 3T0EE 1CDCA 3O2DL 4GUPA 2XICA 4JFDB 1EO7A 1TZIB 3B9KD 4WW1A 5FV2A 1FCGA 5C0FA 4FQ2H 1G6RH 1OF2B 4FN0A 4HK3J 4MB5A 1MHPH 3G6JF 4LCWD 5CD5C 4QYOB 4QNPE 3MODL 1BECA 2XOTA 1BBJA 5JORA 2QSQA 3S4SB 5JDSA 5I1EH 2AJZA 2MPAL 5JPNA 4X6DB 5HGGS 3LB6D 2Z91A 1XR8A 4OLYL 5HYFA 3S3JA 3DMMC 5DUML 4LLDB 2N7AA 3UTSE 1EPFA 3FO0H 2HFFA 1S9XB 2IQAB 4NOBA 2HLFC 1UJTA 1WBXB 5ITBL 1KTRL 2W9LA 4TULL 4BH8B 4J1UA 4QTHB 2R69L 2DQEL 5DFVC 4WI5A 4YNYB 4F3FB 1CGSH 2EIZB 5HHVH 3H9SA 3PP4L 5C0CB 2C9AA 4LGPB 3O2VL 1J9CT 3GJEB 2Z8SA 1KPVA 5C0EB 3GMLA 1K4DB 1YECL 4JLRB 1MUJA 3RU8L 1J0YA 1DVFC 1NBYA 4U6VL 4Y7MA 3EO0B 5GSVB 4HC1A 1N7MH 2JB6B 5B4MC 4UB0H 3NOIA 1NGWB 2D4FA 4XNQB 1W2KT 3MRKB 2L4OA 4RISL 3GKWH 4ZS6C 1IBGH 4J6RH 5B38A 2HTLC 4Z18A 1F4WL 3HMXA 1V7NL 5AAMA 3MZTA 3RNQB 1KEGH 4Y4FB 2H1PH 2PR4L 1IM9B 2P5WB 2X4UA 3JZ7A 1C1EL 4ZUWA 4N68A 3ULSA 5HYEA 4MCYA 2CLVA 4H88H 1YPZA 1LO5A 4MXQC 3WKMH 3HN3A 4X4YA 3BEVA 4NQVB 1QA9A 4UAOB 1RJZB 3INUL 1J5OL 4UINL 4UIKL 5EZIH 1A7RH 5C09E 4HBCH 1MNUL 1AC6A 1CGWA 4HFUL 4Y2DB 5F9OH 4D0CB 4RZCA 3QEQD 3G6DL 3L5WA 1ITBB 3GSOA 4FXKB 5C0RH 1CG9A 5BXFB 3V5HA 3MV7A 3Q1SL 4EOWL 4GBXA 3H7LA 4FQXB 4B53A 2DWEB 3N9GL 2AV1B 1CQYA 1XGQB 5IVZB 1UB5B 1N6VA 4R7DB 3KLHC 3ALWA 25C8L 2EDDA 3QYCA 4WNQA 4JEGB 2F15A 2KPNA 4L29B 5I1HH 3KPLB 2XRAH 6CGTA 5KN5B 5F96H 4TUKL 2HKHL 4RZCB 2KH2B 3BZ4A 3MOQA 1AO7B 5L2JB 1M71B 4L4VB 4RGMC 3CSBA 1NCDH 4PJFB 3A0OA 2R0KH 5IOPB 5M95B 1LMKA 2DI8A 4OFVA 5GS2D 1NBVL 4DZBB 1QHOA 3V0WH 3MV11 3OJDA 1IC7L 4WW2B 3RWIB 1C5BL 5E8PB 3VFSB 3VRJA 3VD7A 4ZFOA 2Y23A 4O4YH 5E2UH 3RL1B 3ULSB 2VAAA 2P5WA 4KRPB 4JJ5B 5CZVL 2X09A 2Z31D 5LCVH 1SY6A 4MNGA 4UT9L 2G5BB 1CN4A 3DX7A 2QADC 3JWDL 2ZSVB 3S3SA 2HT3C 1A4KA 1TVDA 3C5JA 4XNZC 1Y0LA 2H6PA 1IC1A 3OB8A 4WW1B 4GAYA 4UV4L 2G60L 2HJFB 3I6LE 4G8GE 1H3UA 1KJVA 1N8ZA 2IQ9H 4WU7A 4PFEA 4HFWB 3P73A 2X9XA 1KUMA 4ZSOB 1IGJA 4JPKL 4NBZB 4NKQB 4Q0XL 1D5MB 5GGRA 1NBQA 3QISA 4LSTH 1DEEB 1CT8B 4I0KA 1S5IL 3HZVB 2BSSA 2GYSA 3KYAA 4IIQA 4WFEE 4IOIA 1OT1A 5K9QG 3Q6FB 2B0SL 2P1YA 4MDJB 3MOBL 1EGJL 4JQIL 3NFNB 1XR8B 4I5BB 3T08A 4OGXL 3S5LB 2DIBA 2X41A 1J1XL 4YEFA 3FB7B 2CKBH 3IDNA 3AY4C 1QFHA 5E8PA 3VFSA 2W0FA 1V05A 2OM5A 1MRFL 3P2TA 4JAMB 4P9HL 5KZCB 2OL3A 1QLEL 1EO5A 4GRWB 5TE4L 3FAWA 5IV2B 1TZIA 2C1PB 1NAMH 1FO0H 1WWAX 5D1QC 4DOHB 5AAWA 2H2SD 4GAYB 2VDMH 1EHXA 1ZXQA 1RZ8B 1WEJL 3LEXA 4XC1H 1A7PL 3VFRA 4TUJA 3QIUB 4H20L 5HD8C 2BSED 5T1KA 1HZHH 5E9DE 1CIDA 2VXVH 1UWEL 3NGBC 4F9LA 1JK8B 3GSRB 3U79A 2HFTA 2ICWI 4JZOA 3HAEB 1S9WA 3HE7D 4C56D 4OM1L 4AMKH 4HLZG 1OAXL 1YYLL 4RMTA 3V8CA 2ZNWA 4L3AA 5FYJU 1GXEA 3L3DA 4OZHF 1P7QB 2HYMA 2XQBL 4UDTB 5DEGA 3U1SH 5HHPA 3QHZH 4FQJH 3BN9C 1ONQB 2OL3H 3ZE0F 3UTQA 3EFDH 5ADOL 1MQKH 2H9GA 1K3IA 2R23B 3PG2A 3TBVA 4X4YB 3L3IB 3MLYH 5JR1L 1A5FL 2DQTH 4FMFA 3QAZC 1KELH 1YY9C 1IJ9A 4JZOB 1QBLL 1GH7A 4JKPH 2EE9A 5ANMB 2WWKT 4HG4J 1O5DT 2HWZL 3EOTH 4E0RA 5TDNA 2JJTA 1MY5A 3F7QA 1F5WA 1CXKA 2WBJD 1F90L 4FQXA 3MXVL 1HHJA 3FFCE 5K33A 3WFDL 1YYML 1HSAB 4NYLB 4LSQH 3T0AA 5KVGL 3DSFL 1FFRA 1G9NL 1GC1L 3CVIH 1KB9K 5HYSB 1MHCB 1HH6B 1JBJA 2GK2A 2Q8BL 3FCTA 4JO3H 3F7YB 1IGCL 4QHKI 4PS4H 2C4FU 2XA3A 4QHMA 1OTUD 4M5ZL 2YRZA 2D0FA 1RZKL 1WK0A 5K9OB 4JFED 4LSPH 2FB4H 1OSZA 5I8CB 2FH6A 1S7VB 3IFNH 3Q6FA 2KBGA 1I3VA 3GSNA 1KCLA 3C09C 3WS6C 3VD4A 2VE6B 2R1YA 4K8RH 5C2BH 5C3LD 1ORQB 1G9ML 4N90D 4JHBA 5TH2B 5ISZD 1G7LB 1SVCP 4DW2L 3REVB 2V9TA 4HGWA 4Q0XH 5D2LE 1P9MC 2ED9A 1E4KC 4OLXL 3VXNA 1ADQA 4XCFL 4LVHB 1AKJA 2NR6C 4JQVA 1YEEL 5MERA 1TJIH 4NRZA 3MRMB 5C07D 2ESVD 4KKCC 1S8DA 1I75A 4QRTB 1FH5L 1FSKB 1F58L 2AXGB 3I6KA 4YNYA 3DXAB 2EIEA 4P59H 2KL6A 5GGVY 3DUUA 4PJDB 2V9RA 2HJKA 3RI5K 2UZIL 1CDIA 4ODWB 4QRPE 4TRPH 3KR3L 4YDVB 1U93A 5GHWH 4NQDA 4N0FB 1QQDA 2JIXA 4F2MA 4XBPA 4OFDA 4ZYKB 4G6MH 4NCDA 3VGBA 3OJ2C 3KYNB 4N8VA 2CDEB 2DTSA 4E41B 4M48L 1PEZA 5DEZA 4NM8L 3X13A 4MA7H 3FZUC 4ZOEA 2D4DA 1DBBL 3BDXA 2AV7A 5KAQF 3BDYL 4JFHD 3E3QE 1NGXA 1BZ9A 3VU2A 1NBVH 3ELAT 3MA7A 4TNVK 4JANA 3UC0H 5EBWA 2FO4A 3AREB 4FTVE 2IMMA 4G6JL 3E6FB 4L8BB 3BGFB 3WFHB 2QR0A 1V3KA 1X5XA 5D7JD 1VA9A 1P53A 3DMMB 3ARBB 4D9LH 3IRZA 4ONGL 1N0XL 5CP3A 1A4JB 1JHKL 1LO4L 3TWCL 1ZMYA 3D3VA 1XF2A 2GQHA 5GSRB 2ZUXA 1BEYL 2DLIA 2HTLD 2FR4A 2EDEA 3I50L 1NFDA 2E8ZA 4S2SA 4TSBH 1G1YA 4LKXA 1N6QL 1IC4L 3SDDC 5TDPB 4QT5A 5D71H 4K3JH 3HG1E 1ZGLM 1EJ6A 3PNWA 5CP7A 1UH4A 4BSVA 2GITB 1WLHA 3QQ4B 2DAVA 2XA8H 3N50A 4PG2A 4HK0A 5JZ7C 3EJYD 4FFWD 1DQDH 4PLOB 5FHBL 4O00A 5D7LB 2Y06L 1BQHB 4G6FB 4EBQH 4KUZH 4PPTA 3C2AH 3OKOB 3FOMB 1G7HB 5B38G 3Q6GH 5F7EL 2CQVA 4G6AD 1MVUA 2K3TA 5F3HA 1B2WH 3VG0H 5FF6A 3X12A 3CVHA 4BQBA 4HIEA 4ETQA 2VDLL 3GBML 1F6AB 1T3FB 1GJIA 3P9MA 4JG1L 4NZTH 1EX0A 4JGUA 2Y36L 3V7AE 3B2UD 2OBGA 3LQAL 4Y4HB 5E6ID 4E42B 5IMOB 2EYRA 3LKSA 4U7KA 5F70A 2YMXL 5ITFA 3O3AA 2Q7NA 3GNMH 2EDNA 1ZHNA 3B2VL 3UZEA 3MUJA 1F6AA 1T3FA 2R69H 3RY6C 1V7ML 2FEEL 3UJJL 4F15B 1J0JA 1FLTX 2ZCHL 2IALA 1CFNA 5MEQB 2BNRA 2YWZA 3BDBA 1MFBH 1UGNA 4JVUA 5DSCB 3BP6A 2X4UB 3HG1D 4NKMA 1GVIA 3EAKA 3OKLB 2DQCH 2FJFB 4YR6A 3QFDB 1JNHA 4KHTL 4U1IA 5EWIH 2PTUA 4Z7OF 4WI9A 3CC5A 1WUNT 1YY9D 1NUFA 2YPVH 3QO1A 3MMEA 1UQSB 1R3HA 4YLQT 5B8CA 4N0UE 3MNZA 3S34H 4BFEA 4KRPC 5JPMB 2G9HB 4AG4H 1R3KA 5MEQA 3HPJA 1JPSH 2CGRH 3H8NA 1U3ZA 3MYJA 4Z8FH 3BT2H 1FO0A 2VLRE 4UZGA 2VJXA 1UB6A 5CIPA 3IJSA 4KFZC 3GI8L 4CAGA 2KDGA 3MV9E 2E27L 3IDGA 3QXDB 4OLVH 1SJHB 4Y4HA 1D7FA 2IQAA 4KK9D 3FB6A 1TPXC 2X1WL 1PY4A 5DI8B 3KNBA 4WJ5B 4UOW0 4MNQE 3AMKA 3W9EB 1NCNA 1KBGH 5F9JB 1N6QH 1KSRA 2VYRE 2PKDA 5C0AD 2Y5TA 3FO2A 5MEOB 4XP6H 4ZUUB 4PJHB 2V6HA 4FTVB 1KG0A 4RSVA 4R7NB 5EBLA 1N59A 4BZ1H 3QQ9C 1FGVL 5ESVA 1SM3L 1LO4H 3TWCH 5CINL 5D2NB 1E28B 1G7JA 3NTCH 4Q6IB 4BKLA 4H8WL 2WWKO 1BBDL 2YD6A 3GSXB 2OJEB 3DI2B 5J56B 1HYRC 1EXUB 5EO1A 5C6WH 2AI0L 3P0VH 4K7PL 2DICA 3KPNA 2HFEA 3OJMB 4OZIB 3MROA 3PDOB 2NR6D 4YXLL 1OAQH 5JLZA 4P46A 3D5OF 4UV7L 1NCAH 5IB5A 5DVOA 4KHTH 4HS3B 1P84K 4BFIA 1ACYL 2YBRA 1Q8MA 3EGSB 1IM9D 5D5MB 1EEYB 3WNOA 5SWQA 5KVFH 5FEBA 1H15A 1K4CA 1MFCH 1F4XL 4DVBB 4HUXB 1YEEH 1QACA 4LDLB 2O26U 3F65A 5GJSL 4XCFH 1IT9L 1J0ZA 5FYJE 5F3BA 4YBLC 4I48B 3QUZA 5IF0B 3GNML 3LSOA 3TYFB 3O2DA 5H8DA 3MJ8B 2VQUA 2AJSL 4NM4L 1BFVL 3NIGE 4KTEH 2BNRB 2SEBB 1ZHLA 2DTMH 4PJEE 2G75A 2AJVH 3QPXL 5FOJA 2YSSA 5LKNA 1NGYA 4YC2C 1MCBA 4X0KB 4PV8B 4IMKC 3VMOA 3HUJA 2WP3T 3UTSD 3RVVC 4XVUC 4MJ5A 5JIHA 1BLNA 2BRRH 3MRDB 4NPYB 4NT6A 3U4EB 2F9BT 4FQLH 5CIPB 5GS1B 3HAEH 3V6FB 3KLSA 3GSRA 3UAJC 4WCYH 3LKOB 1OB1B 3FN9A 5GXBB 2BJMH 5E4EB 3UJIH 1CLZL 2AEQH 3I75B 2CUMA 4YXKL 2DYPB 3ARFA 4ISVA 2Y6SC 3TYGH 5HY9B 4KC3B 3OZ9H 3BH8B 4Y16C 4BFBD 5HTSA 1JZ3A 4QHLB 4YAQB 5L2KD 3AXLB 1NJ9A 4WFHD 3FB5A 4GW1B 3I9GH 2QR0B 4M6OL 2PYEE 1WSST 2LV4A 3C60A 3FOMA 1G7MB 2EO1A 3WN5C 3CPLB 4JY6B 5KOMC 4W6YB 2J88H 1K5NB 3SDXF 4H1LH 7CGTA 1NDGA 2PW2B 3RPIA 2YK1L 4NCC2 5MEOA 3AU1A 2KQMA 4JKWA 3QUML 2VNCA 4X80H 4Q9CA 2Z92A 2ID5A 5IJVA 15C8L 5GISL 4BFGA 5ISZA 1RVFH 3T3MF 3BPCA 4JKPL 4NWUL 3ARGA 5LG1A 2WINA 1YJDL 1CT8A 1K8DB 1XIWA 1IFHL 4KJQC 4V1DB 4UQ2B 2IFFH 1ZT4A 4ERSL 1PX3A 4XVUD 1HZHL 4QRQA 1MFEL 4OCRL 3MV7E 4L4TB 3UEZA 4RFNC 3O11B 2QQNL 2PO6A 4WV1A 1G7IA 1NAMB 3BWAA 2C3HA 2VMFA 1OAXH 4MZ3A 3QXAB 3WO4C 1OP5K 5FCSH 1T20B 1OGAB 4P0DA 2LTQB 3CFEB 3GI9H 4G9DB 2J2ZA 3WLBA 3MRHB 2EKSA 5BZWB 4R7NA 5EBLB 3X13B 1IGML 2BFVH 3WIHL 1M6OA 1CGYA 2AK1L 3CNKA 1MF2L 5FOBA 4NWTL 5E4IA 2G5RA 2P45B 3T4YB 1SHMA 4ZO9A 4UI2A 4XPFL 3CXDH 4JGJA 1A3RH 5ESAB 2EYTA 4K94L 4PJEB 2BRRL 2IALB 5HDBF 4LEXL 5T1DH 5HDQL 3OAZH 1H3VA 2J8UF 3PIQB 4ZFOL 4ODTH 5E00A 1ZLSH 5FIEA 4BELD 2QHLA 3GHBL 4K3HA 4MQXD 3NA9L 4PRHB 4HT1H 2VERN 4NO3A 2DDQH 3QNZA 1ROWA 2NTFA 3NA9H 1JVKA 3GDBA 4G9FA 2Z31C 4G8GA 2MWCA 2WIIA 4M93B 4LCCC 4HJGB 4G8GD 3I02A 4EIZC 3PWUB 4ODTL 4FABL 3GMNB 5ID1A 5D7IA 1TCRA 4RIRA 3FT2B 1SYVB 1B88A 4D0CA 1NLBH 4I2XA 5IQ9B 4ZAKD 2GJZA 1BQHA 1B6DA 1HN1A 3MRLA 5IR1B 5CEZH 4M7JH 1TCMA 4CUCA 1QFOA 2P46B 4UV4H 1XGUA 4YHMH 3IVKB 3MXVH 1U8QB 3ARVA 1Q1JL 4PJBF 5CHNB 3UZVB 3MBEC 5EU5B 4UNTA 5HPMA 5J9PA 1QSEE 2F54B 3I75A 5LQBH 1NCDL 3QPXH 3U36B 3VXMA 1JF5A 3KXFB 5EU4A 1NFIA 2QQKH 1U8KA 1F13A 3AAZB 5AZEH 4PJ9C 3JUYA 4HKJB 1GGYA 4XNQA 2CK0L 2QQNH 2YD7A 3MBEB 2F8OA 1SYSB 5E2UL 5CMAA 3OPZL 3CFDA 1SEQL 3DROB 4JO1L 5K59F 1M7DB 2OL3L 4WHYG 3RY6A 3MV9D 3SE8H 5ADOH 5IB2A 1VKXB 4PJGA 1B0RB 4NJ9L 4GT7A 1ZWIB 3BAEH 4K3EH 1IT9H 2ADIB 3CU1A 3BPOC 1BF8A 2ARWA 5TH2A 3FN0H 1RV6X 4RNRA 3VWJC 3D25A 5F97E 3H0TA 5C0CA 3AREA 5DK0B 4MAYB 2EIBA 2EIZA 5KS9E 5HGBA 1Z5LB 4H5SB 4XCYA 1WAAE 3C5SA 1I1FB 4HBCL 4LCCB 1MFAH 1I4FA 2E27H 2OSLB 4UINH 5D7LA 2ED7A 5EZIL 2Z31B 1WEJH 4XC1L 5DFVD 4YGVB 2NNAB 1KTKE 4L8SC 1IARB 4H88L 1FNAA 3DJ9A 4YHLH 4XVSL 3D48R 4W4OA 3TPKA 2GJZB 3GIZL 3ESVF 4CJ0A 1JPSL 2JIXB 4F2MB 5IROC 4JFFE 1TDQA 4LP5A 1TJGL 3U0WH 4JR9H 2IG2H 2IF7A 3GKWL 4UILL 5MI0B 1YQVL 2O5YL 4KTDL 3QG7H 1I8LC 1WBZB 1FZMB 1M7IA 5CJBA 5EWIL 3CVHH 3QI9D 1XMWA 4YIQB 4UU9B 4FFYL 1JGEA 5DURD 3THMH 3VXTA 4OGYL 1CFSB 3VMNA 1OL0A 5MEND 1K4DA 5F8RC 1U8OB 4FQLL 5DC0A 2EECA 3QNYB 4IRSA 2BSRB 1TQBC 1QLFB 1RUMH 2Q6WA 3TVMB 5IKCB 1LDSA 3WXWL 1ES0A 5DQJA 1KACB 4IS6A 5EBWB 4KDTA 4EUPA 2HMIC 3WIFB 4QRRE 1Q72H 2Y9RT 1AGFA 1G7QA 3DX8B 3JWOL 3V4VL 4JVWA 4ZUUA 4NQCA 3BKYL 1A64A 4GAGH 1WBYA 3EOBB 1XF5A 5DMIL 2Q8AH 1PYWB 4S11A 5TE7H 2HFFB 2NZ9D 5JOPD 2FBJH 4LLVB 2QSCH 2FGWH 4QXTB 5EA0H 2Y36H 3HE6B 3MUGA 5D2LA 5IVXE 4C58B 1NLDH 4NQSB 5CKAA 3S3PA 3QQ9D 2H2PC 5F21B 3H9SE 3L3OA 1NANI 4PLKD 4JFEB 3LKNA 3OWEA 2VDLH 4GLRH 4MD5B 3WN5A 2P8PB 2A38A 2VKXA 4MNHA 2FDBP 4MCZB 3M1BB 4YBQD 5GGRY 3DXAD 3I6GA 1WIPA 3GSNL 3RVWD 5DUMH 4ZTPH 4P2OB 1FFOA 2AXHA 2X7LB 3DV6B 3K80A 4PJ5E 5CEYB 5L0QC 5IQ7L 4P5KB 4BQCA 4YIQA 4DCQB 4KK8D 1LK3H 3NH7H 3VFMA 1DQDL 3T0EB 4LHUB 2XKUA 2YPLA 1PZ5B 1HHIA 2BXYA 3WN5B 4U1LB 3VXSA 1AJ7L 1RPQA 3DPBA 1U8LB 3UPAA 3RA7H 1HINH 2R15A 3B4NA 2NX5E 4FZ8L 3G5ZB 2XY2A 1QRND 4L1HA 5CKGA 5D2NE 1I8MA 2D0HA 1BBDH 5FXCH 4RBPK 1L6XA 5HHOE 3MV8D 4OIIL 2MCG1 4OCLC 2DQHL 3OQ3B 2XTJB 5E56A 1MWAH 1AY1H 2MHAA 1S9XA 4QWWD 3PGFH 4LCCA 2F19H 3BEVB 1SJEA 3EYQC 3TBTA 4Z76B 2ZCKH 1D5ZA 3FONB 1NDGB 1S78C 5C0RL 1NKRA 3V6OA 3S88H 1QO3A 5J1AA 5IW3A 2EDOA 4G6JH 4EXKA 5JDSB 4M1CC 1TVBA 1A7RL 3PHQA 4N0UA 4FQQA 1IL1B 1CK0L 5F7DB 3TN0A 1CFVH 3VFUA 4U1NA 3VDBA 4Q2ZB 3PL6C 4OLEA 4LF3B 3BI9X 1IQWL 5LBSL 2VXQH 3GFUA 1UACL 1ZLUH 5EUOE 3G5XB 2CGRL 1MCLA 2EC8A 4AG4L 1LP9A 1DP0A 3LKRB 2XZCL 3WDHA 4XPHH 3WSQL 3H9SB 4DVRL 4QRSB 2E5EA 1T4KA 1Q0XL 1LK2B 4J3UA 5E8NB 5CBEB 2E6JA 1PG7W 4U6VH 4G6AC 2XQYK 3HE6A 5TPWL 4EIGB 3O81A 1MFBL 5BOPA 1VACA 3PWLA 1HHKA 4G43B 2BOCA 2DBLL 5E94B 3SCMA 4R3SB 3CX2A 1WV7T 3HAEA 1A6AB 3JTTB 5LGJB 4J8RB 3GMNA 3V4PH 4X6CF 5C0AA 1YEFL 2BOBA 4Z6AT 2PYFA 3VGHA 3OKNA 3LRGA 1KXQE 2AV1A 4M7JL 1OTUC 5IJKA 2CDFB 2IEPA 3R1GH 4A6YA 1FL5A 3LHPH 5AZEL 5DVLA 4S0TD 2OZ4H 6FABL 5JW4Q 2W0KA 2BDNH 5DJAB 4P23D 1KFAH 4AEIL 2BK8A 4DUXA 3U36A 3VXMB 1EVUA 2X5PA 4JREC 1T89A 4Q97A 3QUXB 1JGUL 3QIWD 4JZJB 3FQNA 4Y5YA 3WEXA 5BZDB 1QRNA 1F58H 2GUOA 2F8VA 1T4KB 1FE8H 3RL2A 3S5LA 5C1MB 4NO2A 3G6AA 3QEGH 1S7QA 1KN2H 4POZD 1AFVL 2X2YA 2EEBA 3RWEB 1Y18A 4G7VL 4OB5L 5JA8B 1D5XB 4P2RA 1FPTH 1JNNL 4BZ2L 4WUUB 5DJDB 1EA9C 4UBDD 2Y5TB 2EH8L 4MAYA 3P73B 3S35H 5HI4C 1BIIB 3KPLA 1CD1B 2BSRA 3TVMA 4NWTH 3AM8A 3G6JA 2DQTL 1JP5A 4XH2A 2VIRB 5B39A 4NO3B 1CE6B 4LHJB 3D0LA 1O7VA 4Y4KB 3IDMB 1DSFL 1OGAD 3STZA 4FQJL 1ORQA 2A77L 3IDJA 2MKLC 5AEAA 1CI5A 1A1OA 1U3HB 5C2UB 2EYSA 2ZSVA 1KCUH 4XPFH 1A9BB 5IVXF 2I9TB 5IHBA 4YHYB 5CEZD 2EDXA 4NNXA 4ZO8A 3RQ3A 5KSUA 1A7NL 3MO1B 3OGOE 5D7IE 2CIKB 5DQDL 5C92A 5GS0L 1HILB 1YMMD 3BDYH 3DVIA 1FDLL 2DQGH 4NFDA 2YD4A 2CMRL 4M6NH 4XC3H 1OTTD 3OKMB 4JDVB 4IM8A 3ULVH 4L4VD 5DD6A 3PHOA 3EO1A 5SWSD 3GSQA 4JY5H 2EXYC 3C5SB 4Y4FA 4LFHD 1PDKA 3PWJA 5J4MA 1VEMA 4LVOB 3U0TB 2V2XB 4R2GB 1N5AA 1FFQA 3BISA 5CEYA 4WFHE 2ZPKH 2XWBB 1F4HA 2GJ6D 4QF1A 4M7LL 3ZE2F 1X44A 2GI7A 1A02N 5D8JL 4HJGA 1LO3H 1N64H 5JW4R 1QBBA 4KMTL 1UKSA 5IW1A 4ZODA 2DLFH 5HVWA 1CU4L 5J6HA 3JV4B 1WZKA 5DD5H 1BWMA 3L3OB 4H25A 2H3NA 4G8FB 5BMFL 1TIUA 1RVFL 2NTSP 5DZNA 4AL8H 4F7MA 1EHLH 2AGJH 1K2DA 4JQIH 3K4AA 3TZVB 4QOKA 4Y5VC 1OW0C 4CVXA 3WNLA 2X70A 3GBNH 5C2BL 2P5EA 4LK4A 3NBNA 3OZ9L 3I3DA 5IGXL 4JPKH 5DC4B 2ITCA 1Q9KB 5ALBH 4KROC 4H5SA 4XCYB 3SDDB 5KW9L 4POUB 4OLZL 4ODHH 2WANA 4I4WB 1HH9B 3NPSB 3PV7A 2XACC 4JHZA 3ZE1F 1J1PH 2RCSL 3VFPB 4HHAB 1ADQH 1JF1B 4HJJH 2R4SH 2B1AH 4YFLI 1KLGB 3HB3D 1FNEA 1V3JA 1YEGL 2WNGA 1UENA 5FA3A 1YA5A 2FJGA 3MJ9L 3MR9A 4TUJB 3BGFC 2Q8BH 1JRHL 2BNRD 2AEQL 1X7QB 5GSVA 1DLFH 5GS3A 3R4DA 4WHDA 3R8BB 1RU9L 5I66A 1F3JA 5CGMA 4OZHB 1NEUA 5KZCD 1EGJH 3OG4B 3TESA 4DZ8B 2O61A 2AJYL 4TSCL 1AIFB 1FYTB 1KV3A 1Q94A 1U8IA 4M5YL 4HX1B 3IFOA 4LVNB 2PW1B 5FHAH 4APQC 4X8JB 2R4RL 2Z35A 2F5BH 1K8DA 2PXYB 1TTUA 5E00B 4Z5RA 5I17A 3RVXC 3UYRH 4MD4B 1RZFH 4TUOA 4J2XA 1T6WA 1KELL 2QSTA 4FMKA 5A2LH 3IDIB 4TUKH 3CFBA 3AS3A 2ADGB 5E1AB 2V7NA 1VERA 2EDRA 4OQ1A 4HIHB 1UEYA 3MA7B 5E6ZA 1BIHA 1J0KA 5GGUB 5F9AC 3L5XH 2AEPH 1KGCD 2APWA 3T2NH 4LLYA 4PRDA 5J6GB 1OM3H 1QBMH 4G8GB 1F6LL 4Y5YC 5HGDB 4F33A 3VJ6B 2P4AB 1E6OH 2DQJL 2VN7A 3BIKA 1HYSC 4U0QB 4X99B 2BCKB 5EBMB 3TBSB 1NMAH 5ICXB 3NTCL 3L6FB 5LBSH 4EXPX 4U1GB 3MCG1 2VSCA 1IEAA 1FGVH 3DX6A 3CFJB 3IFLH 2C3GA 3PIQA 2QLVB 3DTXB 4KMTH 2CDGA 5FO9B 5CJ5A 2HLAB 2H2PD 1A9EA 1I7ZB 5BQ7A 1YEIH 3DYPA 5EOQL 3NABH 1II4E 4K07A 1XGUB 1F11<