5D7JB

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords M33.64 TCR Alpha Chain
total genus 56
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB02
1N7ML 4G3YL 4C4KT 5DRXB 4HIXH 5DMIH 3MLTB 3UZEA 4R8WL 1N8ZA 4FQ2L 3MGAA 4PFEA 3FN9A 4S1QH 1JZ5A 1Z0NA 3QIWB 4X5XB 1NEZB 2EYTA 5HI3C 1OWWA 1F13A 2BMKA 5BW7A 4XPHH 4JRYD 3SJVE 3UX9B 3RZCC 4GG6E 4Y1AE 5C0CD 1IC4H 1MWAB 1KGCD 2PYED 2PO6A 2VLJE 5EFIB 1PKQA 1Q1JH 2VLJA 5GQBA 3LKOA 4MS8D 1DN2A 1IJ9A 2BNRB 2J8UB 5DRWB 4EQ2A 3HLAB 3B4NA 4NCDA 1UJ3C 1ZSDA 1NMBL 2NTFB 3LV3A 4OZIE 2X4TB 4NM8H 4AEHL 1YUHB 3T4AA 1XCQA 2A74A 4IJ3B 4XP6L 1MAJA 4DCQB 4NO5B 4L1DA 5KTEH 2GJ6D 4OIBA 3KPPA 5E8PB 1I7UB 1M7DA 4N0FA 4J2XA 1OGAD 1AGEA 1S5IH 1F6AB 1ZVSB 3MRHB 1ZLUH 5HYSG 5IR1B 1P4LA 3K8LA 3SY0A 3I3BA 2ICEB 1DTUA 3WN5A 4O2CB 3T3PF 2X1WL 3SPVA 1UA6H 1J0HA 3MOQA 1UZ8B 2MQ0A 4GBXD 1JGVH 1ACYH 4P23C 3VFMB 2W0LA 2B5IC 3NCMA 2A77H 4QWWD 4M43L 4LNRA 4L4TB 2R1YA 2AK1H 5FIEA 4NQEE 1Q8MA 2XN9E 2HT4C 4MA1B 1ZOXA 4HIHA 1KN4H 4H1LH 3LEYL 2FBJH 1KUMA 5HHMD 3BGMB 2NX5A 3JWNC 1MHPH 1WBZA 5D5ME 3ARZA 4FZ8L 5FO9A 4R97C 5GRUH 1AQDA 3GSUA 2P5WB 3ZTJG 3V4PH 5KVGL 1MLBB 1X6NA 2DKUA 5C0BB 3REVB 2F54A 2ICEA 4D0DA 4UB0L 5A2IH 3VFGH 1Q72L 4BSVB 2A6IA 3VDBA 2R0WL 4S10A 4NFDA 3GBNH 1OAQL 4JFFB 4PJEE 1BJMA 2IANE 3PWPB 3SKNB 2BC4A 3HE6C 5IB5A 4M3JA 2ADJB 1L0QA 1XCQB 1BD2D 2O5ZH 2Y5EA 2VWEC 4MXVE 4CADB 4U1SB 4R26H 4NBYB 2VUOA 3HE7B 1KOAA 2W38A 1DQLH 3SGDH 1RUMH 4K3JL 4P4KA 2X5PA 3GNML 2YWYA 1X5XA 1LDPL 1CTOA 4F9LA 3T09A 1MCBA 4PJXE 2VQ1A 5C9JB 3G6JF 1J8HE 2IBZX 1Q9OB 4MQ7B 5CEZE 1H9VA 1T6VN 3GMRB 3RUGA 5J3HD 5JO5A 4FQJH 3FRUB 3C5ZB 2K3TA 3QFJB 2CUIA 1UG9A 2E7LA 3AM8C 3DUHA 1LP9A 2C3VB 4AL8L 4K7PL 5LQBL 3TNNB 2HLAA 4AEFA 3NCBB 3T77A 2ICWI 4N0RA 4YGAB 3PABA 3FHAA 1TVHA 1SM3L 2IG2L 4HXAL 1RUKL 3EYQD 4X7CC 3G6AB 4PTUA 3TBWA 5J13C 2UVFA 3RVWC 3X17A 1G7QB 3U9PL 4L4VB 1A6UL 4HH9B 4G42B 2UYLB 4G5ZH 3QIBD 2UY7A 2EE6A 3N06B 1C08A 4WHYG 2WUCH 4KU1A 1BWMA 3BP7B 5FKPA 4Z5RB 4LLWB 4P5TC 3NIGF 1TENA 4DTGL 4KRPC 3LS4L 3VRIB 1BVKB 3I6GB 5D1QD 4Y5XA 1VGEL 3BKJL 1A14L 2NQCA 1SM3H 5J9PA 4IRSC 2K7QA 4QRTA 1PZUB 1I8IA 3VFVA 1CU4H 1ES0B 1D5ZB 2AJ3A 2JIXA 4RFEA 3CDGB 3NZ8B 4GRLA 1X5LA 2E7BA 4WUKL 3VFTB 1QSED 1H8OA 1G7IA 3CZFB 5DC9B 4TUJB 1MWAH 4X80L 5GPRA 5K59F 5B38B 2ZUWA 1UFUA 3LPFA 4KFZC 1KT2A 5IVXF 4GKSA 1R5WA 1TQBC 2CGRL 1BZ7A 1HINH 1O5DT 5D2LA 3AB0C 2AI0H 1T66D 3QDGA 1VEMA 3QDGE 4Y2DC 1W72L 3ARBC 3O41B 4DOHE 4ZPTB 5GGRB 5T1LB 4PJ8B 1P4IL 2AEQL 3MRKB 3ZYZA 2DQFA 5JOPE 1U8LB 4LSTL 3C9NA 5F1IB 2WBJC 4WFEE 3ARBD 4PJ5D 4KK5D 4UILL 5DR5H 5I30L 1LK2B 5FGBC 1QFWI 1C12B 4LHUD 4X4YA 1VB9A 1NL0L 5E6ID 4N8CL 1NANH 4YHKL 2DQHL 2XN9B 4OD3L 1WFNA 1HQ4A 5E4EB 2EICA 2NY4D 4UDTB 4XNZB 2IBBA 2R23B 5F7EH 1OQXA 1MCLA 4BQ9A 5TDNA 1DBJH 1L7TH 1R3LA 4PJFA 1MPAH 4PG9B 1DP0A 3CFCH 3MV9B 1AGEB 1ZVSA 2VL4A 4FQQB 5FHAL 3VWJD 3QQ9C 4LDEB 1H15A 2WQRA 3GSOB 4OUUB 2DJUA 5BS0D 4NNYB 4I2XE 5E2TL 1KIRB 5IEHA 3LS5H 4OGYL 4DEPB 2Z9TA 4HDIB 4JFPA 5BQ7A 2LTQC 4GFTB 1ORSA 1B4JH 4YPGA 5DYOB 1U3HA 5D2LF 2HFEB 2PR4H 1EXUA 4GS7C 1EK3A 3PWJB 1GOFA 2PUQT 3PHSA 5ID1A 2XFXB 5KVEH 4XPFH 5FA3A 5I16A 2R2BB 5E5MB 4L5FL 3DX6B 3MA7A 4RA3A 4WI5A 3DSFL 4MYWB 3W0WA 3QDMB 5HHVL 5D2LB 2A9ML 2OLDA 3VFSA 1W0VB 3S36H 5CGMA 4P4RB 5TF0A 1NCTA 3NIDE 3RWFB 4K23L 1UKTA 2H9GA 4RIRA 5EOTB 3LS5L 2DLFH 1IT9H 4MHHI 3TJHD 5HYJE 2YPLE 1KYOJ 3UTTB 3ARED 2X4OA 4OZHF 5EO0B 1WZLA 3VDCA 1ZMYA 1U93B 3U30C 4OLXH 1JYVA 1OTTD 3PWVA 3UTPE 4Q9RL 2QQKH 3VWKC 4XBEL 1H3UA 4PRDB 5GHWL 4NWUH 3PL6B 4TTDD 3ESVF 3I6GA 3VXTB 5DURB 2C1PA 1T2QH 1JJUA 1G6RB 2IADA 1C08B 3O6KL 1FE8L 1FO0B 2AEWA 4AEEA 4AH2A 3TIEA 5CCKH 4AENA 2H26B 4N68A 3DI3B 4ZTOL 4HZLA 1NGWA 5BRZA 5HHXL 5ISZB 3UPRA 2AJSH 1Q9LA 3HNSL 1T20A 3LCYA 4H0GA 1YEDB 3U4EA 4HC1L 2XWTA 3CGTA 4O4YL 1MJUH 2BXYA 4NRZB 2GTWA 4GKSB 2X1OA 1KT2B 4ERSH 5CKGA 3P4OA 4ZO7A 4JAMA 4N1HB 3QFJA 5DD3L 4V2BA 1N0XL 4BA8A 1X5ZA 4IMKA 1J7VR 4UZGA 5C92A 3MLVL 3CFBA 3IFNL 4LBEA 5KSAB 4XXDA 3VH8A 3MNWA 2N56A 3EGSA 4Q74A 5D70L 4QRTB 1CZ8H 3U0PB 1TNMA 4JDTL 5FCUL 8FABA 4MWFB 3WN5C 4ERSL 1G9MH 1BECA 1KCSL 1KG0A 1SY6L 3AU1B 2G2RB 3A67H 3WE6B 3BIKB 1MAKA 4U31A 2VXVL 3JV6B 4WEBL 5J4MA 1A0QL 2BVPA 3TJHC 5FGSA 1R5VA 4WJ5B 3DX9A 2EEAA 4Z78A 3ZO0A 1E0OB 1S8DA 3KYMA 1BAFL 3TESA 3TCLB 3WEXB 2PYEB 3K2UL 2CKNA 2NPLX 3C8KB 3HAEB 3F12A 2WIMA 5CINL 4KXZI 2X89A 1JPSH 5TDPB 1EEZB 4LDOB 5B38G 4M62H 5E95B 3IJSB 3VFPA 1NJ9A 2JIXD 1JHKH 4X7SH 5JW3H 5D4QA 3CIQA 4LHJB 4QOKB 5J6HA 3PNWB 4P9HL 3S37X 1K5NB 3LKSA 2EC8A 2Y06L 4FFVC 1XZ0B 2ZCLL 5IB4B 3BD3A 1ERNA 4P3CH 3AGVA 4R7DB 1ZHLA 2H32B 4OZHE 2VQ1B 3EFFA 2VITB 1WBXB 3X14A 1QPXA 5CINH 1BFTA 1QA9B 3H7BB 1IQDB 1ZANL 2H8PB 3RVUC 3ZHKA 4KJYA 5E1HB 2D03H 4GW1B 1H3PL 1Q94B 3WN5B 5L6YH 3QUKB 2P8MA 5IQ9A 5IHBA 4WVRA 1V7NH 4Y16C 3WJJA 2F53D 2SEBB 3RWIA 3MRRB 3LHPH 5JLZB 5IJKA 1LDSA 1UB6A 3JV0A 7CGTA 2HP4A 2GUOA 1DANT 3QDJE 4DCQA 1WJ3A 3B5GA 5FEBA 3WFZA 1HHHB 1MIEH 1ONQB 4UQ2B 3F7QA 5GISL 3G6JB 4L8SB 5C0CB 1ACZA 1QR1B 3ULUL 1INEH 5A16B 3KHOA 4G6JL 4G7YH 1T1YA 5D2LE 1UB5B 2XOTA 1A7PH 1QHOA 5KVMC 2XWBB 5K9QG 1JGVL 3QCVH 3QI9D 4UDUA 1A6VL 4L9LC 4XHJC 1E4XL 2D7PA 4KKAD 4PJGA 5MENE 4PRHA 1RFDH 3UTTE 1A5FL 4XPGL 3FT3A 2XZCL 5IK3A 2V2TB 2EYTB 3DARA 1RZKH 4NM8L 4AEHH 2B1AL 3LKRA 3VFGL 2F58H 4G8FA 1DCLA 3QT2A 4ZFFB 5DEFA 3MLVH 4U1GC 1F6AA 2V5RA 4KUCD 4V1DB 5SWZA 2MPAL 5T1KA 2NY0C 5L2JB 4ZO6A 2IPUK 3B2UC 4IRSB 1T1ZB 2SEBA 5DJCA 3RPIB 4JE4B 1A6VH 4UV4H 4KGLA 1RSFA 3MQIA 1YYML 1OTSC 3CVHB 4J23A 3L7EB 4EJ1C 4S1QL 2NY6C 1ORQB 2GJ6E 3WIFA 4EN3D 1A0QH 3BOVA 5IMLA 5BS0B 3KLHC 4IRJB 3CSYA 3EDJA 3IDIB 4JEGB 1IAOB 1JV5B 4RGNB 4EUPG 4EBQH 3FQWA 3V6OE 4WGVB 3MOBL 3PGCA 4QHMA 5HGDA 3QPXH 3T8XA 1EGJH 4XVTH 4C58B 1YEEL 1U8MB 1I9JL 2YR3A 4XMLH 4P2QD 3F5WB 4LGRB 4JR9L 3EYSL 3OF6D 4FRWA 4K7FA 1CFTA 1N8ZB 5IHZA 3GM0A 2H6PA 3KR3H 4ZD3H 1P6AB 4F7TA 1CIDA 1QRND 4YHML 1YDPA 1ZEAL 1XFPA 3E2HB 1LMKA 2YZ1A 1T5WA 3HMXA 3HNVL 4MDIA 5J1AA 4GT7A 2VXUH 5CWSA 4IRJD 1QLEL 1P84J 4LL9A 3NFSH 5C0IA 3FO2B 4GQ9H 1B2WH 5J11C 4Y4KC 5L2KE 2V5SA 2ARJB 2ZSWB 3RA7H 2QHLA 1YNTA 3MPCA 1M7IB 2IH1A 1DQMH 4LLMA 3DETD 2A1WL 5GS0L 5FCUH 5LBSH 3SKOA 3T1FB 3MNWB 3QHFH 4XC1L 5F71A 4NRXB 4FMKA 3UXFA 1R0AH 3QUZC 4CVXB 2Z31C 3OB0K 1F3DH 1U58B 4PJBA 2J7LA 3RWFA 4MJ6B 4E41B 4LPYA 4NQEA 4HEPG 3FHQA 1VPOH 4GW4A 2DQEH 5KN5B 4Y89A 1F11A 3KLDA 2HKFH 1S7RB 3MREB 3UBXA 1CIUA 5DJ6A 4K3DL 5DJAB 5EO1A 1JPSL 4LSRH 3MRQB 3QO1B 2X4NA 3GB7A 2AP2A 1U95A 2XKNB 2WBJB 4UT9H 1F4AA 2FIKA 2XRAL 4FHBD 1MQKH 2NXZB 3QJFB 4KK9C 1I3VA 5TH2A 1OAXL 1HXMA 3PL6D 1N3NB 4X9HA 4UT7L 4F9PC 3QDJB 5BCAA 1OM3L 3VGBA 5LGJB 3G6JE 1I75A 4UIMA 1T6WA 5T1MB 3IDYB 5DUBA 1IGJB 1MIML 1FFQA 1I1FB 1XF2B 1G6VK 3MFGB 4QRSB 4JB9H 2UUDH 3QIBB 4HS6A 4Y16A 2AABL 2R0KH 4FP8H 1TVBB 4X5WA 5D7LA 4ZAKC 1LD9B 4L4VD 4X0KA 1LEKA 5LJYH 2IBGA 1ZGLA 2IQAA 1BGXL 1TZGL 5DUML 1QFWM 2YD5A 5CSZA 3H3PH 4KY1H 5D8JL 1CBVL 1BFOA 2QR0A 3MSPA 4JY4A 4U1JB 5I1KL 4Z0XB 5GGVY 2VIRA 1LE9B 4FXKA 2DL9A 3MLYL 4LKXA 1X3DA 2WP3O 3PIQA 4JHAH 4OM1H 3TBYA 3LVEA 2X2YA 4Y1AD 2R2BA 1DLFH 1MPAL 3AY4A 5CP3A 3O3AB 4DKEL 1HSBA 3ILQC 3MRFA 3QG7H 4YAQA 5KSBE 3PWJA 4LPVA 4UILH 1H3TA 2D7OA 4RWHA 1T21A 2QHRH 3O0RL 3JV4A 4GSDL 3RHWF 3ARDC 3KNBB 1GGUA 3JWDL 3TT1H 3LS4H 4NDMB 4FQCL 2X4SA 2O5YH 5EG6C 4ORZC 1DQDH 1RZGB 2D4FA 1RZGA 1V05A 4BFEA 5I1AA 1F3JA 5EU5A 1TZGH 4QXUH 4NWUL 3EO9L 4X6EB 3NIFF 5FK9B 1VADB 3ARXA 3BQUD 3H9HA 4OCRH 2F8OA 4PP1D 4WNQA 1E28A 4ZXBB 5TFSL 4LVHC 4XCYA 4X4XB 4ZPVB 1HSBB 2AERT 4GAYB 1FVCB 4PY7B 4UU9B 5EBGA 2QQQA 3C5ZC 1TJGH 2PW1B 2PO6D 3QI9C 4M7LT 4YHIB 4I3SL 4XPFL 1YN6B 3O11A 3U46B 2DQHH 1I1AC 1A6ZA 2X7LB 2ZP0T 3C5JB 1A64A 5E9DB 1RZJC 1S9YA 3T3MF 3BPCB 4JY5H 1L9NA 4U3XA 3VGFA 4JKKA 4NUGL 3CXHJ 1ZHNB 5IOPA 4K7PX 2YRPA 4RISH 5D1XD 2DBLL 2UZXB 4PRNB 2UWEB 5D9SA 5HYSA 1GZPA 3TT1L 5C08E 4FXGA 1VEPA 3E8UL 4CVXA 4LRNH 4KPHL 43C9B 5FUCE 1WVZA 1GC1H 4DK3A 2BSSA 1WEJL 2GT9A 4PY8J 5KG9A 4JDTH 3FB5B 4XAKE 3RWGB 2HKFL 1PG7W 1G7HB 2EDYA 1EGJL 2F54D 4XVTL 1OAUL 2AXGA 1ZA3A 3C6SB 3I2CH 5BVJB 4ONHA 5FKAB 4DZBB 4M5YH 5J12C 1OSPL 4CJ0A 2R4SL 4MCYB 5C6WH 4Z95L 4MDIB 5FHBH 4KQ4H 4YGVA 3S7GA 4BZ1H 2AKRA 3QJFA 4FQLH 3HFML 5IKCA 4GS7B 4G42A 3CSBA 4ONOA 4HH9A 1QFWH 2BVOB 4YHOH 1IM3A 3ZT7A 1OVZA 5BMFL 4P9ML 2ZOKA 2XKNA 1U95B 1GIGL 3OHXA 1UKSA 1J5OH 1Q9WA 4LP4A 1UXWB 2W92A 2Z91A 3PF2A 4KK8D 5DT1L 3QUYC 4XP4L 1BBDH 3VFOA 4NZRH 3GI9H 5F3BA 3IKCB 5HGBB 1XF4A 4H26B 5DK3A 1CFVL 1LO4H 3JXAA 4OGXH 1YJDH 4HLZH 3L3KB 5B38A 4Y4KA 4OZFA 5EOCL 2VRAA 3B5TA 2W9DL 5LGHH 3RP1A 1EUTA 4FQLL 4AM0A 1MEXH 1YZZA 3F58L 3DIFA 1BGXH 1EVTC 4ODBD 5CILH 4YXHH 1CGUA 4EDXA 3UTTD 3L3IB 2GJJA 4DJMA 4D9LL 3BZ4A 5IROA 3VXSD 1Z6JT 2XQBH 1E4WL 5C0BD 2EKJA 1ULVA 3OKEA 4PP2A 3GHBL 1KBGH 3BRDA 3RWJB 2XTJB 2DM7A 3KJ4B 5D2NC 1REIA 1F58L 1D5BA 1GIGH 3S96B 4F7EB 4P3DB 3D3VE 4HWNA 5DJCB 1J1PL 3BIAX 5J1AB 2HLFD 5IB5B 4MD0A 1MH5A 1C5CL 1BQLH 3V7AE 5H37H 1BEYL 2BERA 1UM4L 4BFGA 2HTKC 4YDLB 4C57C 1JNNH 1Z3GH 5CBAA 1NMBH 1T66C 3BDXA 4JLRB 4L4TD 2F54B 2XZQL 5HHVH 1QKZH 3QP3A 4JFZL 1CFTB 3D9AH 5L9DL 1CXKA 2FLRT 4PJHA 3WXVH 1AO7A 3P30H 1P7KB 3QR2A 4M00A 5C0BE 3FRUA 4M6NH 1OSZB 3MXVH 4JFDA 5EBLA 2BNUB 4JQIL 3C08L 4K3EH 5IFAH 1ACYL 4NBZB 1MCOH 3ZZ1A 5IMLB 1A4JB 4HS8L 4JY5L 1ZANH 2A6DB 5KSBB 3PQYE 1GZQB 1JPST 2EXWD 3QIUB 1W0WB 4J7RA 3LZFL 5IVXE 3BI9X 1X5JA 4RFNC 1V5JA 3T0XA 2I60L 4P46B 4I4WA 3NIDF 1S9YB 1N7MH 1IMHC 1X5KA 3RVUD 3A6BL 4XVUD 2JELL 3G04B 4PYHA 1G7MB 4ONGL 2PETA 5ANMB 3ZLQC 5SX5K 1SBSL 5L0QC 1MJ8L 5HJ3B 4NQTA 2W9EH 5CBEB 25C8L 2F53B 4H25A 1KIPB 1TJHH 4B53A 1GXEA 1QYGH 3WFDH 4XCYB 1E28B 3WIHH 4XVSL 1P5VA 3MRGA 1IFHL 3SGKC 3B43A 2G60H 1EHLL 5D2NA 2Z93A 3SO3B 4KRPB 4UUJA 2QSTA 1B0WA 3MOAH 1I7RB 5JXED 1MUJB 3OV6A 4M1CC 4LSQL 1WF5A 2EKSB 4X7DC 4U1KA 4URTB 5JW4M 4NJ9H 4R7DA 5LWYL 4XGZA 2ZSVB 3MV7E 5F9WB 4QOKD 2BHZA 2UWEE 5I75B 1MWAA 4Y19D 4APQC 2J8UF 3CVHL 3RWHA 1UENA 5A2LH 5FYKH 2LE9A 3DYOA 2VDQL 3WFEL 2G60L 1NCUA 4IDJL 5C08D 2CJUL 2ITCA 3G5XB 2OR7A 4F7CB 4PTTA 2A9NL 3R4DA 4O2FB 4Y2OA 3WFDL 4XNMB 5CEZD 3ZSTA 2DQJL 4KMLB 1Z5LA 4AIZA 1WWCA 3GO1L 1Z9LA 3CPLB 2NY0D 1L6ZA 1C1EH 1MFAL 1HHKA 1AXSB 1JGUL 1IKFL 2R56L 3KXFD 4HMDA 1R5VB 4WJ5A 4Y16B 3GK8H 1QSEB 4IOFC 4K8RD 4N1CA 5FDWB 5HDQH 4ZOEA 2OXGA 2NXZD 4OKVA 2BVTA 2IPTH 3QUKA 3EOAB 5IQ9B 5CGTA 3FMGH 2C9AA 4PLJD 3W5NA 5IFHH 4OZIB 4YDJB 3MGOB 4OLYL 1U8IA 1QA9A 2IMNA 3QIWC 5FM8A 1DVFD 4LGSB 1J1XL 3QDHA 5IGXH 3QDJA 2B2XL 2FX7L 4QKXB 1NC4D 5JHLL 2FNBA 5IMMB 3V5HB 3BYYA 3MV8D 1A6TA 4AM0B 5CHNA 2E9IA 2EDOA 3KPSE 3MRNB 3UTSE 3DMMC 1KCSH 1SY6H 2DQEL 4JAMB 1LK3L 3TVMC 2NY0B 1F90H 4Z7VE 5IW3A 1CZ8L 2PTUA 4WRLA 1RHHA 4Z7VF 5D1QC 1RJCA 2AJXH 4MMZC 5IVOA 5E7BA 1HZHH 2CKBA 4U1IB 2EH8H 2PTTB 4CMHB 1H3PH 3G5YB 2VYRE 2NY6D 3ZL4L 3KYNB 4DGIL 4G8IB 2X41A 1UA6L 2DBJA 2X4QB 1D3CA 1ZEAH 1S9WB 1Q9WB 2X9YA 3B9KA 4K07A 3KDMB 4OLUL 3CD4A 3VGHA 1ADQA 2V7HA 4FFYH 4OD2A 2B4CL 3P40A 5C7XH 4LLVB 1J0ZA 5I8OH 2X4UA 1U91A 3HC3H 3RTQA 3BIKA 2JJVA 1HQRA 1NUDA 2QQNL 2NY5C 3P4MB 5D7LE 5E5RB 2DD8H 4TQEL 3J8F7 3E6HB 5IROC 1KPVB 4IDLA 5C0IB 4TVPH 4M62L 3EOAA 2R4RL 3ARSA 5EUKA 4LRIA 4AIXA 2XY1A 4QTHB 4RAVB 4MJ5A 2D7MA 4OLUH 1IILE 5C09E 3GGWB 2ZCLH 1CLZL 2ZUXA 1QSZA 2KUTA 2Q86B 2R0KL 3C60A 4K3JH 3EOBB 3HNTL 1J86A 1N64H 5JHDB 2DKSA 4XMKH 2GTWB 2VDNH 4P2QB 5DJ2B 1SYSA 3MJ9L 5J6GB 4F7CA 5J06A 1LEIA 3Q5OA 3RWCB 3O11B 1S78D 1ZT7B 4MXQD 4ISVB 2R0LL 1IBGH 1ETZA 4XTRD 2VAJA 1NDGB 1A6TB 4OAWA 1J1OH 2HN7A 3NAAL 4MNQE 4F7MA 1B0RB 1RJLA 2Q8BL 1FAIH 1JHLH 5HHOB 5GGQL 3T2NH 2ZSVA 3J7HA 3H9HB 1MREL 2VXTL 4HXBL 1FYTD 3C6LD 4L3ED 5C6TH 4MMXC 1AGFA 1XGUA 3JBG7 4R97B 1MEXL 4I77H 1TCMA 5HGHA 2NY1D 5JOEA 4L3EA 3DRTA 1Y0LA 3WMSA 1LQSR 4AQOA 1P1ZA 3P73B 2O26U 4XRCB 4NGHL 1KPRA 3L3DB 4PJ5E 3MROA 3MZGB 4OBSA 1JPGA 1SMAA 1EO5A 1G9NH 3BGFC 2OJEB 2AJUL 3S36X 5T3XH 1BD2E 4PG9A 5E03A 4GBXC 1EGJA 4Q7DA 1KCUL 5F6HJ 1JNHA 3Q2CA 4NPYA 4PJ9A 2J3SA 3QEUA 3VGDA 5DJXA 5HD8D 4G9DB 5E6IA 4OFIA 2MKWA 4MCZA 5F3HA 4HSQA 5HYQA 2RBLA 2DQCL 5I1LA 1XR8A 3MBXH 5SV4A 5C0RL 2GK2A 5LCVH 2FJFA 2XPGA 1A6AB 5I1IL 1ZVHA 1UQSB 1QQDB 1OD9A 3QAZB 1HHIB 5D1ZB 4FQCH 3ZDZE 1LO0H 5KAQG 1U3HB 3MBEC 1D5IL 2VLKA 4Y4HA 1HE7A 4R3SB 4JFEA 5F21B 4QXGL 2QHRL 4B50A 4PRPD 2VDQH 4NUJB 4NKMA 5AEAA 1I7RA 1RZJH 3F6IA 2ZJSH 1XF3A 2KL6A 1C8PA 3C5SB 4NNYA 1FL3A 4N0YH 4ODWA 2OZ4A 2HRPH 3AREB 3MBXL 5HDBE 2Y25A 3I50H 3TF7C 4I3SH 6FABH 3O3BB 5E94A 2KH2B 4HUMB 3O41A 3VXUD 3K46A 4P9MH 3IFPB 3WNMA 3RJQB 1N59B 2ATPA 5D7LD 3PHQA 5FO7B 3V6ZA 1D5BB 3VXRD 2FCBA 4LVNB 3STLA 2ED7A 4RGOL 4F15C 5CZXC 3WDIA 3UJIL 5DMGD 3EYOA 2A6DA 3IDXH 4MJ6A 5KSBA 3REWB 4TVPD 4WW2A 5M7QA 5I30H 2XN9A 2V2XB 4QCIB 3U30B 2B0SH 5DJDB 1DLHA 2VLJD 4YXKH 1KXTB 4QY8A 2EYRA 1ZVYA 3E1F1 1T2JA 3SKJH 2XZAH 4UAOB 3TV3L 4M7KL 3MV9D 4WHCA 3LIZL 4PRAB 3WL9A 3MNVA 3PDOA 3WO4B 2PXYD 2DQFB 4H1LA 5HDBF 4TN9A 2GEEA 4ZDHA 1RK0B 1R0AL 3BZEA 4JJHA 4D9RD 1EFXD 3DVNB 2VL5B 1JBJA 1SBBA 4TSAL 5KSAD 1CE6A 3O4LD 3EZJB 4JFEE 4HJ0C 1JGUH 1NCBH 2BNRD 4QYOB 2C3XA 1B4JL 2B8OT 4ZO9A 1ZTXH 4UIKH 4O51A 4EIGB 3DX7B 3OKEB 4ELMB 4S1SH 5JXEC 1PYWA 4ZMAT 1FO0H 5KG9B 2GT9B 2VOTA 1MNUH 1OM3H 3RHWK 5B8CB 5F7HA 2R1WA 4PGCB 5ENWA 5B3JF 5ENWB 35C8H 3U6RB 4Q9QL 3CDGA 3RVXD 1T1XB 1FNSL 4LAQL 3CSYB 3ULUE 4IRJA 3EHBC 3HMXH 3GUTA 1MRDH 3QDME 1DBKL 3ESUF 1IKNA 4X6CF 1LEGB 3LQMA 5IOPB 4PGZA 4NC1C 2B39A 4NRZA 4FZEL 4O58H 2WP3T 5KOVC 1T0MB 1CFBA 4PRIA 3VFOB 4O5LH 3OXRB 43CAA 5ERWA 2KZWA 4IM8A 1QVOA 2P5ED 2NR6D 5HYJB 1T1ZA 1IRAY 1TVDA 5T3ZE 4JY6B 2NMSA 4CU7A 2RCSL 5CJXA 1QLRB 3FB6B 3OKNB 1D5IH 2BSTB 3B9DA 4ZUTB 3AREA 1AKJA 2WWMC 3LKQB 4C55A 4XAWH 3AS3A 3HZKB 4G8FB 5EO9B 1NAKH 3T77B 3HRPA 4WI4A 2CR6A 4M03A 4RGND 3RZCA 3V6FA 4UTBL 5IEKB 4WFHD 4JVWA 4PRHB 2BVEA 3MYJA 4JHBA 4KKNA 2OTUB 3GJEA 5I1DB 3TWCH 1CYGA 4KHXH 5DJYB 2HH0H 4P4KD 5EOTA 1DSFL 4HUKB 3C08H 4K3EL 3CCHA 5T33L 1UJ3A 1QR4A 2JJSC 4XMPL 4MD4B 4CAGA 2GKIA 3UDWC 2JF1A 4M6OL 2CDGA 1N59A 2ATPB 5FO7A 1WITA 4NNXA 1AGBA 3EDDA 4TYUA 3DX6A 3S34H 1HOCA 1I7UA 1M7DB 4EOWL 3ARGD 4X0KB 1T04A 5CP7A 4RX4D 3MV8B 3P4LA 4HIEA 2XFXA 1FIEA 4UNTA 2A6IB 2I24N 3CFKB 1UM4H 1VADA 2IALB 4ONFL 4E0RB 1YN7A 4OLYH 5DMYA 3P73A 3CFDB 2X4TA 3MODL 1ODAA 4KZEH 4BSJA 2ADFL 3CDCA 4U1LB 2IF7A 5JR1H 3MLXH 3BO8B 1B3JA 1JIBA 3H0TA 1YJDL 1C5BL 2HFFA 2NZ9C 3WS6A 3OKYA 3QEGH 2FB4H 2XZZA 4FOMA 4NQSB 3C5ZD 5JTWA 3RI5F 1F42A 5I75C 1HHIA 2NX5B 3C8DA 4JRYB 5DD6A 1XZ0A 3GIZL 1LNUA 5GRJL 4F7MB 3QWRA 3KWWB 3TN0D 4QOKA 5J6HB 4DQOL 2EECA 5C8JA 4S1DD 2BRRL 5DJ6B 1BZ9A 2VIRB 1HYSC 4GG6B 2YD4A 1MRFL 3L3JB 5JOFB 2HRLA 4S2SA 2JCCE 2O5XL 4XP1L 4O2CA 3HAEH 1S7SB 3WIHL 5F7FA 2QEJA 1A1MA 1RZ7H 2NLJB 1BM3L 4WI9A 4BUHA 3IU3A 3HI6H 5TPWH 3LY6A 3M17B 4XP4H 1CLYL 5IB2A 2GITA 3H9SA 2Y1VA 4I18A 4X98A 4Z0BL 4PBXA 4RFNB 4YZFE 3R8QA 4EI5D 1YUHA 4D9RE 4Z7NF 3TP4A 4F7PA 3KPNA 5I1IH 4ZFOA 1NC4A 1YEIL 2BNRA 3DVGB 2WBKA 5F70A 1FSKB 1AGFB 1XGUB 2FD6L 3AXLB 1XGTA 5TH2B 1VSCA 4CGTA 5C07D 3MXVL 5HHOA 1U2HA 2B20A 3SDXE 3CUPB 4LOUC 1SJXA 3G9VA 3SDAB 1JFQL 2M26A 3WNNA 4EUPH 4LU5L 2FH6A 5DRNB 4GBXB 4OLZL 2MPAH 1TITA 1OCWH 4U2ZA 4GRWB 5KVGH 3O3DA 1CD1B 3A6CL 3D2UD 1OPGL 3NAAH 4N0UB 3FFCB 2A6JB 1JHLL 1XCTA 3V4VH 2VZVA 4Z8FH 3MRMB 1BF8A 3QWQB 2FHFA 3PGCB 5MENB 1FO0A 2Q7YA 3ZKQD 2GSIA 4Q97A 1CQKA 4BH7A 1MCWM 4R4BB 4IOIA 4WY7L 3OKLA 1DN0B 1FL6B 2BRQA 3QRGL 1OGTB 1I85C 5DDHB 3QEQE 3BMWA 4JFFE 4PJEB 5F1OB 4P2OD 5F8RC 2QADC 3OL2A 2WIIB 1QSFE 3ARFD 5CWSB 1R5IB 3GZKA 32C2A 4XPAL 5EC2A 5AUMB 4WO4C 3IF1A 3UTTA 4LEXH 4PJAF 4ODVH 1BIHA 2ENSA 1FFOB 2EDQA 4XMKL 5JDSB 4N0UA 4YHKH 2XNAA 3QIWD 3NFSL 4NBXB 4LCYA 3LSOA 4KKCC 5CSGA 4I9WD 4F2MB 5D7KE 5C0EB 5IHZB 1J8HB 4P5TD 3H7LA 4O2FA 4LCUA 2LU3A 3Q3GA 3LEVH 3ZYJA 4JO4L 4OZGB 2B4CH 4P46C 1HYRC 2JELH 2JB6B 1U41A 5I66A 4QTIH 4XCEB 1S5HA 1F4WL 4GOSA 1W72A 3MRNA 4HUUB 3TH4T 3H3PL 1DUZB 5FA3B 2OBGA 3W9EA 4I5BA 2F5BH 5DTFA 4E42A 5GJSL 4QXTB 4TQEH 1IL1B 4PBWD 1P4IH 1YJDC 2VR9A 1UB5A 2NY5H 4MJIA 1WWWX 5DWUL 3B8SA 2XI9A 4Y5YB 4YDJA 3PWLA 5E9DE 4PJCE 2DM3A 3N9GH 2I27N 2NYYD 5KW9L 5HGAB 4L4JA 1GPOL 1MCSA 3MRGB 3U0WL 2P8LA 5GGRY 4WI6A 4G6ML 3UTZB 4EN3C 3BIBX 3OAZH 3HC4H 4DGVL 3O6MH 3GSVA 2D0GA 1MCEA 2IQ9H 2J8OA 3CPLA 1YEIH 5IV2A 4RDQF 4DGYL 5JORB 1IBGL 2DS4A 5JNYA 4OT1L 1KFAL 1PZ5A 4RRPG 5F1NB 3ULUF 3E6FB 2X05A 9CGTA 4I8DA 1NAKL 2QL1A 4HS3A 3AAZA 3MA9H 3T2QA 4JM4H 1A7BA 1OSZA 5IESL 5EORH 1Y18A 4QRRE 3SKJL 2W0FB 4YXLH 2IPTL 3CSGA 1P7QD 1S78C 4MXQC 1A5FH 3MRDA 1GVIA 3DNKA 4YXKL 5A16A 4H0IA 1CFSB 1GOGA 2VLKE 2B5IB 1XF1A 4LLUB 1HHHA 3W11C 1U8LA 1HHGB 3U4BL 5ISZD 4BUGA 4HT1H 5CBAB 4U6HA 2DDQH 5C0NC 5E8OA 3I3EA 3GIVB 5C0FB 2CO6B 1CFQA 2AJSL 4FQJL 3RWEB 1GYAA 1DBJL 3LKNA 1QVOB 4DUVA 4LSPH 3L5WA 4MD5B 2XACC 4O02L 4X6DA 1ZSDB 5DURD 3ULVD 3I85A 3CC5B 1ROWA 2AV7B 5DHYA 2EH8L 2JCCF 4ONFH 4HKJA 5DHVH 4F3FA 4X6FB 3VXQB 1RIUH 3THML 2AABH 3DUUA 1TIUA 3OG4B 1QFUH 3LAFA 1AD9A 5D7JA 1MHHB 4FFWC 5C7XL 4MXWH 2FB4L 3NGBB 3BXNB 2UWEF 1KEMH 35C8L 4NWTH 3WV0A 1H3GA 1N6UA 5A2FA 1TQBB 4BQ8A 1V3KA 3KS0H 1F4XL 4OQTA 4OTXL 3FO0L 1Q9LB 4MS8C 4LLWA 4RISL 1HIML 2VLLB 2HG5B 4QHNB 5I0ZA 1N26A 4ODUB 5MERB 1JL8A 4UV7L 5AUMA 3JV6A 1NGZA 1D6EA 1OTUD 2OQJB 4POZC 3CU7A 3G6DL 5FM4A 4EUPA 2EO9A 3NH7H 7FABL 4ONHB 1Q9KA 5DGQA 1KELL 4P2RB 1XF5B 2XA3A 2AW2A 4P59H 5C2BH 3FO0H 3P9MB 3JUZA 4WTZA 4DW2L 3BE1H 4OZGE 5DK0B 4R96B 4ZUUA 2MJWA 3MFFA 4LCIL 3VH8B 5JO5B 5KSAA 1KPUA 5HVGB 1UCTA 1FFNB 2W9LA 3B2VL 5MENA 4TSBH 4X5LA 4XBGA 4R0LC 3HG1A 4JZJB 1GZPB 3UTSD 3NZHL 5I8KL 3CFEB 3ULVH 1TJGL 3EYOB 1NGQH 3MLPA 1BQSA 2AJVH 3C09B 2AQ3A 1UWEH 4RCAA 5C1MB 2YC1B 1KCRH 1BOGA 2P45B 3FQRA 2D2OA 2C26A 3QAZC 4UINH 1U8KB 2F5AL 4PRID 3UAJD 4C83A 1U3HC 4QTIL 4CVUA 1LO4L 2CK0H 4HWBL 4JZJC 1RZ8B 3KYOA 1DLFL 2CMRH 4OF0A 3MNVB 4XH2A 4PRAA 3RZCD 4XCNA 4LFHG 1FNGB 3QEGL 2P8PA 3JWOH 4HDIA 1Z9SA 2OK0L 1NCBL 2E3VA 1AQDB 3GSUB 5FUCC 4EQ3A 3QXVA 1FG2B 1F8TH 4KUZL 1WBZB 3MMEB 5IVNA 4GG8B 1SJEB 3UZQA 4DQOH 5DQ9B 3EDFA 1IGFH 5GRYA 4QRPE 4NZRL 1K2DA 5H35A 4KI1A 5IBTL 4EN3A 4NHCL 1VA9A 2A73B 4QRRB 4GAJL 4PJ9B 1BFVL 2E9WA 5C70A 1MAMH 1BFOB 1QPPA 5T1LD 4KTYA 3BEVB 5DMKB 1YNLH 2JJTC 3WSQL 1T22A 4QF1B 3KGRA 1P4LB 4FTVB 4PJ9C 2IH3B 2ZUVA 5LGKA 3PE9A 4NO5A 5DQ9A 4DN3L 4JFHE 1KJVB 3PHOB 1EXUB 1DVFB 3MMEA 4ODWB 1S9VA 2VDRL 1A3LH 3VFWA 4Y5YA 1WCQA 2YBRB 1VDGA 5HPOA 1MCKA 4HLJA 2VLJB 1KIRA 3JWDC 4R2GB 1CICA 1QEWA 1CGSH 2PCPA 1MNUL 1A6AA 4KJQD 2FD6H 3QCVL 2LFGA 4HFUH 1IGCH 4RFOH 5DK2A 5IFJB 3S37H 3V7AG 3SCMC 4KI5D 5HYQB 2GQHA 2DQDL 4FTVA 1KELH 3ECBA 2ORBH 3SOBH 1KEGH 3FMGL 5TDNB 3DURA 1B6UA 1UADC 2VSCA 4O02H 5HY9A 3GJFA 2DQTH 4KK5C 5CEXA 4PJAE 3GI9L 1Q0XH 2D0HA 2VKXA 4HW6A 4OCXH 4LQFH 3EOTH 2UUDK 2JCCA 4KVNH 2YXMA 4ODTL 1FIGH 5CJQL 4D9LH 3QHZH 4PRPB 1U92B 4WHYH 5GXBB 4JPWH 2RJMA 4PJXF 4X4YB 1NGYB 1K8IA 2NY3B 1R5IA 3F58H 3HN3A 5AAMA 1I8IB 3ES6A 4EZMA 1NAML 1FZMA 3WLBB 1UVQA 1KEML 4NWTL 3ZKMC 4G6FD 2NY3C 1JZ3A 2Z0BA 5ANME 5I18H 3GJFH 3VXSB 1JWUB 4JG0L 4JHZA 1M7XA 4A6YB 5GGSA 4S1SL 5D1ZD 2F53E 5FYLH 3ZSSA 5BV7B 5AWNL 4NQCA 1JTPA 4L4VA 3N50A 1YEEH 3TIDA 1T03H 4C83B 2WSKA 2X4NB 3H42H 4P48A 5HHOE 4Y5VA 3SKMB 5HYJA 3MOAL 4FQPA 3PV6B 4TTGA 1S7TA 3QCUH 1WZ1L 3BN9C 3MJ7B 4ZTPL 1F8TL 4KUZH 15C8L 4F57H 1EAPA 5IHUL 2FGWH 4CMMA 4E41A 1LP9B 5SWQB 3SQOL 1CCZA 1NLDL 3TO4D 4PJCA 3U6RA 4PV9B 3MO1B 4FNLL 3SGJC 2MFNA 4FZ8H 4JRXE 2BCKA 4NRXA 5T3ZH 3DRQB 4L1HA 3LEYH 1SVCP 5HI5C 2XKUA 3HG1D 1KJMB 5CIPB 3S98A 3RI5K 1FBIL 2X40A 4OJFL 1A4KA 3H9ZA 4ETQB 5CS7A 2VDNL 1U8IB 5T5NG 4M6ML 4OD1H 4Y1AA 4M93B 4HKXB 4QYOA 1J05B 1W0YT 1YMMA 4U0RB 1HQRB 4NZDA 1T5WB 1MCDA 2EDFA 3P77B 4KUCF 3U36A 1MLCA 2VZUA 4W6WB 5I15H 1MI5D 3DVNA 4CDHA 2PO6C 3ULUH 1I7TB 3PGDA 5DFVD 4R2GC 3H9SB 3UJJL 1BQHB 3TA3D 2CDEA 5FB8A 3BP5B 3NFNA 1HHKB 1YQVH 4H1LB 1RFDL 5BV7L 3LRGA 4JFOA 4WV1B 5CJXC 4M7JL 2NZIA 1CL7I 1E4XH 3LN4B 2A77L 4RMTA 3MLYH 1SMOA 3L3JA 1HI6B 4J3VA 3UBXG 4GG6A 4G5ZL 4K7FB 3K3QA 5SX4H 4TULL 2QADB 3UZVB 3RTQD 2J8UE 2ITCB 5AZ2L 1GAFH 2C3VA 2QV2A 5DF0A 3MA9L 5JA8B 2APVA 1EX0A 3T8XB 3HTLX 4WO4B 5GISH 7FABH 4YDIL 1OW0A 1FPTL 1BBJB 4YJZL 5KANG 4LSSH 3O0RH 4YHMH 5I74B 3M07A 4BK5A 3KPSB 3WFEH 3GMPB 1LE5B 2OMBA 4YXLL 1HK6A 3FT2A 2ESVE 2E5EA 3PGFH 3AC0A 1F00I 5FM5O 2EYSB 4J8RB 5DJ0A 1A7NH 1BREA 1L4IA 4QT5B 2ZCHL 2Q76B 4Q0XH 5JORA 3PJSA 4L8SA 1NCNA 1YN7B 1JNLL 1FL5A 5EC1B 4JO1L 4ODVL 2GJZA 3S3PA 3RUGE 5IR1A 1JTTA 4FFYL 4K94L 4K9EC 3NIGE 4YDIH 1HWGB 4KDWA 4DGIH 3WIHA 3SCMD 5L2JA 2EC9T 5D1ZC 5GS1C 3IU4H 5C0JB 3MRRA 3RWIB 1IC5L 1QYGL 3QXAB 3ARGB 5JW5A 4M1CD 3FZUD 4Z7UE 5CUSL 2DB8A 5D72H 4Q6YA 3ARFC 5HYFA 3HS0B 4X6CE 2J8UA 1A3RH 5BZDA 2P5WA 2IJ0C 4MJIB 4NO3B 1FNAA 4LLQB 3RY6A 5CEYA 4K94H 4RX4A 5IB4A 5L7XH 4P57A 4Z8FL 1M6OB 4U1HB 4M8QA 4PJGB 4PJIA 3M1BA 4QRQB 1ZT4B 4LFHD 2F9BT 1X9QA 1LP9F 2OYPA 1OAUH 3SE4A 5DEZA 4P2QE 4L4TA 3X3GH 1EJOH 5KW9H 4LARH 2HT3C 4HF5L 1J8HA 3WUWG 2QSVA 4RQQB 3GMMA 2R0LH 1FC1A 5ICZA 2GCYB 4NP4L 5DWUH 2A6KB 5IM7B 1X7QB 4TSCL 4APQB 3GRWL 5EZOH 4YFLF 4XPAH 3WNLA 4ZO8A 3JV5A 2CDEB 5FB8B 1M05A 3BUYA 5KS9B 5DD5L 3NCEB 4IHOA 5DZLA 1FG9C 2HT2D 5DMGC 3TYGL 3CX5K 3T65B 4HJGA 1KPRB 4N0CC 4K2UL 3MV9E 2NW3B 1LO5B 5HGAA 5GGUA 3P3YA 4YQXL 1URLA 4MQSB 2R4RH 4PGEB 3HLAA 3G08A 5DRWA 4NN6C 5LGHL 4XT1C 1ZV5A 3LEVL 2FEEL 1A4KB 4M4PA 3OJDB 5B3JE 3RIFK 1V7MH 4G8GE 1K4CB 4G8GA 3GUTB 5GS1A 4L8DB 1QLFB 2XA8H 5LVEA 1CT8B 3K0WA 3TN0A 2D31B 1X4XA 4XWOD 4PGCA 3W9EB 5ITFA 1JHTB 1IGYA 1P2CB 1HKLL 1SYVA 3GSNH 4L4VE 4KI5E 1IC7L 1S5HB 4JRXB 3FQNA 2D9QB 3OR6A 1UXSB 2YK1H 5I2IA 3O2VH 2YPLD 3WKML 1I8MA 3KPRB 4O00A 2JE8A 3L5HA 3STZB 2I9LB 1PX4A 3N9GL 3VXNA 1IGIH 3BJLA 1XR9B 5FCSH 3UO1H 3C2AL 4HZLB 2H1PH 5C0RH 4NKOB 4NQCD 2HA1A 5ADPH 5EZJB 3MLWL 4ODHH 3CUPA 2ZZUT 4MAYC 4NQCB 1YYLL 3H2WA 4YX2L 1MLCB 3UYOD 4RZCA 1AI1H 1CXIA 2Z4QB 4KDTA 5KVDL 2GI7A 5LXGL 3O2DL 3VG0H 3FB7B 3IDNA 2YPLB 5JXEA 4XPTL 1CLCA 4I0PA 1UVQB 4RGMB 3E6HA 1MCNA 4IRZL 2PR4L 4GH7B 2LTQB 1BMGA 1EHNA 1GGYA 4QXWA 3L3IA 1FVEA 3EDEA 4LGPB 4MAYD 2Q7YB 5SWZD 4H8WH 4JZNB 2L7UA 3QI9B 4TOYH 4KK6D 4NIKB 3O9WB 5FUZL 5TF1H 1YEGL 1KTLA 2JJUA 3QPQD 2X4QA 3T3ME 3PG2A 4HPYH 2ESVB 3VGAB 3PWNA 1DEEA 2CLZA 1RU9H 2G75A 3BPCA 1E6OL 2R0ZL 4WU5A 2J12B 3WHE1 4MLSA 5DRNA 1C5CH 1NC2A 3ARTA 4JJ5B 5DVLA 4HIJB 4S0TD 3U7YH 4YHIA 3BQUA 3AREC 4WFGD 3VW3H 3TWCL 5E5MA 5A40E 3NA9L 4HCRA 4LIQH 1C5DA 4U3CA 4W81A 4Z18A 3L3HB 4APQD 5IVZB 1WLHA 4M48H 4WCYL 1RURH 1JVKA 1A3LL 5CAYB 1JP5A 4X6EA 4HF5H 3JWOL 3GMOA 5TFSH 3BN9D 1AHWA 2IAND 3ZDZF 2OL3H 4DVRL 2N7BA 1D9KD 3VXME 5IB1B 2Z8VC 4Z76A 1ZGLP 4UTAH 2KQMA 4PGDB 1Y6NR 4MJIE 5HBBA 3S34L 5I1HL 5EO0A 3IAPA 3PHOA 1T2QL 5IW6B 5HI4C 4PD4J 4WWKB 1UJTA 3NOIA 2PNDA 1JWMA 4P5MA 1ZLUK 1ZGLM 4E9LA 5IP4A 3BEWA 1BFVH 4PJ8C 4OD3H 4ZQKA 1AXTL 2HT3D 5GSRB 1KB5A 3D85A 4PV8B 4CU6A 4JPIA 4PV8A 3ULVL 3O4OC 4UQ3B 2PYEE 2CK0L 1IT9L 1U2CA 2GIYA 4G7VH 1XIWB 3HZMA 3ZKNC 3FAWA 2VKWA 4GQPH 3QG6B 4KJPD 5AZEH 4K9EL 4UTBH 2VDML 2PCPB 3DV4A 1WAAA 3HMWH 3JVGC 1KIUA 1FG2A 4PJBF 1HN1A 2QLVB 4U6YB 5E8DH 1DBKH 5JQHC 5F96H 4HV8B 2FLBT 4JKMA 1H3XA 4KMQA 5INDB 1S7WA 5L88L 4S1DC 2DI8A 4F15B 3W82A 3U2SA 4RAUB 3GSOA 1R24B 3LH2L 5C0AA 1PAMA 5CLWA 3OZ9H 4NHCH 1B0RA 5T1LA 3KPLA 5IBTH 5E9DD 3K8MA 1RUQL 2QQLH 1T7ZA 3MV11 3TM6A 1MWAL 1FZJB 1AKJD 1CL7H 1E4XI 2PXYB 4ISVA 2QADD 2BVUA 4PJFB 3T0ED 1MVUB 4RAHA 1FGVL 2EDJA 1FAKT 3ETBF 2Y07H 1SYSB 1CK0H 1EFXB 2YC1A 4JM2C 3V6OA 3VMOA 1G0DA 1I9IH 4GAFB 4NZTL 4WW1A 3A0OA 3CFEA 2GFBA 3RU8H 4M7LL 1RK1A 3FOLA 1ZGLB 5TE6L 4IIQB 5KJRL 1JYWA 3O9WA 4HCRH 4OIAA 4D0BB 4FMFA 3NCJL 4O9HH 3MR9B 4AQ1B 1FVEB 4GKNB 4MJ5B 3TCXA 3MYJB 4QTHA 2XQYK 1NBZA 2PN5A 3BKMH 3S4SG 1U8JB 2O61A 2W9DH 3BP6B 4UIMB 4ZS7H 3UPAA 5GS2D 1A9EA 4MJ2A 5ALBL 3RDTB 1T2XA 2QSQA 4HIIA 5C0DB 2WLZA 3FTGA 4YH6A 5LGJA 4TSBL 5F1IA 3EOYG 2YPVH 4FG6D 4UOW0 2Z4QA 4LSVL 4YHNB 5IVZA 5F7DB 4EEEA 3UTPD 1YY9D 3EDKA 1ZAGA 4YXHL 4NC0B 5T1DH 3X3FL 3SE8L 5EBMA 3X13B 5FGCB 4X8XA 1INEL 2HWZL 3G5YA 43CAB 3R0MA 2VH5L 4IS6A 1IAMA 4PJXA 1MCHA 5CGYD 3EBAA 4YHPB 1KGCE 4PLJC 4OLWH 3V52L 2ESVA 4DKFL 1G1YA 2O93L 4HKBB 4NT6B 1FVDA 5HDLA 3WFBH 4JRYE 5DRZA 3SJVD 4M61B 4CKVX 5D7JD 4TUKL 3DVIA 4OLXL 4RMWA 1RIHH 4X7SL 5JW3L 2FX8L 3TO4C 1NCDL 5F6HI 4OF6A 2R1WB 3QXDA 1D5ZA 2JIXB 2HVKB 3DUUB 4N9GB 5BS0A 4M61A 3BSZL 5I8EB 1A21A 3BKCL 4GO6B 4HFWA 5DO2D 4FABL 5ICXA 5DMIL 5GRVL 5JHLH 1BIIA 4D9QE 3IJHB 3SE8H 3A6CH 3VRIA 1ZLWK 1XH3B 4AG4H 2CO7B 3I9GL 1YMHB 3MUGA 1KLGB 1I1AD 4OFVA 3EYFB 1N6QH 3OHXB 4IRSA 2DQGL 2V5TA 3UC0L 3C60C 1I1AA 1TETH 2VDKH 4ODUA 3VXUA 5MERA 4QRPD 3F7VB 4F7TB 4APQA 5JIIA 1MOEA 3KLSA 4ODHL 4DZBA 4PBVC 1KN4L 5F9OH 1I8MB 2WWKT 3RBSA 5K9KB 3MRDB 5C0GB 4U1MB 2YKLL 3DX8A 4BKLA 3QB7C 4R3SA 3BVNB 4JRXA 3P0YH 2ILLA 5JW4N 1F02I 2XN9D 4KVCH 3MR9A 4QCIA 2V2XA 4XPGH 3AAZB 5DD1H 4WTZG 5DFWH 5HDQL 2FATL 4G8EA 4OGZA 4OFPA 5HDOA 3TO2B 4MZ3A 4HKJB 4DGYH 1ORQA 4JCLA 2V9TA 2R2EA 2VQTA 5GGTA 1A1OA 5C0CE 4XMLL 2GTZA 2GW5A 1QR1A 3FFCE 4UT6H 3IFPA 3UYPA 3OB8A 1MRFH 1QUNA 4YFDB 2ZG2A 3AS0A 3RWEA 2NY4C 1FE8H 1OP3K 4M1GL 3Q6FB 4HX1B 5EIIB 3EIFA 3X12B 3QG7L 3FCTA 4OZIF 4V1DA 2VDPH 3V79C 4LLAA 4TULH 1D7FA 4LKCB 2WK2A 3UTSA 2EDBA 5MI0C 1JI2A 4BJLA 4AL8H 3QRGH 4Q6IC 2EDDA 3PJSB 5A3IC 3HNSH 4WI2A 3ULVC 3GMMB 1T80A 1UH2A 5I73C 3V0VA 1V7ML 3FO9A 4WY7H 5J0BA 1ED3B 4XVJL 5HGHB 1CF8H 4N5ED 4LIQE 5DLMH 3LDBC 1I9RL 3VH8G 5JR1L 4OV5A 3JV4B 2WWMD 3B9EA 3WKNA 3O4LA 1UQSA 1H8NA 3DPBA 2ZUUA 5EU7E 4U1GB 3KVQA 5JHDE 5LBSL 3LKSB 3QG6A 5HSFA 5ESVB 1RD6A 4OAWB 5FV1L 1A7NL 3KPRD 2AJZA 3ZL4H 4YNYB 1MJJA 1EEYA 5GGQH 3T2NL 3S4SB 2VE6A 1KXQE 2C7UA 2J88L 4P2RD 1AD0B 3ARBB 1EEZA 3BPOB 4N0YL 3MCG1 4P2QA 3BPLC 3HE6B 3JWOC 2RR3A 4B5EA 5E2JA 5I8OL 4LCYB 3TH3T 2Q86A 2L0DA 4DTGH 4HK3N 2BOCA 4RGNE 1G7PA 1MCPH 4TVPL 1BAFH 1FLRL 1I1FA 5DD5H 5GRUL 1XF2A 3NCJH 2OTPA 3SDDD 1OLLA 1R3IH 4JDZA 3FQTB 4G80A 4X4MA 2V7NA 2A1WH 5GS0H 3HB3C 2Q7NA 2X70B 3QHFL 4XC1H 4AYFA 4HFWB 1ZHKB 5CIPA 3FJTA 2P1YA 4BH7B 3KLAB 1EJOL 4AK1A 2R69L 1DDHA 3ZKXC 3FN0H 1MCPL 4NN7C 3S6CA 5I76B 1ZT7A 4BFBD 4B7LA 3OZ9L 4YPJA 4JN2A 1UC6A 1IEHA 3SJVB 3IKCA 1RI8A 4JFHD 4JCMA 2X42A 3UJJH 4GW4B 3CLEH 2AV1B 1AGCA 1AR1D 2B1HL 3RGVB 3IETB 5L2KB 3T1WA 1ZLSL 4JFOB 4WV1A 3MLZH 3T3PE 2VZSA 4WUUA 1LGVA 3BT2H 4YBLB 5E5UB 1UM6H 1FFOA 4QNPE 3IB4A 4H20L 5GGVH 4J3UA 3QUXB 1D6VL 2APTA 4OCWL 5C08A 5DQDH 5DUPH 4HUXA 5D5MA 2UZYB 1Z0MA 2IPKB 5F72S 2NXYB 4PJAA 1ZA6A 1A2YB 1L6XA 4HAFA 1FL6A 2RFXB 4J6RL 3MRIB 3B3IA 1RZKC 3FB5A 4UIKL 3O8XC 1OARL 1NUFA 3GSXB 4NQUA 3CLFL 4WHTB 2B7DT 4PLKD 1QBMH 1YEFH 4OFKA 1TFHA 1FGNH 4NM4H 4X6CA 2FEDC 3O6LH 1I8LC 5EZJA 1NBYA 5D9SB 3B9KB 4CVZB 4WUUB 3QZWA 2GFBB 3WKMH 1A1MB 1WICA 3ROOB 1ZXQA 3VXUE 1XR9A 4NQVB 1J0YA 3MRLA 2ZUQB 4LQ1A 5F1KC 1JYXA 1EAPB 3HE6A 5DLML 4S2SB 4JFDE 5JOFA 3O8XB 3HHRB 5T1DL 4PTTB 1T20B 1F97A 3SN6N 2C7UB 1VESA 1XGQB 4JN1H 5EOQH 3BHBA 3MGTB 2F19H 1UEMA 1VFOA 2PW1A 3O3EB 5CHNB 3A6OA 1NGXB 2ZOLB 4Y2DD 4ODSL 4WNQB 4G6KL 4ZXBA 2HFTA 4TPRL 1JWSB 2ARJQ 2HFEA 2ZPKH 2EKSA 4C56E 1B0GA 4GRWH 1S7WB 2OJZH 3DO3A 1PD6A 4S1RL 5DJ8B 1NC4B 3ULSA 4PS4H 4XNZC 1CDIA 3AMLA 4PGEA 4MSWB 5KSBF 2X4SB 3H9SD 3TVMD 3T0EC 1L7TL 2HVJB 5CD5D 4NKDA 1EIBA 2NW3A 1IEAB 3O45A 3F7RA 4G7YL 5E2VL 2C4FT 1DQQB 4I0PD 2LU7A 4K3HA 4HPYL 3D69B 2B4CC 4PUBH 3TPUA 4TNVK 3RGHA 4NHUB 1MFNA 1UZ6F 1UM5H 5L8LB 5L0QB 3MUY1 3VD5A 1VCAA 1BM3H 3DURB 2PYFA 2XTJD 4Q6IA 2ZJSL 5D7IE 3WDJA 3ARFA 3OAYK 1K2DB 4DUXA 5GRXG 4Z7OF 4Z7WA 3VXRB 4OI7A 5F89A 1W2KT 2E9JA 5GRVK 5HI4D 3WXVL 1X4YA 4I0KA 4UDUB 1AJ7H 5ESAA 3SDCC 3MRJA 3O4OB 3KYKL 5FF6A 5JQ6L 5JMRA 5F96L 1Y6MR 2W0KA 3H0TB 4KVNL 3QH3A 3TT3L 5DXWA 5BZDB 2KPNA 4LRIC 1MUJA 4MNQD 3W0WD 3MLZL 5I0DA 1KF9B 2FYYB 3MLXL 1SEBA 1CWVA 4K23H 4LKCA 2X9XA 3CFKA 5FDYA 2AK4D 4XNYH 1KJVA 2D4DA 2R4SH 2CUHA 2Y5TA 4TNWK 5JLZA 3FOMA 3C60D 5D71H 4GKZA 3VMNA 4P2OA 1JNNL 1Z3GL 1AP2A 3WCYA 1HEZB 2P8MB 2OK0H 2P5WD 3TT3H 4F7EA 2VQUA 2BOBA 5C07E 3ARDD 2CMRL 1VGKB 3W5MA 3PWNB 1JGDA 1IKNC 5KBNC 2VDPL 2EEDA 3ZT6A 3ULUD 1AJ7L 5CCKL 1HCFX 1GZQA 4ALAL 4JVPA 3N1QC 4Y8DC 5L9DH 4AEIH 2CXGA 1U0QA 4KZEL 3HMWL 3OAZK 3NZ8A 3O3UN 3MRPB 2XQBL 4LASL 2W60A 1A7RL 2BY2A 4HJJH 2DTSA 5TQ2H 4GG8A 4HWZA 3SKOB 3T1FA 2FIRT 2DQUH 4NZUH 1P5UA 1YNTB 4HKBA 4U1MA 4KKCD 3EYQC 2G5RA 3WSQH 4Y5XB 3K1KC 1NGQL 1PKQE 4Q9QH 4XCNB 4OCMC 5FYJU 1O0VA 3FRPG 3AVEA 2MCG1 4ALAH 2HMIC 3F12B 3BP7A 4RSVA 5KTEL 5D70H 3NPZB 1FO0L 1T4KA 3JTSA 4KJQC 4R2GD 1EUUA 3WNPA 5DA0B 3L9RA 4RA0C 5GGRA 4NQDD 4MD0B 4NYLB 1FYTB 3HMXL 2F8XC 2I5YH 4Z7QE 4OJFH 5JHDD 1A9EB 3HAEG 1XGPA 2OI9C 2VDRH 1RIHL 2H2SD 4ZS6D 1QBBA 3MNZB 6CGTA 3BZ4B 4X7FC 3WFCL 3MJ8B 2RQ8A 1JHTA 3RUGB 4F8TA 1BWWA 1KULA 3DECA 1DBAL 2GSGA 1IAOA 4JG0H 4L8DA 3B2VH 3ARWA 4NNPH 3VFVB 3CFJA 1EH9A 3JWDH 3SE9H 5HYIA 3BSZH 2BJMH 4OF3A 3T08A 4NQDE 1Q9KB 2K1MA 3CNKA 3WLWC 3PHQB 5ACZB 3EJJX 2Z31D 1Z9MA 5DHVA 5K9OB 3NACH 4YUEL 3EHBD 3U46A 1CR9H 1D6EB 5ABDE 4K8RH 1UXWA 4TNVF 3S36L 3GSRA 4HJGB 4BZ2L 3T65A 3FOMB 2VL5A 4I2XB 3PWPA 4G6AD 1X6LA 4KKAC 1Q0XL 2N1KA 3S35L 4I1NB 1ZLSH 1JZ2A 2DLFL 3ARYA 3RGVD 3GEWB 4RAUA 3VI4E 3UTQA 4PRBB 2A6KA 4YHZL 2YD8A 1Q0YH 5A1AA 5IWLC 1CFSA 4YLQT 1MHEA 1ZA3B 3BH9A 3C6SA 2AXGB 3WJJC 3LKRB 1DBAH 3LQAH 2DL2A 3V0WH 4OM0L 1I7ZB 4P23B 1MY5A 4YC2B 4YE4H 4DAGH 3FT3B 5IF0B 3F6LA 1KB9K 4EI5C 4GMSL 1XGYH 2FX9H 2VZOA 3CVIL 4IJ3C 3V8OA 4JHAL 4Y4FA 2R8SH 4M8QB 4PJDA 4Y0GA 1T5XA 2A38A 2AGJL 3VXRE 4PJDE 3VXRA 1JMZA 5F3HB 4YDVB 1MVFA 4K55A 4WIQA 5FV2A 2M2DA 4FA8A 2P44B 4KXZH 3OBAA 4N0UE 1LE9A 4L8SC 3CC5A 3CX5J 1W0VA 3BZFB 1IGML 1RUQH 5IV2B 4YHYB 3L5WB 1A6ZB 2X7LA 4UQ2A 4E41D 4RMVA 1NQBA 4TNWF 3MRHA 1SJVA 1KCVL 1JZ4A 4LSUL 3WNOA 4X83A 1QFHA 1CDJA 3IVKB 3LQZB 3EW3B 3OWEA 4N8PA 5BRZD 4FQHA 3KJ4C 3VGEA 5J1TC 2GJZB 1FL5B 4FNLH 3BWAB 4HKZB 1XMWA 2HVJA 4GMSH 3GNMH 5C0BA 1QSFB 5DSCA 3REVA 3X3GL 5J8OA 5I1AB 4OSUL 1S9VB 4LEOB 3VFUA 3RNQA 3WLWD 4NDMA 1KENL 3W9DB 1J0IA 4OZ4B 3UBXI 3MRJB 1HXMB 3HC0B 5SWZE 4IRJC 3DGGA 3GMPA 3IJYA 3DMMB 1LHZA 1NGXA 5F89B 4BSWA 5KSUB 3UPCA 5M94B 1ETZB 5IWLA 1QSEE 2C1OA 5ALCH 3MV9A 3MGTA 1T83C 2JB6A 3ILPB 3VD4A 2OP4H 4HBCH 3AMKA 5KN5A 2YA2A 1JHKL 2NY5L 3BT2L 3QEQA 3TGXA 5ILTH 4JG1H 5EZIL 3GDBA 2CGRH 1WQVT 3S3JA 4FFWD 2JB5H 5H35B 4M8VA 1NFIB 4G43B 4ZNCD 4MA3B 3OTTA 4MXVF 2I26N 1NAMA 1OOAA 5C6TL 2H3NA 4WHDA 4D2NA 3L6FB 3CXHK 4Y8AA 2PTVA 3HC4L 4DGVH 5D7IA 1CF8L 2Y7QA 4JANB 4WHTA 1X5GA 4G6MH 1FAIL 2YN3A 4KAQL 2CDFB 4P46D 4QHKJ 1FYTE 5GGVL 5I17B 5L7XL 1HWHB 2LAGB 4L9LB 3NTCL 3EYUL 1OGTA 4UI2A 4PGBA 3HUJA 3HR5B 4K3DH 5EFIA 1IL1A 3EGSB 5B8CC 2DTMH 4OCYL 2RB8A 3QIUD 3K81A 5I6XC 1JN6B 4KTEL 4IOFD 4K8RC 3H6JA 5IQ7H 1FH5L 2BHYA 3JZ7A 3MRQA 5I66B 4CRPA 3I84A 4G8IA 4PREB 4QOKE 4LCUB 3RA7L 4KHTH 5JHDA 2IGFH 3FQNB 3MJ9H 3VWKD 4PJ7A 5MEPB 4HG4J 1BHGA 4QHMB 2DQGH 5EUOA 2DM4A 1OP3H 4X7EC 2DRUA 2YD9A 5F1SA 4WDIB 5C09B 3BKYL 1F3DJ 3IXAA 4JZOB 1ZHKA 3VGAC 3P9MA 2VR5A 2ICES 5DVMA 5CD3A 5DDHA 5EA0H 1GGBH 3RL2B 4CMHC 4XP9H 4HUXB 5D5MB 2V5MA 5DS8A 3OKLB 1I9RH 2CDFA 5I17A 4HK0A 4N8CH 4YO0B 5T5NF 2X4UB 1OARH 2W0PA 5F6IC 4K8RL 2BFVL 2CKBL 2HKHH 3QZWG 1YEHH 4OUOA 1CDUA 5IVXA 3KPTA 3ARPA 4KV5E 4ZODA 3IETA 1AGCB 5L2KA 1S7SA 4Q9CA 5EDXA 5I1HH 4M9PA 3GJFB 4A6YH 4M1GH 1ND0A 5HY9B 3STBA 3G5ZA 1BZ9B 1G9NC 3W0WB 1UXSA 2Y23A 5GS2H 2NW2A 1EEYB 4I18C 3GSQB 3VD7A 5KSUA 5DK2B 5T1KD 4DZ8B 4ONGH 2D7NA 2ED9A 3NGBC 4JRYA 3IDIA 4L3EE 3V4UL 5GS1B 1KC5H 2YOCA 1DUYA 4NQSA 1AE6L 4X6FA 2ADIB 2XG5A 5DC4B 4PGBB 1CQYA 1D6VH 4OCWH 4OF7A 3WO4C 4NKIH 2EIZB 3CFIC 1OAKL 1VACB 4F80A 3HI1A 5BJTA 5GGTH 5EWIH 2V17H 3AY4C 1ONQA 4LCWD 1OP5H 1H15B 4NQCE 1DL7L 2H3NB 1EEQA 3SKNA 1YPZA 2UV3A 3CX2A 3GIVA 3MV8A 3QDAA 3RAJH 3WD5L 5SWZB 4KMTH 2NCMA 5C0FA 5IB2B 1RURL 3OKDA 1L0XA 4BSVA 2Y4SA 4XP5L 1PSKL 3MX0A 4MX7B 5GZOC 3NABL 1R3LB 5HHNB 1ZLWH 5ICZB 3I75A 1PW3A 1CDYA 4MB3A 3SOBL 4KTDH 1K3ZA 4YWGH 5FO9B 4ZFZA 1FLRH 3QBTB 2XV6B 5DD0H 5JUEL 3DJ9A 2ITDA 2X4RA 1TPXB 3RWHB 3L7FA 2YD7A 3V5DB 3VI3F 5ESVA 1UWGL 1CGXA 3PP4L 4WWID 2WBWB 5K9JL 1F45A 1WCBB 1HKFA 4FXLA 1IAIH 2I25N 4XNXL 5BZWA 3GK8L 1I85A 4FZEH 4OZ4A 5CMAA 3HI5L 3MV01 3VRJB 4DKAA 2YEZA 1RPQA 4HAGA 4J3XA 1E4KC 1T83A 3HS0A 3L5XL 4UUJB 2YMXL 3RL1B 3V0AC 4LVOB 5E24E 4JRXD 3C9NB 4MNGA 1E27B 4FQHB 3ALWA 2NX5D 3F7VA 5EOCJ 4N0FB 3DXAD 4LDLB 5I8CB 4WTWA 5HJ3A 4Z0BH 4MXWL 2PW2A 5EUOE 2NY3D 4HFUL 1U8KA 1MRCL 1U8NA 1XH3A 2P24B 4EOWH 1MFDH 1T0MA 4FQXD 4Y1AB 1HSAA 3MJ6A 2YSSA 5F7LB 2Z8RA 5D96B 4ZFOL 3T04D 5F8QC 1CXHA 3U0PA 3CFJB 4YDVA 2M8XA 3IAQA 1QHPA 2HFGL 4Z7WF 1W8NA 4IMLA 3HZVA 1YPZE 1M1SA 2GSGB 2VH5H 3KPSA 2MHAB 1CTNA 4JM2F 1G9EA 5SWSD 5B8CA 1DUZA 3VRLF 1J0JA 4CN1A 3VU2A 5GS0C 3KPSD 3TBVB 4OZFB 2XTJC 2WINA 1QRKA 1YEKH 3BVNA 3WBDA 4BKLB 3P4OB 2VABB 4M6AA 3V6FB 5JQ6H 5FYLD 3O6FB 4X7TB 3INUH 2AVGA 1OF2B 1Z2KA 4L5FH 3ZE2F 1JRHH 4JM2B 2D03L 4G6FB 4POZD 3K1DA 1ITCA 1CE6B 3T0VA 1D9KB 1CLOL 2ORBL 3O6KH 3QISA 2ZKHH 2HT4D 3L3OA 3UTOA 1WV7T 1IGFL 3TBWB 3P77A 3U36B 4OQ1A 5J89A 3D0LA 4ZTOH 2DQDH 5T5FL 4JQXA 2RCSH 5D1QB 4CUCA 3PDOB 2WIIA 3S37L 3AU1A 3GMNB 3VXSA 4A6YA 4HCRL 1L9MA 1UWEL 2WBJD 3ALXA 5GRWA 2P7TA 2E8ZA 4GSDH 2K9UA 1U8PB 2JJSA 4PRDA 1DQJA 3ZKMD 3M45A 3CVIH 3ZHDA 3MJGX 1X5AA 4HWZB 4WDIA 5C09A 4XP6H 3BAEL 2XZQH 4EDXB 5CZKA 2IWGA 2QQKL 1BLNB 5FGRA 2DQUL 3LN9A 3MJ8A 4HWBH 2J2ZA 1RK1B 2OMNA 3FOLB 2A6JA 4JFQA 5E8NA 5DRZB 3TJEH 4H1LG 1BVLB 4H26A 5SX5H 3NCYP 4JO1H 2XWTB 1VGKA 1WT5C 5DZNA 3OKKA 5IBUB 3S8WA 4KH2A 1QO3A 1S9XA 5DC0A 4M6OH 3CK0L 2W1NA 1H8SA 1IGTA 1TNNA 3U79A 3NACL 2ZOKB 3BMVA 2EDXA 4YUEH 5I16B 1WAAE 4GAJH 1IC5H 4BZ2H 2VLME 4LVOC 15C8H 1FJ1A 1XGTB 2IADB 5EU4A 2CPCA 3BKCH 3QNXB 3QUMH 2HMID 3P4NA 3OKOA 3RL1A 3FTGB 2LABA 5T3XL 4GXVH 2O61B 3HZYB 5IEHB 3CMGA 3LB6C 5FF6B 3I2CL 3F65A 3GIZH 5IW1A 1NFDE 4MA1C 5F88B 5IT2H 2EDEA 3DV4B 2A9MH 2Z8WC 4X98B 5HHQB 5I1GL 5K59E 4GG6F 2ZCKH 3L7FB 4IIQA 3R1GL 3RIFF 3MV8E 2BSED 4U6VH 1GRWA 4BQ6A 2E8YA 3T0AA 5DJXB 4FQ1L 4MA8L 1VERA 1UZ8A 2CRYA 2H2SC 4ZS6C 4U1JA 1N4XH 1EMTL 4EDWH 2YKLH 3S5LB 2HTLC 3D3VD 3OGCB 3RVXC 3JUYA 5J13B 1IGMH 4N8VB 1NLBH 3QUXD 5JPNB 5IMKB 3O81A 1EDQA 3FRPA 3MROB 1OAYH 4IMKC 3BRGC 1SEBB 1IGJA 2Q3ZA 4GAGL 4MAUH 6FABL 5D1XB 5H37G 3H3BC 3HB3D 1N64L 1V3JA 1AC6A 2YBRA 1MHCB 3PWLB 4HMEA 3I9GH 1EMTH 3HPJB 1ZE3C 2ARWA 5AD0A 3Q0HA 3LKOB 2HH0L 4Y4KD 3R06A 2IALA 5L8JB 2GJ6A 4IBLT 3QCUL 2J1KA 4PB0L 4EKXA 4U2YA 3IFLH 5C0AE 3FO1B 5IMKA 4PP1C 3SE3A 3IAGC 5I1LB 4ZXBD 3IDYC 4DWHA 3IDGA 4L29B 3GSQA 1TLKA 1PVHA 1BJ1H 3UAJC 3QIWA 4OZGA 3D0VA 2PYFB 3OKKB 4Z0XA 3BP4A 2G75B 1Y6KR 5FYKU 2CDGB 3L5IA 4RWYH 2F15A 1KN2L 4CL7A 2IQ9L 5I18L 3M8OL 2ENYA 3QQ4A 1FDLH 4UT9L 4Z7NE 3GRWA 4CVZA 3SO3C 4F33A 4YZFF 4LSRL 2AXFA 5F9JA 4C4KO 3ME0A 4XCCH 3N1FC 5ETUB 2BY3A 5CD5C 3Q5TA 2FJGB 5JIHA 4PGDA 3V4PL 3HNTH 2GYSA 4PJEA 1KLUA 5FYKD 5FHAH 4CDGC 5FGBA 5IB1A 4RMUA 4XX1G 1MHEB 3BH9B 2CIIB 1DN0A 3P4NB 1IAIL 5EIVA 3FB7A 1RY7B 3DO7A 3HZKA 3UTQB 5E8EB 3ZKXB 3QHTC 1IQWL 3D0LB 4ZAKD 1R3KB 3QUZB 3BGAA 2WANA 1S7XB 5DUMH 3RX5A 2XIDA 3MRMA 3VGGA 3EO1A 1GAFL 1A47A 2F58L 1NEZG 1S9WA 3WHE0 4PRIB 2CKBB 4U1IA 2OX5A 3BKJH 3N85H 5INCB 1SEQL 4LIQL 3TNMA 5EN2A 5GZNC 4I13B 3G5VB 4OBRA 3DWTA 1RVFL 1B88A 4JDVB 1HXYA 5DVKA 5IESH 2MHAA 4MQXD 2P4AB 2X1QA 4YHYC 2C4XA 2CR3A 1ES0A 3HNVH 5EOQL 5I1CH 2F5BL 4PLKC 4JM4L 3HR5A 1HZHL 2X70A 3WHXB 5E1AA 2MWCA 4F7PB 2P7TB 4JO3H 4NJAL 1SEQH 2AI0L 2IFGA 4TPRH 4MD5A 1JFQH 3RPIA 5H8DA 2R0WH 5D7IB 2ADJA 1G7PB 4EI5B 4I18B 2AEIT 4WEUD 2P5EA 1JNJA 4OTXH 4PJHF 3KDMA 4M7KH 5TQ0L 1T4KB 3JTSB 3IT8D 4QHNA 5C0ND 2NLJA 4MNGB 1X7QA 2UZIH 3PQYA 5EU6D 4UOJA 1TVHB 3PABB 2ID5A 2VERN 4Y88A 2QKIA 1A1NA 5DHXB 4JG1L 2VE6B 4HQQL 1GGIL 5CMAB 2NXZC 2NY7H 3PP4H 4PJ7F 1OTTC 3WS3B 1RIVL 2EXYD 1O7SA 4YNYA 3CAFA 1YECL 3KS0J 2NY4B 3M1BB 4QRQA 3FQXA 1CLZH 2IFFL 3TN0B 4NQXA 3HI5H 4CBPA 3KPMB 3OX8B 2R29L 4XB7A 4Y4FD 4W4OA 3VWKA 4ZOCA 5BS0E 4A2MA 4YK4C 4LNRB 5LXGH 1OAZH 4JVUA 3ARDB 2AV7A 2ERJC 1ZT1B 1AE6H 1FDLL 4ZUSB 4LCWB 1PY9A 1I1RA 5I9QB 5C0CA 5JW5B 4DVRH 3SDDC 4HKZA 4XNUH 1ZKAA 2X89D 2DQCH 4HBCL 4UV4L 1V3MA 4PJFF 1I4FA 5ITBL 2F53A 4GKOA 1X44A 4Y4HC 3Q6FA 1FQ9C 4U6HB 1HOCB 4AY0A 1OP5K 5E4IA 1U42A 2NXYD 5ANMA 1G7MA 1P4BL 4XC3L 4D0DB 4AIZB 2NZ9D 1F4WH 1Q94A 4O2EB 4LVEA 1FV1A 5DJZA 4ZUSA 1A1OB 3BE1L 1NMAL 2R2EB 1AIFA 1OB1A 4CW1A 1CDHA 5C9KA 3VXPA 2R69H 2VLKB 4Y4HB 2X1XR 1EJ6A 1JZ8A 1N5YL 2DWDA 1T5XB 2XPGB 4J3SA 3RU8L 4I5BB 1KNOB 4JQVC 1DEDA 3DUSB 4JGJA 2ED8A 5E2WH 2LV4A 3WS3A 5FYJD 2ESVD 2R1YB 5B39G 4JM2D 1KJ2L 5IEKA 1J9CT 3PP3K 1FFRA 4WFFE 3QEUB 3NTCH 4ZSOA 1YNKL 1JPFA 1PZ5B 3V0VB 1ND0B 1ZHBB 3LN4A 3B83A 5E08H 2XNAB 4FQ1H 3BWUC 3NFPA 4OGAD 4PRHD 3F7YB 4W4NA 2FZ3B 1I1AB 3QA3A 2CIKA 3L3DA 2X09A 4KHTL 2DLHA 2A74B 1QG3A 4YO0A 1CK0L 1H5BB 3WE6A 5GHWH 2E7MA 1IM9B 4TRPL 2FECI 4P46A 2FECL 4MSWA 1A7OH 3N1PC 2V2WB 5DD0L 1E6JL 1IQDA 1YC7A 2H8PA 4GRMA 3EJZC 4PP2B 5I8EA 3EFFB 3W2DH 3MODH 2GSIB 1P84K 1INDL 3LMJL 3EO0A 1JZ7A 3QFJD 4LHUB 1QOKA 4HS8H 4DZ8A 1G9ML 4M1DL 3O3EA 5I19L 3H42L 1QBML 4ZAKB 1W72B 3FB8A 3S5LG 4PJ7B 4CNIA 5MEPA 1YY8A 2EDHA 3MRBA 4MJ4A 2DWEB 3F62A 5SWQA 3RWCA 4PB9H 4X9FA 1XGQA 1NDMB 1CD1A 4LHQB 5C0GA 1RJZA 3D39B 3LQAC 1E4WH 5EA0L 5E2UL 2H45A 3MLTA 4GBXA 2J8HA 2DQIH 1MFCH 4YDKH 1MRDL 4HJ0D 1CGWA 3C8KA 3HAEA 4FS0A 4Q2ZA 3U82B 5EBMB 3X13A 3VI3E 4KRLB 2IMMA 4Z78B 4XVSH 4H5SA 3M8OH 4LOUD 3OG6B 2XQYG 5D7SH 4YFEA 1LO2L 3DO7B 4D94A 4LPWA 4IIQC 1AXTH 1FIGL 5CJQH 4MNGE 4GW5A 1NCWL 4OI9A 3KAAA 3ROLB 1IZJA 1I1YA 3BESR 2WZPD 4PG2C 5I19H 4L9LA 4DVBB 3ES6B 3D9AL 3D5OF 1IM9D 4G9FB 5DD1L 5F9WC 3TYFB 3DXAE 4ZS7L 3MRPA 4OV6F 3S88L 3CFBB 3DXAA 2IAMD 3QFDA 5F9JB 1HXYB 3DIFB 4ZNEA 4LSDA 1CD9B 2ADGB 4MA3A 4YE4L 2UWEA 4WW1B 4M7JH 4P4RA 4Q9BA 3GBML 1I3GH 3QUYB 5TJWK 5FOBA 1AGDA 1IAKA 5F3BB 4YHOL 3QWOB 4HGWA 4PREA 1HEZA 3VA2C 1P53A 3KXFB 1EBAA 3KPQB 3PV6A 4LCWE 1YN6A 5I76A 2VZTA 1TETL 2C1OB 4AENB 4LPUA 4LPTA 2EC9U 3BFOA 1LNUB 1S7XA 1G9MC 3TZVC 2UVEA 5ID1B 4M5ZL 3UDWA 5ESQB 4FTVD 4KGJA 3KLHD 1YNKH 3C5SA 2M1KA 1QZ1A 2I9TB 1RVFH 2WV3A 2C1PB 4F9LC 2DI9A 5BVJA 4GAGH 1F4YL 2FX8H 3PWUB 4GLRI 1TJIL 1U8HB 4Q0XL 1TZHA 1CFVH 2MMXA 1I3RA 3IFLL 1EEUA 4G8GD 4LK4A 4POUB 1VFBA 2Y7QB 4JANA 3VD3A 1FHGA 1P7QA 3QNYB 3SDDA 5BW7C 4TUKH 4D8PA 3SDAC 1AXSA 1XIWA 2I07A 2GAZB 4YR6A 1VEOA 2EE9A 1H0DB 2OSLB 1HNGA 1ADQL 4OIIL 4FXKB 4AT6A 2NY2B 4ZG1A 4OZFG 1N2RB 2YMXH 3S4SA 1H0DA 5A43C 3MA7B 5GZOD 2AJZB 5T3ZD 1N6QL 3O2WL 3FL7A 3RZWA 3KPLB 5IJVB 3L3GB 4RMSA 5DGRA 1NUNB 3EOTL 2O5XH 2VJXA 3GJEB 5I1DA 3O4LB 2MSPA 1VFBB 1HCVA 2CH8A 4I0PC 4PJGF 4XCCL 1WBYA 4OCSL 4NQDB 5T1MA 1F3JB 5EU5B 1FORL 4RGNC 1UKQA 5LKNA 3BO8A 3X11B 2Y07L 1T7YA 3N1GC 3MCKA 1TCRA 2E7CA 4NZUL 1OPGH 3VWJA 1NH6A 2I9TA 1IC1A 3BWAA 5FO8A 1DVFA 4M6NL 1RJLB 2HYMA 4P49A 1CR9L 5IJVA 1TZIA 4H25B 5CBEA 1LVEA 4HX1A 2R2CA 3D3VB 5HHOD 1KSRA 3HZMB 5KS9F 1CXLA 4JREB 2ADFH 4HG4K 1PLGL 1DFBL 3SGJA 4P2CG 12E8H 3Q1SH 3B9VA 3BZFA 2CRMA 3SBWA 1UCBH 4EXPX 5J1SC 1I1CA 1J87A 3OMZA 1AFVL 2R23A 2OSLA 3PXJA 4ZTPH 3WIIL 5ICYB 1RUPH 4MAYB 1FORH 2Q8BH 3CZFA 1CLOH 4LSVH 1FZKA 4X6CB 4PJDB 1RAMA 4F9PA 3VFRA 4GRWF 1BLNA 1TMCB 4QRUA 3TYFA 2DKMA 3LRHA 1CI5A 1C12A 3BUTA 2VLRB 1P7KA 5DUBB 4RBPK 1XGPB 3QNZB 4Z76B 4GXUN 3OR7A 1MREH 3VFNA 2Q87A 4YBHA 1NGPH 2C3HA 4JGMA 4OQTL 4GW5B 4OLWL 5F9AC 4DKFH 3MLSL 1IGIL 4WWKD 4XH2B 3MXWH 5EU4B 2BDNL 3LKQA 2P49B 2MKLC 5A2KH 4YBLC 3ELAT 1U3HD 4WW2C 5D7JC 1U8OA 4NN6B 1NC2B 4JJ5A 2Z92A 3ZKND 3QXTA 4LVHB 1OLZA 4LQFL 1CFNA 3IJHA 3KPRA 4JQXC 1SVZA 1R5WB 4RDQG 4XWGH 1R3HB 2DIJA 5JZ7D 3QEHA 4XCFH 1FCGA 5LAXB 5JXAL 3GKZA 1J8HD 4MNHA 4P5TB 4WFFD 2MNUA 3WS6C 1T7VA 4JZNA 4MQ7A 1YY9C 4ZOAA 3HZVB 5LCVL 4G8GB 1OL0A 2DIBA 3ULVF 4JR9H 1GGTA 2B1AH 2CLVA 2QQNH 3IFOB 5CZXD 4L3CA 3T0BA 5AG8A 1JGEB 1MJ8H 3MYZA 3HC3L 3STLB 3QPXL 4I0PB 2V2WA 2VZ3A 3MCLH 2C5DC 1I9JH 1T1WA 4TSCH 1A9BA 3GMNA 2E6QA 1OW0C 2D0FA 1EFQA 4I3RH 3LKNB 2VWEE 4KY1L 5D8JH 1NGZB 1K9TA 4HGKC 1K4DB 4OT1H 5E94B 1QSEA 2Y5TB 1G7QA 2ZWLT 3C8HA 1OAXH 5E2UH 5E8OB 1NANI 5EORL 4GUPB 1PEWA 3FN0L 3ZDXE 4TTDC 4U4BA 4HZAA 4RQQA 3ULUC 4XNMA 2HLAB 1F3RB 1G7HA 2A83A 3VI4F 2HJFB 3BW9B 2VABA 1YY8B 3MRBB 1TTUA 3EJYD 1DL7H 2NXYC 1P2CA 1IGYB 1SHMA 4QRUB 5DJDA 3RVWD 4U6XA 2J6EH 5F44A 5JPMB 2HJLB 1M6OA 4U1HA 2BNQD 4WU7B 5CJOL 3ZE0F 3G9AB 2FEDD 4QRRD 4DEPC 4PRNA 3HG1E 4HUWB 3RWDA 1FFPB 3QUMA 5HD8C 3BDYH 3WIFB 3VFMA 4CW1B 1A8JH 4XX1E 1H5BC 3DYMA 5K9JH 2Z93B 4LMQE 4F37K 1AP2B 4CADA 3FAXA 4LCCC 5CIPH 1X5FA 4MX7A 2DYPD 4MVBC 1AY1H 2PW2B 1WC7A 4NC2B 3SDCD 5AWNH 2BC4B 5GJSH 3UTZA 1J8KA 4UU9A 3CLFH 4HUNB 1NFKA 4XI5C 4MA7L 1HHGA 3OGOE 5JOPD 3H9YA 3P0GB 3U48A 1NMAH 1ZHBA 4GW1A 2OCFD 3SKUD 2FR4A 1Y0LB 3VCLA 3D2UA 4NUJA 5DJ8A 4AZ8A 3ULSB 4ODSH 5DI8A