5D7JB

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords M33.64 TCR Alpha Chain
total genus 56
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB02
3RNQB 3VWKC 3RL2B 5KVFL 3FFCA 3U83A 3L3JA 1NLBL 3IJSB 2Y4SA 4K8RD 3KJ6H 2HYMA 3EHBC 5C0DA 4W68A 1SBBA 3PP4H 1QR1A 2X4UB 1I1AB 2HVKA 4PJXF 3B9AA 3X3FH 1F90L 4I2XE 5T5NG 5LGHL 3F7QA 4G80A 1F3RB 1JHLL 1JNLH 1ORSA 2ZG3A 4NQCE 1HHJB 4PJXB 4WFHD 3NOIA 4Y7MA 3PWLB 1A1MB 4ONGH 2PO6B 4M93B 4DQOH 4AH2A 2NW2B 1S7TA 4WJ5A 4GMTH 4HJ0C 2VDKH 3IKKA 1TVDA 2IG2H 4MAUL 3BZEB 3VD9A 2ADFH 3GO1L 3RWIA 5JA8B 1OHQA 3AVEA 2OJZH 4X9BA 3EOAB 2EXWD 3ARTA 3RZCC 3HE6C 3RU8H 3EHBD 5BV7H 4IDJH 4K8RC 1MCKA 1K2DB 1QFWH 4FXGB 4YHLH 3QDMB 4H8WC 4F58H 1I75A 5CZXD 4OIIH 5D93C 4ELKB 3OAZH 4O5LL 4DKFH 2IPUG 4X4YA 5E8PA 2OR9H 4UT7H 5DO2D 1CTOA 4OM0H 5J11B 1VFOA 3Q6GH 3QDHA 5GGTL 1RZKL 3EJZD 2R9HD 3WJLC 2EH7L 2CUHA 3WSQH 4C56A 1KTLB 2DQFB 3VXUB 5C0IB 4NNYB 4OZ4A 3U0TA 4KUCD 3DUUA 4RCAA 3FO2B 2IPTL 4RX4A 4NQDB 1F6LL 3ZTNL 2OCFD 3CH1B 1EZVX 2FECI 3NMEA 4JO2H 1MIEH 1AQKL 2GQHA 3O9WC 4JFQA 1ZGLP 2WINB 3H7BA 2CD0A 1JGLL 5CP3H 3VWKD 4M03A 3MLSL 4KZDH 4JHZA 1QZ1A 1M6OB 3X12B 2YXFA 1I9IL 2FD6L 2FATL 2IEPA 3FFCD 3VG0L 1BWMA 1MNUH 5AUMA 3OGOE 3ARGB 3C60D 1QLEH 1BJ1J 2MTPA 5FK9A 5DEFA 2CIIA 2YKLH 5KG9B 4G9DA 5T1KA 4B41A 1RZKH 2ORBH 4GQ9H 5B4MC 4FQCH 4HT1L 3WXVL 1DBMH 3JV0A 1TENA 3PGCB 3QJHA 1EMTH 2R1WA 4CADA 3BH8B 3LKPB 2AQ2A 3BPLB 5C3TA 1IT9L 3C60A 3IJSA 3FT4A 2W9EL 3QXDA 3D2UB 2NY3C 1XGUA 5F1SA 1EJOL 4NQEB 4QRQA 3ZE2F 4XHQA 3PXHA 3QIWD 2CDGA 3WUWA 4G9FA 4DUWA 3MRIA 3BAEL 4AL8L 1ZA3B 5D2LE 1XT5A 4DCQB 2PKDA 3HE6B 3PWPD 3SGJA 4KRMB 1WFNA 2FEEI 5C09E 2NY6C 3BWAA 1PEZA 3WIFB 5ABDE 4RQQB 1EUTA 3SGKA 4S11A 3HA0A 4YNYA 5E2JA 4JRYA 2QQLH 5E0QA 3R8QA 2WIMA 4KV5E 2J6EH 4LEOA 5BJTA 3UTSD 2AXFB 4M6OL 1RVFL 2IPKB 1ZLWH 3PXJA 3M8OH 3QWOA 3BKYL 2GTWA 4MQSB 5DJ0A 3DX7A 3P11L 4YPGA 3CDFA 1UB5B 4MQXC 3OKEA 3LPWA 5BRZD 4YNYB 5ACLA 2ARWA 1NEZG 3NCJH 3HUJB 1PQZA 3RJQB 3PHQB 1OTTD 1FNGA 5MEPB 2ESVE 2J8UE 2RFXB 4C56E 3BKYH 4HS3B 4NWUL 4OV6F 2HA1A 3BIBX 4M5YL 1IKFL 2VLRB 4U1IA 4MNQB 3RVUD 1EHXA 4HC1L 4HIIA 4S1RL 2DQDH 1X5AA 5EZOH 3RBSA 3PQYD 3Q1SL 2E27H 4XP6H 4DGIH 3LN4A 4TNVK 4AMKL 4P5KA 1OP9A 4HKZB 4LQFH 1XCQB 5D6CB 1WBXB 3WXVH 2AK4A 3E6HB 4UINL 2OX5A 1ZLUH 5DHYB 4C83A 4XAWH 1MHCA 1H3PL 3V79C 1DP0A 3WN5C 1SY6A 4IOFD 4V1DA 5MENE 4I5BA 1AO7A 5HI5C 4ZUVA 3EO1B 1MEXH 5E2UL 3GUTB 1JTPA 1DEEA 2EYTA 4WHTA 4M1CD 5DUPL 1F13A 1JNHB 4TULH 5CSZA 3RL1B 3T77B 5BVJB 4YBQC 5EIIA 1J1OL 2VUYA 4MJIA 1E4WH 4PTTB 5GZND 1QG3A 1I8KB 4XMPH 2XIDA 3JV5A 1T7VA 2W9LA 5EOCL 3CVHB 5HYEA 4P4KA 2QADD 1NGQH 3PDGA 1UJ3A 1T5WA 4G8GE 2NY0B 1AKJD 4NUGL 1Z6JT 4YX2H 1F4HA 2BNQB 3PGFH 1KPVB 4LIQH 3FO9B 1J1OH 4P5TD 3LRGA 5T33L 2VO5A 4Y5XA 1Z3GH 4Y2DD 4Y1AB 4O51A 4I0PA 2MQ0A 2X41A 2YPLA 3DVIA 4MCYB 1AY1H 5J1TC 5FYKU 4NC1C 3U46B 5IWLC 3QHFH 3V7MA 1E6JH 5LJYH 4KJPC 4WO4C 1XF3A 1TQCB 4P4KC 5J6GB 2VABB 3EJYD 3OKLA 3S96A 3SDAC 4HWNA 2BNRB 5DF0A 3A6CL 4MB4A 3KYAA 1RIVL 2CK0L 2WBJD 4K3JH 4KROD 2JJVA 3WNNA 4DTGH 4O2FA 3KXFA 4YBHA 3RKDC 5F9JB 4UINH 1K4CA 5GGSY 3UDWC 3HTLX 2MHAA 3PABA 4R90H 3WBDA 2VZUA 4CVZA 3QDJB 3STZA 2FJHA 1MLBB 2GT9B 3CFEA 3OAUL 4PREB 3ZYJA 5M7QA 4GXVL 1K4DA 4NT6B 3ULUH 5KTEH 5MHSD 2XKNB 4XPAH 3SE4C 3HLAA 2P48B 4G5ZL 1VGEL 4EDWH 3KXFB 1ETZB 3K8MA 1DQJA 1JNNL 4JDZA 4ZO8A 1QRNB 5DT1L 3CAFA 4U1NB 2PYEB 1IGML 3VFOB 3EJYC 3FMGH 4LGPB 4KK6C 4WW2F 5F3HB 5KVDL 3VGHA 5I1CL 32C2A 5JW3H 1MF2H 1KYOK 4JFEE 4UTAH 5J6GA 1O7VA 1JRHL 5C09B 1P7QB 5TDOA 1MRFL 1ZLVH 3VRIA 4HUUB 1FSKB 5E94B 4UQ3A 5D7JD 4PRHE 4DVBA 5I1AB 3FT2B 3RNQA 2VLMD 3O3AB 4Z95H 4JZJB 3GJFH 4ONFL 4NYLA 5FV2A 3W0WB 4F7TA 1GOHA 1P9MC 2WUCL 1U8IA 2HJLA 4MJIE 2ICWA 2XA3A 4OSUL 5JDSB 2BNRE 4KFZC 4TRPL 4DN4L 2B1HH 1A6UL 1PLGH 4HCRH 2X40A 3SGDI 5D4QA 1AIFA 4KKLC 3MGOB 1LK2B 4OM1H 1TJIL 4Q9RH 5D71H 2EDNA 3VFGH 2PF6A 3CCHB 4HDIB 3DVFA 4L9LA 4ORZC 5BVJA 5HGAA 2CGRL 1KFAL 2XG5A 1FH5H 3MLTB 1P6FA 1B0WA 1PLGL 1ZANH 5F9OH 4MYWB 4RFEA 3H8NA 2YPLE 1T1ZA 4DGVL 4U1HB 1JUFB 1DE4A 4X0KB 1WSST 2LU3A 5FKPA 3RPKA 5C0RL 2QSCH 3P11H 2X4PB 3IDJB 2X4OB 3UTQA 2IQAB 5KSAD 1YEHL 1ED3B 1UT9A 3MJ8A 1HHIA 1LO4L 1GC1H 1QRKA 2FH8A 2ZCLL 1RZ8A 4LF3A 5HGGS 1JGEB 1A6WL 3I3DA 3REWA 1F3JA 1E28B 4G8FA 4M9OA 3RHWF 5JIIA 1PFCA 2KQNA 1UCBL 3VE0B 5EDXA 4M61A 4P2QD 3P4NB 2GKIA 5FM4A 4RA0C 2W38A 3MRHA 4RFNB 2Y5TB 1AD9A 1JNNH 4GT7A 4YE4H 1G7QB 4FABL 4HS6B 1VEPA 3MCG1 4KUZL 1YJDC 3CK0H 3L5XH 4M6NL 5C07A 4HH9B 2XZQH 3O6MH 3NTCH 4FQQB 4CN1A 2AV1B 5D7SL 2YRLA 2A6KA 4PJAB 2P4AB 2PYED 4G43A 4GKOA 1J87A 2E6PA 4HBQA 1P7KA 2FX7L 4JJHA 1FZMB 2VDMH 3DXAB 1INQA 2UYLA 4OBSA 2BXZA 4PPTA 1MFCH 2M2DA 4XXDB 1NGYA 4YPGB 4X6BA 4JJ5A 4IOFC 1A5FL 5GGRB 5IHBA 4NP4L 1ETZA 2IPKA 4ERSL 4OIBA 5IF0B 4TN9A 1XFPA 2EXYC 4S2SB 1ND0B 4M1DL 5FYJU 3ARBC 2VZSA 3GIVB 3D25A 1N6UA 4PG2A 3VXSE 5BOPA 2AK4E 1UM5L 5MHSE 3L5WA 3ZDZF 5H94B 5INDB 3BPCB 5D2LF 1CFVL 5LGJB 5GGUB 3HE6A 3VCLB 4O2FB 3FFDB 3RVVD 5ILTH 3ARDB 4KQ3H 4ACPA 2DLFH 2H9GB 2RQ8A 2HFEB 2LVCA 1GGIL 2ESVD 3T4AA 3O3UN 1BVZA 5T1MA 4WWKC 4LCCC 1QSFA 3GSWB 3FT3B 3QIWB 2SEBB 4HH9A 4Z7OE 3QIBD 5IJVB 3SKMA 3V6ZB 1OOAA 3MLZH 3MRBA 5B8CC 2AEIT 1FPTH 2D9CA 4UOW1 5GGVH 4ETQB 4PRNB 1PKOA 1EHNA 3O8XD 4YWGL 2R69L 4I18B 2XXMB 4WCYH 1NKOA 4HPYH 4P4RA 3IU3B 4PS4H 3HZMA 2R0LH 3B6SB 5D1XA 4YFLF 2ZCKH 5T1DH 3MRMB 4E41D 4JQIL 5ITFB 1X5FA 4QCIA 3T0AA 3UMTA 2JB6B 4JFEA 2NY3D 5DHVA 5I1LB 4WI9A 4KK5C 5FO8B 1F2QA 3EYVB 4GBXA 4IMLA 5KJRH 3W11D 4FABH 1X3DA 4LQ1A 1KUMA 5CEZE 3H7BB 3P4LA 2ZOLA 3VI3E 4P9HH 2P5ED 3HE7A 4GKNA 1LDSA 2HT2C 5E08L 1HXMA 4ZS6C 4U7MA 5C07E 2OK0L 2JB6A 3HMWL 1M05B 3SGKC 5C8JB 1U8LA 2H2SC 1NAMA 1ZLVK 3D0VB 1ZMYA 4XHJD 1MHPL 5JW4N 4P2OA 1BVKA 1AGDB 1HCVA 1AGFB 1JI2A 5CJOL 2F54E 3IF1A 3D1MC 5F3BA 4K71C 3OZ9L 5LQBH 3CSYA 1F3DH 2W59A 5CMAB 3SKMB 4HX1A 3ZLQC 1U8PB 1EX0A 3LH2L 1MCJA 1C5DB 3BEWB 1YYML 1AJ7H 2BMKA 5DFVD 1CFNB 3IS1X 2OJEB 2EO1A 4P3DB 4JVPA 1VDGA 1G7IB 3JBG7 3QXAB 4AYFA 4QRRB 3V4UH 4KVNL 1JFQH 3VRIB 4FXLA 5IVZA 4FQXA 4MS8D 4ZG1A 1JZ4A 4CW1A 2A9MH 4HWEH 3UPRA 4NQCA 1AO7E 2VKXA 5SWSB 3U1SL 1VEOA 5FOJA 4MA3B 2DQHH 1F11B 5IBLC 1EXUB 1WBYA 1RUMH 2VE6A 4P23A 4GQPH 3EZJB 4M4PA 3F58H 5DJCA 1HIMH 3W9DA 5FYJD 4OZIF 4QXWA 1CXIA 4J1UB 5D72L 4L3CA 4BSWA 3VXSD 5IT2L 4ODVH 4R2GC 5KSBF 1TNNA 1LEGB 5KVEL 5KSBE 3E3QC 2B4CL 4ZUTB 3SGEI 3F7YA 4OZFG 3SDYH 4P3WA 3O3DB 2DLEA 2WMPA 1FLRH 1RU9H 4K07A 2BRRH 2W0LA 4KV5F 5EBGA 3ZKXB 4KDVA 4NQVB 4LPYA 2EDOA 2VLJA 4AEIH 1RURH 1GJIA 2IFFL 2OL3H 1IZKA 4OGAC 1AQDA 4RAHA 5GGVY 4PRDA 4W70A 4MCYA 4L4VB 2HT3C 4YH6A 4RA3A 4NGHH 1C1EH 4ZODA 5D93B 3QEHA 2E9BA 4KUCF 2ZPKH 1UEMA 1QHOA 5DI8B 2MKWA 4EDXB 3H3BC 5CEXB 1W0YT 5FK9B 4J6RL 2Y6SD 4F15C 4ONHA 4NRXB 1WCBB 3UBXI 1S7VA 1YEIL 5I8OH 1FYTA 4HFUH 3LCYA 1AHWB 1CU4L 4O2CA 5BCAA 2A9ML 1J0KA 5GHWH 3FMGL 1QSEE 3MOQA 1ZVSB 4KVCL 4MVBD 2J88H 2VDRH 4JFPB 1HCFX 1RI8A 5F9AC 1D6VL 3RWJA 1SM3H 4TTDD 3GDBA 3VRLE 4CVWA 3P73A 1ZGLB 2YWYA 1QFPA 3L3IB 1Y0LB 5GGSB 4P9ML 4P2QE 1YNLH 2XYCA 4LARH 4D9LH 1UWEL 3EDJA 5DD1L 1YN7B 5AYUH 5KVGH 5C6TH 2QR0B 4ODTH 4JQXA 2RHEA 3T0BA 3B9KB 4K7PL 1I8IA 4D0CB 1GGIH 4PB0H 3O4LB 3VXUA 2CDFA 3QEUB 4KMTH 4M5ZH 5DUPH 4XRCB 4QY8B 2QJDA 4NQEE 1A3RH 1NCWH 3WMSA 5IJVA 4HMEA 5CZVL 2DQJL 1R5IA 3MNZB 4U1JB 4RIRB 5IEKB 4OD1H 1S7SB 5E8PB 4NHCH 3JWNC 3TIDA 3UXFA 1JE6A 2WBJC 3FL7A 4KROC 4OIIL 3VXSB 1OPGH 3EFFB 1J0IA 1C12A 3WIHL 5E99H 4DFIA 3G6JA 1T22A 1I9JH 3HKFA 4NBZB 1SHMA 5MEOB 5E8OA 4PLKD 4UUJB 1HSAA 4NP4H 1OAZH 4PGEB 4KZEL 5MENA 2PCPB 3OAZK 1KPUA 3NA9H 1KCRH 4LLUA 3PP4L 1G0DA 1LNUA 4U33A 1IC5L 4M7KL 1N0XH 2I07B 1TMCB 4MAYA 3X13B 3A0OA 4LSDA 2D4FA 1JPFA 4J1UA 3MV7B 3PWVB 4P2YA 1H3GA 1KTDB 4DK3A 1AGCB 2AXFA 3ZE0F 3O6FB 1VB9A 4HS8H 1AI1L 3P40A 4P23B 4YDKH 1A6AA 1OAXH 4N8CL 1B0GA 3ROLB 3UJIL 4KWUA 1FZMA 5L88H 3O3EB 5DTFA 4ZMAT 2J6EA 1NGXA 4C57C 2A74A 5FM5O 2NYYC 4MCZB 5JHLL 4FQXB 1L6ZA 3JZ7A 5FF6B 5C7XH 1T21A 1H3PH 5LAXB 1WZLA 1ZA3A 2HT4C 3ECBB 3N1FC 5E8DH 3ETBF 5JOFA 3KPLB 5HPMA 5IB4B 1U58B 4WU5B 3GSQA 5D7JA 4QHNB 4JHAH 3ARFD 4GLRH 3BPOC 4JDTH 4URTB 1NGWB 4JRXA 2J1KA 1T7YA 1SEBB 4N0YL 1VGKA 5CP7B 4TVPL 1CFQA 5F7EH 4ZFZA 3DMMD 2BC4B 4JM2D 3TPUA 2A6JA 4L29B 5HI4D 4XWGH 3MLUL 2R1WB 4Y89A 4FQ2L 4EQ3A 3IAQA 2BSRB 2FEEL 1ZT1A 3CVHA 3Q3GB 1EFQA 4E42A 1BOYA 1RURL 3MFFA 1FZOB 2VITB 1QFUH 3ULUE 3VFNA 4JE4B 4K8RH 1WEJH 1A7OH 3ME0A 4UIKH 3P0YL 4I2XA 2VDOL 3MACH 3O6FD 3QPXH 1EFXA 1T1ZB 3E2HB 4WCYL 1AO7B 5SWSE 4OAWA 2B2XH 3H7LA 4M8VA 2ICCA 2Q8AL 3U7WL 3VXRE 3VGGA 1PZ5B 4J6RH 1YN6B 5JPNA 1X44A 4M6OH 4PB9H 4MQXD 5F70A 3D39E 1G6RA 4E42B 5ITBL 1A7NH 1JGDB 2R2BB 1QBBA 4H26A 5SX5K 4O4YL 2I24N 2I5YH 3DUUB 3FB5B 1IC7L 5E1AB 3PL6A 4I4WB 1A1OB 3FN3A 1H3WM 1CK0H 3KPTA 1N7MH 5L2JA 3BOVA 4PRNA 2JELH 5AYQA 1UC6A 3KPPA 3KDMA 5JHDD 2EE9A 5I30L 2FJFB 4JO2L 1RAMA 1YQVH 4JRYE 1U2HA 3T1FA 1ZA6B 3B43A 4K7PH 2QQNL 2EKSA 5GS0D 1YEKL 1U0QA 2QV2A 5C09A 2R0WL 1WC7A 3V52L 2D7MA 2NTFB 1QRND 5HGHA 1A47A 1U3HA 1NANI 5LCVH 3QCTL 4Y5YB 1B2WL 1NBZA 2F54A 1FH5L 2NMSA 3BKCH 5B38B 1U36A 4DTGL 4NQED 1IGIL 1AGCA 4MXQD 3VW3H 4JKWA 4X6DB 2B39A 2A77H 3F58L 4L3EA 3ZE1E 5BJTB 5AWNH 5A40E 1P9MA 1NCDL 1VCAA 3D25B 3GIVA 3O6ML 4TTDC 3UTSA 3G08A 3SDCC 4D3CH 3IJHA 3PP3H 2QHLA 3I84A 1G0XA 5SWQA 3B2VH 4NCC1 4YHOH 1Y6KR 2G5BB 4X6BB 1KCUL 4JPWL 3REVA 2APFA 3HAEA 3OKDB 5CD3B 4PRID 1MRFH 5ICXA 1TTUA 5C1MB 3Q6FB 4YXKL 3ESVF 3BYTA 2UZIL 5I1JL 4U1JA 1G7HB 4M3JA 4PLJC 3QJHB 4MXVF 5IW1A 1SYSB 2MFNA 2YBRA 4HLZH 4WY7H 4JFYB 1TETL 2FYYB 3PNWB 1CFSA 3SKJH 5I1DA 2LAGB 3M07A 4G9DB 1D5MB 4LLDB 3ZL4L 5I1IL 1EIBA 3WD5L 3IDXH 3EJZC 5KAQF 1T20B 2C26A 4WFGE 3LRSB 2FWOB 3REWB 3KLDA 3WEXB 4GXUN 4PJ5E 1OSZB 2WIIA 2FEDD 5D1XD 5KVFH 3NA9L 1SEQL 5IESL 5BV7L 4O00A 3KS0J 2AI0H 1HINL 3MJ9L 2OTPA 4JFPA 1K8DB 8FABB 1T83C 4ORGA 5BRZB 1NFDB 1DSFL 1QO3A 3MRCA 4Y5YA 1Q94B 1OWRM 3H9ZA 1G9NC 1Q38A 2X1XR 2CXGA 3EDEA 3GMQB 5CINL 5DJZA 1XGRB 5DJ8B 3V9FA 1JFQL 4FQHA 2ZCKL 4Y5VA 2FLBT 2VLKA 5IBLD 1MVUB 4F33B 2YWZA 1U3JA 1ACYL 5IBTH 4C56B 15C8L 3VW3L 2UWEF 1IMHC 4JFFD 5CHNA 4YXLL 2I9LA 1OSPH 3AY4C 2P8LB 2VXQL 4OLEA 4ZO9A 5BS0D 5JW3L 1OAUH 4ISVB 5EU6E 4YX2L 3SCMB 4M7ZB 2BVPB 3GSNA 1Q9OB 1A9BB 2YK1H 2HTKC 4ELMF 4IHOA 1UCTA 4OCRH 5KSBB 4OGAD 3QULB 1AC0A 1SYVB 5IHZB 1G6RB 1XGTB 3B2UD 1NDGB 1MI5E 4RFOH 4OZIB 3TJHD 4ZTOH 1GGBL 5CGTA 4MB5A 3S98A 3DHJA 1P7QA 1S9XB 3N85H 1C16B 3FB8B 1MRDH 1Q9LA 1MFEH 2LU7A 5E5MB 4UDUB 5F3HA 4L9DA 1BEYH 1S7TB 3TV3L 4G6FB 1FC2D 2XG4A 4HJGB 3U4AA 3HC4H 4QF1A 3MLVL 5EG6C 4KTYA 4AL8H 3WFEL 4P2RB 1L6XA 1MREH 3LKOB 1I9JL 4I18C 1P84J 4MDJA 5D7IF 2I60H 1K4DB 4NT6A 2CKBH 1LILA 5F44A 3TF7C 1MQ8A 1KLGA 2HFGL 1B3JA 2ADGB 4HK3J 1I1AA 2HVKB 1QR1B 5A3IC 1YMHB 4U1LA 4JLRA 3MV8B 4BUHA 5IMOB 1FVEA 4JN1H 4LSUL 2RJMA 1YUHA 4KK5D 1BFOA 3T3PF 3SCMD 3MRIB 2IAND 4L8DB 4D0DB 5C2BL 3RL2A 3NABL 5HD8D 3G04A 1U58A 3MRJB 5HPMB 4BFEA 2V2WA 2X5PA 3GM0A 5JNYA 1H8SA 5ALCH 2W60A 4LVHC 2HT2D 3HI5H 3VFTB 1W8OA 4U49A 2K7QA 3W39A 3VXRA 4HX1B 1HYRC 4X5WB 4C58B 4I0PB 5CJ8A 3MRQA 2AJVH 3MLWL 5CAYB 1U8KA 4NQCD 2Y36H 3A6OA 3HR6A 5JXEC 4K23H 1AGDA 4P2OB 3LKSA 4J4PA 1BQHG 3ARFB 3K2UL 4N8VG 1T80A 3V8CA 3MV11 3W0WD 4OZHA 3X13A 5F7DB 1CR9H 4NDMB 4NZTL 3SQOH 4R7DA 3KPRE 3LPFA 2BOBA 3G6AA 5BZDB 3LS4H 1NFIB 2YD9A 2XPGB 5E56A 5E7BA 1ZT7B 2FR4A 4OV5B 3I9GH 3DLQR 3CLEH 5A2KH 5GSVA 1OW0A 3LEVH 2BSSB 2Z8SA 2CGRH 4NGHL 4YGVA 1HI6B 1N3NA 4YDJB 1NC4D 4XNUH 4RGNC 3D2UD 2AJ3A 1IAMA 1DUYB 2M26A 2C3GA 4XXCA 4ZFOA 4Z7QE 1KN2L 1QYGL 1CE6A 2VN7A 5EUOE 5GRUL 2VR5A 4LMQI 1WAAA 4F58L 1DZBA 2V7NB 4PJCF 3NGBB 3GGWB 3VXMA 1T89A 5B39B 1GYAA 3RUGF 3OZ9H 4PRHD 4NO0B 3S5LB 3QUKB 1Z2KA 1J1XH 1ROWA 4XWOD 5DD3H 1CGTA 3MODL 4HIJB 3T04D 3O4LA 2DJUA 5CZKA 3EDDA 4IMKC 4Y5YC 1I85C 3V0VA 4KDTC 3UP1A 1FNHA 1CT8A 2QR0A 5F89B 3UTTB 1N6VA 4ZOBA 3F5WB 2BNRD 4FNLH 4HGMA 1CGUA 1TZGL 1R5VA 4N9GA 2CO7B 5L88L 4ORGB 2R0KH 4LLYB 1WJ3A 4N68A 4PV8A 4U1GB 5LGJA 4JZNA 4NKIH 5IK3A 1CE1L 2X09A 4XPGL 1JPSH 3BP4A 4BSVA 1FZJA 3HZKB 1PZUB 4PYGA 3TH2T 1H15A 1R3HA 5TE6L 4PGCB 1IGTB 3HRZA 3OKEB 1L0XA 4Q9BA 4R6UA 3S3JA 4GG8B 4JQIH 5EU6A 3MXVH 3O4OB 4RGMC 2B20A 1JK8A 3TCLB 4R90L 2PTTA 4LLDA 1RUAL 3BH9B 4I0PC 2A38A 3PV6B 2UY7A 1NC2D 2HFTA 3W81A 1TJHL 1IKNC 4CKVX 1OY3B 4G8GB 3BKML 3K80A 1LEIB 4BK4A 4X5WA 4DAGH 1DTUA 4XWGL 2Z8RA 3B5GA 4JHBA 4HQQL 4Z18A 1FCGA 2GYSA 2HJFA 5TH2A 4IJ3B 2OI9B 1JHTA 4LEXH 1IKNA 2WUCH 3WS6C 1A7PL 2O5YH 4HWUA 1VSCA 2HTLD 4OJFH 5I18H 3DV6A 4PJDB 5DK0A 3L7FB 3RWGB 1JWMB 5EC1A 4ZFOL 2P43B 5IMMA 5IEHA 3ZO0A 3TYGL 3VI3F 3UTTD 5I75C 4XPBL 1F4WH 1D5ZA 3RZCB 3MLYL 2QKIB 4M61B 5GJTH 4YAQA 5KW9H 5GPRA 2HJFB 4PUBL 1UENA 3D39D 3I3EA 2VR4A 3LIZL 4LCCA 4X9IA 3KPQB 5HDQL 3HC3H 5DC0A 1PSKH 5HYJA 4U6YB 1G7MA 4ZSOE 1AI1H 3VXTA 4LARL 4LLVA 4D9LL 3EDKA 4DQOL 4U1MB 5DJXA 5HTSA 4V1DE 4KQ4L 3MV9E 2QADB 2IQAA 2WWMD 1JNLL 1RHHB 5B38A 4LPWA 4QF1B 3CMOH 4FOMA 1FBIH 3O8XB 3MOBL 5KS9F 4UT9L 1T2XA 1F11A 2NY5H 5DMIL 4KJQC 4JKPH 3NH7L 1NC4B 4XC3H 5HYJD 4GRWF 5JQ6L 3IXAB 3IETA 1BGXL 4JPVL 1EFXD 4G8IA 4Q74A 3TM6A 1FE8L 4P99A 3A6CH 2Y07L 3HMXA 5D5ME 2DQEH 5I74C 1D9KD 5T3XL 2NY2D 1S3KL 5FA4B 5JW4R 2QL1A 3NCCB 4F7EA 1FORH 2CLZB 4TPRL 4JPKH 3M1BA 2IWGA 1P4LB 2L4OA 3MA9L 3CPLA 2JJWA 1XF2B 5FGRA 3OJ2C 4F7TB 3QUKA 3CZFA 3BUYB 1JPGA 2OR8A 3IF1B 1G7PA 4CDGC 2E5EA 1KPRA 3MZTA 5E70A 4R0LB 2FSEB 4Y19D 4IBLT 4HUUA 5E94A 4QRSB 4G3YL 4YUEH 1HHKA 5J11C 2J4WH 2DQUL 4ZOCA 5F9WB 1A7RH 4PG9B 1MY5A 4XMKH 3S4SA 1UWEH 4GH7B 3IXAA 5SX4H 3KPRB 1M05A 5C8JA 5EORH 3KXFD 4AENA 1PX3A 2FBOJ 4KMLB 2F9BT 1I4FA 5DMGC 1QD0A 4LDEB 1HZHH 2CKBB 4YHYB 4YDJA 3DYMA 2P8PA 4BFBD 3NZHH 4RBPK 1CIDA 3MREA 4KJQD 1RUAH 3S8WA 4HG4K 3MFFB 3RWIB 3R4DA 4LLVB 1HH6A 4AT6B 3WEXA 5BZWA 2DQHL 1DFBH 4ZAKB 2CUIA 3SDXE 5D1XB 2VDLL 1BBJB 3C5ZA 4NKIL 3RWCA 2QKIA 5EWIL 1B0RB 3U9UB 5C08B 1XIWA 4W81A 4K3EL 2QADC 5LWYH 5CIPB 3SDDC 5L2KA 1LDPL 4LLQB 1PG7L 2R2HB 3O6FC 1S7XA 3TH3T 2YMXL 3VFTA 3Q6FA 2F19L 1QBAA 2VYRE 4MCZA 1IE5A 5HDOA 1X4ZA 3GJEA 2MQ3A 1II4E 1X7QB 3O3EA 5DTFB 3VGFA 3EYSL 1GGUA 2J5LC 5C08A 5KS9E 3ARDA 3L1OL 5IVXA 3FQWB 1F58H 3UYOD 2PR4H 2NZIA 1D5XA 3HFML 3MNWA 5BO1H 4P2CG 2VSDA 4PRBB 3CMGA 4NZDA 3OB8A 1RD6A 1JJUA 4ZUUB 1OGAD 1NCNA 4X7EC 3RY6C 4P9MH 4W6XB 2J4WL 1BJ1H 2R0ZH 1JGUH 4F7MA 3H42H 4JREC 5D7KE 1UXSB 3G6DH 1MI5B 1JNHA 3VA2C 4GAYA 2MCPH 4JFDA 4OLYL 1X5LA 2F53B 1R3KB 4PJBA 1DVFC 1NUDA 3AMKA 3RVUC 1KN4H 5E8NA 3FQTB 2VXTL 1K3ZA 2FX8L 5HHPA 1LE5A 5ANMA 2ZUQC 3ARBA 1UG9A 4GRLC 5HHOA 3AU1A 2VLME 1IQWL 4KKAD 3HR5B 3VJ6A 1IM9A 5EBWA 4ERSH 1AD9B 3PQYE 1N64L 4LSVL 2HKHL 1DQTA 2LVEA 3WO3B 4I48B 4PY8I 5IHUL 3SCMA 3NA4A 4U1SA 4ISVA 1DL7H 3ARSA 4FP8L 3CH8A 3RDTB 3ZKMC 4ODUB 4NO3B 1FO0B 4OTXH 3WFZA 2EDTA 5CJOH 5DURB 2X1WL 1IM9B 5EBWB 3VJ6B 4PLKC 1JGEA 1YEEH 3H6JA 2AJ3B 4IRSC 1QLEL 1QRNE 5HHOB 1J1PH 1CWVA 4XAKD 5EO1B 4NJAL 2D7QA 4G6MH 3GKZA 4CMMB 1A6VH 1I3VA 3BT2L 1IAOB 1L7TH 3FQTA 3TO4C 4JANA 4MD5A 3UTSE 2ZP0T 1T66C 4ODXA 1BLNA 1QLFB 4WFFE 4GUPA 2DYPB 1V05A 4M8QA 5IWLA 4F9LA 2P49B 4G6ML 4MLIA 4PY8J 4K2UL 2KH2B 1INDH 1JYVA 5I76A 4Y88A 3FO1A 5JXEA 1FFOA 1YECH 1G7MB 1T83A 4PJIE 4RMQA 4C4KT 2OBGA 1P53A 5IW6A 3QWQB 2AXGB 2N4IA 1FE8H 1U8QB 1VFAB 2LAAA 5T1DL 4LEXL 4QHUA 3BWAB 4Y4FA 3WIFA 4NNXB 1T03H 1MRDL 4KMQA 5FEBA 4AZ8A 1D5MA 4XVJH 3NFSL 3DV4A 5C9KA 2HKFL 5FGBA 4X9HA 1OP5H 1EGJH 1IGYB 4KVNH 4YDKL 3MV01 3SY0A 5CBAA 3WDJA 2YS4A 5DQ9A 5GGQL 3G04B 3MRJA 5AZEH 1NMAL 4EI5C 4TNWK 2YZ8A 3OPZH 4YHMH 3GMPB 1T1XA 1KB9J 3MCLH 2E7BA 4X99A 5FF6A 1FIEA 3U82B 1HHHA 3NAAL 4BQ8A 3MV8A 3C8DA 5D1ZD 4PJFB 4WHDA 1I8LA 5FHBH 5C86A 3U9UA 4M43L 4WWKD 1A7QL 1DQDH 3M8OL 4YHNA 4OGYL 3TESA 4Z0XA 25C8L 2W9DH 1TCRB 4QRTA 1BBDH 12E8H 1YY8B 2P5EE 2VE6B 2ZUXA 3BP7B 1LO5A 1CZ8L 1NPUA 3HPLA 5SWSA 2AJZA 2PXYB 2JJTA 4BSVB 2E7HA 3GHBH 2EIEA 3CDYA 4X6DA 2VLKE 1EPFA 1S9KC 25C8H 2AVGA 3H9SD 3DBXA 3HB3D 4U7SA 3PIQB 1A64A 1NBVL 1HSAB 3P0VL 1I4FB 1Z9LA 5IHZA 1SYVA 3VFGL 3O9WD 4XP6L 2YUZA 1JBJA 1CFNA 5BV7B 1HILA 1HYSD 1CFBA 4NPYA 5TDPA 3BQUD 1NCAH 5HHXH 1AXTH 3TIDB 3GI9L 5ESAA 2VQUA 4BQ6A 4XPGH 4JGMA 1KTLA 5F7HA 2YUWA 1DLHB 4GRLD 3ZT5A 2FHCA 2R4SH 5IB3B 1Q9KA 5FO9A 1WBZB 2HKFH 1AGFA 4LP5A 2J8UF 3BDXA 2X4RA 3HUJF 1NAKH 3A67L 4OLVH 3OQ3B 1T3FA 3GMNA 5TDPB 3NACL 4E41E 4WTXA 4X8JB 4KTDH 1XGRA 3I6LD 4CU6A 5EOTB 5I1EH 3L5HA 2E7MA 3C08L 3TBVA 3WUZA 4AK1A 4MNGA 2EIZB 3MRFA 2OSLA 4QHKI 1KF9B 1O0VA 5CJBA 1CICA 4PR5A 5H2BB 5C0JA 4OAWB 2W92A 2RR3A 2YC1A 3UJTH 3SGEH 3U9PH 1BF8A 3C5SB 4HD9A 3RTQC 4FHBD 4E5XB 2LTQB 4QCIB 1DBKL 4MA1C 4MZ2A 2BNUB 4PGZA 2G60L 1NEUA 3FQUB 5DC4B 4PRPD 3VFNB 3IU3A 1MCWW 4JREB 5AD0A 1MPAH 1QP1A 5KAQG 3VD7A 1UYWH 2BX5A 4LK4A 4M6AA 3QEGL 2Z9TA 3G5YB 1QACA 1KT2A 5HYJB 5I1KL 4Z78B 3MRQB 4HCRL 1HEZA 2YBRB 2B1HL 4S1SL 4OUOA 4HGWB 3PV7A 3VRJA 1MJ7H 4CRPA 4OF5A 4AIZB 4EN3A 1WFOA 4FFWD 1QSFE 5IB5B 1K85A 4XNXL 5CP7A 1BPVA 1AQDB 4J3OC 3QNZA 2HKHH 2XFXB 4YHLL 4M6NH 1QSED 4PJ7F 4Z95L 4APQB 3FKUS 4A6YH 5EU6D 3BMVA 3REVB 4U3CA 1Q1JL 3IFOB 4Z6AT 4FQLL 3GMLB 5EC2A 1IM3B 3O3DA 2GSGB 4YPJA 4EEEA 5BOZG 4HWEL 2DQGL 1MFBL 3MLSH 5EBMA 4UIKL 1A6WH 1FGNH 4NCDA 1JF6A 2GTWB 35C8H 5C6PB 1J0HA 4NJ9H 3T08A 5I19L 1ADQA 4CMHC 3K4AA 4G42B 3D9AH 1NBZB 4EKXA 2FDBP 1P1ZB 5K9KA 2NY1D 4I3RL 3OL2A 3HZKA 2C3VB 4P2QB 3ULVE 4PUBH 3TVMD 1MFDH 4ZQKA 4WI6A 3WS3A 4PJAA 2A6KB 5FDWB 3EYOB 1W8NA 4NZRL 5E5UB 4GOSA 3KPOB 1ZA6A 3GMLA 2FBJL 1GAFH 1CXHA 1FNFA 1MHHB 1MREL 3QXWA 5DJDA 3QULA 5HJ3B 4QYOB 3PP3K 4HC1A 1R5VB 4N9GB 3RI5F 3LV3A 3VXPA 4K71B 3K46A 4Y5XC 5MI0B 3OKNA 1MCDA 4WW2A 2F53D 1UM4H 2BVQA 5IEKA 4YK4C 4HQQH 1A2YB 1FG2A 3QIUD 4UZGA 4GRMB 5MERA 1CGXA 2ZWLT 4LAQL 5T33H 3CSBA 1LP9F 1LE9A 2ICEA 5K33A 4D0BA 4L8SC 4WFFD 2FRGP 3QR2A 1IEAA 1NC2B 4QRPB 5HVGB 1NGQL 1IL1B 3VFSB 4JPVH 1JV5A 4WGWB 3RGVD 2ICWJ 4KHTL 4QHMB 2R0LL 3NCJL 3ES6A 4LIQE 5EOQL 5E6ZA 5IB1B 2AJXL 4PRPE 3D5OF 1G9MH 3RWJB 1J86A 3CMOL 3V6OE 1YECL 1YPZB 4KQ4H 3BHBA 4O2CB 2EIZA 4NN6B 1F97A 1G9MC 3EAKA 3ZHKA 5ISZB 2BCKA 1ZT7A 4CVUA 2FR4B 1OSZA 35C8L 2RCSH 4NRXA 2C1OB 2RB8A 3DETC 1XEDA 4M1CC 2DQGH 2DQUH 3STLA 2JJUA 4ZUWB 4RAVA 4RWYH 2VXVH 4KGLA 2ICWB 1P4IH 4JY4A 4XP5L 3O2WH 1VACB 5KW9L 5I1DB 1PX4A 1TCMA 4ENED 1WBZA 2XWTB 3D85D 4RFNC 5CLWA 4H8WH 1VERA 3Q5TA 4WU5A 2JIXD 5F1NA 1R24B 3CVIL 3RX5A 3VXRB 3VFVB 3EDFA 4YBLC 5LAXA 1X5IA 3KGRA 4YHKH 1JZ8A 3LD8C 5ERWB 1QNZH 3ZL4H 2VAAB 3RWHA 3WDIA 3EFDH 4OFPA 3HC0B 1WWCA 3GJFK 1B0GB 3I02B 4WRLA 3DYPA 3IAPA 3TA3B 1J5OH 2UWEA 1GGYA 5CJXA 5FCSH 3BMWA 2WBJB 4KROB 4XCFL 1L4IA 2W0FA 3DTXA 5BVPL 3BZEA 4X6EA 2XICA 3HPLB 1MLBA 1UGNA 2GT9A 2XTJE 4HKBB 1KB5B 2FATH 3KLHD 1RJCA 3SKNA 4M7JL 3WFDL 5ISZE 3TBTA 4XMPL 5C0BD 4Y16B 2XQYG 2W91A 4XNYH 2EYSB 1K4CB 3JVGA 4Z5RA 5GRJH 3OXRA 5KZCD 2DB8A 5I30H 1IILE 1HHJA 7FABH 1CBVH 3BDYL 4HK0B 2ADJB 4JR9H 1WBYB 3QDGB 2R0KL 1P5UA 1C1EL 1JN6B 4L8SB 3U6RB 4UNTA 3BPNC 1XF1A 3ZTNH 4PJFA 3UPRB 3TO4A 3OKLB 3S96B 4OGZA 1X5YA 2GFBB 5ERWA 1C16A 2FHFA 3EO0B 4J3TA 4HUVA 2CLVA 1XMWA 1HHKB 4UIMB 5HGBB 4PFEA 5BQ7A 1UFUA 4PJGB 3THML 4OZIA 4FTVB 3MJGX 4Q6IB 5BO1L 5F88B 1U8MB 2R23A 4MXVE 1J5OL 4PJFE 4OZGE 4WHYG 2DKUA 5I18L 5D2LB 3ZE0E 3PL6B 4I4WA 2WBKA 4ZAKC 3BP5B 4POUB 1U8PA 2FEDC 5D1XC 2NY5L 1F42A 1LP9E 5JLZB 4XH2A 2GSIB 5D1ZC 4D9QD 3HCVB 4L8CB 4ODVL 4XCNB 4GW1B 2ZNXA 4K9EL 3CK0L 3L5XL 4GG6A 3ARDC 3C8KB 3VXOA 3OTTA 1ZTXL 3AXLA 1ED3A 2A9NL 5DUML 1BFVL 3D3VE 4KKBC 2NW3A 2X2YA 3MLXH 3D0VA 3IETB 3VG0H 3ARED 5I16A 5KOMC 3G9VA 1MFNA 2VDKL 1QO3B 2CQVA 3MRCB 4TNWF 4WI2A 4FFZL 5BRZA 4X98A 1Q0XH 5DD6A 4Z7WB 2JCCF 4ZUSA 4ZTOL 5I8KH 3AGVA 1TJGH 4F80A 3LMJL 3VMNA 2YD7A 3PF2A 3H9HA 1YA5A 5LGHH 4AG4L 3B8SA 3ARQA 2AK4B 4X5XA 3FCTB 4XH2B 4EIZC 1U42A 2IAMC 4OLUL 5HHNB 5TGBB 4Q9QL 5DLMH 4OF8A 2HJLB 2XOTA 1AO7D 4MD4A 2FH6A 4ODWB 1NFDF 2P8MB 3S97C 2VLKD 5F7MC 4GSDL 5A3ID 3N0PB 1BD2E 4ZS7H 1D5IH 4NQSA 3QH3A 4E9LA 4LAQH 3I2CL 2YA1A 2F19H 4NOFA 1KNOA 3GHEL 3PHQA 2GITB 1WT5C 5T1LD 1QFOA 4PJBB 5IQ7H 4WI8A 5DA4A 4Z7UE 5D70H 3B5HA 1JN6A 4I3SH 4H1LH 3QUXA 4UNVA 4NO5B 4G7YL 3Q5OA 5C0EA 4N0UA 1DQJB 4JDZB 4R96A 5IHLB 2IFGA 4WV1B 1FAIH 2YRPA 2Y23A 4LEOB 3QNXA 1CXEA 3TBTB 3RZCD 4YLQT 3VXRD 1F02I 1UWXK 1YC7A 3P4OB 3E2HC 1C08B 4IMKA 1EEYB 5I1IH 3ZKMD 3LZFL 5C0AD 5IK3B 2DQJH 1LP9A 2XQBL 4YXHH 2WP3O 4HWBL 5E6IC 4PRIA 4MJ5B 4I9WD 3TFKD 4ZOEA 5I17B 2AGJL 3H0TB 4KK8C 3JWDL 4NWTH 5DK3A 4H1LA 1YMMA 1CTNA 3DVGA 2AV1A 2VUOA 3KLSA 2AEPH 4LVEA 3MUZ1 4FQQA 1QVOA 4PRPB 4YUEL 4XMLH 4MDIA 3QFJB 2EDXA 4IM8A 4U05A 2XZAL 3ROOA 3LSOB 1DBBH 1BIIA 1S7RA 5GJTL 5FB8A 5HYSA 1HSBB 3KPPB 2BY3A 4B5EA 1QEWA 3QUML 4EUPA 5D2NE 4YQXL 2R56L 4HIXL 5KG9A 2CIIB 1MJJA 4IOSD 4R97C 3CFKA 4AQOA 1WT5A 3D85A 4F15B 1DR9A 3QG6A 4ZFFB 5C0GA 4HCRA 2WNGA 5JXAH 1WIPA 1HH6B 4AT6A 2AABH 2V2XB 1AY1L 3PGDB 5HI4C 1ZGLA 2P5EA 2BCKB 3HE7D 5EIQA 2ARJA 4HIXH 3FOMB 3S88H 3HNVL 2H2SD 3C09B 1HI6A 3SE3C 5T3ZD 4ZUSB 4QRRE 5C0JB 4AEFA 4OLWL 5DYOB 1K8IB 4JAMA 2Z35B 1YNTB 5D70L 1VKXB 5F7LB 1MFCL 3PWNB 3GKWL 1N4XH 2EYTB 4GBXC 3TBVB 1HH9B 1YZZA 1JP5A 3O2DA 2EICA 1E6OL 4AENB 1NUGA 1U91A 3PDOA 2RCSL 3B9KC 3OPZL 2C5DC 1FFRA 5HGAB 2UVEA 4JFFA 4KAQH 4POZC 3RNKA 2X4RB 4EDXA 1FVCB 3KXFE 3UBXA 3L3HB 2JJSA 4XTRC 1BAFL 1F4AA 1KB5L 3Q3GA 4KXZI 3X3FL 2OP4H 4EZMA 3MRBB 1I9EA 3CZFB 4HULB 5CGMA 3QCUH 5TFSH 3SDYL 3ULVC 1FFNB 2DMKA 2G75B 1JF1A 2H2PC 1OGTA 5TDNA 5I71C 2HFGH 3SO5A 1NGWA 1IC4L 4GRWE 3NFPB 4TUJA 3I3BA 4F7EB 3WFCH 4MNQA 3W2DL 4DVRL 3OKMB 1OTSD 5B39G 3LHPL 3SJVD 2FIKA 1BFOB 5E2TH 4OQTH 4UIMA 5DQDH 5BQ7B 5HGBA 2B4CC 4OFIA 2VH5L 4AM0A 3U7WH 1FVEB 1UCBH 5AAWA 1FNGB 4B50A 1M71A 4K7FB 1HKFA 2YD8A 3L5WB 3P4MB 1Q0YH 5IG7A 4ZNCD 4NJAH 5ELIA 4L3CB 1S7UB 4MA7L 1M7IB 3CDGA 2F8OA 3U2SB 2EYSA 3PWLA 2YD1A 5FUZL 1CICC 4R8WH 1YEHH 2MPAL 1D6EA 5GGRA 5IOPA 2AJYH 2FO4A 5F1IA 1R0AL 1N6QL 2UVFA 2KPNA 2BNQE 4NO5A 3EW3B 3KPSB 3VFUB 1E27B 1Z9SA 3DGCR 4PJIF 3TP4A 3S9DB 1A9EB 3U9PL 5F6IC 1HHHB 2NLJB 1FIGL 2AJSL 4QEGA 5GRWA 2HP4A 1MCPH 2C1PA 1YEKH 2IANE 1R0AH 5IBTL 4JDTL 3TNMA 3T0DA 4FZ8H 5DGQA 2APWA 4PJ8D 3D87B 3G6JB 3NFPA 4TUJB 5EC1B 2VABA 4ODWA 3ZYZA 1A3LH 1JWMA 4QXTB 4WO4A 1KIUA 3EOBA 1MFBH 4L4TE 3FO0L 1I85A 3V5HB 4JFXB 3DX9B 1SMOA 1YDPB 3U46A 2GJ6B 3F7VB 5C71A 5HI3D 4A2MA 3QCUL 5TFSL 4JPKL 4MNGE 1A4JA 1SJHA 2R4SL 3D39A 1RIHL 1M4KA 1KT2B 4WI5A 1MWAA 1WLHA 2VNCA 1FVCA 2APXA 1RZJL 3FOLA 1ZHBA 4HIEB 1WF5A 2AK1L 2UV3A 2YPKA 4X7SL 4P59L 3MLPA 4P46C 3C87A 1UJ3B 3MOAL 2IH1A 3ARGA 3LS5L 4YBQD 4NRYB 5JIHA 3HRZB 4H0GA 4LSPL 1H15B 1R3HB 3BQUB 3MRDA 4BKLA 1EMTL 5T3ZE 2VLRE 3QFJD 2CXKA 5EIIB 3RL1A 3T77A 4EI6A 3QI9B 2DD8L 4EDWL 1OP3H 4PR5B 5H2BA 5CP3A 5EU7E 2DI7A 4L9LB 4FQ1H 4OM0L 5ETUA 3GUTA 2VL5A 2ESVB 1BHGA 2A2QT 2J12B 3VG9B 4U0RB 4LU5L 1YEGH 4WTWA 4XWOC 2A73A 2FJGB 2ED8A 2VZTA 5BW7A 5EN2B 5IQ9B 5IBUG 4KKLD 4NNYA 2HFFA 5CLTA 5E00A 2WQRA 1BFSA 4P46D 1JWUB 5TJWK 5D2LA 4H8WL 5KS9B 1DN2A 3O11A 5F93C 4L3EE 4A2LA 3GK8H 4BQCA 3KLAA 3RAJL 3DI3B 3ROOB 2W65A 4M9PA 4U1KA 3IYLW 4LHJB 3NCFB 1DVFB 2BHZA 3SDCA 4X4MA 5A16B 1EGJA 4K94L 3F12A 4X6CF 5CCKH 3CX2A 1SVZA 1W0WA 3RDTD 3NVQA 2H45A 4ZFOB 3ABZA 1ITCA 1BD2D 4WW1A 5DJDB 5GGQH 1GGCH 3MROA 5AZEL 4DUXA 5ICZA 1J8HB 1TVHA 2ZJSH 1OAXL 1QKZH 1N64H 2WSKA 1F90H 1EO8L 2RIKA 2VC2H 5GHWL 2F8VA 3RPIB 2IF7A 4PJ9A 2AEPL 1IEBB 2BY0A 4WW2C 2IANA 3BDBA 5L8KB 3V6FA 1ND0A 1GL4B 4BSWB 4JRXD 2FO4B 3C09C 2MHAB 1JGVL 2JCCA 4GAGH 4LLAA 3QIUB 4MXWL 5SWZB 4KI5F 3MLVH 2X10A 2F54B 1VESA 1JL8A 5DA0B 4LLMA 5IJKC 1FN4B 2M8XA 1L7IH 1GPOH 2Y06H 3TN0B 1S78C 4WFED 3VH8A 2NCMA 1DBAH 2XWBB 3OX8B 1A7NL 3HE7C 3L3JB 5J4MA 5J89A 4FQIH 8CGTA 1KULA 4N8VA 4QRRA 1C5BL 3TVMC 1TPXC 5F6HJ 5F1NB 4JG1H 4FMFA 1XIWB 1NJ9B 4HUWB 2XWTA 3V95A 2VDPH 5E2VL 1T0PB 3LQAC 3N06B 3KPSD 1YQ2A 4XT1C 2A83B 5IMOA 5INCA 5H37G 1KC5L 1EVTC 3P77B 4QHUB 1BOGA 1TQCC 4P4KB 3WNKA 2C1OA 1R3LB 1TJHH 3RJDA 2BFVH 3BGFC 3FRPG 1I8KA 4GAFB 5I1GL 5C6WH 1SMAA 1TTFA 5FUZH 1RULL 1A4KB 3V2AR 4B7LA 3JTSB 3MTRA 2HWZL 3ARYA 5CFHA 3LKQB 3OR6B 1FGNL 4HJGA 4PJGF 5JXED 4U1HA 5TE6H 1A6ZB 1IAII 4QHMA 5E5MA 3ZKSD 5KVMC 5I8EA 3FN0L 1GVIA 1UVQB 3HE7B 2ID5A 3BVNB 2ZOLB 4NUJA 4QRPA 4YDLC 4X4XA 2HWZH 4WIQA 5AG8A 2DTSA 3LHPH 2ZKHL 2P46B 3AUVA 3J8F7 3PWPA 3LEYH 1XGTA 2IADB 1QOKA 5KN5A 3MGOA 4KJYA 1TZHA 3UEZA 4KK8D 3ALWA 4I3RH 3RTQA 3IVKB 43C9A 3LQZB 1VGKB 1T0NA 4WTZG 2Z91A 4AY0A 3M1BB 2NNAB 4I48A 1Y18B 5LGKA 4U7KA 3MXWH 1QEWB 1U95A 1BJ8A 5DT1H 3FT2A 5FA4A 3V6ZA 2PUQT 4ELMB 1KIRB 3UC0H 4FTVA 1OLZA 3PQYA 1LO0H 4HH8A 4LHUB 1MVFA 1CDIA 3QEQE 2DQCH 5B3JF 1B9ZA 4I9WE 2D7OA 4JFOA 4JN2A 5DJ8A 2JE8A 2OTWB 4XVSH 32C2B 2V9QA 4M7LT 3T4AB 3O6KH 3W82A 3UROR 4OZFH 2GAZB 1Q94A 1NGPH 4QOKE 3T8XB 4NFCA 4GMSL 3TJEH 5I71B 2XZCH 4IDLA 2OZ4A 1JYXA 3DX7B 1S9WA 3C2AL 1KCLA 3GBML 4KVCH 4OFDA 3VXMD 5F9DC 2CLRA 1MI5A 2XTJD 3H9SA 4NZUL 1UXSA 2XNAA 3CGTA 2VXUH 2OLDA 4HKJB 5EZIL 1G7LA 2AXHA 3CFEB 3DTXB 1CDBA 1TIUA 2Q8BH 2XTLA 3VWKA 4H88L 4PJHF 2BY2A 5DD3L 4WENB 2PCPA 1CXLA 2OP4L 5FGCB 3K4DA 1J05B 3EZ8A 4JR9L 3FJTA 4OF6A 3KWWB 3I02A 1BQLL 4PLJD 2KKQA 3TWCH 4YC2B 3VI4E 5IVNA 1AP2A 2IAMD 1JGUL 1FO0H 2VAAA 1UACL 4OCRL 4C59B 3T3PE 1JZ2A 1VFBB 4HF5L 4U2ZA 5E8EB 3I6KB 5I8CB 2IPTH 2R0WH 3RKPA 1FNEA 5ICXB 1S7SA 3LH2H 1TTGA 5DMGD 3GMPA 5DD0L 3IFNH 3ZDZE 4LLQA 5F7EL 3GKWH 3SKUD 5GS1A 2EZ0C 1P2CB 3GI8H 2HMID 1AP2B 4OLWH 3IU4L 4MJ4A 3CX5J 5E9DA 4Y4KB 5L9DL 4HWBH 2DWEB 2CDFB 5D7IE 1N2RB 2HFFB 1J05A 3DV4B 1OW0C 1GXEA 4J8RA 5I74B 1YEIH 3DX8A 2EKJA 4ZUWA 5HHNA 5TGBA 2GI7A 3S37H 5HDBF 5JHDA 4TPRH 1KJVB 1HQRB 4XXCC 1PEWA 2OMBA 5JDJA 3A67H 4U6VL 1LK3H 1QSEB 1LHZA 3AREA 1W0VA 2ZSWB 3HG1E 4MJIB 3BP4B 4QTHA 4UBDD 1G0YR 5D7IA 3N1PC 4FQ1L 3TGXA 4LLYA 1MELA 4JFQB 4HAFA 1EJ6A 1CD0A 4Y1AD 1AHWA 1D9KC 2ADIA 1B90A 5FAAA 4H20H 4ONHB 3SDXB 4OT1L 2OTWA 4KRPD 4OCLC 2VRAA 5D7SH 4ZS7L 4PJCA 2AV7B 3QI9D 4HIEA 5C0CD 2Q76B 1J0JA 1KCRL 4BFIA 2C7UA 3T0VA 4R4NC 3BRDA 5FXCH 2ICEB 2BRRL 2YSSA 4L4TD 2PYEE 5D7LB 3S34H 4K55A 3QQNA 1FG2B 5DZNA 3HC3L 5EU4A 3D0LA 3KJ6L 1BWWA 4Q9QH 4X4YB 1IARB 3CXDL 3I6GB 1C5CL 1J11A 3IDIA 4HIIB 2VDPL 4QOKA 5E2VH 1KJ2L 2R23B 4W4OC 3H9SE 3MLRH 4YHPA 2IADA 4UQ2A 1P84K 5C3LD 1ZT4B 3BKJL 5MEQB 4I8DA 1I1RA 4OZHF 3VA6A 1MUJB 5GSVB 5FYLD 1T1WB 1DBAL 2GTZA 2J3SA 3GMMA 3E3QE 3GSNH 5F6HI 2CMRL 2XTJB 1R6VA 5DZOA 1RUQH 5K9OB 2GCYA 4Z7VA 1EFXB 4DKEH 1FFPB 4LLWA 3KPSA 3MRPB 3MLXL 3O8XA 4HK0A 4HS8L 4XVUC 3X3GL 1NQBA 4FFVC 4F7MB 1M7DB 5DHXB 2UZXB 1SM3L 4P2OC 5DQJA 1EXUA 4NZRH 4JRYB 4U6YA 4KHXH 2HN7B 4XVJL 1X5JA 5JQ6H 3T0EC 4PRBA 3QA3A 4HUXB 2OI9C 2ENSA 5IVZB 3CXHK 3WXWH 3P9MA 4HJJH 5DQDL 3FFCB 1U3YA 2ZUYA 3GSQB 1FRGH 4NQEA 4QRQB 1ES0A 1DVFD 4JZJC 5DVKA 5LXGH 5F7YC 3GRWH 1YY9D 1U2CA 4LFHD 3ZTJH 1HOCA 2FIRT 5E24E 3O4OC 4RGMB 3ZDYE 1QLRA 5CD5D 4PY7B 5FECA 5SX5H 3LB6C 1HEZB 2V17L 1VFAA 3ROLA 5D9SA 3MJ9H 3GRWL 4OD2B 1ZHLB 5GSRA 4NZJA 5GRJL 3RNKB 1GHFH 1BBJA 2K9UA 4MNQD 3JVGC 1G9EA 2ZNWA 3IJYA 4KAQL 1JZ6A 1RZ7H 4U6HA 5KSUB 5GRUH 2IANB 4QRRD 3F7PC 1DBKH 3PWPE 4FFVD 1SVCP 2IBZY 2BZDA 1KJ3L 1YEDA 1QA9B 1A6TA 3QPXL 3DETD 1N8ZA 3NPSC 1OCWH 5J1AB 2O61B 2EH7H 1A3QA 3EOTH 4B0MM 3GB7B 1OB1A 4D9QE 3QJFA 4WU7B 2EEAA 4M1GL 7CGTA 5MEOA 3MR9B 4ZUVB 1GIGH 3T2OA 3ULSA 4NO3A 3MRGB 3ORJA 3LDBC 4P5MA 6FABL 5KANG 1KACB 3G6JF 2NXYB 1HXYB 2BJMH 2EE3A 2P8LA 5EU4B 1JGLH 5JMRA 2H26B 1GGBH 1CGSL 1EERB 2OJZL 1MJUH 4CGTA 3TN0D 2R0ZL 1BZ9B 3ARVA 1KENL 1BJMA 4YZFE 2QQQA 4KK6D 1EA9C 4G8EB 3GM8A 5DJ6B 4NUGH 4EXPX 4YIQB 4P5TB 1MCFA 3VGAB 4H1LB 4NFDA 2FHBA 3DXAD 4LSSL 3WNMA 3B83A 3KPSE 3ULSB 1TNMA 3LV3B 3VXPB 2PW1B 3O81A 4PB9L 5GGSA 3RI5K 1VA9A 1NFDA 1F58L 3EOTL 3WHE0 1XGPB 3S3SA 3IDNB 3RDTC 2X6MA 3MXWL 4TULL 1IGCH 1LP9B 1PDKA 2BSSA 1ORQB 2OZ4L 2ZSVB 4P48A 3LQMA 3RVXD 3INUH 4QT5B 5H37H 4XB8A 2PO6D 4WJ5B 3AS0A 4LRIC 3QXVA 3RKDD 3NN8B 1WCBA 4UV4H 4ZUUA 3OR7B 3T65A 4XCYB 2X9XA 2PO6A 4PJAF 3IJYB 2E8YA 3MV8E 4FTVE 1FAIL 4N0UB 4FRWA 4OD2A 5D8JH 1I3GL 3D39B 1EEZB 2BSTB 5E2WH 2X4UA 3MJ7A 4OGXL 2H41A 3VXUE 5IESH 2VDLH 1UKSA 3KYNB 4AMKH 1DFBL 4GFTB 5J56B 1ZLSH 2DLIA 3JTTB 4UAOC 1BMGA 1FORL 4LSRL 2VLJB 3FHAA 5I8KL 1EHLH 1IGFL 5ICYA 3RX8A 3IU4H 4S1DC 1HHGB 2OL3A 2YN5A 3L3OA 4WY7L 3MLZL 4IS6A 5SWQB 3BYYA 4NNXA 3TPKA 4MNHB 1FYTE 4LPCA 2DAVA 4JDVB 4QHLB 3TZVB 4DOHB 3CJJA 4LSQH 3MCLL 5DJYA 3HI5L 3MCKB 2HN7A 2OMNA 1EAPA 4APQC 3QO0A 5J9PB 3GRWA 3D18B 5L8JB 5HHVL 5HYQB 3GBNL 4FG6C 5B8CA 2YD2A 3X11B 5IIEB 4XPAL 2X89D 4F8TA 1C5BH 2PTTB 4R0LC 3MGAA 1P7HL 4M8QB 1UWGL 4UT6H 1OVZA 3LN9A 2ZUVA 2VLLA 1I8MB 2WANA 4M48H 1ZHKA 3G5ZB 3PWJA 3B9DA 2DLHA 1ORQA 2NY5C 2ZUQB 4L4VE 4Y2DA 5DD5H 5T5NF 1INDL 1OAYH 3P30L 4LKCA 3TT1H 4NKDA 2BVOB 1P7QD 5IM7B 2GJZB 3IS0X 3OKMA 5C0FA 4NQDA 2EXWC 2I27N 4O58H 4ZXBB 1N26A 3U4EB 4X4ME 3SGDH 4XP4H 3V0VB 1CL7L 5DSCA 4DN3H 5E1AA 1YJDL 4XNXH 5IMLB 2MJWA 3LQZA 4JKPL 1EO8H 5DMKA 1MQKH 1K5NA 4LL9A 2C4XA 4DZ8B 1KB5H 5KOVC 3UTZB 1U8MA 2GJZA 5C0FB 5IM7A 5I73C 3CVHL 4XCCL 3AU1B 4PJXE 2Q87A 4NKOB 3JUZA 5AZ2H 4KI5E 4JRWA 2GUOB 4K94H 5CCKL 3SEPA 2NY6B 3BPNB 4LKXA 3AAZB 3PWJB 1YNLL 3QUYD 5DFVC 2CH8A 1HXMB 4Z77B 1J88A 3DGGB 3WFHB 4LVNC 3IGAB 3O2DL 5KSVA 1RHHA 4JG0H 5D1ZA 2X4TA 3FQXB 4PJBF 1A6TB 4MS8C 1LO3L 3BO8B 5J13B 4HHAA 1R3IL 2VTFA 3SPVA 3WN5B 2WIIB 1MLCA 1HQRA 1KJVA 1BOGB 2QBWA 5SWZD 5ITFA 5BMFL 4QO1A 4Y4FC 2B7DT 4J3SA 3DNKA 3TBSB 3K1DA 4XHJC 3DX8B 1NUNB 3NFNA 2UWEB 1ZANL 2CDEB 1KCSL 2DD8H 3AB0B 4WGVB 2XZCL 1HSBA 5HYSB 2XZAH 2OXGA 5JW5A 3WIIH 4NBYB 4LHUG 3W11C 1UZ8B 4GBXD 1NCAL 1S7XB 5LVEA 3L95A 1QSFB 5TH2B 3IFPB 3GMRA 4GRLB 1LO0L 5HVHC 5DQ9B 3MBEA 5BS0A 1F2XK 1XGYH 3A6BH 1A6AB 5FGSA 2QQKH 3Q0HA 2X4NB 1T4KA 4XBPA 3T4YA 3STBA 1KPVA 2DWDB 1IEHA 2ILLA 4JY4B 4HUXA 3QDMD 4H88H 1WWWX 1ZS8A 4FQJL 1FGVL 1T5WB 1CG9B 3UBXG 2P24B 2AQ3A 3BPOB 1XZ0A 3U0WL 2VQ1B 3QUZD 1CLYH 4PGCA 1D7FA 1AH1A 3BN9C 5E08H 1KPUB 3V6OC 1M7DA 4L3EB 5HY9A 3X14A 2V5YA 3KG5A 1VPOH 2HAZA 5EUOA 4J3XA 5CSZB 2D7NA 5HHOE 3WLBB 5MENB 4OGYH 1A6PA 1NGYB 3U1SH 1L9NA 2J7LA 4DGIL 3TA3D 1MI5D 4XPHH 1MCIA 3WO4C 5CJXC 5JORB 5DVMA 1IL1A 1DANU 3P0YH 2P5WA 1AGBA 4RAUA 3VXSA 3OAUH 3SO3C 4LBEB 3DROA 3TO4D 1NDGA 3T1FB 3IT8D 1R5IB 1AXSA 3MNZA 5D1QA 1G7PB 4HGKC 4W4OA 3NABH 1FV1B 4HS6A 3UTZA 5C2BH 5D7KD 5IKCB 3C5JB 1RJLA 4JQVC 4QOKB 1FPTL 3SBWC 3RDTA 3ZE2E 5D6CA 4DZBA 1U41A 5D1QC 3BISA 3I9GL 2Z31A 5FOBA 2X9YA 5EN2A 43C9B 3IVKA 1QNZL 4UTBL 6CGTA 1FSKC 3FCTA 3SBWA 3G5XB 3QQ4A 3C9NB 4X83A 1E6JL 4NHCL 4Q6IC 2C9AA 1FV1A 4NKDB 2Z31C 3MR9A 3VDCA 3QUZB 4MSWA 1AFVH 2Y36L 2E7LA 5FDWA 2BHUA 4FQHB 3NZ8A 2YPVH 2EXYD 3QNYB 5FHBL 2LQRA 5JORA 5MP6H 1YEDB 1NLDL 5E5RB 3PGFL 1LMKA 2ATPA 4DOHE 4M48L 1R3KA 1AHWC 2F53A 3NH7H 1UB5A 3SO3B 1Q72L 4R7DB 5I16B 5EO0B 2VWEC 4GAYB 1XGYL 3A6BL 4WEBH 5AZ2L 4Y16C 3OMZA 4BK5A 3GFUA 5K93A 1C7TA 2X9WA 3AXLB 2DYPD 4UV7L 1EAJA 2Y07H 1W0VB 2DQTL 1EJOH 1J9CT 1MWAB 1P4BH 3EUUA 1U8KB 3MZGB 1YEJL 4GS7C 2XKUA 1KB9K 4LCCB 4JN1L 2IMMA 1FJ1A 3SE4A 3VXNA 3Q2CA 3MYZA 1E0OB 2X1QA 2H6PB 1RK0A 3CFJA 4ZFZB 4J8RB 1KXVC 4RNRA 3CFIC 4NNPH 5TPWL 1S5IL 5L2KD 4ODBD 3HMXH 4XPBH 4JZJA 1QR4A 1HKLH 4N0CD 4NQVA 5JOFB 3HNTH 2BOCB 4ZYKB 3BW9B 1LK3L 3DV6B 1WV7T 1XGUB 2EEDA 3RWGA 1RIHH 5F7KC 3EYFB 3F8UB 5I8CA 4JM4L 1E6OH 5KSAC 1GZPA 3RWFA 4J7RA 2NTSP 3FQNB 3IKCA 5CZVH 4G8GA 4M62L 1A3RL 4JFDD 3WJJC 3BKMH 5CKGA 5L9DH 4OF3A 2G5BA 4JHAL 4UAOB 3ZDXF 1T7WA 1H9VA 3QQ3B 1D6EB 5GRVK 5IOPB 3QIUA 3U36A 3NFNB 5AD0B 1CGWA 5FA3A 4UDTA 1JMXA 3MV7A 1Y6MR 5DRNB 4POYA 2EECA 5AUMB 3RVXC 5DRXA 4JO3H 4CMHB 5C6TL 4BM7A 5I6XC 3DVNB 4XP9H 4HPYL 4PGDA 3WN5A 4CVZB 4R3SA 5D7LD 3V5KA 2XNAB 2V9RA 1KIPA 2JIXA 4EBQH 4JKLA 5GGVL 2PR4L 2XN9B 2WINA 5GS2H 5DMJB 5HDLA 3EJJX 1LWRA 2YUXA 4NSKA 3N9GH 3LOWA 4HK3N 4FS0A 3KPNB 2DKMA 2J8OA 5EU3B 5FCUL 3UTTA 2YA2A 4KPHL 2YMXH 3ZTJG 1DVFA 3S6CA 2DQFA 4HFWB 4LGSB 4PJAE 3QP3A 1RZJH 2H1PL 1TITA 2H26A 4KZEH 3QDAA 4V1DD 5D7LA 2QQKL 2Y6SC 4QXUL 3KLHC 2IALB 4BYHA 2NNAA 3UBXB 2BVTA 4OCSH 1NGPL 4YK4B 1DUZA 4BFIB 4QNPE 2R29L 2XN9E 4NN7C 4KRNA 4PV9A 4QWWC 4HMCA 4Y16D 4ZSOB 4KJPD 4OF7A 3DUHA 4NFBA 5ACMA 1IGCL 1KLUB 4XNQB 5IR1A 1MRCH 4OFKA 2X1PA 3KPMA 2ARJB 2PYFB 4OV5A 1DEEB 5E6YA 4OZFA 1QSEA 5FUOH 5IFAL 3ES6B 4W6YB 1XR9B 1ZWIB 5CILL 4NRYA 4NDMA 5AYUL 3FQRB 4EN3C 4TSCH 2VOTA 1UACH 1MJJB 5IIEA 4PJXA 1ZHLA 2I9TA 2XA8L 2HTLC 5CEXA 2Z8VC 1I1FA 4HAGA 1JNJA 3VXTB 3TH4T 4N0RA 4YEEA 5DWUH 3O2DH 2R8SL 1F00I 1FL5A 4PBVC 1XCQA 2A0LD 3TT3H 1CFQB 4X99B 3FT3A 2G2RB 2ICWI 2R2CA 3MUGB 3UJJH 3M17B 4JFXA 4UILL 4JM4H 2B8OT 3LD8B 1DN0B 3HI6L 4TVPE 1J8KA 1KJMB 4E41B 4OCYL 3HAEB 4DKDC 4YQXH 2CRIA 1BECA 3FFDA 3BKCL 2BFVL 3L7FA 3GBLA 4HEME 4OZHE 2CPCA 1RK0B 3CFJB 2X44D 5FUCE 1OAQH 1NCUA 1EEYA 2NLJA 2Q3AA 3KYNA 1PQZB 3MRNB 1NEZB 1WGOA 2DBLH 4HBCH 1CI5A 3T0XA 4MNQE 1KLGB 5LQBL 1T0MB 2QQNH 3HG1A 2MPAH 3FO1B 3QEQB 3VGBA 3NBNA 5DURD 4XVTH 4WV1A 4AEHL 3VFPA 2PO6C 4M93C 5JW4M 1JPFB 4OTXL 2MQCA 5F71A 5I1HH 5F7FA 4RGOL 3BZFB 5EU6B 1FFPA 3R8BB 3MSPA 2ZG1A 2GCYB 4LSUH 1NBQA 1VENA 4M62H 2K1MA 3T8XA 5B3NA 1A14L 4NO2B 5T1KD 3KYKH 2NTFA 1T1WA 1T6WA 2QTEA 1WISA 1KTRL 4CMMA 3N50A 5E4EB 4G43B 3NZ8B 4CW1B 3BT2H 1IRAY 3OAYH 1F4WL 4PBWD 2APVA 3HI1A 4BZ2H 5MEQA 5ADOL 1BBDL 5C07B 3B8YA 2P47B 3WYRA 4BQBA 4FQXD 4FA8A 4IRZL 4X9GA 1W0WB 2XZZA 5KBNC 1JRHH 1X5KA 5L8LB 4I3SL 1JPTL 3V0AC 3FN0H 3ULUF 2IGFH 2NX5D 2Z31B 1OTSC 4O02L 5FOBB 3LQAL 1BM3H 3V0WH 3QUZC 3I6LE 3NAAH 2KDGA 3LKPA 2IAMA 1LD9B 5E4IA 4HUMB 1UM6H 1VADB 2MCPL 1RUPL 4J3UA 4LSTH 4HC1H 1JGDA 4G5ZH 2ZJSL 4LDOB 1ZVHA 3WCYA 4DGYH 1F4YH 3MYJB 2DI9A 3UTQB 2X4PA 4JO3L 4TTGA 2R4RL 3MRGA 5I8EB 4JY6A 3VFWB 1ZWIA 1XR9A 1KELH 4DK6A 4D9RE 5I66B 2AGJH 3G5VB 3DO7B 4OF0A 1RIVH 3JWOL 5DYOA 3WL9A 4XNMB 1BX2A 1T2QH 1CICB 3TBWB 1YEFH 4HDIA 3S36L 4NKMA 3FOMA 3JWDC 1LO2L 2DS4A 1KEGH 3KHOA 5ESVB 5DR5L 4UOJA 5F7DA 2QQLL 3CC5A 2R9HC 5MEND 3HZMB 3SCMC 2R56H 2DWEA 3K3QA 4OKDA 5C0CE 3WJJA 1S5IH 2YEZA 3U7YL 5KJRL 1RFDL 1DLHA 5LG1A 1WCQA 1YY9C 1G7HA 5D96B 4Z7NF 1QLRB 4H25A 1TJIH 4LVHB 3TNNB 5T5FH 1PY9A 5CD3A 3DVGB 1LGVA 1YMMB 4NQTA 3EO9H 5CIPA 1L0QA 3B9VA 4RRPG 3K74B 1CE1H 1DBML 1CYGA 4U1NA 2HJKA 4GS7B 5J0BA 4PRIB 5TF1H 1V7MH 3N1QC 4OUUA 5EIVA 2BY1A 4XB7A 5HD8C 3O41A 2UUDK 3TBSA 5CS7A 5INDA 4JFDE 3G08B 4U1LB 4P2OD 4N5ED 4XP9L 1NCBH 2AEWA 4XMKL 4NIKB 3QSKB 1T1YA 5IVOA 2MSPA 3FRUB 4PJ9B 2DM7A 3FQXA 4K23L 2F5BL 4OUUB 4TUKL 4F7PB 3N9GL 1MFAL 3MBXH 4Z0XB 4OZIE 4YHZH 4YHOL 1RJYA 4YFLI 3S35L 3DGGA 5SV3A 1XF5B 3KYOA 3SE8H 4FFZH 2NR6C 1PG7X 1HYSC 4Z7VB 5ICZB 1FIGH 2AJSH 1M71B 3CFCH 3IDMB 4PRAA 1X5GA 3ULUL 5DD0H 1KJ3H 4Q0XH 1C12B 3ZYOA 1CDGA 4PG9A 2B1AH 4ZO7A 3QH3B 5FM5M 4CNIB 3HB3C 4OLXH 2WV3A 1XH3B 4U1KB 2D7PA 2BOCA 4AEIL 2YPLB 4ZYKA 4BA8A 3WSQL 1U95B 4XRCA 1CFTB 4Q9RL 1RUPH 3QUYB 5F7NC 4JRYD 2E7LC 3B2UC 4OT1H 1T0NB 4L9LC 4TSAL 4OLUH 5HHMB 2PN5A 4HG4J 2VL4A 4UT9H 3B9KA 5E9DE 2WLZA 4ELME 3KNBB 4Q2ZA 1CR9L 2E6JA 3BGMB 2Y25A 3PJSB 1F8TL 1SBSL 4MWFB 1M1SA 5ITBH 1NSNH 2ESVA 4WVRA 1NL0H 4RMVA 2FECL 2J8UB 1AGEA 2Q6WB 2X05A 3WL9B 2DBJA 2F74B 2JELL 3SJVB 4RGNE 3U0WH 3IDJA 5EO0A 5ID1A 4X98B 4LFHG 1I9IH 4HPOL 4X6CA 3SDXA 4F37F 1A6VL 1E4KC 4EI5D 2X7LB 3LKQA 2IH1B 5F72S 4KHXL 1AKJB 2GEEA 2XV6B 4NQDD 4ZD3L 4UT6L 4X8XA 3QBTB 3U30C 1ZHBB 4GBXB 4IMLB 3AREC 3D18A 4XBEL 1WWAX 3QEHB 3X3GH 1FLRL 5C0RH 4ZFFA 3LRSA 2GSIA 3TN0C 3QXTA 3KNBA 3WLWC 4P4RB 4I0CC 3M45A 4J23A 4FQXC 2BVQB 2ERJC 4RMUA 2MMXA 3QDJD 1A7OL 4WO4B 1ZAGA 4NYLB 5JR1H 4JFYA 2I60L 1MFAH 3MBXL 1QSFD 1P2CA 4ODHL 3HR5A 3TT1L 4UU9B 1KV3A 4HS3A 5I1AA 3HI1B 3RVTC 1ZVYA 5DVLA 3GSXB 3GSWA 3GZKA 3RWDA 1UKQA 2H3NA 4L3ED 1AGBB 4DKEL 2C3VA 4P2QA 3HMWH 2OK0H 4U6TA 1A9EA 4IRSD 3MUY1 4C56D 1FL6A 3C6SA 2Y06L 1OAKH 4K3HA 3QDME 3F7RA 3W5NA 1UZ6E 3BZFA 3VFUA 4N8CH 4ALAL 4JO4L 1U3HD 3ZE1F 4GMSH 3TJEL 1RULH 4L8BB 4M02A 1U6AH 5EBLA 1C08A 2DL2A 4GW4B 4Y1AE 2DM2A 3QUXC 4GMTL 3O8XC 4HIHA 3LKRB 5HHOD 2FL5B 1NBYA 4HKJA 4JPIA 1FHGA 3UC0L 3UYRH 4QRUB 4R96B 5C2UB 1JHKL 3SKJL 2DOCA 5M95B 3BN3B 5IVXB 3MRLB 3ZYIA 4MHHG 5DJAA 1EHLL 2GAZA 4RISH 4QTIH 3V7AE 4YR6A 3EFFA 1IJ9A 3BPLC 2N1KA 1R3JA 3K7UA 1MAKA 4XP1H 1PYWA 1JZ5A 1V3LA 3C60B 3QDJE 4DEPB 4H25B 3CLFH 2UZYB 3NIGF 4PJEB 4XAKE 5A2LH 5ESQB 2DLFL 3P9WB 5C0AE 5GS0C 3V7AG 3KDMB 5J6HB 1KCSH 4RRPA 4JM2F 5F3BB 4K3JL 4M5ZL 4X7FC 5B39A 4FQLH 4NHUA 1ZHNB 1N5YL 5GS2D 4XP5H 1P4IL 2B5IC 1A1OA 3UPCA 4JB9H 1G7JA 3FQUA 3BXNA 1NAMB 3PHSA 4ZAKA 3U0PA 1U91B 3PDOB 3H3PL 2VAJA 5CD5C 1Y0LA 3O4LD 4WFEE 2BDNL 4L4JA 1MJ7L 5ID0B 1U8HA 1CD1B 3I75A 1OB1B 1T2QL 1Z3GL 3GB7A 2D0HA 1YPZA 3SOBL 4BZ1L 1BX2B 3DIFA 4XNMA 4B7IA 4KY1H 3UTPD 3WFHA 3RVWD 2JJSC 5I1LA 3OGCB 3ZHDA 5ACZA 1WUNT 1D9KA 4CJ0A 5ID1B 3LS5H 3OR6A 5E1HB 4AG4H 3VMOA 2J2ZA 3UDWA 4NN5B 2H8PB 2FZ3B 1WK0A 2CKNA 2J8UA 4UV7H 3R0NA 2HVJA 4NHUB 3TWCL 2NYYD 4MWFA 2ZPKL 1R3LA 1DBJL 3C2AH 5FB8B 3MC0A 4L4VA 4MDIB 2GK0A 4QXGH 3ZKND 3BP5A 5IVXE 5C07D 3KHQA 1SEBA 3ZHLA 1AE6L 3U4EA 1WAAE 1Q1JH 2LABA 5CEYA 5IB4A 2O5XH 1ZLUK 1K3IA 1NL0L 4G6AD 4DVBB 4L8DA 3SDDD 1DQQA 1ODAA 3EYUL 2GJ6E 4OD3H 5L7XL 1JZ3A 2Z8WC 3RFZC 1OARL 4HJJL 3IXTB 5TDOB 1I1YB 4GAJL 4L4TB 2DBLL 4Y4HC 3F7YB 2APTA 2Y5EA 2YRZA 3BIKB 4MQ7A 4NO0D 3TN0A 1D3CA 5IROA 2CSPA 3DSFH 2FL5A 4JCMA 4PRHB 4ZO6A 4KJWD 5B21A 5I1KH 2ORBL 3QNXB 5L7XH 3OAYK 1MWAL 3OF6A 3U2SA 4Q9CA 2VR9A 4MA3A 3LEVL 1T0MA 2CJUH 4GRWB 1EEQA 3P4MA 4UILH 4XXDA 3LIZH 1RV6X 1W72L 1FL6B 2W0FB 1MCOL 1NLDH 1OAQL 3MRNA 5DMYA 4L4TA 1S9XA 4Y19E 3R1GL 2H3NB 3QRFM 2HMIC 4XNZB 1REIA 1S9VA 5I9QB 5DWUL 1U8OB 5D72H 4M7LL 1ZKAA 5AEAA 1Z9MA 2R1YB 1VHPA 1G7QA 1PBYA 1INEH 2NXZB 3WFDH 1C5DA 1YEGL 5C7XL 4GKZB 2Y72A 3VFVA 3CXDH 4DWHA 1OL0A 4Y4FB 2VZVA 3MODH 3D3VA 2DQIH 1I3GH 1S9YB 4PGBA 1EV2E 3CU7A 5GGTH 1QBLH 5KS9A 3L3HA 2P45B 4TSBH 1VACA 1EVUA 2I9TB 2EDKA 4Y4HA 1CDJA 4Y5VB 3RIAK 5ENWB 4QOKD 3STLB 4LCIH 4XCYA 4IOIA 2BNUA 5FKPB 5LKNA 1RUQL 4XPHL 2XTJC 3MJ9A 3L3IA 2EC9T 5TE4L 2VL5B 4RFEB 5ETUB 4TSBL 2VERN 1NH6A 3V4PL 5FYLL 5K9JL 3EYUH 4OD3L 4WV1C 3W9EA 3NIFE 4LPTA 1OTUC 4Z7QF 1U8HB 4IRSA 1GRWA 2ADFL 2WWMC 2NR6D 2V2XA 3GO1H 1TDQA 1JTOA 3PE9A 1NFKA 2AABL 3BGMA 4Y2DC 4N1HB 3OKKB 5ENWA 1G7JB 1GOFA 1I1AC 2AS5M 2HRPL 3U0TB 4OZ4B 3BE1L 1YYLH 2XWJB 3UTOA 4P9HL 1MJUL 4QLRA 3OXSB 2EE6A 3QZWG 3QCVL 5A2JH 5K9QI 4K94C 2WQ8A 4HWZA 3U7AA 1MIEL 4R4FH 1A2YA 5KTEL 3GI9H 3O3BB 2DICA 5EOQH 4C54A 3QIWA 1RJZB 5JOPE 1KELL 4HFWA 4NQXA 3RVWC 1W72H 2YK1L 4FFYH 3I6KA 2YPLD 5HHPB 2NY4B 1OT1A 1IGJB 3TO4B 3JWDH 4M1GH 3IDMA 3T0EA 5FO7A 5IHUH 2KBGA 4LPVA 4NC0B 5I9QC 4KQ3L 3DBXB 15C8H 2BP3A 3LN5B 2F58L 1KCVL 4PLOB 1FQ9C 3WIHH 3P4OA 1KB5A 3AC0A 1NFIA 3DO3A 3FRUA 5L0QB 4MJID 4R2GB 3H3KA 3DURB 3QHFL 12E8L 4OLZH 3V4VH 5C0AB 2DM4A 3S36H 4PJEE 3H9SB 4RZCA 2XQYK 5D2NA 5T1LA 2K3TA 1OAYL 2OR7A 2EYRA 3U36B 3JWOH 3TA3A 3UZQA 5CEZH 2HJKB 1KJ2A 5IG7B 5I15H 2O93L 4ZFGL 5TPWH 2FGWH 4Y5VC 5F8RC 3IFPA 1GZPB 4LVOB 4YDVA 5C0CB 3ZT7A 5KZCB 1DBJH 5B4MD 1T1XB 3HNTL 1FRGL 2DQCL 1YNKL 4UU9A 2EDYA 1FO0L 1ES0B 1OTTC 4M5YH 1KEMH 3AS2A 4PJHE 2NY4D 2WLYA 1TQBB 3ULUD 2H2PD 2Y5TA 4Y1AA 1BQLH 2JB5H 3VD4A 1RMFH 5DEGA 1ZLWK 3IAGC 1G9ML 2E3VA 4ZS6D 3M17A 4Z7WE 2VISB 3NFSH 3RWCB 3O4LE 2HLFD 4LSQL 4YEFA 3V0WL 4L3AA 3S36X 2EDRA 4JY5H 1UH2A 3IRPX 3CC5B 4LSPH 3VRJB 5JZ7D 1IC7H 4MLSA 4KI1A 1B4JH 2R39A 1FJ1B 2ADGA 4POZD 4OB5H 3OHXA 5ESVA 1QFWM 5FYLE 1PG7H 5BS0E 5JUEH 3NCBB 2APBA 3UZEA 4P57A 4N0UE 5JMOC 1H8OA 2BRQA 3MREB 5TE7L 1KCUH 2W1NA 4JPWH 3CZJA 4U1GC 1CVRA 5JZ7C 3TV3H 5E7FA 4FQ2H 3LDBB 4RGND 1ZLSL 4PJFF 2DMBA 5CEZD 3R06B 2CMRH 1A0QL 1Z5LB 3FRPA 4YFDB 1MFEL 2HH0H 4M4RA 3P3YA 1A6ZA 2QLVB 4JANB 1KCVH 3RGHA 2NY4C 1OD9A 1YNTA 2IPUK 3QG7L 3ULUC 3I2CH 2R8SH 3QUMH 3TZVD 4Z7VF 1CLZH 3JTSA 5DK2B 3WKML 5IR1B 4K8RL 1BVLB 2DTMH 1CVSC 2Q7YB 3V4UL 4AEHH 4S10A 4XVTL 4D8PB 1UKTA 4FZ8L 4UQ2B 5H8DA 4JFEB 1RU9L 5MERB 5DRZB 4UTBH 2NZ9C 3MRMA 2B0SH 5JDSA 4NWTL 3EOYG 3IDXL 2EDJA 4HKZA 2X89A 3MLUH 3INUL 1WZKA 2VISA 3GSNL 4DZBB 5F1KC 1H5BC 3MV9D 2X1OA 1O5DT 3HRPA 1IGFH 3O3AA 2BVYA 3QYCA 4A6YA 5GS1C 3QRGL 5HJ3A 1XH3A 3BI9X 4PJEA 1PG7W 4O2EB 4WUUB 2C7UB 2O5XL 2WZPD 3MRRA 2J6EL 4F8QA 1ZXQA 5FKAB 4LSSH 4ELKA 3PL6C 2BVUA 4UOW0 2ITCB 1LE5B 4Q6YA 1X5HA 1CD8A 3HUJA 1NGZA 1PVHA 5F96H 3WDHA 1ZEAL 4NO2A 3P2TA 5I1CH 5KVDH 5HYFA 5CUSL 1Y6NR 1V7ML 8FABA 5TF1L 4C4KO 4Z0BL 5H35B 3ZMRA 1KCKA 5T1LB 4RZCB 5D2NB 2XA8H 3X11A 4EQ2A 1KLFA 3FB6A 4GAGL 3VWJB 4CU7A 1ADQH 2XRAH 4X6EB 3EBAA 4OZGF 3LKRA 4HIHB 1BQHB 3VGEA 1B4JL 1NAMH 2OXHA 1JYWA 1IT9H 2F53E 1I9RL 4RQQA 4NQUA 1A1MA 3F62A 4ODHH 4ZDHA 3HPJB 4FQCL 4YAQB 3QQ3A 3MNWB 4OFYD 3L1OH 3GNML 5ICYB 4KMTL 1H3VA 4PGEA 2D9QB 1CFSB 5TQ2L 2AEQL 3QZWA 2CK0H 3DI2B 5EFIA 3QXUA 3WUWB 3RWHB 4JVWA 3VG9C 3FZUC 4GG6F 3CIQA 4YO0A 4BH7A 2D2OA 1NKRA 3R0MA 3MNVA 2B1AL 3IDGA 4RDQG 1OPGL 1RJZA 3RA7L 4P2RD 3LEXB 1X6LA 5IGXH 2ZCHL