5D7JB

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB02
4WHYH 4NRXB 5DC4B 3AREB 1CIDA 3W11D 4D9RD 4YX2H 1AP2A 4LLDB 2HTKD 3QRGH 1PX3A 1CD1A 4R4BA 4CVZA 1QLRA 25C8L 2AK1H 4PJXB 4YJZL 1W0YT 4X83A 2BVOA 1RZGA 3OKKB 5D7JA 5ANMB 5EWIH 1EO8H 4LASL 3BP6B 4JKKA 3FTGB 4P3DA 4WO4C 1T0MA 1AGFB 4MX7A 4UDUB 1A5FL 4JQVC 4X5WA 1N8ZB 3T0AA 4KRPC 3N1MC 1DVFB 2IQ9H 5SV3A 1J5OH 4U1HA 3QA3B 1NGWB 4O4YH 1ZVSA 3VFVB 1ZT7A 5KN5B 4MDIB 1ADQA 5BRZE 4GKZB 4PJFA 1P7KA 1U93B 3R0NA 4QTIH 4LCWE 5I16B 1IGMH 5I30L 5KVEH 4MAYC 5KOMC 3VDCA 4DAGH 1JNLL 1BQLL 2XZAL 2X4TB 1QQDA 4F2MA 2C1PA 3VGAC 3EOYG 3LDBB 2VLRA 3LPFA 3QSKB 1CD0A 3JWNC 1A3RH 5SWSB 5LAXA 2OJEA 1J87A 4XC1L 4NO2A 4QHUB 2NY3C 1XF2A 4XVJH 1MWAL 1C5BL 1XIWC 2IGFL 4QRPD 4ZUTA 3ES6B 1YMME 3ISWA 3Q2CA 5HI5D 1E28B 4ONGL 4NGHH 1L0YA 5ESAB 3NIDF 3VFMA 5DJ0B 1OVZA 3D2UB 2ICWJ 4BFGA 3F6IA 1H0DB 4A6YB 5DUPL 3BI9X 3KXFE 1IGIH 3VFSA 5MENA 5DRNA 3TP4A 4GXUN 2R2EA 1RSFA 3H7LA 5FM5M 3ULVL 4UB0L 3EYFA 5C0BD 5L6YH 3MRCB 4KK9C 1X6LA 1ZLUK 4GRLC 2FX8H 1XGTA 5D9SB 1G7JB 4KJYA 3RWJA 2BERA 3LKQA 5C0DA 4UBDC 5F72S 3KPSE 3KLAB 4Y88A 1CIUA 3RNQB 1IRAY 1CDJA 2R0KL 5KS9E 3LKSA 1ZKAA 3WV0A 5GSVA 3OXRB 4QHNA 3UCRA 3IDNB 3ZDZE 4JFOA 1C16A 4XP5L 5E1HB 5DVMA 5B3JE 3IFPB 4UU9B 2PYEE 3MV8A 4QOKB 3VCLA 3HFMH 1Q9OB 2Y06H 1Z3GL 3LEXB 2WIIB 5GS0C 3QJFB 4WY7L 3L6FB 1MCJA 1P4IL 1Q9LB 1LGVA 1HNFA 3R4DA 2FGWH 3WN5C 1J18A 5JW3L 2A6DA 2HTLC 3DSFH 1DLFL 4OLVL 3VU2A 3L3GB 1XF3A 1JGDB 2P47B 3ARDB 5JXAH 1Z9MA 5E6YA 2X4OA 3MLXL 1I1RA 3HMXL 3FONB 2VXVH 5BMFL 5EIQA 3SDYH 2Z91B 4QXTA 1XH3A 2R1XB 3E2HB 4ODSH 5I1LA 3S36X 3RBSA 1N5YH 1V7MH 4H0GA 5CJXA 3FB8B 3VD3A 3KPTA 2LU7A 4RWHA 3WHXA 1JFQH 2PTVA 1NUGA 1WZMA 1I8IB 5DEGA 3STBA 4NQXB 2Q7YB 2YRZA 5F7LB 3BW9A 4YHNB 4JDZA 3FRUA 2XFXB 1MHEB 1U0QA 1ZSDA 5FYKD 5HYIA 4Y19A 4ZSOA 1WIOA 3ME0A 4G3YH 1BGXL 5FA3A 1D6EB 4GQ9L 2R29L 3QG6B 1S78C 4KI5F 3J8F7 1G6RA 1M71B 3MNVB 2AEPH 3ARGA 3K7UA 1LP9A 1ZOXA 5F3BA 1YN6A 4FQJL 3HE7C 3QXAA 5DJ8B 4X6EB 2ZCLL 1EDQA 1NANH 1TTUA 4G43B 1H5BA 2EH8L 3VJ6B 4WJ5B 4YXHH 3DBXA 4APQD 2HT2D 4JGUA 5IW3A 4MNHA 3BKYL 4BQ6A 1FL5A 3HE6B 1FN4A 1NCWH 1S7SB 4JN2B 1MFBH 3RFZC 1MFEL 3BKML 1A9EA 2JIXD 4PJHF 3HRZA 3MV7B 1K5NB 2FJGA 4U1NA 1JMZA 3V6OE 4QRRE 4AH2A 4KZEH 3V6FA 4UIMB 4TULL 4CU8A 2LAAA 2PN5A 1KGCD 3GO1H 4YNYA 5A16A 3BQUB 4R4ND 3KWWA 4JE4B 1A4KA 1CU4L 4OZ4A 4XNZC 5IT2L 4PRHE 3U0WH 4XMLL 5D8JH 3V5HB 4HZLB 1DANT 3T2OA 5DF0A 1AO7B 3UO1L 2V7HA 1IGCH 3JV5A 5E99L 5HGDB 1K2DB 1UM6L 5EFIA 2PKDA 3MRLA 2ENSA 5E8EA 5DJ6B 4LSDA 1NCNA 2GFBB 2GJZA 2EDRA 4KVNH 1TITA 2W0FB 1EEUA 4CMMA 2QSCL 3B9DA 3RVWC 1CE6A 1L7IH 1S7UB 1M4KA 2D03H 2NY5L 2Z35B 4QRPA 3U36A 4IRSA 5F44A 3VFGL 3S88H 3WNKA 1GXEA 1ACYH 3UZEA 4UNUA 3BPNC 2ICES 2W65B 4DOHB 4JZOA 1PG7L 4DTGH 5F7EH 1F4YL 4JVWA 1ZHNA 3HG1D 1MCRA 4F7PA 1RHFA 5C0RL 3BESR 4PJ8D 4FXGA 5DTFA 5I73C 3QI9A 4DEPB 1EMTH 4X98A 5TH2A 2YA1A 2WZPD 2HJFB 1E0OB 3O9WC 4YK4C 3TF7C 4YX2L 4H8WC 1FZKB 2YPVL 1INDL 4KRLB 5C0BA 4HZAA 3T0EC 3S8WA 3KYMA 2AK1L 4NP4L 1SYSA 5EWIL 1LQSR 3DX8B 1IGJB 3S35X 3EZJB 3LKRB 3GSNA 3IJSA 3U9PL 2EDTA 1AGBB 4OBSA 1OM3H 2AXFA 3SJVB 1I8MB 5SX4H 2IQ9L 1ZLVK 4NKIH 3IS0X 1J5OL 3RAJL 4MA3B 4O4YL 4WFHD 4Y4KC 1HEZB 3RVVD 2GT9B 3I6KA 4QTIL 1A1MA 5DMGC 2GTZB 3JTTB 1IGML 2KBGA 4OF0A 1G7PB 4DAGL 5C86A 1N64H 1KTDA 3THML 1J0HA 3OHXA 5MEPA 4F9PC 1TDQA 1WWBX 2BNQD 2Y6SD 3S37L 2CIIB 3UMTA 3OX8A 4ZUUB 3CSGA 4PV8B 2I27N 2FIKB 5C08B 2DLFH 1OARH 4ZFFB 5L9DL 3R06B 1M7XA 3U0PA 5M94B 3KPQA 5B21A 3SDCC 2E9IA 1FNGB 1UVQB 1MCDA 1JPGB 5HHOB 3BKCH 3QXUA 5HYFA 1GGUA 1U58A 5EORL 2DQJH 3AGVA 3CC5A 4HJ0D 3BZFB 4JGJA 4X4XB 2JELH 5BZWA 5T1KA 3MBED 1FC2D 1DE4A 3DUHA 2UY7A 5IOPA 3N9GH 3KJ4C 2H9GB 5FYJU 1I1FB 4AG4H 5L6YL 4HS8H 3FO2B 4HXAH 3RTQC 2FX8L 2RFXB 3V4UH 1JE6A 4R2GB 4XMKL 1W0WB 4Y0GA 1BX2B 2CLZB 5D70H 3JV4A 4M03A 1YEFH 4HBCH 4YHYC 1X5GA 3QFJE 1YC8A 2FECL 4PFEA 3D18B 4I3RH 4OIBA 1B0GA 1H15A 3ZE0E 5J7CC 1S7QB 3CXHJ 2AJ3B 4CVUA 4GG6B 4PJGB 3IFLH 3HMWH 5JR1L 4BKLA 4FQ1L 1N59B 4E41B 4LCYB 2V2TB 4M1DH 4Q0XL 2Y06L 3IETA 1UJ3C 1E27A 1LO2H 5GGVH 1B2WH 1NC4A 1I7ZA 4G8GD 5GZNC 3O81A 4OLYH 4APQA 4NRYA 1IM3A 3PWVB 5IK3A 2DBLH 4IHOA 2YD3A 5C92A 2LE9A 2EDJA 1D5BA 1UWEL 3AB0B 4B53A 5JXAL 1WFUA 2A38A 4Z0XA 2HVKA 2JIXA 1CZ8H 3I02A 1BPVA 3WFEL 1DBBH 4CUCA 2VL5B 2HRPH 4YXLH 1KC5H 1V7ML 1N5YL 3PQYE 5JPNA 3K74B 4M3KB 3RWHB 3AMKA 2J8UA 1KYOJ 1MVUB 2FJHB 5HHNA 2HJLA 2K3TA 5DRXA 3WXVL 1NDMA 4FA8A 3TA3B 1U41A 1G7IA 1MWAA 3DX7B 2BRRL 4L4TE 3ZTNL 2F53A 3D87B 4G3YL 5IR1B 3P2TA 2V2XA 4I0KA 4NN7C 5H8DA 2G5RA 3OZ9H 4UUJA 1HK6A 4LPTA 1QRNE 4YWGH 3S36H 1T1WA 2AEPL 3QPXL 5I71B 3IDXH 4UDTA 5E1AB 5I8EB 1FFPA 2VLLB 1LEIB 4U6HB 2BDNL 4CMHC 3T2PA 2J1KA 5IGXH 3EJYD 1M7IA 1UXSB 1MJJA 5EOQL 4NC0B 3VXMD 4RQQA 5JXED 1P1ZA 4KPHL 4PRIB 2CMRH 5ISZE 1A6AB 1D9KB 1JUFA 1UA6H 2FX7H 4XVTH 5CJOH 3GBLA 4KHTL 2DDQH 3PP3H 1MFBL 4JZJC 5F8RC 2VQTA 1ZT1B 3U0TA 5I6XB 5DURD 4FN0A 3MREB 4W70A 5IQ7L 1ZE3C 3ARBB 4N9GA 1RD6A 1UZ8B 4NFDA 1SBBA 3TT1H 4BELD 3UJTL 3UTPE 1HSBB 3GO1L 4UAOC 1P4BH 1V3JA 4KVCL 3MOBL 3VI3F 2O61A 2R0ZH 1S7RB 5C71A 3CVHH 4OQ1A 4KV5F 1CLZH 4NBYB 3SKJL 1UG9A 2MWCA 1K85A 3MFGB 5DMKB 3M8OL 4PLJC 3EIFA 5E08L 1WZLA 1IGCL 3RZWA 5HJ3B 1S7XA 1NBYA 4JFYA 1WZ1H 4KJPD 3ZTJH 3HMXA 1IBGH 1NFDA 1HQRB 4JVUA 5IVXB 3P30H 5C6WH 4HK0B 5D7IF 4OZHF 4LLMA 2EIZB 5HYQA 3QG7H 5AYUH 4WFFD 5J6HB 3BUTA 1JYWA 4JFXB 2X4PA 1FL6A 4F37K 2D03L 1PYWB 2JK5A 3K2UL 3NIFF 1UXWA 2MQCA 3T3PF 1ACYL 1MNUH 3MZGB 3IU4H 4HS6A 5BW7A 2CK0L 4EIZC 1CLOL 1RZKL 1KPRA 2P8MA 5INDA 3DVNA 2BSSA 4TYUA 4V1DB 4RZCB 3UBXG 1YEHL 8FABB 4LLYA 3RWEB 2IQAA 4EI6A 4NQSB 2ITDB 3I6LE 4GAJL 3MBEA 2QTEA 2Z4QA 4QHLB 4KTYA 3VMNA 2VZUA 12E8H 3NTCH 2P7TB 1MSPA 3TT3H 2R1WB 3WE6A 5D4QA 1AXSA 3R8QA 4H20H 5B38B 3AAZA 5EO1A 1KXVC 1W0VB 1CD8A 4TUJB 3ULSB 2R2BA 3L5WB 5EC1B 4FNLL 2DQHH 1JN6A 3STLA 3TH3T 4J4PD 3TBYA 4HGMA 3RU8L 2IANB 4BZYA 3BH9A 4PJ7B 4N5UA 4WI2A 2HRLA 2MHAB 5SWQB 2DQDH 1LEGB 2Z8SA 3QNYB 3U82B 2BVPB 4P46B 4QHMB 1PDKA 3RUGF 4ZFOL 2QSQA 3H3BC 4CJ0A 4EIGB 3B2VL 2B0SL 4ISVA 5LGJA 3G08B 1OARL 2X09A 4KZDH 4PJFE 4U6VH 1FQ9C 2JJTA 1KXTB 3BKJL 5MERB 2D9CA 1HILA 3MRFB 1J0JA 5E4EB 4C55A 1FVDA 2NY6C 3SPVB 4NOFA 4PD4J 2VLRE 4RNRB 1U3HB 2JELL 5EU3B 2V5MA 1HHHB 4I5BA 3TNMA 2FHCA 1P84K 4UV7H 1AC6A 2VAJA 4K3HA 1UT9A 2OLDA 4AG4L 1HHGA 1YNTA 4HS8L 3DX6B 1T1ZA 1F11B 5IROA 1QZ1A 3I75B 4R90H 3BT2L 3GB7B 5TF0A 3BO8B 5D70L 3C5JA 2PETA 4OFDA 2ICWA 1YEFL 1CTOA 5MENE 5KVDL 3MUJA 4QXUL 1OSPH 4LSUH 2AI0H 2YK1H 3I6GB 5T1MB 4CBPA 4MQSB 2VC2H 3B8SA 3VXTB 3BH8A 3T4AA 3FT2A 5KOVC 1YDPB 4LDOB 1NEZG 1CTNA 2X4SB 2VLKE 1NMBL 5GGVL 1LO2L 4JRXE 5T33H 4OLYL 5GRVL 2E7LA 5JXEA 3VE0B 2DLHA 2D7TH 4UTAH 5GGRB 3PWUA 3NGBC 4ETQA 5HYEA 4M7JL 2QSVA 3FOMB 5F7DB 3MV8E 3KYOA 1WT5C 2PCPA 3K1KC 3G6DH 1F4WL 3E6FA 1CZ8L 1TJHL 4MA7L 3MRMA 4ZS7L 4NDMA 1A1OA 4TTDC 5HHVH 3GBMH 2VXTL 1XGRB 4ODUA 4OAWB 3QDGB 3GMQA 1IVLA 1FC1A 2ADFL 3TBWA 1CDHA 1S7WA 4FRWA 4U0RB 3GJEA 3G5XB 5CMAA 3CSBA 5FUOH 4PGCA 5JORB 3BYYA 5CCKH 1YJDH 5JTWA 4HIJA 1GPOH 1K8IB 3BPLB 2FJFB 5I1IH 4OD2A 5ACZA 1VENA 3UBXA 1OAKH 5I1AB 2JJSC 5ESQA 5IB2B 3BDYL 3OZ9L 1I4FB 3VWKD 1PVHA 1AD9B 3FFCE 2APBA 1MAML 2VQ1B 3O11B 4QGTA 3W82A 1QSFB 2KQMA 3BSZH 4FABH 5GS0H 1A2YB 4XRCB 1HCFX 4Y19E 3C08H 2EDDA 4ODWA 3S4SB 3GKZA 5MEQB 4XH2B 3V4VH 3NCFB 4HUXA 1UWGH 1M05B 4OGXH 5FYKH 3TBVB 3GIZH 2J7LA 3B9KA 4J3XA 4G6MH 1T20B 4IS6A 4IMLA 5D2LF 2CMRL 4OM0H 2HMID 3IDJB 3B83A 2FX7L 4WUKL 1B88A 4LNRB 1MCFA 5B8CB 5HHMD 4NQDD 5GGTL 2EYRA 4LVOB 5E6ZA 4X5XB 1MREH 1TZIA 3VXRD 2I25N 3QUYB 1J0YA 4AEEA 1JPTH 1UM5L 5L7XH 1U91B 3LAFA 3PWJA 3X3FH 1FJ1A 4W6WB 1FO0H 3BUYA 4BFIB 1Y18A 2ED7A 2HLFD 1P4BL 2IH1A 5JW4N 5DHYA 2R0ZL 4M8VA 1Z5LA 2MMXA 3E3QE 3F7YB 3PWLB 2JLLA 5DJXA 4AEHH 1CXKA 3OKOA 3GJFK 3I9GH 5HGHB 4J4PA 1FG9C 5JW4R 4NO2B 4YZFE 5DVOA 5IVZB 3NBNA 5BQ7A 3VFUA 1A0QH 2QL1A 1T83C 3WFHA 4DN3H 5HYJD 3UTTE 2EEDA 3P30L 2NCMA 3TWCH 3O4LD 3QG7L 4HK3N 4MLIA 4QKXB 2O5XL 5AYUL 4CL7A 3V7MA 1Q1JH 5DRNB 4BZ2H 1SEBA 2H45A 2YXMA 3MRQB 4LCCB 4Y4HC 4S1QL 5FUCC 2Z92A 1MNUL 5IBLC 4MXVE 4NWUH 4JM2C 1KLUB 3C5ZC 4HFUH 4FP8H 3O3DB 4CVWA 3KPRB 5SX5H 5C0CA 3HB3C 2P24A 5C0ND 1CK0L 2WBJC 4YDVB 1K4DB 4NCC2 5CKAA 1T3FB 2IADB 1NEZA 3MR9B 3WIIH 5L0QB 3BGFC 4P48A 5B4MC 4M7KL 4OZGA 3DARA 1IEBA 3W5NA 1RZ7H 3CK0H 5T3XE 4HS3A 2FEEI 3VFTB 4YR6A 1HHIA 2X4QA 4F15B 3KNBB 5IV2A 5IBUB 3CVHB 3QWOA 2XN9D 4NKDA 2DQHL 3RGVA 3OJMB 5DD6B 4FXLA 3AVEA 3FO0H 1T4KB 2NY4B 5KSBB 5EULV 3QEQB 1V3MA 3C09C 4LAJH 4K9EL 1HXMA 1MFCH 2X4OB 1L7TL 43C9B 5I9QC 4PLKD 4NNPH 1I1AC 2DRUA 3RKDD 4JZNA 2DQDL 3FO1A 3KGRA 3V0VA 3S4SG 1JV5A 2IWGA 3BEWB 4X99A 4Y1AD 3MXWH 2GJ6A 1NBZA 3SQOH 4LFHG 1XF4B 4X6DA 2Z0BA 5KSAD 4J8RB 1EZVX 3T0DA 1MEXH 5HDBF 3HLAA 4KZDL 5E5MA 4PRPB 1DBMH 1X5KA 4LEOA 1KT2A 2VDMH 3G5ZA 32C2A 3WFDH 3QIWC 2WWKT 4D8PB 4L8BA 3UTSB 3G6JB 4Z76A 2I07A 1A7QH 5CEZL 2SEBA 5FA3B 4QRQB 2NXYC 4XNMB 5ADOH 1RFDL 1SVZA 2CIKA 2OK0L 1X5LA 3U9UB 4LF3B 4UV7L 1PZ5A 4GAGL 4LLWA 2IJ0C 3QIBD 4QF1B 1I3RA 1MUJB 2IBGA 2BSTB 2Y23A 4MXWH 4NO0B 3BN3B 4JDVA 5D7SH 6FABH 4R90L 2YRLA 4UNTA 4WEBH 1OSZB 1BZ7A 1OSPL 1U8MA 3VWKA 4KXZH 3ARWA 3G5YA 4K3GA 3MO1B 1J8HD 3FO9B 1S9WA 5FO9B 4M6OH 3HRZB 4KMTH 5C0FA 3O6KH 3CXDH 4GSDL 1CR9L 4K3EL 4OZFG 4PJEB 4WW2B 3V6FB 4Y16D 3AY4C 1P7QD 4K3DH 3OKNA 4L8SC 4TNVK 4JO1L 2D7TL 5FFLA 4UTAL 3N50A 4L3ED 5F7WC 3TH4T 5L2KA 1D6VH 4YBQD 5HY9A 2XTJC 4LKXA 3VXRA 1SJHA 1QEWA 3KPLA 3NCYP 2FCBA 3GBML 2XZQL 3W0WD 3L9RA 2I9LB 3MBXH 1JZ5A 1IEAA 5J6GA 3NCYS 3RVXD 1WAAA 3QIUC 2X42A 3QAZB 5DJZB 1CCZA 4ZFOA 2BK8A 3GSOA 2CR6A 3QQ3B 4WWKD 2Q8AL 4OUUB 4L5FH 2EYTA 3VA2C 1FPTL 2NY1D 2PXYD 3WLBA 3VFPB 5I1IL 5DHXB 4JQXA 3HZVA 4QRPB 4NZTL 2AXGB 1G7QB 2EDKA 3ZT7A 1OAKL 2X70A 2J8UE 1BOGB 1CE1H 3RZCC 2CJUH 4EVNA 2HP4A 2EE9A 2Z31D 3ZTJG 4FQPA 4IRZH 5D2NA 3CFKB 4PB0H 3L5HA 1NAKH 1Q94B 5M7QA 4NJ9L 4FABL 4LIQL 5GS0L 3EGSA 3C08L 3KPMB 1EGJL 2QADD 1DQQA 4WFED 1PKQA 2F53E 5SWZB 3V7AG 3KYMB 4KI5D 2EKSA 4NKOB 5ECJE 3HZKA 4OGXL 4OJFH 5D1XA 3QEUB 4Z7VA 3ZHKA 3RGHA 1X4ZA 2Z93B 4P57B 2Q86A 2IAMD 3D48R 2BCKA 3H9SA 3B5TA 3T4YA 4LOUC 2CDEB 4NQEA 4PJAF 3ULVE 1IFHL 2F5BL 5JUEL 1JPTL 5AZ2L 2Z9TA 2V5YA 4X6BA 1WBXA 4Z5RA 3X3FL 4KKBC 4M5YL 2CUHA 2GW5A 4U1SB 4F3FA 4JM2F 2LU4A 4ZNEE 1RURH 4AIOA 1YNKL 4GAYA 4WHDA 1R3LB 4ZXBC 4HUVA 5AG8A 4HV8B 4BSWA 2XN9A 3MV01 3VWJA 5F9AC 4AEHL 2FNBA 2DYPD 3OX8B 2EC9T 3OF6D 4MAUH 5DFWH 4FTVD 5CS7A 2IBBA 3IJHB 4G9FA 3VXPB 4YEEA 3TO4C 1H9VA 4ZTOL 2BJMH 2E5EA 4ZPTB 5BV7H 2E9JA 3IJYB 4DN3L 5E8PB 4YHLH 4MS8D 4WUUB 4DZ8A 4G8FB 1R24B 2P5WA 4YBLB 4P2RB 2C7UA 5FGBC 3TWCL 4IOFC 4MJ6A 1U8PA 3WUWG 1GIGH 3VXQB 4BZ2L 5E8OA 5HI4C 3MV7E 1DDHB 1FIEA 4H1LG 2IF7A 3QXWA 1JYXA 2QQKH 1TVBA 2ZNXA 1NFDE 2J8OA 3LVEA 4LSPL 1JZ3A 1N0XH 4WO4D 4ZOCA 4GMSL 5F1KC 2KPNA 5DD0H 2B4CC 3TZVC 3PNWA 4C56A 1BIIB 2EH7H 4I77H 4OB5H 4QHKI 3CD4A 4KTEH 3FT4A 1JVKA 1BOYA 2GY7B 5CIPA 3SN6N 4LAQL 5KS9F 5C0EB 1KCSH 1A6ZA 2FIRT 4W81A 4DKEL 4P2QA 4N0YL 1P2CA 3PL6C 2ZP0T 3H7BA 5B3JF 1GGIL 2AEQL 4H0IA 2W9DL 2R1YB 4OZFA 1FO0B 2XIDA 3S9DB 1DQLL 1CFNA 5GS2D 3UPAA 4K71B 2G75B 2VXQH 2FD6L 5C0GB 3RRQA 3FMGH 5IP4A 2PW2A 1MCNA 4YC2C 1C5DB 3FAXA 5C6PB 1SQ2N 3LQZB 5GGTA 5KSVA 3DTXA 3C60B 1HSAA 4XAWL 3GUTB 2R69H 3CDGB 4JFHD 1ZTXL 2JIXB 4K8RC 4DOHE 4F37F 3EW3B 3MRRA 4D0DA 1HKFA 1XCQA 5CZVL 2IPUG 4YHIB 2YA2A 4ZAKD 3CFDA 4PRDB 3K8KA 4JRWA 2JCCB 4Y16A 1P7QA 4HUUB 4IDJH 3MXWL 3SQOL 2RJMA 1U8NA 2BXZA 1A9BA 2P1YA 5FM8A 4BA8A 1FP5A 2VZ1A 5EZIL 2ERJB 2K1MA 5DK0A 4GRWH 5E24E 5ICXA 4GRLD 3O2WL 1KNOA 3OAUL 1OD9A 4BH7A 4RWYH 2VDML 4Q6IB 4GG8B 1ACZA 3DMMD 3OJDB 5CWSB 1IKNC 2NYYD 1U8KB 3LIZH 2A77H 4HQQH 2NW2B 4H8WL 4WHTA 1JNNH 3SJVE 1RIHL 4IJ3B 3SOBL 5EC2A 5IJVB 2YC1B 2DIBA 4HPOH 4NUJB 3U1SL 2PXYA 2WAHA 1AGDB 5DD1L 2VZOA 1UWXH 3CZFB 5E70A 2BSRA 3INUH 5D7SL 6FABL 1SVCP 1I9JH 4MB4A 5DFTA 5GISH 4P5KB 1KN4H 3O3BB 3WS6A 3GRWA 4CVXA 4RISL 5TDNA 4H5SB 1P1ZB 1DN2A 3HG1B 3MLYH 1RJZB 3P4MB 5BVJB 2DWDA 4PJ8B 1FLRH 4OCSL 4OZIF 2DWEA 2Y4SA 1FSKC 2UZYB 2D3VA 2VQUA 3HA0A 3PXJA 2ATPA 5C0AB 1DZBA 2COQA 5MHSD 3VG0L 3P0VH 1UEMA 1GZQA 5F88B 4EUPH 5JOFA 4U3CA 5JHLH 5L8KB 1OL0A 4UTBH 4HFWA 2PYFB 1G7LB 4TVPD 1XAUA 1DFBH 2IAMA 4U1JA 4W6YB 1D6VL 3FT3A 3BWAA 5DS8B 2AV1B 5GS1C 3D9AL 1IC5L 1S78D 1BEYH 2RCSH 3LQAC 1WIPA 2ZG1A 5I8KH 5JDJA 3KLHC 1G9EA 3RY4A 5DQ9B 4X6FA 5CJ8A 1TTGA 5I1EH 2BC4A 2OXGA 2APWA 2BNQB 4PJHA 3MLZH 1INQA 4H1LA 1KCRH 4POUB 2DYPA 3LKNA 1T0NB 4PP2A 1DQJA 1H3UA 1T66D 4EI5A 4D3CH 1M6OB 1L9NA 1QUNA 4HS6B 4F7MA 1NL0L 1HH6A 1LE5B 3UDWA 1RJYA 1KOAA 2DD8H 1AQDA 4M7LH 2LTQB 5C8JB 1PY9A 2AJXH 3GSRB 3EYSH 4EQ2A 4WO4A 4FQCH 2E7MA 4GW4B 2PO6D 3L3KA 4OLZH 5EBLA 4JQVA 5JW5A 2AGJL 2Z8VC 1ZA6A 3FZUC 3PWPD 2H2SC 3F5WA 2E6JA 4I18C 4X7FC 3MRPA 3WKMH 4LBEB 3FB7A 4M9PA 1F3DH 4PY8I 5F89A 5CEXA 5FGRA 2XKUA 5CGMA 4JKMA 2VABB 3GHBH 1FNFA 1NAMA 5H35A 1EFXB 4MAYA 1IGFH 4RGNB 2GUOB 2D4FA 5KW9H 1NBVL 5J13C 4PLNC 1IM9A 4G8GB 1N6QL 5F7FA 3IF1B 2J3SA 5F9DC 3HC3L 3W39B 3CDCA 4FZ8H 4DUWA 5EIIA 1AHWB 3L3IB 5BZDB 1XIWA 4PJBF 4GXVL 3H9ZA 5DK2A 4HAGA 5DQJB 3VD9A 5GRUH 3F12B 1FCCA 1H8SA 5F9WB 1G9NH 5HHPA 3LEVH 2BJML 1RZIA 4YHLL 4B7LA 2ICCA 4PRIE 3L5XL 2R23B 1OAXH 2BVEA 2QHLA 3OB8A 4HKZA 3O9WD 2W9EH 1RK0A 3OAYK 1VKXB 3VXSD 2ATKA 1R3KB 3VG9C 1FRGL 2GAZB 1EPFA 3AXLA 1C7SA 2VDQH 3LS5H 4GRLA 4M6AA 3U6RB 4JJ5A 1T1ZB 1ED3B 4GUPB 4UV4L 3U30B 4F80A 4YDKH 4J3SA 4OB5L 4LPXA 4QT5B 3D0LA 4ZFGL 4PGBB 5I1HL 2JB6A 1HOCB 1QHPA 2ZUQB 1TIUA 1WWCA 2XI9A 1KPVA 1WBZA 5DEFA 1F3DJ 5DMGD 5F96H 3WD5H 2F8XC 1HYSC 2IEPA 4M61B 2BVYA 1EGJA 3VH8B 5T3ZH 5IVXE 3O0RH 5C0CE 2UZIH 3WN5A 5C07A 4NHCH 1U3YA 3VXMB 1UKTA 4OCRL 2VXQL 1I7TB 3EOBA 2ITCA 3FMGL 4FQXC 5D1ZD 5I8CA 4MMXC 1A7OH 3PGCA 1PEZA 3HI1B 4OZGE 1V7NH 4K7FB 1CLYH 4X4ZA 2QQQA 5TGBB 3Q3GA 1JGUH 5IFJA 5DURB 4HWZB 1NMCC 3HNVH 4P9HH 1YY9C 3D0VB 5BV7B 2DL9A 1MHPL 1GOHA 2V5RA 2VDNH 1C7TA 3H6JA 4I0PC 1X5HA 3MOAH 3CFJA 2OZ4L 4X9BA 5ID1B 5AUMB 5IG7A 1X5IA 2X10A 1CQKA 4PR5B 1R3HA 1PG7W 5GSRA 1BFTA 4HGWA 3BP5A 4HIJB 3TYFB 4ENEC 2CDGB 3BMVA 2WIMA 4DGVH 4XP1H 4ZG1A 2GJ6E 4X6DE 4Y4FD 4PJ9C 2E7CA 4G9DA 4EN3D 1TMCB 4HQQL 1WFTA 3TJHC 1R5WA 4M43L 2H32H 1MHCA 5A2JH 3ROLB 3ULUC 4NPYB 1S8DB 5E2JA 3A0OA 5IEKA 2OCFD 3HE7A 3JXAA 3UXFA 3U4EB 2NX5D 1YYLH 5JLZB 1FE8H 1CLCA 2X89D 1X5JA 3MRKB 4XPFL 2IPTH 1T22A 1GHFL 4D0BB 4L29B 4PTTB 1QSED 1KEML 2DTML 4XCFH 4S1RH 5FEBA 2CKBH 5GISL 3KPNA 1SBSL 1G0DA 2C3VB 4HWBH 3MLYL 3EYOA 3D85D 4ZOAA 1KCLA 1JGEB 3LRGA 3BRGC 1JF5A 6CGTA 1CDBA 5JIPA 1ZHKB 4C57C 1JHTA 1KJVB 2OBGA 3VMPA 4YQXH 4XWOC 3MCKB 3NN8B 4OD3H 5EZLA 1XR9B 5CLTA 5CJQL 5JHLL 2JB5L 2WSKA 1TLKA 3IKCB 1Z9OA 4F8TA 4NO3B 2EO1A 2VO5A 4EDXA 1JI2A 1OGAD 1A7RH 3V2AR 1EBPA 3PWPA 4DJMA 4EKXA 2ZCKL 4TUKL 4J3UA 2NLJA 4U6YB 4RGMC 1T04A 5DMIH 4R0LB 1X5ZA 1CFSA 3REVB 4E0RA 4O5LH 1HDMA 1DLHA 1GC1C 1NGPH 1BEYL 2V5SA 2H8PA 4KQ3H 1A1NB 1YEDA 4R97C 5I8KL 4DKAA 2BOCA 3VH8G 2XKNB 2P5ED 1UGNA 4RX4D 5GIRA 4OIIH 5L2KE 4N9OB 1JJUA 3TFKD 1QO3A 3MLZL 3MJ7A 5DC9B 5DJDB 2Q6WB 1ZV5A 2QBWA 5GXBB 2QEJA 1VFAA 2ESVD 2JTDA 3SCMD 4O58H 1WAAE 4NQCA 5MP6H 1E4XH 3E3QC 1SJEA 1XZ0A 2ZJSH 5GGRY 4ELMF 1PZUB 1EHLL 4X8JA 3I50H 3O9WA 1HXYA 3GSQB 3ZDYE 5IQ9B 1RK1A 1IAOB 4G7YH 2X41A 4WVRA 4TNVF 4ZS6D 1MELA 3T0EA 3GGWA 1N3NA 1KCKA 1QSZA 3SGEI 4PP1C 3VXUD 1JMXA 4Y2DB 5D5MB 2YD8A 3QNXB 4N0UA 3QDMD 1B6UA 3LSOB 4EUPB 1FZJA 5D7IA 2XQBH 4HS3B 4M93C 2A6IA 4OZHA 4CRPA 2GIYA 1GAFH 5D2NE 1UZ6E 1ERNA 2G60H 4JANA 4FFVD 2E7HA 4GBXC 3CZJA 5JHDB 5J1SC 4MD5A 1W8OA 2DQGH 3TIDA 2HKHH 4XNQB 3DUSA 3DX9A 4PLJD 3TIEB 1JF1B 3MACH 3DECA 1ORQB 1T5XA 4Y4KA 1PKQE 5IKCA 3MGTB 3KYKL 5FGSA 1NCBH 3C6LD 3JVGC 5TQ2L 2EE3A 1ZWIB 1QNZL 1DBJL 1VFMA 5KW9L 4F9PA 4DZBB 4G80B 3ILPA 4OM1H 3F7VA 4ZO6A 3H9SE 2AAVA 1FV1A 3U79A 4NQEE 1BQSA 2ZPKH 3NZ8B 3MGOA 4FZ8L 4XNYH 3U4BH 3HC0A 5C09A 4LKCB 1Q38A 3W9EB 2AJYH 4IRJB 2Q3AA 4U2ZA 3MJ8B 3RHWK 4FQ2L 4P2OC 3SDCA 5GRUL 2Q8BH 3DURA 1JF6A 1BBDH 4UINL 1KCUL 3G5ZB 2BVUA 5J9PA 4YHOH 3O45A 2W60A 2YEZA 2OR9H 4LVHC 3TCLA 4C83B 5FO8A 3P9LB 5H2BA 1QA9B 4G9FE 3LN9A 4LLWB 5I1JH 1DUYA 4L4VD 4PBWD 1I3RB 3DO7B 3E0GA 2VITB 4KGJA 3MCLL 4MJID 3IDGA 3KYNB 4PJDB 1YNLH 3RUGA 4TQEL 2P5WE 4JFFD 3V6ZB 2AK4A 4YDKL 4TSCL 2YD5A 2IH3A 3AREC 1CBVH 3FQRB 2IBZX 1SY6H 2B7DT 1A14L 4AEIH 4MJ5A 3G5YB 2NX5A 2X89A 1NGXA 4HWNA 3HAEH 3LHPH 3OR7A 5HHQB 2DL2A 3LV3B 1ND0B 4Z7UB 3RWCA 3DPBA 4RAUB 1UJ3A 1BP3B 2V2WA 4NKMA 3TBSA 5EUKB 1XF5B 4C56E 1X5XA 5T3ZL 3C5SB 4XVUD 4NQUA 3AU1A 1MCIA 4ORGB 1EEYB 1DVFC 3P4LA 4JRYB 4P2QE 3ULUF 3EO0B 3IDMB 3Q6GL 1V7NL 3BIKB 3FOLB 3MXVL 3NIDE 2WBWB 4WFGD 3TVMB 3LN5B 2FO4B 4NQDB 4XP9H 3HPJB 1HWGB 4HC1H 4OT1L 3SDXF 4ELKB 1JGUL 5EBMB 1N2RA 4IM8A 2NY6D 5IF0B 3OKEB 4MCZA 5EUOB 3O3EA 3TCXA 2VDNL 4WEMB 5FOBB 1BLNA 3BFOA 5FK9B 3LDBC 2NMSA 3DSNA 3QT2A 4I48A 1P4LB 1BZ9A 3OTTA 2FLRT 4JLRB 3MA9L 4I9WD 5JZ7D 2IC2A 1GCFA 1P84J 3G6AA 2UVEA 4ZUSB 2JJWA 3EOTH 5E6ID 5CBAA 4PY7B 5JDSB 2HFFB 3Q5YA 4I8DA 4X7EC 1VADB 2B4CH 1WC7A 3UTZB 1EAJA 3ZHLA 3SE3C 2XWJA 2LU3A 1OPGL 1OAQL 1MJUL 2DTSA 2P5EA 2OTWB 4PREA 4RX4A 2GSIB 5HYJB 4DQOH 3O4LB 1IAKB 4JPIA 3FAWA 2VUYA 1FE8L 5KSBE 3WDHA 3QEQE 4DVRH 4G7VL 4PLOB 2IPTL 1JPSL 5DJCB 4PGZA 4HUMB 5IM7A 3X11A 3SCMA 4XCFL 4S1RL 1C1EL 2CKBL 1FL3B 3VGHA 5TFSL 4Z7VB 2GITB 4GKNB 1RJCA 2VMFA 2FL5B 1FZOB 1G7MB 4JZJA 4NC1C 4YGVA 2WUCL 5L88H 3SDAB 3V7AE 3WNPA 4Y5VB 1VFUA 4K8RH 1VDGA 4KK6C 2EICA 2DQUH 4TTDD 3F8UB 3QDJA 5DSCB 3MRGB 1MIML 3P4NB 1KPUA 1MFDH 5EU7E 5TDOA 5IHBA 1L4IA 3N85H 1KJ2L 5C2BH 5M95B 1HI6B 4JFZH 5ICZB 2KZ1B 1QVOB 2CRMA 1NJ9A 2YZ8A 1SM3H 3QHFL 2Z8RA 4MDJB 3DYPA 3MV11 2FSEB 4RFEA 2VSDA 3ARDC 3I2CL 5JO5B 4KJQC 1ZMYA 4RAVB 5DZLA 2HT3D 1EVTC 5T1DL 4O5LL 3E2HC 3QUXD 1E6OH 3DYOA 2GCYB 3WXWH 1NGPL 4PJCF 4NT6B 4O2EB 3W9DB 4KQ3L 3QFDB 4ODXB 5JIIA 4OIIL 5ID0B 1W8NA 3FFDA 3REWA 2H32B 1NC2B 2EXWC 4Y1AB 4TVPH 4LCIH 2UY6A 3GMPA 5I2IB 4U1MB 3FQXA 4DW2L 1K6QH 1I3GL 5KSAB 2OZ4A 3FQTB 4UQ2A 1U8JA 5E8OB 1RZJH 4O2CB 2B2XH 1Y0LB 2UWEF 2VDOH 2GEEA 4O58L 4LSQH 3PXHA 1J12A 4PJEE 5GGSB 2P46B 4O9HH 1E4XL 4RFOH 4Z7WB 2WP3O 4QRUA 3I50L 4PJHE 1UCTA 3WDIA 3NAAL 1NLBL 5DHVA 4X4YB 1B0RB 5CP3H 2OR8A 3QR2A 4X8XA 3GK8H 5TE4L 3QIBB 5TDPA 4LQ1A 5FDWB 1QFWI 3X12B 1S9YA 5IMMA 4JFFA 4YFLI 3U7YH 5DLMH 2VDKH 1GAFL 4R26H 3HE6C 5CEZE 4O02L 2ORBH 4QRTA 1EUUA 2EDYA 3U48A 2HKHL 3MUGB 2EO9A 2F58H 3CFIC 1PQZA 3MACL 3T8XB 3L3OB 5JNYA 1DJSA 2QHRL 4YH6A 1J8HB 3CPLB 1NCBL 5B39G 1FFOA 1FVEB 1UACL 4NHUB 4Z8FL 2VE6B 1MIEH 1D5ZA 1VGEH 5J4MA 1ZLSH 5DJYB 1F6AA 3HUJF 4X7TB 2UYLB 3BQUC 2ZUVA 4BH8A 1F4XH 4UT9H 3WNNA 1B4JH 4MQXD 3U4BL 5DRZA 3UJIH 2X7LB 4L3EB 1JBJA 5BRZD 1T1XB 3ILQC 2EDHA 3LMJH 5IBLD 4LCWD 4PJXF 4WEUD 5SWZE 2A74A 4AEFA 4JM2D 4CGTA 2MFNA 3HB3D 3W0WB 1MCPL 4YHOL 2C1OA 4XCNB 2C3XA 2DI8A 3RX5A 3M1BA 4ZYKB 2D2OA 2EYSB 4MCYA 2OR9L 1E4JA 5B4MD 2AV7A 1YMMD 5E5UB 2Y7QB 1WCBA 1I7UB 1FNSH 5I1JL 4WWKB 4RMSA 2NY1B 2PXYB 2Z8WC 4HD9A 3S3SA 2YKLH 1MI5A 2BSRB 3CXHK 3MLVL 3V5DA 4FZEH 3U7WL 1U8LB 3KXFD 1CL7H 4O2FA 2M26A 1A6VL 4DEPC 1BFOA 1OW0C 4NM8L 1MJ8H 2Z31B 1CBVL 3CVIL 3HZMB 1WVZA 2D7NA 4R7NA 5FKAB 2HLAA 5I76B 1KIQB 4JPKL 3LHPL 5KZCD 3ARRA 1R5VB 3O6MH 4GW5B 4AT6A 1F13A 3WIHL 2QADB 2Y5TA 3DETC 4Q9BA 2YD4A 2J88L 4WUUE 1QBML 1QHOA 3QCVL 4QWWC 2P8LA 2CRIA 1D7FA 3HNSH 1RAMA 4MVBC 2H26A 4HWEH 1WT5A 5DO2D 4AK1A 3KS0H 2W07A 4LIQE 2YBRA 4P5MA 4Q2ZA 5LJYH 5FKPB 4XP9L 4XP6H 2R2HB 5BO1H 1OTTC 2ZOLB 3S96A 1IL1B 1CVSC 3QIWD 4MWFB 1KYOK 5C07E 4UMGA 2HG5A 5IBTL 1T7WA 3SHSA 4Q6YA 1ZS8B 4JR9L 3V0AC 5EO0A 3VD7A 1EEZB 2NXYD 2GJJA 3TYGH 3Q6FA 2X4UB 2OS7A 2FR4B 3CFCL 1PAMA 5CILH 5I8OL 2B4CL 4FTVB 2FEDD 2JJSA 4ORZC 2BX5A 4OFIA 1OP5H 1RVFL 4QEGA 3JWDC 2VWEC 3KPPA 1FYTA 3K4AA 3A6CH 4DQOL 4Y89A 4OLUH 5FYJH 5BXFB 1BJ1H 4I2XB 3OJ2C 3UYPA 4M4RA 5ITBL 1PW3A 4YFDB 1UQSA 2EEBA 3RJDA 2YUZA 5FF6B 4AQ1B 4R2GC 3EFFA 4H25A 2QV2A 1R0AH 5ESVB 2R56H 2AJZA 5FIEA 4KRNA 3T65B 4UILL 1LE9A 4QY8B 4F58H 4RCAA 1RJLB 1HHJB 1U8IA 1ZA6B 1PBYA 1YY8B 2XT1B 1KCVH 1XR8B 3F5WB 1LO4L 4K8RL 3T2NL 5B39A 4HKXB 2DQUL 3KS0J 4HX1B 3S7GA 3P40A 4Q9QL 1N26A 1S7VB 3SY0B 1UYWH 2A1WH 2CR3A 1NGQL 4IMKC 5ALCH 2QLVB 4U1LB 5C2BL 3RI5K 1GGBL 3QIUD 4QYOA 4I13B 5J8OA 4AL8L 4EOWH 3N06B 2ADGA 3U7AA 3G9AB 1NCCL 3AB0C 1F3JA 1KJMA 4PBXA 1MLBB 1FFNA 4QRRD 1T83A 3N1FC 2OL3L 1E6OL 1I1CA 5IMKB 1B6DA 3PGFH 3EDDA 2PR4L 1I75A 4RDQF 2BHYA 3TNNA 4PJ5A 1RZIB 1A6PA 2Q76B 2MJWA 3BHBB 4ZAKB 4PJAA 2BZDA 4PRHD 4PTUB 1IEHA 3L95B 1U8HB 3D69B 5C0AE 1F90H 5DDHB 5EH1A 3WCYA 3CH1A 4Y4HA 2V9QA 1NFIA 3TA3C 4JM2A 2VDOL 3C5ZA 1SYVB 1S7TA 3P0YH 3QH3A 4PG9B 3EO1A 2AVGA 2X9WA 3GMMA 2WBJA 4FQHA 5KJRH 3DMMB 3L5IA 4O9HL 2G5BA 4RFOL 4LOUD 3LQMA 4ZUWA 5I71C 3B6SA 2DQIH 1NGYA 1CQYA 1JGVH 2AQ1A 2HN7A 3DVFA 4HDIA 1O7VA 4HKJB 5I1KL 3QULA 2ZWLT 2WANA 3T77B 2JB6B 1YMMA 1YECH 4LHUD 1KPVB 1I3UA 4KKBD 4P2YA 3C8HA 1TETH 1DQDL 3E1F1 3VI3E 4WCYL 3KDMB 3P0GB 3MV9B 4NQCE 1I9RL 1N7MH 4KV5E 2CKBA 3NCJL 3CCHB 4R26L 4DKDC 2ORBL 1D9KC 5D1QD 1AJ7H 1UB6B 2MPAH 3T0EE 5I6XC 5JQHC 1NDGA 5F6IB 5F1IB 1N0LA 3RL2B 1F2XK 3ARBC 4M6MH 3GSUA 3LQAL 1I1AA 4N90E 2WQRA 4OZHE 5F7YC 4TSAH 3HAEG 4WENB 4F7TA 3R1GH 1A6UL 1ZANL 1RIVH 2HJKA 3BGMB 4IOFD 4NUGH 1KJ2A 5KS9A 1YQ2A 3T09A 3NIFE 1DBKL 3JV6A 3OPZL 4R9HA 5DQDL 5FO7A 1IGTA 3HI5H 1RUAH 5CHNB 3QUZB 5HI4D 1VFBB 3UJIL 1KIUA 3IAQA 1QR1B 2NY7H 3LY6A 1F2QA 3P9MB 3LMJL 4KKAC 4MQ7A 3MMEA 1Q9KA 1TPXB 4ZPVB 2GSGA 3QIWA 3U4AA 4MD4B 4E42B 1IAIL 4NNYB 2H6PA 2CLVB 5AG9A 1IQWH 4H26A 5J56B 4JY6B 5ERWA 4KJWC 4LSTH 1F42A 4QXGH 1V3LA 1W72L 4NO5A 5C09E 4RSVA 2HH0H 5ETUB 5IB5B 4OD1L 5E9DE 3NFPA 2DIJA 4XBGA 1YYML 1CFTB 2BNUA 5LGHH 2AXJA 1OWWA 1FNSL 5IEKB 1LO5A 1AGEA 2DLGA 3GSWA 4RGNE 5HDQH 3DGGA 2YKLL 1T1YB 1WSST 4FZEL 4GMTL 4L1HA 1CL7L 1P5UA 2VAAA 1MY5A 2DQFB 1VB9A 4U0QB 4U1KB 3PIQA 3WEXB 3SGDI 3PWNA 3DJ9A 5I1DB 2ZUUA 4JY5L 5EN2A 5IMOA 3S34H 3RUGE 4N0FB 2AK4E 4Z7QE 2OQJA 3RHWF 4G8EB 5IFHL 1C5CH 1GRWA 3O2DH 3QFJD 4L8SA 2OI9B 5IVNA 1T03L 5EA0H 3ZE2E 2PO6B 2L4OA 3HS0A 4XXDA 1QP1A 5F9JB 1CICD 1M7DB 1RV6X 4GW1A 2FDBP 2Q20A 5HDLA 3RIAK 1KTRL 3QNZB 4WI7A 5BO1L 4R4FH 1XCTB 5EDXA 2ED9A 2HVJB 4P4KD 4QGYA 1JYNA 2X1QA 4P46C 3VRJA 4UNVA 4JG0H 4LL9A 4OKVA 3IAPA 2NNAB 1TJGL 3QIUA 3TPUB 5JOPE 4OZIA 4ODBD 1U95B 1LO3H 3O6FB 3TBTA 1WJ3A 2GTWA 4P5TB 5CILL 3ZL4H 2JF1A 1KBGH 4GG6F 4PJGF 1DEEA 3O2VH 4WRLA 4U6XA 4I4WA 3FQUA 2GK0B 2MOVA 4F33A 5E4EC 5T5NF 3RWDB 3PQYD 1DBAH 1NUFA 4PB9H 3RZCA 4ONFH 3RDTD 1S3KL 1U3HC 2AJUH 3QEHA 1JWSB 3GSVA 4PRHA 5FYJL 1QSVA 1UB5B 1MH5B 3HPLA 5FXCH 4L4TD 1BFSA 3VXSB 1N3NB 3WMSA 1FH5L 1TVHA 4PS4H 4P23B 2DQCL 1OQOA 2R56L 4FFZH 1C08A 5CUSL 1EAPB 1QRND 3DV6A 2A6IB 4WI4A 2ZKHL 5LXGH 5D71L 2IPKA 2NTFB 2R9HD 4G8IB 1KCVL 1MLCA 3EJZC 5C6TL 4JFEB 3IU3B 2BVQB 3EFDH 4P9MH 5F6HI 5FECB 1OD7A 3HAEA 4Z78B 4S2SB 1UYWL 3GEWB 5ALCL 4OCWL 3O6LH 3KLHD 3WIHA 5BS0A 5ISZD 4EDWH 3QCUH 4ZXBA 1H8OA 2XWTB 1OLLA 5D1ZB 2ZUXA 2A6KA 3L7EA 1FNHA 3QDJE 4LCUA 3GI8H 3TO4A 4TOYH 4XWGH 2YSSB 1A6TB 1RUQL 1AR1C 3UTPD 2P8PB 1L0QA 5FGBA 4S1DD 2YPLA 3ULUL 4CW1A 4MMZC 4U0RC 3UDWC 4L8CA 3TJEH 2KDGA 4X6CB 2NZ9C 4BSVA 3OAYH 2F54A 2AQ2A 2HFTA 1OAZH 3W81A 2V17H 5EIVA 2HT4C 2K7QA 3BPLC 1E4KC 5EZOH 5HPMB 4X9GA 3QP3A 3LZFL 1RMFL 3VW3H 5B3NA 3TZVA 3OB0H 1YZZA 4GKSB 2BFVH 4Y8DC 2PW1B 2VR5A 3UPRA 1AQKH 4PJBA 4Y4FB 1PJ9A 4D2NA 4EN3B 4YBHA 3T1FA 4B7IA 4NOBA 4JFDB 5F93C 2O5ZL 4GRWE 3PL6A 1YECL 3JTSA 2R8SH 1LD9B 1R5IA 4L8DA 1TETL 5GGUB 3F65A 3ECBB 2RQ8A 3P73B 1IT9H 3CLEL 1QSEB 3FN0H 3PABA 1DUZA 5IVXF 5E03A 4F7CB 3QUKA 3I6LD 1GGTA 3GIVB 3L1OH 3K0WA 5LKNA 1BQHG 3P11H 2A0LD 2E27H 1AJ7L 3DVGB 4N5ED 5B8CC 4YHPA 1NUDA 4LVOC 3MRBA 4J3WA 3D85B 3QUYC 4HF5H 3C87A 5LBSH 5DR5L 1GC1L 4M6ML 4OI7A 1R3JA 2VH5H 5HYSG 5IB3A 5LQBH 4TSAL 1N4XL 5A3ID 2XTLA 1FZMB 3I84A 3LKOA 2X4NB 3BN9D 5D93B 3RNKA 1RIVL 3MFFB 5C9JA 3EYUH 4NUGL 3B3IB 3SKNA 3UTQB 5I66B 3BZ4B 3HI5L 4WDIB 3D3VE 3V4PH 1RUAL 1OGAB 3M17A 5JPMA 1BZ9B 1H3VA 3NACH 4XHJC 1R3IH 4ODTL 3ZKNC 3SGEH 3CSYA 4LSSH 3GJFA 4QLRA 5D5ME 2HKFH 1NCAH 5DJ2A 1ONQB 2XA8L 3IDIB 4HPYH 5DUBA 1RZ8A 5SX5K 1IKNA 3RPIA 3H9YA 5FB8A 2OL3A 4DKFH 3PDGA 4K3JL 4AM0B 4FXKA 5MEOB 1FIGL 4HJGB 2CDFA 4QXGL 1BD2B 4JFPB 2HH0L 2EC9U 3FN3A 5LGHL 4WW1B 1ORSA 2VLJB 2XWBB 4LCCC 3RL1A 1J05A 1KENL 1JTOA 1LDPH 2D7OA 1KB5B 3SDDB 4PJ7F 2ESVB 1WGOA 3X11B 3SCMB 4MNQA 3MYJB 5DWUH 1UKQA 5ENWA 1AKJD 3CUPA 5IEHA 1D5XA 3MRDA 3ORJA 3OXSA 4I9WE 1BF2A 1UM4H 5L0QC 1GZPA 4KWUA 5D6CA 4ALAL 3ARUA 2FZ3B 4KH2A 5CP3A 4L4TA 4QCIA 1UC6A 3NFNB 5D7LA 4HT1H 3VXUB 1YY9D 5IJKC 5KAQG 1MI5E 3GSXA 3WFZA 3LS4L 5DVKA 3GMNA 5MEND 4F15C 3QDMB 3MYZA 4HLJA 5HDBE 5EA0L 4EBQH 3SKMA 1I8KA 1Q9WA 3CGTA 1OAYH 5HVHB 5FA4B 2CUMA 4NIKB 2QKIB 4M1GH 1RU9H 4HIEB 2NY4C 1OF2B 2VLKD 5GS1A 1KELH 4ENED 2NTSP 4WV1B 4JRXD 1VPOH 4JPWH 4PJDE 2VR9A 1AXTL 4LRNL 3IVKB 3C6LB 1BM3H 3VFOA 4JG0L 4N0CC 3MSPA 5ISZA 4YIQB 5D2LB 1BFVH 1CXLA 1FNAA 2EXYC 5CJXC 1AGCB 2XA3A 1LO3L 1LNUA 4EJ1C 3MV8D 2BXYA 3IFOB 1WK0A 4V2BA 3RWFA 4LPVA 1V8HA 4YAQA 1K4CB 5EU6B 4Z7UE 4WIQA 1X5AA 3FQXB 3PDOB 5FYLL 4POZD 4CNIB 3NVQA 3MNZB 1F4HA 1SJVA 1VACA 1FVCB 5E5RB 4PYGA 4J3OC 3BVNA 2AJUL 5J1AB 3P77B 2EDXA 4NYLA 2BNRA 1JGLL 3C6SB 3K4DA 4QTHA 1OAUH 2IFFL 4JRYE 2DS4A 3QUMH 1W72A 3LN4A 2BMKB 3OL2A 3ZDYF 5CBEA 3QISA 4XWOD 5GGQL 3RWIA 4ZDHB 4JM4H 1WEJL 3BZEA 4G42A 5I19H 1LK3H 4LLUB 4FMKA 1FAIH 4L4VB 5HGAA 1AH1A 4HIHA 3FHQA 4E5XB 5DMYA 2F19H 4MJIB 1FYTE 4FFZL 2H2PC 1IZJA 1BQHA 4Y5XB 1CGSH 5LXGL 4JFFB 3FFCD 4I18A 3MLTB 4DVBA 1J7VR 3F6LA 3IGAB 3V8OA 5HDOA 3CJJA 4Y19D 4HUWA 5FCSH 5KSUB 3F7RA 4KROB 4R7DA 3W11C 3EFDL 2DKUA 5HYSA 2HTKC 4YUEH 4YDIL 3DLQR 3B5GA 5F1SA 2VDPL 5DYOA 4M5ZH 4WW2C 4XNUH 1N5AB 4AENB 4ELMA 3F62A 3QCUL 3ARGD 1JL8A 5TE7H 4JHZA 4FG6C 4JFQB 1YPZB 1BVKA 1U9KA 1QFUL 1MCBA 2HAZA 3GHEL 4BJLA 1XF1A 4X7DC 3T08A 3X14A 4AIZB 3GI8L 2B20A 2NY2D 3CDYA 1A7PH 4BZ1H 2CSPA 2PUQT 4A6YL 3JWDH 5T3ZE 4PJIB 4NBXB 1LK2B 1ZGLB 4YEFA 4N8VB 3X13B 5SV4A 3GMLB 2VISA 3UP1A 3VFWA 3QAZC 2VXUH 1T7YA 2O5YH 4KY1H 4JN1H 2Q3ZA 1JPFB 3OKLA 3P4OA 4YXKH 5H37H 2BRQA 4LPWA 1G7HA 1WZKA 1XGUB 3MROA 3NFSH 3QZWB 2G9HA 2FBJH 3DRTA 4OTXH 5E6IB 3DIFB 4RIRB 4FQIL 4JHAH 3Q5TA 4D0CA 4PJ5E 2D7MA 3UTTD 4UT6H 4NJAH 1OTUD 4PJAE 5AZEH 1D5IL 2F15A 4C58B 3RI5F 1KG0B 2ARJB 2J8HA 2CH8A 4HIIA 2DICA 4BQCA 3ARSA 5FUCE 1I7RA 3MODH 1NSNL 1INEH 5LWYL 3JV0A 2R8SL 1FGVH 3PGDA 4WWID 5K9QG 1VEOA 2C3WA 2Y07H 1AE6L 2Y5TB 4FQXA 2ADJA 1D5MB 2EKJA 1AKJA 1JWMA 5FOJA 4IRSD 1A02N 2X6MA 4P2OD 5DJAA 3NH7L 3VXOA 2CUIA 3EYVA 1TZHB 5DT1H 5T3XD 3JZ7A 1QPXA 3CFEB 3NCCB 3O3AB 3PE9A 2VH5L 4D9LL 4Q2ZB 2XQYK 3CU7A 5K9OB 3DI2B 5LQBL 1OTSD 2K9UA 1TQCB 5HI3C 1AI1L 3QI9D 5GGSY 1ZGLM 3NZHL 3EYUL 4OGYL 4G6KL 3V5KA 3HR5A 2X4RA 3ARYA 3NA4A 4WTZG 5FHAH 5T5FH 1J10A 4OQTH 1RUKL 3NA9H 3O8XB 3V4PL 4LLVA 15C8L 1HH9B 4Y5YB 1R3IL 4BQ9A 4NRZA 3PHQA 1NMAH 3EDEA 4LSSL 5I1CL 2VLKA 2WMPA 4NM4H 5AD0B 1YJDC 2HKFL 2DJSA 4MZ2A 1ZHLB 1QFWH 4ONOA 4JRXA 1CG9A 3S6CA 4PV9A 3QUXB 4PJ9A 4YBLC 5C0IA 4HH9B 2V7NA 2FHBA 4MXQD 2ZG3A 3KVQA 4S1SL 2DQEH 5ITFA 3SDXA 5KSBF 3MA7B 3C9NA 5EU5A 3P3YA 4PRBA 3ZE1F 5FGCB 3VGEA 1KSRA 2CK2A 1OB1A 5FUZH 4XGZB 4XMPH 5IHZB 5DWUL 3ZKMC 3CX2A 5BCAA 2ZSVB 3EDJA 3H9HA 1UM4L 3IFNH 1CT8A 4LK4A 4HBQA 2FB4L 4PGDB 4QNPF 3H0TA 1ZHBB 3BEVA 4U1GB 3FB5B 4HIXH 1MFAL 1F00I 2HFEA 5D6DC 1T7XA 5T1KD 2ICWI 1AY1L 2E9WA 3G6JF 3ZMRA 1AIFA 2HT2C 2W59A 3KJ6H 4IEFB 3PV6A 4I0CC 2ZSWA 3FFCA 1S5HB 4NNXB 1ETZB 1OAYL 3FQWB 5IW1B 1JRHL 1RU9L 5TQ0H 4H88H 1T2XA 2PTTB 3C60C 3OKDB 3QEGH 2QQLH 4FQQB 3BPCB 4ONHB 4XCCH 4JPWL 1MJ7H 3DGCR 1YMHA 3D2UD 3FN9A 3QQNA 4MLSA 4OI8A 2ZOKA 4FFYL 3ARTA 1BFVL 3ALXA 2XTJE 5E94A 4R4NC 5GRXG 2A6JA 2ERJC 3QJHA 2D0HA 4YHMH 1UWXK 2YPKB 1NC4D 5DD5H 3MCG1 4XT1C 1E6JH 2F74A 5BRZB 1KLGA 1Y6NR 1S9VA 5KVMC 4Q6IC 3ZYOA 2H3NB 3MLSH 1JWUB 4LCWB 1UJTA 2ADIA 1FGNL 3QH3B 4OZIE 4PJEF 4WW2F 1A3QA 1Z9SA 2VIRA 2CLRA 3G04B 2E6QA 4K7PH 1YUHB 3MJ9H 4N1EA 1YEEH 4XB7A 1HHKB 1OAUL 4KK5C 1BVLB 2ARJQ 1K8DB 4KK6D 3RWGA 2HN7B 5AWNH 4XCEA 3LPGA 3QULB 1NUNB 3EHBC 4PJCA 1EHAA 3MGAA 5I19L 3ROOA 3NCEB 1LK3L 3HZYA 5CD5D 1U8QA 4JCLA 3RIAF 3UBXI 3FCTB 4LDLB 4OLEA 3E6HB 3UTTA 2F19L 3LEYH 3PJSA 4WNQA 4GBXA 4ZTPL 1LEKB 1VSCA 1CGSL 1QOKA 3QO0B 4K55A 2BHUA 2I9TA 5AEAA 4ZUVA 4PJ8C 3KXFB 1E4WH 1G1YA 3ARDD 4HMEA 4HSQA 4WGVB 5CEYA 3L3HB 1OT2A 2UUDH 3C8KA 5GJSH 1S9XB 4OKDA 2UWEA 2F53D 1ES0B 2OR7A 4N1HB 5I15L 1BMGA 2AKRB 2FWOB 4MNGA 5E2TH 2A83A 3V79C 1QFHA 1TTFA 3FB6A 4TN9A 2J2ZA 1BJ8A 5A2IH 4WTZA 3KPSB 3MZTA 4JO4H 5TE7L 3VXNA 2FECI 3MNWA 3ULVD 2WUBH 2A9MH 5EBWB 2E9BA 4P2OA 4PUBH 4KDWA 2ICEA 2NXZB 5IMLA 2PYEB 1A7PL 1NKRA 3GKWL 4BZ1L 4QRSB 2EECA 1HQ4A 2EDOA 3JWDL 5BS0E 3D25B 4EXKA 5E8NA 3CNKA 4NQVB 4KTDH 4XCYA 3MRJB 4EZMA 4R6UA 3QRGL 4KY1L 5IB1A 3QXDA 5CZXD 2Y6SC 3SBWC 3QUMB 2RGSA 4HEPG 2ILLA 3NFSL 1JNHA 3QYCA 4XZUB 4JAMB 1EO8L 4C4KT 3OKYA 4HUKB 1RIUH 3CFBA 1ZGLP 3U46A 2B1AH 5D72H 1AGEB 5KG9B 4X0KA 1X7QA 1Y6MR 3EOAB 3HUJA 2YPLE 3HE6D 4NJAL 3IDYB 5AZEL 3BXNA 2F54E 4NRXA 3AREA 5E00B 3GZKA 5DC0A 4LLDA 2DLEA 3MV7D 2LTQC 4PJXA 3FKUS 3OKKA 1TENA 5ANMA 5KVEL 4L3CB 3BP6A 3FTGA 2APFA 1AGFA 1RUMH 4RDQG 5E7BA 4UDUA 3BQUD 1IQDB 2Y07L 5ADPH 2OQJB 1A3RL 4HCRH 2GY5A 2WLZA 4PPTA 4PJBE 3TN0B 2DM2A 4M3JA 1DVFA 4XVJL 1CF8H 1Q72H 2FYYB 3QA3A 5EPMB 5C0JA 1NGWA 3VFVA 5KN5A 2XY2A 3ILQD 5JOEA 4MDIA 4NCDA 3GFUA 1UCBH 4NGHL 1U93A 1KJ3H 3OGCB 3L3DB 5I16A 1CD9B 4RGNC 4P59H 3QPQD 1F58H 5I18H 2X4TA 2AABH 3BD5A 4GRMB 1IGIL 4L9LA 4YPGB 5LCVH 7FABH 2OTUB 5SWSA 5T5FL 4F7EB 2OSLB 4QHUA 1MCHA 4KK8D 4WI3A 1AHWC 1CXEA 3QQ4B 3ES6A 3DHMA 3VFRA 3ZZ1A 1NMAL 5DUMH 3WIFB 4NM4L 4R3SB 1CI5A 5ESAA 5F9WC 4M8QB 2BOBB 4ETYA 4XBPA 1F3RB 1TCRA 1DEEB 2YWZA 1U3ZA 1NCDH 3MV9E 5DJ0A 3D2UA 4KUZH 4QRRB 5EB9A 1H0DA 2XY1A 4A6YA 3W5MA 4HWUA 2A73B 5IB4B 1KEGH 3ARFB 1QYGH 1A4JB 5F3HB 3CX5K 3WLWD 4XNXH 1MCOH 3MRCA 3QWQB 4PRHB 3HFML 5K9JH 5CSGA 5D9SA 1G7JA 1NCUA 4DCQB 3DETD 1Q0XH 2IMNA 2LABA 2FGWL 1Z9LA 3KPOA 3KLAA 3U30C 5FUZL 1D3CA 3SE4C 3DSFL 3SJVD 2JCCF 3SGKC 3E8UH 3OXRA 3IDNA 4Z6AT 1RHHA 2ZUQC 3IFPA 4UU9A 2APXA 2VXVL 2JJUA 4QOKA 3SDYL 1PFCA 1TJIH 3GDBA 1Q9OA 3LEXA 2WIIA 4ODSL 3QJFA 3L6FA 1NBQA 1Q9LA 1YN7B 4LHUB 1QBLH 4WU7A 5ICYB 4MNQE 1KIRB 1U8OB 5H94B 2WNGA 3S5LB 1NQBA 1JFQL 5C3LD 1WV7T 2RHEA 3L3GA 1JGDA 3ARDA 5EO9B 2YMXH 4IOIB 5TQ0L 5D1QB 1KIPB 1S9KC 5D7LE 3FONA 1L6XA 2QQLL 1T80A 1J1PH 2BY2A 2R1XA 5EZJA 2B1HH 3OG6B 4HKBB 4PRAA 1PEWA 3UTOA 5BV7C 3FB8A 3SEPA 4GH7B 5INCB 3UAJD 3GMOB 3QQ9C 4OCXH 3OWEA 3B2UD 1I8IA 4NQXA 4L8CB 2Q7YA 3SGDH 4YHNA 3DROB 1FG2B 2XFXA 4LLQB 4YHML 1MHEA 1LMKA 4YXHL 4M6NH 4XHQA 2IALB 3SKOB 1VGKB 4J2XA 1D6EA 3MLSL 4ZQKB 1B9ZA 1CS6A 1WFNA 5E2UH 4ZNEA 1NCWL 4O51B 1WITA 4TUOB 5F1NB 4K7PL 1M71A 3MNVA 2C26A 4ZFZB 4WHYG 3WL9B 5DJ8A 4X6EA 3MLUH 3LCYA 4G43A 5CD3B 1S5IH 4BFBD 2FH8A 3VJ6A 4KZEL 4NSKB 4WJ5A 1U92B 5IW6B 3K81A 1R5IB 4JKLA 2D31B 3HE6A 2Y1VA 1S7SA 2BNRE 4JN2A 3U0WL 1X6NA 5D8JL 1V3KA 4YO0B 2QQNH 3DXAE 4U31A 3MRNB 3KLSA 5GJSL 3MV7A 1K5NA 2B5IB 4YHPB 3OKMB 2R4RH 1XGPB 4JY4B 4UIMA 5T5NG 1QFWM 4KVNL 3MUHL 3BQUA 2NR6D 3PHSA 4MSWB 3H2WA 4X9IA 4JO4L 4JDTH 2NQCA 1L7IL 2BSED 3QFJB 3BPOB 1NFKA 4YHKH 1LO0H 3V5HA 4HZLA 4PRNB 3S88L 4XVSH 2OXHA 5C1MB 1QLFB 5HGDA 1CICB 4PUBL 1K2DA 4R0LC 2F5AH 3AS0A 5C9KA 5FV1L 1VA9A 4DTGL 3B9KD 5F7EL 5DJ6A 2GFBA 4NBZB 1KFAH 4ELME 2W0FA 5ILTH 1EMTL 4P4KB 4KTDL 1G6RH 2QR0B 3D39B 4NN6B 1S7UA 2Z35A 1YEIH 1SJXA 5E4IA 4JFEE 4ZOEA 4XI5D 3MLRH 1G9MH 2X9YA 4OFPA 1F5WA 4FFWD 2W65A 5K59E 3RVTD 2WWMC 3ZHDA 3C2AH 3NCMA 1JK8B 1WTGT 4PRID 4GJTB 1OM3L 2DOCA 1F8TH 3CDFA 4NWTH 3PQYB 4NKIL 2HJFA 1OW0A 3VRIB 3IXAB 3RDTB 4OFYA 4HXBH 1FZKA 2CGRH 4WU5B 3TO2B 1DSFH 5CSZB 4Y2DC 1FYHB 1N64L 1BBJB 3DX8A 1P6FA 4L4TB 3L7FB 5I74B 3LKRA 1JZ8A 4Z7QF 1YQVH 4UQ3B 5BJTB 5IIEB 1VFOA 2DJ4A 3S35H 1AGBA 3SO3B 4J1UB 3SJVA 1I8MA 4JKPH 2OP4H 4HGKC 2DLFL 4CADB 3ZE2F 1HZHH 5FYJE 1QRNB 4MA3A 2R0WH 4F9LC 1HEZA 4KKAD 1UCBL 2BY1A 2GT9A 3EAKA 3R8BB 2VNCA 2GTZA 2EDFA 3BKCL 2XPGB 3JTTA 3MQIA 5DGRA 4R96B 4ZO8A 2DQJL 1G7PA 5E2WH 5C0CD 5GRZA 5I18L 2AABL 3RY6C 3MRHA 4KJWD 3SO5A 5LCVL 7FABL 2CIIA 3EO9H 3HRPA 3N9GL 5TPWH 4ZUUA 2CO7B 4PV8A 2FIKA 2DQTH 5C08A 1CFQB 4TRPH 4HXAL 1CWVA 3R06A 4JFDE 4IRJC 3BP7B 3V4UL 4YAQB 3OSKA 3DUUB 1AC0A 1FNGA 1UVQA 3FQNB 5F97E 1JPGA 5E2VH 5HHOA 3R0MA 5T3XH 1EJ6A 5IHUH 3KLDA 4HBCL 3HNTH 1P53A 1JZ6A 4X4XA 3BZFA 4I3RL 5A2LH 3GMRB 3PF2A 3VFNB 1TQBB 3RGVD 1AFVH 2AS5M 3IFLL 4OV5B 1QD0A 4Z77B 2QJDA 3HMWL 2Y36H 2H9GA 1I1FA 4WI9A 4M1DL 3FO2A 5K9JL 3U2SB 3ALPA 1B2WL 2RFXA 3WFCH 1CFVH 1KN2H 1W0WA 1BX2A 3BZDA 1Q0XL 2CLZA 1G0XA 1DQTA 2IMMA 2DBLL 2GJ6D 3GSNH 2NW3B 1AD0B 3ULUE 3D18A 4DGIH 1XGYH 2VOTA 4JG1H 1S7QA 1T21B 4DUXA 2AJ3A 4GG6A 4PJGA 3SDXE 1FNEB 2RR3A 1A22B 1N59A 1DBBL 4LCYA 1VEMA 2V2TA 4U1IA 5EU4B 1C12B 2HRPL 1KTLB 4MD0B 4YXLL 4YDJB 3O41B 5DI8B 1KC5L 4R7DB 4IMKA 4P46D 1GOGA 1QBLL 3PWVA 3BIBX 5B38G 3BP4B 3RA7H 1FFRA 4B0MM 5CP7B 3DV4A 1I8LC 3OR6B 1BD2E 5DRWB 1TCMA 1CGTA 1BVKB 3JWOC 1ZT4B 4K94H 3K8MA 4KDTC 3TVMC 1KUMA 4URTB 1PG7X 2N7AA 4CN6A 1G9NC 2VL5A 5EOCH 1A7NH 3RWHA 5KVGH 1U3HD 4YWGL 3S36L 1ZA3B 1MVUA 2FJHA 2HLFC 1IGYB 1X4XA 3IDXL 3S3JA 3L5JA 3ESUF 1EH9A 3VGDA 5JA8B 1SEQH 1AP2B 1C8PA 3LB6C 1CD1B 3QCTH 1EHNA 3IXTA 4R4BB 3TA3A 4CVZB 1IARB 1QLRB 3DX7A 3PHOA 5IGXL 4M6NL 5B22A 2BVOB 1RZGB 4LP5A 2XZCH 1QBBA 5D7JB 5IR1A 5F9OH 2UZXB 4P3DB 1T0MB 4XVTL 5CJOL 1UA6L 3O3UN 4MX7B 4X5WB 1A3LH 5L2KD 2DDQL 2C5DC 4ERSH 3EJZD 5E1AA 2ENYA 5I8EA 4U1HB 2VLLA 1ZVSB 1IMHC 1ZT7B 3MLUL 4U6HA 4PJFB 1P7KB 3CMOH 4GRWF 25C8H 3TT1L 1UXSA 1P6AB 1URLA 4M4PA 4LNVA 2BY3A 3S37X 4OF8A 1QQDB 4PRIA 4HJJH 4F2MB 3CVHL 2C1PB 4OI9A 1A6AA 1D9KA 1CLZL 1A5FH 2VLRB 3T0XA 5BVPH 5LAXB 2OJEB 3F58H 1ZT1A 1XF2B 3SDAC 1YEKH 4Y5VC 4NN5B 3MREA 2D7PA 4ZUTB 3ARBA 4PJCE 5FM4A 1WZ1L 4G6AC 1IBGL 3CH8A 4NZUH 1AR1D 3Q48A 3EYVB 1UZ8A 2CO6B 3OJVC 1F6FB 4P9HC 5EOCJ 5I30H 5J0BA 3VFMB 1HSBA 5JW4M 1JNLH 1S7RA 4X7CC 4GLRI 3VFSB 5MENB 4YHKL 1LO0L 2R2EB 5DMKA 4P49A 1U3JA 2BY0A 3EYFB 2HT4D 2UWEE 4XC1H 3T2QA 3IU4L 1MWAH 1C5BH 2IGFH 2MTPA 2QSTA 5D1XD 3IYLW 5HJ3A 4MNGE 1XGTB 5D5MF 4KJYB 1HQRA 5DK3A 3RWJB 3LKQB 5IVXA 3PP4H 5C0DB 1FHGA 2RAMA 4N68A 4JRXB 4PLKC 1H3PH 4HK0A 3RKDC 1OCWH 3H9SD 1EO7A 2EIZA 4NQED 3LKSB 5J6HA 12E8L 4JFXA 5GSVB 2V7NB 3NTCL 4QHNB 4Y7MA 4JFOB 1PYWA 1C16B 3TT3L 1YEIL 5KSAC 3ULVH 1JP5A 3MLRL 3MV8B 4H20L 3VCLB 1QACA 3C2AL 4GT7A 4LFHD 1G6VK 4V1DA 4IIQC 4RZCA 8FABA 2GHWB 4NQSA 4NWTL 2ITDA 3VWJD 4CDGC 1OY3B 4QHLA 2YD9A 2JE8A 2A6DB 3UYRH 2X40A 3UYOD 1XF3B 5JQ6H 2P7TA 4G9FD 2R1WA 3H9HB 3QIBC 3HUJE 5B38A 5FYLE 4QXTB 1XH3B 2P43B 2P5WD 5I1LB 1X44A 1P4IH 1W0VA 4TUJA 1YQVL 3K2MC 3ULSA 3S35L 4BK4A 3L5WA 5EC1A 5C3TA 1JZ4A 4JKPL 1AIFB 1HZHL 3WHXB 4U6VL 5C2UB 3ZKND 3FHAA 4PJXE 5KANG 5DEGB 2IANA 5ANME 3BW9B 4JDZB 3FRUB 1ZSDB 4PJ7A 3MLXH 3T04D 3GBNH 4Y19B 3D1MC 3LRSA 4ZSOB 2MHAA 1KLFA 5SWQA 1Q0YH 4C56D 1LEGA 3QNYA 2BVPA 4P46A 1J0ZA 4PJDF 5JW4Q 1EO5A 3EO9L 1MAJA 1G6RB 2DQTL 4P2QD 3ARGB 4TRPL 3G08A 1LP9B 5F3BB 1YN6B 3T0BA 1EHXA 3QXAB 5MERA 4YBQC 1JZ2A 1H5BB 4Z7UF 1EIBA 3DBXB 3HNTL 4L1DA 2NY2B 3VD4A 3SPVA 4RNRA 4MNHB 4LSUL 4GQ9H 4OCYH 1FL5B 1U3HA 2I24N 5EU3A 2AI0L 2YK1L 3MLWH 1HHHA 5SWSE 1FN4B 2VC2L 3RVXC 1DQMH 1OWRM 2J4WH 1IC1A 1Z6JT 1A9EB 3DX6A 1NH6A 4FQJH 1F11A 2Q7NA 3T3ME 2FJGB 4U1NB 2ZCLH 3WFCL 5T33L 4WWKC 3I75A 2EH8H 2NY1C 2PXYC 4AH2B 3BO8A 3OQ3B 3UPCA 4YNYB 5A16B 5EUOF 3KWWB 3BKYH 3UTTB 1A4KB 3I6GA 1XGYL 4JG1L 4OZ4B 5T1MA 1PKOA 2Z31C 4H0HB 3VXTA 1CDYA 3G6DL 2NY4D 1SMAA 1YDPA 3QEQD 1MFEH 2X4SA 3BKMH 2V7HB 5HHVL 5HHXH 5F7HA 5EFIB 3MRLB 5E8EB 2NY0D 2QADC 2GJZB 3SGJC 3VE0A 3RA7L 4TULH 4KI5C 5AAMA 5GGRA 1ROWA 4CMMB 2B39A 4NC1E 1JZ7A 5FUOL 1CU4H 3BJ91 4Y2OA 5IBUG 4DK3A 5CCKL 1M1SA 3FOMA 5F7DA 3VXNB 5IT2H 4QOKE 4GKOA 1CE6B 1YJDL 3HCVA 4XC3H 1GPOL 3U36B 4IRSB 4RFNB 2ID5A 1XGRA 5EOCL 1A7NL 2VXSH 4JZOB 3UTSD 4MHHG 4OAWA 5T1LD 1OP5K 1ZHNB 3QDGA 4F7PB 5F71A 4ZMAT 4FXGB 5DTFB 1F45A 3G5XA 3QI9B 4X98B 5TH2B 3BSZL 4D9QE 3BYTA 5K93A 5JORA 5C0BB 4OGAD 1K8IA 4MA1B 4LP4A 1E4KA 2FJFA 2NY5H 3V4VL 4NO0D 1UWGL 3VFGH 5FYKL 1SYSB 3RIFK 3GIZL 1UH2A 4U2YA 4G6ML 5I1AA 4OM0L 2H2PD 5IB2A 3LKPA 3GSNB 3IJSB 4HHAA 1I4FA 3I3EA 1AD9A 4MS8C 2VQ1A 3O11A 2AXFB 1OP3H 1MREL 1QSFA 4J23A 5L7XL 5HXMA 1A2YA 4XRCA 2FX9H 2YPVH 1INDH 4EQ3A 4MA8H 1FO0L 2E7BA 3CMOL 3S4SA 3I6KB 1A1MB 4NP4H 4XH2A 5MEQA 1M05A 3TBVA 4YDLB 1KTDB 1T20A 1O0VA 3OHXB 5MEPB 4HJJL 3IDJA 4FG6D 3U9PH 4X4ME 4LNRA 3ZLQC 5B8CA 3I9GL 5BVPL 4X5XA 3B43A 3F58L 2E6PA 4DWHA 3QUYA 1YEKL 5I1GH 4EI5D 1U91A 4OBRA 1ULVA 3RAJH 1A0QL 3U0PB 4HULB 5C0JB 4YE4H 3KPQB 3KHOA 4NZUL 1CGUA 1UH4A 4BFIA 1U58B 4LPCA 5CEZD 3THMH 4M1CC 3CC5B 3F7YA 5BZWB 4XB8A 5T1KB 1Q1JL 4L9LB 3PWLA 1DE4B 3S37H 5IOPB 4Z7WF 3NIGF 5HGHA 4KXZI 4XX1G 5L9DH 5IVZA 4NWUL 3VFRB 3K8LA 1I9EA 4HFUL 4FP8L 1IKFH 5FDYA 3PP4L 1Z0NA 4XBPB 4AQOA 1TCRB 2NPLX 1H3PL 4KRPD 3JV4B 5EORH 1OCWL 5EG6C 4ZAKC 2VLME 3BE1H 1AO7E 3WIIL 1B0GB 1H15B 4XPBH 4BSJA 3QO1A 3MRQA 4LCCA 1RZ7L 3CK0L 4BKLB 4MAYD 5SWZD 3IETB 4PG2C 1E27B 1KLUA 1IM9D 1NC4B 1I7ZB 3MJ6A 3O3DA 4XMKH 4APQB 4NRYB 1IM3B 2W38A 3KPRA 2YUVA 3BAEH 5IK3B 1VHPA 3KPOB 2NY3D 3DMMC 4IHOB 4YDVA 2NYYC 1K4DA 1J1XH 1XIWD 3V6BR 1NGZA 1T3FA 3UYRL 1D5BB 2IADA 3FO0L 4P3WA 3MR9A 5JMOC 5JQ6L 4Z0XB 1MFCL 1CN4A 2HVKB 1RHHB 3I02B 4NNPL 3DVIA 5JR1H 4FQ1H 4LLAA 1KV3A 5IJKA 4Q0XH 3VFTA 3NPSB 5HI3D 3UX9B 4GS7B 4OLXH 1ZK9A 5JPNB 3QB7C 4WU7B 3FRPG 3KNBA 1FORH 2J8UB 3CVHA 1MCWM 1MEXL 5D96B 8CGTA 5DD6A 4KK9D 5HHNB 2HJLB 1DBML 1UWEH 1T4KA 5KSBA 3QEQA 5F6IC 5DRXB 4KRMB 1NDMB 2VTFA 3VRLF 4UBDD 1G7IB 1MWAB 3WFDL 43C9A 3GBNL 3VDBA 4UOW1 1T2QH 3WFEH 1Q0YL 2EDWA 1RY7B 5J06A 1A7QL 2F53B 4WUUD 5EZJB 2V2XB 4M9OA 4P2RD 3BEWA 4PRAB 5ADOL 5HGBA 4UUJB 1XF4A 4UT7H 4J8RA 5JA9A 1T1WB 3QUZC 5DEZA 4UDTB 4PRPA 5GS0D 4MXWL 5DMJB 1FFPB 4NZJA 3WXVH 1TPXC 1OT1A 1RZJC 5D7KE 2BRRH 1M7IB 3OG4B 5C07D 1MJJB 3ZTNH 4D8PA 4WEBL 1I1YA 3UTSA 4RQQB 3G6JA 5T1LA 2HTLD 4OCYL 4QRQA 3MLWL 4XNMA 3ZKMD 5C08E 1JUFB 3LD8B 3U9UA 1WTLA 4LF3A 1DQML 1W2KT 1OGTA 4QF1A 2J4WL 3QPXH 1MUJA 3U0TB 4M6OL 2BSTA 5HHOE 4KMTL 3O6KL 4NO0A 3CXDL 2BDNH 4MYWB 4N9GB 1T66C 4K3DL 2VWEE 5EOQH 1OSZA 4NQTA 2YA0A 1J9CT 4KPHH 2O61B 3G5VA 4XTRC 3MO1A 3FO9A 4KHTH 3C60D 5FO9A 2F8OA 5HHXL 5IQ7H 3MBXL 1S7XB 1NBYB 4JFYB 1NFDB 4PJEA 4WW2A 2WWKO 2E3VA 3WUWA 3QDHA 2OI9C 3UJTH 1UADC 4LLMB 2PO6C 4F57H 5FHBH 4KVCH 3MOBH 5HYQB 4GG6E 3HE7D 4PJGE 1F4AA 3A6OA 4LVNB 2X4PB 4L5FL 4E41E 4XC3L 3SKJH 1FL6B 2JK5B 1UXWB 3M8OH 3LOWA 5E08H 1JI1A 2VXSL 2I9LA 1CE1L 1MRCH 2P8MB 1KPRB 2CJUL 5INDB 3DVNB 2BSSB 1JIBA 4IRZL 2FGZA 4PB0L 4LLYB 2IQAB 1NAKL 3TH2T 5DJZA 4EI6B 4KK5D 3MBEB 5E56A 2Z4QB 1L9MA 3O6FC 5DXWA 4P5TC 5IESH 3QQ3A 4OUUA 4UZGA 4N1CA 3VFPA 3N1PC 3K2UH 3EHBD 2CPCA 3WE6B 4OJFL 1AXSB 4Z0BH 2AXGA 1G7QA 5I17A 3AAZB 2CK0H 1CLOH 4AZ8A 1BOGA 1ZVHA 5EO1B 4E9LA 1RZKH 4JVPA 4I3GA 1YEHH 3CFKA 2R2BB 1Q94A 1QLEH 2RBLA 1MOEA 4GAJH 5C0AD 1JN6B 3STLB 3TBYB 5GZOC 3EJJX 4XAKE 2FX9L 3KPMA 4MA8L 5SWZA 3BH9B 3VGFA 5HVFB 4NKOA 1X9QA 1RURL 3QEUA 4G5ZH 4P23C 3FRPA 4RMTA 2Z93A 3BDBA 5F21B 3RVWD 4P57A 4S11A 5GPRA 3JWOH 4UI2A 2CDEA 4FNLH 4ISVB 5LGJB 4MAUL 5I1GL 3UZQA 3RU8H 4YE4L 3LRHA 4UOJA 3K80A 1HILB 5BV7L 4U1SA 3HI6H 4ZO7A 4NQCD 3MTRA 2C4FU 2F9BT 1FVDB 1R3LA 3MRHB 4LRIC 1GIGL 2Y72A 4HV8A 4I5BB 3T0ED 3TNMB 4KC3B 5D1ZC 3B2VH 4DFIA 4G6JH 2FO1A 1HHGB 2B0SH 1YNTB 2QQKL 1N0XL 3IJHA 3VXPA 5CGTA 4N90D 1YEGH 2VN7A 3OB0K 3BKJH 5DD0L 5GHWH 3ZKXB 1IKFL 2X1PA 4ZPTA 3LH2H 3IJYA 2EH7L 4I77L 5CKGA 5E8PA 4WUUA 4G8FA 4KQ4H 3C5JB 4KTEL 1R24A 2ICWB 2YD7A 4P2RA 4B50A 4LQFH 5E7FA 1PGRB 1IC7H 3BE1L 4B41A 1KCSL 2N1KA 4Y4KD 1IAMA 4XPBL 3VXQA 4OCLC 3BH8B 3T4AB 3FT2B 1DDHA 5CAYB 5J12B 4LU5H 1GSMA 5A2KH 2OMNA 4LSVH 4PBVC 2FRGP 1BIIA 3BT2H 3BX7C 5TJWK 1X4YA 3BAEL 1KB9J 1I3VA 1J1XL 3PWUB 4QXUH 5C09D 4BM7A 4ETQB 5C0EA 4OGZA 5KVDH 4Y4FC 1J88A 4EN3C 5E9DD 3SDCD 2R69L 2PCPB 3KYOB 3E6FB 1EFXD 3MRMB 2E8YA 4NDMB 4RGND 1A1OB 3TEUA 2R1YA 4N8CH 4U1IB 1FO0A 1NMBH 4ODUB 4V1DE 5D6DA 2VUOA 4OLXL 4IDJL 3ARXA 2G75A 3GMQB 1IZKA 5C0GA 3BRFA 1FORL 3TBWB 2XYCA 3D39E 1S7WB 3GJEB 4K7PY 3RTQD 5CMAB 1C5DA 2M2DA 2R0LH 3DV4B 1T6VN 1BWWA 4M7JH 3LQZA 5HD8C 4PGCB 1DTUA 3C60A 4RWYL 3GUTA 3CDGA 1F4WH 1SHMA 1TJHH 4MA7H 4OD2B 1T2QL 2AK4D 4ZS7H 4YHIA 5ACZB 2AQ3A 3UBXB 2VXTH 3LIZL 4PRDA 5D93C 2DAVA 2JCCA 2A77L 1DR9A 1JNNL 3GM8A 4HUUA 5ESQB 4UT7L 2ADFH 2IANE 4U3HA 4HPOL 3CX5J 4PJ7E 5GZND 5HTSA 3INUL 5CJBA 4ODWB 1I9JL 3IXTB 3AC0A 4Q6IA 1GGCH 3PHOB 4GG8A 1KN4L 4HUXB 3OJDA 5CWSA 3O4OB 3B9KB 1U8KA 1T7ZA 3H3PH 4MJ2A 5JOPD </