5D7JB

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB02
1IAIM 4XPGL 1A22B 4FQHA 4RGOL 2DS4A 4PJDF 1DLHB 2XWTA 2AERT 5E8PA 1FQ9C 4Y19A 3D25B 2ZUYA 1YEKL 3I2CL 5KVGH 4QF1B 2UZYB 2N56A 5D7JC 1CU4H 4HGWB 1HZHH 2ZG2A 5TQ2L 5D72L 3CC5A 5KBNC 4GKSB 4R4BB 1MREH 4WTWA 1G9NH 4YDJB 2IADB 4M7JL 3M17A 4DN3H 2P5EE 1IFHH 3I50H 5FCSH 1OY3B 2XQYK 1OHQA 5D7IA 1T1ZB 5EBLA 1MHEB 1PAMA 2H2SC 5AWNH 5T1LB 4KJYB 3RX5A 2ICEB 4Z0XB 3BUYA 3W0WB 5C8JA 4O9HL 3IS0X 2VB5A 4MA7H 4KK5D 4NKMB 3SDXF 4UDUB 4NKDA 4C58B 4ZO8A 4K8RC 2H8PA 3DUSA 3CLFL 3MCG1 1AHWB 5J0BA 2VLJE 2HLFC 1BZ9B 2HVJB 4N1EA 5C0BA 1LVEA 3U7YH 1E27A 1JV5A 5GHWH 1I1AD 4PREA 4P23A 4P59L 3VFSA 1U8IB 4G9FE 3B9AA 1HNGA 5F88A 4W81A 4GQ9L 3H3PH 1MHCA 3HI6H 3K4ZA 3ARGD 3ULUF 1FP5A 3GSVB 5CSGA 3RPIA 1LO3L 4X6CB 4X4ZA 1NC4A 2P4AB 3OXSA 1G7IA 4YLQT 5DRWB 2OTWA 3OXRA 1DANT 1ORQA 4FFVC 1UM4H 1EFXA 1JI2A 2BVPB 1XEDA 4ZQKA 4F15B 3TYGL 3VG9C 4D0BB 2EDHA 3VDAA 3L95A 1NFDB 5D1ZD 4KZEL 2P1YA 3FB5B 3O3UN 5HGHA 1Q38A 2CLZA 4UU9A 1SJEB 3I84A 4JFEE 3IU4H 3TPUB 3MRLA 2JCCF 3KPQA 4AJ0A 4X5LA 5C0AD 4ALAH 1UYWL 3LPGA 1J1OL 4M7LT 2FH8A 3NCFB 3BQUC 2FDBP 2C3VA 1NEUA 1YMME 4MS8D 4XCEA 5DD1L 2VZTA 5FDWB 3PL6D 1S7XA 4MQXC 3WFCH 4NGHL 4CKVX 2GJZA 4L8SB 3C5ZD 5GRYA 4X80H 1F2XK 4PR5A 4M5YL 1A4KB 1B3JA 3MOAH 2FYYA 5D2NA 3U2SB 4LSUH 1JK8A 5CCKH 3VE0A 5F7YC 4HXAH 3N50A 4CADA 4TSAH 2BHZA 4GW4B 5FXCH 3NFNA 1MI5B 4Y2OA 5I1LA 4WFFE 1ND0A 4X7CC 1C5DA 2FHCA 5EUOF 3ZKND 1WZLA 2KH2B 3JV0A 1JRHI 5EZOL 3SE3A 4PPTA 3MJ9A 5KOVC 4PJHE 2X1OA 1FV1B 3EYOA 5DLMH 1G7LB 3EOYG 1P7HL 3S4SA 2UUDH 4DAGH 5KSVA 3S88H 4ZTOL 1DQLL 2EDDA 4G8GA 3BP5B 2EDBA 2GJ6D 3OPZH 5IMKA 4FFWC 3BP4A 1HHKA 3MLYH 3DMMD 3H42H 5F6IC 1CGXA 5CEXA 2UZIH 1SYVB 5KTEH 3TH4T 5DGRA 2PR4H 4QOKA 3QHFH 3SJVD 1WCBA 4DWHA 3MRGA 3WEXA 4BH8B 3MR9A 4H0IA 2BK8A 4NQSA 1B4JL 3BH8A 2NY3B 4M3JA 5IG7B 4WHCA 2VDLL 2XN9E 4HUWA 1RUMH 4MVBD 3C6SA 4P23C 4Q0XL 1IBGL 1J5OL 3NA4A 3G6DH 3ALXA 4MNHA 5CMAB 4TUKL 5E70A 3D39A 3F12A 3VJ6A 1A6ZA 4HS6A 5HGAB 3MBXH 3GMQA 1BLNA 3G5YA 5E6ID 5K9KA 4XX1G 1CVRA 1J8HA 3ZKSD 4GAYA 1P4BH 1P7QA 3LEVH 3UP1A 4M1DH 3HPLA 4P0DA 3NPSB 3MBEA 5DQDL 3UTQA 2Y7QB 4M5ZL 4UQ3A 5I76B 5IW6A 1NCBH 4LLDB 3W39A 5J12B 3DTXA 3L5JA 5JXEA 5D93C 3PF2A 1BD2A 2ED8A 3AFLA 4FTVD 4S2SB 1JPSH 1KB5H 2HTLD 2BDNH 1JHTA 4P5MB 4DGYH 4OLWL 2G2RB 3W9EA 4FQCL 2D2OA 1T03H 4ZNEA 4WI7A 2A77H 1LEIB 1A9EA 4NQEA 3AB0B 1K8IB 3RWFB 4NKIL 5DJ6A 4JFFA 1DBMH 4PJGE 1N26A 3EDDA 4ZPTB 3MNZA 1XCTA 4ETYA 1HKFA 1J0HA 3KXFE 5F1IA 3WUWG 5GGVH 4IOIA 4LLVB 4AMKL 5D2NC 5I30L 2A0LC 5DVNA 4NC0B 3VA2C 2ZOLB 1ZWIB 4ZSOB 1P53A 3ZHLA 4DK6A 3KPRE 4AIOA 4FQ1H 3UJIH 2B7DT 4DKDC 4TULH 1BX2A 2AK4D 3Q48A 3VI3F 2CRYA 5DJYA 4RNRA 4XPFL 2EXYC 4LVNB 4OLYH 4XCYA 1CLOH 1EEZA 2WWKO 5HYIA 2DI8A 2DQEL 4ZUWA 2C3HA 3R0NA 2DL9A 4MA1C 5GRUH 5IW1B 2Y9RT 2DM3A 1WGOA 1FSKC 4P2RB 3OKKB 4HKJA 5IW3A 4JQIL 3SE3C 2X4OB 5D7LD 1IC5L 2CRIA 2XNAB 3LEYL 4J3VA 2H45A 2J4WL 3EJYD 2R2BB 3RZCB 3FZUD 3FCTB 5J3HC 5HVGB 2XQBH 1EO7A 2QQLH 5DRZA 4FQIH 1J0IA 4Y4HB 4HIEA 4K23H 3MA9H 3LHPL 4LF3B 5GRVL 4U3CA 4NC2B 3HG1D 3S97C 2YPLE 5DWUL 5EIVA 2R4RL 3VGEA 1T3FA 1YNLL 3JBG7 1A1OA 2X4NA 1MRCH 5I16B 5FHAL 5BJTB 4HXBL 3X3GH 1DQQA 4U6XB 4PRHE 4P3WA 4M8QB 4WJ5A 2RCSL 2QADD 4JDVB 4B41A 2QJDA 4KKBD 1PY9A 5I1GL 3CH8A 2WLZA 5C6TL 4JQVA 1E4WL 1I1AA 3V0WH 5KAQF 1MFDL 3SOBH 1KEGL 4LFHD 1CLYL 1FFQA 1GSMA 1LD9B 4Z7QE 1X6LA 4NT6B 4OB5L 3BAEH 4LLYA 2FHBA 1X7QA 5DJAA 2YD5A 3HCVA 3QWRD 1RMFL 3ARGA 1FFRA 3F6LA 3ULVE 3WN5B 1BFOA 3LSOA 1HH6B 4M02A 3MODL 3MO1B 2XTJE 4LHUD 4GXVH 2AEIT 2BFVL 5E9DD 5AYUL 1JPFB 1BIIA 5I1CL 1H3XA 4I5BB 3EOBA 5AG9A 3PP3K 3GFUA 3OZ9H 5D1ZA 1J1XH 3T04D 5JXEC 2EIZB 3B5GA 1C16B 3O45A 3MRMA 1RJYA 3F7YB 1MH5A 1ZVSB 4ELKA 2PXYB 3WFBL 5KSUA 1PY4A 4HCRH 5IBTH 5C0AA 4M7LH 1U8HA 3MRKA 5KJRH 3IETB 3ESUF 3FRUB 4QEGA 4C56E 4OD3H 5DJXB 4OSUL 5TFSL 4QKXB 1T1WA 3PL6A 4X7EC 2HKFL 1I1FA 1XIWB 4NYLA 3C5ZA 2HTKC 3TYFB 1DE4A 5DFVD 5INCB 2CDEB 3ARVA 4NHUA 5IP4A 4B53A 2APWA 3BJ91 4WUKH 1MCWW 2G75B 3H2WA 4M4RA 2AEPL 1DUYA 2I27N 2O93L 1S7WB 1C7TA 1J12A 2FB4L 2FEEI 1NAMH 1BIHA 5DMJB 3P0VL 3QG7H 4U6YA 3CXHJ 4U7SA 1LK2B 1CK0H 1CT8B 1IGFH 1CFSB 1JGVH 2F5BL 2IPTL 2DKMA 5EU5B 2D9CA 5JW5B 5TH2B 2PTVA 5DJ0A 1AKJB 3WIHA 3B6SB 5DEFB 2NXZB 3ARBD 4P99A 4R96A 1NPUA 3B5TA 1QTYT 5I8CB 3IF1A 4RWYH 2N7AA 1JYVA 2Y25A 4PJFE 3QULA 3R1GL 5I18H 1VENA 4QTIL 4Z95H 2GITA 2Y5TA 4WEBL 4CW1A 1AXTL 2QQKL 1MIEH 2R8SL 2GJ6A 3OKYA 4YNYB 2DQTH 3DMMA 4NKOA 2D4DA 1AQDA 1DSFL 2BVQA 1FGNL 2VE6A 4KK5C 1QZ1A 1KJMB 1RU9L 3K80A 5IHZB 1EV2E 4AENA 5HGBA 3QEUA 5KN5A 3OKOA 3SJVA 4ZFOA 3MNVA 3VXQA 4UQ2B 2X4UA 1T1YA 2APXA 1B0GB 1T04B 3S37X 1BVLA 1C08B 5EOTA 3GJEB 4LKXB 1AE6H 2VQUA 3IJSA 4JQVC 4LNRB 1I1AC 4PJEA 3WL9B 4NBYB 4O58H 4EDWH 2BRQA 5ANME 1AP2A 1GOHA 1MCJA 1KBGL 1OGTB 3U0WL 2QQNL 3ARGC 5E6IA 4X6DB 4I3GA 4Y4FD 5CD5D 2DLTA 3BZFA 2JJVA 2Q6WA 5F96H 1N4XL 3AAZA 3EBAA 3ZDXE 1TTGA 3HR6A 2NW3B 3UTPE 3VRJA 1PG7L 3RGHA 4PYGA 1AQKL 1E6JH 4JKMA 1KEMH 1MCRA 2I26N 4NZRH 1M6OA 1V3KA 3MRPA 1FZOA 5KVEH 1WVZA 5IT2L 5D1ZC 3LAFA 1U9KA 5LBSH 3G6AA 4L4TE 3TH3T 5C0CB 2HLAB 1HXYA 5FHBH 4XC3L 3QEQE 2VYRE 3HMWH 4TRPH 3LKPA 2I9LA 5GRWA 2R56L 2EIDA 2WINA 3HUJE 3ZYIA 4MX7B 4LBEA 1RJLA 3VDCA 4M61B 3N1MC 4JFDE 2CXGA 4W4OA 3GJFK 4Y5VA 3MLRH 3ZTNL 1BJ1J 4P2OB 4PLKD 1DVFD 4MS8C 3LN9A 2JB5L 2Z8VC 5HGGS 3VFWB 3PL6C 5DVMA 2Z4QB 5I6XC 2AJVH 4G6JH 4PBVC 1KFAL 2WMPA 1Q72H 1QSEE 3RWJA 3C5ZC 1IKNA 1KCUH 3AVEA 1AJ7L 4PGDA 5DEGA 4KV5F 4U6HB 1BHGA 1MAMH 5C71A 5HHXH 1CDGA 5INDB 3QUKA 3O6ML 5I17B 2VXUL 3DHJA 5GGRY 4GKNA 2XTLA 3X3FH 3QI9B 4WW2F 1I9RL 3CD4A 4JANB 4WGVB 2BOBA 2VR4A 5H8DA 5HYJE 4YWGH 4WHDA 4RAUA 3T65A 2AK4A 1RZKH 1F02I 5CINH 4Y5YA 1Y18A 4GRMA 4UTAH 3IFPA 1U6AH 1JF5A 1WAAE 4UOW1 4U3HA 2EYSA 4YE4L 2MHAA 5I1DB 2Z31B 1F8TH 4XPHH 1F90L 5D7LA 1A1NA 4XZUA 4NRZA 1CGSH 1U95A 1AD0B 3LEXA 2I9TA 5TF0A 1Z9SA 2DIJA 4DUVA 3IU3B 4G7YL 5EO0A 3RI5F 3HG1A 4PJIB 2XWBA 2W59A 3UYPA 2AJXL 3DMMC 5KZCB 1CR9L 1HEZA 5DMIL 5CP3H 1P69B 2Z91B 5CZVL 1F58L 3P4OA 3S35H 1FYTE 5EA0L 1M1SA 3LDBB 3D0LB 3KPLA 4NN6C 4EDXB 4M93C 3PWUB 1IRAY 3FB8B 4CN4A 3P9MA 2RFXB 3V5HB 1KXQE 3FO0L 2O61A 3DETD 3JWOC 3RVXD 1KELL 3MYJB 5DC0A 2FSEB 1OVZA 5EBMA 3OR7B 3C6LD 4MVBC 4WFGD 1R3IL 5T33L 3G5XA 4A2MA 1MCKA 3MV9D 4NZTL 1M7DA 5E6IC 1R24B 1RULH 4JFXB 3QWRA 1AH1A 5GGTH 3KYOA 4ZMAT 5DR5L 3BVNA 5J13B 4L8BB 4N90E 3FQUA 1S9WB 3QWQB 4DN4L 4JFQB 4LHUA 4EEEA 2VMFA 1NCWL 5E9DA 3VXTB 5GIRB 5I15H 3MCLL 4E41D 2C9AA 3P30L 2VLKE 2BOCA 3TJHD 3QDAA 2HT4D 1MJ8H 4IJ3C 2EC8A 3OR6B 5D8JL 1CFQB 1YEJL 5EZLB 2J8UF 3S36X 2AEWA 3H6JA 4HS3A 2HTLC 1JNLL 4HULB 1Z5LB 2NY4D 5I8KH 3KHQA 1CYGA 3EUUA 1WC7B 4NDMB 4W4OC 5E94B 1KENH 2VDPH 4Y5VC 2Y6SD 3JWDC 4HUXB 1IZJA 1C5BH 1CICD 5FO7A 4XAWH 4BK4A 2OLDA 1LO2H 3VU2A 1G7MB 4UAOB 3O2DA 3ZT6A 1IKNC 5D1XB 4M48H 1KLFA 1NEZA 5GRJL 2R9HD 4J6RL 5FECA 1LP9E 1ZLVH 3RDTB 3BEWA 3PWPB 4N9GA 2X1WL 2BNRD 4DGIH 4JPKL 5GSVA 4X6FB 1MFEH 2LAGB 4ODXA 1MFAL 3O2WL 1SMAA 2V2TA 1FO0A 3QDGB 3OJDA 1J9CT 3BYTA 5GXBB 1K4DA 5F3BA 3V79C 4JR9L 4TN9A 4Y5YC 4L1HA 5I2IB 1CBVH 1JGEA 1YNKL 3AS1A 1IGIL 4FTVE 2B39A 1NCCH 4NSKB 4ERSL 3UROR 5I0ZA 1JHLL 5FUOL 1YYML 5BS0D 3ARBA 5LXGH 12E8L 2DWDA 4JHZA 3HC0A 3EJYC 2DQIL 3FZUC 3GI8H 3T0EE 3UTTD 5IFJB 4X6CE 4OCRH 4OUUB 4C83B 2J2ZA 4GMTH 4K94C 4ONHB 5A16A 1BFVH 5FKPB 3SGDH 1YNTB 3MREB 3OTTA 1WSST 3P3YA 2MFNA 4G6MH 1MCLA 3VXRB 5IBUG 5EIIB 2CIKA 4QCIA 3MRIB 1EXUB 4YDIL 3E3QE 1XR9A 3ISWA 2HJFA 2ZG1A 2D03L 4PJ7B 2QADC 5T1MA 2V9QA 2BSRB 5F9OL 4KKBC 1ZE3C 4X9BA 4M6MH 1DN0A 1MEXH 1UB6A 1ETZA 1KACB 4RIRB 2F54B 1N2RB 2XT1B 3MV7E 3ULUL 4YXKL 4F58L 2DI9A 4H1LB 3T3PE 3VDBA 4E0RB 4WWKB 3L9RA 4Y4FA 1N59A 3MZTA 1MFCH 1EUUA 2B5IB 2PW1A 3MLVL 4JZNA 4G6FD 5HHPB 2PTTA 2V5SA 3P77B 5M7QA 2B0SL 4I9WE 1C1EL 4O4YL 1I8IA 3FONA 4QRTB 4I4WB 3HFMH 4RQQB 4OFVA 5FUCC 3IDNB 4HMCA 4HEME 4Z7UF 1KC5H 1H3UA 3CFDB 4NQCD 2IQAA 3L3JA 3UO1L 3DBXB 4LEOB 2Z92B 4YHIB 3V4PH 1N7ML 4F7MA 4JHAH 1IEBA 3MLUH 1CDCA 5LG1A 4ZS6C 2HVKA 1UGNA 3B2UD 2NPLX 5F1NB 2X2YA 5IVXE 5FKAA 1AO7D 3TT3H 3QXDB 5CIPA 2VZOA 6CGTA 5IM7B 1YZZA 3U4EB 4JO3L 4HSQA 2Q8BL 4LARH 4NHCL 3IRPX 1BF8A 3ZKXB 1A7OH 4H20L 4PTUB 3WCYA 3MUGB 3SKOB 3CXDL 5L8LB 3HC4L 2OQJA 2UZXB 4JY4A 4Z6AT 2DQHL 5MP6L 4G7VH 2GYSA 2Y1VA 2NTFB 3GMLB 4G6KL 4K3DH 1T21A 2AJSL 1PGRB 1PD6A 4UIMB 3VWJD 3DYPA 2EDWA 1E28B 5KVGL 4CJ1A 3FFDB 1CU4L 3O4LD 2Z8WC 4OZIE 2VJXA 3ECBB 1OARH 43CAB 3Q3GB 2PUQT 3F6IA 1MREL 3ARBC 1G9NL 3A6CH 4DN3L 1IFHL 3I50L 4KXZH 1XF5A 1VGEH 3QUMH 4AY0A 4OLEA 3IS1X 3I3EA 1I3GH 5AWNL 1AGFA 3IVKA 4CL7A 3OGCB 3DARA 4GKZA 3FN9A 3NN8A 5BXFB 4MA7L 4PGZA 5HHMD 4Z7VA 2PTUA 3M07A 3QEHB 4KROD 2MWCA 4X6BA 3TESA 5M94B 3JVGA 4P9MH 1T5XB 4JVWA 1SHMA 4HF5L 3E6HA 5E56A 5IB3A 4JLRB 1MRFH 1S9YA 3NZHH 1JPGA 3U7YL 3IDJA 1S7QA 4L3ED 3ARDB 5GHWL 2CIIB 4L9LA 3NCYS 3RPKA 1LEGA 4G9DA 1PKQE 3VXME 1FORH 3DROB 3DX9B 4RDQG 5D5MA 4GS7C 5DI8A 3H3PL 3HI6L 4LU5L 5EFIB 3C6LA 4ZYKB 5J6GA 3SGEI 5IQ9A 3KYNB 1S9VA 3KYMA 3H9YA 5C09D 2VZVA 4KI5D 3MPCA 2DKUA 3MV9A 2ZSWA 5ITBH 3T4YB 5CD5C 5J57B 1UM4L 4CN1A 2JIXB 2VRAA 3ZO0A 1EEYB 2VQTA 1JIBA 4PBXA 1UEYA 2ZSVB 2NNAB 2B1AH 4RA0C 2DMKA 2FBJH 3IDIB 3IU4L 4JRXA 4ALAL 3TM6A 4V1DD 1FN4B 3W82A 4XB7A 1YPZA 3VFNA 3B9DA 2FO4B 5BZDA 3IFNH 5SWZE 3QH3A 4S1RL 5GRXG 2LU3A 2NZ9C 3KS0J 5CD3B 4YX2H 3HPJA 4QRRB 3WFCL 4P5TD 4BFEA 2H2PD 2QSVA 4PLKC 4U1SB 4X80L 5MENB 3OB0K 3LB6D 2ZZUT 1CICA 5L6YH 4ZOAA 1LDPH 1RJZA 4YC2C 4A6YH 3KHOA 3MOAL 4ODUB 1FNEA 4LSUL 3UCRA 3H7LA 4HZLA 4PY8I 5CCKL 4G43A 5ID0B 3V0VA 1SJVA 3VCLA 4S1QH 5CKGA 1T22B 1JZ8A 1FFPA 4Z7VF 5KVDH 3QCUL 4TSAL 5C0IB 2BNRA 4PGCB 3NCYP 1CGWA 1GC1H 1U8LA 4XT1C 3IDYC 1BFSA 3STLB 4IDLA 1HYRC 4LCUA 1D5ZB 4TNVK 5CS7A 3GM8A 2AAVA 3MRFB 5SWSB 2LV4A 4Z5RB 3UMTA 4YBLC 3ARFD 1RZJC 5TE6H 5B39B 3D2UB 3UC0H 5D5MF 2W9DH 5DLML 3LN5B 3IJHB 4DAGL 1NANH 5AEAA 2GSGB 5BS0A 3B8YA 1I8MB 4M1CD 2DLFH 3MRJA 4P3DB 5MI0B 3OPZL 4HIIA 1OWWA 3UTTA 3PHOA 1G9MH 3H42L 4U1NB 2UZIL 5CEYB 5KTEL 2PR4L 3BW9B 1LHZA 3JVGC 3QHFL 2MQ3A 4W6YB 4YIQB 3R06B 3H9SB 4F7EA 4LCYA 2NZIA 1U3ZA 4QXUH 1JF6A 4L9LC 1RUML 1DDHA 3KPOB 3DIFA 3DETC 3G6DL 1JWSB 2GEEA 3JV6B 4FQXB 3RVXC 5E03A 1ZA3A 5CBEB 2FIRT 2OR7A 1WWBX 2BNQB 4OT1H 3C6LC 5LAXA 3MBXL 3B9KB 5A2JH 2MNUA 1HHIA 2O26U 3FQXA 3L3GB 1A6VH 2P8LA 1P4BL 3LEVL 4M1DL 1WITA 1UXSB 4EBQH 4Y89A 1GOGA 1H15B 3V2AR 1B4RA 5K59E 3WHXB 4Q9RH 3L3OB 3SCMC 1NCBL 4NPYB 1NUFA 5K9QI 2IG2H 3TVMB 2J6EL 1NLBH 5JHDD 5EOCH 3TJHC 1G0YR 2HT4C 1NUNB 3OAYH 1JPSL 4LSTH 1KB5L 1JZ3A 1J86A 2BDNL 4JPIA 4DGYL 1N6UA 1KT2B 3D18B 1T03L 1UVQB 3EIFA 3O0RH 2A77L 4NQCA 3KLAA 1JF1B 2NY4C 1UADC 1DBML 3SDCD 1EJ6A 4ZS7H 2Y6SC 3REVB 1XGPB 4FA8A 3SY0B 4POUB 1XGQA 1CICC 4WFGE 3GBNH 4JO1H 5E1AA 5GGVL 1AO7A 3N9GH 1ZHLA 1LEKB 2FRGP 3TNNB 1D5IH 4O2EB 4BQCA 3MV8B 4FXGA 4XVJH 4R97C 5DSCB 2QTEA 1JP5A 4FQ1L 1UC6A 3UJIL 3VA6A 2GTZB 5DQJB 3I6KB 4YDLB 4TULL 1BQLH 4DVBA 5FA3B 4D0CB 1L6XA 3VFRB 4Z7WA 2DI7A 4OLYL 1IAKB 3D69B 1CLOL 5L2KE 3RQ3A 5DRXB 1UJ3B 1YC8A 2Y4SA 4GRWB 3DV6A 2PETA 5E5MA 5E8EA 3VWJA 5GRUL 3VXPB 2BZDA 4JJ5B 5T1DH 4R7NA 3WKNA 5GZOD 4QNPE 2VR9A 4L4VA 2GFBA 4MNQB 3OJVC 1DBBH 3HZYA 3O4LA 3RWDB 4LGPB 3O6KH 3PDOB 3X14A 3ARRA 1IILE 2XQBL 5GS1A 1F45A 2QQLL 5FOBB 1M05A 1MFBH 3AUVA 1CIDA 4FQIL 2XV6B 4K23L 3MA9L 4WNQB 2PCPB 5I9QC 1OSPH 2VDMH 1S7RA 3ULVH 1FIEA 1JRHH 3FL7A 1AC6A 2Y72A 4F2MB 1VFBB 1MRCL 1O5DT 1J0JA 1BBDH 3STZB 4BA8A 4F37F 3BDXA 1HQ4A 2K3TA 1WIOA 1LE9B 3OAZH 3VD7A 5AG8A 1TJIH 2DRUA 4YXHH 1NGXA 4OLUH 4FQ2H 2A83B 1U3JA 1K8DA 2A6JA 2EH7H 5DHVB 2EZ0D 4PB9H 4Y4KD 5IF0A 2AJ3B 3Q1SH 4L3EA 5DC4B 3QJHB 1XCQA 3V0WL 3SOBL 4ZOCA 3BOVA 4NO3A 1B6UA 2H41A 5I1AA 3BAEL 1INEH 5DEZA 1NCUA 3MGOA 1HKLH 3DECA 1CE6A 4N8CH 1EH9A 1ZLUH 5C09A 4AL8H 4PJGF 2EEDA 1KIPA 2W9EH 5DVOA 4GXVL 3I02B 3VH8B 4XNXH 1S7TA 2NR6C 2DN7A 4OFDA 3VMNA 3OZ9L 1BOYA 4ZO7A 1J1XL 3SDDB 2B2XH 5B3JE 3U7AA 3BGMB 3MZGB 2X42A 4KJPD 3HI5H 4M6NH 4OIAA 5ERWB 4O2FB 5DK3A 4HCRL 1X4YA 4YDVA 5IBTL 4YFEA 3TIEB 2JJUA 5C2UB 4M7LL 5GSRB 4V1DA 4JDZA 5EU7E 3KPSA 1NBQA 5ACZB 1TPXC 1EZVX 5CJ8A 4XNUH 3HN3A 4JFYA 5GGRA 4Z8FH 4OD3L 4H25B 3MLTA 3RX8A 1KJ2H 3QUXA 4P5TA 1HHHB 5IJVB 5EBGA 2C3XA 3B2UC 1TCRB 3L3KB 5FDYA 2VAAB 1HXMB 3MLZH 1IL1A 3GMOB 1KGCD 2E7LA 3QFJB 35C8H 1SY6H 4WUKL 1AGDA 3W0WD 3NBNA 4JDTH 5ALBH 3D0VB 1NAML 1W2KT 3U4BH 1IM3B 3QG7L 4N0RA 3AGVA 4WHTB 5DUBB 3K4AA 1CK0L 2OI9C 1IGFL 2X4QB 1JGVL 5ETUA 3MRRA 1I3RA 4MWFB 5MEQB 2E7CA 1SMOA 4XHJD 3VWJC 2LABA 3MYZA 3TT1L 5EORL 2I07B 4G8IB 5L2JB 2VL4A 3QUZB 5F1OB 1RPQA 5CSBA 5FA4A 3MGTB 4RWYL 2JB6A 5GS1C 3O9WB 3L3HB 1BQUA 2GQHA 5I18L 5F8QC 1BVKB 1U8MA 1XF4A 4Y1AE 4Z95L 3JZ7A 1MIEL 3ULVF 2YPKA 5DURB 2FJFB 3SO3B 2HRPH 4U4BA 3U0TB 4X4XB 1QFPA 3EYSH 2XKNB 4NQVB 3LQZA 5SX4I 4KROC 1OT1A 1QEWA 1FJ1A 3EO0B 2ZUVA 5CJQH 2NY0B 1D5XA 3RBSA 4P2CG 4PJCA 4J7RA 1MQKH 4LSRH 2GSIA 1LK3H 3NPZB 2ARJQ 4QYOB 1UB5B 1AE6L 1OGAE 1R5WB 1W72A 4X8JB 4O58L 1IM9B 4EDWL 1Q9WA 4KKCD 4WV1B 4XH2A 4RFNC 3ARXA 1OSZA 2CXKA 1U91A 2VL5A 3MSPA 1D6VH 3KDMB 3C60D 3T2OA 1HYSD 4P57B 1NQBA 5FO9A 1QFWI 5BMFH 1JTOA 3FQNB 5DK2B 2OMNA 1A2YB 2ATPA 1E4KA 2MKWA 4XCNB 1XF3A 3KPNA 2CDFA 5F96L 3FHAA 2XZAH 4LVHC 4R4ND 5C3LD 4JREB 2NW2B 1E6JL 3QPQD 4KRNA 1KEML 4GG6A 2DIBA 4NZRL 4NN5B 2A6DA 3PWPE 5KVEL 2HJLA 3V6ZB 3BKMH 3FT4A 4G6AD 4OAWA 3NCCB 5LBSL 3NCMA 3QCTH 1MI5D 5FHBL 3HMWL 4TRPL 4M4PA 1A6TA 1I7UA 3V5KB 2WIMA 4CRPA 1MLBA 2PW2B 5ESAA 2NXYB 1WV7T 5JW4R 5CKAA 3OHXB 1WK0A 4OZFG 2F53B 1CFNA 1KPVA 4GAFB 3MLRL 4JAMB 1T20B 3BKJH 3QXAA 3ESVF 1U0QA 1QLFB 1UZ6F 3QUXC 3IXAB 2AJVL 4G6JL 4ZFZB 4P5TC 3SDCA 3SGJA 3ZMRA 3UTSD 1Q72L 1P4LB 2H2PC 1E0OB 1KCUL 1QSFD 4NN7C 5KW9H 3LB6C 4PJFF 1QRNE 2IC2A 1RHHB 2E7LC 5CP7B 2A6IA 5HHXL 3V6FA 5C0FB 1OAKH 1Q9KB 4WEUD 4KI5E 2IWGA 2XG4A 4LSPH 3DWTA 2BXZA 4JN1H 2CLVB 3X3FL 4JY6A 2DQFA 1VKXB 4RGNE 2FWOA 1HH9B 1ACYH 4YWGL 2F9BT 3FJTA 1RZKL 5L0QB 5J56B 2IFFH 5CINL 2V2XA 4P49A 2A74A 1ZT4A 4UTAL 2NY3D 1SYSB 1PQZA 1U6AL 4PJ7E 1KPRA 2B4CH 1A8JH 1KCRH 1KNOA 3NIFE 1F8TL 2PO6B 4XPHL 2BC4B 1KB5B 5JO5A 2JJTA 2QR0B 1CE1H 5H37G 3U0PA 1NKRA 1O0VA 8CGTA 2EDTA 4LLQB 1CGSL 5EPMA 1A7PH 3CVHA 2Q7NA 3BN3B 3FO9B 3VXSB 3HMXH 4RISH 3ARYA 2O5ZH 4NOBA 4M1CC 1X4XA 4ODTH 5C08E 5SV4A 1WFNA 2P5WD 5GGQH 4CNIA 3CFKB 3ZSTA 3ZDXF 2AJZB 4KZDH 3S35L 1ZT7A 3HE7B 4XNYL 5ESVB 1X5IA 4NUJA 1JCKA 5IB2B 2JLLA 2XA8H 5C0JB 3CUPB 2OYPA 4NZDA 4WWID 1S9XB 3BXNA 4OD2B 2UWEA 3PJSB 4Y4KA 1AXSB 2DBLL 5I66A 2YXFA 3EFFB 3KLDA 2OCFD 3AXLB 3DJ9A 1ACZA 3CZJA 5DDHB 1RSFA 4N8VB 5FK9B 1RULL 4NQDB 2YEZB 5GGTL 2VLLB 4UIKH 5HYSB 4U1GB 4ZXBB 3UJJH 1U92A 1E4KC 1X5LA 1AIFB 4L8DB 4RDQF 3LV3A 3UZQA 1G1CA 4YHKH 5I15L 4J3OC 2H6PA 4KU1A 2CMRH 2RB8A 4XRCA 1TNMA 1L4IA 1MJ8L 1B0RB 1KTLB 4JG0H 1AGBB 1CGVA 1X5FA 1J10A 2R23B 4HGMA 4JRYE 5DMGD 4K71C 3OKLB 4YGAB 2H3NA 3DVNA 4MDJB 4WU7A 2VLRD 5I8KL 3SN6N 1TLKA 5A2KH 1KENL 1DLHA 4P2RD 5TGBA 2YUZA 1EVUA 5FEBA 4QF1A 1WAAF 1QRKA 1XGRB 4HGWA 1FG2B 3SGJC 4PV8B 3SDCC 3RZCD 4XAWL 1LO2L 3RWIB 4HK3N 4Y4HD 1EHNA 4GKSA 4R4BA 5TE4H 3BHBB 4YDJA 2IADA 4YHZH 3L7EB 4M48L 5F89B 4G3YH 1JYWA 1T1ZA 1QOKA 2OK0H 1YA5A 3D6GA 1MHEA 1YJDH 3V52H 4DGIL 4XNZB 4KJYA 1MFEL 2ICEA 4Z0XA 1RVFH 3W0WA 4BSVB 1A7QH 1JUFB 4NKMA 4ONGH 1WZKA 3MUY1 1KYOK 3FFCB 2DICA 3MROB 4XVUD 4IMLA 1AHWA 2NY6B 3WJLA 1CBVL 2PKDA 1BZ9A 5IWLA 2HVJA 1CLZH 5CJXA 1NCCL 2BCKB 1H3WM 5GZOC 2PN5A 2J5LC 5I74B 3QZWB 1U8IA 5LXGL 3JWNC 5E2UH 3MRHB 5GZNC 2JJTC 3IDXH 3GI8L 1S7UB 4YHNB 4OCRL 4GMTL 1EIBA 1J7VR 2OL3A 1BFVL 1CD8A 3L5XH 3UYRH 4X6CA 4I48A 4OJFH 1B6DA 1YYLH 5F3HB 3SKNB 3OAUH 1FFOB 5DRWA 2FGZA 5FYJE 1IGYB 2UYLA 4G6ML 1H5BB 4D0BA 3VXOB 2XKUA 1NFDA 1XZ0B 2H32H 3FB5A 3IB4A 1F3DH 1KV3A 2CK2A 1SJEA 4NNXB 4WW2B 2PXYD 4NBXB 1NAMB 3CFJB 1UCTA 4Y4KC 3MJ7A 4M6ML 3TCXA 5E99H 4DZBA 1H9VA 1UWXH 4K3GA 5D96B 4C4KO 3C60A 4S0TD 5MENE 1JYNA 5CEZD 1XIWD 3UTOA 1NMBH 3P9WB 4L8SA 4XNQA 1MFCL 4BFBD 3TCLB 5IOPB 3K7UA 5EO1B 1A4KA 1K4CB 3GSRB 1Q0XH 2EDOA 1MAJA 1VFUA 2C1OB 3HFML 4JFOB 5CUSH 2HFFB 5K9QG 3LKNB 1KC5L 4IHOB 5KS9E 3ROLB 4XP4H 1MI5A 4ETQA 4KJPC 4PJXB 4ELME 5EC2A 4U1LA 4NNPH 3VFPA 1U42A 2R39A 2DKSA 1GGYA 3GMRB 5SWSE 3V4PL 4TVPE 1AKJD 4JHAL 3MLUL 5K93A 1NMAH 5DJ8B 3TT3L 1FV1A 5E2WH 4LARL 1QSFA 1A7OL 5F9JB 3BP5A 1MCOH 4X6CF 4CAGA 5DGQA 3UTZB 3HLAB 2R2CA 4OZGE 5J6HB 4G7VL 1JMZA 1UG9A 5IJKA 1WISA 4LHQB 5C86A 4K3DL 1SYVA 2W91A 3LPWA 1N0XH 3BO8B 2YPVH 2RHEA 5HY9B 1AHWC 1FNLA 4BH8A 2VXVH 3WJLC 1I7RB 5IWLC 1EFQA 4XMKH 4JY5H 3Q5YA 3CZFA 2MCPH 5CJXC 4HH9B 4FZEH 5D2LE 1D5MB 4Q97A 1J05B 3G9VA 5I0DA 4JFHD 3HB3D 4J1UB 4DVRL 3A6CL 3FT3B 4LVOB 1MAKA 5CMAA 1UT9A 3OGOE 5HGAA 3GMMB 1VGEL 1NGWB 2IH3B 3QUML 3DI3B 1I3GL 1TMCB 5I19H 2C7UB 4H5SB 1L9MA 1IAOB 2XA3A 4O02H 3T3PF 3NIDF 1SBBA 3SO5A 3I6GA 5FGRA 1EAJA 4BSWB 3N0PB 1N64L 2RQ8A 4F15C 4P9ML 1P4IH 3EW3B 5I76A 1MRFL 3NZHL 4LLDA 4ZUVA 4BJLA 5F9WB 4OQTA 4S2SA 4WGWB 1FORL 5EDXA 2D7MA 4P5MA 4WDIB 2A6KB 2APVA 1NLDH 4KKCC 1LEIA 4WHYG 1K8IA 3RWFA 4HKZB 1UQSB 3PUCA 4FQQB 2DLHA 3D3VB 2X89D 5ITBL 3C60C 1HYSC 2EC9U 4XC1H 4K2UH 4ZPTA 2VLME 4HWZB 5CAYB 2LU4A 2EDKA 4L8SC 1LILA 3GKZA 5IVXF 3ZTJG 5MEPA 4R4NC 2BHUA 2B1AL 4LCWB 2FBJL 4ISVB 2ZOLA 1ZWIA 4ZSOA 1YN7B 1V7MH 4X98B 3W11D 5JMRA 1RV6X 2D7OA 2MTPA 4G6AC 1N8ZB 3QNZB 1RZGB 5SX5H 4EZMA 1A7BA 4W6WB 5K9OA 4PRPB 5EOQH 4GRWE 4KQ3L 3IFNL 4OD1H 4P2QD 4YX2L 4I18B 5IW1A 4H1LG 2Z31D 4P2RA 5F7MC 3OKKA 5KSBE 1CDIA 5LWYH 2V7NB 4MMZC 2HT3D 5L6YL 3SPVB 1T4KB 4OZFH 2R2BA 1LDPL 3RZCA 3VD3A 3FCTA 4A6YL 4N68A 5C9JB 4Y4HA 3QG6A 4KK6D 3WUZA 3I2CH 4PRNB 4S1QL 5EG6C 5GJSH 1KOAA 5KVDL 4IRSB 5KZCD 2YSSB 1CZ8H 4BH7B 3NABH 3GSOB 5IJKC 1GC1L 5I16A 4HHAB 5BJTA 3OKEB 4XVSH 5JIKA 4U6XA 3GIZH 3D48R 4WI2A 3DX8A 3Q0HA 4PLOB 3B3IB 4O5LH 5GGUB 2NY3C 4D0DB 5TF1H 3EYFB 5FCUH 4B50A 5TE6L 3UC0L 4Z7UB 1IGMH 2W9DL 5I1KH 3QCVH 4LLWA 5IB5B 5DT1H 4DKFH 2OR9H 1LD9A 3H0TA 4NT6A 4U1HA 4ZTPL 2DLFL 4CVUA 4CVZB 2D31B 2ZCLH 4D3CH 1BVZA 3O3DB 5IFAH 5FGCB 1Q94B 1G9ML 3WN5A 1HH6A 2PYEB 3BIAX 4X4YA 4HG4K 5H37H 1R0AH 3C9NB 4PV9B 5JA8B 4HIJA 1JPFA 4NNYB 3OKNA 3OG6B 5J12C 2WSKA 1NMCB 2DB8A 4QXUL 3TBTB 1C16A 3VGAB 1XF2B 1ZVSA 2PXYA 3WUWB 5DJDA 4HAGA 4KZEH 3N1PC 3SBWA 3KWWB 4OT1L 1MVFA 3IETA 3ZDZE 4I0KA 1A6VL 3AB0C 4NC1C 4PG9B 5DJXA 4PRDB 1MUJA 2R29H 3DV4B 2Q3AA 5FYLE 1W0VA 4GLRI 4UUJB 4EBQL 2IANE 1J1OH 1CTOA 1XIWA 1F3JA 3TYFA 4Q9RL 5DTFB 5INCA 3D87B 2CDEA 4OZ4B 3RDTD 2FNBA 4HV8B 1JNHB 1G6VK 5I1IH 2EEAA 2IG2L 4F80A 2VZ1A 4MD0B 5EU4B 1NLBL 5EOCL 1BBJB 1S7WA 2BY0A 1HNFA 4LSTL 4M5YH 3UPCA 2MJWA 1J18A 2FGWH 3QDGD 4U0QB 2V2WB 1OPGH 1LK2A 2CRMA 4LVNC 3O0RL 1CFSA 4J12A 3V6OA 5DMGC 5D7SH 5EU5A 1QD0A 4HLZG 3K46A 5TH2A 5J9PB 1AKJA 4ZS7L 2EIBA 3B6SA 4U3XA 5E4EB 4Z0BH 2NY5C 5EU6B 3GBNL 4JO1L 5I8CA 3HAEB 3RZCC 1F4HA 4ZODA 1RI8A 1BF2A 3N9GL 3RWGB 3I75B 2ZUSA 1Z2KA 3U6RB 1D5IL 2AV7B 2EDXA 1DZBA 3D9AH 4Y4HC 2JF1A 3RNKB 2AKRA 4PJAE 25C8H 4YHOH 2CPCA 2ILLA 5EUKB 4XI5D 4XVJL 1XH3B 4UDTB 1BQLL 2E3VA 4YNYA 4MDIB 3FO2B 5I1JH 4D9QD 3KPMB 1KJMA 5IHZA 1KIRB 1YY8B 4XVUC 3DOSA 4LIQL 4BQ9A 5T1DL 4CUCA 4UQ2A 1RK1B 4PGEB 4TVSa 1I3UA 4GG8B 1RZ8B 1MHPH 1DBBL 1X5AA 1B0GA 1T04A 2YZ1A 3CU1A 4OF0A 3GJEA 2GI7A 4LKXA 4LNRA 3VRLE 3O6KL 2F54D 2W0PA 1MFBL 1QSZA 4K9EH 4AEFA 3QQ9D 1OSPL 4GXUN 1IGTA 1OWRM 2VDML 5JW4Q 4QHKJ 3ULVL 4AH2B 4X6DA 1PW3A 4YK4C 4WWKD 2IF7A 3WN5C 2EE3A 5E2VH 1X5HA 3VXNB 3VFVB 2XPGB 3HR5B 4HPYH 1IBGH 2SEBB 3WS3B 1BBDL 3QQ3B 4ZAKD 4ZDHB 4XXDB 4K07A 5DA4A 5HPOA 2VO5A 1U93B 3SHSA 4DFHA 2NW3A 3KLHD 5K59F 3QUYB 1TJIL 2GUOB 4YXHL 2XQYG 4LDEB 4H0GA 4OLUL 2E27H 4DKAA 2OR8A 2EH7L 3GHBH 2XRAH 3DI2B 4PB9L 1Y6KR 4J8RB 1QYGH 4N9OB 4TNWF 3SEPA 5C0CA 2C5DC 2HLAA 2QHRH 3Q1SL 5J11C 3K4DA 1UA6H 1FL3B 2PXYC 1I1RA 3X17A 3G6JB 5AZ2H 2JK5B 5JPNB 4MX7A 3SBWC 3AMLA 1INEL 2FX7H 4LCIH 2VLJB 2C3WA 3REWB 3HNVH 4AIZB 1HKLL 1ZHBA 1K3ZA 1S7SB 2BRRH 4N8CL 4RSVA 5DMKB 1CQKA 1U2CA 4AL8L 2W9EL 3INUH 2YA2A 4ENED 1JZ4A 2X89A 1HCVA 4G9FB 3QIBB 1XIWC 1GZPA 4XNXL 1RURL 1F6LL 3EYUH 2YKLH 2X4TB 3C08H 4U6HA 3N85H 1HDMB 4Q58C 4K7FA 3QUMB 3VGBA 4IDJH 5D6CB 4F7TB 2P24B 3TWCH 2B2XL 5GS0D 3QI9A 4PD4K 1NBZB 1U8KB 3HI5L 1WBXB 4M6NL 1JYXA 4X0KB 1DBJH 3W81A 4AMKH 5I30H 5EULV 4RFEB 3QHTC 4WFHE 4XNUL 4Z8FL 1F3RB 1A3RH 4KVCH 4P2QA 4JFEB 3X13B 2OTPA 1KJ2L 5L88H 2Z31A 1PZUB 3MLZL 2XFXB 2Q76B 3WDJA 1WF5A 35C8L 1SY6L 3VXSE 4ZUSA 3MV11 1AD0A 4JDTL 5ALBL 1ERNA 4UILH 4XBGB 4YGVB 4NQXB 1URLA 3U4BL 3HS0B 3IU3A 2OP4H 4PJIA 4LOUC 5GQBA 2Z91A 4HWNA 3OB8A 4HWBA 4G8EA 3S7GA 5HI4C 3D0LA 3S96A 4EDXA 3LHPH 6FABH 3PWUA 3FB8A 4EIGB 2OJEB 4JCLA 2RFXA 3BIKB 4U6TA 3V5HA 4MXWL 4OBSA 4WO4D 4POZD 4QRPB 3MYJA 4JE4B 3OR7A 3CK0L 4GW1B 1X6NA 4QO1A 2FEDD 5JIHA 3B8SA 5FM4A 3VFMB 4JFXA 1PBYA 2HRPL 1MNUH 4X4ME 3BQUB 3EYSL 3T8XB 4JFZH 4L8BA 4PJHB 5BOPA 1S9WA 1U58B 4R26H 4OB5H 4JFQA 2AJUH 4A6YB 4OBRA 5CJQL 3VXTA 3FN3A 2QBWA 2FCBA 3LD8C 1I7ZB 3MRQB 1MQKL 3GSNH 4LSRL 3WNMA 2A9MH 2MQ0A 1LK3L 5IB4B 1BMGA 4OF7A 3OR6A 1CFQA 1FL5B 4RMUA 1L7TH 3VGFA 3STBA 3VXUB 4YHPB 5I1CH 5EZLA 5F21B 3RUGE 1WQVT 5T1KD 4JGMA 2R0KH 1Z5LA 5EOCJ 4QRRD 1WC7A 4NDMA 5E94A 2WW8A 4KTYA 4HUXA 4UNTA 2AXHA 5BMFL 1G7HB 5HDLA 1KN4H 5IFHH 2XZAL 1ZHKA 3P11H 2IMNA 1G7MA 2XWTB 3CMGA 5E8PB 1A3QA 1WBYB 2K7PA 3RIAF 5D1XA 4WHYH 1DQTA 3FOMB 1ZEAH 2V6HA 1J1PL 4KDVA 3BKML 3GGWB 4YJZL 5C3TA 3CCHB 4PJBE 3RDTA 3PWPA 4MJID 2ZUXA 1UZ8B 3QI9C 3T2NH 3QCTL 2W9LA 3AC0A 3ZTJH 3M17B 3TN0B 3W11C 2FX9H 5HDQH 2IH1A 5D7IB 1I7TB 3NFSH 1XAUA 3QDGA 4KJQC 2DJSA 5I2IA 5JPMA 3C5SB 4ZO9A 3BKJL 3U1SL 2Z31C 4PY7B 3RWCB 3MCKB 3WYRA 5KW9L 5F7NC 4NO0B 3CIQA 5C0BB 1OAKL 5T3ZD 1JV5B 2J8HA 4LSPL 3RNQB 4OUUA 4C83A 2UY7A 2BNUB 4ONHA 4KK6C 3VFSB 3GM0A 5FKPA 1KIQA 1CG9B 4KFZC 3QR2A 1IE5A 4BELD 1MHCB 2P7TB 1NDMA 1JE6A 3MREA 3KXFB 2X7LA 3VXRA 1YEDA 2IFFL 3H9SD 5EIIA 3LDBC 1EXUA 4XP9H 2HA1A 3I85A 2OBGA 1K85A 2VWEE 2B4CL 2FEEL 2E7HA 4FQXD 2BSRA 2HLFD 8FABB 2BNQD 2CLRB 1CE1L 4DGVH 5HGHB 2EXWD 4WU5B 4OKVB 5E24E 3B9KD 4RIRA 4WFED 2F54A 5D7KE 3H9HB 1N2RA 2R4SH 1A7PL 5F70A 2KZWA 4ODSH 4BZ1H 3HMXL 4RISL 2O5ZL 4KRLB 4WI8A 4AK1A 4ODTL 3T0BA 3QNXB 5GGQL 5BZWB 4LPVA 4E0RA 4WWKA 3LMJH 4GFTB 4XWGH 3ULSB 1AY1H 4R8WH 4KZDL 3VI4E 5HHPA 3LCYA 1NGYA 4NBZB 4YUEH 2GJZB 4QRTA 4I4WA 4RQQA 4S1DD 2YPLB 3IDNA 4PTTB 4J3UA 2FYYB 5HHOD 4PJXE 4UMGA 1EVTC 3CFDA 5SX4H 3WIFB 2O5XH 3QQ4B 3Q6FA 3DBXA 4LEOA 2X05A 3U7WH 2DTSA 3DRTA 4GW5B 3K81A 2Z92A 5IT2H 1R5VA 4CADB 5C92A 1S8DB 1FE8H 3JV5A 2AXGB 2C4FU 4UIKL 3NFNB 4YHLH 1QR1B 1W72H 3UJJL 5I1LB 4HUUB 3V4VH 4OCNC 3HRZB 3CX5K 2XZCH 3LRHA 3QXDA 1C5DB 1UWGH 1OAYH 4FN0A 4I0PD 4UAOC 3ULUD 3QISA 3MV8D 4MQXD 5D1XC 3U4EA 4EOWH 1FSKB 3WFEL 2CMRL 4PTUA 2L7JA 3MUGA 3Q2CA 5GGSB 3RDTC 3K74B 2NLJB 3SKOA 1QFWH 3D1MC 4JG0L 4JEGB 3R0MA 4JZJA 4I2XA 4WUUD 3GDBA 4M7ZC 3QIWB 3QXVA 4OFPA 3EO1B 4UIMA 3AROA 3BWAB 3BP7A 1E28A 4MSWB 2YS4A 3J8F7 4MNQD 2D0FA 4GRLB 4PJ7F 1FCCA 3FFDA 3MA7B 4QOKB 3NIFF 3ECBA 43CAA 3Q3GA 3MR9B 3MJ6A 4HT1H 5TE4L 4YHZL 4G3YL 2VZ3A 4TOYH 4HLZH 1G1YA 5BV7H 2OK0L 4C56B 1I8KB 1YJDL 3C6SB 3HTLX 3T0XA 3V52L 2IBZX 4Y5XB 3WFHB 1FLTX 1ZA6B 1MCNA 1Q0YH 3OGCA 1RVFL 4XI5C 4MNHB 1A7QL 3D39B 3F12B 4NWUH 5BXFA 4ONGL 4HS6B 4MB4A 5FYJH 3GMQB 3G5YB 3E6FB 3V5DB 4J4PD 5AAMA 3K2MC 1OAQH 5F7FA 4JLRA 1JNNH 2ESVE 4NM8H 1QKZH 1CLZL 3UAJD 3MBEB 3ARDA 5JDJA 2CIIA 1CR9H 2CSPA 2I5YL 5J89A 1ED3A 5E2UL 2NQCA 3DROA 3DX9A 3DTXB 4GKOA 1R3JA 5C07D 4ZYKA 3KYNA 2C4FT 3D3VE 2J88L 3NAAH 3WLBB 1GH7A 3RRQA 1ZLWK 3L5XL 3G08B 3QQ9C 4OJFL 5IVZB 1YYLL 1XT5A 2R1YB 3OAUL 1JHTB 2ORBH 4JN2B 3T4YA 1KJ2B 4AQ1B 4WWKC 4ZOEA 1QFUH 1ZMYA 43C9B 2JIXA 2B5IC 2GJJA 4PJFB 2NY1B 3T0VA 4MB5A 4KDTA 1TVBB 2ZSVA 2NNAA 3KLHC 4AEEA 1DCLA 3RGVB 1UFUA 3F7RA 5C0GB 4DN4H 2DM4A 4PRPE 2VSDA 1FN4A 5F7LB 3U9UB 4KRMB 2FZ3B 5E99L 4K55A 5E6ZA 2FO4A 3SQOH 1V3JA 5T1KA 4TVPH 4OCSH 1WT5A 3ARWA 2GY7B 4EQ3A 1OQOA 4QRRA 3DNKA 1BX2B 4QRSB 1YEJH 4RNRB 1NMBL 4U1SA 4XCYB 2H1PH 4ENEC 2DQCL 1P2CB 5ANMB 2CQVA 4ZUWB 3QFJD 4ODUA 1Q0XL 4OLZH 3ZKXC 5ID0A 5CUSL 4Q6YA 3SGKA 2V5YA 2R15A 4MJIA 4UNUA 2VKWA 5C0IA 4JZJC 3LKOA 4PGCA 1YN6B 2WZPD 2A0LD 4XP4L 3EYQD 1OP9A 1EZVY 3KNBB 3STLA 5IR1A 1XFPA 2KUTA 5DK0B 4NNPL 1BP3B 4TYUA 2QLVB 4FXKA 4OFIA 4JFPB 1G7PB 1RUAH 3QRGH 5SWSA 1NMAL 2C1PB 4Z5RA 5TQ0H 1GGCH 5B39A 4X9IA 1DQQB 3O9WD 5E2WL 3LN5A 3HUJB 1PFCA 4FFZH 3IJHA 3GSWB 2GSGA 3SE8H 3GMNA 4JFDB 1I8MA 5A2FA 1OB1B 5JOFB 1MCOL 1YNKH 4U1IB 4P3DA 3PGCB 5J3HD 4KKNA 3TPKA 3O2DL 3VFOA 1DEDA 1U8NB 1OW0A 1QSEB 2DBJA 2ITDA 3MV01 4M9PA 5CEYA 1X7QB 1N0XL 2YPVL 2NY0D 3BW9A 3NFPA 4LAJH 4U33A 1R5IA 5DD6A 2Z0BA 4YIQA 3R06A 1BOGB 4IM8A 3H9SA 3VRIA 4XMKL 4JY5L 2MCPL 3ARDC 4FZEL 1FO0L 2ZJSH 3JV4A 5L7XH 3KPOA 1IM9D 3EOBB 1O7SA 4FQXA 4POZC 1ES0B 2VXTH 1I4FA 3TNMA 2BNQA 1A6PA 2EO1A 3O45B 4PJDA 4Z9KB 3B9KA 5I19L 2FEDC 3L3GA 4ONFH 1HILB 4ELKB 1UXSA 3GRWA 1VDGA 4GUPB 4MGXA 4HUVB 3MRKB 5BRZE 1UCBH 4X99B 4P46B 3F7VB 1H15A 2RAMA 3S3PA 1F42A 3QNYB 1H3PH 3L3OA 3DGGB 1P4IL 3ILQD 4KDTC 1T1WB 3PL6B 5JOPE 2IPUK 5I6XB 1QG3A 3C5ZB 1WICA 1NAKL 4FQLH 1BREA 1HINH 3MLVH 3QZWG 2F53D 2C3GA 2BERA 1DUZB 1KT2A 3E8UH 4ELMF 1FYTB 1I9JH 2HFEB 3KPTA 1NLDL 2AXFB 3KG5A 1FVEB 1WT5C 4G80B 5MERA 1UXWB 3JTTA 3L6FB 4XC1L 3GBMH 4K2UL 4IOFD 2FLRT 1XGPA 4NQED 3SY0A 4J3SA 4GBXB 3RWHB 4JFFD 1F00I 4D8PA 1K2DB 2MMXA 5DJ0B 3TNNA 2IGFH 2RBLA 4I0PA 4ZUTB 3MV8A 3SGKC 4X9FA 1V7ML 4OZGF 3IF1B 1JL8A 3QULB 4TPRH 2GTZA 5DQJA 3TBWB 5FA3A 5IB1B 1J11A 4D0CA 2X10A 4OGAD 5EOQL 3VFRA 1IAKA 2GITB 2YBRB 3D69A 4HPOL 3QDJD 4OCMC 5DRXA 1UJ3A 1EGJH 3D85B 3HZKB 5JUEL 1B88A 3VXPA 4JJ5A 1DN2A 3QO1B 2DM2A 4NKOB 1FRGH 2PO6D 1WIPA 4LAQH 1AQDB 2BVQB 5D2LF 2JCCA 5LWYL 2Q1EA 4MNQA 4PJ5E 2AJSH 3HI1B 4AENB 3RWDA 1ZGLB 2GW5A 4Z76B 4TQEH 1VFAB 4U1JB 1LO5B 4PLJD 3IAGC 1DQMH 1T1YB 2DWEB 2X9YA 1XGTB 2EDNA 4WNQA 2PCPA 5MI0C 1M7XA 5GJSL 4RBPH 1FBIH 1U8OB 3IJSB 4GMSH 3JTSB 2DDQH 1CZ8L 1AP2B 4P4KB 3NABL 4F2MA 2Z93A 1VFBA 4TTDD 1OW0C 2X70B 3STZA 2WIIB 2MPAH 2E7MA 4JKPH 1D9KD 1LE9A 4XVSL 4P9HH 3GIZL 5C6PB 3IDUA 4J4PA 1LP9B 4N0YH 4OGYH 2Q6WB 4WTZA 5JQ6H 3AAZB 4O5LL 2AV1B 3F5WB 2I25N 5TF1L 5DHVA 5FCUL 3G6JE 1IGML 1S5IH 5I1KL 3QCVL 3MRNB 1EERB 4YH6A 1HOCA 1INQB 3QJHA 3BUTA 1M6OB 5DT1L 2OR9L 1FZOB 4FQXC 4QXTB 4DKFL 1F3DJ 4HF5H 1TZIA 2YRZA 3BWUC 4LL9A 1ZAGA 2LE9A 2EXWC 1AFVH 4OTXH 3B9KC 5EUOA 4OUOA 2ZCLL 1HXYB 5C07A 4D3CL 5A40E 5IFAL 4X5WB 3FRPG 4IIQA 5ECJE 1BZQK 2YRLA 3LKPB 5FYLH 2G9HB 3M8OH 4FTVB 2WBJB 4JKLA 4LBEB 2VAJA 5DO2D 3I02A 1R0AL 3FQTB 4LU5H 5JIIA 4MZ2A 2ZCKH 3VH8A 5DZNA 2AQ1A 3U46B 5T3ZE 1UKQA 2D9QB 3T0EB 5AUMB 5JLZB 3EYVB 4O2CB 1MWAH 3TVMC 2LVCA 3BD5A 1Y6MR 2ENSA 4YHYB 4BFIB 2E9IA 3T1FB 4S1DC 3DO3A 5ERWA 1KF9B 4O2FA 2ATKA 5GSRA 4GRWF 2KKQA 5K33A 3F65A 2NX5E 5ACZA 3HNSH 4AEHH 3MRDA 1MCEA 4KMLB 4H25A 1NGZB 2R29L 3S5LA 4E5XA 5F7EH 1CD1B 1H8SA 5KSBF 1NSNH 4TUOB 5L9DH 5IJVA 1LE5B 3L3KA 1TCRA 4NP4L 2VAAA 3IDGA 5HYEA 1HXMA 5IHUH 3U83A 2X1PA 1G7QB 3GMOA 4EXPX 1TXKA 4S1RH 3MV7B 3OMZA 4I0PC 2G60H 3QFJA 3ULUC 1MJJB 2KPNA 5I1IL 2EYSB 4ODBD 4LASH 2YC1B 3D0VA 2LU7A 1OQXA 4NRZB 1IM3A 3FFCD 4LP4A 4YDLC 2FGWL 4WHTA 3V4UH 5IROA 1OPGL 1EDQA 3MUJA 2X4QA 2WP3O 1ZKAA 5D7SL 1UJ3C 2H32B 4KQ4H 3FKUS 4MWFA 2VITA 5DZOA 3UBXA 3QCUH 3ZE0F 2I07A 3SDXE 4QRPE 4AT6B 5L2JA 4Z0BL 5HHOE 3IAQA 3ROOB 3QIUD 1W0WA 3WLWD 5HJ3B 3EOAA 3O9WA 3PP3H 4Y16B 1XMWA 4UINH 4RX4D 3D9AL 3L3HA 4FP8H 1BVKA 25C8L 3AU1B 3CPLB 4YHOL 3EJZD 5HSFA 5I71B 5LGJB 2HKHH 1UH4A 1U3HB 1PEWA 2FJFA 3U0TA 5IVXB 1Y6NR 4X4XA 3U9PH 5IMLB 5I1JL 2XKNA 3BKYH 3QPXH 4NQVA 3L7FB 3EO0A 1A4JB 4J4PC 3IAPA 5JNYB 3PE9A 2EDRA 2AGJH 2R2HB 4D2NA 1F11B 4FFYH 1MHPL 4LHUB 3VXUE 3UAJC 1UB5A 4X8JA 1IM9A 1CXKA 4XXCA 5E00B 4K9EL 2BOCB 4RRPG 4WV1A 4HDIB 4KI1A 4LPYA 2LTQB 3ZDZF 3GIVB 2A2QT 4IIQC 3P0YH 4P57A 2XKSA 5E2VL 3FQNA 5DK2A 4HPYL 4OZIB 1ZVHA 4XCNA 5CLTA 4Y19E 3ARQA 5ACLA 3RY6A 1G9NC 1RY7B 2NW2A 2ICWJ 4UOJA 4NZJA 2E27L 4MJ6B 1D7FA 3V6ZA 5DHYA 3GHBL 1L0XA 2ADIA 2XRAL 1YQVH 3RJDA 1QYGL 2QHRL 1VB9A 1UA6L 5D7IE 4XAKD 5FUZH 5TDNB 5FECB 2R0WH 2PW2A 5AZ2L 4GO6B 3T0DA 1OAZH 2F53A 2FX7L 4LCIL 4N9GB 5F7DA 1WWCA 3HNVL 3V8OA 2VDKL 2BRRL 2J6EH 4RBPK 4JAMA 4YHMH 1T20A 1G6RH 1FO0B 3INUL 1QLFA 4GAGH 3IXAA 3CAFA 3VFGH 3WNLA 1PKQB 3VXMB 5F3BB 1P4LA 3MJ8B 2ADJA 3T0WA 3EYUL 2YKLL 5C0BE 2CD0A 3C08L 1RHHA 3N85L 5CP7A 4IDJL 5C0FA 1Q9KA 1H8NA 4PJAF 1WLHA 3TWCL 5DF0A 2CLVA 1U2HA 1ZGLM 4GLRH 1VKXA 3V9FA 2FECL 3QDMD 2DWDB 2Q7YB 3X12B 1HH9A 1DBJL 1XGYH 5IROC 4YAQB 2FR4B 3SKMB 3G5ZB 5JW4M 3EYQC 2R69H 5ISZD 3DURA 4PRID 1IEHA 2LVEA 2APTA 1A3RL 4KVCL 1RK0A 1CGYA 3QDJA 5JZ7D 1SYSA 3VMOA 1XGUB 3PIQB 3K8LA 5L88L 4C4KT 4YO0B 2J3SA 3QUZC 2PO6A 4KUZH 2BC4A 3AREB 1KB5A 3O11B 2DYPB 3VRLF 1Z3GH 3SE4A 2Q87A 2QR0A 3O9WC 1JFQH 1I1YA 1XR9B 4LLQA 3X11B 3CMOH 3PWNB 5SWZB 3VGGA 1NUGA 3R8BB 4UV7H 2A9NH 3VXSA 3H9ZA 2ICWB 4UILL 4DZ8B 1I9EA 3SO3C 3EO9H 2OP4L 1CXLA 3CFKA 1FZKB 4OI8A 2AJZA 3HE7A 5ESVA 3GJFH 1FZJB 6FABL 1D9KA 2NY0C 2QKIB 3C8DA 4L1DA 4A2LA 5IB2A 2DLGA 4LK4A 4Y4FB 3U79A 3I9GH 3NGBB 1N59B 1OCWH 4PB0H 2ZPKH 5C0JA 2EE6A 5D2NE 1S9XA 3TBVB 4APQB 5LKNA 3CFBB 1O7VA 4OD2A 5ESQB 3WSQH 2PTTB 1MFNA 2LAAA 3HAEG 5E7FA 4ORGB 4UBDD 3ZE1E 4XXCC 4F9PA 3EFFA 4WV1C 3AXLA 1I85A 4WW1B 4LIQE 5B38G 4R9HA 5F1KC 5DDHA 3VG0H 1I3VA 5FK9A 4N8VA 4NQDA 5HYSA 4ZXBA 1MNUL 3UDWA 4U49A 4JFZL 3L3JB 4QXGH 4L8DA 4U1KA 4IMKC 3BN9D 4OZFB 4R26L 4F7CA 1BPVA 3RTQD 2YOCA 2AJUL 3RY6C 4N8PA 2Z35A 4JREC 4F7MB 4LCWD 1YUHB 1IEBB 5HHVH 1EHXA 3V7AE 4NN5C 5JW3H 3GSNL 2A9ML 1DVFB 3ILQC 1WIUA 1P84J 4Q2ZB 3P0GB 1KTLA 1AGBA 4YC2B 4G8GE 1L7TL 3CU7A 1C12B 2R23A 5CZXD 3KVQA 2NXYC 3NOIA 5HTSA 3OKLA 2G5BA 3B9VA 4MDJA 2R0KL 4P4RB 5T3XE 5EH1A 4R3SB 3FQRB 4QOKE 4N0FB 3BDBA 5ICZB 1XGRA 1KN4L 1FG2A 1T83A 5IFHL 3P11L 4PV8A 3RVWD 2WUBH 5C7XH 3PWJA 3RWIA 4M62H 4IOFC 5A1AA 3BHBA 4W6XB 1FH5L 3GZKA 3L7EA 4ZS6D 5F89A 1ZEAL 3ELAT 2XOTA 1GXEA 3EDFA 3PV6B 2DMCA 4G42A 4LRNH 3D39E 3T2NL 4BSVA 1JUFA 2FX9L 4RMTA 5HDQL 5MHSD 3LIZH 1J8HE 1HN1A 1OTTD 1P7KB 3F8UB 3Q5TA 3NFSL 3FFCA 3MROA 1TQBB 5L0QC 5D70H 4OM0L 3DXAD 4OGAC 4QGTA 5KOMC 3IVKB 3KGRA 1PG7X 3BE1H 2BCKA 2E9JA 4PS4L 2PO6C 9CGTA 1S3KH 3E6HB 5IB3B 4PY8J 2KL6A 3WKMH 4HCRA 2JE8A 3SE4C 1S9YB 3B9EA 3QIUA 3VGHA 3IDJB 1BD2E 2D3VA 3MMEB 1ZOXA 3C2AH 3TT1H 1S7UA 4MD5B 4YHNA 5EORH 4RX4A 4PLJC 2PYED 3V95A 5F3HA 4ZNEE 3QFDB 1FFOA 4XVTH 5K9JH 2XY2A 2W0FB 1DEEB 5IQ9B 4BFGA 1IGYA 2A1WH 2BXYA 4TTDC 3VXOA 3HE7C 2DJUA 4HC1H 3MV9B 1D9KC 2ZSWB 1KPUB 4V2CB 4XP9L 1M71B 2V5MA 3BZ4B 4MD4B 4PFEA 3CDFA 4NNXA 4WW2A 3SKUD 4MCZB 1NAMA 2M1KA 1T7ZA 3CFJA 3ES6B 5HPMA 1Q9OA 2AXJA 5GS3A 4DOHE 4CVWA 2B8OT 3UYOD 4DGVL 5SWQB 5JMOC 4F9PC 4E41B 5L2KB 3ZT5A 1I85C 2D0HA 2R4SL 1GJIA 4ODSL 1FNGB 4BZ1L 4DUWA 2OTUB 5JOEA 4X7SH 1AR1D 4U1GC 4ZXBC 2FJHB 5SV3A 3UDWC 3LMJL 1EHAA 2VDNH 4JVPA 2A38A 4XWGL 1AY1L 4R8WL 4MQTB 4QTHB 5IOPA 4MXQD 3J7HA 5DO2C 5EO1A 2NY4B 1NCTA 1LGVA 3GSRA 4YUEL 5CGTA 3EOTH 2CUMA 1T1XB 4TNWK 4FG6D 2C1OA 4PJBF 1VFMA 4CJ0A 2HT2D 4X7FC 5FO8A 2HFFA 1CICB 2V7HB 1XR8A 4UZGA 2IFGA 3LKNA 1MPAL 4IHOA 3ROLA 2DOCA 4G43B 2O5XL 1F97A 3U7WL 4ODHH 5FYKD 4R97B 1UENA 3GMRA 4EUPG 1FE8L 5GS2H 4YHLL 1SQ2N 5DS8B 1W72L 3TC9A 3RU8H 3MXWH 5EU6D 2WWMD 1EA9C 4BQBA 4JB9L 5GGSY 3V4VL 1T83C 3U30B 2XZCL 3MACH 3MFFA 1N5AB 3EGSA 3C09B 1UWGL 2NZ9D 4AEIH 1OAYL 4EOWL 1NFKA 5FGBA 5F9JA 1BQHG 2ICES 3UTZA 1QFWL 1Y0LB 1GGIH 1BWWA 5J6HA 3OQ3B 4XPAH 3KAAA 3PHQA 3PQYD 5FV2A 3QDMA 3IT8D 1FZMA 1VPOH 5I9QB 4HIIB 1KSRA 3K8KA 5HY9A 3TO4D 4XP6H 5ISZA 4U05A 4Z18A 1I7RA 4PRIA 2IAMB 4JG1H 1CS6A 5IV2B 2AJYH 2F8XC 1YECH 1D5MA 1J05A 1MHHA 5I74C 4HT1L 4J1UA 2J8UA 3FT3A 5HXMA 4U31A 4QHNA 4TOYL 3QIUC 5BV7L 2ZUTA 1NGWA 2ADFH 2IH3A 4JVUA 3WLWC 2R1WB 5C0AE 1Q0YL 2C7UA 3EJZC 3TJEH 4H5SA 5KVMC 2EE9A 4NWUL 1RZ7H 4KTDH 4ACPA 5LAXB 5FYJL 2EKSB 1QPPA 2IALA 3CXHK 4BSWA 1HHIB 2P5ED 4K3HA 2P8LB 4F3FA 3VI4F 1T5WB 1OAQL 4U2YA 2CGRH 3ALWA 1JNNL 4JM2F 2OSLA 4NM8L 4B5EA 5DJCB 1QKZL 1MRDH 2BMKB 2F74B 4WW2C 2AK1H 5F1SA 5A2LH 5T5FH 4DTGH 4PJXF 1UM5H 4XNYH 1QO3B 2VLJD 4WDIA 2A6KA 5JIPA 3NAAL 5EZJB 4HKZA 4FQQA 4J3TA 5D96C 4D9LH 1S78D 2ORBL 1MCQA 4PJ8B 4G9FD 3QIBD 1QFUL 2DBLH 4HIXH 4NQCB 2CDGB 1EO8H 2HFTA 4PRAA 3RTQA 4Y1AB 4LCWA 5LVEA 3LY6A 1RQ5A 5C0EA 1XGQB 4X98A 4P3CH 5E1AB 2M2DA 1DBKL 3ORJA 1N8ZA 3QNZA 1ZHLB 3SCMD 2R2EA 4KV5E 2FATH 3CX2A 1ZANH 2XWJB 1WCQA 3DRQB 5CP3A 1WFUA 1JN6B 1D3CA 2GJ6E 3B2VH 4JRXD 5E8OB 1YDPB 3SQOL 4TVPL 4OCSL 1JI1A 4BYHA 1IEAB 4JFED 4ORZC 4I18A 2VTFA 4DVBB 1KCKA 4JHWL 3FAWA 2Q86B 2OI9B 1QBAA 4MNGA 4Z7WB 3BI9X 2V7NA 1OGAB 3SJVE 2H1PL 3QBTB 3SPVA 1T4KA 1YMMD 3EHBD 1U36A 4HJGB 5C9JA 4R7NB 3RFZC 4OF8A 2W65A 4OLZL 3NA9H 1S9KC 5FGBC 5I8EA 4PJEE 4PRNA 4OIIL 3HZYB 5B4MD 4HKXA 3O4LB 1K6QH 5ILTH 3P4MB 1BEYH 1QLRB 5GGTA 5GS1B 1M05B 2EECA 3GSOA 3LQAH 4EI6A 4BK5A 2AI0H 4LP5A 3FB6B 4HHAA 5C6WH 3FT2B 3OKEA 5ID1A 1RIVH 5CSZB 1RUAL 2NTSP 3DXAA 3GSNB 5GS0H 3QRGL 3ZT7A 3B3IA 5TQ0L 5DVKA 2JKXA 5JZ7C 1GGCL 1NDGA 5GGUA 4D0DA 3EYFA 4KROB 4Z7UA 2X4RB 3QJFA 4FFZL 3IXTB 1L0YA 1LWRA 1NGXB 5IB5A 1L6ZA 3SE8L 1J87A 5E1HB 5DQ9B 5IF0B 3V7AG 2CKBH 2D31A 4CVZA 3OL2A 3O3DA 1Q94A 5E4IA 3G04A 3S4SG 3VFUA 2PYEA 3KYKH 5I1AB 4RFNB 5ICXB 3CDGA 3OX8B 3TZVB 5DUPH 3C9NA 4PV9A 1QRNB 5GRVK 1Q1JH 5FM8A 4NNYA 5C09B 5IVOA 3A6OA 4HX1B 3TBTA 3L3IA 3IDMB 2ZJSL 5HHQB 1XF2A 3OB0H 4RGNB 5L7XL 4PGBB 1S7TB 2GK0B 3WUWA 3HKFA 3GSXB 2RJMA 2VXTL 1IGJB 1RZKC 2J7LA 4PIRF 4UBDC 1GVIA 4O51A 3T2PA 2ICWI 1A14H 4XP1L 4ONFL 4PG9A 2XN9D 4PRDA 4KHTL 3DV4A 3GSUB 2AK4E 4UUJA 3K3QA 2ADGB 3HAEH 1UCBL 4JDZB 1X5ZA 4XWOD 4RGMC 3S37H 4JFYB 2VABB 1VADA 1H3PL 3QB7C 3BN9C 1MOEA 5DTFA 4KPHH 3RTQC 3TO2B 4OZ4A 4HV8A 4FQJH 4H26B 4KTEH 5D7LE 3MRCA 3DSFH 4MD0A 1G84A 5C08B 2BHYA 1OF2B 1TNNA 4CMHB 1PKOA 2NR6D 1IL1B 4FQLL 3BPLC 1HINL 5HVHB 3MXVH 4PBWD 2V2WA 3E8UL 1VEPA 5CZXC 1I9JL 3NMEA 2DQUH 1AGDB 5B22A 2BVTA 3HG1E 3BGFB 1KB9J 1TJHH 4I18C 4BQ8A 4LPTA 5J9PA 3GBML 3DSNA 1ZSDA 1T2JA 4EJ1C 5EU6A 4HEPG 2P8PA 3MRRB 1N3NB 4E9LA 1RJCA 4E42B 3RVWC 5C9KA 1FVDB 3RWGA 3I75A 2IGFL 3U6RA 2VZUA 2AV7A 1WWAX 3RNKA 4HUNB 4LKCB 1HSBA 5EUKA 4LEXH 1XH3A 3ARFB 1ODAA 1H8OA 3KXFD 4TPRL 2VXQH 3LKQB 5BQ7B 4MDIA 1VGKB 1BFTA 2P46B 1U8MB 1NBYB 4ZD3H 1ADQH 3KPMA 3PQYA 1OTTC 2QSCH 1KIRA 4YR6B 1EGJL 1YY8A 4QY8A 4KJWD 3TO4A 3KPRD 5TE7H 1FRGL 1RK1A 4LAQL 4PGEA 1MQ8A 5E5RB 4GG8A 1RZ8A 5E9DE 3NCEB 4JRYB 2BP3A 1V05A 1D5XB 4TQEL 5FUCE 1DQML 4H8WH 1QSVA 1RIHH 4L4VD 4Y2DB 2OMBA 1FBIL 4AH2A 4GMSL 1W72B 2DDQL 2O5YH 3QO0B 3VXNA 3VFVA 3HR5A 1FPTH 1Q9WB 1WTLA 2XPGA 4U1MB 1DR9A 4DVRH 1D6EB 3WS3A 3QQ3A 2R0ZH 1JGDA 4ZDHA 2MPAL 4BUGA 4JKPL 5IEKB 1U93A 3KYAA 4P9HL 1VEOA 3KPPB 2APBA 5T3ZH 2P5EA 7CGTA 2VKXA 2OZ4H 5H2BB 4N0YL 4OGYL 2YPLD 3KPNB 1D5BB 5JQ6L 1NMCC 2PYFB 4J8RA 3VGAC 1S5IL 1N64H 1WUNT 5MHSE 3PNWA 5F44A 4BKLA 3WIIH 5F97E 5BOZG 4IRJB 5IKCB 4PRHD 1QVOA 5JPNA 5LCVH 1AFVL 4OTXL 2VLJA 1GZQA 2QHLA 3FOLA 3KS0H 4AIZA 5JHDB 3ARZA 1S7SA 5FYLL 5DMKA 3HZVB 3M8OL 4K8RH 4QGYA 5D4QA 1AR1C 1CFVH 4S11A 2DD8H 1KPVB 4G9FA 3QIBA 2ZCKL 3DVIA 4KRPD 2X4TA 4HFWB 1I75A 1CF8L 2DL2A 3BKCH 3WHE1 1PZ5A 5BV7B 4MXQC 1QLEH 3QUMA 3ULVD 3SDCB 1MWAL 2H9GA 2P24A 1SEBB 2XTJD 2YK1H 5HGDB 1NBZA 4FG6C 2HT2C 2NY2B 4X0KA 4XTRC 3V7MA 4CMMA 2A6IB 3SCMA 4WENB 4ZFFA 3O3AB 4KGLA 4RFEA 4ZG1A 3HNSL 4AEHL 3RVUD 5E2TH 1U8QB 1T89A 3K1DA 3L1OH 5F7EL 4JFEA 3X13A 2HAZA 3EKCA 3KPSD 4X5XB 1NSNL 2Y06H 5L9DL 2WWMC 1IKFL 5IHUL 2XFXA 1ZT4B 2Q76A 3W5MA 4KQ3H 4EUPH 4C56D 1YMMA 2G60L 4M1GH 3QUXD 1K5NB 3S36H 4LASL 1Z0MA 3TBYB 4JCMA 4NO2B 4XBGA 1CWVA 1UH3A 4J3XA 4NQXA 4YGVA 3M45A 3U0PB 3HS0A 4QRQA 3V4UL 5EPMB 1PVHA 2X9XA 4WRLA 5JTWA 1RFDH 4G5ZH 3H7BB 4KQ4L 2EICA 4HLJA 3TBSB 4S1SH 3GNMH 4CNIB 3BIKA 3TO4C 1X9QA 3BP6B 4NCC1 3BZDA 4LLMB 3G6JF 1ZT7B 5KS9B 3TF7C 2E9BA 1FFNB 4ELMB 3MOQA 4UINL 4GW1A 2IBZY 4FP8L 3PABB 3PG2A 2HKHL 3BXNB 4DK3A 4MCYB 2UWEB 1T7YA 4WIQA 2EYRB 3VFMA 5I66B 1IZKA 3U9PL 3T8XA 2BVOB 4YBQD 4PJHA 2NY1D 1U58A 3BKYL 3QPXL 5GRZA 4A6YA 1SVZA 4ZTPH 3ARTA 3RGVD 1I7ZA 3MRQA 2E6JA 3VFTB 2AGJL 4FFYL 4OZGB 2AS5M 2EE2A 3BPCB 4Q6IB 1A7NH 1DLFH 1BM3H 1OTSD 1TETH 2OJZH 4FMKA 3LOWA 4JGUA 4LDOB 4RMRA 3LV3B 3EJJX 1FL5A 1R3KB 5EBWB 1MLCA 4YHPA 2H6PB 5F7KC 5F93C 1CXHA 3SE9H 4MLIA 1TVDA 1A1MB 3P0YL 4LLUB 4DW2H 1SM3L 4QRUB 1P6FA 1G7HA 5D2LB 5I73B 4M3KB 2XN9A 1WBZA 1HK6A 1S78C 3NVQA 1PX4A 3P40A 1YEIH 3QIBC 3ZL4H 5TGBB 3WE6A 1WBYA 3GSQB 3FOMA 4BZYA 4OCWH 4RZCB 4C54A 4L8CB 1FAIH 2CO7B 3GGWA 1TFHA 2D7TH 4I3SH 3RL2B 3CCHA 1YQVL 3ILPB 2AQ2A 2FECI 5I75C 1UZ8A 4XP5H 5CBAB 2AQ3A 3PXJA 5FUZL 3TN0A 3UTPD 1U41A 2R0WL 1CLCA 1EUTA 1I7TA 1OAZL 3A67H 2W38A 1KJVB 1CDYA 4NRYA 1X4ZA 4Z7VE 1T89C 2P45B 4L4TD 1TZHB 4YHML 1OLLA 2I24N 3C5SA 3QEQD 1G6RL 2XXMB 5B8CA 4GAGL 3LRGA 3VFGL 4IMLB 4PY7A 5GPRA 3RWCA 3MCKA 1OP5K 5F7WC 3BSZH 3KR3H 4V2BA 4JFDD 4NO0A 3BRDA 3G5VB 2BVEA 3P4NB 4S10A 3GKWH 3EHBC 2I60H 4OCLC 3RNQA 3HZMA 3BIBX 2BNUA 5D5ME 5CEZL 5HHNB 3GB7A 4PJHF 5B4MC 1QSED 1CG9A 4PJGA 2P7TA 1XGYL 1FL6B 3KXFA 1Z6JT 3LS5H 4M6OL 1IAMA 2R69L 3MV9E 2OL3B 4QHUB 4I48B 1FLRH 1MY5A 2UYLB 5HYJD 3KPRA 4KUZL 3UEZA 1TQCB 4E41E 1AD9B 1Z3GL 8FABA 2CLRA 1T6WA 3MNWB 2VISB 1JFQL 4WU5A 4JRXE 3L3DB 4OKVA 1UKTA 1CFTB 3BJLA 1QFWM 4KK8D 3W2DH 4LIQH 3CMOL 5JDSB 3H9HA 4K3JH 4W4NA 4UV7L 2A9NL 1YPZE 3MJ7B 5GZND 3QNXA 5KSBB 2DAVA 3EO9L 4P46D 5BZWA 4DZBB 4URTB 1JWUA 3ULSA 1LO0H 1WWWX 3U36B 3BMVA 3MJ9H 2KZ1B 3C60B 3B5HA 4QHMA 2GK2A 3I9GL 4JHBA 1G0XA 1OCWL 4PB0L 4XNQB 2ZPKL 3QSKB 4EVNB 2R1XA 1R3HA 2YPLA 3O3BB 4PTTA 1R3LB 3WSQL 5D7IF 2YD3A 4LPXA 4OLVH 1FYTD 1GC1C 2EDFA 5ITFA 1RUKH 3UXFA 5C0DA 1FVCB 5JHLH 4HFUH 1A0QH 3WIFA 3QQ4A 2IBGA 1B90A 4PRHA 2BNRE 5T3XH 1LO4H 4GW5A 5A3ID 1GGUA 2Q3ZA 3VG0L 5TDPA 1AI1H 1KIUA 1S8DA 5TPWL 2AXGA 4ETQB 1QR1A 2FL5B 4HUUA 4P48A 4GBXD 3HRZA 4QXGL 5EC2B 3WO4B 4U1LB 3VFPB 1ZHNB 4LFHG 3T77A 5F8RC 2MSPA 1X44A 4XWOC 5HHVL 1KN2H 3QT2A 4BUHA 1MELA 5JW3L 3BPNB 3CSYB 5GGSA 4F8TA 2NLJA 3LKRA 4N90D 1G9MC 1MJUH 5BS0E 4LHUG 4ZUUB 3UTSB 3C5JB 2BJMH 2HP4A 3TN0C 1RURH 5J06A 1QSFB 3AS2A 1Z9LA 3QIWA 4IS6B 3EO1A 3UTTE 3D85D 2VLKD 3BWAA 4QHLB 3GHEH 4M6AA 5ADOL 3V8CA 3P4LA 3CH1B 2OX5A 4MSWA 3WFDH 4GRLA 3MA7A 5B8CC 2P47B 1TDQA 2FJGB 2WUBL 5C7XL 4M62L 2Z8RA 2DJ4A 2X4PB 3PGDB 2X41A 3CZFB 5BVPH 4NUGH 2GCYB 4C56A 1I8KA 1F4WH 2ED9A 4LRNL 1FCGA 4P4KD 3DUUB 3LN4B 1GGBH 4Y5XA 3WFHA 1ZA6A 4M9OA 2IANB 4PJ9B 2VDQH 2EO9A 4FRWA 3VMPA 3LIZL 1NEZG 5CGYD 3V0AC 3E6FA 1T0NA 1IAII 5M95B 3V5DA 1QQDB 5T1LD 5D70L 4DCQB 3BE1L 1MWAB 3I6GB 2P5WB 4KJWC 4XNMB 3OKMB 1S3KL 3CDYA 3MTRA 3WKML 4J3WA 1T0PB 4KVNH 3ZE1F 4ZUVB 3C2AL 3ALPA 2HN7B 3WLBA 4MXWH 2WBJD 2FX8L 1S7VB 3G08A 5TDOA 5IVZA 1WZ1H 2R1YA 4HJJH 4WI3A 4XVTL 2V5TA 4JN2A 1KJ2A 1EO5A 4NQCE 5K9JL 3SDAB 3CK0H 4Z7QF 43C9A 2A1WL 2AVGA 3N1FC 3T0ED 4PJFA 4QWWD 4KKLD 1P6AB 4HC1L 3WJJA 1TVBA 3C87A 3V6BR 1SY6A 4PJAB 1BZ7B 3RGVA 1VACB 1AO7E 3ZDYE 3DYMA 4P5KA 2PNDA 5C0GA 5MEPB 5DJZB 2XACC 4HWBL 4D9RD 5JORA 3AMKA 3GMPB 3U9UA 4X7TB 4EI5B 1RAMA 2FZ3A 4HUKB 2GIYA 3PWVB 4LSSH 4YPJA 1OLZA 1F13A 1ZT1B 2L0DA 1QHPA 1EBPA 1A6WL 4X7SL 4Z7WE 5K9OB 4QRSA 1EAPB 2VDNL 2MOVA 1IQWH 3T1WA 3MV7D 1P2CA 2VLRB 5ANMA 4NFCA 3LZFL 4LQFH 4L4VE 2JELH 2VSCA 2WNGA 3EOTL 3O4LE 4KRPC 2ZOKB 4L9DA 2F8VA 3ULVC 5KSAB 1YN6A 2XTJC 3QG6B 4UOW0 2CUHA 1AGEA 2EH8H 3QIWC 3KNBA 2HG5B 5IQ7H 1J1PH 4I9WD 4ODHL 5FGSA 5DK0A 3RVTC 1C7SA 3S35X 4NJ9H 3HC3H 4JFPA 1G7PA 3OKDA 3RVUC 5HHME 4N0UB 3HA0A 4L4TA 3MXWL 2C1PA 4GRLC 4HMEA 3RU8L 3S9DB 3MACL 3QEQA 3WNPA 1UACL 4AEIL 4Y16D 1T7VA 4S0SD 3HUJA 3TA3B 4OCXH 4MA3B 3DX8B 3GSWA 4K7PH 1V3MA 4JFDA 4L3EE 1OB1A 5JOFA 1FIGH 1U3HD 4U1IA 3IJYB 3I3DA 4MLSA 3DVFA 4C55A 1GGIL 3PGCA 3U1SH 4Y5XC 5ELIA 2E9WA 4MA8H 1LDSA 1JZ2A 4LLWB 1HHJA 5D1QB 1MSPA 1U8NA 1YEGH 3H0TB 4XPAL 5CJOH 5HVFB 1P5VA 1QSEA 4U1HB 2E7BA 1VPOL 1NC2B 3FTGA 5C09E 4ZOBA 4LGSB 1W8OA 4YK4B 4XP6L 1BOGA 4X4YB 4JG1L 2FIKB 2AJYL 3MBEC 2WBKA 3WFZA 4F7PA 1YECL 2CJUH 4HIJB 2B1HH 5FOJA 3RWEB 3OKNB 5HYJA 3QRFM 1MF2H 1ES0A 2ADFL 4WI6A 5FYKU 4MHHI 2KQNA 2WQ8A 5J11B 1HILA 4V1DE 2BSED 1WAAA 5DJDB 3TJEL 5LJYH 3IFOB 1EEQA 1G6RB 2UUDK 3KPSE 2WK2A 4GUPA 4HUVA 1RZ7L 4KTDL 5H94B 3P2TA 4X99A 4RMSA 1DQDH 4P46A 1AGCB 4WY7H 3F7VA 4YBQC 3WIHH 2NY1C 3QNYA 1MUJB 2CGRL 3DGGA 3WJJC 3MLXH 1W0VB 2WP3T 2JJSA 1MRDL 3EFDH 3RGVC 1Q9LB 4GOSA 2AK1L 5T5FL 1F3JB 2HJKB 2ZKHH 4DTGL 1UM5L 1OTSC 2ZG3A 1B2WH 1JHKH 1DUZA 1KLUB 1SJHA 1FYTA 2DQGH 2HFEA 2AXFA 4M43H 2DF3A 1C8PA 5J8OA 1FVEA 3FB7B 4G80A 4GAJH 4D9LL 1UXWA 1M7IB 3L6FA 3T4AB 3VXMD 4WI9A 5IK3B 1EX0A 3C8KA 3HUJF 3IFLH 4HIXL 3WD5L 3QA3B 1TJGL 4GBXA 1EO8L 3RWHA 1K2DA 2EDYA 1IC1A 5D9SA 3JWOH 1A7RH 4ZUTA 4YQXH 4AM0A </