5D7JB

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
GITQAPTSQILAAGRRMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSEAGGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jB02
3RGVA 2XICA 3DGCR 4BSWB 4TVPD 1C5BH 1WCQA 1NGYB 2Z31B 1LEGA 4Y2DC 5CEYA 1LE5B 4D8PA 1UVQA 3ARBC 3SGJC 2GK0A 4DKEL 5DEGA 1FC1A 4XH2B 4LLAA 4PJXA 3MCLH 5K93A 1T2QH 1N3NA 2PTTA 1ACYL 5HHMB 1A6UL 4DUVA 1F3DJ 3DXAE 3F5WA 4E0RB 4BZ1H 4HG4J 4DZ8A 1LP9A 3B6SA 3BE1H 4MA7L 3RKPA 5DQ9B 1WBYB 3RVUC 2DLTA 4MS8C 2QR0A 4TUOB 4Z6AT 3MRLB 4E41A 4U1SA 1CWVA 3DSNA 3RJQB 2CJUH 5BV7L 5ID0A 5KBNC 1EJOH 3EGSA 4JHBA 2P42B 5C0AE 5JZ7C 4EOWL 1BQHG 4M7JH 2DJ4A 5F72S 4NNYA 1YEGL 3BIBX 5J1SC 2PXYA 3O3AB 5BW7C 5FCUH 4FTVA 1XF4A 4XNQB 1FLTX 4X7SL 4PGCB 4V1DD 1T1XA 4OKVA 2OL3B 3QAZB 4D9QD 4KK8C 5FUZL 4XBGA 3VG9B 2LU4A 4XPAL 2F58L 2OQJA 1JHTB 3MLUL 1ITCA 1C16A 4MX7A 3D69B 5L6YL 4H88H 5GRZA 3FQWB 4MAUL 1BOGB 5JHDD 1I1FB 4MQSB 1U8KA 1UWEL 1CI5A 5C0DB 3ALPA 1EGJH 3KPSA 1QEWB 2H2SD 5I8OH 1FCCA 1UKQA 3MUGA 4M61A 5C0BA 1MCWM 4AEHL 4XTRC 1BJ8A 1MWAA 2DLGA 4RDQF 2XZCH 3WMSA 1A3RL 2VLRE 3NPSB 4I18B 1JRHH 1ADQA 4H1LA 4L4VB 4Z7VE 2Z4QB 1J05A 3AFLA 2OL3L 4L5FH 1CG9B 3LDBB 3VD9A 2ZUSA 4LF3A 2EC8A 5ACZA 4Z7NF 2NLJA 3FQRA 3P4OB 5E8EA 2P46B 5DUBA 1QTYT 1FO0B 5CIPA 1KCSL 4OM0H 3BQUA 2XV6B 1JF1A 3VMNA 4TSAL 4PJBA 3GSOB 4OD3H 3DGGB 1JPSL 1PZ5B 4JKMA 1C1EL 3SDYL 3UJIH 1HINH 1L9NA 1PKQB 2CIIA 1TTGA 4MA8L 4DGIH 3IDMB 5IBLC 4O51B 3ZE2E 2OI9B 4XVUD 2NNAB 2DQHL 2H1PH 5DSCB 5LGHH 1FPTH 4AQ1B 1FZMA 4PRDB 3SDDC 1P5UA 4GLRI 4AMKH 4N90D 4JRXA 3KDMB 5B4MD 5T1KD 5F7YC 1QG3A 3TA3A 2OX5A 3F7YB 4C58B 4JJ5B 2RFXB 3A6CH 4OF7A 2YZ1A 4XRCB 3MRRA 2CKBH 3RUGB 4DCQA 1I8MB 4M48L 5AAMA 3T1FA 4MZ3A 1FO0L 3LB6C 4G6MH 1RJYA 3LV3A 3U0PA 4Y4FD 4LLYA 4W4OA 2PKDA 4YBLB 1KOAA 4LAJH 3TT3H 3I6LD 2YMXH 2H2PC 3VE0B 1A9BA 2VE6A 1B6DA 4JHAL 4XPGH 4OCLC 2E8YA 3JTSB 1RIVH 3MJ7A 5D7IF 5JW3H 2KDGA 4NOBA 4KGLA 1D5XB 1EO7A 2UZIL 2DQTH 5I8EB 2Y06L 1GIGL 4J23A 1D9KB 4JQIH 4MDIA 2R0ZH 4NZUL 4NZJA 1JGDB 3IJSB 2PYED 5CJXC 4IDJL 4U0RB 1MRCH 4WWKA 2VXVL 4JDZB 1KFAH 3BGFC 4DOHB 4R2GB 3AGVA 2B2XH 2IH1A 5K59E 1GPOL 4G7VH 3QDGB 1G6RL 4MA3B 4NYLB 2UVEA 1IGFH 3QPXL 3O0RH 4OCSH 5LGJA 4QCIB 3O6FA 1QBMH 3S37H 3B2UC 5F7EH 4M4RA 1E4WL 4I3RL 2NR6D 2X05A 3PHOA 4QWWC 5SWZE 3FHQA 1Q9WA 5I1CL 4XBPA 3OKLA 3P4MA 1OARL 2ICWJ 1IKFH 2EDTA 2FHBA 4S11A 1TZGL 4P46B 4AIXA 4HLZH 3NAAH 4QTIH 2K3TA 4NSKA 4X9BA 3RTQD 3HCVA 3SGKC 3BSZL 5I1AA 1TZHB 1U36A 4JRWA 1BF8A 1NCAL 1A1OB 3TBSB 1TNMA 3V52L 3NTCL 3V6OE 3MCKB 2HH0L 2FWOB 4OAWB 2X9XA 4HIJA 1KCLA 1VENA 5B39A 3PE9A 4RBPH 4OZGE 1YUHB 2CRMA 3SDCB 4HW6A 2F5AH 5I74C 4H8WL 4YGVB 1OL0A 4OCRL 1LQSR 1A4JA 1JJUA 1OHQA 3CSYB 4U6XB 2F53A 4YPJA 3TIDB 1A6AB 1MWAH 1U8QB 1NDGA 2V2XB 3I02A 2Y07L 5F6HJ 3CFKA 5I75C 3U4EA 4H1LH 1YPZF 3BEVB 1DL7H 1FVEA 2FX7L 2UUDH 2D3VA 4Y19A 1BLNA 1CD8A 1MH5A 1OCWH 3TVMC 4GKZB 4PJFA 3S97C 1IEAA 5EFIB 2CDGB 3BKYL 4LRNH 1YEFL 4L8DB 1EO8H 1DFBH 4XPTH 4XCFL 5CIPH 4MAYA 3D2UB 4PB9H 3TLRA 1WFTA 2C4FT 5CD3B 4FN0A 4ZTPH 3PWLB 3GMPA 5FUCC 1T7ZA 4YBQC 2NTFB 4HWEL 4YDIH 2VDKH 3KYAA 1MFDH 4P2QA 1GXEA 3V95A 5HDBE 5SV4A 3DX9A 4JFFD 1JI2A 1KN4L 1AE6L 5FA4B 4EZMA 2L0DA 4ISVA 1RMFH 2R4SL 2GY7B 3QHFH 5F3BB 1HKFA 3WJJC 3LD8C 2WUBL 3B83A 2B1HH 4GMSH 4TUKH 4G8GB 4RMVA 3DHMA 2EIBA 2VXUL 1MHEB 2QBWA 3UPAA 4JPIB 4MJID 4U7MA 1FZOB 4G6AD 4KI5E 5DUPH 1Z3GH 1YC7A 2JJWA 2XY2A 1PZUB 4G9FE 2E6JA 3NCYS 4YNYB 2OXGA 1NC2A 1N59A 4EBQH 4LU5H 4P59H 3QIWD 1A6TA 4JRYA 3SDAD 1IJ9A 1S9XA 4F7MA 5BS0E 3OKOA 1ZA6A 4K7FA 4Y16D 1CE6A 3WIFA 1IAII 1TQCC 4F7EB 1WAAA 1OAQL 1RY7B 1RIHL 4O9HH 1NCWL 4JG1L 1U3HA 1NSNH 2B5IB 3GSWB 4J12A 4C4KO 4KK6C 4JPKH 3CVHA 5C08D 4PJAE 3MRCA 4ODWA 2Z93A 3BPNB 4G6KH 3H9HB 2UVFA 5DRZA 4HUXA 1CL7I 3I2CH 1JVKA 3CU1A 4Z76B 3ULUC 2VLKB 4UBDD 3QUMB 1J18A 3DVGB 3V6ZA 3O9WB 1UB5A 4RMUA 1I9RL 1NBVH 4NQEE 3RPIB 5TDOA 3BP6B 5ABDE 2WBKA 3MC0A 5HXMA 1RUML 1CXIA 3GKWH 3ZE1E 2FH8A 5JMOC 3C6LC 3RVVC 5I1KH 3QUZB 3PWNB 3TF7C 1INQA 4ZO9A 1FL3B 3S98A 3PABA 1MVFA 4LCWB 5SV3A 3MREB 1J0IA 4MNGE 5FA3B 1R3KB 4YHNA 5ESVA 1NBYB 2VRAA 2DS4A 2XWJB 3MUJA 4U1HB 1EHXA 4OUUA 5HYSG 5GRUL 1UZ8A 3TH4T 1IAKB 3P73B 4HWNA 4ESKA 1KPVB 3TCLA 1OSZA 3MNVA 2H32A 1UJ3B 3BESR 3KYOB 4G6JH 4RIRB 4YHOL 3CVIH 4GAYB 4OLXH 2YUXA 2DWDA 3TPUB 1JN6A 2ESVE 1A7RL 1NCNA 1X5HA 1R3IH 5D70L 2Y1VA 3STBA 5SX5K 3INUL 4X98A 4IMKC 3NPZB 2APTA 4CN4A 4QXUL 4DKDC 4RISL 3F8UB 1MLBA 1W0VA 1RV6X 2AXGA 3ROOA 2DQCL 2JJSC 1CICC 4U6HB 1INEH 5I1LB 4HUKB 4WFHD 2AQ3A 1WBXA 2D03L 1OT1A 4V1DA 2BVTA 2OSLA 3VXME 5D2NE 5J11C 1VKXB 3Q1SH 2BVEA 2A9NH 2GITA 3ULUE 1AFVH 1C7SA 4R96A 3HRZA 4QTHB 3WL9A 4Z78B 4OI7A 2BNQE 1G9NH 1N0LA 2E6PA 3UDWA 2MKLC 4WTWA 1U3JA 4QHLB 4QHKJ 3QQ4B 3I6GA 3I3EA 1DJSA 4OBSA 1GHFL 3BGMB 5EB9A 4P9ML 2I9TB 4P2OC 1YY8A 1ZVYA 3IGAB 3KLHD 4Q7DA 2WLZA 1NDMA 2Z8SA 3S36X 4HLZG 3GSNH 3O45B 1H3TA 1P4LA 5TQ0H 2NY3D 3MRKA 5J12B 1CXLA 3SQOL 1JGEB 2EYSA 5IJVB 4PJGE 2XTJD 4L8SC 5IQ7H 4JCMA 2GFBA 3C5SB 3DUSB 2VJXA 2ZG3A 3QNZB 5HHMD 5J9PA 3EYQC 4D3CL 3WLWC 4XBEH 3VG0L 4ZUSB 1V3KA 4APQB 4WTXA 3QUKB 5JQHC 4U3XA 3GMLA 4UV4L 3BPCA 4W68A 3FT4A 4HCRH 4WV1B 4AL8L 2DLFL 3GHBL 3LKQA 1I75A 2VKWA 1U3YA 3HZVA 3U7AA 5I1DA 4OV6F 3FFCA 5LWYH 2BVUA 1CFQB 4M9OA 3TJHC 1F8TH 4GMTH 4L29A 2WP3T 3W5MA 3UMTA 1KUMA 1W0WB 2UZXB 4Y5YC 4X9HA 1KB5B 2NXZC 1A1MA 4GRLB 3IDNA 1WZ1H 5E9DA 5T1KA 5HDBF 4PJDF 5HHVH 3IDYB 2R1XB 4OFDA 1FGVL 4O5LL 2F8OA 2BDNH 2X10A 5FYLH 2P5EE 2P7TB 2RGSA 1LNUA 2C7UB 4TTDC 1CFNA 2EXYD 4LLMB 1S3KL 5B3JF 1J87A 4YPGB 5DEFA 4LQFL 4Y4FA 3HB3C 4QRQA 1EX0A 1XGPA 2ADJA 1V3LA 4K7PH 4B0MM 2IBGA 3QIUC 1EEZA 2VH5L 3MNZB 5AZ2H 1T1ZB 3BEWB 3P2TA 5F7NC 3CFEA 4WNQB 4KWUA 3WE6A 1N7ML 2BHUA 4ENEC 5IEKB 5IW6B 5DVLA 4BH8A 1FE8H 1ZMYA 3LEVH 3RWIB 4FQLH 1JP5A 3BUYA 5ICXA 5K9JL 4JFDE 1S7QB 4WW1A 5GS1C 4L4VD 2H32H 1KB5L 1FL6A 3C60D 1KIPA 3PL6C 5JXAH 4FQHB 2PYEA 4Y8AA 3MO1B 4G5ZH 1P7KA 4QF1A 4PBWD 5HJ3B 3NFSL 1ZE3C 1X7QA 1ZWIA 2H6PA 3IXTA 4NRXB 3WFEL 1R5WA 1ORSA 3EDDA 3IAGC 4DFIA 3BDBA 5EOCJ 4PREA 5FKAB 1UM5H 2E9BA 1FBIH 4PJ9B 5ERWA 1LO5A 5INDB 3QUYB 2EDJA 1Y6NR 2YPKA 3LEYL 5D1QD 4JKLA 5D72L 3BPLB 3H7LA 1BBJB 4U2YA 5AG8A 2V5YA 2Y5EA 4LSRL 4NKDA 4YBHA 4HIIB 4JFXB 4LSDA 1JTTA 4IS6A 2Y5TB 4G80A 3L9RB 4AEIL 1C7TA 3SCMA 1HH6A 1D6VH 2NW2A 4NP4L 3V0WL 1Q38A 2DIJA 2ZUWA 1Q0XL 3LQZA 3FB7B 3U1SL 1WVZA 4MD0A 3RTQA 3IJHB 2ZCKH 4HKJA 5ITFB 3O6KL 1CD9B 1U93A 5DRXA 3VXUE 4KKCD 4NBXB 3MRPA 4MZ2A 2OTWB 4GRWF 5JTWA 1RFDL 4ELME 2VWEE 3OTTA 4YK4C 5C0JB 5CINL 4FS0A 2CLRA 4MWFA 2Y36H 4DKAA 5DJ8B 2PF6A 4OFVA 3IXAA 2ORBL 5DJAB 4P23C 1I7ZB 4WDIB 2DIAA 5JO5A 5GZOD 3HAEB 3VA2C 1QSED 3ALWA 3KPRB 1PG7X 2FIRT 5DMKA 4R7DA 4EQ3A 4FG6D 4ZYKB 1PKOA 2FJHB 5DD6A 3LKNA 2VDQH 3KYNA 1YJDC 3HHRB 4L9LB 3WXVL 3O2WH 1RK0B 1N6QH 2A0LD 3BRDA 2VDOH 1RZ8A 12E8L 2X89D 3DI3B 1YYMH 5EO1B 2XWTA 3T65A 1PLGH 3MUZ1 4RFOL 2AQ2A 4QRSB 4P49A 4RAVA 4R2GD 4N0CD 1B3JA 5BRZB 3RNQA 4KZDH 3LSOB 4IJ3B 1VEMA 1DBMH 4PRPD 3UO1H 4P9HH 2ATPB 4YO0B 1X5KA 1GAFL 4KKLC 4JFFA 1TETH 4YE4H 4LVEA 1DQLL 3L95B 3KPMB 4JB9L 4UQ2B 4U1NA 1A7OL 4HFUL 5KAQG 4N8CH 4PB0H 5DMIL 4OLZL 2AERT 3QJHA 5CS7A 4LHUD 3O81A 3MLPA 1MJ7L 4QXTB 4P2YA 3THML 5DA4A 4P46D 1K8DB 1I1YA 4MJIA 4PGZA 2XQYK 4X5WB 5SWSA 3LPFA 1FVCB 4GG6E 2EH8L 2QLVB 4KRPB 2X4RA 5JW5A 2WBJD 1SEQL 1JZ6A 3BO8B 4PGJA 2OXHA 3QNYA 1TIUA 4WEMB 1KC5L 5BZWA 5JOPD 2VB5A 3RZCB 3GMNB 5AZEH 3SDAA 3S88L 2VNCA 3RDTD 5FYJU 2WZPD 3MGTA 3TEUA 1FNGB 4QKXB 1DVFB 1KCKA 1MRDL 4I0CC 2R0WH 4Y16A 4ZUVB 2IFFH 3F7VA 4F80A 1QLRA 5FYJL 1XH3B 4WU7B 2EKJA 2E5EA 1UWGH 3I3BA 3VFTA 4UAOB 2GI7A 1U92B 5C08A 5B8CB 4FA8A 3QDMD 4ODTH 4WU5B 2R2CA 3MJ9L 4FMKA 2LTQC 5D7IB 2NX5A 1AI1H 3ZKXC 3D0VA 4NHCH 3CX5K 3LS5L 1TLKA 5T33H 4LLDA 5CP7B 2XN9B 1IAMA 5L2KB 1B0GB 3P0YL 1KLGB 2AGJL 4QRRB 5DZNA 4Z0XA 1KPUA 4UTBL 4OZIF 1F11A 3VA6A 2IANE 1YEIH 4KK9D 4FNLH 3OB8A 4K8RH 1DN2A 3KPQB 1YMHA 5KVEH 4K23H 2DM2A 5DHYB 3FOMB 1WCBA 3OAUH 5DD0H 3OKNA 1CLZL 2DQGL 4YHIA 4X80H 4EI5C 1G7QA 4U33A 1FSKB 2GSGA 1EFQA 2YKLL 3C08L 4P5TC 5IMLA 5KSVB 2OP4L 1WJ3A 1CQKA 2P24B 4G8GD 4MJ6B 5SWQA 5JOFB 2XFXA 4G43B 3T08A 3HZYB 4NHUB 3GDBA 3LN9A 4YR6B 4PY8I 2XA3A 5F8QC 4AQOA 1Q94A 3BW9A 2F74A 4HSQA 4EDWH 4JGUA 5FYKL 3DO7A 2ZJSL 5C2BH 2IAMB 1E4KC 5EUOA 3LN5B 1MHHA 4HUUB 1X5FA 5CD5C 4YXHL 1YNLH 2OLDA 2EDHA 4JY6B 3WIIL 2EDQA 4OLVL 3QP3A 3CUPB 4KAQH 3SE4C 3UTSD 5JR1H 3AM8C 4NRYA 4X6EA 1TJIH 2HFTA 4D9RD 1CF8H 1T4KB 4IM8A 5C0GA 3DXAB 3MLVL 1PYWB 3G6DL 1I3GH 1LMKA 4GKSA 1LDPH 1ETZB 4QNPE 2V7HB 4GBXC 5C2UB 4ACPA 1BZ9A 4I9WD 1T5WB 1QFWM 1RZFH 2YSSB 2MHAB 2VN4A 2DQEL 2ADGA 4M93B 1U8HA 1YPZB 3E3QE 4FXKB 4LSVL 1U8JB 2VLKD 3RU8L 5MERA 4PD4K 1FL5B 1DQML 5E2WH 4LVOC 1VFAB 3ZDYF 1S7WA 1P9MC 2DTMH 3B9KC 3WUWB 5D71H 4Q6IA 5E8NB 4X7EC 2VLJA 5D1ZC 1X5GA 2N56A 4NUJB 1IARB 2BCKA 4I0PB 1ZGLA 1QFWH 2CXGA 4BSWA 3VFVA 2Z31A 1FIEA 4Y4HD 3EO9H 2H45A 2VL5B 1LE5A 5D93C 3IVKB 4ODHH 5FB8A 3IF1B 2JELL 3VW3L 5DMGD 3VFNA 4XH2A 1MHPL 1X9QA 2OR9L 5FGBA 4FZ8H 3D85B 2NXYC 2YN3A 4E0RA 3S4SA 1EBPA 1B2WL 1BVLB 3PHSA 2EXWD 3RA7H 5DQ9A 4BUHA 5ACLA 1AXTL 1H5BA 4Y2DB 1RD6A 4TUOA 4YIQB 2LVEA 2VLRB 3MRLA 3ARBB 1CDHA 3OR6A 3MLXH 3FFDB 1BJ1H 4R97C 2DF3A 5IEHA 4PUBL 1JFQL 4NUGH 3UTTD 3W2DL 3HE6D 1KELL 2LQRA 4TNVK 3O3AA 4LAQL 1S78C 4S0SD 1DQJB 1HWGB 4XNQA 5E03A 3GSUB 4P3CH 2OTPA 2HVKB 4PGCA 1SJEB 1QPPA 2OL3A 2X2YA 4J1UB 1I8IA 3T4YB 3U46B 1LP9E 4F15C 1RZKC 4GXUM 2D9QB 2EZ0D 4ODUB 5CSZA 2ZCHL 5TE4H 1T89C 4HXAL 4E41E 4QYOB 3W9DB 4JY4B 3D69A 1TJHL 5CLWA 1EH9A 3FQWA 3V79C 1BOGA 4QT5B 1I1FA 5C09B 1N8ZA 1HSBB 5C0DA 1LO3H 1MY5A 1S7UB 4JFPB 5EPMB 4K3GA 2P43B 2AK1L 1HH9B 4FTVE 1KCUH 1RULL 4ZD3H 3PQYB 4E42B 1FORL 1HYSC 2XQBL 4DGYL 4I18A 3X3GH 1I7TB 4L4VA 5CEZH 3C60A 5DO2C 2M1KA 1ZHBB 2HRPL 1BM3H 2RIKA 1WF5A 2EEDA 2VQ1B 4AJ0A 1G7HA 4OZHF 1RZJC 1AXSB 4ZAKD 3G08B 3P4OA 3OV6A 1NJ9A 3BIKA 3MGOB 1FO0A 2NY1C 4F33B 5EWIH 1YDPA 3KPSE 3C8KB 4QXGH 3GSOA 3DGGA 1PZ5A 4OQ1A 3WHE1 4QRUB 3ECBA 1A5FH 1PKQA 1QHPA 4HJ0D 5JIPA 4N5ED 4O51A 3FRPA 1QPXA 2NNAA 5GRXG 1QQDB 3IDXH 4X5XA 3FQTB 5DSCA 5SX4I 1FNEB 1AGFB 3DUUB 1RQ5A 4XHQA 1EBAA 3MQIA 1KJMB 4ZOEA 4GRLD 4PJCF 3IRZA 1ZGLM 1HHJB 3KDMA 1Q72L 3G5VB 3AUVA 1ACYH 4JN1L 4JJ5A 2NY7L 2RFXA 3G6JF 4XRCA 3DMMC 4ONGH 3RUGA 5HSFA 1GGIH 4MA7H 1I8MA 1L0YA 3E6HB 4UQ3A 4P4RB 1HI6B 5TGBB 2AXFB 2AQ1A 5TDNB 4CMMB 1MCNA 4KRNA 3RKDD 4HIEA 3SDDB 5BV7H 4S1DC 3TBVB 4PBVC 2HLAB 4LDOB 1QSEA 4F2MA 4EOWH 3M17A 4XCYA 5GGQH 2R1WB 3DVNB 5ID1B 3JTSA 2XI9A 2IBBA 1EIBA 1T22B 2F54B 5DURB 5K9KB 1D5XA 4X7SH 4CAGA 2UYLB 5I8EA 5LKNA 4Q9CA 2AW2A 5FUZH 2QKIA 2XKSA 1JGDA 3IJSA 3C5ZC 2X89A 5DJ6B 3H8NA 1M7XA 1GGBH 3K4DA 1P4BH 3QEGL 5D1XC 4PJ8C 4DQOL 4LKXB 5GISH 4GQ9L 1NC4D 4JDZA 1BVKB 1FFRA 1CLYH 1FFQA 3QDGA 4O2EA 3GHEL 4NYLA 4KRMB 4PRPA 4DVBB 1FCGA 1BQUA 4QCIA 3T0ED 4K3HA 3MFFB 1JE6A 4HBCH 1IC1A 2VDML 3HKFA 4AEHH 1MFBL 4LPWA 5F8RC 3PWJB 3L3IA 5HHOD 1PG7L 4H5SB 1JPGB 4UOJA 2V2TB 1F3JA 1H9VA 4UDUB 5E2VH 3BGFB 3RAJL 1T3FB 4NQCB 2AJUL 2FLBT 1MF2H 3CZFB 4P46A 2OL3H 3B3IB 1AC6A 2BVQB 2PR4H 3GBNL 1AGCB 4KDWA 1TZHA 2ZG2A 2AI0L 2MPAL 1A1OA 4P57A 3RWHA 5CZKA 2DTSA 3BPOC 1KCSH 2FX9L 4YEFA 3MCKA 4PJDB 4OAWA 3RPKA 4TSAH 3VFGH 3QRGH 5KVGH 3LZFL 4J8RB 4DKFL 1JPSH 4PGDB 4ONFL 5DD3H 4XP6L 1YUHA 2ATKB 2IH3A 3RDTA 3SDYH 4GW1B 4MA8H 1EMTL 4F7PB 4YGVA 4MXQC 3LKOA 2DQHH 3CSYA 4U6XA 5EC2A 1F42A 2DOCA 3KPRD 1CFTB 1A6AA 1OTTC 1FHGA 1MCPL 1GOFA 4UT6L 1E4XI 5I17B 3PWPD 3BEVA 5JXEC 3CCHA 4GKZA 5GRVK 2ZOKB 4OGXH 3GSVA 4KVCH 1IGML 5EFIA 2CDGA 3OB0H 3MBED 5CCKH 4P5KB 1LK3H 4IOFC 5DYOB 1VFOA 1FO0H 5HVWA 1BMGA 3D2UA 5CD3A 3EJYD 4JREC 2HJLB 3PWLA 3IYLW 2F53E 5I75B 2NTFA 3SGEH 4WW2C 4XP4H 5DK2A 4JHAH 3NCYP 3D6GA 1FDLL 4QHMB 2X1PA 3ILQC 3ILPB 4HAFA 3MRFA 2FDBP 3H42H 2UZIH 4RZCB 4R8WH 1GIGH 4J2XA 3MLSH 1LO2H 3AXLB 4G8GA 2BY3A 1MHEA 3PJSB 15C8L 1BD2B 4FP8H 3LHPL 4IDJH 4JPIA 4OSUL 1FZOA 2P8LA 3CFDB 2VXVH 1JZ2A 4YWGL 4NC0B 3M07A 4NQVB 1GPOH 3I50H 3RZCD 4N1HB 4P2QE 4YUEH 4K2UL 4R4FL 2VO5A 4I2XA 1MRFL 3HG1B 3O3DB 4GRWB 1G84A 3LD8B 4NZDA 1E4WH 2CO6B 4RQQB 1QOKA 5E1AB 4F7EA 4CGTA 1MHCB 2P5WE 3UTSA 3D3VB 1B0WA 4JJHA 5I1CH 3BD3A 4M7LT 5DJ0B 2G9HB 2XZAL 3S34L 3RWDB 2HTKC 3VXSB 2VR9A 3MOQA 5DVOA 1PX3A 2X7LA 4M6NH 1CDBA 4Y8DC 3NZ8A 3GB7B 3H9HA 3IFPB 4ZXBC 1I3RB 4Y2OA 1NCAH 2VLLB 2BNRD 1S9VA 3V52H 4X8JB 3JV5A 2VLKA 2G5BB 5GGSY 3DVGA 1B9ZA 1TQCB 4AT6B 5FYKD 1H3GA 1GCFA 1AGEA 2XN9D 2YPLB 5JIKA 3RPIA 1OW0A 3V4PH 3ZT7A 4NJAL 3P30L 3QUZA 3PWNA 4W4NA 4OCRH 2PN5A 4PYHA 3BDXA 2NY4C 3RX5A 3UTZA 3KPNA 3MREA 3VXMB 1BJ1J 2K7QA 5FA3A 4YLQT 1NBYA 2Y07H 4Q97A 4CMHC 1IM9D 2Z0BA 4B7IA 2BVOB 3NCCB 1EFXB 2H41A 1MJ8H 2EKSB 4M5ZL 4R0LC 1IAKA 1KPVA 3OKMA 4L4TB 2N4IA 5CZVL 5IKCA 3BI9X 3TZVD 5KSBE 3KYOA 2DQIL 5FYLE 1OAKH 3C6LB 3H3KA 4WO4D 5DFVD 3BKYH 4RIRA 1JYXA 4GAYA 3VD3A 2B4CL 1ZT7A 2XA8L 2YEZB 3Q2CA 3TPUA 3RWGB 5IOPB 2BERA 3QCTH 3QDAA 1K8IB 25C8L 4HWEH 3H9SE 3T8XB 5E8OB 1UJTA 5HI4C 5K9QG 2C3VB 5ILTL 4OZ4B 3GIVB 1ZSDB 3HI1A 2D2OA 4MXVE 3UTTA 5IW3A 1NQBA 3HE6A 2J8UF 3QYCA 4PG2A 2R4SH 3MJ8B 4WGVB 3ULUL 2WUBH 3DXAD 2APFA 3QG7H 1KBGH 1F4XL 2VXUH 3T3ME 3FAWA 2MCPL 4JN2B 3TN0C 4GFTB 3S4SG 3L3KB 5GGVH 1ONQB 2WQ8A 4RAUB 1L6ZA 4Z78A 2WINB 3GSRA 5F71A 3PGFL 5C0AD 2X4QB 3DV4B 1QLFB 9CGTA 1CICB 1EEQA 5D8JH 5IB3A 1FIGL 3L3GB 4QHLA 4NQDE 3QQ4A 3VGBA 3C2AL 1PGRB 1NMBL 5IROC 4ZFZB 2NTSP 2NY2C 4V2CB 2AJZB 3BGMA 3EYOB 1XGUA 4PRNB 1RIHH 1F00I 3I6KB 2I9TA 4V1DE 4OZIB 4NO0B 2UWEE 3RX7A 3UPCA 4D9QE 2YXFA 2CPCA 2VERN 3STZB 3V7MA 2A6IA 3S37X 2JKXA 4QRTA 3EDKA 5IJVA 2QADB 3QUXC 4HWZB 1T6VN 4IOSD 3D85D 3DUSA 3QNZA 5ALCH 2R1YB 1I9RH 35C8H 3LOWA 4KQ3H 1Q0YL 4B50A 5HI5C 2PO6C 1OP3H 4MNQE 2MKWA 3SDXE 4ZUSA 4LSTH 2GYSA 4APQA 4M02A 2ARJA 3QUKA 4DGVH 3BVNB 4OT1H 1NAML 4WV1A 5E6IC 4ELKA 2VLRD 3EUUA 4X4YA 1UXSB 4AENB 3DO3A 1VFBB 3JUYA 4L8SB 4XP9L 4FRWA 2CO7B 4WI2A 4NRZB 1RIUH 1DLHB 2R2BB 4LLUB 1QA9A 2WUCH 5T1DL 1W0WA 1KCRL 1OP5H 2FBJH 4YFLI 1KB5A 3TBWB 4GRLA 3MLYL 3QH3B 3STLB 4YHOH 2ZOLB 3DARA 4MS8D 1OM3L 3S8WA 3KPTA 3ZHLA 4LBEB 3QI9C 2R1XA 2UY6A 1ZT4B 3QUMH 4ZPVB 2P7TA 3QO0B 1HHGB 2BK8A 4ODSL 1IC4L 2C7UA 3NIDE 4UTAL 5JZ7D 3FFCE 3FT2A 3HI5H 4K8RC 3OGOE 3R4DA 1WITA 3FRPG 4Y5YB 4QXUH 2NXZB 1S5HB 2O5XL 3KAAA 3BEWA 4BQ6A 3CLFH 2VDPH 3MROB 4HLJA 2DQCH 5J6GB 3RWFB 4KK8D 4HT1H 5IEKA 4HXBL 5IW6A 2YD6A 5E9DE 3DURB 3RWIA 1BVZA 2D03H 2X09A 2JK5B 2QEJA 3B9EA 1S7QA 4N1CA 2PW2B 3HA0A 3WKNA 1OGAE 3HE7C 5HD8D 4LMQI 2ZCLL 1OVZA 4FQHA 4S2SB 4XHJD 4EEEA 3KHOA 3MO1A 4KJPD 2Q8AL 4RAHA 5TPWL 1BF2A 3HTLX 5HJ3A 3QIUB 1F4YL 2FGZA 2W0PA 1NC4A 5E0QA 1JTPA 3QO1B 3P4LA 4XTRD 1N6UA 4PJ9A 4CUCA 3P9MA 4NWUL 5INDA 3QUYA 1DUZB 1GOGA 5CJBA 4YFEA 3MOAL 1GHFH 5GS1B 3QDJB 2BOCB 2HYMA 1KJ3H 5LG1A 4QY8B 4P9MH 1SBBA 4KJYB 4DTGL 4QLRA 1L0QA 3PL6B 1DCLA 1AGBB 1KIUA 4HIIA 5ADOL 4JFXA 2VABB 4WFGD 5HHOA 1UYWL 5D5ME 1IILE 2Y5TA 4JG0H 4RFEB 3S35X 1T83A 4TPRL 3SQOH 1KYOJ 4N5UA 4KQ4L 4TN9A 4WW2F 2EYRA 1MIEH 3FB7A 5A43C 1F02I 3WD5L 4Y1AE 1MUJB 4LDLB 4NZTL 3UBXI 4PJHE 1FNSL 5FM5O 5EC1B 5HGBB 5ITFA 1IMHC 4HFWB 3D18B 2OTWA 3DPBA 1R3HB 4JZOB 3V5HB 4UV4H 5SWZD 3DX7B 5E6ZA 4TQEH 2DLFH 2XPGB 3GHBH 4H26A 1MCHA 3GNMH 3CMGA 4M7ZC 2WP3O 5DJ8A 3SDDD 4J3WA 5DJAA 4FQQB 1I7ZA 4WDIA 1EAPB 1YQ2A 2UUDK 3HAEA 4UV7L 3O3EB 3KPRA 4PYGA 1JTOA 4BKLB 4K7PY 4LHUG 2GEEA 2M8XA 1CFVL 4ZYKA 1TCRA 3HC4H 1VGEH 2WBWB 3HR5B 3LEXA 4HZLB 4XPFL 2F54D 1ORQB 4L9LA 4YK4B 1PQZB 3PXJA 3LB6D 2AEQL 4MXVF 4O5LH 2HTLD 3QHZL 3MBEA 4N0UB 5EO1A 5B22A 4P23B 5DK0A 1CIUA 1D5BA 5HVFB 4QRSA 1MCKA 3QA3B 4LQFH 2K9UA 1F4WH 3LMJH 4OZHB 3PHQB 4NKIH 2P45B 3VFMB 2CIKB 5BRZA 3LSOA 5GXBB 3O6LH 2EE6A 5EOQL 4YFLF 3TO4C 5DS8B 3PP3K 2FZ3B 3EYSL 4YO0A 3E2HC 1XCTB 5E70A 4EUPB 2VAAB 1OLLA 4CVZA 3BAEH 3IT8D 4POZC 5C71A 1Z2KA 4K3EL 3F12B 3L95A 3KPMA 1G9EA 5DJZB 1KB5H 2GJ6B 3MJ9A 2DQUL 4Z8FL 5IMKB 4XNUL 2EDBA 2UZYB 3VWKC 1K8DA 1F4AA 3FO9B 4IMLB 5D9SA 5EU6B 3NFSH 1YC8A 4X5WA 1QRNB 4HKZB 4XMPH 1FVCA 4IRSD 3MACL 3BO8A 4PJCB 3R0NA 4QWWD 3RZCA 3GMNA 5C6TH 4U7SA 3G6JB 1K3ZA 1U2CA 4WHYH 3EJZD 1P84K 4D0CB 3LEYH 3DSFH 5F3HB 4WENB 1FNGA 1CE1L 1OWWA 1YJDL 4ZUVA 3CMOL 5E7BA 4X7FC 1CBVH 2D9CA 3BRGC 4NPYB 4PV8B 1XH3A 4FQPA 4WU7A 4XAKE 2ENSA 3SDXF 4BZ1L 4JLRB 1H3WM 4KI5D 4NO3B 1TNNA 3V0WH 4KMTL 2BVYA 3AB0C 4G9FD 1DQQB 5SWSE 1AR1C 4WU5A 2IQAB 2WIIB 4AZ8A 5ACMA 3RVXC 5D7IA 3OG6B 1IGIH 2AKRB 4U1JB 3O6KH 2BNRA 2X41A 4X4MA 3O3UN 1JWSB 5D7LE 5I9QC 1RFDH 3DTXB 5CP7A 2XN9A 4M43L 5CINH 1B0GA 3MYJA 4LCCC 4QRRA 5FCUL 4UDTB 3CSBA 4E9LA 3BHBB 1Z5LB 4TYUA 2ORBH 4EKXA 4F8TA 3VRIA 4Y4KD 2LTQB 3TVMD 1KPRB 1R3LB 2VC2L 3KPQA 3CDFA 4C56E 3ZKXB 4X6BB 4TNVF 5DHYA 3FOMA 3ES6B 2HMIC 5CBEB 5H94A 5KG9B 2YUZA 2NX5E 4H88L 1HZHH 3Q5OA 3TZVA 3ARXA 4MJ6A 2ADFH 4J4PC 4WO4A 3TESA 3PG2A 4ETYA 5JOFA 1EGJL 4P48A 1JYVA 4YR6A 5HDOA 5I8OL 4P0DA 4HHAB 4OGAC 1U9KA 5IT2L 1NCDL 1XF2A 4R9HA 1JZ5A 5I8CA 5BO1H 4WCYL 2YPVL 4PJIF 1SJXA 5C0CB 4HUUA 1D5IL 1A3LL 4D2NA 4HGKC 5J57B 3R0MA 4EI5B 5F7HA 5D2LF 3VFSB 2D7TL 4JY6A 4L5FL 4P5TB 1DLFL 5E4IA 4BH7B 3HAEH 3RL1B 4OI8A 2BY1A 5GZND 2ICWI 5CEZE 5CGYD 1A7OH 2Q76B 4HFUH 2DLHA 5DMIH 2RCSL 2BVPA 1OAXH 3DXAA 4OM0L 2CGRL 1PYWA 1MJ7H 4JPWH 1ETZA 3THMH 5D6CB 1JZ8A 1BP3B 1VEOA 1IC5L 5DZLA 3HPLA 4BSVB 1T5WA 2YSSA 4DGIL 2MHAA 4MXWL 5EUOE 3EJJX 1SEQH 1AGDB 3HPJB 1WT5C 4PY7B 1NUFA 1O7VA 2MNUA 1OQXA 1FPTL 3EOTL 4KHXL 5IVZA 4OD2B 3SE3C 3S88H 1VFAA 4U31A 3WFZA 4N68A 2NZIA 4P4KD 3OAYK 3QULB 4KK6D 4PJHF 5KSAC 4GBXB 5FYJH 4WFHE 5HGDA 3K2UH 3IDJB 3VXMD 4YHPB 1NKRA 2OTUB 5M95B 1XGTB 4ODVH 2EICA 2VL5A 3VGAC 3ULUD 1NEUA 4QRPB 3IVKA 3U6RB 1EFXD 3MJ9H 3VG9C 3IF1A 2BNQD 2HVJB 4LVOB 5DVKA 1UACL 3VCLA 2GY5A 1G7JB 5IB1B 3B9KB 3ZDZE 3O11B 3RVVD 3D85A 2YMXL 3LS5H 3E1F1 3KVQA 5C07B 3PDGA 3P0YH 4I4WB 4XPGL 1ZVSB 1K5NB 5HY9B 1RIVL 5JW3L 1BVLA 5C86A 3IDGB 2VLJE 3NFNB 4KMQA 5IWLC 1H3PH 3WV0A 4JGMA 1CGUA 4Y2DA 4YHMH 5D93B 2VLRA 2QHRH 2CRYA 4JQIL 4K3DH 3ARBA 3SGJA 3CXHJ 3FFDA 1DANU 3F58H 1MRCL 4A6YB 2NXYB 1DQTA 2DQGH 4PFEA 4ORZC 3GI9L 4LNVA 1GGCL 1IGFL 3GSUA 5A2JH 3O0RL 2DQFA 3KNBB 3ULSB 5T1LB 1ERNA 4J1UA 3T4YA 3U46A 3S37L 1I7UA 4X6CF 4ODUA 4R97B 1U95B 2ZJSH 1CU4H 3FKUS 1CS6A 1MAMH 1J0HA 5GGSB 1P6AB 5F44A 5IGXL 5BW7A 1JPFB 3WIIH 4QTIL 4WFFE 4OLVH 5GS0C 1OTUC 5EPMA 1HH9A 4F15B 1NPUA 3PQYA 4E42A 2DM4A 3MLVH 4A6YL 3G6DH 4NO0D 1CR9H 1WQVT 3S9DB 2P5ED 3JZ7A 3VDAA 2EE2A 1ZHBA 4ONOA 4LKCB 3V7AG 1RAMA 1J1XL 1ZS8B 2E7LA 3R06A 1AXSA 3MLZL 5I18H 2EDXA 4S10A 4OF5A 3X3FH 5D7KE 4P2OD 3KXFB 4PLNC 2DI9A 4Y7MA 1VPOH 5E2TL 1OCWL 3LKSA 1REIA 5HBBA 1MFCL 4BA8A 1V7NL 4LRNL 4OZFB 5B38B 1DFBL 4XPTL 2DN7A 1YMMB 2C1PA 3FQTA 1FNEA 3L1OL 1WTLA 2J2ZA 4ZTPL 1TCMA 2NY1B 3MV11 1GGTA 1KJMA 1MHPH 2OR9H 2J8UB 1LGVA 1GJIA 3ZMRA 3VXNB 3G5VA 2PXYC 1MFDL 1PD6A 4HMEA 4M03A 4PJEF 4NC1C 1G0YR 3PNWB 4GS7B 4PR5B 3W11C 1JK8A 4I5BA 3K8MA 1OSPL 3BJ91 3LQAC 3E6HA 1HI6A 5J1AA 1PKQE 3QHFL 5TGBA 2AXFA 5TDNA 3GMOB 4CMMA 1JF5A 2YA0A 4JFQB 2ARJQ 2FJGB 2NZ9D 2HP4A 4GMSL 1M7DB 1IRAY 2A6DB 4M6AA 1T0PB 4XZUB 3SDDA 1IFHH 3I85A 4PUBH 1JFQH 2HLAA 1C5DB 4KJWD 5JPMB 3W2DH 1KELH 1BOYA 2R1WA 3DVNA 5EH1A 3DMMB 1RZJL 2E9JA 2FEEL 3OAZK 4GLRH 1MJJB 4LAQH 1JRHI 2F54A 3VXUD 5K9KA 2CK2A 1U8LB 1JGVL 2XZQH 5ANMB 5DLMH 4TRPL 4F37K 4TTDD 1WLHA 3RUGE 2DWEB 1K3IA 1J0KA 2DRUA 3HB3D 3OPZH 3P4NB 4JAMB 1F6AB 3DROB 3Q6GH 4KJQC 4HXAH 3TFKC 5L7XL 1I8LC 3ZE0E 4MQXC 2VZ3A 1NSNL 3VWJC 4PRHB 2LABA 4JPKL 1BVKA 2C4XA 3GSXB 1F90H 4DVBA 1URLA 3HAEG 4C4KT 1VGKB 2AK1H 3FN9A 3BQUC 3MFFA 3QFJB 3BXNB 3FAXA 4NBYB 5BOZG 1J5OL 3W81A 2GUOB 3PL6D 4HUWB 3C5ZB 3QJFB 1CN4A 3I9GH 3PWJA 3B9DA 1NBVL 2HT2C 4RWYL 4AG4H 5D1XB 4PJ8B 2IJ0C 5DJ2B 3FO1B 4RDQG 4UDUA 5D7JD 2HRPH 3EBAA 1MNUH 3CZFA 3B3IA 5MEOB 5EO9B 4DZBB 1AGCA 4DOHE 1FVDB 5D6DC 2QSCL 3WNKA 4TSCL 4NWTH 3MBXL 3QDGE 2GCYB 4ALAH 4HS8H 2SEBB 4HK3N 3S5LB 1QO3B 4J8RA 3VDCA 2ATKA 1L7IH 3CNKA 5T5NF 4U1KB 4GW1A 4U6YB 2XWBB 5DDHB 4F7PA 4G8EB 3CVIL 2C1OA 4OLXL 3EOBB 3WNOA 1CFTA 3REVB 2YUVA 3LPWA 3HFML 3V5KB 4RGMC 4JEGB 1KIRB 4RA0C 3BPOB 3G5XA 5E8PB 1M71B 2HJFA 1LVEA 1JHKL 2CRIA 2D7PA 2NY7H 4JZJC 5FUOL 5KOMC 4NKQB 4Z7UF 1WFOA 4ZUWB 4P5KA 1XGQB 4NNXB 1INEL 1HCVA 1AXIB 3R1GH 1E27B 4YHZH 2HJLA 1RJLB 4N0RA 2BOBB 3O8XD 5FDYA 1ZVHA 4F7TB 4Y4KA 3TC9A 2DIBA 1HHHB 3TVMA 1AD9A 4PJAA 1T0NB 1T2XA 1A6WL 5JA9A 1Y0LA 2CDEB 5DWUL 4QHMA 4XWOD 2BP3A 3O6FC 5L2JA 3IAPA 1T04B 2V5SA 3AXLA 1SY6A 4JREB 3PJSA 1BD2A 3ZT6A 3AREC 3QEGH 2XXMB 4JPVH 2Z8RA 4PGEB 4WW2B 5I1IL 4YZFF 3CFDA 4GQ9H 2L4OA 2IAND 4FQXC 3JWOC 3VD5A 1NLDH 2NY6C 2W60B 4KFZC 1T7VA 5KW9H 4MNGA 4NQVA 3JWNC 3GSNL 5TQ0L 1G7PB 3B43A 3O3DA 2DM3A 1RUAH 1RU9H 2VDMH 4RQQA 5E1AA 1MHCA 1NGQL 4W6YB 5IESL 3D3VA 1CGWA 5DJ0A 3VMPA 2G9HA 1DEEA 4XBEL 3ZKMC 3RWDA 1JWUA 3RAJH 3VXSA 4YGAB 3HUJE 2FECL 3JWDC 4HCRL 5J3HC 3WHXB 3GBNH 5AD0A 3GB7A 3IFPA 5E95B 3H9SB 3HMWH 4WUKL 1NGZB 5DC0A 2AI0H 3ARGD 2DQDL 3KPPB 4X8JA 4HQQL 2G5BA 1MEXH 1F8TL 4GMTL 5CAYB 3IKCB 4UOW0 5TE7H 3WFBL 2YPLA 3OJDB 5K33A 1IQDB 4LARH 1QVOB 4XP6H 3VFWB 2H26A 2PTUA 3N1QC 4P4KA 3W39B 5H8DA 2EO1A 2IEPA 5HHVL 3HMXL 5HGGS 1S9WA 2C5DC 3VXMA 1N26A 4RGOH 4ZXBB 2BDNL 5HDQL 1MCPH 2F5BL 4CJ1A 2NY5C 4CVXB 1QSFB 3T77B 2BVOA 1EFXA 1EJ6A 2EKSA 1UGNA 1SJHB 2FSEB 2VLKE 1YEKH 4K7PL 2J3SA 1YN7B 4NQTA 5FM8A 3MV01 3UZQA 2NY4B 2YEZA 1U0QA 2YBRB 3RWGA 5L8KB 5IOPA 3LEVL 4FQLL 2X4UB 4CMHB 1K8IA 4LCWE 3D1MC 1NBZB 5E8OA 4R0LB 4EI5D 2C3VA 5DD5H 5JXAL 5BJTB 4JHWH 5EZLA 4OZ4A 2AV7B 3GIVA 4P5TD 1FDLH 2J6EL 1ZSDA 2EE3A 4PJXF 1D5ZA 2P49B 3GMRB 4LK4A 3X11B 1JBJA 5HVGB 4EN3D 4KTDH 2QQKL 3MV9B 5BXFA 3MJ8A 1FV1A 1UM5L 1FJ1B 1HNGA 3PXHA 1FBIL 5GJSH 3DYOA 4JN2A 2A6JB 2HT3C 5DZOA 1AO7B 3RGVD 4OSUH 4JGJA 3L3KA 2Y6SD 1IC7L 5CD5D 4IMKA 1ONQA 1YQVL 4RAUA 3HI6L 4F7CB 5M94B 2WINA 4R4ND 1M7IB 3ESUF 4Y88A 2C3XA 4FQ2L 5BZDB 3SJVB 2X4QA 3DV4A 1QLFA 1D6VL 1CICA 2JJSA 1NCUA 3D0LA 3NCJH 4P2RB 1QHOA 5F1IB 1GZPB 3OSKA 2X4OB 2AJZA 3TN0B 1MQKL 4PRNA 5F1NA 3VGHA 1T03H 1MCBA 2EYTB 1AY1L 4LHJB 3I6KA 2IBZX 3O4OC 1HQRB 5JNYA 3MV7B 2XZAH 3S34H 4NO0A 4OQTH 2FIKB 2GTWA 1PEZA 1K9TA 5FIEA 2Y36L 3STZA 2YRLA 1YA5A 4E41D 5I2IB 1SY6H 1BBDL 2ED7A 3CFBA 1X6LA 4LDEB 4BK4A 3NACL 4JFZL 3B8YA 4YQXH 2NY2B 3IETB 5D1ZD 1NLBL 2R1YA 5F96H 5K9OB 1WK0A 2HG5A 4WJ5B 3QEQB 3FJTA 4FTVD 4P2OA 2FJFB 2VDQL 4NJAH 4HS6A 3GMMB 3P30H 4ODXA 4CKVX 1G7LB 5F89B 4G8IB 4MB4A 3O2WL 3BVNA 4GRWH 1N6QL 2KH2B 2ID5A 4ZTOH 5IFAH 3UC0H 3TV3H 1OGAB 1P53A 1S7SB 3QUXB 1YYML 4I3SH 4L8SA 4PJIB 5IHLB 2N1KA 1DLHA 1PLGL 2R2BA 1QNZH 5EA0L 1R0AH 5D2LB 2NXYD 5IW1B 2AJXL 1JNNH 5AYQA 5BMFH 2PO6B 4Z7QE 3TBWA 4KZDL 2YK1H 1DBML 3UO1L 3STLA 2ZOLA 3X14B 5T1LD 1SYSB 1S8DB 5F93C 4LBEA 5E6IB 5BQ7B 3MGAA 2XA8H 1ZT4A 3G5YB 4ZPVA 4DK3A 1Q9KA 1TETL 2FLRT 5C0RL 4WI3A 3QPQD 3QO0A 1HHGA 3K1DA 4ZPTA 5GGVY 25C8H 4N8CL 5C9JA 3QCVH 4LLQA 5I76B 1II4E 2FEDD 5E8DH 3FHAA 4Y5YA 3CDGB 3SO5A 1SJVA 1YNKH 3CXDL 1S5HA 3LRSB 1SVCP 1U6AH 3KLDA 3MROA 3V5DA 5EOTB 3RWFA 3QI9B 2DMCA 4L3CB 4BM7A 2R4RH 1WZMA 1BWMA 3DURA 5IJKA 5I6XC 5AZEL 1S7XA 2E27H 2JK5A 3VGDA 4ELMA 5F6IC 3ARYA 4PS4H 4DW2H 4HJGA 2R0WL 3F7RA 4S2SA 5IP4A 4U49A 5DJDB 1Z9MA 3QIUA 1H0DA 3A67L 4PV9A 5HGAB 3EHBD 1RZ7H 1TZIB 1UWGL 1V3MA 3HUJF 3QO1A 4Z95L 5E5MA 2O5ZH 4OIIH 1FIGH 2DICA 4ODTL 4TULH 1UKTA 3C2AH 1DUZA 1NMBH 1MVUA 1SHMA 43C9B 5IVNA 3EFFB 3QDJA 2BOCA 2KQNA 1HE7A 1AI1L 2AEWA 3HE7B 4QY8A 4KJYA 3TWCH 5DEZA 3ZTNL 3PL6A 4NGHL 1RK1A 3GZKA 2VABA 1I1AD 3L7EB 4XC1L 3RBGA 2X4PA 3ARFC 1YMMD 1NFDE 4K9EC 4RFEA 4XVUC 1VFMA 2WK2A 4W6XB 4LGPB 2ITDB 3OKKA 3FTGA 4NDMB 1YEIL 1MUJA 4K8RL 5IMMB 3DECA 5EC1A 5A3ID 5HGBA 5IG7B 3L5HA 5EZOH 5KVEL 5B4MC 2Q3ZA 1OGTB 4L8CB 4HFWA 3D18A 3GFUA 5ICZA 1R3HA 3OAUL 4JZOA 5DD0L 2B0SH 4X6CB 3V5HA 3E6FB 1U8MA 4AEEA 5HHXL 1FNAA 5JPNB 1EVTC 4R3SB 1LWRA 4NOFA 4HZAA 1CVRA 2VIRA 3OKDB 4FQQA 3A6OA 5CJOH 5EULV 1EAPA 4XP9H 3C6SB 4FXGB 1UEYA 4G42B 5CMAB 3O3EA 5CHNB 4WVRA 4EDWL 3K4ZA 5T1DH 5C2BL 4GG6A 3TNNB 1FG2B 3DMMD 3LVEA 4Q9RH 4HZLA 4ZODA 3MLYH 3VI3F 1OM3H 2WQRA 1PQZA 1YNLL 3NFPA 3EOAB 4M7ZB 3K2MC 4S1DD 4KAQL 1PFCA 3LN4B 4BUGA 1TJIL 1UWXK 1IC4H 4UTAH 2DQJH 2W0KA 3FQXB 3QA3A 1CF8L 1K6QH 4GUPB 1DVFC 5LVEA 1GL4B 3PHQA 4HMCA 2ZSVB 3VFMA 2IPUG 2CIKA 4PG9A 5GGRY 2O5XH 3JUZA 4LLVB 5DS8A 1RZFL 4DK6A 3A0OA 2FZ3A 1XCTA 4PJFF 2ICWB 2RAMA 4EUPA 5IB5A 2VAAA 4HXBH 3H3BC 1GVIA 3C5ZD 3F12A 4MHHG 4LCYB 1ZHKB 1I9IH 2NR6C 2VITB 5DJZA 5E2WL 5D7LB 1MELA 1M6OB 5IVOA 2EECA 2GJ6A 2JCCE 3ULVF 1W72L 2ZCLH 2H8PB 5D71L 1CFSB 5CWSB 3L3DA 3DV6B 2Q8AH 3FO9A 4IMLA 5EU6A 2F53D 3TO4B 5J6HB 1QRNA 4HKZA 1TJGH 1FLRL 2IANA 3E2HB 4Z7NE 5BRZE 3EO9L 4PJCA 4HKXB 3KJ6H 5JUEL 5T5FL 4CRPA 5JW4M 4PJEB 5FYJE 4NWUH 3G6JA 2APVA 2ZKHL 5HDLA 4JM2C 4CNIB 2W91A 4PTUB 4DTGH 4FZ8L 4YXLH 1MCRA 3VWKB 3L3HB 2KL6A 1J88A 4L9DA 4PV8A 3C2SA 1UYWH 5FOJA 1FSKC 1ZT1B 3RA7L 4HULB 3OF6D 3ARZA 1UXWB 4NO3A 1X4XA 1DQQA 5FGCB 2V7NA 4H25B 2WIIA 4XI5D 3WD5H 3SPVB 3MRJB 1EGJA 1FNSH 32C2B 4U1JA 5I73C 4P2QD 1LEKB 2IAMC 1WWBX 2VXTH 5EU7C 1TENA 1ZHNB 2WWKT 1PJ9A 1J8HB 5EO0B 4MXQD 1OD9A 1WAAF 5IQ9B 5D7SL 1QRKA 2P5WD 4FQJH 4GO6B 4KV5F 4UDTA 4CDGC 3CZJA 1MCCA 3EDEA 3QQNA 1Z5LA 3RHWK 3AB0B 2DKMA 2VR4A 5JXED 2ZUUA 5MHSE 1KPRA 3AROA 1CFVH 5MENB 5TE4L 1X6NA 4X6BA 4WFEE 4DWHA 4XPFH 5KG9A 5D7IE 5I9QB 4RGNC 5CGTA 2A74A 2D4DA 2Q8BL 3QNXB 4LCCB 2FO4B 4O2FB 4XXDB 4QOKB 4HJJH 1I7RB 2GQHA 5KZCD 5L2KE 2Y4SA 3QHZH 3OGCB 1VDGA 4QRRE 2DYPB 5FM4A 1KCUL 4ZD3L 1X5LA 1BQSA 2FL5A 5JORA 1U3HD 1FYTB 3HNTH 4G6AC 2AJ3B 4F9PA 4YXKL 5J56B 4BYHA 4I0PC 4L3EB 5CEZL 2EE9A 5C0CA 5EOQH 4ZFOB 1JPST 4YH6A 5L88H 4EI5A 1BM3L 3QIWC 2JIXD 4CW1A 4UUJB 4BH7A 4P5TA 4KROD 3RL1A 4ERSH 4P3DB 4FFYH 4K3EH 4LSPH 5FYLD 4MNHB 2NYYD 3J8F7 2Q76A 4MD4B 4OFIA 1JNHB 3L3OB 3QZWA 3JV6B 3DNKA 1KT2A 1MFAH 3VXPB 4QXGL 4XNUH 5D6CA 1TQBC 4OCNC 1E4KA 4XVTL 4YDJB 3BH8B 4PLKD 4PRIB 1A5FL 4MVBD 5ESAB 2AS5M 3H9SD 5EU7E 2J5LB 5DJCA 3MACH 1CD0A 3HPJA 1NFDF 4YJZL 4PY7A 3IDXL 2Z91A 4GT7A 1JPTL 3AM8A 2XTLA 5GRJL 4OD2A 8FABA 4JVWA 1FN4A 4UBDC 2DMBA 2VOTA 4Z7UB 3T2NH 4GRMA 1MCLA 1CE1H 5AAWA 2HTKD 3QULA 4ZFOL 1YJDH 4M6OH 4F57H 4KDTC 3CMOH 4TTGA 4GBXA 3E8UH 4EUPH 5GHWH 3OX8A 5HYJB 3MJGX 4ONGL 2N7AA 2WNGA 2VUOA 1XIWC 3FCTB 1GGIL 1QR1B 4KC3B 1XGTA 5FO9B 1QSFD 4KMTH 1WC7B 4QRPA 3U6RA 1ZK9A 2NY0C 5HPMB 5A16A 1YPZE 5IMOB 1AQKH 2KBGA 3C09C 4X0KA 1OP3K 1A7BA 5CBAA 1P9MA 5IB1A 3B9KA 2P1YA 1S7TB 3O11A 5IV2B 3MRDB 1QD0A 1A47A 5KSAB 4NQDD 5D1ZA 2NY4D 5KVMC 1AHWA 4M43H 5GGQL 4I4WA 4KMLB 2D0FA 1ZVSA 1K5NA 5HY9A 2X4SA 4XNYL 3IDGA 1WZKA 3NFNA 1BHGA 4ZOBA 1J10A 1ZKAA 3VGAB 3MRMB 4X9FA 1JCKA 3MX0A 1K4DB 3CPLB 1A4KB 1OP5K 1WBZA 2VC2H 3GGWB 1BFOB 1TTUA 5JMRA 2I26N 2G75A 3BZFB 1T20B 1A1NB 1GGBL 1P4BL 2CD0A 4A6YA 1NEZG 5GISL 4X9GA 5ESQB 3MV9D 4F37F 4F3FA 1KNOA 3NZHH 3L5WB 1C08B 1CLYL 1JI1A 4XPBL 3UTPE 4MNQD 2ZSWB 1ND0A 3KNBA 3ULSA 5T1LA 3W0WB 3FN0L 3FN3A 1IEBA 4MQ7B 4HBCL 4UOW1 2HT4D 2AEIT 5IT2H 2EC9U 2CLVA 1NCDH 1U95A 5EBMB 3WEXB 1KJVB 2JCCF 4WCYH 2YPVH 2O5YL 3FT3A 2IPKB 5E2VL 1D5IH 3MOBH 1A3LH 5GGSA 1MF2L 2D7TH 3B9VA 1DLFH 5F88B 2EDLA 3OBAA 2PR4L 2RB8A 1QFWI 2J4WH 4NC2B 4OIBA 2VDRH 1LD9B 2RCSH 4EI6B 2CGRH 4PJ5B 1UH3A 2R2EA 3WFDL 4R4BA 3VFGL 5HYSB 3QRGL 5KVGL 1T89A 4ZNCD 5ALBH 5DD3L 1IC5H 4HWBL 4B5EA 3KLHC 3VXRB 3FOLB 5HVHC 4MXWH 3FFCD 4LKCA 2NY3C 1S9YA 5CJ5A 3A6BL 4GW4B 1JYWA 4PP2A 1AKJB 2O61B 1RUKH 1FYHB 1OB1B 3EOTH 5C09E 4KHXH 3TBYB 4Q9QH 5TDPA 3QEQD 5GQBA 4OD1L 1J1PH 5E9DD 3UYRL 1HSAA 3PQYE 1R6VA 4OGXL 1OAZL 2YA2A 1WIOA 4KVCL 1MREL 1YY9D 1H5BC 1W2KT 3Q3GB 5CEYB 2ZWLT 1OGAD 2JB5L 3DIFB 1UVQB 4IBLT 3RIAK 3V0VB 4FXLA 4D8PB 5B38A 1LK3L 1I1AA 5CCKL 3BMVA 2AJVH 4J3VA 2GK0B 1EZVY 1YMMA 1SMAA 5BVPH 5FO7A 3BYTA 4PJXB 1PSKL 3BWAA 3BOVA 4R26L 1UACH 4WHDA 3IKKA 2HLFD 2PO6D 3MLWL 5LCVL 3IU4H 4X8XA 3NCEB 4ZOCA 4XP4L 4PR5A 1X4ZA 3PNWA 4M62L 5GS0L 2QR0B 5GSVB 2KPNA 3H42L 1ZANL 5E4EC 3GMOA 4R8WL 2IMMA 3MLSL 4JFQA 2FJGA 1LO2L 4QHNB 4WFGE 5ADPH 2MQ0A 4GW5B 3ARDC 3TNMB 4FP8L 4QXWA 1UZ6F 5SX5H 1C5DA 3U9PL 5SX4H 4M8VA 2PXYB 5JPMA 4MCZA 3FO0H 4ZFGH 1WEJH 5C8JB 4Y1AD 1T0MA 3DMMA 3GI9H 4MSWB 1MJJA 3I50L 4JM2F 1GGCH 4YDVB 4KZEL 1U8LA 2BRRH 5ANMA 1JL8A 4YUEL 3UTQA 4G6FD 4PP1C 3T04D 1ZLWK 2DWEA 1B6UA 2OQJB 1XF3A 4RA3A 4XNMB 2ITCA 2DDQL 2PNDA 4K8RD 3P4NA 5DI8B 4JAMA 3GEWB 1F6AA 1NGWB 5FHAH 1VADB 5H37H 2Y23A 4M1GH 3U0TB 3C8HA 1U8KB 4F9LC 1IGCH 3SCMD 1HQ4B 5IGXH 4M6NL 3FB6B 2AK4B 4X6FA 5C0BB 1VGKA 3MUHL 3QFJA 3BXNA 5IR1B 5ETUA 2F54E 4KKAD 1MPAH 4ZS7H 5D4QA 4HUWA 4A6YH 3C5ZA 3QJFA 5D1QC 3OXSB 2ICES 3FO2A 3LH2L 4J3XA 4PJ8A 4Z7WF 3U79A 3V4PL 5DJ2A 3V9FA 1Z9SA 3MV8B 4FFZH 3VWJB 3UEZA 1MCJA 5F7FA 5LGKA 1WIPA 4BFGA 1L9MA 5E8EB 5MEOA 1J1XH 3P0VH 3B8SA 4XC3L 3MLZH 1FVDA 3WCYA 1I85C 3BQUB 3PGCB 1JF1B 3CFJB 1CD1A 2E7MA 4PJBB 2GCYA 1KXVC 2SEBA 3WKMH 1MCFA 1MJ8L 1QO3A 4KKCC 5E2TH 5JLZB 4EUPG 3N1MC 1UQSB 4NCC2 1OAKL 4U1KA 1MFCH 1F97A 2XWBA 4IOIA 1V7NH 5DDHA 5C6PB 4TOYL 5HPOA 4UT9H 3NIFF 5K9QI 1N64H 2DKSA 2VZSA 5FGSA 1RZKH 3L1OH 4NQCE 1V7MH 3REVA 3QCTL 5GZOC 3LKRA 3OF6A 4JRXB 1KIRA 4KXZH 1L6XA 1Q9LA 1RUQL 1M71A 4FG6C 3MXWL 3KS0H 2R0KH 3MRQA 4PJDE 3UJJL 2DL2A 3T1FB 1OSPH 4ZUWA 1WISA 3LV3B 2A0LC 1XGQA 4JQXA 3MCG1 2P5WA 4JZNA 1E27A 4BELD 3GSNA 3QFDB 4XAKD 2IGFH 1I1RA 3QG7L 4NCDA 4RRPA 4CU7A 1KBGL 5B3JE 1RJLA 4RGMB 4XP1H 2BOBA 4BZ2H 1CXKA 2VE6B 5JXEA 3HUJB 4F7TA 1K4CA 4Y89A 5SWSD 1HHHA 3PV7A 5GGVL 4Q6YA 4OZFH 2X42A 1T0NA 4YC2C 2I9LB 4H8WC 2CDEA 4OUOA 4JZJB 1E4XH 3EDFA 3RJDA 4CL7A 1RZJH 1A02N 4ZUTB 3HNSL 1JGVH 4UIKL 4KI1A 4TRPH 5D7LD 5D8JL 4HCRA 2V5TA 1XZ0B 4M5YH 2OYPA 1WSST 4WWKB 3U4AA 2XT1B 2P8PB 5L7XH 1YEHL 3TBTB 2IH1B 4PGEA 5I1GH 1P7QB 2EH7L 3S36H 2HA1A 3N85H 3QCUH 3O6FB 1UCTA 4POZD 4C56D 2E6QA 2WBJC 1G7PA 5TE6H 4OF0A 2JIXA 2NX5D 3HMXA 3MYZA 1Q9WB 5KSBA 1J5OH 1UT9A 2JJTA 2CDFB 3VWKD 4JR9L 5ALCL 3FZUD 3L5JA 4RWYH 35C8L 3RWJB 4KQ3L 3AREB 1IGJB 2X44D 5FUCE 1BD2E 1U8OB 4FQXB 4LSTL 2NY6B 4OCYH 5E2JA 4DGVL 1G1YA 4OT1L 4GG8B 2VXQL 3M1BB 3WHXA 1IKNC 1G0XA 2GT9B 5E1HB 2QSCH 3H9SA 1IAOB 4TSCH 4FFWD 2XZZA 3MBXH 1OLZA 3KPPA 3HZKB 4HIJB 4W6WB 1RIUL 4HIHB 3HG1E 3IKCA 4KVNL 4GRWE 5EU4A 3QIBD 4WI4A 1AQDB 1IQDA 2WUCL 1QVOA 2FBJL 3VFWA 5CEZD 1A4JB 2X1QA 2E8ZA 3W39A 2M2DA 3SGEI 3D3VE 5EG6C 1NDGB 2J6EA 3D39B 1AR1D 3I02B 4U1MB 4HX1B 3ZYOA 3VXSE 3CFKB 1NCCH 2CMRH 3QUML 3QZWG 5GGRB 3RVXD 3U4EB 1IL1B 4ZXBA 5MEND 3HFMH 4KK9C 4UNTA 3ZKNC 4CVXA 1QSFA 1KCVH 3RWEB 1BLNB 1MH5B 5FECB 1A7NH 4G3YL 4PJFB 4ZUUA 3MR9B 4JDVB 3HI5L 3JWOL 1JHKH 1SJHA 5CJQL 4YHKH 1SBSL 2WV3A 3P0GB 2E7HA 5HHNB 5FUOH 4QOKD 3QT2A 1UKSA 3WHE0 2YPLE 4NQDA 3CLFL 2VDPL 4JO3L 2QTEA 1KB9K 4HT1L 4NO2A 1BFTA 3IDIB 3GRWL 2YBRA 1NMCC 4P5MB 5CLTA 7CGTA 4JKKA 2VAJA 1V5JA 2YWYA 2Q6WA 4Y5VA 1XF1A 2UWEA 2HMID 4MLSA 4R0LA 2D0GA 2Q86B 5BJTA 1A6WH 3JWDL 5DWUH 5BVJA 2R15A 4J4PD 3UCRA 1IBGL 2V17H 3GMRA 3X11A 4L4TE 1J0JA 3MV9A 4MMXC 2AXJA 2QADC 4GKOA 1OAYL 4MNQA 3SDXA 2A6JA 2VLJD 1BFVH 2GW5A 1KJ3L 4PRID 1L7TL 3BN3B 1NC2B 1PBYA 2VISB 5I1IH 2Z31D 4D0BB 1A6TB 3ET9F 1M7IA 4JRYB 1LE9B 1O5DT 4JG0L 1KLFA 1HILB 2NY5L 3WIFB 4LP5A 1MIEL 1SM3H 3GBMH 4Z0BL 1I3UA 4P2RA 5F1IA 4KK5C 1GZPA 4LFHD 1NGQH 5F7DB 3P3YA 5IESH 3QQ3A 4J6RL 4PIRF 3CVHB 1WZLA 2FIKA 5JOEA 4K07A 4M00A 4TQEL 5TH2B 3H6JA 1F58H 5JHLH 4Y4HC 1CDCA 3GNML 3QHTC 3FB8A 4WUKH 4JVPA 1VSCA 3V6ZB 1UA6L 1R5VA 2DQDH 3AS2A 3PF2A 2X1XR 4HQQH 5FV1L 5IROA 2FD6H 5DMGC 3T2PA 4H1LG 3B2VL 1U91A 2FH6A 2KZ1B 3IETA 1GC1C 3QEHB 4WFFD 3WFBH 5K9OA 5AYUH 3MTRA 4WJ5A 5L8LB 2R69H 3HC4L 2ZUTA 3QEQA 1OPGL 1VGEL 3O4OB 2FJFA 5CEXB 3GMMA 1S7VB 3O2VL 3PABB 4TNWK 4G8IA 5F89A 5HGHA 4BFEA 1LO4H 3HMXH 2G5RA 4OZIE 2G60H 1KTDB 1OGAA 5HDQH 2F5BH 3QUXA 4Y0GA 4PRAB 3K8LA 3U36A 4XCCL 4U1GC 4OTXH 3OHXB 4P99A 3MNVB 5D2LA 5IW1A 3LMJL 1F4WL 5HYQB 2ZZUT 4NKIL 4Q0XL 2PO6A 1BFSA 1SEBB 3O6LL 5D7KD 3AC0A 1CGSH 1S8DA 5E6IA 2HKHH 4NQXA 2QSQA 3BAEL 3G5YA 3DJ9A 2ZG1A 3FQUB 4D0DB 2EZ0C 1JUFB 1RJCA 4HPOH 5DMYA 4X98B 4ZDHB 4HS3B 5I76A 5D5MA 1NFDB 3CDGA 5B38G 2AXGB 5L9DL 2I25N 2J6EH 1G7MA 3LRSA 3TH2T 1DBBL 1WFUA 4GOSA 4XMPL 5F70A 5F9WC 1WBXB 4Y1AA 3GSQB 2QQKH 3CAFA 1LDSA 4L3CA 4O4YL 2HKFL 4PJHA 2OSLB 4GKNB 3SOBH 4X99B 5C6TL 1HHIA 3DSFL 1W8NA 1XGYH 2AJYH 3HRZB 3MNWB 3VXRD 3BFOA 4LSUL 1IC7H 2QQNL 4HUVA 4ZQKA 1YQVH 1CBVL 2O26U 3HI6H 3U4BL 4OLYH 4LVNB 5GS0D 5JHDB 5HGAA 1OTUD 4FQ2H 3F7PC 4J3TA 1TZIA 2APWA 1I8KB 4DFHA 1QYGL 4ZAKC 2WSKA 4I77H 5GGUA 1EV2E 2FX8L 1PDKA 5KS9E 3ZDYE 1Q9OB 4B7LA 5I6XB 3PIQB 3WO4C 43C9A 5F9JA 5EZIL 2OZ4A 1BECA 3EFFA 1IGIL 1YY8B 5C0IB 1MQKH 2KKQA 3HE7A 3O2DL 5F6IB 1AY1H 4PLOB 1T7XA 1P4LB 4HJ0C 3MRKB 3L7EA 3U2SB 4N5EC 3CJJA 1PX4A 4HWUA 4OCWL 5TF1H 3EYFA 1BBDH 1VCAA 3NABL 4IIQC 3NACH 3L5IA 4NDMA 2E9WA 3KS0J 4JFZH 4OCXH 3VD7A 4N0FB 3MLRL 2Z9TA 5IMMA 1NLBH 4J3OC 5IG7A 3EZ8A 1NANI 1OGTA 4L8CA 3BPCB 4WHTA 3FT4B 3C87A 3REWA 3QDJE 3LY6A 3LKQB 4X6CA 3HZVB 5I66B 1HZHL 3ARFB 4PJ7E 3RHWF 1D9KD 3M8OH 3MA7B 4I0KA 2ADFL 4GAGH 3VRLE 4NFDA 1MLCA 4KY1H 2JCCB 4L29B 5T1MB 3C6SA 3RKDC 4FXGA 5B39G 5CMAA 4G42A 4JM4H 5EA0H 1U3ZA 3TH3T 2AJXH 3CX2A 1A3QA 1W0YT 1A1MB 4Z5RB 3TNNA 2BY0A 2Q20A 1K85A 3QDGD 5BO1L 1W72A 1CK0L 4FHBD 1F5WA 2YOCA 3EO1B 2F19L 3QXAA 3EOAA 5C0RH 3JTTA 1P7HL 2Q1EA 4AIOA 3LN4A 2R9HC 1IM3B 2EDRA 4GUPA 1OAXL 3SE9L 4BFIB 1T21A 3L3JB 4JPWL 1H15B 4K9EL 3CFEB 3CXDH 6FABL 1JYNA 2AK4D 3ZHDA 3GI8L 4LHQB 2OJZL 4R6UA 5DRWB 5KOVC 4BH8B 3CU7A 5I1JL 5ICXB 3K80A 2W38A 3T0EC 1ZLVH 1X44A 3LKPB 3BD5A 5H2BB 4LCYA 1ZHKA 3IJYB 2VITA 4KJQD 3TFKD 3BX7C 5D7LA 3QSKB 1B4JL 4LCIL 2PYEB 1M6OA 1ZTXH 5TJWK 3SDCD 3VWJD 1P7KB 4N0UE 4HIXH 2H8PA 3IXTB 5CWSA 3QEUB 2Z92B 3DV6A 1T83C 1ORSB 2CLZB 3K2UL 1U42A 5CZXC 3D9AL 4UZGA 3OXRB 5HHQA 3A67H 4OZHE 4JQVC 4RRPG 4Z95H 4HKXA 4ODVL 4C56A 1CLOL 1J1OH 2HT2D 2R23B 4O58H 4NKDB 4CNIA 4PTUA 1MCDA 4X6DF 4IS6B 3ZTNH 4PGBB 4NGHH 3LCYA 2A77H 3VWKA 3L3HA 5ELIA 1CGVA 4BQCA 4RNRB 4H0GA 2GJ6E 4XC1H 1HH6B 4YHYC 2NW2B 1CYGA 1XR9B 3V8OA 5ISZB 4K94C 1QBLL 3D2UD 1ZT1A 1KV3A 5JQ6H 3LQZB 1H3PL 5EU6E 4MD0B 1CDJA 3RTQB 1AH1A 1QRNE 4YHML 2QHRL 4HUMB 4K3DL 2ZUQC 1U93B 3MRJA 3MRPB 32C2A 4PJCE 1ZV5A 3F58L 4JM2B 5J8OA 5A2LH 2E7BA 3BDYH 1U2HA 1V05A 4N9GB 3S3PA 1ZHNA 3G6JE 4QHUB 2FHFA 1J8HA 5EBWB 3QIBA 2J1KA 5HHXH 5I0DA 3V4UH 3IXAB 4PRBB 2OZ4H 1U8NA 3RY5A 3EJYC 2FR4B 3WN5C 3VGGA 4LIQH 2BC4B 5DC9B 4BQ8A 5I73B 1TPXB 1ZOXA 3KYNB 5MENA 1FZJA 1CU4L 1IEHA 1MAML 4OGYL 8CGTA 1RZ8B 3ROLB 5FXCH 4MJ2A 3QNXA 1MIMH 4LCCA 2FO4A 4WI5A 4XXDA 1KIQB 4XGZB 3JV0A 4QOKA 4OKDA 1I7RA 3T65B 5DJXA 4LOUC 3OGCA 4Z7WB 4RAVB 1PAMA 1U41A 3U7WH 2IPUK 1P7QD 1FYTA 1CR9L 2AJ3A 3T0WA 4IEFB 2MJWA 4NKOB 4RGNB 4ZFOA 4JFFB 4LNRB 5IUSA 5C6WH 1A7QH 4UUJA 3GJFK 2J8HA 4J4PA 2ZNWA 1GOHA 3T3PF 5I18L 2DKUA 3O9WD 1BZQK 2GJZB 5DHVB 2V5MA 2EIEA 3ARED 3BMWA 4MD4A 4J3UA 5E94B 3FL7A 4DN4H 4K71C 3ZO0A 5HHPA 3X3FL 5KS9F 3L3OA 3JV6A 3I75A 2OCFD 1W72H 1I1YB 3K8KA 4FQXD 4MJIB 4NNPH 3VXPA 3QUZD 3ZKSD 1VPOL 4YDJA 3BH8A 3MRGB 4PRIA 5FO8B 1PG7W 3QNYB 4LCWD 5ESAA 5BZWB 1FLRH 3NIGF 3QIWB 1NGYA 3DX6B 4FABH 4ZS6D 5C0CE 3SDAB 5JUEH 2YUWA 5T5FH 4YX2H 2ZKHH 2W9LA 4Z7UA 1GSMA 3Q48A 1QLRB 4R7NB 3V6BR 4JFHE 1IT9H 1TQBB 3RIAF 1HXYB 5AUMB 5HYJA 2OK0L 5C08B 1KEML 2BJMH 5FO9A 1WBYA 4PJ7F 4OFPA 1WT5A 1WC7A 3OMZA 3VRLF 1XT5A 5J06A 4R90H 5HPMA 3SE3A 2WWKO 5IMOA 3H3PL 1WIUA 1IFHL 3SKJL 3UAJD 3NOIA 1S7TA 5IV2A 4JO4H 3O4LE 3TZVC 1FAIH 4Z0XB 3UYPA 3PWUB 5D7SH 4WO4C 5DFVC 1ULVA 3FONB 3LIZL 2V6HA 2PW1B 3SE8L 4HG4K 7FABH 1EUUA 1XIWB 3GM8A 2H9GB 1F11B 2DBLH 2XZQL 5DLML 4M1CD 1EVUA 2D7OA 3MRMA 1N4XL 1IGTB 1PEWA 2YN5A 1K4DA 2NY0B 4PTTB 1WTGT 2GTZB 4KUCD 2Q3AA 3OPZL 1XF5B 2H3NB 3C09B 1WCBB 4KRLB 1BFOA 1JHTA 3AMLA 2R56H 3BZFA 1T20A 1A1NA 3OKNB 4QRPE 4HPYH 3Q6GL 3DRTB 2AJSH 3WFHB 4YHIB 3QXDB 1WFNA 4FQ1L 3NGBB 1EDQA 2Q8BH 3L5WA 1C08A 4HWBA 3KJ4C 5ITBH 5EUKB 2LU7A 1F90L 5GGTL 5I30H 5IWLA 1KENL 1Q94B 5C07E 5KANG 4U0QB 1QEWA 4MQ7A 1AIFB 4GH7B 5I71C 1CXHA 1FAKT 5KJRL 4KTEH 1MHHB 3SEPA 4AH2B 4KUZH 1D5MB 3I9GL 3OZ9L 4YXKH 3WEXA 4AG4L 1KJVA 5TQ2L 3I84A 2IPKA 2J7LA 2YD1A 2HWZH 4WY7L 3WNLA 2VUYA 2Z4QA 1G9MC 1MNUL 4G7YH 1CG9A 4X6EB 5J89A 1XCQB 3ABZA 3ZDXF 2IALB 3U48A 2HT3D 1LD9A 2DM7A 4NWTL 4GKSB 2MQ3A 4ALAL 4HS8L 1TXKA 3GO1L 3ZL4H 4APQD 5HYSA 4XVTH 4XCNB 5C3TA 3KLAB 4X4XB 4GS7C 4LGSB 4ORGB 1L7IL 3VXRA 1RHHB 2B20A 3FOLA 3IDMA 2A1WL 1D6EB 4B41A 4GW4A 4EJ1C 2D4FA 1AKJA 5FKPB 2O61A 2HJKB 2GK2A 1JPTH 3TBYA 5GRJH 2I60H 3BN9C 4PRDA 3J7HA 4Q6IB 2MFNA 3TYGH 1KXQE 1VEPA 2BCKB 1ZGLB 4XP5L 3VFVB 2APXA 2ERJC 3F7YA 1OD7A 5T3XH 4C54A 2NPLX 2A83B 3FRUB 1TVHB 3P77B 3Q3GA 5HVHB 3V0VA 3DIFA 2NY3B 5FB8B 5CILL 4RWHA 3R1GL 4RMTA 3LAFA 3VFNB 4YHZL 2XTJB 2WIMA 4KTYA 3LRGA 1DBKH 3DWTA 3WDIA 3S4SB 3VE0A 1NGXB 4XPHL 3KXFE 3CSPA 2A9MH 3S3SA 1H5BB 4XNYH 3AU1B 3CFIC 2EDNA 3GK8L 4WUUE 5GSVA 3VFOB 4O00A 3OR6B 3CH8A 5IEHB 1D9KA 1T66D 4QHNA 2QSVA 3BZ4B 4GW5A 5KVDH 5T3ZL 1YMME 3TNMA 2FB4L 4JPVL 5C8JA 1NLDL 3V0AC 3WUZA 5KW9L 2J8UE 4HBQA 4JKWA 4MSWA 1Z0MA 4PJ9D 4MA3A 1I8IB 4XPBH 4YDVA 3CLEH 3QUYD 5E4EB 3FN0H 5CSZB 4XNMA 3VFUB 1PW3A 1RU9L 1RUAL 5GJTL 2IG2L 5DI8A 1NGWA 3ARDB 1TMCB 5HD8C 1VADA 2W9DH 4X7CC 2XRAH 2X4TB 4XHJC 3TPKA 3U0TA 2O5YH 3VMOA 4KJPC 1N8ZB 2E7LC 3EDJA 4Z7OF 4AIZB 1HQ4A 2YA1A 3KYKL 4POYA 3SKNB 3TYFB 1AD0B 5TFSL 4CVUA 3FB6A 2AK4A 4DVRL 3VI4E 3HMWL 5IR1A 1NAKL 3B5TA 3TBSA 5GPRA 1GH7A 5ANME 1OTSC 1MFEL 1MEXL 1TVBB 2FWOA 3QXUA 3WFDH 3OXSA 4OFYD 3C60B 5TE7L 2FNBA 1I8LA 4LARL 4HWBH 3SDCA 3MV8A 3VWJA 1G7HB 2FHCA 3X17A 1IAIL 5EIIB 3MZTA 3A6BH 1NJ9B 3BIKB 2LAGB 3TIDA 1N5AB 4PRHE 4UB0H 2V5RA 1U8QA 4RGOL 2V2XA 1YDPB 3PGCA 3CFJA 4UU9B 1IZKA 4XNZC 3ECBB 5D1QB 1DZBA 3QFJE 4OD1H 3UYRH 1CL7L 4JKPL 3ARFD 5JLZA 1EXUB 1YEKL 4NM4H 1OAZH 1UQSA 1MREH 1BZ7B 2XNAB 4X5XB 4L8DA 4U1LB 2JB5H 3GIZH 2D7QA 4AM0B 4PLJC 4NT6B 5D6DA 3GBLA 1PSKH 4R26H 3BD4A 3F6LA 2GIYA 5BRZD 3MLWH 5LCVH 2AAVA 2HFEB 5DD5L 5FYJD 1KGCE 4JHWL 4M62H 3V6OC 4UQ3B 4CADB 5GS0H 3BZDA 5EBLB 4L1DA 1G6RB 4FFVC 5FA4A 4K3JL 4AY0A 1ZANH 5F3BA 4KTDL 2HTLC 4HIEB 3SQBA 5GJSL 3QFDA 3LRHA 4MYWB 3T1WA 1QSEB 2W07A 4F2MB 4X5LA 2BSED 3M17B 4XCYB 2RHEA 1J0YA 3HUJA 3U9PH 3RY6A 4KRPD 2I9LA 4YNYA 3FQNB 4JZJA 3WNNA 5LBSL 2JB6B 5GRYA 3EYUL 4ZUTA 4KZEH 2QKIB 2ZUYA 3OL2A 4H0IA 1XZ0A 1DVFD 2DDQH 3NCJL 3UZEA 5GS2H 4LRIC 5HYIA 3IDUA 2P8PA 1T03L 3BGAA 3QQ9D 3TBTA 3K1KC 1EHLL 1P7QA 4O2EB 3GSWA 4YC2B 4OQTL 3V8CA 2F8XC 5MHSD 4PRPB 4IRSC 1VA9A 3V6FB 4WFED 4HH9B 1SY6L 4ZFFB 1IE5A 2ZUVA 5EN2B 5JDJA 3EJZC 3L3IB 4Z76A 5HI3D 3QUMA 3PUCA 3IFLH 2CDFA 4YQXL 1UG9A 3O9WA 1F3JB 1X5XA 4IRJC 4LHUB 5F96L 2AABH 3DETD 3LH2H 3BP6A 3AREA 3RWJA 5L2KD 3NCBB 5ISZD 1IGJA 4QRRD 1AP2B 3LQAH 4FQXA 1U8OA 4XX1G 2HFFB 4GG8A 3M1BA 4KI5C 1FL3A 2WBJB 4ZTOL 4XC3H 4P57B 5IFAL 2GT9A 3RWHB 3UC0L 5EOCH 2Y7QB 4LCWA 4WEBL 5IK3B 3TV3L 5LQBL 1IAOA 3HLAB 1R3KA 3DOSA 4JM2D 1JMXA 3SY0B 4I3SL 3HZKA 4HDIB 2XWJA 3GRWA 5JW4N 1QNZL 4HIHA 4U1HA 2YD8A 4XXCA 2IH3B 3BH9B 1JMZA 3RDTB 3GM0A 1R0AL 3N1GC 4TNWF 1JNNL 1AQDA 3WIHA 3P73A 2I07B 5BMFL 1CGYA 1FZKB 1UJ3A 3LKOB 1CFBA 2YK1L 5EBGA 5EC2B 4TOYH 4P2CG 3D39A 3GUTB 4U1MA 5T5NG 1TTFA 5GSRB 1A0QH 4HX1A 1QLEL 2HAZA 3QDMB 5GGRA 1IL1A 1ADQH 2KQMA 4Y4KC 2IAMD 4JO2L 3RWEA 3CCHB 5FECA 1G0DA 1RUQH 4CN6A 3MR9A 3MXWH 4JDVA 3QCVL 3GSVB 5E8DL 2C3WA 5HHNA 3UJJH 1YNKL 1XAUA 1YECH 3OJ2C 3Q0HA 1U6AL 3VU2A 4OJFH 1NBQA 4U6HA 1BEYL 3VJ6B 5I1LA 2DL9A 3IDIA 3P11L 2R4RL 4PBXA 1G6VK 1MAKA 4P5MA 4GXVL 2VZVA 2E27L 4LFHG 2DI7A 1MCSA 5DK2B 3SGDI 1MCIA 1VHPA 5F21B 4RGND 4C83B 2VLME 1ZHLB 4PS4L 1VKXA 3K81A 4I3GA 3WYRA 4DW2L 1QSFE 2Q86A 3F62A 3MRFB 1R3JB 3SBWC 4OLWL 3HZMB 4QTHA 1DBJL 3PP3H 2M26A 3F65A 4XNXH 3HNSH 1RZ7L 1YEJH 4UIKH 4RMWA 2O5ZL 4OIIL 4X6DB 1H8OA 5GZNC 2NW3B 3K3QA 1NMCB 1HYRC 3RFZC 4ODBD 4OBRA 4TULL 5CGYC 2L7JA 3VI4F 2P8LB 4HC1L 3MRBB 4I0PD 2ENYA 1A6VL 1YEHH 1FNLA 2ILLA 2VISA 3TWCL 5KN5B 1UFUA 4Z7VF 2EH7H 2QQLL 3OWEA 3IGAA 1JNLL 4D0BA 3S35H 1LE9A 5LAXB 4I2XB 1S5IL 3WDJA 2A6KB 1I3VA 2B4CC 3O45A 3N0PB 4HMDA 4HK0B 4JDTL 1HILA 1JGEA 5E5RB 1MCEA 4JANB 3UTSB 1CVSC 5I19L 3LQMA 2IADB 3C5SA 3MV9E 4CDHA 4JR9H 5DF0A 5F7DA 3UTPD 1FRGH 1OAUL 4LVHC 4P4KC 2R29L 4LMQE 5EZOL 4JO1L 3BRFA 3U0WH 2X7LB 1UB6B 2VYRE 5EIVA 1AO7E 3NZ8B 2B0SL 1T2JA 3ZE2F 3L6FB 2VXQH 4Y2DD 3VXTB 1I4FB 5D2NC 5TH2A 1FG9C 1S9VB 3ARBD 3LS4H 4EVNB 2DAVA 5CJOL 1CFQA 1C12B 3SJVE 1AGEB 3GKZA 4LSSH 5I8KH 3QEHA 4KVNH 1RURL 1WUNT 3BKML 4P2RE 4Q9RL 4NJ9H 5CEXA 4O2CB 1XIWD 4DN3H 3UTZB 4FZEH 5ICYB 1S7VA 3BP5B 3KPNB 4S1SL 3RVUD 3PP4L 2O93L 3MV7E 4Y4HB 1Y6KR 2NY0D 1KTDA 2VDNL 2CR3A 2APBA 4DAGH 1F3RB 4BQ9A 4PRAA 5IBTH 4PPTA 3OKMB 2DQJL 4G3YH 4LLMA 3OHXA 4AEFA 5IKCB 4YPGA 4A2LA 1K6QL 3JWOH 3OG4B 5HYQA 4MHHI 3EFDL 5CJQH 4HGWB 1SBSH 5FK9B 1Q1JH 5C09D 1E28B 1HCFX 2W59A 1SEBA 1ZT7B 3N9GL 3IS1X 3MNZA 5KS9B 1T1ZA 1LO0L 3QEQE 4JO3H 4WNQA 4Q74A