2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Protein Slc8a3
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
2FWSA 3GINA 3FQ4A 3E9TA 3US9A 2QVMA 2FWUA 2KLTA 3H6AA 3EADA 3RB5A 3RB7A 2QVKA 2KLSA 2LT9A 3FSOA 3E9UA 2DPKA
chains in the Genus database with same CATH superfamily
3SBPA 4FQLL 4J3UA 4P3DA 4QRTB 5KJRH 3D30A 2OCFD 3TO2A 5I75B 3UG3A 1JPSH 2XLLA 4UTAL 4BZ1L 3O4LD 1D7DA 4IOSD 3OGOE 3KCPB 5AVUB 4U1LB 5K33A 3W56A 4HJJL 5FUZH 2WY3B 4LRIA 3CMOH 5D4HA 4LO9A 3D9AL 5ESQA 2R1WA 1A7NL 1SHMA 3VRLE 3ARSA 2WBWB 4PJHF 2XNAA 1KNOB 1UJ3A 1I8MA 4PJHA 4RQQB 2P8LA 3X1BA 1OM3L 1KCLA 2JK5A 3GI9H 2A6KB 2HB0A 1BD2D 1E2VA 4OTXL 1M05B 2OL3L 5H94B 1NANI 2ZT9C 1OVZA 1J9CT 1CGWA 2LW3A 4RAHA 3V10A 4K9EH 1LK3H 1OCWH 2NY6B 4X6BB 4PJAB 1K4DA 3NP3A 3SJVD 1E8XA 5HDQL 32C2A 1IC7L 1YAZA 2BSRB 2WWMC 3NJNA 3BP4A 4IOSA 3B9VA 5FM5O 5IIEA 1TJMA 5CD3A 3V6ZA 1NOFA 4CVWA 4BWUA 2ERJC 4AVIA 1TQBC 2A6KA 2O5YH 4KQ4H 5F96H 3X14B 2MOVA 2TSAA 2C3VB 4JKLA 2P3YA 2F8XC 3HG4A 1DBKL 2ADFL 1I7RB 3AMKA 3F7PC 5IHWA 2X4RA 1C9SA 1OEZW 4ISVB 4JO5A 2O5NA 3NQKA 2IG2L 4HPOL 1IGIH 4RDQF 5EO0B 4PJBA 4TRPL 1RMFH 1MJ8L 2GT9A 2BY0A 2ERJB 1KJ2B 1RFDH 1JUFA 4DUVA 1YYLH 1TENA 4HJGA 2BPBA 4WGWB 1I85C 4QXGH 4KDTC 3ZLQC 1WFNA 4XBGA 1JZIA 1YEDB 3UPCA 4HQQL 4IRSA 1QLFA 4Z7UA 2H6UA 2A9AA 4I9WD 4QOKB 5D1XB 3T0XA 3FUIA 1PD0A 4KXCA 4KMQA 3CQPA 4EN3A 3O6FC 4GSRA 2ITDB 3CX5J 5KBKA 4LCYA 1RUPH 1I1CA 3ARWA 5J13C 5BS0E 4AMKH 1ZT1A 4HCRH 2PCXA 4ZPVB 5T33H 1OAXL 1NMAL 3FFCD 2AJYH 4OJEH 5GGSA 4PJAF 4UNVA 5ICYB 4PS4H 3P0YL 3QIWD 4YBQD 2X4PA 3CVHB 4LFHG 4Y2DD 5C0AD 5I82A 1Z2KA 3QXWA 3H3PH 4U33A 5IQLA 4Q9QH 1NMCC 2N1KA 4LLVB 4GAJH 1RURL 4NKDA 5B39G 3RGVD 1F6AB 3HUJA 4G6AD 4LHUB 4MCZA 5EO9B 3VD1A 4L9DA 5F7KC 4XPTH 2AAVA 4MCYB 2H6OA 4C8XA 3WFHA 1KXQA 5IMKA 3QHZL 1TTGA 1U3HB 3B2UC 5T3ZL 3VFRA 5CJ8A 3JV4A 4PJ8D 1YUHB 2PTTB 3DX9B 4NN5B 4U1LA 2YMOA 3K6FA 2XWTA 3FT0A 1Z7JA 2XZCL 1QFWL 1P4LB 3FFCE 3QC6X 5HYSB 4BQ9A 1IB5A 4JRXB 4WI3A 1OHQA 3MO1B 1IAIM 1WIOA 2NNFA 1A66A 5JW3H 1TTBA 2NW2A 1JGLL 1JYWA 4KNUA 4O2EB 3T8XA 3CSFA 4JFFA 2G75A 4KHXH 2FJHA 4MB5A 3TJEH 4OF6A 5DJCA 3H3KA 4AYID 4WI6A 4WW1B 1AY1L 1M3IA 3WN6A 2H32B 3M1BB 3DPBA 3B8SA 5JHBA 1M7DA 4HSAC 1SEBB 3VG9C 2YGQA 1KPUB 4J12A 4MKMA 1U8LA 1PEWA 2K9UA 3HE6C 1EXGA 5INDB 3NSXA 3QDAA 3P9WB 3R4DA 4DQOL 3ZQWA 3WTWA 1YMME 1A3RH 2NT1A 1SY6H 4OM1H 3WS6C 1P7QB 4TOYH 1SYSA 5DFAA 1P7KB 3WAJA 1JFQL 4E41A 3GPEA 3MXWL 3FH7A 1JGUH 1PNDA 4WNQB 4N2LA 4FQ1H 3G5ZA 1IGJA 4OF0A 2J20A 3UZVB 1QOKA 5MERA 3MV8B 2QQKL 4PB0L 4PWHA 4PRID 3F2LA 4N0FA 3VYNA 3OR7A 2VIRB 2XWCA 3UTSA 5EC2B 3EH4B 5J4MA 2J71A 3US1A 5JHDB 3G6JE 5DJ8B 3AQDA 1KXVA 1QRNA 3AWGA 5C08D 1T1WA 2ZKYA 3BIAX 4FJZA 1LO0L 4N2CA 4FHJA 1KLUA 5DMIH 3TFKD 3L9RA 5BXFA 2KL6A 2J21A 4HUXA 4MVBC 4UILL 2ENQA 4U3HA 3I9GH 3LRSA 3GMLA 1MSPA 2X9YA 3QISA 4YLQT 1IGTB 1DDHA 5FO8B 1R3KB 5J57B 4JGMA 4IHBA 1YEFH 3U9PL 3RI5K 5C07E 5E2TL 3L1EA 5I0XA 3P1VA 2YLKA 5DVMA 1GW6A 5F70A 1T5XA 1QBML 4MA3A 3NJIA 1TU2A 5DVPA 2RMNA 3MLXH 1A7OH 4O02B 4PJXB 4G8EB 1FL6A 1G9ML 1E28B 3SQRA 2XT1B 1C8QA 3AVEA 4TSBL 3GLEA 5L7XL 3P4LA 3ARPA 4YDJA 2J1ZA 3X3FL 2OJZH 1TZOA 1T6BX 1N12A 3L1OL 1D5ZB 1F58L 3QT2A 5I73C 1VPOH 2R4SL 2X0VA 3LH8A 1G94A 4GBXD 1SJVA 3SDCB 4MMXB 1FNHA 2UZXB 3QXDA 3N9GL 2BDNH 4I3RL 4OZIA 4TVPD 5AVYB 1AHMA 3N04A 1Q94A 7TAAA 4L8SC 2K70A 3DC0A 2I5YL 3EH2A 2PLTA 3GSVA 4PJGE 5H94A 3ESUF 3L5XH 4UB0L 3CFIC 1PG7X 1X5ZA 3AT9A 3DO3A 1ACCA 4XC3L 4ZQKB 4KUZL 4XN4A 4BH8B 4AIEA 3PP4L 5C0NC 2FSEB 4XCFL 5DC0A 1T20A 2DQJL 2KLRA 3JWOH 1OGAA 3GHEL 3MLWL 3UC0L 3PWPD 3A24A 3VFGH 5EU4B 2XBZA 2PWEA 4R96A 3MCKB 2O4EA 4OQTH 2V7HB 3VFSA 4OLZH 2WQUA 4Y4FA 3HLAA 3PUCA 2IMNA 4G9FB 1DVFC 5C70A 1XIWD 1YNTF 2ARWA 2UZYB 1H5BA 2VLLB 1DQDH 1TTUA 3CUPA 2VERA 4GW5B 5BRZA 1MJJA 1MZZA 4I13B 2ZXWB 1FYTE 1JV5A 2CGYA 4NWTH 3V6BR 4JJ5B 3SKUD 4PJEA 3SQBB 5BVJA 4AW7A 5IMMB 1DJZA 1EA9C 2KH2B 1Q90A 2Q6WA 1FL3B 3VA6A 5IB4A 4M5TA 1CLZH 1DSWA 4R26L 4ENZA 1TG8A 5C6WH 2DLFH 3FT3A 2OK0L 2JFCA 4P3WA 1WAAF 4HBCL 4LB8A 5BS0D 5ABZA 5FDWB 4FXTA 1SLXA 3SYAA 4JUSA 1CICD 2VB5A 4GXUM 4ONHA 4PJ5E 4XP4H 4BSWA 2I7OA 5FYJE 5HI4C 2PCYA 2QVFB 4KI5F 3EH3B 4TNGA 4S1QH 1JNLL 3BVUA 1QATA 4QCIB 3WSQL 1INEH 3ZL4L 5DRWA 2P43B 4CAGA 4L9LB 1AS8A 3NFSH 1ORSA 1ONQA 3WY2A 4P2RE 3FUNA 4ODWA 2WP3T 1V7NL 4JFQA 5D1QE 4HUWB 4YX2H 2CCLA 3WTYA 4NFCA 2A74B 2X7LA 4TSAL 5LB1A 1J0JA 2TSBA 5D7HA 4FQXD 3RDTA 1FVEA 5A6LA 3V8OA 5D1ZB 4JO8A 1UH3A 4AE1A 2YXFA 1HHKA 2VISA 1X5XA 4PSRA 4WEEA 2R9HC 3M17B 4J3BA 3QEUB 3N1QC 1EUTA 2XV2A 3ATDA 3QORD 4PGZA 4LP8A 4WI7A 2XQYG 3PJSA 3TPKA 1XCQB 3HBPA 5EU6D 2V17H 4KKAD 3SE8L 2P8PB 3V4PL 4UTAH 1VHPA 1ZWIB 3I02B 1XGQA 2FLBT 2WXGA 2IOIA 3IB4A 2GUOB 3EYFA 3LXCA 4UANA 4D9RD 4OVUA 3P4OA 1ZHNB 1TQUA 1A7NH 1IKNC 4HHWA 1HNYA 1OP5H 3D39D 5E8EB 1SBSH 2N7AA 1HYSD 2W0PA 2BZ7A 1JVLA 3TWCH 4FLOA 1INDH 4OFYD 5KW9L 1EPFA 2ICWB 1JF1A 1LP9F 1KBVA 2BHUA 5FYKD 2EZ0C 2BSCA 2PNDA 3EO9L 3EYVB 3IGFA 4A7VA 4DGIL 4L8BB 1OCWL 4G80A 3KBPA 1N3NA 3S2AA 4ZTPH 2AMUA 3E38A 5ABDE 5K39A 3H6JA 5KANI 1RP9A 2A99A 1CO1A 4LHUD 3LPGA 4NNXA 5D2LE 3B2DC 1SFHA 1I1AA 3ASNB 4HFUL 1JDDA 5F7DB 5J11B 5AENA 5C0AB 2MKWA 5K5YA 3VI4E 1JPEA 1QSEA 4K94H 2VN7A 2V3DA 4X4XB 3LQZB 5T1KA 3TIEA 3BIKB 5KTEH 2FX7L 4HIXL 1OAYH 3QUMA 2YAQA 3CVIL 1BECA 3D34A 3MLSH 4QIRA 1MREL 3BXNA 4Q9CA 1IT9L 3NK3A 3MNVA 4NDMB 3NA9L 2E5EA 4NOFA 5AD0A 1YYLL 4UM9D 4IOIA 4UQCA 5C07D 1F11B 3DETC 5EIIB 1V3JA 5AW2B 4MNHA 1QW9A 4P2YA 3N40F 1JZ6A 1K8IA 3ULVL 1X7QB 4BUGA 5FPIA 5HBBA 2BSEA 1SFDA 1OTTD 1JHLL 1WK0A 3KR3L 2CMRL 2D0GA 4BQ6A 1NCGA 4WDIA 3QIUD 5CNHA 5HTSA 1XF2B 2B59A 1FZKA 3UBXG 4HETA 4X8XA 4NRXA 3RTQD 4D0DB 2CXGA 1TZIA 2ZUYA 2PYFB 3BH9B 4O02A 5IEHA 5JHLH 2A74C 1OAQL 3N41B 1VFBA 4R0LB 2A6IB 4J3OF 1NGXA 1F13A 5EOQH 1KCRH 3VNYA 4J6RH 1ZE3H 3SN6N 4G42A 4MSWB 4KY2A 3GO1H 1RZFH 4R8WL 3GMNB 4X9BA 3GWJA 3NN8A 1DUZA 5J13B 1ZXKA 4YOKA 2YD1A 4H88L 3ZOAA 2XACC 3GK8L 3VD7A 1FL5A 1PX8A 4JDZB 3OZLA 3OC5A 4PI2A 5TK4A 2C9AA 5JA9A 3KPLA 3FZUC 4U1SA 2GPZA 3OD3A 1XB8A 5EEWA 2V33A 1LDSA 3DX8B 3HZVB 3QGVA 1J9RA 1RK1B 1S2EA 4FXKC 4IIQB 4JFSA 5B8CB 4A37A 2ISDA 2GTWA 3VXRB 5IVZA 5I8OH 1EGJH 3VI3F 5BW7A 1CL7H 1PG7W 2PW2B 2CDFA 5H2BA 5JPNC 1T3FB 4LARH 1V7ML 4Y19B 3IDYB 3S8FB 2IDSA 3GM0A 4PJFE 3EF4A 5E0FA 5CUSH 4Z76B 2MPVA 1IFHL 2KZBA 2QVKA 5ACZB 4JNXA 1WHOA 5DD0L 1AG0A 2VUOA 4XH2A 1QFWI 4EAEA 2DWEB 5DMYA 1T4KB 3K4ZA 4ORGB 3RDTC 3DV6B 4H4NA 1H3XA 1VFUA 2E74C 3AS1A 4XXCC 5DD3H 5AW0B 1A5FL 1RLWA 4FNRA 5BJTA 3MX0B 3KW7A 1ROWA 2CRYA 3UXFA 1QKZL 5GGVY 1Z9MA 4WHTA 5LAPA 1YO4A 2TRHA 3WUWG 4P4RB 4MS8C 5HYJA 4P2OB 4M6NL 1EIBA 4OM1L 2AEQL 2H2SD 2J88H 1ETJA 2AITA 4YVNA 5IW6B 1JFQH 4PGCA 3MXWH 5FYJU 1AFVL 1JGUL 3HC2A 4FQ1L 3FRPA 4WHYG 1KIQB 5FCSH 5K9QG 1CDGA 1BQHG 1ZKAA 4ONGH 5A2JH 4YDKH 2EVFA 2VAAB 3B9AA 1YN6B 5A6MA 4XE0A 1E0OB 3NFPB 5E03A 3IDMB 4JAMA 4PP2A 4AYBA 5I15H 2COQA 2KQMA 4R97B 4QHPA 5G2NA 1HE7A 7CGTA 2OMZA 2X05A 1M42A 3BLPX 1E27A 2FYVA 1S78D 4AQZA 4BK5A 5MHSE 4IRJC 4KK8C 4KUCD 4K8RH 1CGXA 4CVZB 2YZ8A 5E6YA 1D7FA 1QA9B 2CM6A 5B38A 3FCTA 4HP5A 1TNMA 4LSPH 1J5CA 3ZW3A 4QI3A 5EO9A 2DIAA 2R1XA 3ZO9A 1KV7A 5CP7A 3VXNA 3DROA 1T66C 1VEMA 3FQNA 5DUPH 1BX2B 3G7TA 5IHLB 3HCVB 1YEFL 4ZSOB 2D9QB 3R0MA 1MUJB 4Y2DC 5E2TH 1BP3B 3AGVA 4Z7QF 1SXBA 3CFNA 5DI8A 3LKQA 4XMTA 3G6AB 4JDEA 4RWYH 5AOJA 4FS0A 3CHRA 3L4CA 2X89D 1L9MA 2EEDA 2Q7AA 4WUUB 3Q2VA 3V55A 2OJZL 2UX7A 4ELDA 4NNPL 2AEIT 5DZLA 4NXKA 3B9DA 1TTCA 5L9DH 4QHKI 1LQSR 2RHEA 2OMUA 3ZR6A 1BEYL 4L3AA 3OZ9L 5D7LA 4P23C 4HJGB 5HHXL 4BZ2L 4NNYA 1VJSA 3JV6A 1JGDA 1G7JA 2P28B 4KX7A 3OKYA 4F2EA 1HI6B 4RAUA 3N2JA 2UXFA 2WNXA 4OZGA 2FBJH 4DUWA 5EO0A 4F58L 3WU1A 1OALA 1XZ0B 2WQWA 1MDAA 4UT7H 4B9KC 2Y1VA 1G7LA 3KYOB 2VLKB 2YK1H 5HHNB 4KUZH 3T6QC 3V5DB 2YO3A 4MAYC 1TKWA 4PW9A 1J0KA 1U9KA 1U92B 1W8NA 2WBJD 2X4TB 2YEZA 3GHEH 4YSOA 2ESVE 4ZFZA 2X5PA 3NIFE 3S3CB 4LHJB 5AWNL 2JQAA 2XTJE 3CIQA 4OLZL 3KPSA 4P5TA 3VXOB 1XTMA 1F56A 1I3GL 3TA3A 2W9DL 5ECGA 3RVVC 1J8RA 4NZRL 4LLWA 3W0WD 2ZONA 2BW5A 4HMCA 4XB3A 1P2CB 5EUOA 2GSIB 3C6SA 3IMTA 2QGEA 3BMWA 4OZHA 5KSBA 5K9OB 5D72H 4TMPA 1GYWA 3FCTB 3VTAA 4MXVF 4OZFA 1E4XL 4GUCA 5HPOA 2OMUB 2A9CA 5KUMA 4Z7OE 2E9WA 4NWUH 4PJHB 4RGNB 3WKML 4NN5C 3ULVD 3GGWA 3KPNB 5GS1B 2BVQA 1P4UA 3LNGA 2OK0H 2YPVL 3JXAA 1W72L 2CM5A 2CIIB 3QIBA 2P5EE 4HBCH 5AYUL 5GGTH 1HHIA 3U46A 2A7BA 1WSST 4I77H 5JZ7D 2YSSB 2A9NH 1A6VL 2O5ZL 1DDTA 3BWUF 4H5SA 2N56A 5KYXA 1RZ7L 1CVSC 4Z0BH 4I88A 4NUGH 3B7SA 4XAWH 4BJLA 1DZ0A 4X9HA 4DP5X 1P6WA 3ZL4H 1AVAA 4DGUA 1CD9B 2HJLA 2O6DA 5FYLE 5IW6A 4ALAC 1X4ZA 4O2CB 3O11B 1WZAA 2WLLB 3RTQA 3PGDB 4GT0A 2V37A 5EA0H 2D03L 3BKCL 4PV9A 3FO9B 2R1XB 5B22A 2OM5A 4RNRB 1HU8A 3S2CA 4AWJC 3MLUH 5ADOH 2Y6SD 4KOCA 1G7PA 3GS0A 3N40P 3QHFH 4PRDB 4X6EA 1XCTB 2WO4A 5F6HI 1DFXA 3O8XC 1DQML 4FYRA 1MCHA 3ZN6A 1CT8B 3N50A 4MCMA 4A6YB 2WV3A 1BQHA 4PHZA 1MHHA 2CLZA 1HEJC 5JIHA 5CIPH 4EDXB 3QS2A 4GSDH 2IQAB 4PP2B 3ZDZF 2RACA 3LMJL 2ILLA 1H3TA 4UOW1 1J0YA 4BGDA 1Y7VA 5CZXD 1I8AA 3KYAA 5CN1A 1XSKA 4ANXA 2DICA 3CZNA 2VO8A 4APQB 4AT6B 4ZMAT 4K5PA 4AZ8B 1FQ9C 2V17L 5K1NA 2PPEA 4GQZA 4LVNC 3QUXA 5C0FA 1HNFA 2Q9OA 5E8NB 1QHQA 2EE6A 2EABA 4H0IA 2Y07H 3GSXA 4OUOA 3GJFK 3MCG1 3CVBA 3MOBL 4NQEA 5FS5A 4YHPB 1MCRA 1IVLA 1OTSD 4U1HB 4ELMF 3GSWA 1ANUA 2DL2A 4POZD 4F3FB 5IP4A 1FVDB 3Q8FA 4OD2B 4PJ9C 3RBGA 1GPOH 1IQWL 3RZCA 2R0KH 4JHBA 2DWEA 4HKXB 2GHWB 5E08H 2YZ1A 1A3ZA 3MV11 1IX2A 4FYQA 5HI3C 5IB5A 3FFCA 1A47A 5GRVL 3VI4A 4KXAA 4TQHA 4DGIH 3HZYB 2NTFA 1XGPB 1RPKA 1PZSA 1OPGL 2D0HA 2X4UB 1EAPB 3QJHA 2A9ML 2R69H 1OSZA 3FQXB 1VFBB 3LRKA 5AUMB 3VNZA 3U4BL 4ATWA 2IH3A 5I2IA 5JOPE 2Q10A 1HKLL 4BZ1A 5D1ZC 1FG2B 1ZTXL 1FO0B 1ACXA 1TQBB 2WWMD 1BD2B 4NHUA 4ACPA 4Z78A 2IPUG 4KKBD 2VDLH 5I30L 4OZ4B 5DMKA 5TFSH 1PQZA 3HMXH 3A21A 1JNNH 1BM3H 2V9TA 2WW8A 2NY1B 1OAZH 1AR2A 1WAAA 1EAQA 2KC0A 1E2WA 3DARA 3DX7B 1WZKA 1LMIA 4K9JA 4FQHB 4U1SB 2LQRA 2YD3A 1EJOH 1YMMA 1Z9NA 3R18A 1CICC 4QHUB 5DFWH 3CBJB 2YAHA 5JOEA 2H9GB 4LE8A 3GMRA 4A55A 1OZTG 3CSPA 3SO3C 1PZCA 5C08A 3V8CA 3MNVB 1I8IB 4Z7OB 1ZS2A 1BXXA 1WWAX 5GSVB 3MODL 3A6CH 1LMKA 4QGTA 3VM7A 3WFEL 2EYTB 3CFEA 4B60A 1MF2L 4GLRH 1G6VK 3OQ3B 4KNQA 1C8PA 4AKQA 1JHLH 3C5ZB 2BSTA 1YEKH 4X6DF 1WZ1H 2GBAA 3ZYJA 1ND0A 4GO8A 4TYUA 1FO0L 4IEFB 2W95A 3TBWB 5I6NA 1USZA 2XC8A 4XBEH 3K71A 1TYJA 4P2QA 2NY7H 4EEEA 4LCCC 4NFDA 4GQRA 3BEVB 3LNIA 3MROB 4F8TA 3L7EA 2YEVB 4J7RA 4NHCH 5JPMB 4ZW5A 2V8MA 2VSKB 3LH9A 4MQ7A 4O58L 4J6RL 4OCSL 1XCXA 3MLZL 4MJIB 2GY5A 5I6XB 5IMOB 1JXDA 2J5WA 3PF2A 4C83A 3TIDB 3RWCB 2MRYA 2LU5A 3B7TA 3GK8H 1MHCB 2X6BA 2DTML 4EI5D 3KWUA 3HEIB 1MH5A 1F42A 1SMOA 4Z7NF 3VI3B 1WQVT 1U8CA 4G6AC 2PCPA 1R4XA 1TT6A 1H8NA 4J8QA 1ZJBA 3CSGA 1OAUL 5DQ9B 2MQ0A 2YGVA 1K3ZA 5AVVB 2O6EA 1VACB 3B1TA 4IMLA 3ZRFC 3PXHA 4CVXA 4GQQA 1DEDA 1X5AA 2OMTB 3JZYA 3TVMC 1XGQB 4QRPB 1DN0B 1Z0MA 4K3HA 3ZRSA 2ZUVA 3HPJB 2PF6A 2WZ6A 1MHPH 1EJ6A 5IVXB 1CL7L 1GZQB 3CNKA 3WCYA 4Q6YA 3IPEA 3FUMA 5T1KD 5EEVA 1L0QA 3MUGA 4HC1A 4XP5L 5TGBA 4YDMA 5LGHL 2EEBA 4HULB 3FSVA 3FT4A 4M1GH 5CUSL 1OGAD 1Q1JH 3BP6A 4HUKB 5G55A 4Y16D 1RIVH 4N0YH 4PJFA 1URIA 2G3ZA 4Y4KB 3D0VA 3GSRA 4XCYB 2ATPA 1RQ5A 1N6VA 1IIIA 4AY0A 4F37F 2VR9A 2I9TA 3Q3GA 2WB7A 5ERWB 2HZHA 1A5FH 1F5WA 4PWFA 1QFUH 2RD0A 1F4XL 4L4TB 3EDFA 3GZPA 4LPWA 1E3ZA 4XCEB 4YDIL 3H0TB 4OI9A 2OSWA 4X6DE 4MYPA 2H26B 1KN2H 2GUOA 3EYFB 1MW2A 4DGYH 2R0ZL 4GKZB 5IEKB 5MEQA 1DCEA 1PU0A 5JHMA 5KVGL 1ZT4A 5DT1H 2VDKB 1SOKA 3FCGA 5AAPA 3H54A 5E6IA 2BNQE 3H9HA 4QRQB 1FORL 5ESVA 2KHAA 3PJNA 3SKNB 3QEUA 1XL4A 4IRSD 5KS9B 4N90D 4ZFGL 1S46A 3L4TA 5DRZB 5CILL 3AS0A 1J12A 5AVWB 2CO6A 4PJGB 1RP8A 5TE7L 4JZJA 1UCBH 3KYMB 1WV7T 5DWUH 3TL5A 1FL3A 2AQQA 4NCDA 4A7TA 3T2PA 3P9MA 4LSSH 3HBGA 5GPRA 3DWTA 3QNZB 1JZHA 4BDVB 3VXPA 3DVIA 4PJFB 1NFIB 3TFKC 1KGIA 4JR9L 3VD0A 1JN6B 1HOEA 2PCFB 4PBWD 1F1GA 2EYSA 1J0IA 2ICEA 4IJ3C 2VITB 4U6VL 5E8OB 2DN7A 2UZIL 3MDJA 3SYPA 4AIOA 4UT9L 4JCLA 2BVUA 5DJXA 4S2SB 4KXBA 2KYIA 3MFFA 5JDSA 4EUPB 3KLKA 1DN0A 1OGAB 3ARQA 3RUGF 3NSDA 2ZF9A 3AY4A 5I8CB 1JPST 2V2XB 3D2UA 3WEBA 5EH1A 4OY9A 5C6PB 3GMMA 4C47A 2ESVA 1FV1A 1KOAA 4HK0A 3HRZB 3Q6GH 4KVCH 1SUHA 2BJML 2DV6A 2W91A 5IB4B 5L88H 4ZXBB 1J5OH 1JERA 1MH5B 2QSCH 1T7YA 1P5UB 3OSKA 4FLQA 2WSPA 4WV1A 3MA9H 3A4EA 3O2WH 5GZOC 4D3CH 2GJZB 2BXZA 4LGRB 2VDRL 1AZBA 1FC1A 3REVB 4XVUC 4FYSA 4TNVF 4WI2A 3U83A 5C0CD 3ZXAC 1V3MA 1WEJH 1KXQE 2XFGB 3EJPA 2NNXA 2QT6A 3NZHH 4GPVA 1W6LA 4NGHH 5BZDA 2PN5A 3QWQB 1VB9A 5PCYA 2Y9RT 4QGYA 1J8HD 4OGXL 3SGEH 4OUUB 2QTEA 4OFIA 1BZ7B 2CUAA 1OK0A 4HK3N 3U0PB 1TEFA 4B5EA 1PAMA 4GMTL 3V9EA 5TD4A 3FUFA 4JZNB 1CFVL 4YPGB 2XN9E 1RH8A 3OC8A 4LSVH 3S36L 2AMGA 4OGQC 3PNWA 4XCNA 5IFHL 4JFVA 1QAWA 1N19A 1AOHA 1BOGA 1IC4H 3K6DA 3G5VA 1ZVYA 1XF1A 4NWUL 1YJDC 5FUCE 3WKNA 2IIJA 3LB6C 4XO8A 2V4LA 2N3JA 1E5BA 3DHPA 2Z31B 1IBBA 3QUZB 1W72H 2BP8B 4NUJA 4L3CA 4UUJB 2NY3B 2G0LA 5D1ZI 1ZV2A 2JIXA 4JHAH 1FO0A 5EORH 4XBMA 3INUL 1DBBH 2EDQA 3U4KA 4ZMWA 4P5MB 3WGUB 4EZKA 4Z0BL 3VGAB 5IUCA 2DD8H 5LGJA 4Z7NB 2BNQB 4NN6C 1HN1A 1TLMA 4F57H 1P7KA 1OO2A 1UA6H 3GQFA 4HVBA 3ECBA 5C9JA 5AL8A 5HGBA 5JR1H 2XUWA 2DS4A 3N6YA 3ASOB 4N20A 4GXFA 3ZE0E 3F5WB 5IB5B 3IDGA 2KMWA 3AAZB 3IDJB 5ABAA 1W0WA 3IDNB 4RVBA 5IF0A 4XB8A 2HKAA 4DNLA 5HHME 4JGUA 3V4VB 1DEEA 3VXMA 5MHSD 4E0RB 5DVOA 1A6TA 2C9UA 5GGQL 4ODHL 1Y6MR 3KPRE 4W70A 2WIMA 4FHBD 5EOTB 3D9AH 3IVKA 5IHHA 1F90H 1FNEA 1TVDA 3VD5A 1FGNL 1XR9B 3STLA 1NKRA 3VM5A 1OM3H 3UFIA 4XHJD 4P8QA 2NZ1A 4PJHE 3OL2A 4RGNE 4NZTH 4PJEE 1QABA 4KDWA 1Z9PA 2DJ4A 2GK0A 1MZYA 2FATL 2IH1A 3H3BC 5F0MB 1KTLA 3FO1A 4R9HA 5F88B 3L17A 2FX9H 3Q8CA 5DS8B 1NDGB 2A1WL 3QORA 2OSLA 4XNZB 12E8L 2WLMA 5GZND 4FQ2H 5HHQA 3VH8B 1U93B 5HDQH 4CKQA 4LEEA 2FBOJ 2OQJA 3UDWC 1TJHH 2FNBA 4G2AA 1HAWA 3SGJC 1U8NA 2B16A 5J11C 4HUVA 1CD1A 2Z35A 3LJ3A 4H2AA 4HXBL 4KQ4L 5DGRA 5F96L 4HWUA 4ZJ9A 1EEUA 1OB1A 2F74B 3D0LA 4KI1A 3D1MC 4L37B 4KRPD 1Z3RA 3TZVC 5L8JB 3EH1A 3QXUA 4FC3E 1AHWC 1SLVA 3IJ9A 5IR1B 1A9BB 4AK1A 1W91A 4TRPH 5IM7B 5E4OA 3GINA 3MUHL 4LCYB 3RGVC 3MV9D 1JWMA 1J1PH 2UXGA 4POYA 4JVPA 5I30H 3BHBA 4BFFA 3GBNL 4PJAE 3FOLB 4NQSB 3QUYB 1BM3L 1OKEA 4WFGD 4KJPC 5IMLA 1SVCP 1U95A 2ZWZA 3ROLB 1DBJH 4LLAA 3JUZA 3Q1EA 5JORB 4KAQL 1LGVA 1QNZH 3OAWA 3GIVB 1GY1A 5IQ7H 4OIIL 3GJEA 2XTJD 1NEZG 4GW1A 3SCMB 1S9YA 5ITFA 3AUVA 2X6CA 5BO1H 3RDJA 3L7FB 1A6ZA 4N25A 4L5FH 4HCRL 3K2MC 1LO4H 5KSUB 1OAXH 1IAOA 1HHJB 1JS4A 3K8LA 3GLAA 4U2ZA 3P0YH 5I6KA 5BRZE 3LZPA 1T2QL 3QUMH 2Z91A 1KTJA 1YEKL 2ADGA 1MCNA 1LO5A 4GJTB 4WAFA 3ZK0A 3L6FB 2VR3A 3QCTH 4PB9H 1BZ9A 3G9VA 4AJWA 4A38A 2ITDA 2NY7L 2XV6B 1BD2E 2EKSB 2R2CA 3DBXB 3O8XD 1P4IL 5CP3H 3TT3L 1VLXA 1P84K 4LASL 5D5MA 1S7VB 3CZGA 4XNQB 2H0EA 1S5HA 4FNPA 3RTQC 3WNIA 3L7FA 4ZFFB 5DXWA 3N85L 3C5JA 4G8GE 5F7EH 3VSUA 2FJFA 2IBZY 3D52A 4QAWA 2EDYA 2HT3D 4L4VE 4AYDC 1T0PB 2JJTA 5IQ9A 1KJ2A 4O5LH 4L8CA 1WCQA 4WWPA 4Y1AD 1DQKA 5IZ7A 4CMHB 1PPIA 4IK6A 1U95B 4HOZA 1YUKB 1VGEH 1PZ2A 1P5VA 3VWJB 5T3XH 5IMLB 4L29B 3DX0A 3L4UA 1OAUH 1ETZB 3MPCA 4OZIE 2O5XH 4BFBD 1NCUA 5BUPA 2PYEA 2ZUQB 3GPSA 4ELMA 1GTFA 4XAKD 4RCAA 2ZYRA 3BAYA 3DTDA 5F7UA 5CJQH 1AD0A 4P05A 1AJ7H 4ADJA 2EDJA 3MR9B 3LQAH 3DJSA 4HXAL 2HKFH 2EIBA 3VI4F 2YC1B 4MZ2A 5IR1A 3V7AG 4M7JH 4NN6B 2CR6A 4Y1TA 4NC2B 4G71B 3QJRB 1EVTC 4GIAA 2PPAA 1X5LA 4FA7B 3VRLF 1GSKA 3SPGA 4KVPA 2JV6A 3PWNB 1P5UA 1OY3B 3QEGH 4PCKA 4WFEE 3IGUA 1S8DB 4KJWD 1A3RL 7PCYA 4NFBA 4XMUA 1D6EB 2R39A 2YRPA 4FFVD 2IANE 3U9WA 1NOLA 2YAPA 3FDWA 2OSLB 3KPRA 4MB3A 4NPYA 2OMZB 2WIIB 4NKIL 4E9YA 2IH1B 5K9KA 1TETL 1Y18A 1EV2E 1JPGB 5KYYA 4MX7B 3GIZL 5EEUA 2DQTH 4TQ8A 5JQ6L 5CIPA 5HDOA 5DT1L 3G6JA 1LO0H 3VQMA 1AKJB 2NR6D 3P3SA 1Y0LB 5IB3B 4XO5A 4MYWB 4Z18A 1UH4A 5D6DA 4ZFGH 5J6GA 2KZ1B 3BPNB 1RAMA 2R15A 4WWNA 1UFGA 4L1LA 3QXAA 1GYVA 1QTYT 3FU7A 3HB3D 3PV6A 5D70L 1JWMB 5FF6B 4AGNA 1HFUA 2ZCZA 3BYYA 3FSZA 2DI9A 5DWUL 4PJGA 2EH7L 4UTBA 1D9KC 5DD6B 4R7LA 3AAZA 4IRJD 1NM4A 1A7OL 4UU9A 4XTRD 3C9NB 1J5DA 4XVSL 4TSBH 1UQSA 4UDTB 1H19A 3BPOB 3TEYA 2VMDA 5CLYA 2DI7A 3ECBB 4GRWE 1DVUA 2AXJA 3O6MH 4A68A 1E43A 2DQCH 4MXQD 1N68A 5MEQB 1SJMA 3BDYL 5JIKA 1X5GA 2LAAA 4DK6A 4DKTA 1CC3A 2IQ9H 2X9XA 1OT2A 4P2RD 2GCYA 4EI5C 1SVZA 3BZFA 4RGMB 4UQEA 2WBJC 3N9GH 3VU1A 4W6XB 2BDNL 4I3RH 4PBXA 3CSBA 1QO3A 2FX8L 2QSTA 1TZHA 3NZ8B 1DANU 2I9LB 4JM2A 3RB5A 3QUGA 3FH8A 4GKSB 4M00A 4JM2F 1AH1A 3W2DH 1TPXC 2EINB 4N8CL 4UB0H 3ES6A 1YQVH 5KYUB 1WA1X 1LEKB 3WMSA 1ZGLB 1EJFA 4JL1A 4XNYL 1DE4A 1XTLA 3GMNA 4OLXL 4JE0A 1E4HA 3HOGA 1YECL 4F7KA 4J23A 3UC0H 1AZRA 2VDRH 1UATA 4IRZH 2C7UA 5ILTL 2OR8A 2VR4A 3HG3A 1FZOB 1R75A 3NZHL 1CIDA 4L2LA 4GIPD 3BO8B 3CBRA 4XNMA 3U1PA 1HXMA 1RZ8A 3B2VL 1RK0B 2P5ED 3HRPA 4WDIB 5SWZA 2JXMB 4F8OA 3IDUA 4GEIA 1S9VA 5FKAA 4I85A 4TVSa 2C3XA 4BZYA 4GEJA 4X6DA 1BZQK 3RB7A 1MWAH 3FHEA 1P6AB 2D7OA 3BISA 1CLZL 4RFEB 3VWKC 2VDKL 5HHVL 4PEEA 2OMBA 1NAMB 3JSSA 2DKSA 1HIMH 4JM2D 2W65A 4QHLB 3T2NH 2WTRB 3PUUA 1EZSA 4FTVB 5CEZH 1JK9A 1L6ZA 4PCTA 3WNOA 3SSGA 4O2FA 43C9A 4ZMXA 2A5UA 5D7IA 1BVLB 4QT5A 2VDOH 2OTWB 1MLCA 3T1WA 1JNLH 3LQZA 1JAEA 2CHZA 3K71B 2FT8A 4KQ3H 1QSEB 4ICXA 1S7TB 3AABA 1UWGL 3NEEA 4I7ZC 5EUOE 1NFDE 2F7QA 1HOCA 4JHAL 5I5MA 1E8ZA 5D9SA 5E6SB 1MCOL 3QNXA 1WHPA 5I19H 3MV8E 5EV7A 3E8VA 1ZA3A 2DWDB 4PRHB 4NUQA 3S34L 4F57L 4FRWA 1DE4B 1E8WA 3NVQA 4JFOB 5FFGA 5I9QC 5K1VA 4JO4H 3F7RA 4NRZA 5BV7L 1DJIA 2OTPA 4A2EA 1GJIA 1NGZA 3O3EB 5I1KL 1U8KB 5L2KB 4NCC1 4XMVA 2YD5A 3SGDH 5D96B 4RMTA 4NCC2 1YRKA 4JFED 5HGDA 2FWSA 2WLIA 2F54E 2FJUB 1BD2A 4BM7A 2AV7A 4WWID 4ZPTA 5A1AA 1F86A 2R2EA 1G6RA 1F90L 1LWHA 2JMRA 4I1RA 5CLZA 5I2IB 3I02A 1FGNH 3DGGA 5DMJB 1O6SB 1ZY9A 2OMWA 4R90H 4PJDA 4TF4A 1Z3GL 5KVFH 3FCBA 3K5RA 4MA1C 3P2TA 3QWRA 3JYBA 1N59A 1NDMA 5KSVA 4YK4B 4C59B 1WC7A 3HZMA 4WV1C 3DRTB 4XVUD 3PL6C 4RFOL 5F21B 4YWGL 3VTMA 3T4YA 4UT9A 4UQ2B 5F6IB 1CGUA 4WJG3 3QQ9D 1JZ3A 4GAAA 1MPAH 8CGTA 3S5ZA 1WBXB 4G7QB 5F0JB 2GHZA 4Z7NE 4M61A 3PWPE 1IGCH 1B2WL 3ZDXF 1UD6A 1X44A 2OMNA 3TO4D 1I9JL 4JJHA 1WYJA 4WO4D 5E5RB 2WBKA 2Q8BL 5HJDA 5EZLB 5DR5H 4PJ9D 1H6UA 3V0DA 4BFJA 5D2LA 5IVOA 4DEUA 4Y5YB 4HXBH 2B5IC 2CZNA 2X0UA 3DUHA 1JN6A 3AU1A 5TH2B 2QDVA 5KTEL 3QNZA 3MNZB 5DFTA 4WFED 3FUJA 3HPJA 3L3OC 2WAHA 4Y4HC 1W9XA 4BSWB 2RFXA 3ET9F 2Y1ZA 4TLKA 5HGAB 3CLEL 4N2KA 1J1PL 3M1CA 3MN8A 5AW9B 5LJYH 4HX1A 4W4NA 1EEYB 5F93C 5CINH 2XXGA 3GBNH 4WUKL 1IKNA 3WIIH 3AROA 1KJ3H 4GSQA 4M43L 1SOXA 4WW2C 4ZFOA 1CMOA 3FXIC 2LU3A 2EDBA 4ZOAA 3HN5A 3SB3A 4KAQH 3PWJA 2YJQA 5E2UL 5KS9F 35C8H 2RQEA 5KN5B 2Q76A 3GYRA 3BKML 1WWCA 3ZMNA 1EO5A 5FYJH 1O6SA 2OMWB 3S96A 3WEXA 1MJJB 3WNNA 3DXAD 4ZAKA 3CUPB 5H37A 3SBWC 2MNUA 2H26A 1R5IA 4JFXA 1OAQH 4BFNA 2FK9A 3SDYL 4Y5VC 1FFOB 3C2SA 3VGAC 4HIQA 5HGHA 4NLAA 1U8PA 2FB4H 3OJDA 3RVXC 1MIEH 3ZKQD 3QCTL 4PB9L 3AM8A 5GS1A 4G9FD 4JKPH 3C5ZA 2OMYA 3HRZC 3ZZQA 1TQCC 4OB5H 4Y4KA 3QSKB 4G5AA 1NGZB 1UXWA 4WFFE 4MCNA 4XXCA 2OS7A 4NRZB 4MA8L 1G4MA 1CL7I 2QVTA 3FK3A 3OF6D 5FYKE 3VFMB 1K85A 1WBZA 2IWGA 3N85H 5DYFA 2E7LA 1JWUB 2X0WA 1URLA 2MKLC 4KNTA 4TL5A 4Y16C 4CN1A 5D2NB 4LLWB 2UXVA 3FQWB 4FNTA 3IXAA 4A39A 3JZ7A 1NBYB 2GY7B 2KUTA 1GZPB 1FH5L 1RHHB 5CSZB 1MCSA 4OI8A 1JV2B 4B3EA 3LVEA 2EYRA 5I8OL 1EGJL 2F54B 3VD9A 4GUPA 3RG1C 1YMHB 2W81C 3AW5A 3TS8A 2X4TA 5ICXA 3GTTA 4QYOB 4N22A 5EIIG 2NZ9D 1MCWM 1ML0A 2RQ8A 3SDXB 2V9UA 5T1LA 5HY9B 3EJJX 3KJ4C 5CJQL 5KOVC 4ADGA 3IMSA 2WYIA 3GXFA 3OKLB 3KYOA 5ECJE 5L2KD 4E5XA 5DD0H 4DERA 4ZTOL 1BIHA 1SMDA 4NZJA 2WLYA 4OZGB 4HGMA 2Z7WA 4E9XA 1MLBA 3ZRCC 3HC3L 4BUQA 4K23H 3GJEB 3EGDA 4JG1H 2LABA 3X1FA 4H44C 3QNYB 3NT0A 1F02I 3MRGA 3X1GA 4RRPG 3G5XA 3EGXA 4KJQD 1GYCA 2J88L 1PDKA 1DCLA 1XWVA 1T4WA 5D8JL 5F3FA 1KLUB 4U6YB 2ITEA 3T3ME 1FNSL 2BLFA 3WXWH 5DJYB 5FA4A 3HS8A 4NT6B 4HCFA 2LR4A 3KGTA 2C26A 3ILDA 2VZOA 1SPDA 5J6GB 2CNYA 2YRZA 5E1GA 3PDGA 5EFIA 3TBYA 1A9BA 1KYDA 4NIYE 4WO4A 3E0GA 4OFDA 2WUCH 3QC5X 4BH7A 1RSFA 1TVHB 3MRHB 4IYKA 5IB3A 4X5XA 3WGVB 2XQBH 3GIZH 4BFEA 4HJ0D 4Y4KC 1OB1B 1DQJA 2AJSL 1MRDH 1OT4A 1JPGA 4PV8A 3ES6B 5I1LA 3LKPB 2XXCB 3T3PF 3LS4H 4XXWC 5EBGA 1E3FA 1M2OA 5FM8A 5LBSA 3L3KB 3DTXB 1FH2A 2WKGA 4JPSA 3IJEB 1QA9A 4PIRF 5E7BA 2XIIA 3L3DA 4I9XA 5D70H 5E00A 4X6EB 2NY3C 4QHNB 1P7QD 2GCYB 2VMCA 4G1EA 5HHOD 4NQTA 1C7SA 4RWYL 1T21B 1IBDA 4I4WA 3PREA 4FI7A 4KI5C 4MJHA 1GSMA 1KZYA 1KB9J 4I8DA 2A77L 2UZPA 3GF8A 4ZO6A 3RJDA 4UDTA 1RSYA 3WFBH 3BPCA 4F7CA 2HT3C 2Y7QB 4QO1A 2BIHA 3ARFD 4Y9CA 5FKPA 3O2DL 3ZTJH 4MD0A 1VADA 1IM9A 2WANA 1I53A 2NX5E 4QKXB 3MRIB 2G3XA 1Z5LB 3QIBB 4E0RA 2PO6A 3F84A 4QYAA 2VW7A 1A7QL 4JRXD 3HVNA 2HTLD 3FB7B 3MBWA 2VABA 3FFDB 1AANA 5J6SA 5GHWH 2V9RA 4F58H 2WCPA 4G1MA 3BLKA 4BXVA 1H3PL 1LO3L 3LXUX 1Q0XH 1WAAE 4XOCA 4GLRI 4F5CE 1A65A 2CGZA 5K9OA 1B0WA 4BFGA 2B1HH 2HVJA 3DSFH 5C9JB 2R7EA 3VA2C 4ZUSA 3QJUB 5TE4H 4B95C 3MNWA 2FJFB 3WJJA 1CDJA 2Y36H 1LE5B 2BNQA 4QPEA 2Y7NA 4APXA 3BZEA 4ZPVA 1LWRA 4H8QA 4KDVA 4YXHL 5F7MC 1AQKL 1XXDC 5DUJA 4PUBL 1BLIA 4NO0D 5D7JA 4FTDA 3B2VH 2VH5H 3SKOB 3QH3A 3T04D 1T7WA 1I7UA 3B7RL 4HZLB 3SEPA 1JZ8A 1E5CA 4R7XA 5GRJH 1E4XH 1RHHA 3MC0A 3O11A 5CSZA 1FPTH 3ULUH 2WOBA 5I1CH 1V27A 4K3EH 1AOZA 1BIIA 4NO0A 1ILSA 1KIRB 5D7JD 3L4VA 5AYUH 3VVWA 5CEZL 4OI7A 1HK6A 1DVQA 1GC1C 1KGCD 3MLYH 4XMZA 4PHXA 4P2QD 5CJBA 5CZXC 3U2IA 3ZYIA 1LE9A 2ZSVA 3K8KA 4PJBB 3GSNA 3QPQD 4OBRA 5HDRA 3D0AA 4MJ6A 4JB9H 3ESNA 3VFTA 1ETZA 2EEXA 4OFPA 4DKEL 2O6CA 2B08A 3O9WA 1UWGH 5D93B 4FJ6A 2GBUA 2BVPA 1DJXA 5F2FA 5EA0L 5BMFL 4KUCF 2D03H 1OTSC 2W9EL 5FW8A 2CJTA 2FWOB 2DF3A 3IMVA 5MI0B 3GDBA 3MLUL 3UMNA 5T5FA 1HINL 1HWWA 3BRDA 3S34H 5I6OA 5GS2D 2F5BL 2F68X 4NB7A 1AXIB 2AK4A 1DQMH 3HHSB 3L4YA 5B1BB 4HUVB 3PP3H 3IU4L 5HJBA 3OKLA 2AQPA 1H5BC 4P2RA 3L5JA 3TO4B 4QNPE 4MA1B 3Q43A 2ED8A 4N8PA 1S4IA 3O3AA 3BIKA 1HQ4B 1J1XH 1DL7L 2VXTH 2NY6D 1MNNA 5FAAA 2ZWKA 5D55A 2R4RH 1CU4H 2AJ3B 1IAOB 3TBCA 3GXNA 2EYRB 1NC2D 5CGMA 7PAZA 4IKIA 3BP5B 4JFDB 2BM3A 3MKGA 1AGBA 4HAFA 2Y07L 4LVNB 5D71H 4L1DA 3IWUA 4BK8A 1I85A 4XRCB 2V5RA 3WV0A 4NP4L 4KOBA 4R90L 4WFHD 5FW7A 1KIQA 5D6DC 4NO5B 4J4PA 5J5EA 3F8UB 5IB1A 4LXFA 1GGIH 5GRYA 3LVTA 2R0KL 1CFMA 2BOCA 3MRCB 1BVKB 4G1MB 2DWTA 3GEFA 4U1JB 5GGRY 3SCMC 2HVKB 4RZCB 1X9LA 3MX0A 4XNXH 2GITA 1MPAL 3DVFA 3ZIMA 4CSTA 4EI0A 4PGDB 2JKXA 3MACH 3BEWB 3G5YA 2HCZX 2Y2WA 2XPZA 4ODVL 2D4FA 1HKLH 1F45A 4P57B 5FO2A 4ZW7A 3TN0B 3ZIYA 1UOLA 3FT9A 4U1IA 1KCKA 3BSZH 1UXSB 3MXVH 1F4YL 1H3VA 4ZX4A 3HG0A 5AVTB 5KN5A 4AIXA 1P4BL 1H3WM 5B7MA 3EBAA 4FFWC 3VXRA 3T2QA 2YD9A 1LYQA 4GRLA 3JV5A 4YQXH 5FO7A 4UOJA 5HHQB 4S1DD 1FFNA 3EDKA 5CBEB 2AAAA 2EADA 4L4TA 3LKSA 3RWHA 3J7HA 4AKOA 1S9WB 1FUNA 4MD4B 3TASA 3QUZA 1BYPA 5DS8A 4D9QD 4F9PC 2J5LC 1JZDC 3WFEH 3HI5L 5IBLC 1D6VL 1T6VN 2OR9H 1KELL 1QWUA 2B9AA 3CVCA 3CPLA 4UTCA 4ZNEE 2QKSA 1U8KA 5DO8A 5L2KA 1KCWA 5MEOA 1UWEL 3KDPB 4XMPL 3RGHA 3NBNA 1IM3D 5JA8B 3RI5F 2HG5B 4LESA 3PIQB 2BXYA 3N44B 4QF1A 3I50L 2QLYA 3Q2WA 5KZCD 3IAPA 2VN5A 4PS7A 5JLZA 2VL4A 1CGSH 5HYJB 1PYWA 2VQUA 1IAKB 5KBDA 5ID1B 4UV7H 5EBMB 1NBVH 5D9SB 5I28A 4Y1AA 1CGYA 1T6WA 4ONHB 3CN4A 3P54A 5E99H 4OCSH 2NLJB 4XX1G 2L7JA 3W0WB 4MNGA 2JTDA 3IDNA 4I0CC 5IF0B 5GIRB 3MJ8A 3T4YB 1HXYB 2UYLB 3WN5C 3VD4A 2RR3A 3QNYA 3OWRA 1CXLA 3IDIA 3TBTA 5F8QC 1AQDB 4Z0XB 1K6QH 3C6LD 4JREC 4AV0A 4JY4B 5IQMA 3OKDB 4HIHB 1OF0A 4F2FA 3SKMA 4FTVA 3GBML 4TVPE 3SZKC 4CGUB 3BWAB 4QRRD 4IQHA 2W65B 1F00I 3MRFA 2ZNWA 4BSVA 4IDLA 4PLKC 2AJXH 1JD7A 3HC4L 4JY4A 4X4YB 4ODBD 1AD9A 3KPOB 4Y4FB 2AV7B 4L2YA 1YNKH 2JKIS 1DVSA 2WYTA 4ONFH 1BM7A 3HZVA 2Q8AL 4Q97A 2YIHA 3L95A 1K8DB 2BCMA 1FV1B 4HK0B 5I0YA 3KM2A 3L13A 3GJFA 3UZQB 3QQ9C 4G8GA 4XPFH 4AQ8A 5DDHB 3CDGB 3QFJE 4M1GL 4U0RB 4ZQKA 2YR3A 1AIFA 3C08H 3L3HA 4IBWA 3REWA 4CJ0A 1UKSA 3TO4C 4ZTOH 3ESVF 4N2IA 5K39B 3RVTC 5JLZB 1XD0A 5I76A 1BF5A 1PCXA 2FGWH 3OPZL 4DAGH 2J1XA 1RPUA 2VITA 5E8OA 3Q5YA 1N3NB 3APFA 4P5RA 5JIIA 4KH9A 2YXWA 4GP4B 4W9HC 3SDCA 4OGYL 1A7RH 1EK3A 2Y06L 4Z7WA 3GXUB 3AFLA 15C8H 2R0ZH 2ENYA 1N67A 1T5WB 1U33A 4GSUA 5ETUB 5BZDB 1HHHA 1MG2C 1ZIAA 2CRZA 3NCJH 1GAFL 3B2MA 4KJWC 4KFZC 1YEEL 4BFOA 1JPFA 2H45A 2DQ6A 2MHAA 3D69B 3QQDA 3KVDD 1CYWA 3ZJAA 2YFOA 2Q5BA 1FORH 3Q8BA 2NQCA 5HVGB 5DA0B 1P7HL 4F2MB 2M8XA 5D2NE 1ZPLA 5I0WA 5I8KH 4IU3A 3T5WA 3FL7A 3RNKA 4QRQA 3LX9A 4I2XB 5T1MB 1FVCA 3KBHE 3MRQA 1R3IL 5FGCE 3FSOA 2XQBL 43CAB 3VH8G 2UY7A 4HIHA 4Y7MA 2WWNA 5IVNA 3HZYA 4MS6A 1C16A 3FRUB 1YEJL 3GRWA 4KXZH 1A2YB 2XZQL 4NYLB 1UKQA 2LHAA 2YPLA 3HMWH 4XGZB 4YHMH 3S48A 5KUKA 2IWEA 3C5SA 4UYPA 3OKKB 4M62H 4ETYA 2O26U 4HUXB 1Z66A 2WP3O 1HXMB 2EDOA 4Y7OC 5AVRB 2YD8A 2F7RA 3ZDZB 1CE6A 1PJWA 3FUHA 4FZ8L 2ZQKA 1RIHL 5F9OL 4CJ1A 5FIEA 4KITB 2H3NA 3FULA 5DJ8A 1YMMD 3QA3B 2H5UA 2B77A 3K5SA 4LL1A 1VSCA 2K4AA 4OLEA 4QXVA 3VX1A 1VZGA 2Y7LA 2BW4A 4XP9L 4LSQH 4P5KB 1DTUA 1B0IA 4HWBA 2YRBA 4X7EC 3QIBD 3MV9A 4Q0XL 4AGPA 3KWTA 1E4XI 5CIPB 5I6PA 4LVOB 5I74B 2R51A 3WS3A 5KBNC 5AZ2H 1HCZA 1JF1B 4PJIB 1TQCB 2MTAA 2ZOOA 2ICWA 3MRKA 4A2MA 2QSCL 5DJZB 3DURB 3LV3A 1WAPA 3LQAC 4WK4B 5FHBH 1TIUA 5INDA 3U0WL 1QWHA 4PY7A 4S0TD 4Y19D 3V4PA 1JXFA 1SJEB 2E27L 3EG9B 4K0OA 5I71B 1A7QH 2Y1YA 2A0LC 2X1QA 4CGTA 1FIGL 4XP1H 4GRLB 2A38A 4JRYD 4LSUL 1RERA 3SGEI 3HE6D 4LEOA 4NYLA 4XGZA 5DHVH 2H3KA 1Q9LA 4HFWA 4M48L 5C0BE 3S7GA 4PJEB 3SQBA 5ISZD 3T0WA 4PJDB 5A2LH 3X11B 1MELA 3V5KB 1E4WH 4MJIA 4P9MH 1N6QL 2UZYA 2I26N 2ETWA 4OGXH 2WZPD 5M94B 4QMEA 2MCG1 2D3NA 2FWOA 3K2UH 4HEMA 3FQYA 4K3DH 4N90E 1PCSA 4DHLA 3ULUF 5IHBA 2ZCKL 4MMZB 4OM0H 5GRUL 3RWFA 5IV2A 1NUNB 2FD6H 2WJ5A 1FFRA 3AMLA 4PUBH 2PYEB 3BKYL 1A4BA 2EDFA 3VG0H 3VXSE 4W68A 2GBTA 4B7LA 2FR4A 4LSVL 2DYPD 4O9HL 1RJYA 2OA9A 4KTGA 4MJ6B 1EHAA 4LOUC 4KZEL 1T0OA 3WFHB 1XH1A 1BG1A 1DLFH 4M8RA 2J44A 4X5RA 4X2UA 1D5MB 1U2YA 3DRQA 1N5AA 1FNGA 4XOEA 1BF2A 3QIUB 3NJKA 4MX7A 3FQTA 5TQ0L 2AI0L 3GNMH 3TV8A 2YUWA 1AGBB 2CHXA 3HI6H 3HW7A 1FN4A 3S6CA 1DBBL 3NSYA 2B1AH 1KYAA 2VQTA 4WJ5A 3MRDB 4JANA 3BGFC 2OL3B 2OXHA 5KVEL 1VACA 3P69A 1OSEA 3MFGB 4DKEH 3MV9E 2OTWA 1RJZB 1AHKA 1F3RB 1KBBA 2DB8A 1ET5A 5FGCB 2K3TA 5TK2A 4QTIL 5DC9B 4Z7VB 4KZDL 3T0VA 1J88A 3F83A 5D6CA 3WE1A 1HEHC 5E95B 1SDDA 4OD1H 3ARVA 1OW0A 4BQBA 4K94C 4WKZA 4HOWA 1A4CA 3P0VH 3RX9A 2VM9A 3UEZA 1QUNB 3Q6FA 2FBRA 1F1AA 4YSRA 5GGQH 1B2YA 1PL3A 1U4FA 1ID2A 2AQ3A 3MUY1 1E90A 3IAQA 4LMQI 4WGKA 3Q8EA 3UAEA 2VMFA 3OF6A 4DT2A 4EIGB 5GS2H 3HR5A 3W0WA 5DS2A 1KEML 3OGCB 4OCNC 2F53B 1NEPA 2PO6B 5C0ND 4F1ZA 1CU4L 1W72B 2DQFA 3CC5B 1KMGA 4AJVA 5K9QI 1WD9A 3GXTA 3MCLL 2FX9L 2F7OA 3II3A 4WSKA 1FZMB 5JTWA 1O5DT 4NP4H 4N24A 2H1PL 2VN3A 1DFBH 4L37A 1N5YL 1DANT 4JQVA 4P59H 4PCSA 3CG8A 2Z35B 4HW6A 2GIXA 1R5WB 1IC0A 1V5JA 3DXAA 1QLEB 1GCYA 3DX2A 4ZAKD 3SE3C 4HH9B 2IGFH 1H9DA 2WTPA 1SXZA 4LT7A 3ZDXE 2VR6A 2OQJB 1M05A 4X7FC 2Y7SA 1U93A 3L6FA 4D0CB 3ABGA 1KFGA 3IEAA 4JY5H 4QHNA 4TTDD 1YDPA 3UAJC 5AAWA 5J8OA 2R23B 5LN8A 4YZFE 1KBGH 3L3DB 3ARZA 4IKLA 5E00B 4XPAL 5AVSB 3QORB 4X7SL 2QHRL 2JSFA 5DEZA 4A7UA 3I6KA 4E2OA 1WWWX 4ZNEA 1I3UA 3ISYA 5C71A 2GAZB 3ILPA 3NFPA 1KT2B 3NK4A 4PMFA 1ZTMA 1EX0A 2EXSA 5SWSA 1NFKA 1F4YH 4PJ7F 1YN7B 5DZJA 1FZJA 4ANVA 2B4CL 3T65B 5C0EA 2EIMB 3U9UB 4PIBA 4KXZI 1UM6H 2BRQA 4QRTA 1FYTD 2ITFA 4TQPA 3UJJL 1YHPA 2P8MB 4MQXD 1WCBB 4BH7B 5B4MC 1Y6NR 4PJ5B 4G5ZH 1U8OB 3RZCB 2YXMA 1AZVA 1QSFB 1FVDA 2NY1D 2Z7YA 3UZEA 5FEBA 3FU7B 5FF6A 1Y6KR 5DJYA 3RLSA 2E6QA 3CSYB 3HE7B 2JLLA 3B3BA 2OW6A 1MEXL 2XHNA 5EC2A 1IL1B 1XVSA 4XH2B 2E7DA 3B4NA 3IXTB 3W9DB 4LSDA 1E4JA 2B15A 3QUXB 2SEBB 3SDXE 1AO7E 4XN7A 1HL9A 2XVGA 1AQ8A 5J1SC 1KG0A 1OSPH 1JWSB 1DSFL 3DSNA 3FSWA 2K45A 4M5YH 3SGKC 1CICA 3AU0A 1OW0C 3FT2B 2IFFL 4M6OL 1NEZA 5IVZB 4BQ8A 2K6ZA 1Q72H 2XN9A 4LASH 4V1DB 2WKOF 2DM4A 1RK1A 5JXEA 5SV3A 3GI8H 2H2PD 2YA2A 4EO5A 4MASA 2W5PA 5F7FA 3F65A 2NY2D 1AI1L 3L3KA 1I1RA 3IK2A 3EDDA 1KCVL 4UAOC 1BOGB 2LVCA 2E7LC 4WI4A 1GGTA 1XIWA 1JZFA 4OCRH 3DBSA 2HFFA 1W8OA 2ZAGA 3HVDA 1B4JL 1P4LA 3MJ7B 4MJ5A 4Y9GA 3TH4T 3I6LD 5HYSA 2XWTB 4WWKD 3ZR5A 2AJXL 3FSAA 3HC4H 1AJ7L 2Q86B 2OYPA 1JZJA 2EDHA 5KYWB 4M9OA 5F44A 3C75A 4JRWA 3QJSB 5E5MB 3TEUA 2Q8AH 1QHPA 2PR9A 3QR0A 4AI7A 4AJYV 2EDLA 1MOEA 2AKRB 2JE8A 2R2BA 1J86A 4M7JL 3UO1L 4B97A 4GKOA 3SPIA 3UTTD 4Y9FA 1TOXA 3K72A 5EN2A 5FK9B 3HR5B 1PNCA 3RWEA 2J6EH 3KDMB 1P5VB 1U8PB 3VWJA 1CDBA 4WEBH 4G8IA 1U91B 4ZMVA 3D4ZA 4OZFB 2B8OT 4ZNCD 2YKLH 5CD3B 3QQNA 3KWVA 3PV7A 5K59E 3EJZD 1JVOA 1CURA 1X7QA 2X4NB 3AG4B 2FT7A 1R0AH 2BFGA 3KPQA 2FGWL 3OPZH 4RISL 4DAGL 5DTFB 1MUJA 1EMTH 2FSDA 3EH5B 2PR4L 5F0PB 4A2DA 1XB6A 4D0BA 3VQLA 3OB0K 3VJ6A 3RKPA 4QDGA 3DJTA 1R46A 5DZOA 2E8ZA 4YMPA 4NQXA 1HL4A 3QQ4B 4FFWD 5CJXC 3SPHA 5B38B 4MLSA 3HZ3A 4YDNA 3SGDI 3AWFA 3GMMB 1GAFH 4AH2A 1EEYA 3JWNE 4GUPB 1PW3A 1NWPA 4BCYA 3UTTE 3WNPA 2ICES 3OHXC 3ABKB 3BZEB 4G9DA 4IRSB 1F8TL 1AZNA 1HVXA 2G3NA 4X7TA 2ZPKL 5GQBA 2VDMH 4JZNA 1X3DA 4XPGH 2I25N 3DIFA 3R7QA 4HPYL 1T1YB 2IOMA 3TLRA 3VFMA 5CEZD 2Y7MA 1YEJH 4GRMB 5JHDD 2APXA 2WSKA 1KB3A 1J11A 1GS6X 2CRMA 2WNKA 3NCXA 5E9DD 4NQED 3F7QA 1RZJL 5C86A 1AXTL 4Z95L 4M4RA 3VGEA 3GSOA 1URZA 2OYMA 1KB9K 3A0OA 3NABL 3PG2A 4IU2B 3VACA 2A4EA 1L6PA 4TNWF 1OP5K 4ABQA 4AEFA 4WHYH 2AJZB 3OLGA 4PLOB 4H1LB 2XA8H 4E9WA 3NACH 4FZ8H 2DQEH 2F1BA 4MMZA 4QHMA 2R0WL 2CA4A 3PWVA 3PXJA 1TDQA 3QFDB 4HKBA 4LBEB 2IQ9L 1G4RA 3O8XA 4MA7L 1GHFL 2RA1A 2OMVA 2CG9X 4UIKL 5IHZA 3TEXA 4XP9H 3H9HB 4GRLC 4LSQL 1A6AA 1WIPA 5CZRA 3NIGB 4NAMA 4Q9RH 3F6IA 2ORBL 3TBVB 5IFAH 4HFWB 4MRBA 3WL9B 1BZOA 3NZUA 1NIFA 4KK9C 1C1EH 1KLGB 3TFBA 5FHAL 2VDRB 3IGLA 3EW3B 1YQVL 3H0TA 4MNQA 2RAMA 2ESVB 5E2WH 4O51B 3WUWA 4CSPA 3Q44A 3C09C 5F1IB 4DZ8B 1Q9WA 5IK3B 2GYSA 3V0JA 3Q2LA 3IJEA 1BW8A 1NA8A 2VXVL 3OKNA 3DURA 3FUKA 5LGKA 2JVUA 2ED9A 4Y8DC 4FFYL 4LEBA 5ILTH 1F97A 1NINA 1QTPA 2HTLC 3EOTL 4JDZA 3BGMA 5CJOH 3O6FB 3BT2L 3OSVA 4QXUL 2A73B 3ALXA 5T5NF 1YY9D 3GZKA 4M5ZH 1NGYA 2VDLB 2G5BB 3HFMH 1G9NC 3UAAA 4J4PC 4J2XA 3P9MB 4FZEH 3BUDA 4JO1L 3T0BA 4LU5H 3SODB 4F8PA 4MMXC 4LNRA 1KCBA 2NUTB 2IC2A 4DGVL 1OL0A 3IJYB 3HG1D 5CR8A 1QRKA 1VEPA 1OD9A 5GJTH 3OG4B 4EIZC 1S78C 3VG0L 4ECNA 4TTGA 2CQVA 1HH9A 3ZPDA 2H0FA 1MHEB 1IBFA 1BVNP 1R3LB 1ETB1 4HF5L 5E2JA 1JTOA 3G04B 2X87A 4O2FB 2P24A 2CAKA 2EIKB 2BSDA 2OXGB 1HDMA 2KZWA 3HI1B 1G1OA 43CAA 1CLVA 4FL4C 5EU6E 4YR6A 2H1XA 4NJAH 1BJ8A 1BAFL 1XH2A 4HIJB 4OFKA 4OU3A 5A2FA 5I1HL 5TPWH 1BVNT 4TULH 3WTTA 2WWKO 4XCEA 4KO9A 5D7JC 2N7SA 2J8OA 5I19L 5T5NG 5FKAB 3EKCA 5C2BL 4DH2A 4FP8L 1FF5A 4MD5B 4R4BB 2O72A 3O81A 4EJ1C 4CMHC 4UQ3A 1TQSA 4NJ9H 3KPLB 3FC8A 1IGYA 1YEIH 3DUUA 4ABVA 1WVZA 4PJCE 4PREB 2BZCA 4YPGA 4WTXA 2LOEA 3GSVB 2VJ0A 5EO1B 1JWUA 3GKWL 1JDCA 4DPCX 1R3HB 3VWJD 3EYVA 3QJQB 5JIQA 1A6UL 4WI5A 4OF5A 1NCDH 2CKNA 1OP3H 1M71B 4IMLB 3QJFA 5C0GB 1S3RA 1KEMH 3KGRA 1PQZB 4LPTA 5JO5B 3SOBL 2OPCA 1KB5B 4MJJA 2Z4QB 1BVLA 2J72A 3BDBA 3CU1A 4GS7C 1UM4L 4N86A 5JPNB 1R47A 1NJ9A 1FG2A 3GBLA 4JHWH 3PQYB 4QEGA 5FUOL 4G8EA 2ZXCA 4PSPA 3JYCA 3SY0B 2GJZA 1L7IL 3MCLH 4FNUA 4R4FL 5DD5H 4AGMA 3FQXA 2C9PA 2CSPA 1C5BH 3NJMA 4X4ME 3K91A 4JKMA 2AC0A 1JDAA 2OXGA 1UEYA 1A1MA 3RVVD 3HS0A 3JWDL 1TO5A 1CR9H 2R27A 4U31A 2QKIC 2FEEI 1TZGH 5C2UB 3SHSA 4EF3A 4LP5A 1PG7H 3ZQXA 4DN3H 1E7VA 4UU9B 1JMZA 4HGWA 5DR5L 3DUUB 3CH1A 1O5PA 4JFFD 4EXPX 1ZHKB 1EHNA 1K2DA 3SCMD 5IBLD 1ZT7A 1KBGL 4NI6A 3MJ9L 1B0RA 2VO5A 5EBMA 3VSQA 1YPZA 3RIFF 1GC1H 2DQUH 3TESA 4FDWA 3GRWL 4GY4A 2P5PA 1KWKA 5C0FB 2EKJA 2EXYD 3CLEH 4PJ8C 4IBLT 5HYQA 1MFEH 1CK0L 1FJ1B 2WVVB 4MWFA 2GSGA 4JPKL 4DPAX 2EH8L 2CPCA 3E9UA 3KEDA 5DRXB 5TDNB 2FYYB 1G9NL 2GABA 2XN0A 3BN9D 5HDWA 4EDXA 4IK7A 2B20A 1BQHB 1XZWA 4UNTA 3HLKA 1IU1A 3FB6B 2NNRA 3KPRB 4JRXE 4W9GC 4YNYA 1OCZB 5EMYA 2BNUA 5DQJB 3ZKXB 3AQXA 4MJIE 4BRJA 2LV4A 4EZMA 3SDYH 2X4UA 3A3YB 2BNRD 2GJ6D 2Y7OA 5EZPA 5DHYA 1UC6A 1QRND 1L3NA 1OSPL 2K7QA 3R7RA 2X9ZA 5LBGA 2G30A 3QUYC 2L3BA 3T0ED 2EECA 3ARBA 4P23A 1SN5A 2AVFA 4LBEA 2Y5EA 4XP6H 5FYKH 4BK5C 3IMBA 4LSRL 2F1AA 3MCKA 2H3XC 3QZBA 3WBDA 3VWKB 2XCMC 2JJUA 2WINB 3Q01A 2XKNB 5FFLA 4UNIA 4XVJL 4J3TA 3PV6B 4PW4A 1MJ7H 4OKVB 4EDWH 4PI0A 1PIFA 2BVQB 2HYMA 1KACB 1IM3A 2F61A 2WMPB 4I0PA 3D0VB 3RVTD 3D3VE 3O6LH 4R2GC 1ZANH 1NC2B 4M6AA 2VE6A 2WQXA 3QDJA 5IQ9B 3G6JB 3QDGB 2K8QA 3ZE1E 2ZCHL 5HYIA 5IVXA 1M1XB 3S97C 2VLRB 4OLUH 2DMGA 4MKTA 1G7MA 1CVRA 4RX4D 1T0NA 3CDYA 4KKPA 1HOCB 2OMVB 3UTSE 3CZSA 4ZDHB 3RX8A 4YSCA 2JELL 3V95A 5D1QA 5AVXB 3UO1H 3LRMA 3MRLB 4JN1H 5HDBB 1VFOA 3HZKB 2J6EL 3WFDH 4KK5D 3I3BA 5MP6H 4JPWH 4J3OD 2FRGP 3FN0H 4AM0B 1E28A 3EJRA 5KVDL 4D0BB 5CWSB 5E56A 4F27A 4Y88A 3UTTA 1A3LL 1EMTL 2Z31D 3OX8A 2PR4H 2VN6A 3QWOB 3DMMB 2DWSA 5JPMA 3WFZA 4GBXC 5FO8A 3VFSB 4NO3A 4KO7A 5KYXB 4KI5D 4Y16A 1NCCH 2VXQL 5EWIL 1FGVL 4CVUA 4H5SB 4X5PA 5CHNA 4QXWA 4M02A 2EUXA 2OV0A 4P2QB 4KBPA 5LLIC 1ZK9A 4HSQA 5CSBA 3MNDA 4LVEA 3ARFC 4FFYA 4UZUA 3X14A 4BIKA 3RUGE 2ZKHH 1MQKH 2J4WL 5F9AC 1FFTB 3FAWA 1BZ8A 5LAXA 3V6ZB 2W07B 3NJHA 4E9LA 4NKOB 4AQEA 3ZYZA 3VXQA 4HV8A 2PW1B 2VZ1A 3KEHA 3IT8D 5AKTA 5IG7B 2HAZA 4YDLB 3KW8A 4OSUH 5JW5B 4PJAA 3KLQA 4EN3D 1K5NB 1QEWA 1U0QA 1NAKL 1OGAE 2CBQA 1XIWB 4HPYH 2UZXA 4X6BA 5TF1L 2Q2EB 4P5TB 3VXOA 3ML8A 1KN4H 3DX6A 3UEQA 1FAIH 3FQNB 5G4NA 2D4DA 5BW7C 2EDWA 4CMMB 4DEPB 3DX7A 2BIIA 4RFNB 4BBWA 1TZHB 3NZ8A 4FXKA 4UM9A 2JKTM 1TVBA 3ARBC 1MFNA 1M4KA 1WFJA 4Z78B 1XSJA 2WC7A 5SWSE 1I8MB 3NACL 5FK9A 4M3JA 2EVJA 1SDAB 2BWDA 3T77A 1UTDA 1IE4A 1KGUA 4HH8A 2ESVD 5C6TH 3WFBL 1L0XA 3C09B 1NC4D 5G4OA 1CLOL 4XWOD 1E5ZA 3RIKA 3O2DH 1KTLB 3FO1B 5ISZA 3VGGA 1L6XA 5LCVL 2J57A 4GIOA 4J3VA 2WNWA 1EDHA 1H3GA 1CDUA 1GJUA 3BZ4B 1Q9OB 3NGBC 4DSYA 4B9CA 4LF3B 4Q9RL 3ULSB 1G6RL 1DDHB 1WH0A 5E1HB 5IFAL 1YVLA 4RH4A 4RX4A 5GHWL 3CTTA 1N0XL 1WGOA 4RIRA 1H3PH 3V0HA 2O6PA 3FB7A 2FVNA 4Z7QE 4MQSB 3Q2CA 3B7UX 3WJMA 3WKYA 1IC1A 4U6HA 4F92B 5KANG 3T0DA 5I18H 1LHZA 1BVOA 1U3HA 2XOTA 4MZIA 4BYHA 5KAQF 2VRKA 3N0PB 4MRCA 4WFGE 1OOAA 1Z1WA 5F8RC 2LVEA 1H0DB 1NSNL 1AKJA 2XN9B 4V1DA 4E9TA 4YXHH 5C0BD 5DLMH 4QXUH 4FLHA 1DYZA 3LS5H 1QNIA 5AW8B 4NO2A 4GQ9H 1CLCA 1VRSA 1AMYA 4TV3A 2VH5L 2IVFC 1GMIA 1NBCA 1UZGA 4BKSC 2VJXA 4G82A 1BFVH 1S7WB 1YEHH 2OTUB 3ULUL 1GOFA 3LHPH 4PRPD 3I3DA 1YDPB 2NY5C 3Q8AA 3CSYA 3LZFH 5GRWA 1B4LA 1J10A 2P9RA 4UINH 2DIEA 3P40A 1T83A 3QK0A 4ODSH 3VG9B 4Z7AA 2K7PA 2IPKA 1HS6A 1QSFA 3T8XB 1YN6A 1PAZA 4G3YL 3CC1A 2CO7A 3LEVH 1V55B 5DWPA 3ZE0B 1EO8H 5KBMA 3MO1A 1J1OL 3GS7A 1V8HA 3U9UA 2HJKB 4LCIL 4NP9A 3ZT5A 1LK2A 3HG1A 4M4PA 4YHOH 1D5IH 4UYQA 3PHOB 5EN3A 4H8PA 1O75A 3RWIB 3VFOA 4G8FA 3VQ1C 4HYTB 5FOJA 2PWDA 4JFZH 1S7QB 4QRUA 4R0LA 4KRLB 5DMGD 5ALCH 3HNVL 3CK0H 5E94B 4NRXB 4U6YA 1UZ6E 3DOSB 2ZJSL 1N4XL 1T1ZA 1KB5H 1XXFC 3DJRA 4PS8A 1S7UB 4FMFA 2CDGB 4W81A 4MB4A 1Q0EA 3D12B 3RL2B 1NMBH 3TBSA 2BY3A 4YHIA 1KJVB 1IBYA 3H7BB 1VFMA 4JGNA 4FQJH 3PWLA 3GKWH 4FF9A 1PGRB 1SDDB 1GGBL 3EUUA 1WAEA 1S7VA 4HALA 2GTWB 5TDOB 3CHXA 5IFJA 1HQRA 1KFAL 2CIKB 4YEFA 1AP2B 2BIOA 2UXTA 4UUJA 1NBZA 4FQCL 2VW6A 4ZT1A 2JK5B 4X4XA 3EHBB 2GSMB 4DO5A 5A16A 3LEXA 4N3UA 1OTTC 1ULVA 1RXLA 1GKEA 1TJIL 3LZRA 1K5WA 2MSPA 4AVJA 1JGVL 1CDYA 5CHNB 3AT0A 3CDZB 1OGSA 3S36X 3IFPA 4HAGA 5D2NA 2AQTA 5H35A 5C97A 3FQ1A 3ZE0F 5J12C 3JV6B 3P9LA 1FNGB 4FKHA 4MQXC 1DBML 3DX4A 4FFZA 4M7KL 1C5DA 3MACL 2WVUA 5DJAA 2NY1C 1YY9C 4E9RA 5C8JB 2WZPA 4BDVA 4OUUA 1PVHA 4ENEC 5C0RL 2HKHL 3DI2B 3PABB 4CBZA 4AYEC 3BE1L 3BSZL 2GI0A 5HD8D 1IKFH 5DZVA 5HHMD 2J43A 3WE6A 3OAZK 3WS6A 3RP1A 3NJXA 3BYTA 2DYRB 3QG6A 5IM7A 3NJLA 5TE6L 4QRFA 3FZUD 5JR1L 2ZYIA 5IJBC 2C4XA 4W1TA 1NWOA 4PJ5D 3EO0A 2BSRA 1BJ1H 2WXIA 3DYMA 1EFXA 3GB7A 4PRAA 3MRPB 3UL4A 3CFKA 2EQDA 1RU9H 2QQNL 3GZQA 3HCVA 4KTYA 4WV1B 2WQAA 2I07B 1MFEL 1KY7A 2YAEA 4ZI8A 4NDMA 5JDJA 1QMUA 2DIJA 1N0LA 1PLGH 4XN5A 3BXNB 2J8UF 2MCPH 1M3JA 1HILA 2VE6B 2OR9L 1KELH 4G6MH 3OAYK 2F15A 5D4QA 2YPKB 2HH0H 1CD8A 2BRRL 2Q2LA 2WXFA 4K71B 4XVOA 4CNIA 1SJEA 3EG9A 5B4MD 2CLRA 2MQ3A 2M26A 4N0UE 1ZA6A 1D9KA 4PY7B 5FA3A 4DVRH 5JYLA 4JK0D 2R1WB 1I1AB 3LNEA 5GS0C 4FG0A 4GRWF 1CGSL 2IOOA 3A4DA 3VWKA 2JCCF 4UV7L 2CGRL 5GISH 1QLEL 2WO3B 4X5QA 1ZGLP 4B0MM 3GLZA 1AO7D 1W0VB 4JE4B 3SDDC 3OLEA 3UBGA 2F9BT 3V4VL 3WLWC 3L3OB 3H4HA 1U8HB 3UGUA 2MTPA 4KX9A 1JFHA 4J3SA 2AJUH 4AMXA 1UHVA 2VT0A 4HOXA 2KI6A 4I1PA 2V2TA 4FXGA 3DXAE 4P4RA 4XHJC 3BAEL 2YPLD 5KJ7E 1KSRA 3ZL2A 3PWPB 1CE6B 3U1SH 1HZLA 4JRFA 5BJTB 2X6VA 1C12B 4XC1L 3PDDA 5JOFB 1E40A 2BK8A 5F3HA 4E41D 3QDHA 4JG0L 4B0MB 1OE1A 5L4FA 3EJZC 1QVOA 1U42A 4GYBA 2NZIA 4CADA 3MRJB 1NDMB 2DEYX 5KSVB 4U3SA 3WY4A 1I3RB 2NY4D 3LHAA 4Q6IB 3RL1B 1AS6A 2NY2C 5D7SH 2JH2A 3CHPA 3ECUA 3KWWA 2V2TB 3VFVB 1F4WH 2N1TE 3PJSB 5CMAA 2FQEA 2F2HA 3GBDA 2H6PB 4JFEB 4JFUA 1FLRH 3M8OL 1R17A 2GTZB 4OLUL 1J9SA 3K6IA 2Z8VC 3W11D 3SDCD 3D87B 1NIEA 3D85D 4GBXB 1PS3A 2YGOA 4WNSA 2HWZH 3KCWA 2VNCA 1IQDB 4KY1H 4AQOA 3D69A 4I3GA 4RGNC 2JELH 4GXUN 2DAVA 4TNFA 2KKQA 4JN1L 4K07A 4L3FA 4F15C 4JG5A 3WFDL 5LBSH 4KPHH 3QE5A 4HMEA 4JPWL 1JHKL 5HI5C 5K9JH 4KMTL 2L8AA 3FCSA 4ODXA 3L9YA 4TUOB 3VRJB 1CD0A 4OGYH 4YZFF 2Y06H 5AZEL 5IBUB 2QBWA 4GG6F 5I24A 4IW4C 4DKDC 1A3LH 4QCIA 4XCCH 1QSED 1JNHA 2EXYC 4HEPG 3AREA 5IESL 4YFLI 2XBDA 5E9DA 1BZ7A 1I9RH 3S5LB 2VKXA 3QXDB 2XDHA 1QTSA 5IBUG 4ZFOL 1X5MA 1XF5A 4PRIE 5I8KL 2VXSH 3PQYA 5DDHA 2G2RA 3D09A 2B39A 4XB7A 3KPSD 3NEOA 2UX6A 4FTVD 4X6CB 3I9AA 1DQQB 1ZV5A 4XAKE 3NFNA 5JW4Q 3DMMD 4OZ4A 3TTYA 2IBBA 1JI1A 2PCPB 3L95B 4JO2H 2PPFA 4D8OA 2YPVA 3HMWL 4Y2LA 3S3BB 4BE5A 1DVYA 3EOAA 2FDBP 3X3GL 4M62L 5AW7B 4BSVB 3TIDA 3PFQA 1TU2B 3MV8D 3COOA 3UBFA 5BRZB 3V6FB 2GFBA 2ENSA 3TV3L 2VN4A 5AD0B 5ITBL 1AG6A 1NAKH 4FNQA 1CCZA 2W0FA 3FW6A 4P99A 4PJ6A 5E4EC 4EZJA 1XEUA 4LDEB 4PREA 1A7PL 3IDIB 1H8LA 4PVBA 1QASA 3P4NA 1ZLWK 4ETQB 3WAKA 3BVNA 3MYJB 2VLRD 1ND0B 2VZTA 1WRFA 4IRSC 4EKJA 4ACTA 2QGDA 1OF2A 4HUUA 1H15B 4I5BB 4S0HA 4JO3H 3QZWA 4YSSA 4EUPA 3DNKA 2EUWA 2GIYA 4NQEB 5FOBA 4U0QB 4F5CA 1AP2A 3FN9A 4IDJL 4IBQA 2ZX8A 3G08B 4GI6A 2HFEB 2I69A 5F9WC 2DQGH 2QMKA 1CDIA 4EIUA 2E9IA 3WD5H 3EJUA 4HIJA 3DJZA 1ACYH 3BWAA 2PXYB 4P2QE 4P4KC 1NFIA 1CBVL 4NBZB 1SM3H 3QZNA 4QJ3B 1BREA 5AL0A 5JNYB 3FO2B 1ACZA 3UPAA 5E8DH 3G04A 3KJ6L 5LBVA 1LEGA 3TBTB 4PLNC 3MOAH 4KK9D 4E9SA 1NL0H 3MLVH 2V5SA 4MD4A 2HPTA 2Z7ZA 1IGFL 2MPAL 4OJYA 5DK3A 3ZTNL 1DQQA 2NYYD 4ZMTA 3FU5A 1MCDA 5I18L 2BOBB 4W93A 5HXMA 3IBEA 1ZHNA 2J2ZA 1QYGH 2TRYA 3D48R 3WHE0 3CPUA 2DMBA 3BW9A 2IH3B 2CBOA 5HHPA 4CUCA 2FJHB 4IKNA 3PHAA 2ZKMX 4F15B 3F6LA 3HR6A 5DLML 4AZUA 1IEBA 4A66A 2BSSB 2P80D 4O2CA 3SPVA 4DEPC 4QF1B 3L9BA 4HIIB 1R3KA 4GKZA 2HG5A 3MGTB 1BAWA 2OZ4L 1MFBL 4LEXH 4PMEA 4O9HH 2L0DA 3UAJA 1CJYA 4XR8C 1FDLL 1MCJA 1JPTL 1O7VA 3CBKB 2XQYA 5DD6A 3S37X 3CZEA 1KGYE 4LLDB 3ARGB 1BFVL 4JQIA 4AVKA 3NA4A 3MJWA 3RDTB 3GSWB 1GVIA 3ZHDA 4YLBA 2XZAH 1T1WB 1I7ZA 1UA3A 4UINL 3UPRA 4FQQB 2DQMA 1SVBA 3QJZA 4JVUA 4GAGH 4Z7QB 1E9QA 2EACA 1YA5A 2EVIA 4O51A 1HZHH 2Y69B 4OLVL 1IZJA 3HI6L 3WUWB 1ZXQA 4BEIA 3UZEC 4QOKD 4AKPA 3ZX1A 4KROC 4MCYA 4YSUA 5ADPL 3N43B 3BUYA 3FKUS 5DRWB 4Y89A 3VWJC 3D39A 3SOTA 1ITBB 4UDUA 1A4JB 2WZAA 1PJ9A 4LFHD 4EKXA 4AMWA 3MRJA 4QTIH 3BSHA 4NIKB 3VXUA 4U1IB 1NPUA 1MW1A 2EDTA 1M53A 1OM9A 4MAYA 1M7UA 3H1ZA 4ZFZB 4JBSA 4OD1L 3QZMA 1BLNA 3TZVA 1ET7A 1CFTA 2H32A 3BUIA 1FLTX 1LP9B 3QDME 2AJZA 1AO7B 4N26A 3WDIA 3V5DA 4YBLC 4DP4X 2HLAB 2XRAL 1ZOXA 1BMGA 3FPXA 4JPVL 4O2EA 2XFXA 5ANMB 1WFUA 4TTDC 2J12B 3HHSA 1ORQB 1X6NA 3UDWA 1Z9SB 4YE4L 1BA9A 1NCIA 4WY7H 4N28A 4FQJL 5E70A 1REIA 2DL9A 5F7HA 1G7JB 3BWSA 4RDBA 1GGBH 2HG0A 2KPNA 5D7KD 5T1LD 3E1ZA 2WLHA 3KGSA 3IETB 2WXRA 4UZSA 4HEME 4FE9A 5LWYH 3BWZA 3BP7A 2AGJL 2PPCA 4HUMB 2BY1A 2XWEA 3ZZ1A 3QS3A 3KD4A 2AJ3A 4LQFL 4Z77A 3M45A 4YDVB 2X4RB 1AZZC 4JFHE 4Z3IA 5C3LD 2BERA 4CILA 3LN9A 2VW4A 2ODIA 1NBZB 3CFEB 3DDFA 3K6OA 1PZBA 4C4BA 4JQIL 4BA0A 1SOQA 1UH2A 4NPJA 4Y1SA 4C55A 3INOA 1AR1C 5FYLH 3BP4B 5KBLA 3WTSA 3PAYA 3M88A 4L3EB 4LLVA 3ILQC 1PBYA 3HNTH 1A6WH 4N1CA 1A64A 3UIZA 3TA3B 1XSOA 4XHQA 4X7SH 2HMIC 4YHIB 3EO0B 4JRLA 1M9WA 2FIRT 1OP9A 3KH3A 5I23A 4MDIB 3EDJA 3PRZA 3UCRA 4TUKL 1G9MC 2A83A 2XWRA 3F04A 5DK0B 1ODAA 4ZW8A 4GFXA 2XNAB 5EPMA 5H37H 4OF3A 2P5WA 3UJJH 3VGBA 3WENA 3VFUB 2W88A 3MZGB 3P73B 3TYFA 2GEEA 3OMZA 4L8DB 1ZLSH 3W37A 1FBIH 2J8HA 1KTDB 1V3LA 4RMQA 1JGDB 3DVGB 5KSAB 4MJ5B 3UC2A 4LOVA 1ICTA 1TZ8A 2HJKA 3QP3A 3WXVH 3CDZA 4OTXH 1PLGL 4NQCA 4M3HA 3D51A 2PTUA 3FONA 4LLUA 3TN0D 3BUBA 3O4OB 5ANMA 4GG8B 4ISVA 5DO2C 3TZVD 2XA3A 1VA9A 1PMYA 2W92A 4M1CC 1OD7A 1DQLH 4DVRL 4WCYL 1MCCA 2CO1A 3AS3A 4OFYA 2YEQA 2ITCB 2YOAA 1CFNB 1KXTA 2DYPA 4QO1B 1Q72L 5HGBB 3MGOA 2NPLX 4HGKC 3GBEA 1PLCA 4APXB 2X3AA 3NH7L 1NEZB 4KJPD 4NXSA 5J6HA 4PH8A 4DIXA 1DVXA 1AC6A 3L4XA 4HDIB 4G8GD 4OR1A 3SYQA 4ORZC 3BCDA 2YAOA 3MV7A 4XVTH 2R7EB 4JKWA 3LKRA 3U4EB 1OV8A 4G72B 3MAWA 5J6HB 4E42A 2H8PA 1W2KT 4TNEA 4HT1H 5CCJA 3FTGA 1P1VA 3FFOA 3KAAA 3T0EC 4E9QA 3EO1A 1Q38A 2QQLH