2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
b'HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Slc8a3
publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
3EADA 3FQ4A 3FSOA 2KLTA 3RB5A 3H6AA 2FWUA 3US9A 3E9TA 3RB7A 2QVKA 2DPKA 2KLSA 3E9UA 2FWSA 3GINA 2QVMA 2LT9A
chains in the Genus database with same CATH superfamily
5E99H 3C5ZB 4YDLC 1ES0B 4KO7A 2MCPL 5AG9A 5IQNA 1MJ8L 4NI3A 1BW8A 2OMTA 3LRKA 3LY6A 3MU3A 2DM3A 5FXCH 5BS0E 3SPVA 1RQ5A 1C12A 2RJMA 2ZWYA 3TBYA 1KBGL 2C3HA 1CLYH 3KCPB 4X6FA 5KAQG 1I3GL 1A3RH 5FKAB 2WKLA 2YGOA 3U0WH 3FF7A 1FL3A 3QO1A 4IKLA 3GLAA 1YY8B 1KJ2A 3TO4D 3BN9D 2ZXWB 4F33A 4YDKL 1R3JB 4S1RL 5FLVA 3L4CA 1RZQA 5DT1L 5T1MB 4EE2A 5C0EB 5K9KB 2FT6A 4FFZL 1UXSA 4HKXA 5IUCA 4NLAA 1S5HB 3AQYA 3FT4B 1DTUA 3KD4A 4H44C 1R75A 4MJID 4NIYE 3L3OB 4YSQA 3VI4F 4I0PD 3RWDA 4JR9H 3KPTA 3JV5A 5DS8B 3PAZA 5FDYA 4ECNA 5EF2A 4JQVA 4CNIA 4R2GB 3HLKA 5DRWA 1I1FB 1SYSA 1X4YA 2YR3A 2ZNXA 1EEUA 1L6ZA 1XCQA 4PJFE 4L4VA 3MN8A 4YIQB 1BIHA 1SOXA 1A4KB 4QTIH 3ECUA 4GKNA 1HYSD 1YEDA 3PG2A 4KKPA 4GRLC 3V0AC 5D2NA 5DMGC 3MNWA 2A6JA 4Q2ZA 3G9AB 2IH1B 4X6CB 2FR4B 2CHZA 3SKJL 1XF3A 4OFKA 3SE9H 3BP6A 4P5TB 4N2DA 4P0DA 4WGKA 1PSKL 5GRVK 2P5WD 3CX2A 2Y07L 3D07A 3FU0A 3KPRE 4OZHB 2VWEC 4LHQB 3Q6GH 1IGIH 4XMPL 1UM6H 3MMEB 4QHUB 2HMIC 2VABA 3NCYP 2ZYHA 2X9YA 5T1DH 5KG9B 1CVSC 5EEUA 2A73A 4B9FA 3G5YA 3OAZK 1JZ4A 4KVPA 1BM3L 5C0IB 5LGHL 1E9PB 1XSKA 3UJTL 1GGBL 3AVEA 4NFCA 4NO0A 1BQRA 3BPOC 4F7CA 2Z9TA 5I5RA 1MCEA 3RUGF 2IVFC 5C7XH 1UKSA 2UUDH 3GI9H 4A04A 1M2VA 2NUTA 2OV0A 4PB9L 1UXMA 4BQ6A 2YXMA 1OWRM 3QFJB 4KBPA 4BWWA 1LVEA 3DNKA 5DZLA 3A4AA 1FG2A 5K9OB 4JVUA 5HGDB 2BS9A 2JK5B 3EG9B 3L3DB 4FQCL 1HHHA 3WFEL 3CLWA 1WBXA 3O3DB 4YHNA 2BERA 3KYMA 3MBEB 4ATWA 4AEEA 3C5ZC 3MRHA 1UA7A 4UTBH 3OAYK 4XC3L 1HQRA 4TNEA 5DQ9B 5L0QB 2KERA 3MJ9L 2OQJB 3ZQ9A 1RXLA 5TDNB 4M4RA 3OF6A 1MJUH 1J5IA 5C0NC 2J56A 4QRQB 2AFNA 5C8JA 1EHXA 2QPUA 2FX8L 3QPXL 1ZJAA 1SFHA 2PCYA 3NUKA 5EB9A 2CGRL 1NFKA 3V0WH 1DANT 5L2KD 2ADGB 3QC6X 4L1DA 1ZLUK 3L3GB 5I5MA 5KW9H 3HZVB 4PGDA 1QBMH 2YQ3A 3VSTA 5BMFH 5E1IA 1WEJH 3I3EA 3L3OC 4KK6D 4G59C 1OTTC 1V7NL 1BLNA 3HZMA 4R2GC 4KO5A 5DJZB 4AY0A 3ZMEA 1OV8A 1MFAH 3ARUA 4NZDA 4K94L 4C4BA 4AV0A 1EGJH 3JT2A 5DJXB 4QRRB 1PW3A 1S46A 1BIIA 3NJKA 4HOZA 3GBNL 3QIWA 1FV1A 4YK4B 5DWUH 5HDWA 3TJEL 3TEWA 1AGDB 2PPEA 3EH3B 2XWBA 3GSOB 4WWKB 4PRPB 5C0AB 3L3HB 2FYYA 1IZJA 3PL6D 3T1WA 4LNVA 4JQIA 4E0RB 4P5TC 4NM4H 2VKWA 5GIRB 1JGUH 1CFNA 5DJDB 2XN1A 3TVMA 1FFTB 4L8SB 1NBYB 1O7SA 3TN0D 1LO3H 4LCVA 5I1GL 3HHMA 2VDOB 4F1ZA 3D18B 1AIFB 1B2WH 4WDIA 5GZND 3D06A 3I6KB 4S2SA 3IPBA 4DW2L 3WEBA 1EZUA 5IEKB 3S5LG 4YX2H 2LE9A 4HS6A 4WI2A 4PJCB 1IAIH 1BFTA 4PBWD 4A7GA 2J5LB 4C56D 2GTZB 5JIIA 4MNQE 3RWFB 1RJZB 4JX0A 3W9EB 4MKTA 1XIWB 1NMAH 1ONQA 2BK8A 2R4SL 2DDQH 2UWEB 1IBHA 3MV11 4NO5A 5D1ZA 5EUOF 5IB5A 4U6VL 2YD4A 1LK3L 4K4KA 4UV7H 5DJAA 1P1ZA 4G5ZH 5IQMA 1HNYA 4JFFE 1KJVA 1WBZA 4G6AC 4JG5A 5D7SH 2CMRL 2R2EB 4UOZA 5E7FA 1I1RA 4WUKH 3T0EB 1EDQA 4M43H 5KYUB 4X6DA 3VFTA 3VVVA 4AK1A 3NJJA 3MBEC 1LK2B 1HESA 1O9VA 1UWXK 4Q0XH 5E5MB 3FSOA 3SE3C 5T33L 4PGCA 2JI2A 1Z2KA 4RGND 3ZX1A 5L0QC 3LQAL 4X0KA 4JY6B 2B14A 4OR1A 5FIEA 2Q8AH 3N0AA 3BAXA 1CGVA 4TNWK 1XB3A 1WAEA 2PCPB 2VQTA 1IGFH 4WU5B 1R5IB 3NT0A 1U30A 1MCLA 4M9OA 4TMPA 4AIZA 1VPOH 4ZD3L 3VWJA 2BSSA 4OLYL 3CH8A 1CDGA 3HG1B 3TBBA 3C5XA 3JWOC 2XQYA 1E6JH 1JRHI 4JQIH 5L2JA 1F18A 3IJ8A 2EYTA 2OMVA 1ADWA 3BIAX 2E74C 4IOSA 2H1PH 4AENA 4WEUD 2LFGA 5AD0B 1XGYL 4EUPA 5GGRA 4YGVB 4PRBA 3QQ9D 5ALBL 1AZNA 1NKOA 1U6AL 3OMNB 3T0XA 2YPLE 4YK4C 2Z35A 4BH7A 1J10A 3FU8A 4MQSB 5CILL 5GRUL 1N3NA 3GD1C 5G4MA 3RA7L 4ADJA 4PV1C 3J07A 1TO5A 4HOMA 5CLZA 4F8NA 4XN4A 2CHXA 4IKNA 4Y4HB 4L8SC 4PRIA 3V4LA 1U3HD 5EA0H 2A5UA 2YEZB 1IM3D 4P57A 5EO9A 1NIEA 1ZTXH 2XN9A 3IPFA 3TBTB 5LN4A 3NSXA 2L7QA 1DHKA 1TZGH 2CLVB 3OHXB 3A47A 4KI5F 4WO4C 1MWOA 5C86A 4NBZB 1AGBB 5I8KH 1AMXA 1TYJA 5TFSH 1F86A 2MNWA 1WWBX 2J5LC 4YDVA 5F96L 2ZCHH 5D7JD 4QRPB 2R1YB 3VG0L 3IDIB 5I1HL 1XIWC 1DDHA 1Q9WA 2RIKA 1G6RA 5G55A 2UZIL 1DVYA 1CD1B 2QQQA 1JF1B 3WY4A 1RZFH 4X6CF 1I8IA 5KANG 5DHVB 3QRLA 4E2OA 5HI4D 4G2AA 1LLAA 4J4PD 3CMOL 1T83C 3M1BA 1X9UA 3NA4A 4OZHF 1RIUH 5DK0A 4EZMA 4ODSL 1XF5A 4FADA 3OGCB 1P5UB 3SE9L 4NZTL 1DSFL 4EKJA 1PYWB 3WIFA 5B1JA 3D25A 1AG6A 5C2BH 3BUYA 3LZRA 3TZVA 4UMSA 1KEGL 1M1SA 3WFBL 4EUPH 2PTVA 1BVKB 2OFQA 3LXAA 4ZS7L 4LVNB 1QATA 3MXVH 3VFUB 1H6TA 4Y88A 2ITDA 1T7VA 1U58A 1KBPA 3PDOA 4OCWH 3O3UN 4KQ3H 2FX7L 4OLXH 4P4RA 5T1KB 4GAGH 3BZ4A 2H6PA 3MLZL 4YSCA 2B7DT 4MCZA 1AZZC 5H8DA 4MNHA 2BHUA 4N20A 2W80C 5BW7C 5I8CA 1SY6L 1FFOA 2PWHA 1LO5A 2F08A 3EOAB 3PJSA 4XN8A 5E03A 3BUQA 2D03L 1ET8A 2VLRD 2DQEL 1KCBA 4IEFA 5CKAA 1LO0L 4YLQT 1XSIA 3CQQA 4PJ8A 2I07B 1Q9LB 1ZAGA 4YHLH 4D0CA 5IM7B 1T5KA 2CK0L 1T03H 4JLRA 2H47C 4XC1L 2E9GA 3GMMA 1A3LH 4Q6YA 3ZE0B 3VXNB 5KYYA 1UXWA 5FK9A 5FA3B 4PI2A 5TQ0L 1VFAB 4UV4H 1BHGA 1F0LA 3KWUA 1I7UA 1SXNA 2CDEB 4Y4HC 1B3IA 3MYJA 1WRFA 4F2MB 4ZX6A 1LM8V 3CSYA 3TT3H 2ADIA 1FFPA 1TFHA 4JRXD 1QLEL 3GXPA 3AXLB 3ETBJ 3OHXC 5D7LB 3CSFA 1MI5A 2GSIB 4W6WB 1TTBA 3JV0A 5D2LE 1PL3A 4JG1L 2DL9A 3PGCB 3E7JA 2ESVA 5HHVH 3ZU8A 4QUOA 4JO3H 1DQTA 3D09A 3BAYA 1I1YA 3GF8A 4DF9A 1F4XL 2WW8A 1TNNA 3AU0A 3E6HA 5KVFH 2ZAGA 1QRKA 2O4EA 4ELME 4XBPA 3S2AA 1KXQE 4RBPK 2GKIA 1GZPA 3TLRA 3NZUA 3EYSH 4OD2B 1S5IL 4RX4A 3GKWH 4I8DA 1CDYA 4LLWA 4U31A 1G7HA 4DCQB 3B8YA 3DV6B 3N04A 2EAEA 1OL0A 4U0RB 1OCOB 4PUBH 2V17L 4K3JL 4HJTA 1NANI 1CICD 5T1JA 1QLRB 3GRWH 4PJCF 1KC5L 3LN5B 2AABH 3ARBA 4FL4B 1JGEA 2VE6B 1IEBB 3UG3A 1U42A 1VZHA 4MHHG 4LVNC 2FHFA 2BHZA 2NNXA 2UWEF 4KDWA 3AY2A 4TLTA 4XHQA 2QKIA 4F7PB 4CBZA 3HVDA 4FKEA 2O6DA 4U3XA 1GH7A 1W80A 5EEYA 5ITFA 5L4IA 2K78A 4N0FA 4YFDB 4XP1L 1ZVSB 4M00A 3K81A 3L8QA 5AAMC 1VZIA 4OFDA 7PCYA 3WEXA 5ISZD 3OPZL 3QA3B 3M6DA 2ZXEB 3QUML 3UGEA 1XEUA 1RUKL 1WCBB 4FG2A 1OAZH 3CU7A 3TC9A 4G9DA 3HBGA 4L05A 1JVLA 4WFHD 4LVHB 5JXED 5I82A 4XPBL 2OMYB 4NFBA 4ONHB 3AS2A 2ZKHH 5INDA 1IEHA 4ALAC 4ZMWA 2BIOA 3GC3A 1WICA 4MAUH 1JI2A 1IEAB 2G75A 3EBHA 3L4XA 5DUML 1FGNH 1RJLA 2YGVA 4Y1AE 3SOBL 5I30L 3K71B 2QQLL 4LHUD 3JYBA 1RZ7H 3K6DA 4UNVA 1TOXA 2H8PA 2VXVL 3N1FC 3TCTA 5IUSA 1NFIA 1PD1A 3ELAT 1X5LA 4YS4A 5I1DA 2CXGA 2AJSL 2KT6A 1KTDA 4IDJL 1ASQA 4HEPG 3CFIC 4M7KL 2J73A 2QVKA 3KJ6H 3WN6A 2ZPKH 4FG0A 4BWTA 1AP2B 1PZ5B 2BX5A 4KKCC 1F13A 4Y9FA 2HJKB 4XNZC 4WF7A 3PHAA 4TS6A 3H9HB 5FYJH 3NCWA 1JHKL 1P4IH 1X5JA 5ITBH 3ULUE 4W9ZA 2EZ0C 3BZEA 3PFUA 3T3PE 2WCPA 1LWJA 5B39G 3B2DC 3HE7D 4NPJA 4Z5RA 4DZ8B 1YMHA 3CPLA 4P46A 4DSYA 3I9IA 3S88H 2H41A 1VF5C 3GSUB 3SE6A 1C9SA 2BOCA 1XH0A 4LSDA 5AW6B 3TIDA 1XBRA 4NKIH 1T7ZA 1QEXA 5INCB 3V4UL 3HZKA 4L4JA 3UBXA 1K4DB 2DBLL 3SQRA 4FL4C 4QXGH 5DO2C 1J1OH 3PWLA 4J3OC 5KZCB 1ZLWK 2OMTB 5CCHE 1DVQA 1EJOL 1PLGL 2Z4QA 5KVEH 3KXFD 3FYIB 4LARL 3KPNA 4P05A 3VD3A 3SPVB 3WKML 4A2MA 1C12B 4X4MA 3TBYB 4GRWF 1JVKA 4KTGA 1CS6A 1FL3B 2F7OA 5E5UB 1U91A 2GJPA 3FU3A 4F33B 4WWPA 3T0AA 1IAIM 3A4DA 2XTJC 1USZA 2Y24A 4EI6A 4HKXB 3VXMA 5D4HA 2H2PC 3QJTB 4LVHC 4Z3JA 4HH8A 3RWDB 4P2QD 1ACYL 3EH2A 2UVFA 4CNIB 1TVBA 3DYOA 5DRWB 1JK8B 1SYSB 3RNKB 3KL5A 4MWFB 1T20A 4Y1SA 5DO8A 5HYJD 2Y72A 3K74B 3FCGA 3WLWC 3P30L 2B0SL 4L4VB 1T1XA 2VKXA 1FNLA 2D0HA 3IF1A 4GKNB 1INDH 1YEDB 3EF7A 3CZLA 2DYSB 5F7AA 4QCIA 3MNWB 5AW3B 4Q2ZB 3MRIB 3UCRA 1URZA 3IDMB 4R4NC 4RSYA 1XF3B 1A3QA 1F4HA 5F7EH 3BP6B 2C1OA 3VAEA 2VAJA 1ODAA 5HJ3A 2A3TA 3HEIB 3LKSA 3QPKA 4OZFG 5DA0B 1E9QA 2NR6A 4OIFA 4I3GA 3PWJB 4N6QA 4LFHG 1BV8A 3RGVD 3MNMA 1NCBH 3Q1EA 5F1SA 2J2ZB 3FQUA 5JUEL 3WHE1 3IN2A 3N1MC 1HWWA 1KIRB 4JY5L 1N0LB 3NJIA 3LOWA 5DC4B 3UTZA 3G5ZA 5DDHB 2A73B 4AYID 4CC4C 4AMKL 2YD6A 1NOFA 3EO0A 5I1JL 2YXFA 3X11B 2V7NB 4U1HA 4N2FA 4F7CB 1XGPB 2YGNA 2ZOLB 2VZOA 4Y2OA 3F7RA 4P4KB 5DK3A 1B9ZA 2ZT9C 1THCA 1HL5A 3HNSL 1S9KC 2CCVA 2VXQA 5H2BA 4Y9CA 1A1MA 1FG2B 4MKMA 3UZEA 4CVZA 1ZHKB 2FK9A 2B39A 4OM1L 4UB0L 4LDLB 1DJZA 1HHHB 4DQOL 1F1AA 1QFWI 4ZUSB 1TUPA 2EO9A 1WBXB 3KYMB 1S3KH 1OCZB 3RIKA 1KCUL 5IV2A 2GYSA 2JCCE 1HKLH 2MIZA 2WVVA 5DFTA 4M6OH 4GAJL 2BVUA 4YE0A 1EK3A 2JKRM 2VMCA 2J6EH 1UB5A 4YXHH 1R3HA 2EXSA 4NNPL 5C8JB 3MUGB 2EIKB 4S1DC 1CXHA 2FTAA 3ZYZA 5BQ7A 3C8KB 5CBEA 3WS6A 1OB1B 1YUKB 2FJUB 4R97B 2Q6WB 3HG5A 3ZTDC 5IMKB 2PP9A 1UWEL 3GSRA 5C6PB 4YN3A 4LSUH 5BRPA 4MQ7A 1FNAA 4Y5XA 2OXGA 3NN8B 3FUFA 2VLKA 4U3HA 1K3ZA 1AKJD 1XGTA 3MRCA 2IALA 2XKUA 3ULUL 3L7EA 1JFQL 3HZMB 4JQVC 2ZKWA 3POHA 3QGVA 3S5YA 4G6FB 4XI5C 1CDIA 2CNYA 2K0RA 1G0DA 4J3OF 3ARDB 4P2YA 2YAHA 5E2JA 2Y3NA 5J3HC 3ZHNA 1HZHL 3QIWB 1FV1B 2X2IA 3QZWA 5CJQH 4HJ0C 5C08D 4WI9A 1XH3B 3ESPA 1UH2A 5I6XB 2XWBB 5D2NC 1FZJA 3EUUA 3T2LA 3D0LB 4HBCH 4XCNB 5E8PB 5LGJA 4OSUL 5FF6B 4OIIL 3EJTA 2NNAA 1E5BA 1Q94B 4JFPA 1QR1A 2VXQH 3EFFA 1OZUA 4L8DB 1T66C 3D05A 1JGLH 4AC4A 1EXUA 5AYUH 2VERA 4TULH 4MTMA 4X83A 3ULVD 1SXCA 4E9WA 4TRPH 3MUJA 3L5IA 1E67A 4HS6B 3TPUB 3IK2A 1FBIL 1EEYA 1ZANL 2AK1H 4F93B 1J0JA 4TLUA 3ZE1B 3ALPA 5L6YH 4NKOA 4I2XA 4M1GL 3I2CH 4P4KC 5DJCA 4F7KA 1AZUA 2F58L 4EZLA 2BNRD 2DJSA 5IB5B 3QNZA 5D1ZB 5JYMA 4LCUB 4IU2A 4UQ3A 3IFPA 3UAJD 4AYGA 1P1ZB 4K73A 3OD3A 1KJVB 1WBZB 3FFOA 4P5MA 3MZTA 3BSHA 5HYSG 2XU9A 1NM9A 1ZHBB 3PWNA 5EU6A 1ZA3A 5D7IE 1JPGB 2BY1A 2W0FA 1OCCB 4APXA 3VFTB 1I7TB 3CFUA 2CLZA 1Q0XH 4YFLI 1VRSA 3H0TB 3NZHH 4PGCB 3GFUA 4K7PL 3CVHA 2QVTA 4JDTH 1RURH 4JFXA 4X0KB 5C09E 1MVUA 2Y25A 3O3AA 1HOEA 2EDYA 3VA6A 1YAZA 3ZVVA 4ZX5A 2P8PB 1YC8A 3PQYA 1OGAA 2R0ZL 2PXYA 9PCYA 2G9HA 2VLJB 4R97C 2DD8H 1BYPA 5EIQA 3MX0A 1SHWA 3VWJB 1AC6A 2O6FA 1DJWA 5B3NA 1RK7A 1TCMA 1QRNB 1T0MA 3I85A 4MJIE 1L9TA 5AG8A 5L2JB 3BISA 1MLCA 2EYTB 2OMVB 3V0HA 4CKQA 4AENB 1AH1A 1SXSA 1SMDA 4JHBA 4PI0A 3QHZH 4OLWH 3TNMA 4POYA 2B2XL 5IESL 3KPSB 2ICEB 4WI6A 3MV01 1B0IA 2F5AL 3KG5A 4U1MA 1OVZA 5D96B 3QIWC 5CD3B 4BH7B 5I6XC 2Y7QA 1ZHLB 2WY3B 3RU8L 1KELL 5E9DB 1I9IL 4ERSH 4Z7UB 1EO8H 4HC1H 3AXIA 4LOUD 1N6QL 1LXMA 3FTYA 5ID1B 1WVZA 4PRIB 1J1PH 1WC7A 4I0KA 5EO9B 3CFKA 4PV9A 3TBSB 4OI7A 1DL7L 4QTHA 4TF4A 2VR9A 5T3ZH 1KBWA 4L8CA 1H8OA 3LEYH 3AC0A 5E1QA 4HIXH 2OSWA 1R3IL 4KOBA 1ZWIA 2IADA 1FYTD 5ESAA 3MLVH 4R26H 4XBEL 1YJDH 2K7QA 4FHKA 1Q9OA 4YDVB 4F5CA 2GCYA 4RMBA 1I8KA 1FL5A 3Q8CA 4O02L 3QJUB 1SXZA 5KS9F 5FM4A 2J1XA 1JXGA 1DDHB 4G80B 3L1FA 5EU4A 1Q9WB 1ET5A 5D1ZC 4DK5A 1JZ3A 3SYOA 4DZBA 2WBWB 1ZIBA 4JN2A 1MNNA 5EH1A 1IMHC 2DWXA 5E2UL 1KNOA 1E5CA 2CIIA 5CZKA 2X10A 2P8LA 4XOEA 4NBXB 2VM4A 3V4PH 1OAQL 5CJOL 4AW4A 5LXVA 4FYSA 1XF5B 1P5VB 2A0LC 4JHUA 3T09A 1A14H 4YNYA 3CE1A 4UUJA 4QKXB 3ZO9A 3WIFB 4WKXA 2ZXCA 3D25B 2VDMB 1FAIL 1TTAA 4LKCA 4BZ1L 4PP1C 1DQLL 3TYGL 3WTYA 1C5CH 2B1OA 2NY6D 3PWUA 2YKLH 4TUKH 2Y69B 4PWGA 3EOTL 4PWFA 4H2CA 2BNQD 3BAEL 1U58B 2BXZA 3PDOB 1XDTT 4H8VA 4LKXB 3VWJC 1I7RB 4G43B 4P4RB 4NWTL 1BF5A 5EO0B 4IQHA 1RFDH 3BZ4B 2H6PB 4RETB 2VZSA 5F3BB 4Z7QB 5K59E 4OQTL 4WW2A 4FERA 1FFOB 1LO5B 1U36A 2FQFA 4JFZL 4U7SA 2PR4L 5J57B 4IEFB 1W9XA 4V33A 3F7VA 4FQPA 3VU2A 3B8SA 4EN3D 5HYIA 3O6ML 1NFDF 2ICEC 4WCYL 1QI4A 5D96C 1V5JA 2AANA 4JLRB 3O2DA 3LSOA 3BZFB 1UXWB 3NSFA 1JRHL 2XNAA 1N64L 2Q0ZX 1MCPL 3PLYA 4PJBF 5FK9B 2C4FU 4HLEA 4D9QE 3S37H 1N8ZA 1ZA6A 2P80A 3BDYL 3NIDB 4KK5D 4LCWB 4NUPA 4E9RA 3T2PA 4JPIA 2YAEA 3BFQG 3MYJB 4J3WA 2OL3L 1RZ8A 4KXZI 4Q4EA 4XNUL 1QSED 4J12A 3QCVH 3CN3A 1SNRA 1Q72L 4TSAL 3SY0B 3IPEA 1MI5B 3GK8L 2JTDA 1U93A 3CFJA 5JW4R 4ZBJA 4E42A 5DD1L 1FI8C 3KWVA 3WMPA 3T1FB 2OS7A 2E75C 1I1YB 1JXDA 3EJJX 3HBQA 2X4QB 5DTFA 3VX0A 5E95B 1WAAE 2QL1A 3NJMA 2J72A 1J5DA 4WTWA 1D3CA 5F3FA 4XBPB 1WIUA 3HW7A 5JDSA 4P9MH 1GZPB 1YG9A 3BAIA 3KPMB 2G3MA 4UTCA 1PD6A 3FYEB 4N5EC 2WSKA 1G7HB 1WS7A 1Y18A 1FPTH 4ZTPL 4P06A 4OVVA 1F3DJ 4P2OA 5GRXG 5AZUA 1RERA 5B1JC 4DUVA 1XL4A 3MUHL 2NY1D 2PP8A 1ZPLA 4U7MA 4ZSOA 2DJUA 5IBUB 2Z93A 2WPGA 1P9MC 3FO2A 4JRLA 3UYRL 1JGEB 3ZE1F 1PG7L 1KMGA 1WYJA 3RIFF 2AI0L 4HUUA 4X8GA 3E3QE 4FOMA 2ZG2A 1GXEA 2D8KA 12E8L 4MA7L 4TVPH 5ITFB 1OP9A 5SX4H 3SDYH 2R2BB 3VFNA 2PCFB 1BD2D 2XFXB 4NSKA 1F1GA 5D7KD 1R33A 3WEXB 5FB8A 2C1PB 4DEUA 3DYMA 3NACH 2FCBA 4QOKA 3W9DA 1VGKA 2WKOA 2XX0A 1ED3A 4NQVA 4G9DB 1G7MA 4ZFGH 3I6LE 4UBDD 4CVUA 4O9HH 1A7RL 5DD0H 2YFNA 3N5AA 2P7TA 2VJ8A 5INDB 3EHBB 4PAZA 4Q9BA 4RFNB 3KR3L 3GS0A 2YPKA 2ENSA 3PXLA 5TJWK 3AGVA 1MDAA 3G9VA 1UKTA 2ZUXA 4PRDB 5IB4A 4MDJB 1ADQH 4R7NA 1KG0A 3T2NL 5FFGA 5HVFB 5F9JA 2H8PB 5GHWH 5EZLA 5FYJD 1NFIB 1RKRA 1SDDA 5BZWA 4EIZC 3S48A 3LX9A 5I1DB 1DVSA 5D1XD 1RIVL 5SX5H 1KTDB 2FL5A 1LYQA 4X9YA 4L0YA 3NFSL 4FI8A 3OXRA 4WY7H 1CU4L 2VDLH 3KYKH 4AJVA 3B7UX 3OJVC 4F3FA 1RHHA 5BV7H 4JO1H 3I6GA 4RAUB 3FQTA 3VGHA 1N9PA 4Z7UF 1F4YH 3S5LA 4J3SA 4HSAC 3JT0A 3VI3E 2YAPA 1MCOH 4K7FB 5GJSL 4ZXBA 2EIZA 1MEXL 2XZCL 3J2PA 2DH2A 3BZEB 2AQTA 2D7TH 1NAMA 3CN1A 4Q6IA 5B22A 5IROD 2OR7A 1DE4A 4Z5RB 1YMHB 1M6OA 4P46B 4KTDL 3N91A 3L2LA 5C9JA 2Z31D 5D1QA 2ZICA 2BOCB 2NLJA 1YQVH 3TIDB 1UD4A 2X9WA 2CIKA 2ATKA 5KSVB 4JGMA 5AYQA 1A6VH 3GMOA 1AI1L 1OP3K 3PWLB 3OKEA 4B9YA 2GHZA 2DY2A 2VR7A 1U4EA 3QRGL 3FT2A 2PYEB 2XXGA 2Z4QB 3N85L 3GHBL 4MB4A 5CUSH 3T2QA 3KPNB 3HE6B 1R24A 1E40A 4AYDC 1KULA 3T6XA 2OMNA 2DM7A 2EE2A 4IM8A 4BFFA 1RZGA 4S0SD 2IPTL 1T2JA 4HJGA 4U1NA 2K4WA 4UT7L 1I8UA 2YD5A 4P3WA 2XN2A 4N2KA 3IETB 5E00A 1QACA 4GQ9L 2BS8A 4EI6B 1SJEB 4GRWH 3VXMB 4QXTA 2Q5BA 3WG7B 1MF2H 2OMXB 5DR5H 1RPKA 5BQDA 4A2FA 3EHBC 4RFNC 5K9JH 4JN1H 4KKLC 1TVBB 2QHRH 2XSKA 3D52A 5CHNB 2NY5H 4OFYA 2ARWA 2LOEA 1QYGH 3DI3B 3VYNA 3MRDA 4PG9A 3TYFA 2X41A 3NCJL 1S7QA 3NG5A 1T1XB 4JRXE 4DKFH 3SJVA 2BC4A 1EAOA 4X5RA 2MOGA 4JFEA 4ZDHA 3ZZLA 4FMFA 4P59L 4Z7QF 2JB5L 5EZOH 3CFMA 2IMMA 3RVXC 4DP0X 4QDGA 2C1OB 3EDEA 3ZLQC 3D3VE 1E9QB 3FT0A 1EAPB 5E08L 2WLIA 4Y8DC 2EE0A 3FQUB 1DBAH 1LP9A 2WOYA 2WNKA 3MHZA 3QXWA 4K55A 1UZ6F 3CSGA 3ROLA 3UTZB 4LU5H 2EXYD 3G5ZB 3ML8A 1EEQA 4B50A 3C5JA 4YLCA 1HAWA 1NGXA 3EO0B 1YPZB 3CSBA 3HUJE 2NNCA 1TIUA 2EDKA 1F2QA 2VITA 5FGCB 1MCFA 3NIDF 3VRLE 3KPOA 4LAQH 3CHQA 2WYZA 4Z7VE 5H2BB 2IWGA 2O5YL 4DTGH 2YRBA 2LGNA 4PRHD 1IT9L 1GZQA 4P46C 2DH3A 3DRTA 2EYRA 5ANMB 5GJTH 3OAWA 4CU8A 4ZS6C 5KN5A 3GSVB 4G72B 4K5MA 3ABLB 5A2BA 2JKSA 4TOYH 1MVYA 4XOBA 5IV2B 5I6MA 1ZGLA 3VFWA 1QFHA 4GSUA 4R96B 3BSZL 2WVVB 1LNUA 1EO7A 1BEYH 3QHFH 4HOXA 4XWGL 3TA3B 1BLIA 5TTRA 3DX6A 5HTSA 4XMWA 4U6HB 2GT9B 2GTWA 2YRZA 4XHJD 3VQMA 1NCAH 1RUMH 4HHAB 4V2BA 4K8RD 4TNVF 5BQ7B 5DZAA 1BCIA 1S8DA 5CBEB 3BWUC 2XWJA 1TTUA 1DCLA 3S3CB 1V3LA 3MUUA 2QGDA 2VZ3A 4TYUA 4WUUA 2QQNL 3QXAA 2LABA 3AXHA 5C70A 4Y5XB 1D2OA 4FNUA 5E4EB 4XMTA 3FBKA 2WP3O 4BFBD 2VLKB 2I69A 1JV5B 1QSFA 4DGYH 3RPIA 3S0PA 1XGTB 3MRCB 2IALB 2JJUA 1VAHA 3Q2NA 3LPWA 2FEEI 4FQ1L 4KJYB 1MCJA 5K93A 3FL7A 4MNGA 1NUDA 4TUOA 2ED9A 4JKNA 3HC0B 1NJ9B 1PAZA 3UZVA 2J1WA 3I50L 2VUYA 4PWHA 2DLTA 1FZJB 3ATDA 5JW5A 5IZ7A 3UC0H 5FYKD 4UQ2A 4GSDL 1KTBA 3JWNC 4JFPB 1BYOA 1K5NA 4NOBA 5SWQA 2BIHA 5DQJA 1JMZA 3IDXL 4M1DH 1H3WM 2C3GA 4AEFA 3H4FA 4JVPA 3GZPA 2YBRA 4FGMA 3JV6B 1KWGA 1EXUB 2ZJSL 2YS4A 1WFUA 3ZBMA 1S7WA 1Z3GL 1UT9A 4OLUH 3REWA 4GLRH 4B96A 5JR1L 3PJLA 2EEDA 1YEFH 2G3ZA 2WSPA 2P4AB 1EEYB 2J5WA 1XZWA 3V5HA 4YE4L 3LZLA 2YXVA 3MV8D 2BDNH 4GRLD 4WU7B 5DMGD 3VJ6A 5DJCB 5LQBH 5MENB 5TF1L 2FGWL 2VXTH 5CKGA 2ZUTA 4DKAA 1A0QH 1ZSDA 2WJ7A 3LRGA 4IU2B 3CDZA 4UQ3B 4GKSA 5CIPH 4PWEA 2JV6A 1TMQA 4XNAA 3UIZA 2X44D 5LBSL 3UZEC 3VNYA 2G3NA 3UO1H 2GJ6D 3LH2L 5EU6B 1ZA3B 5KYYB 2HMID 3W2DL 2W0FB 1P4LA 2VIRA 2YA1A 1ETZA 1A2YA 3CH1B 1QUPA 3GIZL 2CLZB 3E8UH 4GW1A 4PJGB 1FLTX 5TDPA 4UQAA 4LQFH 2DQIL 3LV3B 4G6JH 5BZDB 3CVHB 5EHFA 3TA3C 2QPSA 1WITA 4JFXB 2J21A 3UPAA 3R7RA 1B4JL 3V6FA 3HZ3A 4KV5F 1YDPA 2E9JA 5E0FA 4BFEA 2ZCLL 1OGAB 2PXYB 3GJEB 3WS6C 3MX0B 1MAML 1QFWL 4X50A 2E47A 4LL1A 5IFHL 4I18A 2AEQL 5KJRL 2I60L 1A65A 4Y5XC 5E4EC 3W56A 4OJEH 1MRCH 5T3XD 1I1CA 2W65A 4P2QE 5FUCE 2BIQA 3C5ZD 2DQCH 3H42H 1MLCB 4AEIH 2E9BA 4DEPB 5HYJE 3OSKA 1NIAA 3THMH 1GS8A 5CSBA 5I26A 2Y5TA 4IU3A 4J6RH 3RX8A 5IB2A 3JWDC 4AL8H 1BX2B 5C0ND 3JTTB 3P3TA 5TE6L 4DPRA 3F7KA 1RZJL 2NY7H 1YA5A 2Y7QB 4H4NA 4ENZA 5LXGH 1IGYA 1E50A 1ZY9A 4M29A 4KPHL 4P9HC 5CJBA 3ZRFC 5GS0H 1M4KA 3ABZA 3F7YB 3HS9A 2YMXH 4ABQA 2FBRA 3BKYL 5KBLA 5JPNA 5JIQA 3U2IA 4GUPA 1PQZA 1WC7B 4WWID 4GB9A 4PW4A 3RGHA 1OTTD 3D33A 3CFKB 1XD0A 5DZNA 2IG2H 1JNLL 4HAFA 1GJUA 4M7LL 4PSRA 4R2GD 4LEBA 4TQIA 3N9GL 4X0NA 2UXVA 2MRYA 1Q4NX 3LMJH 1EXHA 2IADB 5ESAB 3TU6A 4IGBA 2HVKA 4GY4A 2VAAB 5E8EB 2GCYB 3FUMA 1FL5B 1S3RA 2I26N 3PWPE 2CUMA 2BWQA 1T22A 4HPOH 5LCVL 2X6BA 1I8LA 3C5SA 4HEPA 5EU4B 4ZMAT 4NQTA 4RRPG 3FB5A 4P5TD 2VLME 1EBAA 4QRUA 4XZ4A 1HI6B 4XN9A 3WOVA 1MWAA 3UTTE 4NIKB 3NIFE 1KNOB 4AV4A 1NC2A 5HDBB 2P8LB 3U1SL 4GG8A 3CVIL 1QFUH 3B83A 5FFLA 2WMPB 3MBXL 4KTYA 4RA0C 1CE1H 3II3A 3BGFB 2E0PA 4UUJB 4LVOB 5B39A 4OAWA 5KSAA 1YPZF 1XXDC 3PWUB 1YECL 2R2HA 5AZEL 3QFJD 1UOWA 2PXYC 3GS4A 3SGDI 4G6AD 4KY1H 1JP5A 4HIIB 2AVFA 4D9LH 2ATAA 1BZEA 3MA7A 5I1KH 3BOVA 3P4MB 1I9RL 2LTQB 3DHUA 1SM3L 2VM3A 3X1BA 2X6UA 1CL7H 5LAPA 3MBED 4BKTC 4ODWB 4XPTH 1JWMA 4KQ4H 2R69H 4WW2B 2P5ED 1PKQA 1J11A 2B20A 2VH5H 1UCBL 3R06A 5FCSH 3Q01A 3T65A 3ZE2B 1J8SA 1FIGH 1UM4H 2ENPA 2ZF9A 3U0WL 3F7VB 2BXYA 4FXGB 1G7JA 2OTUA 4H20L 5C08E 4U2YA 1P0SE 2WLKA 4JHWH 3QWNA 3EFOA 4BZ2L 2H1XA 5IQ9A 2R29L 1IGTB 3ARTA 4JHAL 4RWYH 5H35B 2CBTA 2KLRA 2XNAB 2Y1ZA 1FH2A 2O1AA 2YD2A 4QI3A 2XWXA 1N8ZB 5ABAA 1CGUA 2ZCKL 4GO6B 2WJ5A 1A7QL 4JPIB 2FLRT 3ULVE 1FLRH 1DQIA 1C16A 3FRUB 2C34A 4GSXA 4KGLA 1X5IA 2C7FA 5CR1A 4HLZH 3MOAH 1U93B 2HFTA 3HG3A 4QRRD 3F84A 1E27A 2AJYH 3MLUL 1MCCA 1XX9C 1B0WA 5E1AA 2FLBT 4PB0H 1QP1A 4H1LG 4NHUA 4PRPD 1NBQA 5C0AD 4TVUA 4Y2DA 4OZFA 4JJOA 4H0GA 4G5AA 3K1KC 4FQQA 4NCC1 1JHLH 2HX9A 2K3TA 4ISVA 5E8DL 1GYAA 5D72L 5JDSB 2GJZB 3KLAB 4JGNA 4MYPA 5ETUA 3SGJA 3VXSE 4Z8FH 3HMXL 1OE2A 4Y4KA 2YQ2A 3HG0A 3K6OA 1XGQA 1DQJA 1SHXA 2B5IB 1Y18B 4WO4D 2Z6FA 2HJLA 2SEBA 4ETQA 5C0DB 2WLZA 2JWYA 3BGFC 3NK4A 3K6FA 2YRLA 2TRHA 4P2OB 5C7ZA 1NMBH 4LVOC 4OH2A 1QR4A 2F53A 1JG9A 4Y7OC 1XIWD 3NJVA 2Z93B 4Y19A 1KIQB 3EIFA 3FO2B 2O5ZL 1PX4A 3KBEA 4BKLB 1BZ7B 4R3SA 4CGTA 4MASA 4HUUB 4DP2X 1BG1A 1O9WA 2QPDB 1RD6A 2NXZB 4KVCL 4UTBL 4XNYL 3V5KA 2EO1A 3QJRB 1C5DB 2LTQC 4MLSA 3VW3H 2FATL 4ZUUA 2HH0H 1L4IA 2DIBA 3SDXA 3VFNB 4WW2C 1J86A 3UABA 4NSKB 1JYWA 1ZTXE 3HHSA 3RVVC 5FB8B 1BQLH 4UT6H 4PJGF 5FYKU 3ZL1A 4FXGC 4LEXL 4JKPL 4QOKB 3QZPA 1KCSH 4FE9A 4FA7B 1VGKB 2VZUA 3ESOA 1AY1L 1ED3B 4HCRA 3DIFB 4NQVB 2CJSA 2YPVH 3LZNA 4YWGL 1IBYA 2YQBA 2P7TB 3HG1D 1E28A 2Q20A 4NN6B 1WFMA 3QVAA 1FO0B 1HHGA 2YPKB 3FUNA 3MV9E 3O4LA 3EJYC 3QJQB 3QUKA 4RH4A 3B5HA 5IB4B 4PJ5A 4DUWA 3ECQA 4HUVA 5DJYB 1BMGA 5HVWA 1CLCA 1NUGA 5AVUB 1QHQA 5F7KC 1SDDB 5BZWB 3WY2A 4D7PA 4NAMA 4PJAF 2G0KA 4Y5YA 2J57A 3HMWH 1MFCH 1Y7VA 3SPIA 1OCWH 1R3LA 4PWJA 5IVXE 1BFOB 3IAQA 5DHEA 2BSED 1GPOH 1HEHC 1SEQL 4WEBH 2JNZA 1RHHB 4X4ZA 2ARJB 3CXHK 1N0XL 3FQTB 1WGOA 4K9EC 2J8HA 4Y4HD 1XL6A 3PHOB 5DRZA 1ETA1 4DFHA 4I5BA 3S5LB 2W1NA 4ODHH 2FRGP 1Q90A 3EH1A 1A6AA 2EIZB 3CFDA 5DUPH 4E9VA 2B5IC 2UZXA 1SXAA 3G5VA 2ERJB 3UJJL 4NNXA 2ICCA 4PJ7B 4Q6IB 4XNXH 1DE4B 5JW4Q 1TXKA 1CFTA 1M6OB 1NMAL 1LE9B 4P2OC 1QLFA 4LOVA 3EADA 3A5VA 5C9JB 2B08A 5D1QB 5EORH 1ZSHA 2NLJB 3FB8A 5H37G 5EO1A 1A6PA 3V0JA 4CJ0A 1KJMA 5D7SL 4K7PX 5CLTA 2W9DH 5HYSA 3MBWB 3ULVL 4Y4FA 3RILA 2Y1AA 2WAQA 5DHDA 4KKAC 4HCRH 1CYWA 2MOQA 1BZ9A 4M6MH 4A2GA 1ZLEA 2YD7A 3BHBA 4FTVE 2NXZC 3X1GA 1DQDL 1FNFA 3VXQB 2CKBA 4G8GE 1R24B 3MCLH 2NX5A 3CCHA 3NIGB 2W07A 2YK1L 4YGAB 2N7SA 2Q8AL 2A83B 4Z0BL 2ZWLT 3DOSA 4HG4K 5D9SA 4LSRL 1ZV5A 3BIBX 2O6PA 1JDCA 1ZE3C 2X28A 3KEDA 3O0RL 5HGBA 4DKEH 4G42A 1ZGLM 4WZ9A 5E00B 3T3MF 5B3JF 1ZT1A 4QXTB 1HOCA 5LVEA 5CCGE 1E4XL 1MREH 2VDPH 3EDJA 5T1KD 1G9NL 3RTQA 2P9RA 4NENB 1JERA 4NN6C 5KVFE 4JNXA 5B7FA 2ZG1A 3MRDB 4PG9B 2H1PL 1WFTA 1QSEE 1QTSA 2HUHA 3TM6A 2JIXB 4BUQA 3SJVB 2BC4B 4QPEA 4RGOH 5KWYC 3DKHA 4ZZFA 4JFEB 4PJDB 4X9IA 1HH9A 3DGCR 1YEJH 2X4PB 5J13B 1GC1H 5JMRA 3ZE2F 3L2MA 2Q76A 1R17A 4AW7A 5AW2B 2WLIB 2EYSB 2WYIA 3WFZA 1KFAL 1KZQA 2KUTA 5E4AA 3CPUA 4X9FA 4GUOA 1PFCA 5IIEB 1UB6A 1TETL 3QZBA 4OJYA 3C5JB 1JVOA 5ILTH 3FQYA 1TZGL 3GRBA 1H3UA 4EVNB 5HPMA 2AQ2A 4NQDE 3S34H 2VITB 2IANA 3F85A 3OHMB 3SZ6A 2XT1B 3QP3A 4ZXBC 3MRNB 1FA4A 1J1XH 5D7LD 4L1HA 4R4BB 1PZUB 3E6FB 2ERJC 3D8MA 4Q6IC 3D4CA 2R51A 5I9QB 1GZQB 2HRPL 4GXVH 3DX4A 2E9WA 4TQHA 3T8MA 3VMPA 3ZDXB 3MROB 1GIGH 5A1AA 5D1QC 4R90H 3IU4H 3DX7A 4ZMXA 3TFKC 3ROOB 4S1QH 1KWKA 2FH8A 1RLWA 3I84A 4WI5A 1VDGA 2DEXX 2YOCA 4KKCD 5KN5B 4E41D 4JFUA 3INOA 5F7UA 4KO9A 5DI8A 3S36L 1CTMA 4IKJA 4UIMB 2ZX8A 3P2TA 3VMNA 3HR5A 3MRLB 1D7CA 1NGQL 1NFAA 5SX4I 2EZ0D 1TZIA 3QWRA 4G8AC 3BH8A 2GTWB 5HVGB 1XBDA 5KVGH 4XVUC 1IC0A 3FTVA 2XWJB 5BOZG 3CLFH 3QO0A 1BAFH 2JJSC 1YZZA 4GAYA 4OZ4B 4PREB 3U4KA 4WUUB 3QXAB 3L5XH 3NRPA 4HOWA 2AP2A 2XG4B 4AJYV 1JAEA 4DIXA 2EUXA 5DJ8A 4W6XB 4GJTB 1QSFB 4GAGL 5DO2D 5KJ4A 4J3OD 1EHLL 2R15A 5IBLC 5EBLA 4EQ3A 5CZRA 3ZDZB 1AQDA 4DQAA 3K5RA 3EBAA 1GMEA 3ECVA 4TUOB 4HG4J 3RFRA 3UZVB 5FYJE 3VM7A 1SXBA 1EZVY 1R34A 2J1KA 3HRZB 3QIUA 3T8XA 3NCYS 4MRCA 5D1XE 3TV3L 1LHZA 5AVZB 5JW5B 1A6UH 1T03L 1A8ZA 1IFGA 2QVIA 1HEZA 1R5VA 3HS0A 2XTJD 4HYTB 5J13C 2AMUA 1GW6A 4QRSA 2W9EH 4F15C 1OCRB 3N43B 5DEZA 4ZW8A 2H2PD 1RULL 3DMMA 2BY0A 2GUYA 1E90A 1YEHH 4JPWH 1M7DB 2YBRB 5F1IB 1UGNA 4KKBC 3EO9L 1S7WB 5AB1A 3REWB 3S3BB 2DQJH 3TT3L 3WLWD 1JXJA 4M4PA 3CC1A 1QBLL 2TAAA 3ABGA 2CHWA 3O8XA 4LP8A 3WS3A 4MJJA 4FA6A 3HC4L 3DX2A 4NAQA 3VJ6B 1ODUA 4N0UE 2HKFL 1XSOA 4MVBC 2ZX6A 4H7VA 2EH7L 4R4ND 2XJKA 1KBGH 4GI8A 4DP1X 4TNWF 1TEYA 4AQAA 1I3GH 1WFIA 1TZHA 5I9QC 4ZODA 4GKSB 1XHHA 2YKKA 3V9FA 1GTFA 3X17A 2IV9A 3CGTA 3H54A 2EEBA 2CLRA 4XMKH 5AVYB 3MCKA 1G4RA 4S1RH 4XN7A 3BUIA 2FIKA 5DT1H 5C0CE 3D39A 1P4LB 1T2XA 2VIRB 3H1ZA 4JJ5A 4FFZH 3NQKA 5F6HI 1QW9A 3S96B 1ETZB 1GR7A 1A2YB 3KYNA 4GW1B 3CBJB 2EC9U 3D5OF 2Q10A 2RBLA 2YSTA 3MJ9A 4DO6A 5AYTA 3TCLA 1PG7X 1UZ8B 4QYAA 4S0HA 2LAAA 4WI4A 5CBAB 4X7EC 2HKAA 1HCYA 1OD9A 4B9JA 1OE3A 3RJQB 4N2NA 4NRYA 4XBGA 1D5IL 2DWYA 3VI4E 5FW6A 1NDTA 4R83A 1LQSR 2UVEA 4PS7A 4ZMNA 1JZJA 2AF2A 1BQUA 4PJ7F 3IS0X 4W9GC 3I9AA 3K4ZA 3SKJH 5HDOA 4MAYA 4O2EB 3VGAB 5LDSA 4LT7A 2W65B 1PSKH 5JIHA 4F8LA 2Y07H 3FAXA 2HFEB 4X5QA 1G5AA 3AABA 4N22A 4KNTA 3IXTA 4XMPH 5KZCD 3WO3B 1JPTL 1ZCRA 2J8UF 1CGXA 1QO3B 3P2DA 4MJ4A 2AJUL 3QJHA 3QW9A 1D6VL 2EP6A 4XMXA 1BM3H 4S1DD 1IBBA 1GGBH 1A9EA 1A5FL 1Z0MA 1UTDA 1A1OB 4KH9A 4CC1A 4BFKA 3DBSA 5I16A 3NIGF 2DMBA 2HJFA 4PB9H 2NSXA 4NUQA 4LLMA 3DVNB 2VJXA 1NIFA 5JPNB 2QSTA 3MNZA 5GGTA 4MAUL 1WIPA 2FEEL 1P7KA 3QK0A 5DRNA 3OWRA 5DJ0A 3RUGE 3LZPA 4FQCH 3WFEH 3X2QB 4XI5D 2OR9L 1RZ7L 4KZ0A 1CLZH 4L1LA 5J3HD 4L4VD 4IGBB 3H6JA 3Q8AA 2HVKB 3BRFA 3FB6A 4OGXL 4HJ0D 5I1LA 2Q9OA 4ZMQA 3GXFA 4ZOEA 3LHPL 2YA2A 1T22B 2ZE0A 3K1DA 5KJ7E 1P7HL 2V9UA 3C5SB 1FZMA 3AG2B 3KJ6L 3FB5B 2EDQA 3QPXH 2FX8H 4PJ9A 4QRUB 4ONFL 4GUQA 1Z9MA 1OO2A 2CGRH 3MLSL 4PJDF 5IFJB 3PP3H 4YHZH 1MWAB 2C4XA 1T66D 3C8HA 4N2OA 3ME0A 4R4FL 4X5WA 4PJFA 1X5AA 1WHPA 3SGEI 1ID2A 4JFDE 1TKWB 5FYJL 1VHPA 3BDBA 4XCCL 4A55A 1P4IL 3K8LA 4NO0D 5EPMA 3D85A 4AQZA 3PCYA 3ES6A 2FECI 2P47B 3KPRA 4P4KD 3ZT7A 3OKOA 3VFVB 4L3AA 3S88L 3CK0L 5BRZB 1L0QA 4K94H 4UOW1 3SYAA 2FYVA 3WNLA 4AMWA 2NNRA 2V9QA 4NKIL 3GNML 1P7QB 3DUHA 3GBNH 4BQBA 3TJEH 3VFRA 5FUZL 2AZAA 2ZX5A 2DMKA 2P5WB 3FO9A 3FTUA 2B4CC 1ICTA 5EC1A 1J1OL 3EGSA 3SKOB 2KH2B 4BQ9A 1JWMB 1HDMA 3VMOA 4HIHA 1PMYA 3MYZA 2Q7AA 5I1GH 1NIDA 5BRQA 4RDQF 1G5GA 2Z7YA 4UQIM 5I6KA 3TBCA 4F9LA 1G7JB 2OTUB 2VO8A 3OF6D 3BH4A 4JCLA 4XNQA 4ES8A 5ABZA 4I88A 1Z9NA 3GB7A 3EFOB 2NRDA 4TLSA 2XUWA 2BCKA 1PG7W 3MFFA 1KBBA 2CDGA 3DO4A 4NNYA 3OM3B 2VGLM 5G5DA 1KXVA 4H8WL 1QAWA 2R4SH 3PV7A 2VSCA 2VDKB 3GUTB 1M05A 4U6VH 4PCYA 3SQOL 4FFYL 1LK3H 5JPNC 4NC1C 4LRIC 1KLFA 1XGRB 2C9SA 2CMRH 4YHPA 1KCKA 2B1AL 2V3DA 3MR9A 2DLFH 2R0LH 2V7HB 4WNQA 3GO1L 2XWZA 4GLRI 4G6FD 1A6TA 1IQDA 3T71A 1OHQA 2Z3FA 5EUOE 3JTSA 1OWWA 4DKDC 1FNGA 5SV4A 8FABA 3MV8E 1AVAA 5T33H 5DFAA 4AYBA 4IGBC 1E27B 3QIWD 3WAJA 5E1AB 2X1XR 4YSUA 3FRPG 2OTWA 2EINB 3LQAH 4OLZH 5EEXA 4Y2DB 4OZFB 1F58L 3V6ZB 1I8LC 2XI9A 4LLYB 3STBA 4ES9A 2WLLA 4J2XA 4FQQB 4OKVB 5IW1A 5L2KB 3BP4A 1FFQA 3KBPA 4ANKA 5B1BB 5DU7A 1U9KA 4ZD3H 4HFWA 3QZLA 5ETUB 3HNTL 2X4NB 5GRWA 2A6KB 2C9VA 3N43F 1XGQB 3ORJA 5EF3A 1DQJB 3H2WA 4R8WL 3PGFL 1NCDL 3IFOA 2HJLB 1X5XA 4AM0Q 4ETQB 5JHDB 3U0TA 5GS2D 1RLBA 2ITFA 3L3JA 2G5BB 1BQHB 1XGYH 3QRBA 4K07A 3WY1A 5D1ZD 3MLPA 3JXAA 4Y19B 1XGUA 5ALBH 1U6AH 2WQVA 3PL6B 3D2UA 4I1NB 4R3SB 1AHMA 4N3TA 4W9KC 4HKJA 3S3DB 3RA7H 4XAWL 5GRUH 2BIMA 4WSKA 5HY9A 5LGYA 1S3KL 4HFUL 1E7VA 4B9ZA 3KL3A 2DTML 4MNQA 4ZUUB 4M6OL 1PZ2A 3SDXB 5HJGA 1F90L 1QBAA 2A0LD 3BQVA 1OF0A 2QDWA 1IL1A 1UQSA 4U1KA 2LR4A 4JPKL 4JFFA 2H9GA 5T3ZE 2OMBA 3L9RA 4PP1D 1KXTA 2F74B 1YYCA 1IUZA 3U7YL 4N9OB 3K4AA 2MQ0A 4XRCB 3FQ2A 3L5WB 3SYQA 2VLJD 3MRQB 5F96H 2YD3A 2ORBL 1G84A 3VWJD 2WHVA 4X6EA 3VG0H 2ZXDA 2C9RA 3RWEA 5I1HH 1SN0A 5C0JA 5KTEH 1QRND 5FA4B 3O4LB 4KI5E 3GJFK 4NZRH 2HT4C 4MB5A 4PMFA 2UZIH 1QD0A 3VM5A 2F2HA 4K8RL 1LD9A 2DS4A 4IOSD 3K8KA 3OKLA 3CMOH 4JM2A 4OD3H 1TU2B 5CJQL 2CM6A 2AC0A 4ODSH 4ZPVB 1TJGL 3KPSD 4Y5YB 1DSWA 3GSNL 2Y2TA 1DSFH 3FC8A 4GIOA 1W0YT 4NZTH 4X6CE 4A38A 4YFEA 1R3LB 2GI0A 3Q3GB 2J20A 2N1TE 1EFXA 3L9EA 3QCUL 1K4CA 4Y2DC 4OZHE 5E9DD 5I8EA 3T5WA 4XZUA 3OLDA 3WFBH 4ZS7H 2EDDA 4BHUA 4PRID 5DRZB 2WO3B 1ZDQA 1R47A 3GGWA 1AD0A 1DVTA 4I5BB 2D3JA 4NPKA 5MEPB 3SGJC 3SQBA 4Z3EA 1UOVA 1ZLVH 3L7FA 2FX7H 2YPLA 4Y4KC 1OGPA 5HGGS 1A6AB 2LLGA 3IE4A 2Z65C 3MLZH 2YA0A 4NRXA 1WTLA 4NNXB 2VDNL 5FYKL 2VDRB 3APNA 1CC3A 3RPKA 1SY6H 1X4ZA 1CFTB 2GC7C 3OR7A 5CFAA 2NT0A 2D03H 4MD4A 5DZOA 1KPVA 2DQEH 2V8MA 3FB8B 2G2PA 1KJMB 4AIEA 2P8MA 4MBRA 3WEMA 4N2LA 4AVJA 5HYSB 1CMOA 3EXJA 5E0QA 4Y4FB 4DPBX 2CK0H 4AOFA 3IEAA 3JV4A 4YR6A 1JZDC 4XB7A 4GKLA 5HD8C 2FVNA 1CI3M 1H6EA 5GGVY 1UCTA 4ODVL 4H26A 1FHGA 5TQ0H 1P6WA 4PY8I 4N5ED 3GBEA 2CKBB 4GS7B 1RK0B 3U48A 2JQAA 3MPCA 2W07B 4KROB 5A3IC 3QQDA 4PGEA 1AHWA 1O6VA 3FPYA 2WUCL 5D9SB 2DWEA 1I4FA 3FH5A 5B7MA 5IB1B 3F6LA 3LRSA 1QUNA 1QLEH 5HGBB 2DD8L 2W92A 3FO1A 3LCYA 3BEWB 3L13A 5I1AB 4DPAX 5HHNA 1ZT1B 3ZMRA 4JG1H 2CJTA 3TASA 1JNJA 3DUUB 3KPPB 1KSRA 5CSGA 4E5XG 3RTQB 4AQ1A 1F4XH 3RL1A 5LG1A 2E7HA 1TPXB 4LF3B 3V0IA 3FN9A 4Z95H 1KGJA 1PY0A 4JO5A 1P4BH 1JYVA 4M9PA 1S5IH 1OLLA 1UD3A 5CGBA 1HH9B 2EIDA 3RY5A 4U05A 2KHAA 2XTLA 3VTMA 5JMOC 2WZPA 1U8JB 2GG1A 1IKFH 3AGWA 4PRPE 4Y5YC 4IBUA 1ZLDA 2Q76B 3IJ9A 5T3XL 1JIBA 2V17H 4FG6C 5EBWA 3NEXA 1HKFA 1I85C 4F58L 3WNIA 1UENA 3QDME 5JHLL 4LHUG 1CGTA 2Z4TA 4QHKI 5JNYA 3SDCB 1KC5H 2OMUA 2TSAA 3BEVA 1UB6B 4LCWD 3FUDA 3P02A 5HPMB 2BNUA 4PPTA 4HIXL 5E51A 4ETYA 2IANB 2XVLA 4LIQH 1YNTA 5PAZA 4OVUA 3RWCA 4TVPE 4OJFL 4PJCE 2NQDA 3W0WB 1TJHL 1MI5D 2DM2A 3ISYA 3PUCA 4XP1H 3C6SA 4WEEA 2UWEE 4RRPA 4XCFL 3OPZH 3DX7B 1SLWA 4S10A 2H45A 1EZLA 3O3EA 4FTDA 2W9LA 1FYHB 3QUMH 4ONOA 1UOLA 3U25A 4FQJL 1RUKH 4XPHH 4ZFZA 5GGRY 4Y4FC 3CIQA 2CO7A 3KEHA 3T0EE 5DI8B 4XPBH 4W9FC 2CQVA 3FCBA 2DQ6A 4HGMA 3HR5B 3TCXA 3TTSA 4AYFA 4RX4D 4LXFA 1NC4A 4UINH 4CVXB 3QB7C 4GS7C 5DUMH 3L45A 3BH8B 1ZLUH 5EU3A 3SOBH 5I30H 3VRJA 3DTXA 2QQLH 4KROC 4WW1A 5L8JB 1C5CL 4ELMA 3QO0B 5D1ZI 5KEZA 4P49A 1KXQA 4RMTA 3B9KB 4GAYB 3ILDA 2QGEA 2EABA 4HWZA 4PW3A 2AJSH 3HBPA 3X12A 4IDJH 1UG9A 3HG1E 2GJRA 3OKDA 4X5XA 2A9ML 2XWDA 5IJBC 3RTQC 5EBLB 4P8QA 5TE4L 1N10A 3MREB 1BF2A 1AQDB 1TPXC 3GMNA 3L9YA 3G6JA 4L4TE 4Q89A 3Q1SL 1U8HA 4FABL 1CXKA 4QF1A 1E0OB 1EJFA 2NPLX 1KTKE 1KYDA 4OUUA 5DD3L 3SCMA 4KNUA 3T8XB 4LNRB 3SDXF 3SE8L 1JHKH 4OFQA 5AWNH 4XPAL 1HEZB 3HS0B 1J88A 3PAYA 4QRSB 3RZWA 3V4VA 4XX1E 8PAZA 1GS6X 4ZT1A 5CWSA 3N50A 3L9BA 1SGKA 3AUVA 4JM0A 4NYLA 2EACA 1A22B 5EBMB 4AYMC 3CN2A 3BXNB 3EHBD 4HZ1A 4NC2B 4KKLD 3ZKSD 3SDCC 4WTZG 3V4UH 1XMWA 2HT3C 2DBLH 3FDWA 5HPOA 3O8XB 4YXKL 4JGUA 5LGKA 1N19A 2NW3A 1ZE3H 2Z1KA 1ROWA 2XWTA 2YARA 1DQQA 3CSPA 1EJOH 1PLGH 5TGBA 3ZR5A 4LARH 3WKMH 4FZ8L 3LIZA 5B1KA 1I82A 3RVXD 4HS3A 3JWOL 4H1LA 4AQAB 1FVEA 3LKPA 1TZHB 4QRPE 4YDIL 2X38A 3ZOAA 2A6DA 4KAQL 4WWNA 4Y1AA 3DHMA 1PZAA 1FO0H 1D7BA 3MCKB 4BWUA 6TAAA 4RDBA 3MLTB 3D39B 3MCYA 4JJ5B 1S7SA 4DVBA 2A7BA 3KYNB 4GRWE 3ZKXB 2W8CA 3KL0A 3A6BL 4AE0A 3OKMA 4Z76B 3STZA 2DLEA 32C2A 4AUUA 2BP3A 2BVYA 4BD4A 4TQPA 1ACYH 3TCLB 3FB7A 2MNJB 3OTTA 1W0VA 5ICZB 2PLTA 2R27A 3P30H 2B0SH 1IVTA 1A4BA 4WTQA 4NRYB 4P46D 4XBGB 5IF0A 4UQ9A 4BSJA 4MX7A 3COOA 2BO0A 3WFHB 3B9KC 2VDOL 4ZS6D 3FHQA 3LH8A 4N2AA 4TXVB 4MAYB 4FKHA 1OP5H 1JHTA 3DLQR 2R2CA 4HU8A 1A1NA 4GBXA 5DUBA 2IWEA 3IXTB 3SDYL 1PCSA 1TMCB 3VXRE 3V6OA 2PYED 5JUEH 1W0WB 3QJHB 2NY4B 4AMKH 3EYFB 3CVBA 2PABA 4FS0A 3WJJA 3TBVB 3F58L 5I1JH 1A9EB 3B9VA 3ML9A 1CYGA 4TKWA 1O7VA 2OI9B 2UUDK 3QIUC 3Q7JA 4GQZA 4F8TA 4CL7A 1U8QA 5I18L 1BSIA 5I16B 3Q5YA 3HNSH 1YYML 4KKQA 3HS0C 3KWWA 3BI9X 3VACA 2E7MA 4O9HL 3WXWL 4X4YA 3VDCA 4LLMB 2ZOKB 5M95B 2CK2A 2AXFA 3VXMD 2R59A 3VTAA 3MNZB 1ACCA 4HULB 2Q7NA 1DEEB 3O0LA 4G7SB 4OM1H 1MG2C 4UB0H 3WBDA 4A2LA 3QE5A 5IR1A 3WN5A 4RISL 4DQOH 4F2ME 3INUL 1UGKA 4ATTA 1MAJA 2G2RA 1KCUH 5FPIA 3O8XC 3P9MB 2IQAA 3NAAL 4UM8A 5IQ7L 2E6PA 5ENWA 1VJSA 1GMIA 3FB6B 4OCXL 4GAJH 3TL5A 3QEQE 4YBLB 3GDCA 4M5YL 4GH7B 4NFDA 5DZJA 5FGSA 1FZMB 4NNPH 4PJ9B 2H0EA 4FEMA 3H7LA 5H4YA 5AVWB 4UMGA 1TZOA 3ME0B 4X5WB 4AZUA 4PJFB 1PLCA 1UWEH 4D8PA 1E4WL 4KQ0A 5ESVB 1JBJA 4X8JA 2WBXA 3ZKXC 1CK0L 3M1CA 2YRPA 2GIMA 2NTFA 4K3GA 4K5PA 3ULUH 4FP8L 3R18A 3ES6B 4LSTL 1JFQH 1RHFA 2JLPA 4IJ3B 4PJIB 1REIA 2BZDA 4HUXA 4GMTL 4TQEL 4S0TD 1H15A 5AENA 1YQVL 2R8SL 1HZHH 1AGFB 4LMQI 3WV0A 1D5ZB 5IOPB 3QDHA 4MD0B 1WG3A 2PMZA 1A6VL 4LSQL 3BWZA 2FB4L 4M03A 4OSUH 3TGXA 3EGSB 4OIIH 4HALA 4MAYC 2NY2B 5GS1A 3S35L 2ICES 2NZ9C 4UIKL 3CU1A 5CUSL 3ZR6A 1HDMB 2EE3A 4HIHB 5A2AA 4X5LA 4X2UA 3V0FA 3P0YL 3TA3D 2KZ1B 4M7LT 1F8TL 1PLBA 3IDYB 4XMVA 4XNQB 2NY4C 3BAKA 2H4EA 2EADA 1FBIH 2XBDA 1ZANH 5I17A 2WNXA 2BCKB 2XG5A 2D7QA 4I0CC 3MFFB 2OI9C 3PREA 5G5DB 2JCCA 2DYPA 2F58H 4Y16B 4NQEE 3CFCL 5LHDA 1M05B 4LSVL 1T3FA 3EJCA 3ZPDA 1BBDL 2VLKD 4FQXA 2QHRL 1BPVA 1KLFB 4G9FA 3RQ3A 2NY5L 4KX9A 4YHPB 1EX0A 4ODBD 4F27A 5I28A 1LO2L 3QUZA 3VFSA 1E4JA 2K1MA 1IARB 3F65A 4WNQB 1A6TB 1IQDB 2N7BA 1E3ZA 3RURA 4CVWA 2X70A 4JZJA 3JTSB 1R46A 8FABB 3BLKA 4PIRF 1BM7A 3OQ3B 2O6CA 5EOTB 4NZ8A 4K7PH 2WVTA 3QXTA 4ICWA 3T4AA 4YBLC 1NWPA 2OTWB 2DB8A 4BDVA 1S7RA 2Y23A 3MA9L 5EIVA 1IBGH 3LNIA 3WKQA 4PJ9C 1P7BA 3BP4B 4XB8A 1SDAB 3GUFA 2R0ZH 5DEGA 1X9QA 5H37H 1DQML 5B21A 4ZW6A 3UO8B 4BGDA 2OCFD 2IXQA 1N26A 1TR7A 2CO1A 5E6RB 5KUMA 3EYOA 3IFOB 3IXAA 4CUCA 2YAMA 4PRNA 3LNDA 3DVGA 3OMIB 3U0TB 1U8PA 3CVCA 3BWAB 4XAKD 2NY0C 3L3JB 5MEND 5TPWL 4JDVA 3QPQC 3KH4A 4IJ3C 4RMWA 1SMOA 1PU0A 3FN0L 3DX9B 4ALAL 1AOHA 3IJHA 2B2XH 3P4NA 5FGBC 4RZCA 3GLDA 4AM0A 4ORGA 2F5AH 5GZOA 1AO7E 4JB9L 5BOPA 3D2UB 2P3YA 4HKJB 1KDIA 2KLSA 4A6YB 2H3NA 3QNXB 1NLBL 3NGBB 2GHWB 2YUWA 3RU8H 5HY9B 1YCSA 3IMVA 4TOYL 1KELH 3EKCA 1I9IH 5EU6D 1MCHA 4MSWA 2XJLA 1WA2X 3ZUNC 2Q2LA 4MNQB 2NY2C 1N6QH 3SPCA 2WQ8A 3GEFA 4BFJA 1IL1B 3ZGIA 1CDHA 3V5DB 1UHVA 1P84K 2JQMA 2XBTA 2Y6SC 1RPUA 3L9RB 5JW4M 1KXTB 3US9A 4F9LC 3IDYC 2BOBA 5HHQB 4LCCA 2EDXA 3VFGL 4WHYG 1R3IH 1VADA 5D7IA 2X7LA 3B2PA 2CSPA 4XBEH 1OGAD 4JEGB 2PXYD 2FWUA 4N5UA 4B9GA 5GSVA 4O02H 1ZKAA 4PJEB 4X6EB 1KXVC 3RWEB 3Q9PA 3AG1B 4Y16C 4IRZH 4L1SA 5HP5A 4XNDA 3FAWA 5C07B 5C09A 1J5HA 2OL3A 3NP3A 4TTGA 5SWZE 2PW2A 4N85A 5DVPA 2VXUL 5E2UH 4PLNC 4X98A 1LD9B 4U1JB 4XCEA 5KS9E 1S7XA 4JM2B 1HZKA 1IGML 3IBOA 2JFCA 4G6KL 1OAQH 2WXQA 4J8RA 5CJOH 2WLNA 2VN3A 1FSKB 4WKZA 3R0MA 1HS6A 2VRQA 5F0JB 4MJIA 43CAA 5EG6C 4UOQA 2VL4A 3VYPA 1FAIH 3AAZA 3S8FB 4M6NL 4BZ1H 1EFXB 1DQLH 1G9EA 4JVWA 4M1DL 1G0XA 4XZUB 4AYEC 4QHLB 5D6CA 1SBSL 2QTEA 3PIQA 3EOTH 3S5ZA 1NGZB 4XVOA 1H8SA 4I1PA 3GGWB 4AVHA 1AD0B 3BAEH 3X14A 5F21B 3SQBB 1KGCD 2WLYA 5JLZA 2W91A 4NWTH 3ARWA 3U36A 2GSGA 4NRXB 3SPJA 3RWIA 3U6XA 1OQXA 4OQTH 5T5FH 3OR7B 1ASOA 1JCVA 4JFZH 1ZMYA 2PR4H 1HT6A 4UU9A 3DIVA 1GHFL 2X6VA 5IG7B 1H9DA 1YMME 4HT1L 3CZKA 3O6MH 4N86A 5I74B 2P8MB 1N2RB 1DJXA 2IBZY 5BZXA 4WCYH 3ZHLA 3AT0A 4M62H 2AZUA 1J9TA 4YC2C 4YR6B 3IU3A 4ZYKA 1IILE 2YD1A 4CN4A 5EDSA 4OF5A 3NGBC 3BMVA 1G1CA 1JRHH 1N64H 5CXPA 1MCPH 4G8EB 4M02A 3WXVL 2DWSA 1DN0A 3L16A 2W59A 1J9CT 5I6LA 1NFDE 1MELA 1KZYA 4RRPM 5E7BA 5AW4B 1TEFA 2YEQA 1NDMA 2Z91B 3QQDB 4PGEB 1AHWB 3NJHA 1AXSA 5F72S 2KI6A 2DWEB 1I4FB 3BZ5A 4XNUH 2GFBB 3S3JA 4PJBE 3LRSB 1Q72H 3BKML 4TSAH 3V79C 4OZIF 1IJNA 3QDJA 3G04A 2FE0A 5HHNB 3ISRA 5DD1H 5I19L 1NCOA 4PJIF 2QGCA 2FJGA 3UTOA 1CI5A 1MRCL 2XX1A 1G7QB 3K2MC 3TEXA 1NPNA 4AQ1B 1U95B 3LN4A 3RL1B 3PP4L 4IK6A 4XXDA 2FSEB 1K8DB 4XPFL 5IK3B 3GMLA 4YPGB 1UM5L 5DQDL 4NLHA 4MBOA 2V2WA 2X09A 4JM2C 3RVVD 2PO6A 4GG6F 5IMLA 2X87A 3M17B 1BXUA 3D50A 2NY7L 1FSKC 4ZTPH 2Q87A 2CDFA 4MD5A 3PRZA 1F97A 1IB5A 1X5YA 1AQ8A 4D94A 2VLLB 4X99B 3RDTA 2C3XA 2NY6B 2WBKA 3A6OA 1U8LB 5HGHA 5JNYB 2AJ3A 1WHOA 3F83A 2OMUB 3BEVB 2DQGL 3EJYD 4NJ9L 3UYRH 2P80D 3K91A 1PG7H 1EA9C 2FUQA 4FKKA 3ZMNA 3VDBA 2AI0H 1CLOL 3HS8A 4XMLH 2QVFB 4R5VA 4MXWL 3ATBA 1YNTB 3GTTA 4ZFQA 4QRAA 4WJ5A 5EULV 12E8H 4MA7H 5TK4A 1CE6A 2HA1A 3RWCB 3BESR 1U8CA 2IDFA 2XPGA 3ZE1E 3D69B 3TN0A 4YSPA 1IC1A 3ZTNH 2NXYB 3ZL2A 3LB6C 1A9BA 1GYCA 1J0ZA 3V7AE 3O3EB 5JOEA 5IHLB 5I74C 1BZ8A 2D31A 5DEFA 1DUYA 4IHOB 4ZFZB 1FJ1B 4DP8X 1MLBA 1S78C 2CO7B 1YNLL 4BFOA 1F5WA 1A7RH 4ZUTA 3FHAA 3OXSA 1NC4B 3LKRA 3QT2A 3KR3H 2PWFA 3UEZA 5IJCC 1BWWA 1MAKA 5EU3B 3J27A 3ILEA 3VRJB 4F2FA 1WAAA 4WW1B 1HHKA 3FSAA 1AHWC 4HK3J 4P2OD 2ISDA 2DL2A 2Q3ZA 4NRZA 4UAHA 5GRJH 3UTPE 2B15A 2B3RA 4L18A 3RLSA 1NCTA 4WTXA 5AVRB 3ZHFA 5M94B 4LSSL 2VLJE 4NN7B 1RIVH 1T04A 2F8VA 3E1ZA 2D4DA 3X12B 5I1KL 3TIEA 4KKAD 3REVA 1RZPA 3NFSH 1F02I 3K72B 1QRNE 2O61A 1EZSA 3IGKA 1CU4H 2NXZD 3ZRSA 4AQ1C 2R69L 1B0RA 1BVNP 3GMNB 5AALA 3G6JB 4LK4A 2ZCZA 1DANU 4QF1B 1KY7A 2E7BA 2IO5A 3SCMB 3NZ8B 5I6NA 3UEQA 4ZAKB 2N0MA 4N2HA 5I66A 5GJSH 3KPSE 3KW8A 1MEXH 2XZCH 4QOKD 3U6RB 2IF7A 3HC2A 4PJXB 3MRBA 3V4VB 4BA0A 3BQUB 5ACLA 2ZNWA 4MMXA 3B37A 2J43A 5C0BE 2DQMA 3VGGA 5E9DE 4KTDH 4Z7UE 3HBZA 3NOIA 3AG3B 1TVDA 5DA4A 3OQRA 3QQXA 2AK4B 2ZUYA 5F44A 2V37A 4H0IA 5TH2A 1KPRA 3HI5L 2CWRA 2QLYA 3Q6FA 3UACA 1AI1H 4PJEF 5IB3A 2EDMA 3GXUB 3FOMA 4PGBA 3TXAA 3QG7H 1KYFA 2XWTB 3BP5B 1NSNL 1DQQB 3B5TA 3QRGH 2D3LA 3N85H 3GHBH 2F8XC 4IIQB 3APFA 3HN8A 3ZN6A 4IMLA 5JTWA 4NC0B 3FRPA 4HS3B 4H1LB 2IBGA 5I73B 4HWEL 4JM2F 1ZTMA 2H0FA 4HUNB 5L8LB 1IM3A 2A6DB 3CMGA 4Y1AB 3GXNA 2IJ0C 2NXYC 5D55A 4UT7H 2KZBA 4Q7DA 4P99A 4PTTA 3S8GB 4JMXA 3QIBA 4FA8A 1QNZL 4GQ9H 3WTUA 3BSZA 1LMKA 3GTVA 3OKMB 2CBMA 2OJZL 3STZB 1KYOK 5AKRA 4IBWA 32C2B 3AB0B 4TTDC 5D7JA 5MHSD 5DMJB 4ZXBD 3UDWA 5F0PB 1NCCL 3FQXA 3MRFB 3NCJH 4UI2A 5IF0B 3QC5X 4NGHH 4NOFA 4QLRA 5CAYB 1UT1A 5FW8A 2ROXA 4U1IA 1MIML 2CD0A 4MX7B 5D1QD 4P59H 3TFKD 2JB5H 3VI3A 4POUB 1F3JA 4HXAL 4UTAL 1FVDA 3F01A 3OJ2C 4J23A 4NN7C 3ALWA 4D0DA 1GA2A 3LKNA 1MFUA 4I87A 3ULSB 1YLBB 1JHTB 4LHJB 5CEXA 4GBXB 5DSCA 5DUBB 2F54B 5SWSB 4IHBA 4Z7QE 3DROA 1O6SA 2C3VA 3G08A 3NJLA 4RFEA 3N1QC 4ONGL 1E8YA 2AVGA 3CN0A 1MVFA 4L37A 3U46A 2IGLA 3D2TA 4W4NA 2FJHB 4XVUD 4P3CL 5D4JA 2F19L 1AR2A 5BZZA 5EV7A 3SCMC 4ZAKC 3MNDA 1JF6A 1GCYA 1UJ3A 2X2UA 1VERA 3M7FB 2ZYRA 2GUOB 4Z3GA 2YPVL 3F8UB 3SGKA 1UZ6E 2BSTA 1X6LA 3KWWB 4W9LC 2BMKA 3S6CA 2Z31B 4BV1A 2O5YH 4JRYB 4X4YB 2WXPA 3BQUC 5D7HA 1IT9H 4DGUA 2B9BA 4EDXA 4G7YH 4GP8B 4JKWA 5IBLD 3NIDE 5IR1B 4LCWE 3QJXA 1WWWX 4PCSA 4LLVA 1R5WB 2EDNA 1NDGA 2G2RB 4YPJA 4CSTA 2IQAB 1SLVA 2WQAA 1ZJBA 3OKKA 4UT9A 5ENWB 3SJVD 3CV5A 4EXPX 3ESNA 4GMSL 4ELDA 1U3NA 4JFED 1JV2A 4C55A 1CUOA 1T1WA 2O5NA 3FS9A 5C0GB 5KVGE 4WEMB 5BPPA 5FGRA 5GSRB 5I73C 3LQZA 4LMQE 1GPOL 3BJLA 4WEBL 1BVNT 2DJ4A 3GKZA 4P2RE 3HKFA 4KRLB 3HHRB 4KKBD 1U2HA 2QQNH 5DS2A 1W72B 5AOKA 1OPGL 4X8JB 5AOLA 1HINH 3B2UC 5HHOE 4F7TA 5J11B 2XY1A 5DUPL 3W3BA 4UDUA 3SBRA 2YOAA 3GMQA 3AB0C 3D3VA 1OEZW 2QTVA 2X9XA 4FQ1H 1N18A 2XICA 4XNXL 4MVBD 4HUXB 4M8VA 1NGYB 1N5YL 1H15B 3I50H 4DETA 4GP5B 5HDRA 3E9UA 3SYPA 1MFNA 3HUJA 1C8PA 1RIHL 3DXAE 3I3BA 4GSDH 3GMPA 5GS1B 3T0VA 3UOAB 4Z7VA 4GBXC 3WTTA 4Z78A 4FQIL 1CICA 2EDHA 4V1DE 2ZJSH 3V6OC 1Z3GH 3UZQB 2O5XL 1K2DB 3B2MA 3BKCL 3OZ9L 1KOAA 5JR1H 2GK0A 1LDPH 3WJJC 3DSFL 5I17B 2X2YA 5KBNC 1M57B 4YE4H 3X1FA 1CD0A 2D3VA 1FP5A 2A74A 4PRHB 2VN6A 2DYPB 4KK9C 4WUUD 1AJ7L 2FGWH 4N8VG 5TF1H 3WTWA 1Y6NR 4N90D 5GGQL 1T3FB 2FQGA 4E5XA 2XQBL 4HISA 1G94A 2MNUA 1QSFD 4FQXB 4G9FB 4CW1A 5LBSH 2CR3A 5I1EL 3FKUS 3LH2H 3QUZB 2I5YL 1IO4C 3U83A 2NW2B 3W2DH 5HYFA 2VDML 5F89B 1KB9J 2B77A 3VGEA 5I75B 1KUMA 2X70B 4JZJB 2VSMB 3GIZH 1PS3A 5K5YA 3CNKA 4Y0GA 2DQIH 2WWOA 1AFVL 1AZBA 3G6JF 4HSCX 3HOGA 4BDVB 4RMUA 1G9MC 1HXMB 4QO1B 3F5WB 3UADA 3VGBA 1S9VA 5HHPA 4PJHB 3NRFA 4YAQA 2ZCLH 4LHUA 5DEGB 4ZFOB 4NN5B 3ZHDA 1MAMH 4PU2A 1EERB 4PJXF 5IFHH 4Z1PA 1MCDA 2AEQH 5KJRH 1YUHA 4KV5E 2ZXAA 4GFTB 3EYOB 4PHXA 3IXAB 1JPEA 5J11C 4JPQA 3I9GL 2FNWA 3QR1A 4K2UH 3ZYOA 3O3BB 5EZJA 4J27A 4JE4B 3UFIA 3QCTL 4WFGE 2LQRA 2KYIA 1PEWA 4LLDA 1GIGL 3P4NB 4AM0B 4ORGB 4W9HC 3QNYA 2NUPB 1RZJH 2WYTA 4EDWL 1I7ZB 2ZTBA 1ZD6A 3QZOA 4KPHH 2XYCA 4TV3A 4FXKB 5GS1C 3N40P 3BKYH 3HE7A 3WJLA 3O45A 4KX8A 1QFOA 4P04A 2PYEE 4QHMA 1UUNA 3IDGA 4CU6A 3GM0A 1GZHA 2WN3A 3I02A 1JNLH 4XGZA 4M7LH 5F8QC 4S11A 2BOBB 4RIRA 2E7CA 1MZZA 3N9GH 1VEMA 4LCCB 3B34A 5ICXA 5LDUA 4FNRA 2PTUA 5D7IB 2X7LB 4IRJA 4JHZA 5J89A 3IJSA 1AQMA 5GSVB 5KSUA 2FJFA 3EOBA 1WZAA 5LCVH 4DJMA 3GXTA 1Q9KA 3G3LA 4C54A 3ZUCA 1A7BA 3OMAB 5C09B 3T2OA 1WK0A 1CFQB 1T7YA 4FQXC 4I85A 3KHQA 1UUSA 1WWAX 5F0LB 2FDBP 1W6LA 3QUZC 4XCEB 1S7XB 2CUHA 3U1SH 1HE8A 4J8RB 1MKFA 1I75A 5I75C 3BPOB 4JZJC 3CVIH 4WKZB 4HWNA 3S37X 3MBXH 2CE6A 2RALA 3AUWB 3T4AC 43CAB 1JZ8A 4JO8A 4YSSA 5LN8A 4P2QA 3JWNE 2R83A 4MCYB 2WXLA 5ABDE 4JPWL 1YEHL 5D6CB 1YECH 4PGZA 4XO4A 5AZEH 1J7VR 1FDLL 3OPUA 3PIQB 3QQ3A 4GXUN 5AQ0A 1JPSL 4WTZA 4NN5C 4KY2A 3X14B 4QMEA 5DRXB 4NAJA 3EZJB 5JLZB 2Y3AA 1DN2A 2R9HC 1I9RH 3Q5TA 1SM3H 1YPZE 3U36B 3F6JA 3VG9B 3Q05A 5I5JA 5KVDH 1JTPA 4XBMA 3BKJL 2JJWA 4IGBD 5JW3L 1UCBH 1WISA 4UU9B 1GOHA 2F18A 2E7LA 3TH4T 1YN6A 2IPUG 1OM3L 5C3LD 5L4MA 3H9SA 2IH3A 4H20H 3DGGA 4PYGA 4BEIA 4JL2A 4YH6A 1MFDL 2MJWA 5ANME 4XMKL 5GZOC 5I71B 1CJYA 2GC4C 4ZYKB 3IU3B 4BZ2H 3UJIL 5HJDA 2R29H 1WPCA 4JHAH 4UTBA 4FNTA 3A3YB 2IH8A 1KN4L 1JK9A 4FXKC 3PWPA 1BFSA 4O51B 1NUNB 1TJMA 3ABMB 4UM9A 2PTTA 1I1AA 4HH9A 2D2OA 2YWZA 2ZCKH 5ICYA 1J9RA 1A7QH 1NDMB 4L8BB 2WKGA 1IC7L 2JCWA 3HAEB 3UTTA 1JDDA 1XFPA 3GM8A 5BRZD 4LCCC 5KSAD 1ORSA 3QDJB 4TUJB 4HS8H 1P7QD 5FM5O 2EDTA 4LOEA 3MLUH 2FJGB 4ZO6A 3ZQWA 4ZUVA 3EYVA 5KANI 5FHAH 1KB5B 2DEWX 3FOLA 4M7ZB 1SN5A 1X7TA 2QQKL 3LN4B 3RX7A 4C59B 3MKGA 2OTPA 4XXDB 3T6VA 1MIEL 3I9PA 3O2WL 2KBGA 4EF3A 3RY6A 4HSQA 5E8DH 2H6UA 4N2IA 5D72H 3HPLB 3K2UL 1EGJA 3BJ91 4FQLH 4HCFA 4RSVA 1KV7A 3HMXH 4N8UA 4MS8C 2PO6B 4X9BA 5IMLB 1GJIA 4ZQTA 5IT2L 2RACA 2OA9A 3VD9A 1VB9A 4A66A 5MERB 1V3MA 2CDFB 3QDGA 3CWGA 1HJCA 3T8VA 4R7DA 3RWGA 3FBQA 3ARGB 4MXVF 5HGHB 3DBXB 2AJ3B 4LLQA 5DLLA 5E8OB 3ZYJA 2O5ZH 2HT4D 4BIKA 5CP7A 4BRJA 2BS71 3H53A 3VD4A 5FFOA 5HGAB 4AQOA 1CLZL 3N41B 4KVCH 4O2CA 4OGYH 4XNYH 2P5EB 3VSQA 3E8VA 1JZFA 1HYRC 1MPAL 2FATH 1CE6B 4WJ5B 3VG9C 5BCAA 1A64A 1U8CB 2A9CA 2EUVA 2XPGB 3LXUX 2GIXA 3QSKB 4XX1G 5JOFB 5MENE 2EVIA 5DURB 1OAXL 3ARFB 3VQ2C 1A9BB 3TBWA 4KMTH 5FOBA 1WO2A 4Y2DD 4LEXH 4JKPH 4OGZA 3W38A 4YHZL 2ITCB 4IRSA 5DEFB 1DUYB 1AY1H 4XN1A 2Y7LA 3VD2A 2ZSWA 5I71C 2IV8A 1GGIL 5EU6E 5AB0A 3MSPA 1IV8A 5AW8B 4YWGH 3N44B 1SYVA 1NAKL 3PHQB 5ACZA 4PJGE 2W60B 2LFEA 1VCAA 3OXSB 4PJHF 1V3KA 4Y4KD 1RZIA 5C0FB 3Q8FA 3SDDA 5B38G 3TPKA 4Z7WA 1G0YR 5JHDD 3DVFA 3MNVA 2ITEA 4OD1L 4NRZB 4QRTA 2QMKA 3RKDC 3S35X 1OGAE 5SX5K 3VXSA 3S8WA 4Y19D 3B3IA 1CYXA 3ARYA 2H0JA 2Q8BL 4CKVX 1T04B 1HSAA 2XPZA 3REVB 3CX5J 3TIEB 2O61B 5HD8D 2WQWA 4JUSA 1JUFB 4OJAA 5I23A 5CSZA 2H0PA 4M7ZC 4OZGF 5JPMA 5L9DL 5DLML 4YSAA 3B9EA 3BH9B 1SEQH 1Z5LB 4HK0A 3Q8BA 4EIBA 4PJAE 1KTLB 1N0XH 4KXZH 4OBSA 1KCLA 5A3ID 1INEL 2JQZA 4WO4B 2PO6C 3N40F 4AG4L 3KYOA 3FJTA 1ZLSL 3L3KA 4WK2B 3BYYA 4Y5VB 3UG5A 3MRBB 4YEEA 3UJJH 5IVZA 3DRQA 4A6YH 4MMXB 3STLA 1WJ3A 1OAKH 1UWYA 5L8KB 5F2FA 4PVMA 4WI7A 3RDTC 2R23A 3EUDA 4DT2A 2AQSA 1DBML 4D0BA 2TRYA 4N26A 4Z3FA 3ARGC 2CG9X 4MFHA 1KIUB 3O4LD 3VXOB 3ULVH 4EPSA 5ELIA 5TH2B 1KPRB 2DLFL 3UTSB 3Q6FB 1KGCE 2R0LL 1MQ8A 2BJML 2W5PA 4FX5A 5IB3B 4PGBB 1L7IL 4TSCL 2VC2B 3MRRA 4J28A 5IKCA 4FULA 4G8IA 1ZK5A 1DQDH 4GINA 5E8NB 2HLEB 2C7UB 5FS5A 3WUWB 4N6RA 5JDJA 3OG4B 4OLZL 3TF4A 2APXA 2YK1H 5HDQL 2AJVL 3MV9A 4Z0BH 4HZLA 3SPHA 4FG6D 4LSRH 2YD8A 3ARFC 3GJFB 3L4VA 4ESKA 2X6MA 3O0RH 4PTTB 4L3FA 4NDMA 1TENA 1SOKA 2AXJA 5EIIB 3VFOA 2E46A 3JWDL 2CRMA 4CBPA 2XA8L 1ESOA 3TONA 1E4XH 2I9TA 3IFLH 1P1VA 1G9NH 5LWYL 4DN3L 2AEIT 4P9HL 5IVXA 2X2HA 1RK1B 2DPKA 4YDJA 3T3ME 3SDAA 4IOFC 5B3JE 3MCG1