2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein Slc8a3
publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
3E9UA 3EADA 2FWUA 2LT9A 3H6AA 3US9A 3FQ4A 2KLTA 2FWSA 2QVKA 3RB7A 3FSOA 3GINA 2KLSA 2QVMA 3E9TA 2DPKA 3RB5A
chains in the Genus database with same CATH superfamily
1MCPL 4DT2A 1D7DA 5IW1B 1V7NH 5A6MA 1E5CA 2YAMA 2J25A 1GOFA 2KC0A 1FGVH 3WXWH 1LJMA 3IVKB 2DQCL 1K8IB 3MR9B 3NYKA 5HTSA 5T3ZL 4GSDL 3QO1A 3B37A 4PJHB 3UZEA 4BH8B 2Z65C 5C9KA 2GJZA 2X2HA 4CKQA 2EILB 2QDWA 2FYYA 3LRSA 3MACL 5K9KB 4UNVA 1D5RA 2XZCH 4ODBD 2BNUA 5I5MA 3P73B 4DPCX 4V1DB 4QHNA 4PV1C 2P24B 4DZBA 4LO9A 5EEZA 4PJ7F 1OANA 1PZCA 1YECH 2JK5B 2GSIA 4PJ9A 2QQLH 3FUNA 1BMZA 1ZA6A 2I26N 4WWKA 3NFPA 4QTHA 5J1SC 4QGTA 4F3FB 3VFSA 2RB8A 1VPOH 3VFVB 1CDJA 4FFZH 2VITB 2XPYA 4HXBL 3RWGA 1VENA 3WTTA 3ECBA 4JCLA 3QUML 2ENQA 2BP0A 3DROB 5E56A 2YPKB 3G9VA 2ESVD 2QV2A 1BZ8A 5I6PA 4UTBL 5CEZE 5JHDD 3OZ9L 3MV7B 4JM2F 2X0VA 3D2UB 5E8EA 4JPKL 5EZLB 3SKNB 1TXKA 4WTWA 4PJFE 3NJKA 2W88A 2C9UA 4NAQA 3LZFH 3RTLA 8CGTA 4UAOC 2X3CA 2LTQB 4NRYA 2DTMH 2X9YA 4ZG1A 4JGNA 4GAJH 3WNIA 3MV9E 1E28B 2MHAB 1SF5A 1RUQL 1WUNT 1X5AA 1JFHA 1KY7A 5IQ7H 5FO2A 1CTOA 4K7PH 4OZFG 5BPPA 1O7DE 2L7JA 1HC1A 1MRFH 3BUPA 5F88A 5J6SA 3DRTA 5DK2A 3LKPA 4LP8A 4E5XA 1OF2A 2AXJA 2UY7B 3O0RL 3G6AA 4QRPE 1FHNA 4U6YB 2K4WA 2AQ1A 3P0YH 4XMKH 3MBEB 2PPCA 1AS6A 3J27A 4POUB 1FDLH 3T77B 3N06B 4DJMA 4J6RL 3B4NA 3QJHB 4UDTB 5J11C 2HB0A 2X1QA 4AM0B 4DQOH 5FHAH 5B8CA 4XTRC 1XR8B 3O0LA 1AKJB 3FONB 1W6LA 4WFHE 1O7VA 1IGFH 3ARYA 4JANA 2XA8L 1HHIB 4X8JB 3ZRFC 1BG1A 1ZA3A 5MEQB 1OAXL 2X6BA 2VQTA 3HUJF 3ARGD 2N56A 1S7WA 3RWHA 4BZ1H 5F3HB 4CU6A 5FFLA 3LZNA 3K71B 3KXFE 4XVJH 4Y19E 4YGVB 5AKTA 4FD0A 4FQIL 1F90L 2XQBL 4QGYA 4FQJL 3VSUA 5I6MA 5BQ7A 4IS6B 5I30H 3EDJA 5B39B 1OE3A 1MNUL 2XFGB 3M6DA 3ZRSA 3QRGH 3DX1A 5H8DA 2JV6A 4ZPTB 1M05A 4PB9L 3T0EA 1ZKAA 2ZCKH 3UZEC 5IB4B 4G6JH 2HFFA 4XGZB 1WCBA 2FUQA 1X3DA 2A4EA 4C58B 5FX3A 4G43B 5EPMB 1FFRA 1RZ8A 5BOPA 2BO0A 2YBGA 5D1ZA 3CWGA 2N1KA 2ZSWA 1RLBA 4FMKA 1I4FB 4NNXB 4ZSOA 1A1NA 3L4XA 2K4AA 4PMEA 2NY5L 2OMXA 1N0LB 4MD4B 3BD4A 5KVFE 4MCMA 4HU8A 3W82A 4B3EA 1NC4D 1VEPA 2C7UB 5EF1A 3CVHA 1WBZA 3QQDB 4PJ9C 1TQTA 4WWKC 3QE5A 3RB5A 4P5TB 4PI0A 2VDNB 3C5ZD 1SN5A 1J0IA 2ZYRA 1OSZB 2NW3B 5C0JB 1SXBA 4J6IA 4G7YH 2XTJC 3MRQA 2O6EA 4RX4A 1JPST 4Y1SA 1QTPA 1GSMA 3CN4A 3R0NA 3B2VL 3BPOB 5EHFA 5HPMA 2ZUWA 4RDBA 1N5YL 4H26B 4KRPC 4OGYL 3N50A 2V3FA 3B2UC 3GIZL 1GGCH 5I1AB 1CD8A 3ARFD 2CR6A 5ILTL 2PWGA 1JZ2A 3MBXH 4PJIF 4TKWA 2FYVA 1TCMA 3GSNA 3QJOA 4J3UA 1Q72H 1V7ML 1FNGB 1NWOA 1T4KB 1T1WB 2QR0A 5I8EB 3QR2A 2GTQA 2QQKL 3VI3F 5IHUL 4E41E 4LOEA 1ZSDA 2XUWA 4KRMB 3PGCB 2PPAA 1TNMA 2QJDA 1UXSB 1RHFA 2V9UA 3KPSA 1NIFA 3NJNA 4TNVF 2JE8A 3U9UB 3BPLB 1F6AA 5EU5B 5FUCE 3ULAB 3VVWA 1GMEA 5FO8B 1V54B 5F0MB 4ZS6C 2VXQA 2AXWA 2YK1L 4EQ2A 3MRDA 3Q7JA 1IQWL 3SDXB 4FNSA 3WI9A 4UT6L 2LE9A 1WFOA 3K4ZA 1BREA 2BNQA 3E6FB 4O02L 3GSVB 1S4IA 3HJEA 3FOLA 4NM4H 4F5CA 4UUJB 1T2JA 4NCC1 3BP6B 4HU2A 3OKMA 4MNQB 3KBHE 1KJ3H 2BNRD 1JPGA 4ZUSA 4APQD 5SWSB 4WW2A 4HHAB 2YPLD 5F9AC 4PJFB 5D7LE 2WNKA 3X3GL 4NHUB 5B8CC 1NDGB 4NO0B 3RGHA 5IQOA 1CICB 1GY1A 2WLIB 1IM9B 1MY5A 3ATAA 3FZUD 5E1AA 1M53A 4N28A 2VN6A 2G0KA 3MV9B 4ONFL 5F7AA 3HLKA 1UD2A 3WU1A 4LBEA 3KW7A 2GW5A 3O8XD 1XGRB 3A23A 3F00A 1YDPB 3GMQA 3WDIA 1UD8A 2NY2D 3EO1A 4XAWH 2CBOA 5LBSL 4RFNC 1QFPA 4AQZA 5CFHA 5KSAB 5AZEL 2CPUA 4XVTH 4FXTA 1HINH 2XWZA 2BY3A 3BXNB 3OTTA 5JW4N 2QPFA 4K23L 1N18A 3KGTA 1BLNA 4LPWA 2BVEA 2XWTB 3CE1A 1G1CA 4QT5A 3IPBA 2QQNH 1J87A 1J5DA 2FIKA 3MV8E 3TN0B 3P0VH 2OMTA 4QRUA 5D1ZC 1WIUA 4FTDA 2XN0A 4PJXB 1TJIL 4YHNB 5DJDB 4X80L 4L4VA 2CQVA 2E86A 2WQVA 2Z7UA 3EYOB 3R0MA 2HRGA 4TUJB 3HFFA 3I74A 2BS8A 4KK5C 4EAEA 4KQ4L 4S1QH 4A7UA 5F7HA 3P77B 4UM8A 4XO9A 3KXFB 2Q3XA 1NGPL 5DA0B 5GJTH 4OUOA 2V4LA 1C16B 1R5IA 1AGFB 1GY2A 1VFAB 1TQUA 5ID0B 3S8FB 4HVBA 4RA3A 3UAJD 4Q6IA 4GW4B 4LCCB 4X7SL 1ZOXA 2BLFA 2NR6A 3ESNA 3MOQA 4HIHA 3FPXA 3RNKB 5BUPA 1ZTXH 4F7EA 3IFNL 1EJFA 1NBZB 2NT1A 2YUXA 2MCPH 3PABB 4FQCL 5KVMC 4Z7UA 5EEVA 1CL7H 2KDYA 5EIIA 3MLVL 4L9DA 2X44D 4HUWA 2VDOH 3IN0A 1K4DA 2ZKYA 3HS0B 1OAYL 2Y36H 1LDSA 1NIEA 3ROOA 5DS8B 1I1FA 2IDFA 4LESA 2BY0A 3L6FA 4JO4H 4X99B 1DZ0A 1HH6B 4XX1E 2OK0L 2BMKA 1N6VA 5ID1B 3QZNA 3S6CA 3BWAB 4PV8A 4XRCA 1NSNH 2X70A 3S98A 1JIBA 1OPOA 1XMEB 3LEXA 3QIBB 3R06B 1EO7A 1A0QH 4X7EC 5DLML 4U6HB 4GG6E 4HIEB 3VI4A 1BZQK 2PETA 5HDBF 3SD2A 4OB5L 3FQNB 4AG4L 7PAZA 4WW2C 5C0EA 1KIQA 2ADFH 3EJYC 3BGFB 3PHOB 1XH2A 3FU0A 2HA1A 5C0GA 5FEBA 2PYEA 4V1DD 2NX5E 5TJWK 3TBWB 3H6JA 3VMNA 2D2CC 3SE9L 4P2OA 3H8NA 1RMFH 2ZWLT 5JOPD 3EGXA 1JRHL 5DRXB 3CG8A 1ZPLA 3QG7L 3TO2A 3AU1A 4HFUH 4P9ML 3ATDA 4X6BB 1JGLH 3DDFA 3MXVL 2N1TE 1DBAH 3P11L 1NAMB 2DM7A 1U8IA 2PCPB 4PMFA 3KPPB 1F18A 1AE6L 3DSNA 2WMPB 3ZTCC 5I75B 1FFPB 1HT6A 1E4XI 4L37B 1DN2A 4WI8A 1FQ9C 2EO7A 2JB5H 5JIQA 3MV7D 1EAPB 1K85A 4P5MB 5JLZB 4CSTA 3F04A 5CUSL 5IJBC 3QVAA 1HK6A 5AUMA 1R3KB 2C9QA 3QUYA 5JA8B 5CWSA 2WTPA 3VRJA 2OZNA 4AYMC 5GGRB 2D03L 5GSRB 5JYLA 2DL9A 5D7LB 4QOKD 1A14L 4U7KA 3IDIB 1QUPA 4FAAB 5GGQH 2ZG1A 4HIXL 1MLCB 4IGBD 2AABL 1SJMA 3C5SA 4ELME 1A8ZA 1USQA 3KPOB 3PP3H 4GQRA 1IFRA 2NRDA 1G7QB 3Q8FA 4I89A 4B96A 1P7KA 5IBTL 1D2PA 2OJZL 5KJRH 2H2SC 1XEUA 1PNCA 4ZOBA 2WVTA 2FT7A 4I2XE 2VUYA 1MVUB 1NGXA 2WIIB 2HLAB 3BH8B 3U1SH 2OAAA 3UERA 3R4RA 1UA6H 3QEGL 2K70A 1JGVL 3JVGA 4Q6IC 1RZKH 5DO2C 2NR6C 1OB1B 3TS8A 3ZDZF 2G5BA 2QMJA 1NBVH 2C4XA 2EP6A 2O6DA 2OZ4L 2X89D 3HG4A 3ZHDA 5AOMA 4XPHH 1AKJD 4PN6A 3VXTA 5AW8B 5L9DH 2H6PA 1A7RL 3VJ6B 1DL7H 3JUYA 4M5SA 1EXUB 1E7UA 4DH2A 2FUTA 2ZCZA 3OKLB 2DYPA 4Y5YB 3WN5A 4PS4L 4XP4L 3L95A 2OR9L 3QUZA 4RBPK 2JCCA 2OXHA 4L3CB 1AFVH 1IZKA 4LB8A 2Y3AA 3UBXI 3E6HA 3ES6B 1U95B 2WAHA 4Z7OB 1XAKA 5I73B 3EOYG 2VM9A 4JFXA 1BVLB 4MXQD 1I75A 4PJCA 3VE0B 1TOXA 4NO5A 2NY6C 1KEML 3LNEA 3MYZA 2F19L 1R17A 3FBKA 3INOA 4FG0A 4S1SH 1CURA 1INEH 2DEYX 1ACZA 1UM4H 1BD2D 3QR0A 3VAEA 4HS6A 4XBEL 4DP6X 3L5XH 3OAZK 3WFEH 4ZUVB 2O5NA 2VZOA 4GEJA 4ANWA 1TCRA 1F97A 3AS1A 5EO0A 4X7CC 4PRIE 3LIZA 3M1OA 4MB3A 4P2OC 1LP9F 1CDIA 4HGWB 1PLGL 4HUVA 1NGQL 3L7EB 4XOAA 1H3GA 1FL5B 1GC1C 3U4KA 1Y1DA 2F8OA 4R7DA 1VSCA 4P2CG 5AG8A 3V5HB 4YAQB 4E9SA 1ASPA 1DVSA 1Q38A 1LNUA 4JQXA 1U93A 4M6ML 4QLWA 4YVNA 1MJJA 2D3NA 3GLDA 1SEBA 1CD0A 5IVXE 5D70L 1O6VA 4AMKL 3DXAA 1QFOA 4H88L 1J10A 1QBAA 1TTRA 5K5YA 2BS71 5CEYB 4XMZA 5IUSA 1E9QA 3M17B 3QUYC 1E2ZA 5JIMA 3IGLA 1UJ3B 4ZPVB 2CM5A 4HV8B 5C2UB 4K3EH 1QKZL 1XH3B 3B2XA 1QUNB 4ZNEA 2W9EH 4APXA 1E4HA 2XI9A 3J8F7 3EJTA 4GP5B 3IS0X 3EH1A 4ETQB 3GF8A 4TNEA 3W39B 4BFOA 4L05A 1JJUA 5AL0A 3JWNH 4H8HA 2WZPA 4E5XG 3IPFA 1UT1A 1ASOA 2R4SH 2ZG2A 3FT1A 4PHZA 1UXMA 1PZ3A 2DV6A 3LOWA 3REVB 1KN4H 3MRRB 3SDAB 3U2SB 2R29L 5GRUL 4ANUA 3L3JA 4XCEA 5BVPH 4K9EC 2XXCB 4CSSA 3DK2A 1ILSA 4NBXB 2ZX6A 1HYSD 2PTUA 1NCAH 4MNQD 4P5RA 1W0VA 4PY8I 5CJ8A 3BP7B 4GQZA 5E9NA 5SWSD 1HOEA 1DUYB 1I7UA 3JVGC 1WDAA 1IBFA 4RZCB 2ATPB 3NRPA 2W65B 3ZE2F 1ZVSA 1Q90A 3TIEB 3W9EA 4GAYA 4CNIB 3K6FA 3IMVA 3VWKA 1NH6A 2ZOOA 3IFOA 3FQTB 4HSQA 4NO0D 2CLZB 3SSGA 3C08L 1CICD 3WHXA 5KVFL 4F8QA 1IIKA 1MFAL 2YD1A 4PCTA 4WSJA 2ODIA 2YIHA 3MUUA 1JV2A 2WTRB 5IQNA 4H2CA 2FWOA 2AVFA 4P2RB 3DRQA 4M6AA 2F5AH 1XEDA 3QUZC 1L5GA 1QTSA 3W11D 2QQQA 5DFVC 2E74C 3EOBB 1QMUA 2FECL 4QY8B 1XBRA 3TVMB 3NG5A 3UG4A 4UTAA 5EU6B 3X14A 4OBSA 5CGYD 5FA3B 1B9ZA 2JVUA 1KJ2A 5HJ3B 3FBQA 4AL8L 4YSSA 2HJLA 3GSWA 5KSAD 5FF6B 3QQ3B 1VFBA 1KBWA 3WSQH 1BPVA 1J8HE 4UT7L 1G7LA 4P5SA 1JN6A 3KYNA 4HG4K 3FH8A 2WM0A 3DURA 3IU3B 5G4OA 5HGDA 4PW9A 4F58L 3WIHA 1KEGL 5HHVL 4DKFH 4WGKA 2EDNA 3TN0D 3WXVL 4FRWA 3VXRA 2EH7L 4UQ9A 3S8GB 2FJHA 1UJTA 5F6HJ 4YDVA 3WJLA 2B9AA 4JVWA 3DOSB 2LVCA 2F1BA 3T65A 5JHLA 1U8KA 2F8VA 4JDEA 3CDZB 3MGTB 2YXFA 1SEQH 4RSVA 2ZKHH 2LABA 4AI7A 4WKZA 3KL5A 4PM1A 5BJTB 2YFNA 2DQFB 4JQXC 1LDPL 4XNYH 1RD6A 3N43B 2CO1A 2ORBL 4WNJA 4ZFZA 4OM1H 4F92B 2DLIA 2HKHL 5FM8A 5F7EH 1NCOA 2JB6A 2WXIA 1GSKA 3IDYC 3MV01 4P2QA 2CBPA 5DQDH 5SX4H 3WG7B 1OAKL 4ANKA 3LNHA 2J88L 4JO3L 1C7SA 3MLZH 3K72A 4WV1B 4KHTH 3WS6A 5LGKA 3H42H 1U58A 4M4RB 4WDIB 3ARDB 1D6EA 4NXKA 1YNTA 5GIRB 5DD3L 4XXWA 3ZR6A 4DUXA 4HG4J 3QDMA 3GXDA 1IB5A 4XXCA 4Y1AA 2GC7C 5C7ZA 3UMNA 4B97A 1P6FA 2OCJA 2QV4A 3FT3A 1S78C 2CLRB 2Y69B 3P3TA 3AAZB 4GBXB 4H8WH 4MLSA 2A74A 2F5BL 1FO0H 1SLWA 2EQDA 2JKSA 3HFMH 2H3NA 4IIQA 5TDPA 2RIKA 4NGHL 1QSFB 4MX7B 2R7EA 4U1KB 1YMHB 3AWFA 1Y6MR 1HTYA 1FAIH 1W8NA 3ZTNL 4IEFB 2DQTH 3QFDB 4MAYB 3HS9A 4EI5B 3FQXA 2ZE0A 3OSKA 1CFQB 1HCVA 1P9MA 3MRKA 3IJSB 1NMCB 1FFNA 1S9YA 2GYSA 4HIJA 3O3BB 5IVXB 3O4LE 4D9RE 3K6DA 3PYCA 3MROA 3R19A 5B21A 1AQDB 5HHPA 2Y07L 1PNDA 3T71A 1FL6B 3QEQB 1U30A 4IMKA 1F3DH 3D6GA 4WF7A 3TBVA 2X53A 3VXOB 2D7QA 4Z7VA 2D4FA 3VWKC 1R5VB 3E8UL 2NYZA 4P04A 5DFTA 2WHVA 5C07E 2IWGA 2VXVL 3C8KB 2W07A 4Y2OB 3QT2A 4HOWA 4NCC2 4YHMH 3DIFA 4FQPA 3ZW3A 4ZO7A 1RZPA 1ZPUA 4NO3B 3RFRA 5FA4B 5D7HA 4W9FC 4AGLA 2IAAC 2VDML 5ICYB 1L7IH 3DHJA 1CD1B 1QFWM 5J3HC 3UBHA 1MWAB 2VDPH 2C9RA 3S0PA 3Q8CA 5DZVA 2HVJA 3CQFA 4PCKA 4ODWA 3QNZA 1PQZA 4GLRI 4JRYA 1ODUA 3D39E 3MLSL 4DUVA 5KSBF 2DH2A 2QHLA 4ZRGA 4NZDA 4CRPA 3S3CB 3P4NB 3Q05A 2F8IA 1ZS8A 3O6LH 4NQVB 1HXYA 2B59A 3PL6A 4NQCA 1DN0B 2FLMA 5A40E 1TMQA 1IC7H 3WJLC 2X7LA 5E2WH 5SWQB 5I6XC 2P5EE 2P5WE 4JFHD 4DN4H 3CSTA 1AXTL 3ARBA 1ZXKA 2PP9A 3TEUA 1OGAB 1SLVA 1RK0B 3CZFB 3LQZB 5BRZE 3O2DH 1OSYA 5EBMA 4ZOEA 3MRGB 2R8SH 3IT8D 2YWYA 1FORL 4U1LA 1DQLL 3HKFA 4WY7H 4KK9C 2IH1A 2FSDA 3Q1SH 4O51B 1NC2D 3I50L 1OTTD 2ITDA 1JAEA 4AQ1A 5I15H 4PJAA 4K94C 4DCQB 3WKYA 4M1CC 2R23B 1I1RA 2YUWA 3QO0B 3L45A 1Q0EA 1UWGH 5FPIA 1T2QH 4OT1H 2W91A 5AWNH 5EIIG 2ARJB 1TQSA 3MOAH 3P0GB 4U49A 3LDBC 5GGVH 1NINA 3UJJL 3V6OE 3WS6C 5D4IA 2Q6WB 1AO7D 1I7ZB 3KVDD 4H25B 1QI5A 3LQAC 3Q9QA 4TQEL 4HIQA 1U3JA 2DMCA 3BN3B 2ZXAA 3B9DA 1MAML 4WU5A 3SBRA 2CUAA 1X5MA 1IZJA 4HKZA 4KKLD 4XXCC 5E7FA 3D85A 2J20A 5TGBA 4J3OC 4GRLA 3AACA 2BSEA 4M43H 2A74C 2X6AA 1KBKA 4LLVB 1MCNA 4I18A 3GB7A 4FCAA 4PFEA 1A6ZB 1AGDB 4DVRH 5AW9B 3O6FA 2N7AA 5E4AA 4GQQA 3D33A 1ADQL 1UKQA 3MRMB 3CFUA 1NGYA 4AYID 2DDQH 3OPZL 3TO4C 2DJMA 5LNEA 4TXVB 1JPFB 1GOGA 1MIMH 5A43C 4JDTL 5F0PB 2AXFB 3SY0A 1KYUA 1YEFH 3BZ5A 3NK4A 4UIKL 5F7YC 1JZ5A 3MJ6A 4K8RD 1NCBL 1CE6A 2F7RA 4RDQF 5LJYH 1XSKA 4KK8D 2LU5A 4YXKL 1G87A 4GW1A 5DYOA 1A7OH 2ZXWB 3VDAA 2AJUH 2CO4A 1XSIA 2J44A 3HG3A 2YGQA 1OK8A 4ODHH 4Q14A 3ZTDC 1XGZA 2F0CA 2RA1A 5E8NA 5BV7C 3JTTB 1HILB 2WVVA 3VCLA 2A6KB 5B1KA 2VQ1B 2ZOTA 5FW7A 3RTQA 4NUGH 1JPTL 1V7NL 5DFAA 3BWZA 5KS9E 5CKGA 5L0QB 2VISB 4F7TA 3MNVB 1QFWL 4BSJA 3L2MA 3NCYS 4JFEA 3PXLA 1JRHI 5KBLA 3FU6A 3OB8A 3VXMA 5KVEH 4QIRA 1OLZA 4TPRL 3N42F 3ULUE 5IBUB 2WWKT 3OJDB 2ZOKA 2KBGA 3BVNA 3N3EA 4LQ1A 1WD9A 2KUTA 3RI5F 4JRFA 3EFDL 1Z7JA 1FG9C 5IQMA 3EHBB 4XB8A 2IMMA 3MJ8A 2H8PA 1Q1JL 5C0BE 4Q0XH 1PJWA 5E4EC 3ARBC 5IWLA 5H2BA 5C07B 5CBEA 1MREH 2K9FB 1A6VH 2JJUA 3VXPB 5ALCH 2N7BA 3VFTB 3IDJB 4WUUB 3MBWA 3REWB 3WY3A 5A16A 3SDAD 4YBQD 4C4BA 4YS4A 2OMZB 2ZWSA 3CFBA 4GO8A 4S11A 2DKMA 1PZDA 1CDHA 3DECA 4M3KB 3LNGA 4NOFA 1ZLUH 2CIKA 4AQ1C 5KZCB 4W4NA 3C2AH 3F7VA 2DQGH 4F2MA 1B0RA 2IDTA 5GS1C 1AAJA 3QA3B 4GSQA 5I1CL 3Q01A 1WK0A 1CI3M 2O30A 4G9DA 4YEEA 2VAAA 5D93B 4CKVX 4JG0H 1U8NA 4R7NA 5DC0A 4YMPA 4H20H 4M61B 1F4YH 4CMHC 1D5IH 3B56A 3ZKXB 1E6OH 1NBYB 1L9MA 3LZFL 4QXTA 4NXSA 5A2AA 3E3QE 3MRIB 5HDOA 4KKNA 4YFEA 1NA8A 2R2HA 1MW1A 1WWBX 2O93L 4M93C 3DX6B 2X2YA 1LEKB 1OPGL 4GFTB 4P2RD 2J56A 5HI3C 3UTTE 1L0QA 3BVTA 3G5VA 2VDOB 3C6EA 1QVOB 4GRLC 3RVVD 3VXSA 1IFGA 2ICEA 3VM5A 3RWFA 1IGTA 1DBBH 1KCRL 2PXYA 2ZICA 2C34A 5IQ7L 3VD2A 5EU6D 1KXQE 3CTTA 2NTSP 5AW7B 3PHSA 4JUSA 4F8PA 3IXTB 3FCUB 1DQQA 3WIAA 4G9FA 3DTUB 5I26A 3U79A 3QJSB 1RURH 2VN4A 5GS0C 1B6DA 3JV4A 5HYQA 3GBLA 3IE4A 4FQ1L 4I0KA 3QC6X 1KNOB 5JPNA 2OTPA 5KANG 4DO6A 3WY2A 4HWBH 4JZJB 1D2OA 1BQHA 5IB5A 1DVFA 3MRFB 4W9IC 2OTUB 3IF1A 4KI1A 3VWJC 3B5HA 4YHKH 1EHKB 1OW0C 1XZ0A 3DI2B 2GJ6A 3JWOC 3PWJB 4IYKA 4X8GA 1EEUA 5ACLA 3LKRB 1GGIL 3QORB 2VJXA 4M7ZC 1TT6A 2QSTA 1TJXA 3EJPA 4NO2A 4LCWD 1YNKL 1H19A 4AYBA 1MWAL 2BVUA 2NUPB 3RTQC 5F96H 3KJ6H 4N0YH 1CQYA 3Q3GA 5CP3H 3PV6A 3HI5L 3MUGB 43CAA 5KG9A 3N44F 5D9SB 3PU7A 4AK2A 5E95B 2PWHA 5DD6A 2UZIH 3FB5B 1N0XL 1R3JB 2HJFB 3QRGL 4FOMA 3HTLX 2VE6B 1QNZL 5IT2H 4LFHD 4G6JL 2X09A 2CUMA 4URKA 2VTFA 1MHCB 3WS3B 2L8AA 3PWLB 5EZJA 4NNYB 3UC2A 5E24E 1EQWA 4MJIB 1AZNA 4NNPH 2A6JA 3ARDD 1X5KA 4NWTL 2Q2LA 1WZMA 2F53E 3E38A 4NJ9H 5ETUB 4ZX3A 1FYTA 2WLNA 1U8JA 5JMOC 5LN4A 4S10A 3H3PH 1KN2H 4R0LB 4PJ6A 4N0CC 3WO4C 4PCYA 1BMWA 1GYUA 2VKXA 5I1IH 4MQXC 2COVD 4GBXD 4WQOA 3QG6B 4YLBA 3TBSB 2B77A 1QSFD 3ILDA 1IVLA 2EDFA 1I9RH 2H9GB 3F6LA 4KJQC 3V4VA 5KAQF 4POZD 3VGBA 4ATTA 4X5WB 1CLOH 3F7RA 3H1ZA 4MAYD 5KJ7E 1E4WL 3NP4A 4EI5D 2Z92A 4M7JH 1QWUA 5TK2A 1MFUA 4Z7WB 5KS9B 1Q9OA 5EORH 1KGIA 2QKIB 4RFEA 4GFXA 2IAND 2MOQA 4JRXD 2WO4A 1U8MA 2H32H 4I4WA 3QEQD 3I9AA 1PZ5B 5KOMC 4S1RL 1TZAA 1KIRA 1O9WA 3JTSB 1WHPA 3VXNA 4E42B 1CFSB 2BIMA 1C12A 2JIXA 1EEYA 2DQMA 2XDHA 3RE0A 4PJ7E 3T6WA 5ADOH 4KVNH 4D8PA 1UD3A 3AFLA 3GRWA 3U30B 1U2YA 1B0GA 1B2YA 2CHDA 4AJVA 1C1EH 1UB6B 4M8RA 4FQQB 2QKSA 3LH2L 4PRHE 2AP2A 5C0BB 2DMBA 2MWCA 3PIQA 3EOAA 4F33A 5ISZD 1Z2KA 2IWFA 1RHHA 3BFOA 5K1JA 3QARA 5CCKH 4YDLC 4XP9L 5HGHA 4J2XA 5L7XL 1YEGH 1Z9SB 4MDRA 1IT9L 5FO9A 2PCFA 4U6VH 3VXQB 3GK8H 3KH4A 5EBWB 2ADYA 3NZ8A 1D5BB 2DQDH 3I9IA 1FFOB 1ZWIA 5BZDB 2J6EA 3AABA 2X4PA 1QR4A 4Z0BL 4ZMVA 1A66A 1QA9A 1ONQA 3BQUA 4TNVK 3GXTA 3ZSSA 5I5IA 4E0RA 1FZJB 2QSCH 4GIAA 4JW3A 2FECI 5CIPH 5TDOA 3EFOA 3GIVB 3TJPA 4ZS7L 4N1CA 4AGNA 1DVFC 3ECWA 4MKTA 4ZXBB 5C0AA 1TDQA 1R3HB 4X4YA 1OGAD 3IK2A 1OAUH 4K3HA 2XKSA 4UQDA 2FJFA 1MCCA 4YL4A 1MEXL 3IJHB 2AJ3B 4YDIH 1LVEA 4S1DC 2B5IC 2JKWA 3KMDA 3HN8A 4EKXA 3V5DA 3UTTB 2B14A 1UVQB 3W0WB 2PLTA 4NFDA 2O5YL 2B2XH 1DSWA 3IRZA 3U7WL 5HHOB 1EJ8A 3O6KH 2IDQA 4YHLH 2F9BT 4LSQL 3VFWB 5LXGH 5HGAB 3ZYIA 2XKNA 4WI0A 2ISDA 2UXGA 3L3IB 1Q9WB 3BDYL 5LGHL 1NCDL 2VMFA 3G5XA 3QDJE 4Z0XA 4XC1L 2QQNL 4WFFD 1Z5LB 2CRZA 2WQUA 2HRPL 3D18A 1PKQE 2LLLA 3P0VL 4J3OG 4J8QA 5D55A 5DUPL 1PIGA 2NY0D 2DRUA 3PHAA 1JPSL 4LVNB 1NCGA 3ULVH 1NPJA 2A0LD 3CFMA 2J8UA 5B3SB 4XP1H 3NN8A 3O3EB 1T0OA 5HDQH 1IGJA 3PJSB 3RUGA 2GK0A 1NANH 4B5ZA 2ESVA 3O3DB 2FWUA 5DHMC 5JHDA 2FX8H 4A7GF 5DZ9A 4MJHA 3CVHH 1G7HB 2WYIA 1HIMH 5CSGA 4ELKB 2NXZB 3FUMA 3NJGA 2DWEA 5FKAA 4FFYH 5KYNA 2E6JA 3QCTH 5DD5L 4GMSH 3QHFH 4NKQB 2Z6FA 5HHME 2Q76B 5K33A 1OCWH 2BW4A 4H0LC 4IRZL 3VH8A 5DJ0B 1N6QH 1DQML 4EUPA 3MA9H 4LPTA 4GUPA 1D9KD 3CMGA 1ZTXL 4TTDD 1XVSA 4YIQB 4R9HA 1F4HA 1J0ZA 2O6CA 5C1MB 1RI8A 2HFTA 4IBWA 4Q9QL 3UYPA 1MCOL 3AITA 1XR9B 3GSNH 3CVDA 4U3CA 2MNWA 2VDOL 2XZQL 2F53B 4TNGA 5FHBH 4PI2A 4XN7A 3KL0A 4HCRA 2LQRA 5FECB 2EADA 2YA0A 1UURA 1ZLUK 2X4OB 3LKQB 2R4RH 4O2FA 1THCA 3MUHL 1BIIA 4U6XA 2EVFA 2F6AA 2AJXH 4JFFE 2XN1A 2LAAA 4TVSa 4W6YB 3HMWH 5L6YL 4WFEE 2Z4QA 3GSXA 4OFKA 1ESOA 5LG6A 3WE6B 5J89A 2ZSVB 4JL1A 5TDNA 4F20A 1GKEA 4KHXL 4OFVA 1MJ8L 4OI9A 1K2DA 2F7OA 3TFKD 4UQ3B 3GEFA 3JT2A 2GBVA 3MCKA 1Y1UA 1BWMA 3FU7B 1X5LA 3EO0B 2P46B 1HXMB 2ZJSL 4XNXL 1OGTB 4HMCA 1TZIA 3T1WA 3EHBD 3ILQC 2EH8H 1DANT 1YY9C 3ARGA 2DQIL 4TM9A 4DP8X 4AM0Q 3EYSL 2AI0H 2XQYA 5KW9L 1LK2B 4WUUD 5DC4B 4DGIH 5I2IB 3ZQWA 4PRHB 1VGEH 3QUMA 2VWEE 3AZUA 4ODTL 1GW6A 4FNLH 3L3HB 4J28A 4K5PA 3ZZQA 5CINH 1MQKH 3C9NA 4UTBA 1ORQB 1M6OB 2RMNA 4XMXA 2DM3A 1X7QA 5CEXA 4JM2B 2XPGB 3H3BC 3C5XA 1KTDA 1PDKA 3Q5OA 5I0DA 4P3CL 4F1SA 1JHLH 4UNIA 1NC4A 1CGSH 1JZJA 3J07A 2YARA 3C5JB 1KELH 6PAZA 2VDLL 1H8NA 1BBJA 2WBJD 1IC1A 1W8OA 4WHYG 3C5ZA 3SPGA 4JQIA 1RJLA 5E8OA 4LKXB 1JZ4A 1HHJB 3D0LA 3D25A 1EZLA 1NDTA 3NUKA 1C7TA 4HK0B 4NN6C 4JG1L 2HT4D 5MEPA 3PPSA 2G2NA 2PF6A 1RLWA 1TJMA 3ARFA 4L29B 3S5LB 4JO1H 1I9JH 5KJRL 1HOCA 5ERWA 5C6TL 4GB9A 3G04A 4P4RA 2WXPA 4X6DF 4XXDA 5GRVK 1YSOA 5FW8A 1M1XB 4LCIL 4L1TA 5CFAA 4XCFH 1E0OB 4L3AA 4P59H 3ULUL 1N2RB 3PWVA 2CD0A 1ANUA 5M7QA 4MNHB 3W5NA 3T6ZA 1WAAA 3VTMA 3HC0B 1S9KC 5KOVC 2X1XR 2Q9OA 5ITFA 4IBYA 1PBYA 2EYSB 4M6NL 3R18A 4X4ZA 5EZOH 5FDYA 1DL7L 4MA7H 4TN9A 5DJZA 3E2HB 4QRSA 3QORD 4UMGA 4XWOD 3VGEA 3RKPA 5ELIA 2QGDA 3HBZA 3HUJB 3MA7B 5TFSH 3V0WH 3TNMA 2FWSA 3P3SA 4PJEA 5KJ4A 4PJ5B 2A9NL 2WJ7A 5GZOD 3CZJA 4N6QA 1TO4A 3KPMB 4JG9A 2K8MA 2K3HA 2AXGA 5DF0A 1L0XA 4ZTPH 5EEWA 4CA4A 2A9CA 3ZMRA 4APQA 2YPLA 4UQ2B 4CVZA 2CNYA 5GSVA 3AT9A 2H3KA 4MA3B 1INEL 2VR8A 1UM4L 1MCSA 5F3FA 4DGWC 4YX2H 1WZ1H 4MJID 3L3DA 1BEYH 5DK3A 1AQMA 1HWHB 4S2SB 3UTQB 3FS9A 4U4IA 1LEGB 3ARGC 1QBLH 1QFWI 4LVHB 1AD9B 3V5KB 1K4CA 2R69A 3PWUA 4ES9A 3ZHNA 2JI1A 2VL5A 4R4FH 3Q6GL 2PR4H 3O6MH 4M7LT 1BSIA 4OIBA 2O61A 3A6CH 1XZWA 1PG7X 2CMRL 1KLUB 3RZCB 2Y24A 2A77L 2UZYA 2G3ZA 3TCXA 4NQQA 3CDFA 4P23B 1RZGA 4OCMC 5I1LB 2F74B 4GG8A 4LSTL 3PP4L 1GC1H 1QASA 3IGAB 1EGJH 3X1FA 1XF3B 4OVUA 2P8LA 1PLAA 5IKCA 1H3PL 4G11A 2J71A 5DD1H 5FGSA 3E9TA 4XPGL 4PJIB 4XT1C 1FSKB 4YQXH 2FJSA 3U4EB 4L2YA 5FR3A 5L4JA 1QO3B 3F7YA 4O9HH 3ZKMD 4HZ1A 3M46A 6CGTA 1DLHB 3VI3B 1IFHL 4ILDA 4J3TA 4NBYB 2WQWA 1S7XA 1E8XA 3UPRA 4AYEC 3C5ZC 5KWYC 4G1MB 3BW9A 2W9EL 3BPCB 4XC3L 4D0DA 2A83B 4WO4B 4DPAX 2WQXA 3PREA 5IMLA 2EKSB 3GSUB 4QWWD 1DQKA 4HJUA 4JO8A 1PVHA 4UT6A 2BVQA 4EVNB 3PHQA 3K4DA 4P4KB 2WQSA 4O02A 3ARFC 3VFMA 5EMYA 2JWYA 5GS2H 2G3MA 1YYCA 2NY7L 4ZUWA 2AEOA 1JXDA 5FYLH 3G6JE 4PJGE 1BQHG 4FXLA 4N1HB 4K73A 1OP5K 3TYGH 1OARH 3MRPA 2H1LM 3D0VA 5E9DE 3BLKA 2Y23A 3PJNA 4DP4X 3TPUB 1NPUA 3U36B 2N0KA 3KPRB 5HY9B 4ZXBD 2B7DT 3BH9B 3BJ91 3IGUA 1QSED 2HLFD 3KBFA 4PUBH 1IE4A 2WIMA 2CRYA 1ETB1 5IW1A 4E9YA 3LEVH 1TJGH 1DSFH 4NZUH 4DQAA 5LCVL 3CSGA 3IVKA 1K8IA 3HI6L 3MR9A 3ULSB 4LARH 4MAUL 3W0WD 1URIA 3EW3B 4HWNA 1YEJL 1J9TA 3BX7C 2Z4TA 3G6DL 4NUMA 5AW2B 4PJHA 4HISA 5FB8B 3EGDB 2QT6A 3QWQB 4BH8A 5HHOD 5K9KA 4MQ7B 1HZHH 4APQC 2QVTA 2H0JA 5E5MB 2YRBA 3P73A 3GNMH 4UU9B 3Q13A 4KXZI 4V1DA 2V2TB 3M8OL 2JKNA 2P24A 1XGPB 2JK5A 4L8CB 3D05A 5LGYA 4C55A 4FMFA 5GRJL 2XA3A 3FZUC 4QXUH 3LH8A 1TTAA 3VFVA 2DWXA 35C8L 3MRLB 2VITA 4JKWA 3R4DA 4K3JH 1G9HA 1RPUA 2OI9B 3DROA 4GT0A 3HVNA 1G5AA 3O8XC 1AMXA 2YPKA 1DBJL 4F8NA 2NY2C 4JPSA 4Y2DB 4WEBL 1A3ZA 4GOSA 2O26U 2X4SB 1DJXA 3MV7A 4U3XA 3D2UA 3HOGA 3LX9A 5CLWA 5I18H 1UZ6F 2I9LB 2NXZD 3GO1H 1TENA 5E2TH 1XF5B 1DQTA 5EZLA 3SKNA 5H37A 5LBVA 5BMFL 4OM1L 3WLBB 3GKWL 3AS2A 3I85A 2XV6B 4OGXL 4UOW0 1BVNT 2LW3A 1J1XH 1B90A 3M07A 1X9LA 1UXLA 4GXFA 2IG2L 4U1GC 1ORSB 2ZD0A 4G5AA 1BOYA 4FZEH 3NOIA 1OVZA 4JFYB 4L8SB 1H8LA 3G9AB 4FEMA 2ZX9A 4PY7B 1IVTA 4ZO9A 1YEHH 1E28A 1LP9E 2MHAA 3LSOB 4O58L 3NJMA 4L4TD 2Y9RT 3SDYH 4BQCA 4PG9B 3PNWB 1UB5B 2P8MB 3BT2L 2EEFA 1BMGA 2VN7A 1N9PA 3MLUH 4JE0A 3NCWA 2Y4SA 4G1EB 4ADJA 2C1PB 1E2VA 2UY7A 3ETBF 3H9SB 3IXAB 3S37H 4AYSA 4PWFA 2V17H 4U6YA 4MB4A 4MVBD 4MCZB 3DLQR 3MBEA 3HR5B 4XMPH 3STLB 6PCYA 3UAJC 3T77A 2BP8B 3CIAA 5B38A 1M3JA 1TZGL 4WK2B 3QJHA 4AC4A 4UDTA 5D7KD 4AM0A 5J12C 4Y9CA 2X89A 3FN0H 5HDBB 1XR8A 2KERA 1AKJA 3FONA 4KAQL 1KTKE 2VM4A 5EF3A 2LHAA 2A6IA 3DVGB 5J5EA 3O11B 1HHIA 1OK0A 3LYRA 4XVUD 5MEQA 5HPOA 1QAWA 4A2HA 5T5NF 3E7JA 2DS4A 6FABH 5AVVB 2FCBA 4W70A 4C59B 5KBPA 4RAUB 1LO3H 1JV5B 1UQSB 2CZNA 4M3JA 5F3HA 1EHAA 1E3XA 4HC1H 1ODAA 1FYHB 2D7TH 4U7SA 3K71A 2NSMA 1Z3RA 1MFDH 3L5IA 4I48B 4YGVA 3DPDA 4EIZC 2DWYA 5HHQB 3O9WB 4XO8A 4IS6A 3IDNB 5B39A 3NFNB 1ZV5A 4Y4FD 5C3IA 1OP3H 4FE9A 2BOBB 4UM9D 4ZPTA 1ID5I 1YHPA 2OMYB 5IB4A 5LXVA 1XD0A 2F8XC 4XGZA 4AJ0A 4AXWB 2IXQB 1M3IA 1A7QL 1DLFH 4G43A 3RJOA 5EPMA 3BP5B 4QAMB 1ZAGA 2LLNA 2BFVL 2XY1A 1I4FA 4NNXA 1SMDA 1DHKA 4PJBE 4MD4A 1BYOA 1N0LA 1U8LB 5JMRA 2LOEA 1YMMD 2C7UA 1TIUA 3QQDA 2A73B 3II2A 4P5TA 5DRWB 1QATA 4AVJA 5C0JA 2NW3A 4NJAH 3R7QA 3TEYA 1OSEA 5E2WL 3WIHH 2AEWA 4A7VA 4Z76B 4LLQB 1JDCA 2HTLD 2J3SA 1NLDL 3QZMA 1JS4A 4XPTH 4YN3A 1RJZB 2OR7A 4H26A 1AS8A 1YN7B 2YKKA 5I1AA 3H2QA 2CO2A 4N2HA 4D94A 1P2CB 4Y88A 1MI5E 2EJ1A 3K4AA 1CDYA 5AW1B 2IGLA 1FNGA 1T1WA 4UV4H 3UBXG 5EA0L 5I8EA 5I0XA 4EUPG 1WQVT 1YJDH 3FK3A 2IJ0C 1B2WH 1ZLDA 4A2GA 5MENE 4HPYL 4TQPA 5GGTA 2E7LA 4JK0D 3PGCA 1XT5A 2LTQC 4ONGH 4NQXB 1KZQA 1UXSA 3S2CA 3ARPA 1JNNH 3ZDZB 2FGZA 3FHAA 5GGVL 1XWVA 2H32B 7FABH 4CVWA 3F7KA 3U9UA 4LL9A 1UOLA 2A4CA 5EU5A 4AQAB 4BJLA 4IGBC 1IC4H 4RFOL 1OHZA 1XSOA 5FO8A 2W0KA 3I9GH 4YDZA 3NEEA 3SDXA 2XX1A 5E8EB 4K3GA 4KGJA 4GIOA 3E6FA 4DK3A 5AB9A 4PJ5D 4D0BB 4M43L 5CZVL 3ME0B 4UUJA 5LQBL 2CHZA 4JX0A 4QXWA 3BP6A 4UYQA 4MNQA 2W9DH 4JHAH 5JHAA 2Z8RA 3IDMB 1J11A 2JLPA 4GKOA 5SWSA 2B15A 4HHAA 5HGGS 4B5EA 4PJFA 5K59F 4WEUD 4L9LB 1FLRL 2RH0A 3CCHB 3WNLA 4IHOB 3KJ4C 1MIML 4NHUA 3GHPA 5I1DB 4NO0A 3QIUB 3H2PA 3OKNB 3CFQA 1CICA 1YQ2A 2WLIA 5DR5L 1IM9A 1W72L 2IALB 5T33H 5BVJB 4HWZB 2DI9A 2XQYG 2YRZA 2AEQL 1WPCA 1TLKA 4FEIA 4PSRA 1EERB 5EOQH 4E5XB 2B4CH 3MV9A 2XXMB 3T6VA 1LP9B 5CIPB 3NGBB 4R5VA 4GP4B 4NUPA 1F11B 3FUIA 1RUPH 1CGWA 2DLFH 1XGRA 2VQUA 3CC1A 5LHDA 1YDPA 4YEFA 3RZCD 4KKCD 2EDLA 3UH8A 1LWRA 2WVSA 4OTXH 3HRPA 4MXQC 5KSAA 3AREB 5I76B 3BXNA 4LLUB 5HVHB 1YNLH 1T7YA 1TTCA 1ADWA 3FULA 3DC0A 2DJSA 5BV7H 2XWTA 3FQ4A 4I77H 4POYA 2XN9E 5CLYA 3D48R 3TN0A 2P28B 3I2CL 1VKXB 3DX7B 4PJXA 4Z7QF 2HMID 4YHNA 5DJDA 4AEHL 1ES0B 4N8PA 3RU8H 2I25N 3DJTA 5DMIH 2VSKB 3DKHA 3EYOA 4MCYB 5EG6C 4CW1B 3IWVA 3TASA 1S7UB 1W91A 3FF8A 2WLKA 4TUJA 3GS0A 4WO4D 5FWQA 1A6VL 2EEAA 3P77A 3U7YH 4JGJA 3BPOC 3KXFA 5ALCL 1KTCA 1XCXA 1C16A 3NZHH 3N6YA 2E75C 1AGFA 1VFAA 5ID0A 6TAAA 1QTYT 2ZQKA 4KTDH 3RI5K 1DQIA 2FD6L 4GW4A 4LCCA 2V2WB 5D5ME 3VYNA 3E1F1 3VQ2C 4QKXB 1CFTA 2QGCA 3C2AL 3RNKA 2X88A 3LXCA 5KSBE 3MLXH 5ENWB 1NBZA 3EDFA 4YHPB 3PABA 1EDHA 2CR0A 1FNLA 2IVFC 2E7LC 1DJZA 2WKOF 3SODB 3ARRA 4KVCL 3TV3L 3ZE2B 4PJDF 3HS0A 1D5IL 5JOFB 1E6OL 4LQFH 3KPRD 3WTYA 3K2UH 5IW6B 4MNGE 1IGCL 5DS8A 3BPLC 1ZHNB 1ZMYA 3MOBL 4LKCB 2B1HH 4RAHA 5IG7B 2APVA 2HPOA 1XTLA 2VO8A 4QRQB 4X99A 1HH6A 4YVUA 2YFOA 1T6VN 1U3HD 5ID1A 4FA8A 2YZ1A 3BWAA 2OTWA 3KWWB 5DTFB 3SYOA 1BFTA 3QIBA 2VO5A 3R06A 2WB1A 4FXGB 1HYSC 3OGOE 4U6HA 2VLRB 4HIEA 4ZD3L 1MCHA 3C87A 1KY6A 1MJUL 3RG1C 3D50A 3QIWB 4WHYH 5C70A 4L1BA 5EUOF 3PHOA 3EIFA 3VFPB 2R56H 4N68A 1LILA 1CGYA 4WTQA 5J1AB 2EUWA 1RURL 3B34A 3EUDA 4XO5A 3TBWA 3TNNB 2I5YH 3SDDB 1CICC 1ZT4B 2IBBA 2VN3A 1YA5A 1Y0LB 3OMIB 1MG3C 5DRXA 4GAGL 1PZBA 3FDWA 1OCRB 3FL7A 4BV1A 2ZX7A 3EOTL 2IV8A 1FL3B 4X6BA 4YHKL 3W11C 4MSWB 4ENED 2V5SA 3FFCB 1ZANH 2PCPA 3GLEA 1JPGB 3HC3H 3KPPA 3UJIL 5I24A 2WMPA 2WWMC 4Y2DD 1FFPA 1Z0NA 5CGYC 2NY3B 4L37A 2N59A 3KVQA 2HCZX 5DUMH 5KSAC 1EAPA 1SFDA 4P5MA 4MBRA 5JLZA 5F96L 1PAMA 3MFFB 1KV3A 1R3KA 1S3KL 3TWCH 3KLDA 3GTVA 1RFDH 1DDTA 3TN0C 3BGAA 1W2KT 5GGRA 4FG2A 5EEXA 3WTVA 3HPJB 4GQ9H 5GSRA 4XX5A 2F54E 5D7LA 5EOCH 4R8WH 4G6KH 3IDIA 4R84A 1NLBL 5GRVL 1ZRUA 3ZL1A 4PGZA 1MLCA 5DRNB 3TWYA 4MA1B 1H9DA 3WTSA 2VXTH 1RERA 2X05A 3KPOA 3EDKA 4Q58C 5D1XE 5C09B 4HETA 3ZUCA 1G7QA 1GYVA 2WO3B 3U9WA 1A3QA 2YOAA 3VFNB 3Q2VA 5I1IL 2AQNA 3DMMB 3FO1B 3H9SD 2IGFH 1G9EA 3S88H 2DM2A 5JXAL 4UV7H 4OF5A 3QXDB 2CHWA 2WIIA 1MVUA 3BH8A 2HLAA 4PWKA 3TT1L 3QFGA 5F7WC 2MQGA 2UXTA 2BS9A 4LCCC 1LO2L 1OB1A 4RISH 3WAJA 3CX5K 1A9EB 3GRGA 2PPDA 2B20A 4YUEL 1CXHA 3P9WB 1N4XH 2AQSA 3CH8A 1A3LH 3HNVH 1FBIH 4OI8A 4LASH 3DSFH 5KYUB 1EX0A 3VJ6A 2BOCB 2Z0BA 4OFYD 4OQTL 1IGIL 2OM5A 3OKLA 4OD1H 4Y5YA 2ARJQ 1J9SA 2R0KL 1LK3L 1NEZB 5DMYA 2E56A 1IV8A 4L3CA 1KCVH 2DKSA 2FBRA 3L4VA 4LVOC 3SGJA 4MS8D 1UZ8B 3FQ2A 3O9WD 4ZMAT 3ES6A 2VRAA 1U95A 2ZNXA 1YPZF 3PGFH 5CXPA 1BVLA 3E0GA 3S48A 3S7GA 3KPLB 3VE0A 4Z3IA 1S7TB 5TPWL 1YEGL 1FCGA 5K69A 3D87B 3OVUB 3FT4B 1JYXA 4YSOA 4DNLA 4H0HB 4OIAA 3CUPB 4ZUVA 3BGFC 5FLUA 3GSQB 3TBBA 1CQKA 2X3AA 5CSBA 2I7OA 1DBKH 3EO9H 3CZGA 5KSBB 1VA9A 2YD0A 3CFKB 4HGWA 1I9IH 3BIBX 1VZIA 4HS8H 5C3LD 2ATKB 1A3RL 3L7EA 2X2IA 1JVOA 4IM8A 1FL5A 2BZCA 4FHJA 3SHSA 2G30A 4RH4A 4JG5A 3CX5J 3V5HA 4YAQA 4LGPB 1UH2A 3H4HA 1NICA 1URLA 1WRFA 2OULB 1HL8A 1SHWA 4XP5H 3NPSB 5JUEL 5H37G 2J5LB 3SQBB 1J5OL 1F1AA 2X40A 4RGNE 3QCUL 4M48H 4MASA 5CEYA 1JZIA 3WV0A 1WFUA 3IBOA 3OAUH 3CHPA 4YSDA 3M17A 4DOHB 4YHLL 1Z3GH 3LZPA 3FAWA 2ZP0T 1UJ3A 1M9SA 1UKSA 5AKRA 1TR7A 3E8VA 4ZPVA 4HV8A 1ZLSH 4BUHA 1XH3A 4JFZH 3AGVA 1QUNA 2DM4A 2OX5A 2KH2B 4TLKA 3MV11 2H2PC 3ZU8A 4CVXB 4L5FH 1WZLA 1CLYH 4ETQA 4OFDA 3W39A 5AVYB 3WJMB 1SUJA 4KZDH 3GLAA 3QHZL 3REVA 3SDAA 4KMLB 3MRRA 3U2SA 3Q2LA 3NCJH 4MJ6B 3T5WA 1J05B 3F62A 2W60B 3GMRB 4WZ9A 5D2LF 3CHXA 4DESA 1FGNH 1OTTC 5TQ2H 4M62L 5IFJB 5I1GH 2HT2D 5B38G 4G42B 2ZPKL 5F2FA 2WD0A 1KFAH 2VSMB 3BP7A 4AYFB 2NT0A 2XYCA 4DW2H 4EMZA 5B3JF 1BZOA 1DUYA 2DD8L 1UTDA 4N26A 1HIML 1N10A 1H3VA 2ATPA 4H8UA 4RZCA 2W65A 4YBHA 3SJVB 3TIEA 1A7PH 3RWJB 4FFYL 3SD5A 4CNIA 2J1YA 2YQ3A 4OCXH 1MHPL 1O0VA 3FQTA 3LV3B 2CLZA 3QIUD 3F84A 3KWVA 1SJEB 2NYKA 1KMGA 2E7CA 3QISA 4BZYA 1YAIA 3MA9L 1S9XB 2WTRA 3BUYB 5L4MA 2P7TB 5A2CA 4Y5YC 4P2RA 4KKLC 2XIDA 4BIKA 2YD4A 3EOBA 5B39G 1I85A 4QY8A 3AADB 3BWUC 4JREB 4M8VA 4NQEB 2XN2A 3TVMA 2NUTB 5EU6A 5FA3A 5HJ3A 1EO8L 5I73C 2CNZA 4QLRA 3QQ3A 5FF6A 3ARED 2R2EA 4A2DA 4LAQH 3BLBA 2AJXL 1T0MB 3IU3A 3SBQA 3FAXA 1BQ5A 3QDGE 3WN5B 3M86A 2BY1A 1KJVB 5JHMA 4K8RC 4E36A 4NHCL 4E9WA 1WEJH 4N9GB 3N42B 1QI4A 4I7ZC 1SYVB 2ICWI 4R4ND 4BQ8A 1BP3B 1BQSA 3WFZA 3DOSA 5C0RL 1OL0A 1KF9B 3NJIA 2DBJA 4GSUA 4OZGE 4YE4L 3VFOB 3E6HB 3CDZA 3MGTA 3QJXA 5IV2B 3T0XA 2J8HA 1SMOA 1CFVH 4GAAA 2NW2B 3V9FA 3NCMA 4JCMA 3T0ED 5BJTA 1A47A 1KB5L 2DQFA 3MLWH 4NAMA 2AI0L 1KB3A 3ULVD 1W15A 1DQVA 4MCNA 1E4XH 1NCIA 2ZCLL 1UH4A 4HFWB 4KMTL 1E8YA 1PG7W 1B9KA 4QR7A 4KH2A 1MQKL 1SDAB 1Q9KB 3ZSTA 1N12A 3VGGA 4WV1A 3BUQA 1UGKA 2VC2B 4N85A 3LZOA 3WMQA 3ML8A 4M4RA 3CNKA 4ZFFA 2XZAH 1JGEB 4WDIA 4GS7B 2EDDA 1H3XA 4RX4D 2ZXEB 3OKEB 3WUWB 5GIRA 3F83A 1QRNE 2JKJA 3F12B 4JFDE 1FIEA 5F7DB 1AC6A 3HHSB 5GZNA 1XO8A 4YXHL 3S5ZA 1XAUA 2CLRA 1I8MB 3AAZA 4GBXA 4JDZB 2X4RB 1B6UA 1MRDL 1QSFA 3SDAC 4YBQC 2BDNH 4MX7A 4UIMB 3FRPB 3OZKA 4U1KA 3U83A 3RIKA 1YMHA 4AQ8A 4BH7B 4RWYH 5DJ6B 5L4FA 4NPJA 4IEFA 1G7MB 3QFDA 3KLQA 4HULB 1SHMA 2MOGA 3WFBH 4MAYA 4H13C 4EI5A 3ZOAA 4FL4C 4HJTA 3WL9B 1CFQA 3CD4A 3IJSA 3PDDA 3FN9A 5IVXA 2VLRD 1NEPA 3O3BA 2OL3L 5KVGE 1JHKL 1AQDA 4OLYH 3SCMB 1G9ML 1ZLEA 1W0WB 1FL6A 3KPSD 3QEQA 3QIWD 4RAVB 1A6WL 1VCAA 3VXOA 5FGBA 4JKNA 1BJ1J 5D1QE 1R5VA 4RQQB 3KLKA 1UENA 4P59L 3MCYA 2BHZA 4GINA 3SDDD 5E08L 5JW3L 4OV6F 4X6FB 3C8KA 3FTYA 4B53A 4Y2OA 4MHHI 3ZL4H 1CZ8H 4LRNL 2TSAA 1CFMA 4PWJA 3S35H 3K6IA 2ITCB 1PS3A 1K6QH 1BBDL 4F9LA 2D9QB 4G6FB 4HAFA 2GSGB 3F6IA 1ACXA 4C4UA 5IJDC 5EZOL 3RVVC 3FFCD 4NO3A 1I85C 5FA4A 1CVSC 2V0AA 2ZUQB 3MGAA 2DEXX 5ICYA 2YMXL 1MFCL 1YC7A 1CD1A 3BYTA 2NY3D 4MJ5B 1MWAA 5F1SA 3W9EB 3GJFH 3BAXA 1TLMA 1OAQH 2CIIB 2UVEA 4JO2H 2VZTA 1B4LA 2WZ6A 4Z7IA 5C08E 3N44B 3HC4H 4M56A 3L9YA 4RVBA 3F8UB 1OQOA 5BRPA 1MCPH 3HNSH 4B41A 3P4NA 3DX8B 3DRQB 3S36X 4NQVA 2OMVB 4U4BA 1DN0A 5C71A 4KFMA 3KS0H 5SWQA 2Q7AA 5T3ZH 3RVUD 2NYYD 4GSDH 3BSZH 4YX2L 1OGAA 3CZFA 1RK0A 3LQZA 1BEYL 1TKWB 3UTSE 1GXEA 1AZRA 1E5UI 3ARTA 3MACH 5G4NA 5D7JB 3AQXA 2HJLB 5C09D 3MRGA 4N0UE 1E9OB 4ODVH 3GXPA 1YUKB 4WUKL 3LKSB 4O51A 1SXCA 5D2NB 3KW8A 1KGJA 4HJ0D 3QS2A 4JQVA 3BZEB 4DCQA 2R23A 3QO0A 2WWOA 5B4MD 3S2AA 2QFPA 1GH7A 4GMTL 4R97C 2BHFA 2VSDA 3FCSB 4CN4A 2OSYA 4K71C 2ARJA 4HXBH 4L4VD 1SN2A 4I88A 2BRRL 3ARVA 3CBKB 2Y72A 3K81A 3QUMH 4WV1C 2Q6WA 5EF0A 1LO4L 4AGOA 1I7ZA 4H25A 4Q9RL 2PUQT 5INCA 1EZVX 2ZOWA 5I1EL 3ARDC 4JFQB 2VN5A 4YSUA 3KLSA 4UTBH 3HVDA 4ZMLA 5IR1B 1Z0MA 3OZ9H 3KZ8A 4ALAL 1I3GH 4JPKH 4OCRH 5GZNC 1IAOB 3POCA 3UPAA 3PRZA 2ZXBA 4YHZL 1G1OA 3LNFA 4GBXC 4HGKC 1BXUA 4WKXA 4LLVA 1A6ZA 1AGDA 1X5XA 2R15A 2VDRH 1X4YA 3GBEA 4POZC 3V6FB 4MWFB 3MRMA 4MAYC 4EI5C 1KCSH 4CSZA 3S4SG 5FDWB 4RA0C 4YSQA 1NMCC 4ERSL 2SODB 2NTFB 1JPFA 2VR7A 1RUQH 3AUWB 2AXFA 2WZAA 2YMOA 3IM1A 1QLFB 4EDWL 4BFRA 3WOVA 4QJ5B 4J27A 5FGBC 4RMBA 5FYLL 4KO9A 1KYAA 2ZUSA 3O0RH 4JPWH 2F7IA 5DQ9B 4HUNB 4OJAA 3ABKB 4P8QA 4QJ3B 2CA4A 5DJ2B 2I69A 5EC1B 4F9LC 1RJCA 3I3EA 4OJYA 3JTTA 1HILA 3MRBB 4J6RH 4PGBA 2H4EA 4E9LA 2FQEA 3B1UA 2A6KA 2E0PA 2XG5B 4CADB 2VQ1A 4NI3A 4Y5XC 3F05A 2RD0A 4JCWA 1M7DB 1KGCE 3LEVL 3A4AA 4EN3B 1SZNA 3FSOA 1EDQA 1DSFL 2M1KA 4IMLB 4AEIL 1SXZA 2XA8H 2VISA 1FN4A 1AGEA 3U25A 3MNVA 3R7RA 3FO9B 1OAXH 3CSFA 2VMDA 1KPUB 4X6DE 2G5RA 1Z5YD 2PWEA 4BFIB 3D0AA 4M1DH 4UYPA 3OJDA 5E94B 4LDOB 1HZHL 4K7FB 1TTBA 4A6YH 3FC8A 2HH0L 2C3XA 1A6TB 2JH2A 2QADD 2XQBH 3QP3A 4FQJH 1IE5A 2A38A 4JFTA 3TCTA 2YPVL 4V2CB 2ERJB 3RP1A 3FO2B 2G2PA 2GHWB 2IDUA 3ISWA 4PB9H 5C07A 2Y7LA 4M7LL 4Q52A 3VXPA 5I1KH 1BW8A 5D6CB 1OOWA 3VFTA 5F7UA 3IDJA 4WUUA 3REWA 5CZKA 5L88H 2R51A 1H3UA 2G75B 2ZCHL 2Y2WA 4L48A 5DLLA 2OMZA 3VW3L 3W3BA 1R24B 3VD4A 2NY5H 4NKMB 4OD2B 4JQVC 1HNFA 3DJ9A 1NGZB 4LF3B 4BEIA 4K2UL 5I23A 3EYUL 1GAFH 3QA3A 2VC2L 2XY2A 3SJVD 5E2TL 1JF6A 2FSEB 4M61A 1CVRA 2X4TB 4IBTA 1NBYA 1TZHB 3B2VH 1UACL 5GS2D 5C08B 4IRZA 3MRIA 1N5YH 1I1YB 3FU8A 1HX0A 4OGYH 1MF2H 3GIZH 1WYJA 3BHBB 3MNDA 5FYLD 4ZMWA 3FJTA 4GAFB 2NY0C 3DX6A 5J13B 5ILTH 1LEKA 2XXFA 5F0LB 3AQYA 2FIRT 2A0LC 2Z8SA 1V7MH 1QVOA 2WUBH 3DGCR 3DX9B 3SDYL 4GG6F 1FWXA 5JW5B 4NZTL 3D4ZA 4NQED 5CHNB 3VDCA 2YXWA 1U3NA 1U6AL 1VB9A 4F9PA 3RX7A 4B6ZA 1TJHL 1RZIB 5FWRA 3IXTA 2DI8A 1ZLWK 4QHKI 1EK3A 4FNQA 2MOVA 1AZCA 1HVXA 4LU5L 5DZAA 4YK4B 5IGXL 5CJOL 1JWUB 1QSZA 4PLJD 5JZ7C 1KNOA 2YK1H 4D7BA 3BPNB 1EXGA 1ZGLB 4K0OA 2DYPD 5K9JL 1NFIB 1T5XB 4JZJA 4UT6H 3SIKA 1LO0L 1L7TL 1MCWM 5D7IF 4OW6A 5BZZA 1D9KC 5DMKB 4O02H 4TTDC 3FN0L 3MRFA 4XH2B 3V6OA 4MA8L 5SWZE 3WY4A 2OTUA 1ET5A 3NBNA 3PWJA 5GPRA 2CDFB 3LKRA 3QORA 5DURB 3K8MA 4J12A 2C3VB 4MXVE 2X9WA 4A66A 4XX1G 1J5CA 4Y8AA 1FG2B 4HC1L 4BKSC 2OXGB 3ALXA 1T6WA 4M5ZL 2NUPA 15C8L 3GPEA 4AH2B 3IETB 3L1OL 2X4UB 3GSRB 3MUGA 3IJ8A 3UEZA 3ZIMA 2H6UA 1YC8A 4KI5D 4XN8A 5D9SA 5L0QC 1QYGL 3MZGB 3QC5X 2Q86B 1R3JA 2HJFA 1HDMB 2VE6A 3O3AB 3RBGA 1IL1B 4ONFH 2KZ1B 3TFKC 3X13B 3ZR5A 5I0WA 3QXAB 1MHCA 1U91B 4HAKA 4ZUUB 3PWLA 4FC3E 4NNYA 3WS3A 4ELMF 1JPEA 1OLLA 4FHKA 4MJIA 1GHFH 3FB8B 2H0EA 3KDPB 5ETUA 3EHBC 5LBSH 2VLLB 4IKNA 2YAHA 2CCWA 3WEBA 2ENSA 3APCA 5AZEH 3UYOD 1Q8MA 4R0LA 1P7BA 2BC4B 4B9FA 4I0CC 4K23H 3CN3A 3BUDA 3CSBA 3QG6A 1IKOP 4NPYB 2DTSA 2H9GA 1XIWB 3ALPA 1JVKA 4X5WA 1I8KB 3JWDH 1HNGA 1TJIH 3GXUB 3DBSA 3S97C 4Z3FA 4X80H 4BK4A 1CK0H 4BCYA 4P46B 5KS9A 1JFQL 4N8VB 1OT1A 4IBQA 1PX4A 2QKIA 3SCMD 5IHHA 2MCAA 4NC1E 2Y1YA 4IRSB 5D93C 1PZ5A 4IBSA 2CGRH 4X6DB 3JTSA 4E42A 5DGQA 1CFSA 4KQ4H 2VM3A 3APMA 3ZKXC 2J1ZA 1YJDL 1NGPH 2GG1A 5EU3B 4MTMA 1OCZB 3UAAA 1C5BL 2ED7A 2WBJC 5J7CC 4BKLB 1UB6A 4X9GA 4FQQA 3IE9A 1MFEL 1J5HA 5C0BA 3TZVB 1F8TH 4X7SH 5BRQA 4TSAL 4PGJA 4ANXA 1IC4L 3ARSA 4C4KT 2HYMA 4F2MB 1VIWA 1P53A 3IFNH 2HT4C 1AI1H 1MCBA 1Z9SA 4RNRB 4BHUA 4U1NB 1PU0A 2C9AA 4F9PC 3MLVH 3VXQA 1JHTB 3DTXB 3T0BA 2WZ0A 1TFPA 1DCLA 5EBWA 3SO3C 1D5BA 4DFHA 1YEDB 3LPOA 1ZGLM 4OKVB 5F93C 1FFOA 1YAZA 2XFXB 5BZDA 3NIDE 1GIGH 5E00B 4ZTOL 1FNHA 1AHWB 4HZAA 1MCRA 1FZJA 3MX0B 3V0AC 3ZK0A 3OJVC 1JD7A 3SQRA 4GUQA 1O9ZA 4JZJC 2OK0H 4R5TA 5EF2A 3GIVA 1U2CA 3BI9X 3WEMA 2VW7A 3GMLB 3V6OC 4ZXBA 2X9ZA 3PWPB 1R3HA 2D31A 4LHUB 1HL9A 1NOLA 1MHEB 1OD7A 2GSMB 2ZAIA 3DHUA 4RGOL 2Q87A 3QORC 2IPUG 4OB5H 4XWOC 3EGSB 3IJHA 1U92B 4XCNA 5E9AA 5DDHB 4AG4H 1E5BA 5JA9A 3UTTA 5DT1L 3WFHB 2R0ZH 2EXWD 3BMVA 3H4FA 2I07B 3B2DC 2QZ5A 1UVQA 1CCZA 3O45B 3W0WA 5MHSD 1RUPL 3J7HA 3SE9H 5DZNA 4PRPE 5GZOC 4LEOB 2XV2A 1NL0L 1HKFA 1P4LB 5HHOA 5B3NA 4M02A 1JRHH 3VFWA 1KBBA 5HGAA 5KVGL 1MCLA 2GQHA 2ZTBA 3FB7B 1SLUA 2HKAA 3L3IA 1Q9WA 3FNKA 4P9MH 4HEMA 4N2AA 5IBLC 3V0HA 2MTAA 2GJ6B 4AJYV 3P11H 2Q7YB 3U6RB 4ACTA 5AAMC 1Z5LA 1AE6H 4QRRE 5K9QI 1TITA 4ABVA 3DJZA 3UTPD 4OFQA 5K9OB 1S7RB 3CHOA 1CF8L 4R0LC 5SWZB 3C09B 1FRGL 5CUSH 3A4FA 3SPCA 2VLJB 1EPFA 1VACB 4YC2C 4KY2A 4KDTA 4M1CD 1F58L 3O3EA 1RKRA 3PJSA 2DZEA 4H1LH 1CXIA 3BAWA 2L7QA 1PZ2A 3O3DA 3X1NA 4MJJA 4A38A 5CSZB 3MRCB 3QFJE 4NQDE 1G7HA 3RAJL 3VG9C 4ELKA 1A14H 2Z7WA 3PUUA 4KXBA 4BE6A 4OI7A 2RHEA 4L8BB 4HIXH 3W81A 1KDJA 2AABH 2M2DA 2QKIC 5IIEB 3NQKA 5DFWH 2X87A 3QJTB 1DJHA 3T3MF 2CE6A 4PY8J 5DJ0A 3LAFA 3RPBA 4Y1AD 5L2KB 1T1XB 4WU7B 1RH8A 5IBTH 1Q94B 4YIQA 3ZKMC 4ZW6A 2XTSA 1M2OA 1XR9A 2B39A 3CLWA 4KTEL 4P5KB 4ODUB 4YZWA 4A55A 4Z7AA 2F53A 2OQJB 5KUMA 2FATL 3FO0L 5FECA 2V37A 4U3SB 5DEGB 1JGVH 5JNYB 1C5CL 4NQUA 3SGEI 1M9WA 4QWWC 2GT9B 4KO7A 1QLRB 2Y0SA 3SPIA 2X4OA 3LKQA 4WWPA 2OZ4H 3U0PB 1PFCA 2OSLB 4PLOB 2L7UA 5LCVA 4EN3D 4JFSA 2NXYB 3D09A 4FJZA 3WE6A 2ZSVA 4OM0L 4U1MB 4BYHA 5DRZB 1OWRM 2Z35B 4PS4H 1E27B 2FLBT 3EJCA 4XP4H 2YKLH 2OR9H 4UQ3A 4JJ5B 3W1ZA 3LEYL 5AAWA 1BAWA 4PS7A 3FU7A 3WEOA 3EO0A 1BGXH 1HXMA 1OGTA 4QRBA 2MMXA 1HCFX 4ZFOB 2XTJE 2AQTA 1LQBC 3ZZSA 1SN0A 3IFLH 1L9PA 1QACA 4OCYL 4PJ7A 4ZXBC 3CAFA 4MJ2A 5BXFB 4LSRL 2HLFC 2F19H 1BVOA 1DVQA 1S9VB 3SOBL 1UATA 3T1FB 1LK2A 4FN0A 7PCYA 5I2IA 4XBEH 3ELAT 4PRHA 1KLFB 1RPQA 3VMPA 5HI4D 3ZLQC 1ECYA 4JRYD 2P80A 3L3HA 4BFBD 5DHXB 2E7DA 5HBBA 5HVWA 1JYVA 1ZANL 4GXVL 1ORQA 1M6OA 1OIOA 5L8LB 1PLGH 5B1CA 1NGQH 1F3JB 1XTMA 4WHCA 4WWNA 1IAIM 5DUML 2GK2A 3PL6D 4NQCD 4JM2A 2XPGA 1JZDC 3VFGL 4ZMPA 3VQ1C 5AG9A 5K39B 4XP6L 4G7RB 2XJLA 1WAEA 3TWCL 4M6MH 2AJYL 3C5JA 3N0AA 2Q3ZA 4HXAL 4OGZA 3LD8B 5D70H 3UTZB 1L6XA 4XCCL 3ZQ9A 4OIFA 4BDVB 4R8WL 4G6KL 1A2YB 4PS8A 4LKXA 1HHJA 2BSSB 3S3JA 4BUGA 1KGYE 1P7QB 1KGWA 3A21A 3B7SA 2IH8A 1UXWB 5TK4A 2J7LA 4KDTC 4HK0A 3V0IA 5MI0B 3F64A 3OXRB 3WLWD 1A7NL 4W6WB 4L29A 3JWNC 3S5LA 3C6LB 1AGBB 1F6FB 3AQZA 3AS3A 2NXZC 4HKBB 3WE1A 1M1XA 3HE6B 2Y22A 2P43B 2C1OA 2Y3NA 1REIA 3NIFF 1AR2A 1N2RA 5AVQB 3IDGB 1LMIA 4MNHA 2KHAA 3WAKA 4PWEA 2R29H 3D85D 4XAKD 5GRUH 3HC0A 3RVTD 3P69A 5T5FL 3QDJA 4Z7QE 2J8UB 3MLTB 3OPUA 1Y07A 4JVUA 3VYPA 2BSED 3GMMB 2FRGP 1A3LL 4FFVD 3HNVL 3I9PA 4JY5L 3AXIA 1G7JB 5I17B 2R0LL 1I8AA 3O6FD 2I7SA 2B9BA 3QQXA 4N0FB 3HUJA 3MA7A 1X5IA 3TH4T 3EAKA 3G5WA 3N9GL 1HWWA 2AJSH 4A2FA 2KQNA 1AD0B 1XBDA 4KNSA 4JO5A 1KENL 1YQVL 4PJ5A 3ZHFA 9PCYA 2GABA 4K07A 3UYRL 3KPMA 4MVBC 5KVFH 1A4BA 1MFAH 3S3DB 3HPLB 3PGFL 3UBXB 1RUMH 3OSVA 2EEBA 3QFJB 3GMNA 4UQ2A 2TRHA 5J11B 3UYPB 4G6AD 4EQ3A 1RSYA 3GJFB 4MA3A 5AAWC 3HMXH 2HFGL 4WTZA 2HN7B 4DN3L 2L0DA 4N1EA 4LHQB 4J7RA 3S8WA 4XVUC 1LL1A 4S2SA 4QF1A 4D0CB 2EE3A 4PJDE 3TCLB 4AL8H 1DBKL 1LEGA 1IJ9A 3QPQD 4UT7H 1AD9A 1LM8V 3V5KA 5GJSL 4QO1B 3TM6A 1R34A 1KEGH 5HHVH 1GRWA 4L8DB 3US9A 1KLUA 3RZCA 4U05A 4PP1D 3WXVH 1XIWD 3V95A 3PV7A 4P23A 1N59A 3U0TB 2EH7H 2UUDH 4Y4FC 4WHTB 2F74A 4C57C 4ES8A 3GMPB 5K93A 3IGAA 3QUHA 1XF3A 1X5YA 2ZOUA 2CKBL 3QI9B 1QABA 3P1VA 3WKNA 3UDWA 1LE9B 4LL1A 4PJIA 1IAIL 1QFHA 3OG4B 2WBKA 1CTMA 1JGIA 3PXJA 1PY0A 4HQQL 1A6AB 3PDGA 4JM2C 5EUOE 3TU6A 3U4EA 2C9VA 2X2JA 3VTTA 4F37F 2ZG3A 5F6IB 1QO3A 3RL1B 3IKKA 5DZPA 1LDPH 5FFOA 2W8CA 3NCEB 1DLHA 3VI3A 5FYJE 2ED8A 1AOHA 1S3RA 4KJQD 4M8QA 2HKHH 3DYPA 1ZLSL 2Z93B 4HUKB 4PB0H 4G1MA 3I6LD 2BNQE 3BPCA 1NIDA 1SHSA 3C12A 25C8L 2B1AL 2FO4B 4WO4A 5HYJB 2WNXA 2EKSA 3GSUA 1CLYL 1OAKH 2HTLC 3OZLA 4XNMB 5F9JB 4HH9B 4OIIL 4F5CE 1D5ZB 2Z7YA 2ZOLB 3PUCA 3QJZA 1V05A 4JO3H 5FLVA 1QQDB 2WXGA 4KJWD 4EVNA 4P4KA 3GBNH 4H8WC 1N64L 3C60B 4H2AA 4WFGE 4UNUA 4JHVA 5JQ6L 3IU4L 3M1BB 4LSDA 1ERNA 2G3NA 4NZJA 5DD3H 3MI6A 1FGNL 4AK1A 2BVPB 2VDRB 3QJRB 3S3SA 2APTA 3D2TA 3HG1E 4K15A 4EN2A 4OCLC 2ETWA 1WHOA 4NGHH 2AF2A 2KPWA 1AR1B 1CL7I 3QQ4B 4L3EE 4IK7A 1A7PL 3D0LB 3TPUA 4ZW7A 3ZTNH 1UUSA 3DNKA 1ZEAH 3VXSD 3H9ZA 3KPRA 5HY9A 2Y06L 3BH9A 1W72A 3PWPD 2PXYD 4PIBA 5GISL 3BEVB 5CP7B 3E2HC 4XNZB 2EKJA 2BSDA 4FLRA 4WSKA 2Y07H 3OLDA 4N8UA 5I1HH 4NQTA 5LN8A 1CUOA 3DX2A 1PZUB 3PDOB 2H1XA 2OJEB 5JHBA 4HMDA 3ULSA 3WKMH 5I0VA 3E8UH 2AK1H 5FB8A 3EGDA 4KRLB 3TA4D 2VXVH 4MB5A 4Z8FL 3EJJX 3SKJH 1WFTA 3VG0L 1UM5H 1WJ3A 5E5MA 3IFPB 3CK0L 2C5DC 4UU9A 2V2TA 1F5WA 2GJ6D 4GY4A 4ZFOL 4YFLI 5LDSA 3BO8B 4YNYB 4L8CA 4A2EA 4BWWA 1T1ZB 2VDMH 4OV5B 3D3VE 2XCMC 1BZEA 4KROB 4NFBA 1WEJL 3NA4A 4A6YB 3MRLA 3EH5B 3IMSA 2VLJD 1JI2A 3MLSH 5HP5A 3ASNB 3TF7C 2YQBA 1BEXA 4M29A 2PTVA 2WP3T 3QH3B 5H94B 3PWNB 1KLGB 2NZ9C 2ZKWA 3RZCC 5C2BL 4KKCC 4Y2DA 3L1EA 1CFVL 2X4SA 1Q0XH 5EUKB 4QRAA 4X7TB 5TF0A 3MLWL 4ZQKB 3RY5A 3LN4B 2Z0UA 4FLQA 1HKLL 2I9LA 5I8OL 4EZLA 1XF5A 3PFUA 2E9WA 1E4XL 3TH2T 3WLBA 5CN3A 2DIEA 4FTVB 3L3DB 4JN2B 3BEWB 3ESVF 1THAA 3UDWC 2V9RA 1E3FA 5E5UB 4LSUL 4A7SA 1FYTD 1FSKC 5CILL 1ORSA 3ESMA 1W6WA 1FORH 4L8SA 1T4WA 5E70A 3VFRB 1DQLH 5L2KD 4H40A 1K4CB 3W2DL 2G5UA 2V5MA 4MMZB 3V4PH 4PY7A 2HMIC 3LSOA 3CFCH 3QJFB 4FNUA 1AXSB 1M7IB 3RLSA 1NAKL 4PG9A 3UBFA 3PNWA 1G0YR 3BIKB 5EO1B 1UB5A 2P8MA 2GIYA 2APXA 4PJDB 1AXIB 4GO9A 4U0RB 4KO5A 5T1MB 4WO4C 1TYJA 5EU4B 1H6EA 4G1EA 4N3TA 2C1PA 3H9SA 3IXAA 4KY1H 4PWIA 3UJJH 5IKCB 2A9ML 5E7BA 1NCTA 5IFHH 2BDNL 4P4KC 5CJ5A 2NXYD 4MCZA 1E5ZA 1OALA 3GXIA 3HR5A 1RZJH 3STLA 1TVBB 2QEJA 4N24A 4W9KC 4C47A 3WFBL 2PYEE 2BP8A 1C8PA 2EE0A 2CDGB 3O2VL 5JOEA 4ATWA 2ZAGA 4OLYL 3QZLA 3PGDB 3D5OF 5FW6A 2EIMB 5AOJA 4C56E 3DVGA 3TEWA 3O11A 5EEYA 4N2MA 2JTYA 5EUOB 4OFYA 3TFBA 5J6HB 1SJHB 5PCYA 4JRLA 1BCIA 1ADQH 1FHGA 4RAUA 1Z9LA 4XHJD 1JV5A 1UQSA 2X0UA 3OPZH 2FQDA 2AEPL 3AB0B 2EXYD 5I6KA 3ZL4L 1NM4A 4KKZA 5J57B 4N86A 4I48A 4JDTH 5HHQA 1A1OB 2VLKE 4X0NA 3O9WA 3MNWB 4UIKH 2PYFB 3IDNA 5DS2A 1ZS2A 1NCBH 3AXLB 4Q9BA 3NFNA 1AG0A 2CHXA 1OM3L 2XVKA 2YD3A 2EAEA 5D2LE 5KVDE 1SOSA 2BOBA 3BQUD 2MH4A 3FCGA 5L2JB 2OMYA 1L3NA 4AXWA 1BXAA 4JNXA 3L4TA 2IXQA 2LR4A 5CP3A 3RWCB 1MFNA 3BP5A 1EEQA 5C0AD 3TIDA 3BUTA 4DKAA 4JE4B 1KTBA 3EJSA 3BUBA 5DUJA 1U8LA 3INUL 4D3CL 2FB4L 3HNSL 4I9WE 1JPTH 4NB7A 1DO6A 1MH5B 3R8BB 3BE1L 2FX7L 4LLDB 2A73A 5MP6L 4L3EB 4X2UA 1CIDA 1C08B 2IQ9L 5DRWA 4OF7A 1QFWH 2DYRB 1JZ6A 4Z76A 2V8MA 3NABL 3KYOB 1OT2A 4LLQA 2OI9C 2R0WL 3BSZL 5I0ZA 4TPRH 1L0YA 3JWNG 2YGPA 4ORGB 4X83A 4ENEC 5A2BA 1AQ8A 1RJZA 3KYAA 4GUOA 3EFDH 1PGRB 1YN7A 4ODVL 4Y2DC 5KBKA 3C6LD 1P2CA 3DHMA 3T2QA 5FC9A 1Q1JH 3QULB 3ABGA 1QHPA 3GTTA 3OMNB 5GGSB 3GWJA 3HE6D 3QRFM 1OY3B 2PCXA 4Y1TA 5EULV 2LV4A 4LPXA 3RX8A 2JQAA 4NQXA 1T20B 4L8SC 2OMWB 2H32A 2JCCE 3VA2C 3FB6B 4OQTA 4AQAA 1CC3A 2WXKA 4ZBJA 3D3VB 2JSFA 4UT9L 5HJGA 5DSCB 3VU1A 2EVHA 5I1CH 3FHQA 4XO3A 2CJSA 2UUDK 5GRWA 1I3GL 3WNOA 4OCRL 4PJCE 2MRYA 5HD8D 4D0BA 3ME0A 3HIZA 3PQYE 1AC0A 2EDHA 5H4YA 1JCKA 5KBMA 3WNMA 2VDRL 1M57B 3OAWA 4WW1B 5LLIC 1YPZB 3J2PA 3IDMA 1MCJA 1OPGH 2H0PA 1N8OE 1KCSL 5IHLB 1XGUB 5CCGE 4L9LA 3CCHA 4Z78B 5JPMB 1IGYB 4IHOA 5I1DA 1V10A 3WYRA 5DC2A 3QIUA 3OKNA 1KCRH 1WFNA 3WHE0 5BVJA 2IALA 4HWZA 4W9JC 1U8OB 1TQVA 3DVNB 1YY8B 5J4MA 1BJMA 1B4TA 5C0ND 3B9KB 2Y2TA 1LP9A 5CIPA 4JY4B 4JPWL 3TC9A 5DVPA 2UVFA 4QNPE 1F11A 1OHQA 1T0NB 4FQ1H 4UOJA 1UGNA 5T3ZD 4AIZB 1NGWB 3DXAE 4MS8C 4OZHF 3O9WC 3SOTA 2XV0A 4M9PA 2AK4E 5B38B 1P5UB 3LKOB 4NBZB 3K0WA 3AREA 2NY6B 5I76A 1Q0YL 4Y8DC 3WENA 4LLUA 4BFNA 2YZ8A 5CJBA 4PYGA 1Z9MA 2A6IB 3QI9D 4LEEA 2PKDA 5IVZA 2F1AA 3CLFL 4MRBA 2IFGA 1FZOB 1GGIH 1RPKA 3ABMB 1DQJB 5LAPA 4LRIA 4KXZH 1VKXA 4ZNEE 2E46A 3L54A 3DX7A 1F2XK 1I31A 4M1DL 1YNKH 3LRHA 3MNZB 1MWAH 1ES0A 4AYDC 3B43A 1CPUA 2EIBA 4A6YL 1B4JL 4ZOAA 4C56B 1A21A 3HI5H 3VXUE 4ZI8A 2XJKA 3B7RL 3K91A 5FK9B 3IMTA 1WA1X 3MODL 4MCYA 4CW1A 2HAZA 1MLBB 1S7UA 2DW5A 2PW1B 4I3GA 1N0XH 3MLYL 4NAJA 3UABA 3U4AA 5HYJD 3N41F 1QNZH 1MZYA 2V2XB 3ARZA 3CDGB 3S5LG 4ZDHB 5SV4A 5I1KL 4YHYC 1OP9A 1HESA 4ZX4A 3CHQA 5L88L 5IOPB 4TVPE 2VLKB 5A1AA 2B08A 3C60D 3PY9A 3QWNA 4NWTH 3VGAB 5T1LB 5BS0E 1QG3A 1WVZA 4H1LB 2ODHA 4BRVA 1GS7A 5D2LB 3CQPA 1JXGA 2V2WA 3BZDA 4HGMA 4YSRA 3RBSA 3X2QB 4L1SA 4W9ZA 5ENWA 5J8OA 1GAFL 1R47A 4YHPA 3RILA 3LHPH 4Z18A 3KYMB 1D7CA 1EFXB 2VZVA 1AR1D 4FFYA 1U4FA 1N68A 3SE8H 3VB8A 3GDBA 5JOFA 5IW6A 3KE0A 1SLXA 4OLEA 1E4WH 4RBPH 1ZHNA 3WNPA 4LKCA 3N91A 1MF2L 3Q8EA 1FCCA 1PMYA 5F1NB 2BWDA 4N90D 5IG7A 4X0KB 2NDFA 4IRJB 4QRQA 4NM8L 3MHZA 4QYAA 1U2HA 4QUOA 4S1RH 1OCCB 4OQ1A 5L4IA 2HG5B 4GI8A 3RL2B 2WUBL 3S36L 3KWWA 1P4BL 5DTFA 3CBJB 3OKYA 5C86A 3C2SA 4FXGA 2HT2C 3HHRB 2VLRA 1Q1PA 1R75A 2BW5A 4KKAD 4WTZG 3CXFA 32C2B 3OAZH 3QIWA 4GNKB 1KXTB 3LH2H 4GW5B 3VFPA 4RZKA 3SPJA 5J1AA 4HOMA 2V5YA 3TNNA 4XP9H 3QIUC 3AY2A 3SDDA 5L7XH 2DQHL 1ZT4A 2VJ0A 4HHWA 3WMSA 1IT9H 4DEWA 4HJEA 4KROD 1Y0LA 1JDDA 3RGVB 3SDXF 1O6SB 1BWWA 1N7ML 1CO1A 1G6VK 2UZPA 2CKNA 1FL3A 3NGBC 1BVNP 4MSWA 4Z0BH 3FFCA 1G0DA 2MKWA 2W38A 3ZRCC 1WFMA 3ZDXF 4Z3JA 3HB3B 2LLGA 4P2QE 4XODA 3TBYB 3AREC 4ZS7H 4DZ8B 2L4OA 5HVHC 1JUFB 3BVWA 3PQYB 2OS7A 2F61A 3BD3A 3MFFA 4X5PA 3D9AH 1OTUD 1XF4B 5IVOA 4FTVD 2SEBB 3LZRA 3SQOH 3V10A 3B7YA 5EIVA 3TT3H 1UM6L 1WA2X 3L3KB 1MEXH 2EIEA 1C5DB 4LRIC 3HPJA 1BXXA 5I16A 5JYMA 5I74B 3QDME 4R4NC 4DEPC 5IMKB 2VABB 4TLSA 5L8JB 4DETA 3L2LA 5DRNA 1I7RB 3WIIL 1GHFL 2JJTA 1U8HB 2O5YH 3BZ4B 3G5YB 3U7WH 2QSVA 2V7HA 3FTGB 4EDXB 4LSQH 5C09A 3RY4A 2FVNA 3PCYA 3U6XS 3VFNA 1IAII 4QRPB 1ETJA 3T0EC 3BDYH 5LGHH 2O5XL 3DMMA 3FO1A 1NCDH 3P02A 3K1KC 4MHHG 4XC1H 5FUOL