2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Slc8a3
publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
3EADA 2FWUA 2QVKA 2QVMA 3E9TA 3RB5A 3US9A 3H6AA 2LT9A 2FWSA 3FSOA 2DPKA 2KLSA 3GINA 3FQ4A 3RB7A 2KLTA 3E9UA
chains in the Genus database with same CATH superfamily
4F37F 3SDCD 3BO8A 4MVBC 3LEYL 1QR1A 1DUYA 2LFEA 3IXTA 2OMUB 3LH8A 2R1XB 3RGBA 2JCWA 4FZ8L 1QLEB 4BRJA 3FU6A 3TH3T 3PWPB 3VYOA 1LWRA 2DTML 4P9HL 1T1YB 2IALA 3T6WA 1GCYA 1UH2A 4TNWK 2FUTA 1YDPB 1CIUA 1FO0L 2PP8A 2IOIA 4ZUTA 4TOYL 2AXGB 2EDQA 4QLWA 3VFWA 1PX4A 3MREB 3QEQE 4ATTA 2OZ4A 2O61A 3SOBL 3P0YH 4ETYA 3O4LE 2N59A 3MV9A 3MX0B 4OI9A 2B2XL 4PH8A 4ZDHA 3FBKA 1E40A 5KANI 1KCWA 2XWJA 1PZ5B 4CSSA 5K1NA 1Z3GH 2BSRA 3PP3H 4LCWE 2XQBH 2QZ5A 4JO2H 3OXSB 4LOEA 4MJHA 2CRYA 5HJBA 1F4WH 4XP6L 1SY6A 3WAJA 2MQCA 3QNZA 3RTQD 1B2WH 3OJDB 4AMWA 3PQYB 2WXKA 4N87A 4M1GH 1I3UA 1ZWIA 3G6JA 1GZPB 3N50A 5K1VA 1EFXA 4M7ZC 3EJUA 1L9SA 2YZ8A 4PBWD 2OP4L 4DVRH 2DLEA 4P23A 1L3NA 4W9LC 6PCYA 1EAOA 1JN6B 3AG1B 3LKOB 3ECBB 3MVSA 1V55B 4HCRH 2VLKA 4JGJA 3OKKA 4HHWA 1FFPB 1WV7T 1V3LA 5ITBH 2YKLH 1EFXD 2ZTBA 4NQEA 4XOBA 4LSUH 4LCYB 4GW1A 1A4CA 1P7HL 4P23D 3ECWA 1WEJH 5AW2B 4PI0A 4PY8I 5BJTB 4L1HA 4DQAA 4P3CL 3L2MA 3KPPA 2IDUA 4RETB 4CDHA 4CVUA 1FG2A 3MSPA 2JB5L 1KGIA 1XL6A 4BK5C 2FIKA 4JHUA 3CDZB 4BFJA 2VDPL 2DRUA 3NN8B 3ET9F 3S97C 3RFZA 4PJGE 4UT6A 5A2AA 1RIVH 4RAHA 1H15B 1DQQA 5MERA 4URTB 3FCTB 4JPVH 3EOBB 4PJXE 4BSJA 1OPOA 4TLUA 4ZXBC 4LIQH 1CXEA 3MDJA 2K1MA 4K23L 4EZMA 4NQSA 3RWJB 3UAEA 4XWOC 4HKZA 1Q72L 4YHIB 2NTSP 4B9CA 2L7JA 1G7IB 3KLAA 4LQ1A 3EKCA 4NZUL 1G84A 3HC0B 4WDIA 4PJ7A 4ZTPH 1ZDSA 5CEYA 5GGUB 4Q4IA 4BQ6A 1RUAL 4GW4B 4M93C 2NCEA 3KPRE 4U4BA 5HGHB 1YMHA 2ZJSL 2VXUL 2IANB 2F53A 2UZXB 4ANWA 1JGDA 4NQCE 2RFXA 4PJ8A 2XLLA 3NFPB 3C6SA 4AQ1A 5HJGA 5D2LA 2OXGB 3BKYL 4AEHL 1QAWA 3UBXA 5CJOL 5F0MB 3WFBH 2NW3B 3O6LH 1MUJB 2WGNB 4GSUA 5DJ8B 4DF9A 1TOXA 4HLZH 4U31A 4YPJA 4E9TA 2VDKB 1C5BH 5I1EH 2W60B 1WQVT 1FFQA 4E41B 4Z0BL 3RVWD 4D9LL 3II3A 3U0WL 5B8CB 4U6XA 2QVFB 4FA8A 3CFNA 1IGFH 4G6ML 4NDMA 4MNGA 5ANHA 3ZKMD 3FMGH 3ULUC 2Z4QB 4YWGL 3FUDA 5L2JB 3MCLH 4JFFD 1H8NA 1WAPA 2B59A 3X3GL 1E4HA 1CDYA 2WWKO 4FNLH 3EJRA 2E7HA 3QIUA 4LZKA 3S36H 4LARL 1DQLL 1WWCA 3FN9A 3OX8B 5LNDA 4Y2DC 1QBBA 2NNAA 2F19H 5KVGE 1AZVA 4C4KT 2EUWA 4FXKC 2NNCA 4QOKA 4NQVB 4YLBA 4EIZC 1HN1A 1W15A 3MV7D 5SWSA 1JFQH 1AGDA 3F7YA 3SZ6A 3VVVA 4LL1A 4UQIM 3WN5B 2D0FA 1AD0A 2ZWNA 4OZFA 4RAVB 2YD3A 1NCTA 2F54A 2IVFC 2FHCA 4GRWB 3UAJC 3QFDA 1QSEB 4XBMA 5D1QD 1WZMA 5GGQL 1J9SA 2XQYA 4JHAH 1HC1A 5SWSD 2VUYA 3L7EB 1UGKA 2NQDA 2QFPA 1O6SB 3A67H 3BGMB 4TUJA 1BG1A 3RX7A 1FV1A 3HOGA 4CW1A 2FO4B 2KZKA 1MH5A 4LKXA 3DRTB 2KBGA 3RZCA 4JKWA 2V2TA 2LQRA 4GAYB 4NQXA 3UP6A 3LS4H 4B9YA 4XZUA 4DCQB 2FATH 1UKSA 1WUZA 3MCYA 3EZ8A 4OFQA 3NFSH 3ZTNL 4ESKA 2J8HA 3FSWA 5CP7A 3F7PC 5FC9A 1MHEB 4YHNB 1X5IA 2IGTA 3BVXA 3LV3B 5IMLB 1F58L 1JWUB 3O6FD 4FFZH 1JTPA 2H32B 3I85A 1IO4C 2P5EB 3KLHD 3EO9L 3ABMB 3ZTJH 1E4KC 2Z92B 4ZS6D 2IOMA 5LBSH 3M8OH 4HJSA 3ZHKA 3PJLA 2BP8B 1ZPLA 1TYRA 1DR9A 2V5MA 4N2LA 4YX2H 1KXQE 5ICYA 4WI6A 2I5YH 2WBXA 1CYWA 2AQRA 4M7JL 1YEIH 4IIQA 2LVCA 1DUZB 2K4WA 1DDHA 3F6IA 3BT2H 4AV4A 3CQPA 4JJ5B 2XUWA 3OMNB 5EA0L 3F58L 3LX9A 4JFOB 4OFYD 4MRBA 4WFEE 4WK2B 5FYLL 2IPKB 5EFIA 3SGDH 3VFSB 2IQAA 4LSQH 3ZSTA 1HHKA 1OQXA 4MMXA 5F7DA 1J8HB 2XG5B 1A7BA 3AG3B 1T0MB 3WI9A 4NKDA 2MOGA 3CN3A 15C8H 2R4RL 1GTNA 1GC1C 4UZSA 1LNUA 2F5AH 1IQDB 5DRXB 2JELH 4OM1H 3HRZC 4R2GD 2WXQA 4XPFL 4X99B 2QSQA 5FAAA 5HHVL 4DP2X 4Z7VA 3RNQB 2EYRB 5E5MB 2E5EA 4MZ2A 2Y6SD 3GIVB 3FFCB 3QO0B 4KXZH 4RBPH 2K6ZA 1OT2A 5F1IB 2YN3A 2L7UA 3T0EE 2ZZUT 1INQB 5DUBA 4DO5A 3SE4C 2V5YA 4L3EA 4ZSOB 1KZYA 4PCSA 1TETL 5B1JA 1KPVB 2Y07L 3GTTA 2ARJB 1HEZA 3FUEA 1F11B 3IT8D 5DJXB 1J5HA 1DSFH 3VXTB 5KS9F 1CBVL 5E9NA 4AQOA 2XN1A 2BCKB 4Z18A 3W1ZA 1UYWL 3D3VE 1RVFH 2QQKH 2VMJA 4S1RH 5GGTH 4M3KB 1TQWA 2ZOKA 4PJ5B 4WF7A 1Y6KR 3TWCL 4NRXA 5E6ZA 1NOLA 1SM3L 1BQLH 5E99H 4JR9L 4FZEH 2WZPD 1TQCC 3PWPE 5HYSG 2Q2LA 3Q44A 5JHDD 1MF2H 4JREB 5CMAA 1C8PA 3MACH 3WLBB 1ZANL 4Y4KC 4KY1H 4XAWH 3VG0L 3LZLA 4EF3A 2UUDK 3UG4A 5F7EL 4ICWA 3PAUA 3BN3B 4KQ3H 2GSIA 2W0KA 5L6YH 1GIGH 2DJUA 4XBEL 4AGOA 4MNQB 3MTRA 4XPTH 3M86A 5E1IA 4DEUA 5B38B 5TH2B 2CLRA 3LZRA 1TJHL 2WWMC 3CDCA 3QUMA 4L8SC 4WEBH 2VDRL 3M17A 1QNIA 5LGHH 2IOOA 2QADD 3FOMA 1E8WA 1T5WA 1Y7VA 3JWDL 5C71A 1HAWA 3M1BB 4TUOA 3MRLA 3KVDD 3IDYB 1IM9B 2P9RA 3WKQA 2H9GA 3GSOB 2VGLM 4ZS7H 3UTTB 2R29A 1M6OB 5A6MA 4ANUA 2QHLA 2BHYA 4X0KB 4PJDB 5DVLA 3KCPA 4G7SB 3D69A 3MLTA 1A9EB 4GMSH 4YSQA 5EU5B 1M7DB 3CN1A 4A6YA 5GS2H 3ARGB 1XF3B 1L7IH 2CO7B 1IJNA 2W95A 4HWBA 3GM0A 3MLRH 4ZTOH 2B1AL 3B7TA 1VPOH 3ULVE 2ZAGA 1AHWC 4QHMB 4BQ8A 2RBLA 2Z7YA 3P40A 1XTMA 3SGJA 2PCYA 4PV8A 3I75B 5CUSL 4EN3A 1OIOA 2J20A 4D9QD 5EZPA 4O02H 3TJHD 4KVCH 5I5IA 1FGVH 2V2WA 3OMAB 4NHUB 2VABA 1ZK5A 4LL9A 5CN3A 1T83A 3JV4B 1LP9A 2X4RB 2HP4A 3D8MA 4CVXA 1F6LL 4K5PA 3TPUA 3LZFH 4EN3D 3PWVA 3U46A 3OKEA 2YLHA 4OFDA 2BVYA 2R56H 3T3PB 4DTGH 1GSMA 3FQUB 3OGCA 4B9ZA 5CD5D 3Q3GA 5CIPH 3MNMA 2OZ4L 3ALXA 3FQ1A 4TULH 5F1SA 3P3RA 3J27A 3WMQA 2OTPA 3W9EA 5AOZA 5FW8A 4MD5B 2C9AA 3QNXA 3FT4A 3JZ7A 1HDMB 1Q9WB 5C9JA 1F4AA 3LRSB 1MAJA 2H3NB 3BZEA 2X0WA 1DEEB 2GEEA 1BX2B 4FC3E 5JIMA 4NNPH 1KN2H 4I1RA 2YMXH 1A6WL 1IGYB 3DTUB 3L08A 1LJMA 4PJHF 4ONFH 1SY6L 3ATBA 3ISWA 5DQ9B 2F7PA 2O6CA 1YEJL 3LKRB 4O2EA 3RPKA 1GY2A 3IJ9A 1ORQB 1P6AB 3O3UN 2WCPA 2GTWB 1OGAA 2F15A 1UURA 4ODUA 4LLYA 4H8WH 4HH9B 2CCWA 3HMXA 1B3JA 3UACA 5C0IB 1RULL 2ITCA 4HIHB 3F5WB 3VWKA 3SQBB 4HFUH 4E41E 1C9SA 4Z3TA 2EEBA 3BP5A 4QT5A 4TNVK 4RMUA 1CG9B 1GR7A 1NMCC 1R1CA 1RZGA 4JG0L 3OTTA 2GUOA 3HAEB 1U8PA 2FQDA 2EILB 2YOAA 4IEFB 4OM0H 1DVXA 1KB5B 1L5GA 4IK6A 4JGMA 4YGVB 4OIIH 4NC2B 1RUPH 4MD4A 2K3HA 4BZ2A 3IJSB 4FNLL 1O7VA 4YBLC 3S36L 1CLYH 1F6FB 1JV2A 4J3WA 3QE5A 1T20A 2WBJD 3MOAH 3CQQA 3BP6A 1NGYA 3MTXA 1OGTB 4KI5D 3CZNA 1LE5A 2OMXB 1NEZG 2J88L 5D9SB 4ZD3L 1QYGL 1HXYB 1OPGH 5LQBH 1N5YL 1JFQL 4Y88A 2H4EA 3PNWA 1F0LA 3BP4B 2UXVA 4OCXH 1UD3A 2CPCA 2EDLA 4GRWE 4H8QA 4WCYL 1QSEE 4BRVA 3WTWA 2NSQA 3PDOB 3K81A 2OA9A 1QOKA 4FRWA 4G7YH 3RWDA 5DD1L 4GT7A 5HP5A 2HJFA 4V11A 1LO4H 5MEND 1K4CA 5EU6A 8PAZA 4KK9C 4APQD 5A2FA 5F6HI 3MFFA 4GQ9H 2VMDA 4F58H 4GSRA 4KRNA 1OT4A 1WC7A 2NY3C 1FH2A 1B0WA 2PNDA 5I1AB 4R97C 5G4NA 3MRQA 4X7EC 1OTSC 5HYFA 4G8AC 3BYYA 4I3RL 1U92A 4UAOC 1CDCA 1K4DB 2JXMA 1F6AB 4N0CD 3WEAA 4YS4A 2FJSA 2HRLA 5KAQF 4RDBA 1ZK9A 2H26B 1ZLSL 4ELMA 3TEYA 4JKPL 1GGCL 3FZUD 4PRNB 3NFSL 2YD1A 1YN6B 1X5XA 4U6HA 1HQ4B 3MRPA 2YGQA 2CALA 4G5ZL 1BBDH 1P7KB 3JWNE 2GPZA 2P5EE 2HFEB 1M57B 3ARQA 3ETBF 1RZ7H 1O7DC 1M71A 3HZYB 3MRIB 2BNQB 1W0WB 3V4UH 5JXEA 2YPLB 3A3YB 3BRDA 1D5RA 1IAOB 1JZGA 2ICES 1AFVL 4X6BB 3CLFH 3ZDZB 5CLWA 3MRCB 4JM2B 3WO4C 3X14A 1HNFA 4UNUA 3VXUB 1Z9LA 3QPXL 2X4PA 2ZYRA 4P4KC 3BT2L 4KV5E 5KZCD 2CO2A 3CFCL 1KELL 2Q6WB 1K85A 2V7NB 4Q6IA 4AJWA 2ZCHH 3GSVB 1PG7W 1AS6A 4PMEA 2ADJA 3MV01 1J8HE 1BBJB 2O5XL 1HXMA 1KBBA 5TQ2L 4CBZA 2WZ0A 5DCCA 4EKJA 2ZX5A 5T1LB 4IRZH 1MHHB 5ITFA 1FZOB 1O5DT 3Q2LA 4YDNA 3R1GL 2FQFA 3HS9A 4UT7L 4OLUH 4YHPA 2VLJA 4ZUWA 1NEUA 3TL5A 5IW6B 1DN0A 1SDAB 1XXDC 3D39B 3G5ZB 4JDEB 2WSKA 5K5YA 4HYTB 2KQNA 3REVB 3NPSB 2WXRA 4PRDB 2AVGA 4PRIE 4CVZA 3MFGB 1J1PH 1JGIA 3QNYA 5E6RB 2X6CA 2VLJD 1WBYA 1U8NA 5I16A 4HUXB 3AU1A 3POCA 4G8GB 1YEKH 5CCKL 1LD9B 3MCG1 4YNYA 4YDKL 2WMPA 1ASQA 1JNNH 2JQAA 1OE3A 3GEWB 3T6XA 1XGPA 4WSKA 1ZGLA 4WNQB 1H6FA 4R7VA 1DFBH 3N85H 4PP2B 4ZX6A 4Z77B 3CLEL 4PJ5E 1Q94A 4S1RL 1E5UI 3SGKA 3OAYH 2QSVA 4HU2A 1CQKA 1JHTB 3BGFC 2QMJA 4GO9A 3A21A 3MRHB 3GM8A 2VW6A 3FU5A 3OB0K 4QHKI 2Y1VA 2WVSA 3V0AC 4NKMA 3MNVB 1V10A 2CIKA 2Y5TA 1MRDH 2JKJA 3F83A 1AIZA 4HIXL 4JPWH 3I84A 4HPYH 2B5IB 2FSEA 3EJJX 2ITDB 5G4MA 1PKQB 2BSDA 2P5WB 2A6IA 2BVQA 3L8QA 4FQXA 4JFZH 1I1AA 2A9NL 3ROOB 3TBVB 4MAYA 1WBZB 4KQ3L 3VXQA 5A6IA 4XTRD 4UDUB 4XXWC 4Q9BA 4MNQE 1H9DA 3RY6C 5KYNA 5J11C 2KYIA 4F8LA 1ODUA 1AGBB 1M7UA 4FQXD 5JO5B 2J6EA 2N7SA 4TVPD 4WO0A 4F8TA 3U83A 4GKSA 4EQ2A 3LQMA 2EVHA 1EXUA 1I1AD 4N1CA 4MAYD 1OB0A 2BFVL 3BD3A 4U7SA 3KPQB 3MLSH 1DBBL 2JLPA 2NY5C 3BVDB 2CO6B 1NBVH 4H44C 4BA8A 5IREA 3BUPA 2X3AA 3UTTE 1CFVL 1ROWA 1DVQA 3UX9B 4NZJA 1SFDA 2VT0A 3MLUH 4W9EC 4GBXA 5TD4A 3RGVB 3PV6A 3GO1H 4XO5A 2CM5A 2P8LA 4B9PA 4JFQB 4Y5XA 4X4XA 1GJWA 1ZLUK 3TNMB 5M95B 3O4OC 4HETA 5HHQB 3MRKA 1T3FA 4PYHA 1A4JB 4OSUL 5FK9B 1LEKA 4M9OA 2OW7A 2ZCKH 4BUQA 2R1YB 4QXGL 5EU7C 4OAWA 3QA3A 1I85A 3VXMA 4XP9H 1MNNA 5IF0B 3KJ4C 5FWQA 5D70L 2H0PA 5F70A 2H45A 4POZD 4DKEL 1EANA 2FZ3B 4MS6A 3S8FB 2ZYSA 5LAXA 5BQDA 3E38A 3HEIB 2XIIA 2NUPA 3RWGA 3WTTA 3BUDA 4PLKD 3RE0A 1BVKB 3PPEA 4KZ0A 3G6DH 3PHQA 1FGVL 3C5JB 1D9KA 1U42A 2VDML 3W5MA 1ZT4A 2I07A 3DXAA 3CHQA 5IBUG 5C0GB 1ZTXE 4F7CA 3NCYS 4MAZA 4MQXC 4GXUN 4NWUL 4TVPH 3T3PE 3ZL4L 4G7VH 2C4FT 1KGJA 3LRLA 2YWYA 3QXAA 5D7IF 4Z7IA 1D9KD 3S37L 4QO1A 1GPOH 4TULL 3CBRA 1A8JH 2ZCZA 2SEBB 4I18A 2NOYA 3ZMNA 1H3GA 3KLKA 5FKAB 5H4YA 1NM4A 2ICWJ 3QUML 2WCGA 3ATAA 1U8QA 2QKSA 1A7QL 1MAKA 5IROD 3WFEL 1KGUA 2BC4A 1DBMH 2VRKA 3RWHA 3ZOAA 3QI9A 1Z2KA 4FNRA 1G0YR 3TH4T 3FW6A 3U36A 2I85A 4ONFL 2JTDA 3MOBL 1ILUA 1ADQA 4LVNB 1IILE 3HPJA 5AAMA 2R29L 4LCCB 1WFTA 1KLFA 1RZIB 1FRGL 2BSSB 3CLWA 4UI2A 3JV6A 2I9TA 2J3SA 2FHBA 3HE7D 2APSA 3MV11 3TCLB 3NQIA 3JV5A 3RL2B 1K2DB 2XACC 5DJ6B 1KSRA 2UVEA 4Z95L 2NUTB 1BZDA 4JRYA 1GL4B 4NYLA 4RVBA 5KVFL 1NUGA 3SPCA 4NO5A 3JTSA 4P2QA 3H9HA 1WG3A 5TGBA 5ISZE 5HDLA 1CYGA 2R7EB 5C0FA 1F1GA 3T6VA 2WINB 4NX0A 1GSKA 3SCMD 4KY2A 1KBGH 1MCEA 1Q9LA 2PO6A 1AGEB 5ACZB 4JY6B 3GI9L 3L3IB 5D2NA 4N5UA 5DWUL 4M61A 5FCSH 3Q8CA 4FQHA 1RUPL 2XG4B 5DD6A 4F7MB 2HLFD 1GZQB 4PRHD 3QYNA 2BJMH 4FL4C 5DGRA 4HK0B 1SXSA 1H5BA 3BKCL 1CD1A 4QRPA 1MVUB 2DPKA 2FJUB 3MOAL 2VDNB 2Y1ZA 4UM8B 4HJ0D 1A5FL 3KVQA 1YEGL 3NRFA 3BHBA 1JGEB 1MRCL 1KB3A 1QVOB 3IDIB 3IPEA 3D50A 3VGHA 3DBXA 1C12B 3LKNB 4NM4H 12E8L 3KH4A 5FUCE 1EHXA 4MLIA 3ZRSA 2CR6A 1P4LA 5IMMB 3DUSB 4WFGD 3QUXB 4LASL 5AOKA 3PCYA 5I6XC 3WUWB 3A4EA 3U0TA 1WHPA 1SMDA 5I73B 2DWSA 4MCMA 1JZ3A 1NANH 2V17L 4L8CB 3NCMA 3HMXL 1IGJB 4JY4B 1E6JL 2HPTA 3E2HB 1LO2L 3UFIA 3B4NA 5BUPA 2GTZA 5D7SL 2C1OB 1KENL 5J06A 1J1XH 4M1CD 3TESA 3L3GA 3MA9L 4L4TA 2DEYX 1YC8A 4KNQA 3SDXB 2OMWA 3EUUA 3P11H 4EI0A 4JDZA 2ATPB 3V0VB 2WBKA 1E43A 1IAIL 1G4MA 3IE9A 2AJUL 4KJPD 4NQQA 2XWZA 4WI7A 5E9DA 4URKA 1LTXA 1HH9B 3MHZA 3VTTA 3VXSD 1OALA 3V7MA 4RESB 3M07A 3OAZK 2DY2A 3P3SA 4L4TD 3ZDZE 4XB7A 4FX5A 4X4YB 3ARDB 3GMRB 3FB5A 3BQUC 5ESAA 1Q0XL 4NRYA 4LVHB 4YIQB 5LB1A 4J3OG 4LCUB 2CGRH 4L8BA 4QHNA 3VRIA 1RZ8B 3VI3F 3F8UB 1JGVL 2I26N 1A1MB 1ZVSA 2OL3A 2QPUA 1LQSR 2OTWA 1PLAA 2XYCA 3FDWA 1MWAA 1AHKA 3WY3A 3O0RL 4R84A 5DSCA 3IDNA 3S3DB 2OULB 4JFDD 4WFHE 2V2XA 3DVNB 3TVMD 2MHAA 5A43C 1FBIL 2BVPA 5D7KD 1YVLA 3S5YA 3D39E 3GYRA 3BN9D 4X5RA 4ODVL 1DLFL 3PJSA 2L0DA 4X9GA 2XX0A 1CD9B 1RJYA 3CFUA 4YO0A 1G5GA 1E7UA 3CPLB 1M9WA 5D7JC 3VO0A 2DN7A 1GGBH 4F2FA 5TJWK 3KAAA 2M26A 1R75A 2XWTA 4G8GE 4QDGA 3D9AL 3JV0A 4ISVA 4KUCD 4RGND 4Y4HD 3SDYH 3UOAB 3SJVA 4P5KA 4WI5A 4K9EH 5HYJA 5CKAA 2DV6A 3IMRA 4NB7A 1NAMA 3MRGB 2J73A 4KRLB 4AJ0A 3G04A 5CZKA 3VH8A 4AENB 3OR7B 4FD0A 4FMKA 1EHLH 5ABZA 3SJVD 1JCVA 1NCBH 2DQIL 4KX9A 1EDQA 2J8UA 4YXKH 3O2WL 3OPZH 1MRDL 3PL6B 2DAVA 3LQZA 2J44A 2F1AA 5AW6B 2P5WE 4BK4A 4HW6A 3Q2WA 3BW9B 5CSZB 3TJEL 4JFZL 2GIXA 3P4NB 3PWLA 5EBLA 3WXWL 3FUIA 2MJWA 2G3ZA 4LSTL 3FYEB 4EIBA 5LCVA 1S5IL 4UILH 4XMVA 2OTUA 2CJUH 3ZUNC 2QZQA 5FDWA 1PD0A 1XSKA 1RUMH 2Y7NA 4PEEA 5F7LB 5K9QI 1WH0A 2CHZA 4W4NA 2CLVB 2Q20A 3DBSA 1AI1L 4N6RB 1RUKH 5ENWA 4IU3A 5BNXD 3CFKA 4MJ6A 3KPMB 4LHUG 3IFOB 4XNQA 3TA3D 5JTWA 4E0RB 3IMUA 3NDYE 4G11A 2CJ3A 1QRNA 4R7DA 2D4DA 4IRJC 4K8RH 3QCUH 3RVVC 1CF8L 5JOPD 3GZQA 3C5ZA 1P7QD 1B2YA 2AV7B 2W0PA 2GITA 2WUBH 5GIRB 1KG0A 3BAEL 2WTRB 3EGXB 5DUJA 4N2HA 2WANA 4KNSA 1QFWH 1QRND 2HJLA 3IDGB 4XP4H 5H37A 4JB9L 3ARZA 4GB9A 3B8YA 2B77A 2VSMB 1EERB 5DR5H 2OSLA 4G8IA 5IVNA 2O6PA 1KJMB 4YZFE 1ZA3A 1ZEAL 2E9GA 2UUDH 4YZWA 2X7LA 3LVEA 2ESVD 4RFEA 4MCYA 1ZLVK 1TPXB 5AVVB 4ONHA 5D1XB 2P43B 2KLTA 3EDDA 2CU9A 5IVOA 4FTVA 1DQTA 4HX1B 1J9TA 4G1EB 1D7CA 3NIGF 1JI1A 1BGXH 1FI8C 4OZGB 3WJMB 2VDQH 1KJVA 1ZA6A 2C1PB 4L4VB 1SDYA 4F7PA 1E8YA 4TVPL 5EC1A 4R7LA 4B97A 4W4OA 3OKNB 1KYAA 1RCYA 4MVBD 1YAZA 2MTPA 4H0HB 3DIFB 4YZFF 5I1CL 1PSKH 2EAEA 1GPOL 2ZE0A 4MQ7B 5SX5K 1BIIA 2A73A 2EECA 2IBZX 4XMXA 1R3IL 2J6EL 3M1CA 3V7AE 3AITA 3GSUA 3CVIL 5J57B 2YFOA 3CFJB 4UV4L 4B5EA 1GHFL 4PJAF 2AQNA 1WTLA 1Q1JL 3LSOA 5DZAA 1HQRA 4WUUB 5CZRA 1P6WA 4NPYA 1SGKA 5CKGA 1QO3B 2BIIA 3MRJA 4TQHA 3FT3A 2WXPA 4JFED 5TDNB 5BO1H 2ENYA 2VMFA 1OTTC 3TA4D 5HDOA 3BOVA 3SDCB 1AZNA 2BRQA 3B2UC 1JXFA 2H1PH 4MMYA 2I25N 2IG2L 1KT2B 5DLMH 4JO1H 4PREB 1A6ZA 4RRPA 3EBGA 1GYCA 2QT6A 3AAZB 2DLHA 3FTGA 1OAXH 1ETZB 2J5LC 3MA7A 3VD5A 3ZE0F 3UBXI 4N5EC 1DUYB 3IXTB 1TT6A 1OT1A 2AXFB 4IKKA 5J6HB 4HSAC 1Z5LA 1BJ1H 1AJ7L 3IAPA 4HIIB 3VXRA 2IALB 1ED3B 3VDCA 1W72H 5FFLA 1LK2A 1ODAA 4ZUTB 1NGXB 4AEIH 5C97A 1ORSA 1ZT7A 4HMEA 3HZKB 2YGNA 3UCRA 3HFML 5DK2A 2PYFB 3T0EC 3RTQB 2IQ9L 1C5CH 4ZQTA 4GOSA 1NGWA 4BSWA 3QUKA 1EWHA 3A24A 1YYMH 1F86A 1CLZL 1BF8A 5GPRA 3RWFA 1PIFA 1CFNA 2CHNA 3C08H 3P9MA 2IXQA 2X2UA 2YAEA 3PWNA 5K33A 3QC6X 4NWTH 3O11A 3QNZB 3FQWA 4G43A 1MHCA 2DH3A 4L5FL 4FOMA 4ZXBD 4ELKA 1ADQL 2V3EA 3AROA 3FTZA 1GMEA 2AW2A 3IJHA 4YE4H 4EEEA 3B2DC 4K3GA 2H7WA 2E4TA 3QUHA 4XWOD 1EFXB 5ALBL 4KJQD 3P4OA 5IVZB 1P4IH 4P23B 1FCCA 3ZYJA 3QQ3B 1X5HA 2X88A 2Q86A 3TZVC 3OKKB 1AKJA 4Y4FA 35C8H 4MB4A 1ZV2A 1S7XB 4OF8A 5J12C 1QLRA 4Z3HA 1JNLL 3FO1A 3VMPA 2GB2A 5IKCA 4PJFA 1KXVA 3NABL 4TNFA 3ILQC 2DI9A 4KKAC 5T3ZE 4IRSA 4F8NA 1MDAA 2A5UA 4LLWB 3EJQA 4TSCH 5EV7A 1YYCA 5J56B 5GISH 5C6TH 3S7GA 1BM3H 1O6TA 1EQWA 2HKHL 3DVGB 3MU3A 2X9WA 4I0PA 3U7YH 1G6RH 1RPKA 2EH8H 3C09B 5INDA 3MLVL 4B41A 3EJCA 1PNCA 4OV6F 2L04A 4PSPA 4XE0A 4OZIF 4OZHF 5MERB 1XAUA 5L9DH 5MEPA 5JPMB 5DZJA 3VI4F 2Q10A 2B15A 3QWOA 2HFFA 4R0LC 3ULUD 2ZKXA 4OJYA 5JORB 3ATDA 4JZJC 4WSGA 1O9WA 2N1TE 1S3KL 4NQSB 4OGXL 4GAJL 3CBJB 4HKZB 1KB9K 1XGRB 4FKEA 4P2OA 4AXWB 1M2VB 3MRMA 4OZ4A 5IHZA 4TSBH 4UBDC 4U6YA 2XPGB 4M48H 4WDIB 7FABH 4XNZB 4FAAB 3ILDA 1DBJL 1YEEH 3KWVA 4A7UA 1TF4A 3U9UA 4Y2DD 5BW7C 2Q76A 3ULVC 3ZK0A 3RTLA 1V5JA 3JQOB 4P2OD 2NT1A 4AEEA 4KDVA 4UT9A 4D0BA 3L4YA 4YBQC 5CFHA 3COOA 1NIBA 1L6PA 3FU7B 3LNIA 3WKMH 4YDJB 3EOTH 4AQ1B 4KO5A 4MQSB 6PAZA 4JN1L 3UAJD 3OKOA 3IGUA 4UQEA 5DZNA 3FSOA 5G5DB 1PYWB 3V0WL 1IKNA 2BPBA 5AW4B 4Z7WF 1IARB 3AGWA 2W65A 1CXIA 4JFFB 2Q3ZA 3VMOA 1QWHA 2APTA 1MQKL 3WDHA 1A7OL 5IT2L 1PU0A 4OH2A 5DVKA 2CJTA 4R4FL 2GJZA 5KSAC 1QTYT 1EAJA 2VDLH 3PGFL 3D34A 2VISB 1EK3A 1WT5C 5L2KB 3VCLA 3ULUH 5I82A 1YN7B 4IGBC 1SOQA 3H3PL 3MV7B 2BMKB 2VM4A 1KJ2H 3HG2A 4HCRA 2AXWA 3T6QC 5FYLE 2CD0A 1TMCB 1MG3C 5HPMB 1D7FA 3TT3L 1QUNA 2EO9A 3OL2A 2ADFL 4HOWA 1KCRH 3BWSA 2OL3L 5D1QB 1MCWW 2DQ6A 4YUEH 2WVVB 1UACH 3DPBA 5SWSB 2WLLA 1MWAL 1I1RA 1AZZC 3W9DA 4C47A 5DMIL 5B1CA 4XRCA 2WB7A 2HRPL 2N0KA 3D18A 4M4RA 4BDVA 2RR3A 5EBWA 3SYQA 5KSVA 1XF2A 1AD0B 1OD7A 3KL0A 1KGCD 3D33A 4H1LG 5CU5A 4TTDC 2ICCA 4R90L 2EUZA 3A4AA 2J55A 2YA2A 2K6YA 4HEPA 2X9YA 5B8CC 1OE2A 1XBDA 4PN6A 3O6KL 3WMPA 3W11C 5I1JH 4A66A 1J5OL 4IBVA 1ZHNB 2ZWZA 3O6FB 3OB0H 3SE4A 3LS5L 4MXWL 3V0HA 4XMPL 2V2TB 3A47A 4POUB 5JR1L 2ZXCA 2Z7ZA 5CP7B 2P26A 1FE8L 1W0VA 2WOBA 3UTSD 3WJLA 1IX2A 3QDMD 5D1XE 4DAGH 2X53A 4MGXA 1B0RA 5CWSA 5HI4C 5FHBH 3IE4A 4PRPD 4OU3A 4QY8A 4OZGE 4U1KA 2BS8A 3OXRB 1U3NA 4L4VE 5ICYB 1F3JB 2XX1A 4IIQB 4WWID 5CBEB 5HDBF 3FUNA 4L8DB 4BV1A 4M5ZH 1EZVY 3EUDA 3QB7C 3DV4B 5I1HH 4UQ3A 1J5IA 1A3ZA 2KZWA 4EI5A 1BJ1J 5LCVL 1T04B 3AFLA 1ZSDA 4KTDH 4GO8A 4R2GB 4EZKA 1HHKB 3VFNA 3QZMA 2XKNA 3KHOA 5D96C 1KXTA 4NJ9L 1DJXA 2WKOF 4Y4KD 1ZMYA 2YQGA 1ZLUH 5IQ7L 2ZONA 2GHWB 1GC1H 2VERA 3BEVB 4YFDB 2WM0A 3S48A 5CM1A 1G94A 3JSSA 3MBXH 1X4YA 3SGEI 1WS7A 5C2BH 3NCYP 1FHNA 1PY4A 2ZOTA 4WUUE 3TONA 2DQGL 3WEOA 3JWNC 5ICZB 2WWMD 4RX4A 1I9JH 2BCMA 2X70A 3PRZA 3IMSA 1URZA 1XH2A 3BP7A 2IWGA 5D1ZC 1EEZA 2PWHA 4AVJA 3W37A 3FFDB 2LW3A 2V9QA 1KBPA 1OWWA 3VXOA 1MCSA 3MRBA 2BDNL 4GKOA 4N2FA 4Y2OB 1AGCA 3FONA 5EIIB 2B39A 4D2NA 2X4NA 5JHDB 3D0LB 3KPOB 2JB6B 1DL7L 2ZOKB 4M62L 4DGVH 4JBSA 1OEZW 1OAXL 4OBRA 4DHLA 2VITA 4O02B 5IB4A 3P9LA 5KVEL 5IB1A 4EBQL 5CMAB 2JK5B 1F02I 3HVNA 4F8PA 2Q7YA 1PQZB 4WIQA 1F8TL 1IAII 2WLIA 4NHCH 2MMXA 2AJZB 2QADB 4NZRL 4ERSH 3PGDB 4L1BA 5CIPB 1AXTL 3TFKC 5IQ9B 1AYOA 3GPEA 2JVUA 1E9QB 5ID1B 1JXKA 4ZK8A 4J3OH 4EVNA 4WENB 3C8KA 3QJOA 3QZWA 5G2NA 3M17B 5DO8A 5F7BA 3LEXA 3FOMB 4CUCA 4CSPA 1PZCA 4AQEA 5E8NA 3TEZA 2E86A 1JF5A 4WW2A 1WITA 3NCWA 4NWTL 3MJ9H 4P0DA 2OAAA 1ZV9A 3D05A 4XAKE 4YDVA 4A7TA 2O6EA 3G6JE 3Q1EA 1O9VA 4ODSH 1SN2A 1NCWH 1N6QH 2NSXA 1JZDC 3U6XA 2QELA 1WZ1H 3CMOH 2QR0A 4C4UA 2BVUA 2OKMA 1U4FA 3I6LD 3MLTB 4FULA 3D5OF 3BUIA 2VLKE 4R6UA 4Y0GA 3T4AC 1X5JA 1I7TB 5AW9B 5C0BA 1DSYA 1YQ2A 4NBXB 2CM6A 3HLAB 4M8QB 3BAKA 3NSFA 4HGWB 1BVZA 2JCCA 4KTEL 5ANMB 1D7BA 25C8L 3KGUA 4HIEB 2UY6B 4UV7L 2H5UA 2EYTA 5ERWA 1FYTA 5E2VL 1Z9SA 2IAMC 3QQ4A 5T1DH 3UJIH 4RMQA 4E5XG 4OLXH 4EN3B 1S7WA 2PWEA 3O41A 3DLQR 2A9CA 5EZLA 5C0BD 3W2DL 3IS0X 3BYTA 3ML8A 4HUCA 4S1SL 2DQEH 3HS0C 4WUKH 5IM7B 1XH3A 1BM3L 1THCA 4OLWL 1UD5A 1EH9A 5GS0L 4QNPE 5E8PA 3QFJA 2R0LL 2EDKA 1VAHA 2EH8L 4IBLT 5K69A 4GW5A 3U46B 4OQTH 1XIWC 3P0VH 4H8PA 4N1EA 2ICWB 5E8DL 2AAAA 5KTEH 3AM8A 1AE6H 3OLEA 3Q3GB 2HT4C 3LXBA 2AABL 4WK4B 3L5IA 4HIQA 1VFUA 3GIZH 3QFJD 5ALCL 3TBSA 5GGTA 5LG6A 3LXAA 3SKOA 2EIZA 1QI3A 4M43H 3WKNA 4X5XB 3WS3B 2UZIL 3J8F7 5DRNB 3DK2A 3HI5L 4XHQA 4Z5RA 4H25B 4UIKL 1NGPH 4ENZA 5E1AB 3ABLB 2APWA 2E7CA 1GJIA 2DI7A 4J1UA 4PGCA 4PWFA 4Y5VA 3G5YA 2DZEA 2A83B 1EGJA 3V6OA 3PUCA 4O2EB 5GGVH 1F3DJ 3FC8A 2F53E 3DX7A 2XIDA 5E24E 2WN2A 2IV8A 4X42A 5DHVA 1MCCA 3BSZH 5GZNC 5GJSL 4WV1A 3N43F 3WKML 5D2LE 1JDAA 3U7WL 2YHGA 3QUZC 3HCVB 4OF7A 1R19A 5DJAA 4PJ7F 1OTUC 4AQAA 3OAZH 4N9OB 3VB8A 2ITFA 1PMYA 3EO0B 4KVNH 2DBLH 4KK9D 4OCWH 4JFFE 3TN0C 4G3YH 4OF5A 1VFOA 3ZYZA 2ZWYA 4QT5B 1FVDB 4EUPG 1MIEL 2NY3D 3NGBC 1EHAA 5KSUB 2DQDH 3TP4A 4ZUVA 3C6LA 1OTSD 5T1KD 2VUOA 3VXNA 4P5MB 3GLEA 4WY7L 1UWFA 5J3HC 3GTVA 1KEML 3QJXA 2WBJB 4YQXL 5D2LF 4P2AA 1L5GB 1HILA 5DHXB 3ZMEA 2B16A 4HZLA 3AB0C 2JI1A 5LGJA 3MV7E 4GUPA 3S3PA 3H2PA 3C6LD 2R23B 4ZUSA 1L0QA 4ACPA 2XNAB 1KEGL 3DX9A 2NY2D 1JWMA 1N5AA 1ZJAA 3J07A 2LU5A 1R3HB 2OMZA 3WIHA 3BP6B 3NACL 4MDRA 5D1QE 2OI9C 1A65A 4ZFFA 3EFFA 3MJGX 3SKJH 1LE5B 1IGIH 5SWSE 2FT8A 3H7BA 5DRWB 4JM0A 3IAGC 1XZ0A 5AVYB 1ZTMA 1NGQL 5MENB 4H88L 5KW9H 4EMZA 4Z7NF 5D71L 4APQB 3BH4A 1CI3M 1MFCH 4YAQB 4P4KD 2YK1L 4HDIB 4TTGA 3N1MC 5JHLA 3ALPA 1HZHL 5D4IA 3V5HA 5ADPL 2HJFB 1OD9A 3T0BA 4MQTB 2XA3A 5EUKB 4UT9L 3IKKA 4HT1H 2F68X 3QWQB 3NCFB 2C8NA 4Z7UB 3B3BA 1WC7B 3CU1A 1MXDA 4NZDA 4KPHL 2CBOA 3MRFB 1JZEA 4QRFA 3T3MB 4Q9RH 2BWQA 2WAQA 3REWB 5EULV 1IKOP 2EINB 5E4EC 4PS4L 1F2QA 5T1MA 2Q8AL 2IMMA 3MRPB 4HJGA 5F2FA 3LMJH 3EYQC 5DVNA 2CGYA 3GMQA 5B4MC 4CMHB 2DMHA 2PWGA 2JLLA 5KZCB 4HF5H 5FFGA 1HJCA 2G3MA 4F80A 1TZIA 3RX8A 1ZLWK 2XXFA 2VJ8A 3B3IB 3MGOA 4YHLL 4A04A 4DKTA 1JZHA 5IEKB 3K4ZA 4Q6IB 3CHPA 1DANT 3BAXA 5I8CB 5FO9A 7TAAA 1TENA 2X1QA 3VW3H 5DVMA 3LQAC 3P30H 1A14H 4G8EB 3OAWA 1LDPH 2RHEA 5EOCJ 5IB3B 3QAQA 4NO3A 2RTTA 3QG6B 2VLJB 3SQOH 4Z7VE 1M2OA 5T33H 5JQ6L 2LU7A 2K45A 1G5AA 3QCVL 3GBMH 4OGYL 1B3IA 4LEOB 1YNTA 3QUYA 1YUKB 5E4AA 4ZZKA 1Q0YH 3HE6C 5I2IA 4YHML 5AB2A 2QQNL 1VGKB 4HHAA 2APBA 3FQNA 3KPNB 4IMLB 5IOPB 5IW1A 2XFXB 2CLZB 2AJ3A 2DM7A 2XDHA 4M6OL 2BXYA 2ZUWA 2LAGB 2WJ7A 3QJRB 5HHOD 1ZLVH 4JM2C 4AIZB 3QYCA 5KYUA 1WK0A 4MWFA 1I9IL 3AS2A 1MZYA 1AS7A 2TSBA 4UANA 5F8QC 1XGPB 1ZGLB 1MJ7H 2QKIB 3UDWA 1QFPA 2ZSWB 3IB4A 2UYLB 3AXHA 3DX6B 4AYBA 1TVBA 1JJUA 3ECQA 3FN0H 3APNA 3KPSD 5TE6H 4H20L 1CVSC 1MAML 3SE9L 4JPIA 4ALAH 2CIKB 5M94B 2JH2A 1MIMH 2ZP0T 3GMLA 3PIQA 5CZVH 5ES4B 2RALA 5E0QA 4PBDA 4PIBA 4JY5L 5DHYB 1HL5A 1EHNA 2EQDA 4X9FA 3TCTA 2O93L 4FQXB 3ZO9A 3EYFA 1YJDH 3MLZH 4MAYB 3VXQB 3CZKA 3GHEL 3TU6A 1BQSA 5EUOB 1J88A 2Z0UA 4WQOA 1CURA 1IEBA 1SXAA 2ARWA 5EOCL 2JKLA 3F64A 3PWJB 5C7ZA 2F5BH 5IBLC 3AMLA 1SF3A 2V8MA 4DOHE 5GRJL 3NJVA 2G9HA 1PZUB 4MQXD 3Q2CA 3U9PH 4NC1C 3CDYA 3MR9B 4B9JA 1UB6A 1G4RA 4UUJA 3MLWH 1WFIA 1MCIA 1MHPL 4JO3L 5HSFA 1ZHBB 2DQJH 3IXAA 2AQPA 3QIWC 3CD4A 1DLHA 2P52A 4H5SB 3PY9A 2F18A 2VR4A 5CJQH 4X6CA 4I0KA 1ACZA 2A6JB 2H2SD 1DQDL 4PVMA 4NSKA 3R8QA 4AX3A 1FAIH 3PV6B 2JJWA 5GGVY 1E5YA 3DHPA 2P8LB 3E8UH 4N8PA 5JOFB 4I77L 5GS1A 1CE6A 4RWYH 1KNOA 4O2FB 3MRKB 4RQQA 3FU8A 4OD2B 2A2QT 1S7UA 3MODH 1JK9A 3QRFM 1NCCL 3S5LA 4LU5L 2NCMA 4LT7A 2G60H 2DLFH 2IGFH 5KVFE 1UT9A 2Y24A 2BY1A 1RURL 4L48A 4OAWB 2DLGA 3GT6A 2H8PA 2FJFB 3MNZB 1TJIH 3N0PB 3O3AB 5T1DL 5I71B 4NUJB 2VLRA 4ORZC 2KPNA 3KJ6L 3SODB 5IGXL 1HSAB 3ZL2A 3EG9B 4IM8A 3H1ZA 1KGYE 3RJOA 4QYOB 5I6NA 2JKIS 1T21A 1D9KB 4JL2A 1DZ0A 5CLYA 1IE5A 1N6UA 4ODHL 3QO1B 1AQKH 3BPOB 4BZ1A 3T2PA 4X7SH 4YDLB 4ZQKB 4PV9A 4HMDA 1SHXA 4E68A 4MCZA 4MA7L 4I8DA 2P8MB 4WFFD 5KTEL 3V0IA 1AE6L 3KYOB 3QDJA 3LKPA 4N68A 4RNRA 5CF3A 1UD8A 1GRWA 2L8AA 4QO1B 2GKIA 3RWCA 3GGWB 4I18B 5TDOA 1UJ3A 3EYOA 3FO0L 5AL8A 3NJLA 3BD4A 4GMTL 4F9LC 3OV6A 1AYRA 3W38A 2GAZA 4KKQA 2E56A 1GJUA 1U8JA 4JRXA 1XQ4A 1NL0H 3KLLA 4OGZA 1LP9F 2BC4B 4E9WA 4UTBA 3QDJD 1WRFA 1A1OB 1FL5A 1NGPL 4MTMA 3HE7B 1W8OA 1XR9B 2WY3B 3QIBA 4N0FA 2X1XR 4AL8C 1XCQA 2B0SL 4MXVE 1P5UC 3HPJB 43CAB 2DYPA 2DQCL 3LJ3A 1VLXA 1JK8A 3CCHA 1OGAE 3V4VH 4DFIA 3WLWD 4PQXA 3JV6B 2YRZA 2R0WL 3BSZL 3MNWA 5E2WH 1SJEB 4P9HC 3QXUA 1A6UH 4NN5C 4P59L 3LB6C 2PPFA 3FB8B 5AAWA 3P2DA 1N7ML 1E9PA 2IFGA 3SCMB 2R2CA 4NYLB 3HBZA 3B9KA 5I6PA 4U1HB 1CK0L 1B4LA 3GRWH 4KHXL 1QPXA 4NO5B 5LNEA 3H9HB 1X4XA 2FEDC 4KVNL 5D5MB 3DYOA 5HGBB 3A6BH 4MXVF 1FJ1A 4PRHB 5EO9A 3WENA 5DWPA 1MLCA 3QPQD 1JHLL 4FYQA 5GRUH 2ID5A 3C2SA 3MLPA 4UINH 3AVEA 3GXNA 1E7VA 4KI5E 4O5LL 2D9QB 4B7IA 4YSPA 5I8OL 2DKMA 4FQHB 4XB8A 3WNPA 4N8VG 4LEBA 2OR8A 3O2DA 2XKSA 1H5BB 4N25A 4DVBA 4NN7C 3ESOA 3NIFF 2O5NA 4DT2A 3FCSA 1UD4A 2E7DA 4NO0D 4ONGH 5HVWA 3BHBB 1WBXA 4M6MH 3PPSA 5EOTB 5D72H 3RB5A 5MENE 1HJBC 3MZTA 2R83A 3BQUD 2XPYA 3GSQB 4IMKC 2P80A 2GI7A 3QXVA 4O4YL 2XIBA 3DJ9A 4GSDL 2JI3A 5E2TH 3FF8A 3VGFA 5FYKL 1NCJA 2NYYC 3NCCB 4DZBA 2D03H 5I76B 3JWNG 1E6OH 1EGJL 4U1LB 5DFTA 3DO7A 2P80D 3POHA 3U0TB 4MJ5A 2YAQA 4HIJB 5DQJA 5MEQA 5MHSD 4XNBA 1R3KA 2DMKA 4Y7OC 2GC4C 2EXYC 3K3QA 4K5NA 1N68A 1F4XL 4LLMA 4HKJA 3WGUB 5IESL 3A5VA 4GYBA 4Q9RL 2FX7H 1TIUA 4JGNA 4H0GA 3U2IA 1OAKL 4QRUA 4G7QB 3VXSB 1QSZA 4AVHA 1SBSL 3AG4B 2K3TA 4DETA 4L4TB 2OR7A 5AYTA 5D7JD 3VQ2C 2FX8H 2BNUB 3BUQA 3T8VA 1XD0A 4PHZA 4FQPA 4JN2A 4RA3A 3QEGH 3QZPA 3VSQA 3CPUA 3ZKSD 4ANXA 1A4BA 1A6VL 2ADGA 5EU4A 3WJJA 3ZT5A 4J39A 4YVUA 2JQMA 4TYUA 1J48A 5DRZB 1QTSA 1ONQA 4R83A 4Y16C 3HFFA 3WUZA 5ESAB 2VXVL 4LOFA 5EIQA 2GHZA 5GJTH 4ELMF 5F96H 3U2JA 3PYCA 1MREL 2EP6A 3NPZB 3OZ9L 2IH1A 2FB4H 4HJEA 1S9WA 4IYKA 4JFDB 4GQQA 5LGYA 3WIHL 1JPFB 1ZVSB 4HXAH 1OSZA 2OTWB 3TVMB 3CSPA 1RZJC 3E2HC 3MGTB 3MOQA 5F93C 1RK1B 4HJTA 4TQEL 2UZYB 1BVLB 4GXVL 3KPRD 5GGSY 2MPAH 2PTTA 2VZUA 2VLJE 4XCFL 2V2XB 5JHLL 4PU2A 2WWNA 1ES0A 2BVPB 1TZHA 2MIZA 4RGNB 4Y4HB 3VFVA 1Y18A 4P3DA 1BF5A 4U0RC 3PJSB 4HXBH 1M7IB 5GSRB 1Z66A 3JUYA 3LKQB 4YO0B 3KWXA 1E27A 4BWWA 1MEXH 3NJJA 4Y89A 1JNJA 5EZIH 1A7PH 5B39B 5LLIC 4YDIL 4JL1A 3U1PA 1TFPA 3G3LA 5KBKA 2V5RA 5EN2B 4ISVB 3WBDA 1VSCA 3N41F 1Q9OA 3SJVB 3K71B 2OMTA 3N55A 3RVVD 2GK0A 1HKLL 4CN4A 1NIFA 5B38G 1WICA 3JVGC 2JJTC 3MBEA 1P53A 3LDBB 4ODWB 3RUGA 4EOWL 3CXHK 3VRJB 2KLSA 5B1KA 4OB5H 1ACYL 3ZW3A 5FYJL 2Y7SA 4Y1AA 4KDTA 5I5JA 1UVQB 1MCDA 2E7MA 2VZ1A 4FGMA 5L4FA 2RA1A 4FXGC 4NCC2 2ZIDA 2VAAB 4MZIA 3V0GA 3VGEA 3LQZB 3SO3B 2Q8BL 2XV0A 3MBED 2VDQB 1T03L 4FLRA 4WJ5A 2D9CA 3GKWH 4TVPE 4FCHA 2R4SH 3O6ML 5HDWA 3VQLA 4JUSA 2GC7C 1CO1A 2PW1A 4MDIB 4TRPL 3RX9A 4F24A 5EUOE 1L0XA 4IBWA 4UQ2B 5AKSA 1QW9A 2ILLA 5C0CB 2EH7H 2CSPA 2YC1B 3TA3B 4PS3A 1A9BA 2OTUB 3SN6N 5CGMA 1H3PL 2YD4A 4DW2L 3CC1A 4QHLB 2ZAIA 1N4XL 1P7QB 5ENWB 3TX4A 5JMOC 4IU3B 2BK8A 5CR8A 1AVAA 3OAUH 3EGSA 3VB9A 4KZDL 3QUGA 5EPMA 3Q13A 4NAMA 1QRNB 3NA9H 3DGCR 3JT0A 5DFAA 3BDYL 1E5BA 3VFUB 2NY5L 1B4JH 1DVTA 2P45B 2AMGA 5EMYA 3MJ8A 2YEZA 1AACA 2YGPA 3QAZC 5CJXA 2WWKT 4LGSB 2AJVL 4MJIA 3UYPA 3ZR5A 1QWUA 4I5BB 1BFOA 1FFNA 2EICA 2WLHA 3N40F 5E6IB 2CKBA 1G1CA 2ESVB 1RAMA 1XF1A 5E94A 1XO8A 1N8ZB 4JANA 4LDEB 3VXME 1CZ8H 2VJXA 2UY7B 2OSLB 2G5UA 1BVOA 3BLPX 3ILPB 4OKDA 4UNTA 3HUJB 2R69H 1F4YH 1J8SA 5F3BB 5J7CC 1NJ9A 4FP8H 5IFHH 1JXDA 3B2UD 3MXVH 1IAMA 4XGZA 4UAHA 1XGUA 4DH2A 1W72B 5GGRA 4WFED 4I3SH 1O0VA 5L7XL 1BM7A 5KS9A 3APCA 2MTAA 4XNUH 3UG5A 1N3NA 1F18A 1HU8A 3T1FA 5L4MA 4V1DA 4GI8A 4UB0H 1KB9J 3GF8A 4MX7B 43C9A 1Y6NR 4BKLA 1G9ML 2NLJA 2PWFA 2C7UB 1BIIB 2A73B 1LVEA 4FXTA 5J8OA 4AM0B 3SEPA 1W0YT 4LPTA 4O51B 1FNGB 1OXYA 3RBSA 1QMUA 1A4KA 4OIFA 2QPFA 4JFEB 2PYEA 4YH6A 3UIZA 1EXHA 1TTGA 4L5FE 1EAPA 3NJIA 1HE8A 3UZVB 1U4EA 3HAEG 3T0ED 3ARBC 3WYRA 4ECNA 4ADIA 3FT3B 3BLKA 4LP4A 2DDQL 4JVPA 3TNNA 2F8OA 4LBEA 4DPCX 2B8OT 4M7ZB 3DC0A 5E2WL 4ZFQA 4FLQA 4Z7OE 3TIDB 1KUMA 1RLBA 5E08L 3SPVA 5I26A 3LPFA 3GJFA 1LEIA 1JCKA 4HJUA 4MMYB 4P2QE 2X4SA 3WCYA 3ZE2E 4U3CA 1A6ZB 1SOSA 3AT9A 5DC4B 1FCGA 3BKJL 3IRPX 4IHBA 3U9WA 4S0HA 3NZHH 4N9GA 3WNOA 3WS6C 3RI5F 1NUNB 3M46A 3O45A 4N24A 1I4FB 5JLZB 3TZVD 3JWDC 1YAIA 4MNHA 4DQOL 1TLMA 4RFOH 5D2NE 1PIGA 1T22B 1OZTG 4R4BA 2BFGA 4XR8C 3HHSA 3SD2A 3VRLF 2ICEA 4Z7OF 2FHFA 3ILQD 3NAAL 3B6SB 3KS0H 3WV0A 4BZ1L 5HHPA 5IFJA 3HI6H 2EDTA 5EO0A 4K71C 2HH0L 1IC5L 2NR6C 3S96B 3ZE2F 3C9NB 4N0UA 3J7HA 4BFIB 5DK2B 4NBYB 1CLOH 2PPCA 4PB0L 4K15A 3QEUA 3ETTA 4L9LC 1NGWB 4ZXBB 5D72L 3QUKB 3QNFA 3SIKA 5K59F 2BP3A 2DMGA 4IOSA 1UQSA 3SDCC 3UGUA 3MV8D 1D5XA 5IV2A 1CFNB 4DUWA 1MCHA 4UTBL 1K8IB 3CZJA 5DJ2B 1N0LB 1BOGA 4GKZA 3E8VA 1DCEA 3O11B 4FQ1H 5SWZA 2XJKA 3FQWB 4Q9QL 3IDXL 4NENA 1FFOA 3IBEA 3WY4A 1XD1A 4WEUD 5IQNA 3OQ3B 1IC0A 1PEZA 1V7ML 3BVNB 5F7HA 1HNYA 4N4YB 2O5YH 3P4OB 3D07A 4POYA 4UBDD 1ZT1A 4Z3JA 3IJ7A 3C8HA 1I8LA 1GZHA 1QLEH 1PZSA 2AFNA 1VEOA 1JPGA 5AW7B 5C3LD 2IBZY 4XN5A 3VXSE 3ESUF 1E28B 3O3DB 4F27A 2G75B 3BCDA 1TQBC 2D3JA 3D08A 4L4TE 3RWEA 5EU3B 1QEWA 1AGFB 4PJFB 5IKCB 4YHKL 4YBQD 1QHPA 1FZMA 5I75C 1NEZA 4JPQA 4W6YB 4AEFA 3GMNB 3KPLB 5T5FA 5E9DE 5F7MC 1I8KB 3D25A 1CF1A 4X4KA 1FFTB 1OARH 4CJ1A 3N42B 4BZ2H 1AOHA 4XCEA 4OJCA 5KSAA 4MHHI 3BX7C 1QI4A 5HGGS 2OMVA 5T3XL 1S8DA 5HHNB 3CSYB 3HZVA 2VZ3A 6FABL 1P4BL 2W07B 3O2DL 4IGBA 4F7TA 3S2CA 1AXSA 1OCOB 3IU3B 1TZAA 2BM3A 2YPVH 4YOKA 5D7KE 4XCNA 5KSAD 3ZXAC 4Y2DB 2VR6A 3KWTA 4W9JC 4FXKB 4P2OB 2W94A 4M7LL 4IGBD 1E4XH 2OCJA 4JE0A 5IHZB 1Z32X 2NZ1A 3NEXA 2H3XC 3HC4H 4YVNA 2VL5A 5H94A 3IGLA 4BWTA 4RGNE 2VSCA 1IEAB 3OKLA 2LTQC 4CU6A 1DYZA 3A0OA 3ULVH 3C6EA 3D51A 3CFBB 4PAZA 4GQRA 32C2A 3EFOB 1E9OA 3LD8C 1MSPA 3S0PA 1NDMA 3O9WA 2OSYA 4MBRA 4ORGB 5DMGC 3WTSA 1UC6A 3SJVE 1G7QB 3RRQA 1MI5D 4O2CB 4Z0XB 3RFZC 1KCVL 3K6NA 3KZ8A 3GHBL 1ZLWH 3JBG7 1LEGB 4Q0XH 4X5LA 4DEPC 3IGAB 4QYAA 2MNWA 4PM1A 3GLZA 5C09A 3U4KA 2XYBA 4GEIA 1T5XA 1WFNA 4EZJA 5HDQL 3BIBX 3OJVC 3RIKA 3T8XA 3BD5A 3L13A 2B4CL 5LNGA 1I1CA 4OCRH 5ESVB 5DD5H 1RZFH 2HTKC 1JRHH 3B2VL 3RVUC 5MI0C 5C09D 3EGDB 4O9HH 3QHFL 1CVRA 1TEYA 1DANU 1E5ZA 4R3SB 3VFGL 3PP4H 1MJJA 2R4SL 2W9EL 1CU4H 3F6JA 5C7XL 3P4MB 2WXFA 3UBGA 4ZX4A 3OJMB 1A4AA 2YD2A 1H3VA 4PJ8C 3NEOA 3V6FA 4FQLH 4WI0B 5F0LB 3DPBB 3I6SA 2WLLB 3W9DB 3UXFA 5LKNA 2J8UF 1KDIA 4BDVB 4XRCB 2Y2YA 4HCGA 4Q9CA 4M4RB 5KSVB 3R4RA 3K2MC 1JMXA 2A6KA 4IS6A 4Z3EA 4P2RA 1DQJA 4BCXA 5BRPA 1QRNE 5I1IH 2Z91A 4OCSL 2DB8A 1R5IA 5EZJA 2CRZA 3UIYA 3LRMA 4H8VA 2M8XA 3HRZB 3M6DA 2VDKH 4PTTB 1KYDA 5CGYC 3VA2C 4AV0A 4B0MB 3G5WA 3VQ1C 1ET7A 4P2RD 2OJEB 5HGDB 1J1OH 5GRYA 4D9RD 4RMRA 1XEUA 2E75C 4X2UA 2ESVE 2IDSA 4PJBA 3UTSB 3NRQA 3R06A 2CK0H 2X4QB 3QDMB 1T0NA 2IPTL 2WKGA 2EVGA 3QIUC 4P99A 4PWJA 4XP1L 3NSXA 4N6QA 4PRPB 4K73A 3C2AL 2XETA 4DZ8A 2WXGA 2QSCL 2R1WB 4MZRA 4HQQL 1RH8A 1UB5A 5D1ZD 3JZYA 4LFHD 3V7AG 1IVLA 2GCYA 3HUJE 3N44F 5D7LA 1B0RB 4QRSB 4FTVE 4NKOB 2J21A 3DX8A 4QIRA 5KVEE 2X2IA 2R69L 5FXCH 3LRHA 4NM8L 4HWEH 2WCSA 5E00A 1PJ9A 3B34A 1QPKA 1U3HA 4H0LC 4PPTA 4JDTL 4U1KB 2FYYA 1ITBB 1KIRA 1TQCB 1UWEL 5KJRL 2GJJA 1PLGL 4FA7B 5K9OA 1DE4B 3ECVA 2X6MA 4Y4KB 3SBRA 4E9VA 4XNUL 2G0LA 1SF5A 4CL7A 1Q1PA 4KMTH 1N64H 3ZY7A 3PE9A 1R46A 1KC5H 1KTLB 3Q2NA 1H6EA 2CUAA 1N2RA 2YUXA 1LK3L 3RZCC 1R24A 1KF9B 4L8SB 4WU5A 3EJYC 2X4UB 3DMMA 1YEFH 4QRQA 2ISDA 4AIXA 3X1NA 1QASA 1I7RB 2FVNA 3BAJA 3K72B 3TFKD 3BZDA 4R7NA 4LRNL 4E9XA 1R33A 3ULSA 2COQA 4OV5A 1X9LA 4HMCA 4XC1H 5CD3B 2AQ3A 1KJ2A 1QRKA 4F93B 4R8WL 3PABB 4AH2A 1YNLH 2IADA 4RZCB 3JWNH 1UZ8B 4HS3A 3SDXF 1P69B 1NMBL 3Q06A 2YRBA 5DJ0A 2IFFL 1PZ2A 5C0EA 4J2XA 1U8KA 3HC3L 5IK3A 2VZTA 1HXKA 4ZO7A 1AQMA 2CKBL 2WP3O 4IIQC 5HI5D 4G9FD 1M1XA 1C16A 3DROB 4I4WB 1A3QA 5TK4A 3TO4A 4GAGL 1HWGB 3F84A 3CWGA 3AMKA 4WK0B 1KIUA 1G9HA 5EWIL 4R26L 4B53A 4X6DA 4MMXC 2DWYA 1AHWB 2VC2L 1U8HB 3BZ4B 3FPYA 5IB4B 1ND0A 1MVFA 4K7PX 3IDMA 4X98B 3P9LB 2ATAA 3TH2T 4FNQA 3O8XA 5DA4A 3NT0A 1CR9L 2XC8A 1CFQA 4P8QA 4XMLL 3OWRA 4ZPVB 1ZHLB 2MEJB 1LL1A 2ZAHA 2HSIA 2XZAL 2IAMD 1BWMA 4HGMA 4OD3L 2EKSA 1HYRC 3L1OL 2ZKHH 3STBA 5TDPA 1ZAGA 2HZHA 3LNHA 3O8XD 3EH3B 1NLDH 4J4PA 2FWSA 4OCNC 4B50A 3BC9A 4K0OA 1SYVB 4D0DB 5KUMA 1HTYA 3SZKC 5B1JC 2VMCA 1NC2A 1A3RL 4K2UH 3T77A 3HZMB 1MVYA 1XIWD 2AQTA 4J4PD 1YNKL 2V9RA 3Q05A 2VDOH 1MFVA 2HT4D 4FI7A 3WHE1 3T65A 1NCAL 4WWPA 4YDVB 4Z8FL 3ARFA 3D0AA 3TBTB 2WO4A 2HB0A 4L18A 1B9ZA 2AI0L 4DKFL 5DZPA 1A7NH 3L4WA 2XZCH 2QR0B 2OW6A 1PFCA 4YSUA 1YEWA 3UBHA 5AFAA 1I3GL 2FT6A 4LAQL 4TPRH 3F12B 4XPBL 5DQDH 3AC0A 3HNVH 2P8PA 1CT8A 2VXQH 4XMWA 1T7XA 2ZOWA 5C0BB 3KDPB 5F9JA 4PJFE 2FNBA 2DJ4A 2V7HB 3RIFF 1JF1B 2O6FA 3CV5A 3DKHA 4BQ9A 3H9SA 5ILTH 3L2NA 2MOVA 3U4EA 5GZND 1C5DA 2X5PA 3TN0A 5J1SC 4L29A 4MCNA 3O41B 5E5UB 4UQBA 3QCTL 4MZ3A 5TTRA 3QUZD 2ZSVA 3LH9A 1EJFA 4XCYA 2HFGH 4NKIL 1NMCB 5K39A 4NQTA 5JW3H 1OTUD 5K9KA 2JQZA 1X7TA 1ASOA 1DBKL 1HESA 2CG9X 3QFJB 4J8RA 4XMZA 3TN0D 5FA3A 3B37A 3NFNA 5JIIA 3SYPA 3UC0H 2IDCA 2QMKA 4WHYG 2AEIT 1IJ9A 2BSTA 1VCBC 1OAQL 3VFOA 1A21A 1U8MB 4YBLB 2DYSB 3GLDA 5J3HD 4KUZL 4LLAA 2FCBA 1XCTB 2EIZB 3NJNA 5FA4A 1KLUA 3DTDA 3HW7A 3L9YA 1J0ZA 2APXA 5DZLA 4Z5RB 4QF1B 4JQXA 4JFVA 1J05A 3KPTA 1KTDA 4PGCB 4J1UB 2EDJA 4FQJH 3SGJC 2YLKA 3QJSB 4R96A 5IB2A 4U49A 4D8OA 1FNSL 2NY7H 3DX7B 4GFTB 4X6FB 1LO3H 2Z35B 5BZWB 3U2SA 4A7QA 1R3JA 3ES6A 1HT6A 4UMGA 5CD5C 3US0A 3BPNC 1GGTA 4AUYA 4ZMYA 1T83C 5AVUB 4U7MA 1R47A 4A68A 1WTGT 4PLNC 2NY3B 1L7TH 3LN4A 4R97B 3UG3A 3MBWA 5DJAB 5I6MA 2YMOA 3BAIA 4AQAB 5T1KB 1NPUA 5L88L 4BELD 1U8LB 4QR7A 4XN8A 4RDQF 4UAOB 5ISZD 4Q0XL 4X9HA 1EMTL 1HI6B 3EOAA 4BKSC 3BT0A 4NI6A 4YK4C 5T5FL 4C56B 3C6LB 1A7RL 3BKMH 2VE6B 3MCKB 5DJYB 3K4AA 2NY2B 4OCRL 1RZFL 5AWNH 2ZKWA 1T7ZA 4LHJB 1T7YA 4PGJA 1JPTL 4ZUSB 1SVZA 3WO4B 4TUKH 5HJ3B 1CU4L 2NW2A 1MJ8H 9CGTA 3MC0A 4XHJC 4DGWC 3GUTB 1KGCE 2XXCB 4P4KB 3WIFB 1HINL 2FJHA 4K3EL 2YRPA 4U1MA 2HWZL 3FF7A 3SPJA 1PX3A 2H6OA 4G1MA 3VWKC 3QYMA 2PR4L 4JFHD 3TM6A 1ACXA 2X12A 4FNTA 3ETBJ 5A2JH 2B1HH 4HUUA 1BAFH 2IH3B 2QEJA 5J1AA 4A2HA 5ETUA 3S37X 1QTPA 4WTZG 1H3TA 3WFDH 5CBAA 3BFQG 1INDH 1H9VA 5JA9A 2FLRT 2YBRB 1YPZA 4PY8J 3TEXA 3VI3A 4DO4A 3RU8L 3GSXA 4OLVH 4OJAA 4UM9B 5KSBF 1BZQK 4CGUB 3UTSE 3I6GA 3TOPA 3T0XA 3WL9A 4GKNB 3QDME 3F6LA 2P1YA 1HHGA 2WXMA 5L4JA 4MBOA 2EIBA 2QHRL 3A6CL 1UENA 4LESA 4PRPE 1J5DA 4G80A 1S9YA 1ZHKB 5C0RL 5CHNB 4HKXB 4HC1A 3CHXA 3HE6D 4HJGB 4DGYL 2H41A 2X87A 3BRFA 2HX7A 5LGKA 1QSVA 2BOBA 1GAFL 3K6OA 3TASA 3Q5OA 5EF0A 1XGYH 2Q5BA 4LHUA 3BGFB 3FFOA 3GMPA 2PXYA 4MMZA 2J4WH 4PTUA 4XWGL 1ZJBA 5J6GB 2NX5A 4AYFA 4HFWA 2AK1L 4K94L 4N2GA 2VXSL 4Y2LA 2I27N 4YHOH 2BLFA 3QORA 2F58H 3HLKA 4MXQD 2BS71 5FO9B 4KMTL 2PCXA 3WXVH 1NFAA 4RISH 5J11B 4ZUUA 2X6AA 1UM5H 3LQAH 1MFEH 1QSFA 3QORD 2DWEB 1YSOA 2D31A 4FABH 5I19H 4X8JA 2R8SH 2D0HA 3ELQA 2OJZH 3HHMA 5HHOB 1TU2B 1WGOA 2DOCA 3D4ZA 2G2RB 1WS8A 4PJ6A 1IM3A 4AV5A 2WYHA 1LHZA 1IU1A 5GZOA 5BZXA 3ZDXF 4PGDA 4YGAB 5IBLD 4UQDA 5I2IB 5JXEC 1UH4A 4WHTA 5BZZA 5JW4R 3RAJL 3I6KA 3K5RA 1T6BX 4F8OA 3CK0L 3FQ2A 3O4OB 1UA6H 3KPSB 3QIWD 5GZOD 4BH7A 2AJYL 2VXTL 2H6UA 3AUVA 4P3WA 3S3BB 4F1SA 3BXNB 4OCYH 3GSNL 3I2CL 3VFTA 2QQQA 3FULA 3MAWA 4LNRA 4Q6IC 4C4KO 3VD1A 3UYRL 2YEVB 2AXJA 2LLNA 3KJ4B 4J12A 1BLNA 4PY7A 2WBWB 4CU8A 5BVJB 2ORBH 4HAKA 2DD8H 2NXYD 1NCHA 2EO1A 1YYLL 3GMLB 1G7JA 3ZZSA 4IU2B 5E8OA 1XTLA 4JX0A 1FGNH 2R51A 1OAUL 2WN3A 1DVSA 1VKXA 3QZBA 2EUXA 1RMFH 2FD6L 3Q6FB 1NDGB 5CS7A 1NM9A 2OS7A 5IOKA 1YG9A 1IEBB 3AWEA 5J9PB 1X5YA 4UYPA 2ZX6A 3KEHA 3QBTB 3SKNB 4H2AA 4AGLA 4W68A 2VW4A 2OPCA 1AC6A 2XQYK 4UUJB 4XO4A 3FQXB 1NAKH 3IXAB 4S2SA 5C0AA 4B96A 4JM4H 5EC2B 1DLHB 1KCKA 3UO1L 3V52L 1Q8MA 3SGKC 5D8JL 2MWCA 1LXMA 4HU8A 2VH5L 2FX9H 3G5XB 1I1YA 1S7TB 4C83A 5D7EA 3QDGA 4QAMB 4HPOH 4XXDA 1BFVH 1P5UA 3BPLC 4LQFH 4MA8H 3FUMA 5C0AD 1LQBC 3K8KA 3KG5A 4RQQB 1IKFH 4BSVA 4I13B 1CPUA 4JAMA 5C0BE 1B4RA 3S5LB 4JK0D 2VXQL 3OHMB 4FQXC 1RK7A 4FFYH 2JCCE 4GEJA 7CGTA 5EEXA 1I1AC 2AJSH 5KVMC 1NCDL 4WW2F 2WQWA 4PJAA 1Q38A 1NGZA 2H8PB 5AVSB 1SEBB 3NZUA 3T2LA 4FNSA 1VFAA 3GBLA 1XF5A 2HA1A 4JO4H 3WHE0 3KGTA 1LMIA 1LO5B 3DJRA 5LXGL 4XC3L 4LF3B 3HMWH 5E4IA 4JPKH 2NXZD 5E23A 2P48B 1GOHA 3KBEA 1VEMA 3ZHLA 4KBPA 4HVBA 1X5MA 2HFGL 2A9BA 5AQ0A 1AKPA 1FIGH 4QTIH 3V4PA 2ODIA 5JW3L 2ITEA 3QFJE 4G9DB 3GNMH 3CUPB 1FL3B 2VSKB 3QQDA 1BZEA 1X9QA 3WFCL 1C1EH 2FEDD 5I8EA 4EDWH 2JCCF 2ZCLH 2EDYA 2UWEB 5CP3H 4LHQB 3ARTA 2N7AA 4GBXC 1BMZA 2V3FA 4FL4B 2DIJA 3QDJB 3LEVL 4PJEA 4RNRB 2E8YA 4Y5XC 4E9SA 2OZNA 3UBXG 3RWCB 5D4QA 3T4YB 3OLDA 4W9HC 1TJGH 2Y1YA 4EDXB 1EZSA 1UJ3B 4XVTL 1PG7X 4XBGA 2GAZB 5J5EA 1QX1A 1JHKH 2Y3NA 2ZX8A 1SVCP 2JFCA 4XPAH 5B7EA 5FYKE 3NIDF 5DTFA 3BMVA 1I85C 3B2MA 1JVLA 3V6OE 5LXVA 1X7QB 1I7ZA 3IM1A 4MLSA 1SRDA 4NO2A 4DGIH 1JIBA 3HG1A 2R2EB 2PCPA 3AREA 5I8KH 4AL8H 1P0SE 2EXTA 2J25A 2GJPA 1NC4D 4O00A 5I6XB 3LEYH 3MNWB 2X4OA 4PGEB 1D9KC 1JZIA 3KWWB 2GSGA 3QJFB 1IFRA 4PGBA 4HWZA 2X6BA 3JWOC 4FZ8H 4XX1E 5DFVC 3UZQA 4JG9A 3FB7A 4KK5C 4ZFGL 3HG1D 4U1IA 2DTMH 4P9HH 5GRVL 3ARED 1U30A 6CGTA 4KFZC 1FO0H 1T1XB 5I66B 1E4WL 4TOYH 3TYGL 1MFUA 3ZL1A 5DDHA 4I18C 3SOBH 4FJ6A 2EXYD 4U3SB 5D93C 4ZYKB 4B6ZA 5DK0A 3N6YA 3E1F1 1DEDA 4OZFG 2B2XH 2DMBA 1O7DE 3O4LB 4BXSV 5KYYB 1G87A 2ED7A 2NNXA 4JFPA 4NZFA 2XQYG 3SYAA 4NO0B 2Y22A 3QI9C 3DSNB 4QD2E 1MXGA 1VACA 2G4EA 1USZA 4BH8B 5BRZA 4Z7QF 3CFEB 4XP6H 4Y16A 3BQUB 3RPBA 1NINA 2EJ1A 5AAMC 3OWEA 2D7TL 5AVWB 3WHXA 1A6AA 1MFDH 5ICUA 1JNHA 4ZMAT 5C1MB 2RMNA 3IFNL 4GRLA 2W0FB 4WU7A 3S35X 2OP4H 4Y16D 2UXTA 5CEZD 2VM3A 3T0WA 5SX4I 3L3OA 3D06A 2NRDA 1I3VA 5MEOA 1QQDB 3RKDD 4HZ1A 1H19A 5F9WC 3UGEA 4ZFZA 5FOBA 4NPJA 3V8OA 4RMVA 3L1EA 5HGAA 3NTCL 3WFDL 4OZIA 3QJTB 2XWBA 1QBAA 1Y0LB 3K7UA 4NPKA 3VI4A 4HOMA 3FO2B 2F74B 4P57B 2PO6C 1WGVA 4P3CH 4OKVB 1VA9A 2CIIB 3AABA 5D7JB 3FCUB 2JB5H 2QTEA 5D2NC 5F1KC 3STLA 3VFPA 2OX5A 3ILEA 2PTUA 1YQVL 2NY4C 1KTRL 2VDPH 3VJ6A 4QRUB 4GFXA 1H3UA 4CC0A 1H5BC 1UT1A 3IJYA 3GUFA 2VWEE 2YR3A 1N8OE 4P5TA 3T71A 5DFWH 1DQKA 2FECL 3U7AA 5FYJE 4PJCA 2OFQA 3ZRCC 3E6FB 4MA3A 2LLLA 2OSWA 3WAKA 4K23H 4CMMA 2BHZA 1Q72H 1ZLDA 4H1LA 4S1DC 3V4VA 4P5TD 1KN4H 3IN2A 2EVIA 4JFYA 4F9PA 3TBYB 3Q0HA 5KN5A 1T1WA 2Z65C 4WI3A 2FQEA 5DC9B 2AGJL 1GOGA 1RUAH 2ED9A 4IKNA 3APDA 1CGVA 1G7PA 2IH1B 1SQ2N 3MRRA 4Z7WA 4ZMOA 1S9WB 3F7VA 2ZJSH 2VXUH 2YD6A 3KPRB 3SDAA 1D5ZB 4K7FA 2UXFA 1OSZB 2W0LA 4BIKA 1DJIA 3U1SH 1G9NC 2A74A 1UUNA 4QWWC 3QQ9C 2DLTA 3QJZA 5IWLA 1IGCL 1YC7A 2A9DA 4AI7A 4KXDA 3IJEA 2HKFL 3LQAL 4YXHL 4AEHH 5IJVA 2CHDA 5CJOH 3D0VB 1NSNL 4RMSA 2PTTB 3VACA 4XODA 1PDKB 4UOQA 5AVQB 5HHOE 1V7NL 4LL4A 2GQHA 2XWDA 4DP5X 1FVCB 4MB3A 1S78C 2GVYA 3UC2A 3VFVB 5HHMD 5IMKA 3D4GA 4Z0BH 1HOCB 4PLJC 1PCSA 1S7RB 2C9VA 1S7QA 2VB5A 3EJTA 4G6MH 5CCJA 3CVDA 1WHOA 3KPSE 4GG6A 4YWGH 2WOYA 3VFRB 2GBAA 1O6VA 1WE5A 4U1JB 3X3GH 4K3HA 3WKYA 5F3HA 2IWKA 2X1OA 3EDKA 2DWDA 2FEEL 4LARH 1DTUA 1DQLH 3D1MC 3MBEB 4HC1L 3GKZA 3X11A 3V6BR 5FW7A 2AJXL 3GXUB 1OAYL 1KPRB 1MELA 3BN9C 3B2XA 3PAYA 2FBRA 4M1DL 1J0IA 1OSPL 1ESOA 4Q2ZB 4XMKL 3MLYL 2ZXAA 4GSXA 4WJ5B 4J3UA 3NJFA 4XVSL 4J5VA 1BZ8A 4N2AA 4RGNC 1VENA 2WQUA 5GGQH 1L9TA 2EDEA 5F6IC 5ADOL 3HBGA 4KJYA 4N8CL 4RAUB 2CUIA 1O9ZA 5F6HJ 2DMCA 3QWRD 1BQ5A 5JPNA 1GS7A 4WHYH 4DP4X 4MDJA 4MSWB 5CU9A 2BVOA 1UXSA 3QEQA 2AITA 4PB9L 1E2WA 1E5AA 2WTPA 1OWRM 3LN9A 2VMEA 2YD8A 4XXCA 2Q2EB 1QBLL 1SUJA 4YHYB 2EC8A 5HY9A 2J8OA 2QDWA 3ZTNH 4KAQL 4LDOB 4LCWA 4QXTB 1P84K 4A7GF 3FUHA 3SSGA 3HBPA 1BEYH 4NFCA 1IT9L 4ZOCA 1KCSL 1F58H 3DOSA 1OP3K 1PKOA 3SKUD 3EO9H 3ARBA 1FNFA 3T09A 4BK8A 4G6JL 3PHAA 3SQRA 1H0DB 2LR4A 4NT6A 5DC2A 4LMQI 1QNZL 3CFQA 1RIHL 4WTWA 4JANB 2EDHA 4M7JH 1BA9A 2E8ZA 3P73B 3ARBD 5T1JA 5EA0H 4X6CF 3BUBA 3F58H 4NQDD 2VLRE 5FO7B 4Q58C 1MZZA 3NCJL 2Z31C 5FYLH 3VA6A 3K0WA 3KBPA 3AACA 5TE7L 4Y5YA 4BBWA 5KYXA 4WFFE 1SYSB 4CKVX 1NJ9B 3QJQB 2J5LB 2BP0A 1NKOA 2R4RH 2IPUK 3W57A 4AGNA 1HHJB 1U93B 4XGZB 3G6AA 4KU1A 5IB5B 1XGUB 2R0ZL 2M2DA 4IHOB 1U3ZA 2FLBT 4K5MA 4XPFH 1AZRA 1GGUA 4CBPA 3C5ZC 5HHVH 1ROCA 5BQ7A 1N3NB 3QDJE 4M5TA 4XH2A 3RJDA 3T1FB 5FF6B 3GLAA 3L1FA 1MRFL 4IKJA 4NAQA 1YRKA 2NLJB 2DYRB 2XN9A 3LPOA 3RDTA 3GQFA 3GSWB 4V2CB 4I48B 3T0EB 4F7EB 4WGKA 4PJXA 2Y07H 4LEXL 4ODXA 3ZTEA 2HG5B 4I2XA 4M8RA 5BOPA 2OMYB 2Z9TA 1CBVH 2GFBB 4E5XA 5ABDE 3DGGB 1N59B 3IU4L 1UYWH 3HN5A 4JDVA 2C3GA 1GGIL 4W9KC 1XR8B 1NCIA 2FQGA 1LO0L 4NRZA 5DYOB 3TWCH 3CXDL 1UFGA 1U8CA 5AW0B 5I5MA 4LBEB 2R9HC 4P49A 1SM3H 3BWAA 1PTZA 2E4FA 3VWJA 1F56A 4JR9H 4G42A 1I1FA 3KW7A 4DP6X 3NCEB 3KLQA 2KLRA 3TEWA 1JBJA 3CXFA 4NQCA 3GJFB 4N20A 1ZANH 3M88A 4GRMA 3VG0H 4W4OC 3TZVB 5F7EH 2DI8A 5B21A 2WZ6A 3OR6B 5DA0B 1WO2A 5J12B 4KH2A 1JVKA 3L3KB 3OKDA 4B95C 2AQSA 3DARA 4XBEH 2VN6A 3IMTA 5FS5A 3ZKXB 1UOVA 1KYFA 2NQCA 5A6LA 1KTKE 5IFAL 3KLDA 5FO8B 5E6SB 1TJHH 3RL1B 2P24B 2BNRA 3KYMA 1KY7A 3BGAA 3OC8A 1BHGA 3QULB 2VDRH 4C4BA 3V4PL 3QP3A 1KMGA 4YL9A 5T3XE 4UTAA 5EO1A 3JWDH 2MCPL 4P04A 3WD5L 2WSPA 4KTYA 1NIEA 1T1ZA 3BZFB 5EO0B 3MV9D 4M8VA 2BNRD 3GB7B 3MV8B 1NCOA 4XCCL 5F72S 1B4TA 1MFDL 2A9ML 4ZMWA 4U4IA 5K9JH 2ENPA 3LTVA 1S6NA 4R0LB 4DWHA 4G8FA 2LE9A 4JZJB 2X42A 1UQSB 2AK4A 2J1ZA 5IEHB 1OK8A 5MHSE 4M02A 4XAKD 4QRTB 3VVWA 5GS3A 1BOGB 1NBZB 1UM6L 5EOQL 4ZMTA 4EUPA 5KVDH 2B1AH 4BGLA 3M45A 3GI8L 2COVD 1BF2A 2BVEA 2XV6B 1RHHB 1L9NA 3GMMA 1HZLA 4LPCA 4FADA 3FT2B 3CSGA 3N91A 1AQDA 2AK4D 4IDJL 5CUSH 4N85A 5JHAA 1KIPA 4QJ3B 3LKSB 5F88B 1DVFC 2VLKD 3CIQA 3MQIA 3UTPE 4F15C 5C70A 1R4XA 4TNWF 2IPUG 1HHHA 5GS0C 5KBDA 2V9UA 3Q9PA 4UIMA 3CVHA 4GUQA 4NQED 3WGVB 3L6FA 4GUCA 3L9BA 4WO4A 3PGCA 1HH6B 3TBWA 3D85A 3RG1C 2PETA 2XQ0A 3RWEB 4U1SB 1BXUA 4PJHB 1S9VA 5AKVA 3UMTA 3NG5A 4WGWB 4DP0X 3F7RA 2O5ZL 3U6RA 3UJTL 2OZ4H 5EBGA 3D25B 4MASA 4MKMA 1W6LA 5D1ZI 1VRSA 1CFMA 5DMGD 3NCBB 4FQCL 2GT9B 2ZWKA 4P07A 2OXHB 4KJQC 1FZJB 3CN0A 3AQZA 2Y2WA 5CILL 3ABKB 1KN4L 5KSAB 5CLXA 2OMVB 1WAAF 4AYID 1A6WH 4CGTA 2OQJB 4PWIA 1IL1B 3H56A 4L23A 5TPWH 4DN3L 5CEZL 5FGBA 1P5VA 1SY6H 3ZKQD 3FU0A 4IGBB 4H2CA 4PG9A 1YEJH 2A4CA 3D7PA 3V5DB 3HR5B 3NSJA 3UTQA 4WHCA 3EZJB 4XCNB 2ERJC 1CFSA 2HTKD 3S3JA 3U1SL 3UERA 1AXIB 3VE0B 1R5VA 3RVUD 2EVFA 3EJSA 4Y4FC 1RULH 5HHXL 1QEXA 2AEQL 1JFHA 3HG0A 3BWUC 3RWIA 1WFOA 3IDJA 1RZJL 2G3XA 1WIUA 3Q8AA 1KXVC 2VUKA 4NN6C 4CAGA 4E42B 2F53D 3RILA 3QXDB 4YEEA 5BZDB 3OKLB 4PJ8D 4IRSC 1MI5B 3VAEA 3QW9A 3FJTA 3NESA 5FX3A 1JZ4A 4WWKA 3WEBA 1I31A 32C2B 4JG0H 4WKZA 3UABA 2MNJB 4I0PC 3IFPB 3BJLA 3QG7L 4B27A 2EIKB 1IEHA 5DI8B 1CLVA 1YECL 2AV1A 2C26A 1BQHA 7PAZA 2EUVA 3KEDA 3BRGC 4LE8A 4WWKD 5CGYD 3D12B 5DD0H 2K4AA 2Y7QA 2I69A 1IZKA 4DIXA 5DS8A 3UROR 3M1OA 2BOCB 5C09B 4XPHL 3L3HB 4M6NL 2F8VA 3NK3A 1OSYA 1VFBA 2NSMA 5CLZA 4KXAA 3T8XB 2CKNA 4P2OC 4Z3FA 2J88H 3D3VA 4BQBA 2BXZA 1QYGH 4ZD3H 4F91B 1N5YH 4A2MA 1U58B 1SHMA 1WFMA 2XRAH 3QIUD 4U6VH 4XBPB 1MLBA 3R7QA 4WCYH 2R1XA 3BISA 2WC7A 2PLTA 5DD1H 3PWPA 4QOKD 4AGPA 1AHMA 1KIQB 4N2KA 5KUKA 5K93A 3RUGF 3HG4A 1QFUH 1UZ6E 3MJ7B 5JNYA 1YDPA 3DUHA 2DW5A 3TXAA 4PJIF 1EXGA 2AXGA 2ZX7A 4N8VB 3MREA 4NGHL 2F54D 1USQA 2IF7A 3U0PB 3T0AA 1J9QA 4DPAX 1OF2B 1VB9A 5D96B 4N1HB 1ZE3C 4I3RH 4P2RB 2PCFA 1RZKL 3LIZA 3X1EA 1IKNC 1U2HA 1IQWL 1Y1UA 1ZLSH 1PZ5A 3FBQA 5T5NG 3B83A 4JKPH 1GGCH 3OXSA 1KBWA 4Z3GA 5AVRB 4G5ZH 1BEYL 4GI6A 1GW6A 1UZ6F 2DBJA 2A7BA 3OJDA 4JRFA 3RZCD 1FN4B 3I9GL 3IETA 3PQYA 1YHPA 3QZLA 3EJYD 2YPVA 3IMWA 3VYNA 3FQRA 5D1ZB 1T0OA 3R06B 1XCWA 3QH3B 1AFVH 2YFNA 3Q8EA 1R0AL 3GSNB 2ATKB 3QPXH 1JN6A 1P2CB 3B5HA 3ECBA 3PQYD 1JP5A 2BSBA 3K2KA 4DZ8B 2WQAA 3FB6B 2W9DL 5CNHA 3CFCH 1KELH 5C8JA 3WKPA 3HR6A 3V6ZB 1UB5B 5