2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
b'HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Slc8a3
molecule tags Metal binding protein
source organism Mus musculus
publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
2FWSA 3US9A 2QVMA 3E9UA 3FQ4A 3H6AA 3FSOA 2DPKA 2QVKA 3GINA 2LT9A 3RB7A 3EADA 2KLSA 2FWUA 2KLTA 3E9TA 3RB5A
chains in the Genus database with same CATH superfamily
2O5YH 2EDDA 5JOFB 3HS0C 2VRQA 1UEMA 4LL1A 1FLTX 3NCJL 3NFPB 5GGVL 4AYMC 2DLHA 5I8KH 3CXHJ 4LARH 3L3JA 4XPFH 2VDQL 1I7TB 3DSNA 2WLMA 4X80H 3FB7B 3P3TA 2WNGA 4MLSA 3F84A 4UQDA 3TA4D 4BHUA 3N44F 5MERA 2R1WB 3LSOA 2FATL 3RA7H 2BVPB 3DBXA 4KV5F 1ZPLA 5FHBH 5HDQL 5L2JA 3F00A 4JFZL 1Y07A 3D87B 3HC0A 4RRPM 3VYNA 3QCVL 2EC8A 2EABA 1IC4H 3E9TA 2PPDA 3GTNA 5E9DA 3PG2A 2OR9H 4LSQH 3P30L 2FD6L 3KG5A 5H4YA 5CEYB 3SE3A 5C3IA 2NTSP 2J25A 4QIRA 4M6AA 5HYSG 1EJOL 3PHSA 4R9HA 1KCRH 3V0JA 1KCVH 4N0YL 2C3HA 1DCLA 4JM2C 2J55A 4QEGA 1RERA 2FUTA 4LEXH 3UJIH 3P11L 4Y5YB 3A6CL 1QYGH 3CH8A 2PMZA 5DZOA 1KV7A 3GYRA 2YGOA 3I6KB 4FKHA 4L8DB 2XVGA 1BQKA 5ESAB 2CAKA 4HWZB 5GGSY 4JPSA 4N8VB 4NO2B 3QWRD 6CGTA 2WZ0A 2AJZA 3DNKA 3N1QC 1CZ8H 5DZAA 1VADB 2VQTA 3OAZH 5CBEB 5I8CA 2FJFB 1EZVY 4GRWH 4ZPVB 3CLWA 2QQLH 2YQ3A 3QWOB 5AEAA 2AF2A 5INCB 3VXQA 4YBQD 4DGIL 3TN0D 4M61A 4BK4A 1MFAH 4XMPH 1J5IA 2ARJB 3ZMRA 1YEEH 5GSVB 1JBJA 3GRWH 4GINA 5FOBB 3CC5A 3WBDA 5EO1A 3KWTA 3RUGB 3VFOB 4OCLC 4XPBL 2B8OT 3OL2A 3SN6N 5CIPH 4B95C 4M6OH 2Z4TA 4JJOA 3VRLE 3TFBA 2MQGA 2O26U 1ACCA 1DVSA 2Y7MA 3MBXH 3G6JB 1U4EA 2AMUA 3B7TA 4PLOB 3QUKA 2F18A 3WTUA 2R15A 3AG3B 1A6PA 5J1SC 2A0LC 3BAXA 1UURA 1T21A 4P0DA 5CP3A 4DO5A 2NSXA 3PWJB 1XSIA 2PW1A 4N8CL 4TTDC 2BVQB 1NICA 3RY6A 4GMSL 2DB8A 4CVZB 4XP5H 4MCMA 4MD4A 1JPTL 2ARWA 4OB5L 4P2QB 5GQBA 5I1CH 3KZ8A 4PJHA 3L4YA 2ZUTA 1HZKA 4OFKA 2WLKA 4YQXH 3EJTA 1NM9A 2L3BA 4LLWA 5T3XE 4XHJC 5GS1A 2WIIB 1U3HB 3F64A 4PRAA 2M1KA 4UB0L 3RURA 2F7QA 3GLZA 4G9DA 3SBWA 4GRLD 1KEGH 5DO8A 3OKOB 3VSVA 3DX8B 4TVPD 1XD0A 4KV5E 5B1CA 5B38A 1RJZB 1PZ2A 2PCYA 4M7KL 3T0VA 1LO0H 1QRNE 4GH7B 5EN2A 2MEJB 3MV9E 5DD3H 3V0WH 2HFFA 2H8PA 2QMJA 3T1FB 4GSQA 5CHNA 1WD8A 2ALWA 3FOLA 4NPYA 3T6VA 5DSCB 3EW3B 3K8LA 4FKEA 1YNKH 2R29L 1VEMA 3FH8A 1W72H 4Q6IA 4PBXA 4GQ9H 4PJ8A 1WAEA 4V2CB 4BH7B 3N9GH 1J5HA 1X6NA 1VGEL 3ATBA 3MV9B 4E0RB 5IHUH 3ZKMD 1OAJA 3WFCH 3MLZL 2PTTA 2N59A 1NFDA 2PR4H 3ARGC 3EYQC 5K9QI 1AIFA 2Q7NA 1OPGL 1DBML 2I69A 5AVZB 3KWUA 1FPTL 4B7IA 1J5CA 3MBWA 4R4ND 5E7BA 5EO1B 3TT1H 3WEBA 4X7FC 3APMA 3WXVL 2CA3A 3LRHA 4TNFA 5EO9A 3TT3H 2VDKB 2VYRE 1MDAA 3OKKA 1BVNT 5LBGA 2EDKA 2R56H 1PNCA 2R1WA 2E7LC 1U2YA 5AVSB 3BPCB 4XO4A 4QJ3B 4JREB 4MSWA 3MYZA 5BRPA 5I23A 4OVUA 3V4VA 1I1RA 2VOTA 3APFA 1SXAA 3ESVF 1GMIA 4EI6A 4EMZA 4F8OA 3HRZB 2DV6A 3ATEA 2E9IA 3H9HB 1HILA 2VDPH 4LNVA 3GUTA 2EDYA 4J1UA 5DO2D 5LAPA 4EKXA 3RPIB 5AUMB 1WBZB 3WNMA 3FQTB 1XH3A 1UM5H 2GCYB 5AYTA 5KVGL 1NH6A 1LK2A 3NP4A 3DA0A 1UC6A 2Y5TB 3GMOA 3B2PA 3T0BA 3C6SA 1JZ4A 1TOXA 4PRHA 5F9WC 3NIGF 3V9FA 3IRCA 2VQ4A 4M7LH 5DFWH 1WAAF 1BQRA 5LN8A 5IIEB 4HKBB 4E5XB 4DVBA 4R90L 1ADQL 4N8VA 2VERA 1LDSA 1M6OB 1M9SA 1DUYB 1XCXA 2J1YA 3WJLC 3O4LD 1R5WA 5B4MD 2WLJA 3QI9D 3VTAA 1LEIB 3F7VA 1KACB 2GB2A 1OB1B 2D31B 5I1KH 1DN2A 1E5AA 3ZQ9A 1U42A 2DIBA 5AOLA 2VL5B 1N59B 4OH2A 4C83B 2JKIS 3PHQA 2AJSL 5F1NA 4I0PB 2EUXA 3NFNB 4ZPTA 1KCWA 2VC2H 5KG9A 5C0BA 2QADC 3RLSA 1IGTA 2BP0A 3N1PC 1RUKH 1JGDA 3IDNA 1XCQB 3I3DA 1HIML 2OMNA 5IQ7H 2CDGA 2O30A 2G3XA 1XGTA 4OZGF 3N43F 1GPOH 5DJDA 3GJFB 4FQIH 5LLIC 4O2EB 1DDHA 2G3NA 1B0IA 3X2QB 5JZ7C 3VXPB 4U3XA 2F7RA 3QBTB 2RGSA 1J8SA 2CBMA 1IAOA 1JZHA 1E27A 4GXVH 2AAAA 3U0WL 2JCCF 2IADA 3A6OA 2JJWA 3MN8A 5BQ7B 1YQVH 4QRBA 2CGZA 5BS0B 4WEUD 1HXKA 2OW6A 5JOFA 1AR2A 1CGTA 3T8XA 2O1AA 2DWSA 5K39B 1P5UA 3MV01 3A4AA 3ECBA 3T2PA 4ZYKB 3KPNA 1HHKB 3CVBA 2EE6A 4NKIL 5DQJB 1RIUH 1YCSA 1FFNA 3BVNA 4GAYB 1C7TA 3IWVA 3GMQA 3MI6A 4OV5A 2DQUL 4GXFA 5EBGA 3MRNB 2VWEE 3KW8A 2HZHA 3W11C 1WFJA 3JWOL 3L3KA 4A7TA 1BCIA 4G7RB 3AUWB 4F37K 2DD8L 1ZV9A 4ALAH 4Z0BL 4AUUA 5FECB 2Z7UA 2BOLA 1ETJA 1UYWH 1OEZW 4PU2A 4I87A 4HPOH 4BK5A 4M5YL 1BF5A 5H94B 3A21A 4NGHH 4KGLA 1MWOA 4DTGH 1N0LA 4K5PA 3L95A 4XXWC 3B4NA 5IOKA 5IFJA 5FO8A 4G9FE 4HIXH 3RVWD 5JO5A 5MP6H 3ULUL 5DEFA 4CRPA 3MLSL 2CHXA 2WXJA 4GO8A 1G94A 3IGKA 4ODTL 4JK0D 3NRFA 5EIQA 2WZ6A 5F7HA 4GG8A 3PWNB 4S11A 4PJXA 3REVB 1IM3D 2P46B 2V2XA 3QS2A 2VDPB 4NC2B 1T83C 4H8WC 2Y69B 3CVHH 5DRZB 4HKJB 5TH2B 1EUUA 2DQCH 1KJ2A 4OZ4B 4HU8A 1T5XA 4HX1A 4WI0B 4KXAA 5IB2A 3LKSB 3HRZA 4BWWA 3RY6C 4C58B 4OZFB 1HTYA 2Y72A 1EXGA 3GBNH 4JE0A 4XN1A 4WK4B 1IM9D 1WCBB 3VMOA 4ZMZA 1KIUA 4FL4B 4K9EL 3ZKMC 4J8RB 4Y19D 1KZQA 1WFTA 4P2RA 4AIEA 4HOMA 5IESH 5KBKA 3IVKB 5TF1L 1CGSL 3SDAD 3IFPA 3MRLB 2I5YH 4PIRF 1MFBH 2NNAB 1IKNA 4NM4H 4OGXL 4HG4J 1EH9A 1OIOA 2VABA 4UUJA 4PWFA 1XSJA 4ZD3H 1EWHA 3HBPA 1M71A 4TKWA 1WTLA 2VL5A 3U7WH 1RUML 2PYEB 3SE9H 1ACXA 1G7PB 2ICEC 4PJEA 3VCLB 4HJGB 1P2CB 3D34A 3TPUB 3L6FB 2A6IB 1MHCB 4Y4KB 1T89C 5TDOA 5E5UB 4PAZA 3IEAA 3RBGA 1OHZA 1FO0H 1L6XA 1MFVA 4FC3E 4HUXB 4RAVA 3F6JA 1AHWC 3H9SE 4G70B 3X3FH 1MCWW 2ODHA 3SOBH 4WUUB 1M56B 5IW6B 2OJZH 3U7YL 3FKUS 4NQDB 3HFML 1WAAE 3EDFA 3DX7B 4GBXB 3RWEA 5DRXA 4WK2B 4M1DH 3SDXA 5TQ0H 15C8H 3VXPA 1AJ7H 4ZPTB 5BNXD 4A2LA 2XPGB 4IK6A 4C56B 1A3ZA 2BP3A 2EH8H 3IPFA 3WKMH 3ZE0E 3CE1A 2IDTA 4OLZH 4KK5C 3QQ3B 3EYUL 1OZTG 1VFAB 4NFCA 1U8KA 2DQEH 2V5RA 3EYSL 5MEND 1YJDL 3BCFA 3H42L 4GRMB 1GGYA 4NZFA 4AGOA 2V7HB 4WV1A 1FNHA 1AXSB 3O6ML 2MCPH 3B2UD 4H1LB 4B3VA 5SWSB 3FPXA 3L13A 1UA6H 4CBZA 2CCLA 1GCFA 1TMQA 4ZOEA 4GP4B 1G5AA 1GSKA 2GUOB 4N0FB 4YSSA 4PJEF 4H0HB 4HEME 4PJIE 1DVFA 4HUKB 5E5RB 5BZXA 4S0SD 3AT8A 3FTGA 4BM7A 4RIRA 5FM5O 5GPRA 4LPXA 1TNMA 3RFZC 4PJFF 2NYZA 1KIUB 4B9GA 4QXTA 2YA0A 5FCUL 4L37A 4FQCL 4PW3A 1R9FA 1G9ML 4PW9A 3NJNA 4EDXA 5GS3A 4ZMQA 4QXWA 5A3IC 1SMDA 4XNMA 4IU3B 1QZ1A 4ZMAT 2DQIH 3T71A 4WFGE 5LG1A 3CN3A 1O7DE 2FVNA 2W9DH 4AJYV 2C26A 1YUKB 3ASOB 2FJSA 4BH8A 1VKXA 3ASNB 3GUTB 1BD2B 1NKOA 3EG9A 3VFNB 5I5JA 3QZMA 1IBDA 5JIPA 4PJXB 2YUWA 5D9SA 1CIDA 1KV3A 4KX9A 5A6MA 4B0MB 3RFZA 2Z31D 5D7JC 1G4RA 2ZUUA 4E9LA 3FU8A 2IH8A 2FUQA 5F88A 5J56B 5MEOA 2LVEA 4AENB 3FC8A 2ENQA 2QLYA 3NZHH 5JO5B 2CWRA 3GJEA 4JHVA 3R7QA 2HRPL 2VMDA 3KL3A 2VDMB 2CPUA 4XP6L 5AW1B 3Q7JA 1EZVX 1W0WA 4PJ6A 4WV1C 1OALA 2HP4A 3UO1L 4BFBD 2M83A 5C0IA 1MHHA 2VSMB 5H37H 1VJSA 1JGIA 3A4FA 4AG4L 1MCOH 2RR3A 3VXRE 1FNSH 1ORQA 2O5ZL 5DMKA 4JM2F 1OF2B 2A73A 2B59A 2ED7A 1QLRA 2QHRH 3VJ6B 3EIFA 3PABB 1MPAH 3S96A 3E2HC 4KI5C 4PJAB 4EXKA 1MELA 5SWSA 5IOPB 3C08L 3L1EA 2AFNA 1VHPA 4JCLA 4LEOB 2JJVA 3CFDA 3JZ7A 1M7XA 3QIBC 4PJXF 1XF2B 1H3UA 4KKBC 2XVBA 2AXHA 3BMVA 1FYTA 2IWFA 3GS7A 3L3IB 3MRIB 4WJ5B 3HBGA 5AL8A 4FTVD 1FFTB 2QVTA 1AYOA 2WQSA 1AOZA 4JANA 5G4MA 4MJ5B 5I24A 3KNBB 4YXLH 4AITA 4L29B 4HD5A 4W9FC 4RISH 3GXTA 3CDCA 3T6XA 5FO7A 1W0YT 4XX5A 1XIWC 2B15A 1SYSA 2J88H 1MW0A 4QHUB 5F96H 5KAQG 1LTXA 2OJEA 3HNTH 1VLXA 1SDAB 4GO9A 2RBLA 4L8BB 4KQ0A 1XH2A 4ESKA 1RK1B 3IJEA 2XWDA 1FE8L 2WLNA 5CR8A 1L6ZA 1A2YA 4MS8C 4NNPH 3TN0B 2CRIA 4OF3A 2NX5A 1N9PA 1HL5A 3PAYA 3W2DH 2GI7A 1B0WA 1NAKL 3VXUE 5JPMB 1ZA6A 1ZE3H 4AVKA 3ARBC 1UXMA 4ANUA 4WI4A 1NC4A 1I7UA 4H0GA 4BQBA 3D1MC 4XGZA 3WFHB 4XMLH 4U6TA 3MGTA 4LCCC 4NQCE 5DEGB 3ROLB 2J6EL 2ZJSH 5C09A 4YDKH 3P2DA 3DPDA 1HOCB 5DRWB 3BUYA 2DWXA 3FRPA 3MFFA 1NPJA 4HMCA 3TGXA 5FYLH 4XP6H 3BFQG 4J6RH 1FQ9C 4FFZA 3ABKB 3ZU8A 5F7KC 5CD5D 5B3SB 3MBED 5KANI 3TNMB 5E6IC 1SY6L 1KTLA 5AVQB 2CHWA 1QBML 3QQDB 4R26L 1GZQB 3Q8FA 5GHWH 3RZCD 5E08H 3Q8AA 5ANHA 3L8QA 4HCRL 2ATKA 1DN0A 1ROCA 3G3LA 1KB3A 4YHYB 5DLMH 5ABZA 1FZKB 3KWVA 1T2JA 4RZKA 3HJEA 1SLUA 4Q8BA 1U21A 2I60H 3T2NL 1QHPA 4KI1A 1HE7A 3QO0A 3DJTA 5ENWB 5GJSH 3RX9A 4P23A 5D70L 1P4BL 3S5LA 5KVGE 3JVFC 3JYBA 1IBHA 1IL1A 3CFEB 2V5TA 5DQDH 5HDWA 1L9QA 1A4JB 2VDLL 1H6UA 1TTFA 5F9AC 1H3XA 4QLRA 3WIHL 3NACH 4QRPB 2FEEI 5BUGA 4P2RB 3IVKA 2LGNA 1T6VN 2J7LA 3ARDD 4NUMA 3R8BB 3QUZC 3UFIA 1YEJH 2UZXA 5ADOL 2EJ1A 5I26A 5MEPB 1OM9A 1OAUL 5J6GA 4DN4H 2X1PA 3ZDZB 2L7JA 4EI5B 5HYSB 2VJ8A 3RVVD 1SDDA 25C8H 1DTUA 2IQ9L 1KIRB 1NFDF 1BV8A 1R3IL 2HFGH 3BQUA 4UDUA 3L7EB 5JW3L 3GS4A 4PI2A 3QJSB 3LN5A 2AJZB 1GW0A 3BT2H 1GGBH 1X7QA 5CUSL 3KBEA 3C8KB 1KJMA 4Y4HC 4KVCH 4PJFB 2R2HB 2X6CA 2MMXA 4GXUN 4EIBA 1GGCL 1MG2C 3FONA 4WO4C 2VDLB 5DRWA 4ABUA 4OLUH 3D05A 2YUZA 3H0TA 4N8VG 3WUWG 3QULA 2AJVH 2F19L 3W82A 1AFVL 4Z77B 4PJGE 4L29A 4BXSV 2ICWA 1NMBH 1BQHG 3VD5A 1E9PA 4HGWA 1RH8A 4MJ2A 5DUMH 3MV9A 1WG3A 5SWZD 1RK7A 1L9PA 3AY4A 4MA8L 2OCCB 4I4WB 4TVSa 4RFNC 5EULV 4AZUA 4ZX3A 1PQZA 4FMVA 4WNQB 3U2IA 2Q6WB 2A2QT 4MS6A 4FXKC 3V6FA 5CHNB 3LPGA 4XBPA 3SE9L 2BMKB 3VXSA 4PGEB 3G6AB 3TO4C 5ANME 5HHNA 3WTXA 1OKEA 5HD8C 3PWJA 3O3BB 4OKVB 2GY5A 5F7WC 4TNWF 4ZD3L 2JQZA 1O6VA 5M94B 1REIA 2YARA 5FKAB 2CHNA 2I5YL 4P2CG 1TPXC 1CGSH 2XRAH 4X4XB 5A16B 4AUJA 4GEJA 2JCWA 4NO5A 1BVOA 3FUKA 3PGDB 1ACZA 2ZXGA 2VRKA 4K9EH 3S8GB 2D9QB 1P5VA 1XGYH 3BPLB 4BSJA 1UGNA 3GBNL 4QHMB 4V1DD 4ZTOL 6FABH 1TVHA 4M56A 2GAZB 4Q56A 1CR9L 5DHYA 4H8QA 1PZ5A 2DQ6A 1FIEA 4L4JA 2CJTA 2F8VA 2D8KA 3G5VA 4ONFL 4ZOCA 2F8XC 1F4WL 1F02I 3ILQD 3KPPA 4MSWB 2Y2YA 1NC4B 5D7LA 2ATPA 4NZ8A 4APXA 2R4RL 4IU3A 2FEDC 2ZKHL 5C9JB 2FQEA 1GZQA 4M7ZC 4DPBX 1MW2A 2W80C 4ZQKB 2NY7H 3GPEA 3NABL 1I3RB 4QTHB 1I8LC 2YXWA 3HPLA 5EBLA 5F71A 5TE7H 3ZL4H 2RTTA 1OT4A 4M6NH 2J20A 1RJLB 1JI1A 2JCCE 3DWTA 4J3OH 1J11A 2XQYG 5CGBA 2HT4C 5D1QC 2G2RB 5MP6L 4DKFH 1TQVA 4UIMB 5F7NC 2F7IA 1NGWA 3MODL 5J7CC 3Q44A 3FCSA 4PR5B 4JZNB 3V0HA 1P4UA 2Z4QA 1JD9A 1P53A 2Y1YA 5DUBA 2C7UB 2WZPA 5E5LA 5C0NC 1N59A 2NNXA 1I9IH 4C83A 3K3QA 2QZ5A 3SDCD 4EN2A 2BHUA 1ZLUK 5EIIB 1O6SB 1KGJA 3O3DA 2WKOA 1J0YA 3HR5A 5GRXG 1PSKH 4UOZA 1F6LL 3MX0A 5DI8B 1A7RL 1XZ0A 3DV4A 3TX4A 4ES8A 4FFYH 2OMXB 2VT0A 3LHPH 4K7FB 2DTMH 5JZ7D 2XV6B 1UOKA 2JF1A 1MFMA 2QFRA 3RL2A 2EDLA 2F54A 5TF0A 2DKMA 3CSBA 4WF7A 3MRHB 4NBYB 2FHBA 3T65A 4F7EA 3OAYK 4N0UA 1KB5L 4BBWA 1ITCA 1BEXA 1G9MC 1XH3B 2GCYA 2PWDA 3MRGA 5I66A 2BM3A 4JRLA 3FBQA 4Y5XA 3Q8BA 3MRIA 3II2A 2EE3A 1UVQA 1IBGL 3INOA 1OT2A 2J5LB 2FX8H 2AI0L 2WINB 3B2DC 5KVDE 3BP6B 3UTSA 4JZOA 4WIQA 2DBLL 3TLRA 1BFTA 1JP5A 3VFTB 3NUKA 3P4NA 4N3TA 2ADGA 1GYWA 4Z95H 2F0CA 4MMZC 4JKPL 2BO0A 1JIBA 2AEPL 4L3CA 1U3JA 4NKOB 4ZUUA 3MR9B 3T8XB 8PAZA 4KZ0A 5CJQH 4BELD 1QUNA 5SX4I 1INQA 4OF7A 2PABA 2WXFA 3RI5K 1R24B 1SOQA 1D5ZB 4XO9A 1JSYA 2PF6A 2Q7AA 2HLFD 4I3SL 5KYUA 2F53A 1Z5YD 3R06A 4UYPA 1GZHA 5JPMA 2BSCA 4S2SA 3P77B 4KX8A 4I2XE 2LFEA 1CICA 1L5GA 1ZT4A 2CJSA 4LLQB 4JKNA 4FQJH 5E8NA 1PY4A 4K7PX 4TNVK 4QOKE 1MVUA 4DVRL 4S0HA 2XV0A 2X4OB 5CLYA 1SXCA 3NZ8A 2XT1B 1YMHB 4EDWL 2Z91A 3ERXA 4JAMA 1AC6A 3PWNA 3ZMNA 5HJGA 4ALAC 4QTFA 4CVUA 3N85H 5DURD 1JHTB 1KWKA 1GKEA 4DAGH 4AGMA 2EADA 4K2UH 1FV1A 3C9NA 3MLVL 4LLVA 4ONHA 1OV8A 4PY7B 3RIFF 3BKML 3QJOA 4OR1A 5D7LB 2NY4B 5I15H 1ILSA 1WIPA 2I9LB 3MRFA 3NJIA 4FQ2H 5HHQB 4UQ2B 2OZ4H 3GBML 5IQLA 2EZ0D 5D7JB 3G5ZB 1IKFH 4W9LC 1RJYB 4ZW3A 4LCVA 5CEYA 1FL3A 1WV7T 3QUGA 4E41E 1N70A 1D5BA 1BFSA 2OYLA 4WWKC 2H9GB 1RJLA 3QUMA 1TQSA 2DF3A 2OZNA 3HG5A 3I74A 2H5UA 3TIDB 3AREC 3RTQB 4G80B 4YFLI 5C0GB 3EFFA 5E99H 3REWB 3WMQA 1DJHA 2X1OA 3TT3L 4AT6B 3PREA 2XN9A 4PB9L 1EEYA 3WXVH 4U31A 4XPHH 3H7LA 3JWNH 1BIIB 4RFEA 3ECQA 4NO2A 1MFUA 3ZYZA 2YD5A 4GKSA 4YK4C 5GXBB 1DBMH 4G7VH 5KW9H 2CK2A 1S7RB 3CFCH 1TT6A 2YBRA 3K7UA 3MLWL 1TZHA 5LXGL 3MLZH 1ET5A 4UINL 1V7NL 3K6NA 4N2NA 5KS9B 3HS0A 2C9XA 3MLRH 1W72L 1CGVA 4L3FA 1T5WA 2PYEA 3TEYA 1RULH 3HC3H 2E6QA 5HY9B 1F4HA 1P6FA 4ZAKC 3BAWA 3E2HB 3WS3B 1IBYA 1LNUA 5DD3L 3V0WL 3HZVA 3I50H 2NT1A 4PJFA 5CEZL 4FQHA 5F9OL 2W95A 1FH5H 3BOVA 5IQMA 4A04A 4LLAA 2YHGA 3D51A 5CZKA 2X40A 4HIHA 5KAQF 3QHTC 3UDWC 5KSUA 4JFDE 5FOJA 4GAJL 1E6OL 2JJSA 3LKSA 3S3JA 1KBGL 1KYAA 1LEKA 4EO5A 5B3JE 1RIHH 1TYEB 3VYOA 4BQCA 1LHZA 4G43A 2ICWB 2P4AB 3MUUA 1ECZA 3K2UL 4X4MA 4A38A 3HI5H 4CA4A 1JPTH 4L4TB 4Y2NA 1WBYA 1C5BH 4HHAA 1MAKA 4PY7A 1KOAA 1F2XK 4DUVA 3HHRB 4S1SL 4X6CB 2P9RA 1OTUD 4KKRA 1HL8A 4J4PC 4HIEB 4YDLB 3VXUA 2SEBA 3C60C 1ICTA 3VXRD 3RWGA 2LU5A 3GSOB 3R7RA 3OKNB 4QNPE 1KCUL 2EP6A 2IH1B 2YRZA 3EZ8A 4UIKL 4AJVA 5C86A 1AIZA 3WU1A 3EADA 1S5HB 4YAQB 4YE4H 2VDML 2CO7A 1ES0A 2XWXA 4WHTA 4LSDA 2ZX8A 3BLBA 2ENJA 3BYTA 1WGOA 5E2VH 4PVNA 2D4DA 2DKUA 1RUQH 2VZVA 3QORD 4DQOL 1YVLA 2X1WL 3EOBB 1B0GB 2K7QA 1DE4B 5J6HB 3OJ2C 4U2YA 3LKPB 4FEIA 4QHMA 4FNSA 3RGBA 2K6YA 4MMXC 2QBWA 4DGYH 3F5WA 3ZO9A 5DHYB 1IT9H 3FB8B 1NQBA 4OJDH 2XPGA 4BWTA 1TR7A 4W6YB 3MGOA 1KLUA 1NJ9B 3B56A 4IJ3C 3IMVA 3VXTB 4Z76B 4WFGD 1CZ8L 2WD0A 4HH9A 2ADFL 1T5WB 4MAUH 2OTWA 4N1EA 3T8VA 5B7MA 5EZIL 2ZF9A 3MCKB 4B60A 3IAGC 4KK8D 1FAKT 5IVXE 3Q2LA 1JDDA 2UWEA 4HJSA 3VI3F 4PJCA 4JQIH 2VLRA 4MZIA 5D1ZD 4WAFA 2Z8SA 2JJSC 2DH3A 4GXUM 5D2LF 3EGDB 5KBDA 2WXQA 3ATDA 3O3AA 4HIJA 4PJ5A 4XAWH 4W9EC 3LEXB 4AC2A 1OPOA 5IFAH 4PPTA 1BM3H 3EYFA 4GAFB 5AL0A 5KS9E 1XGPB 1YUHB 1RSFA 3BGAA 5E7FA 3WL9B 1JXGA 4K5OA 4XC3H 5F7BA 2OR9L 4NRZA 5BOZG 5D72H 4RMRA 1IV8A 2LTQC 3FQNA 4U1GB 5GRUH 3RVUD 5CJ8A 3S97C 3QCUH 1BJ1J 5KUKA 2Q8BL 3DGCR 2WWKT 2ITCB 1DEDA 1XZ0B 2YLHA 1NDTA 1M7DB 2A4ZA 4KO9A 5L88H 3LDBB 1AO7D 1H19A 3QCTL 5C0AD 1MRFL 5AD0A 2WLZA 3BLKA 3MLTB 3ZPDA 4X4KA 4XPGL 4FHBD 5DZVA 3E0GA 1U91A 2YD1A 3SDDC 3S36H 2IOOA 1HL4A 1RHFA 4JDZB 5IT2L 2EIEA 4HD9A 2JCCA 1I1AC 1MCLA 2XG4A 3BHBA 3F8UB 5D6DC 2B2XL 2RMNA 1R5WB 3PDDA 4LF3B 1U2CA 3CXDH 3QXAA 1KGCE 3CFUA 1VACB 4IHOA 3NCYP 3LZOA 4KUCF 4OM1H 1FIGH 1I9JL 2QVFB 2XIDA 3UTSB 3EYVA 2YS4A 4G8GE 3W5MA 5C0BB 3WS3A 3IDMB 4KFZC 4M7JH 2OMTA 2R2EA 3W37A 2X6UA 1SBSH 3H3PH 2ZWSA 3UAJC 7CGTA 3DURA 1EEUA 1PZ3A 1Z32X 4KMQA 3MGAA 4ZFGL 1K4CA 5C0AE 1JNHA 2ZG3A 1V55B 3RVTC 3THML 4UOQA 3WFBL 3WN5A 5A2KH 4Y19E 4ELMA 3EBIA 4Y2OA 1OGAA 1MFNA 3ARRA 4FFWC 3F6LA 4P5KA 5BV7H 5IOPA 5D7SL 1UZ6E 2Y1ZA 3FTZA 2FL5B 4MJIE 1RZ8A 3FU5A 2HT2D 4JPKH 1ZE3C 1MOEA 3IJYA 4KI5E 1HWHB 1M53A 2D7NA 4OLVL 2ZXBA 2OULB 4L1BA 4MYWB 3I9IA 3A6BL 1EZLA 1JZFA 5LJYH 4XZUB 3FRPB 4XNYH 1OW0C 4Y2DC 5H4ZA 4AWJC 4ORGB 2ZCLH 4ODHL 2F5AH 5L7XH 2BIMA 5IJDC 2EUZA 4XPGH 1JK9A 5F9JB 4MNGE 4Q89A 1ETZB 5DJXB 5AB1A 5IQ9A 5I76B 1NDGA 1U3HD 2G4GA 2H3NA 4K94C 2QPSA 4X0KB 1Z6JT 4K3EL 3OQ3B 5K9JL 3K71A 3VGAC 2Q8BH 2VR7A 1D9KB 1N10A 1UXWA 1PMYA 4HH9B 2CKBB 5E1GA 1IKNC 3U2SB 4M03A 4U3SA 4L9LA 1EO5A 2FLBT 3OKKB 2YN3A 3HBZA 1KG0B 1XQ4A 3KLSA 1E2VA 5KN5A 1PEWA 1PKQA 1XGRB 3QXDB 2R23B 4A7UA 4I77L 3C60B 1MF2H 3W3BA 1XAKA 4YHIB 1CFVH 1FFPA 3LPFA 1G1CA 4MGXA 4EI6B 1T6WA 1O9ZA 3B2XA 4P99A 3T09A 3U48A 1M7IA 1CO1A 2DPKA 1TEFA 3GO1H 4MAUL 1A25A 4MNQE 5IMLA 2WSPA 2Y1VA 5FGBA 2D03H 4AV5A 2H45A 2DYPD 1CURA 1DVFD 4ODVH 1JNJA 1WT5C 4W6XB 1T0PB 1YNTB 2ZUYA 1M1XA 1K6QL 5IF0A 1GIGH 2CMRL 2CCVA 1UWXK 3CMGA 3KHOA 4YHML 1J87A 5C08D 5AW5B 2G9HB 1FG2B 4HCFA 4J3OD 1JK8A 4DGYL 3WUZA 2CKNA 4D0DB 4PVLA 4DGVL 1ZTXH 2A7BA 5DGQA 5JXAH 4DP7X 1CTMA 3LN5B 2XZQH 1Q1PA 1HINH 1KXQA 4PRIA 1G7HB 2R69A 4RETB 3DROB 1C5DB 2R2BA 3HG1A 2ADIB 4MQ7B 4GYBA 3UZEA 1G1KA 3K46A 1MNUH 3QUXB 4UQCA 4HVBA 4QWWD 1I9RH 3AC0A 1MCNA 2WO4A 3DX9B 4PJ7F 1SLVA 5IJKA 2CR3A 4OSUL 1L6PA 2AEQH 1UZ8A 1HI6A 3KPQA 4MRCA 4GUOA 1UH4A 3SSGA 1IBBA 5D7KE 5C09E 1U8HA 4EVNB 1F8TL 4GKLA 4K15A 1XGTB 1D9KA 2VDRH 3M46A 5A2CA 2R0ZL 4IHOB 4NQCA 2WN3A 2PR9A 3TJHC 3G6JF 4ZUSB 1YEKL 1GW6A 2X28A 3NJFA 3OKDB 4MASA 3LNHA 1MEXH 4QRSB 4LDOB 3W38A 4TVPL 4UQBA 3NGBC 2IADB 2KLRA 5F9OH 4KQ4H 5CEZH 4XAKD 1E9OB 1L4IA 2YQGA 1S7TA 3FT3A 2YZ1A 3MNVB 3O0RH 4V1DA 1OHQA 3BVVA 3I50L 1O5DT 4Z7QF 2AJYL 2ITDB 4JCMA 1CLYH 3VDBA 4WY7H 3C5JA 2R4SL 2JB5L 3T77B 4AQEB 1JPGA 3L3DB 4YUEH 1BGXL 3RVXD 1FFNB 1FGNL 3PP4H 1TTBA 2PXYC 4UM9D 4IM8A 1OGAB 3HN3A 1QRKA 4Q6KA 4D9QE 3MU3A 4Z7WB 5I6LA 2Y0SA 5IB3A 1MAMH 2WOBA 2F1AA 2XXMB 1KCBA 3QA3B 2H3NB 3WS6A 1T0NB 4B9YA 1GVIA 1U6AL 3GRBA 5E51A 2HA1A 3ZKXB 5IFJB 2EDJA 1JXDA 5LGHL 4GIOA 5CFAA 3GM8A 1R3KB 2HLEB 2HRLA 4HS3A 5I1AB 4XN4A 1QTPA 5DHMC 1OAKL 5I71B 5C7XL 5DR5H 5DMYA 2CLZB 4ORGA 3QORA 2BS8A 5AOIA 3AY4C 4L0PB 1P4LA 2BSRB 4F27A 2DQGL 4QNPF 3UTZA 3SKJH 1QR1A 1OTTD 4KKQA 4MD5A 4UIMA 1D7FA 1EFXB 3OJMB 1N6QH 3U1SL 3DSFL 3X1FA 1KC5H 2ZSWA 5F21B 4QHLA 3EHBD 3SPVA 5IHZA 1X5KA 4WO4A 2FX7L 4FADA 1KB9K 2L0DA 3C5XA 2W0KA 5F6HI 4ANWA 4Z7QB 2P7TA 2FGZA 4Y4HA 4Y1AE 3RB5A 2NX5D 3D33A 4NENA 3TWYA 3ZDYE 1IKFL 5FF6B 4Z7NF 3DVNA 3MV7D 5I30L 2OZ4L 2VLRD 4LSTH 5D1ZA 4FQ2L 2VIRA 2IQAA 3CZFA 4ZSOA 3SBPA 2DQJH 3HMXL 4X7TB 4JGUA 3VAEA 3BE1L 3TBSB 4Q4IA 1NMCB 4OGZA 1J9SA 5HGAA 3ZJAA 2ATAA 1IJNA 3LZQA 1KGXA 4UQ9A 2PCPA 4HJGA 1OAYL 4FG6D 3V5HB 4G9DB 4CBPA 3EJSA 2F8OA 1EHNA 2ZWLT 1U8OB 4NZUH 5A2LH 3QUYD 2YSSB 2E6JA 3S4SA 4MNGB 3IF1B 5C0CE 1UCBL 4UUJB 1EGJH 4H8WL 1KULA 3VDCA 2YD0A 4PJHB 5LAXA 5IF0B 4ZBJA 1RVFH 1A6VH 1A9EA 4AZ8B 3AS2A 4F2ME 3RDTA 2MNWA 2OQJB 3TPUA 1DHKA 1QFWH 3HE6B 4LCUA 1OWRM 5JYLA 2AQ1A 4MJIA 2BVEA 2QDWA 4QDGA 1HXMB 2H2SD 1L0PA 3F58H 4QOKA 1HEJC 4QI3A 1J05A 3ZZQA 5D1XE 5EHFA 2ADIA 4MQ7A 5DJYA 1P7BA 3QEQD 4CU6A 1MY7A 4Y19B 4UQIM 4OCXL 4ZXBB 4X4YA 3CZSA 2RHEA 1QPKA 3AQZA 3QWNA 3QJZA 3QFDA 5I1EH 2EIDA 3N04A 1YMHA 4YSRA 3RPKA 4NQCB 4AQ1C 5EZOL 5ITBH 5SX5H 4JFOA 4DERA 4EUPB 1BAFH 3WO3B 5KYWA 4NYLB 4G7SB 2FX8L 4MA3A 2ITEA 3IDIA 2NY1C 5C0BE 2GUOA 4YXHL 3DOSB 4N8UA 5FUZH 1Q9OB 1KB5H 1ZK5A 3LTVA 2Q86B 3VMPA 3G5ZA 3NA9L 5CKAA 2OP4H 3FU7B 4FZEL 4I3GA 4AOFA 5J0BA 2X0WA 3C87A 3CUPB 2DI7A 4UMSA 3WFEH 1OD7A 1B88A 4QXTB 5IBTH 4L37B 2YUXA 2YPLB 1FV1B 3C9NB 3AB0C 4MNHA 4LKCB 4X83A 4WKXA 5TK2A 1SUJA 3JUYA 2EICA 5L2JB 4IW4C 2VLKB 4AYEC 3U9WA 4LRNL 1B6DA 5I2IA 4PSPA 1MCCA 2KHAA 1S9WA 1MVFA 5D71H 1RZJH 2FO1A 3QZOA 3RIAF 1CBVH 1XX9C 3PNWA 4TLTA 2C1PA 4PEEA 3VU2A 3CVIH 3PE9A 1OCRB 1AD0B 4BZ2H 3L3HB 4QJ4B 2H32A 2QGDA 5E4OA 5D4HA 2PWFA 1K9TA 1X44A 5C92A 1T0NA 4TRPH 3ZSTA 4X5WA 5LAXB 4GOSA 5C07A 4P23D 2A6JB 5F3HB 1U3ZA 4WU5A 2JK5A 3V4VH 1OQOA 4M6NL 2CUMA 3KR3H 1BBJB 4MAYD 3GINA 4WTZA 4Y9FA 4DVBB 4XRCB 1BIIA 3BE1H 1Q9WB 1JTPA 2NY7L 3IDXL 3NABH 2BOCB 5EBMA 5IUSA 3D85B 2I27N 3HZVB 5TFSH 1A7PL 4JS7A 5CAYB 2ZKHH 4LRIA 3QDJB 12E8H 2R4RH 1HSAB 2C9UA 1C1EL 2O72A 3UBXB 1PX8A 4NX0A 1P7HL 3CDYA 4PBDA 1U8MB 1OSPH 5FGCE 1U33A 3WJMB 1MIEL 4KZDL 2OV0A 1WHOA 2KQMA 2TRHA 4KKNA 4PJAF 3TNNB 1D5XA 3L2LA 3GMMB 2CR6A 1HSBB 2FX9L 4G42B 2GQHA 1RJYA 3DSFH 2VLJB 2FYVA 3VFOA 4L2LA 5IM7B 1S7SA 1G7HA 3DROA 4PJXE 2JIXD 4RAUB 3FCTB 2NMSA 1J18A 7FABH 1A14L 2NNCA 2G2PA 3NJLA 4I13B 4XCYB 3WE6A 1P0SE 2M26A 3GLEA 3KPMB 1A6TB 1ZA3B 4GRWB 4Y5VA 1PG7W 5LGYA 4PTUA 2VUYA 4CDGC 1FSKC 4TUUA 1ND0A 2W8CA 5LGHH 1T7ZA 3S7GA 4KXCA 3LN4B 2XTSA 3ORJA 4XNQB 5JHLL 1MJJA 1PX3A 1B6UA 1X7TA 2J43A 3BVTA 2F53E 3ZE1F 4KK9D 3QJVB 1ZHKB 2HN7A 3L54A 3FSVA 3EJJX 4LXFA 2Q2LA 3NIGE 4YUEL 4JFQA 1KNOA 4PMEA 5K39A 5DUML 4NKMB 1R33A 1XBDA 2WXMA 2VAJA 4MJ6A 1HEHC 3VFWA 2MH4A 4XVJL 5IV2B 3VD2A 2I26N 3BP5B 2UXTA 3MNWA 2AJVL 2F19H 1HWWA 4X6CE 1FGVH 3F7KA 4LHUD 3V52L 2APTA 4X8CA 3SJVB 3ARWA 3RWFA 4KQ4L 4TULL 5IEKA 1YDPA 3O8XB 4YGVA 5SWSE 2BP0B 3FL7A 4NO3A 5F8RC 3TTSA 4QRAA 4JE4B 2OZ4A 4XNXL 5IROA 3IGFA 4EN3B 5AVVB 5C0CD 2FNBA 3F65A 3TZVA 1DL7L 3UPRA 1R4XA 3GMPB 1S7QA 5LCVL 5DC9B 2VDRL 3D48R 2IQ9H 3QH3B 1OO2A 3ESMA 2QVMA 4L5FE 5EOTA 4N8PA 2YQ2A 3T2QA 3GXUB 4HALA 2EEXA 1H9VA 2ZT9C 5IMMA 4YIQA 3BGFC 2G5UA 3VFUA 1YEJL 5ADOH 5I0WA 2IH3A 4GUPB 2VISB 4UT7H 3ZR6A 4K5LA 4Z5RA 4UOW0 4XGZB 4AUYA 2AANA 4NO5B 4OSUH 4ZOBA 4R2GD 4ERSL 1GHFH 3U9UA 4BA0A 1ZTMA 4YS4A 3M1OA 5F1OB 1OP9A 3TV8A 3MCKA 2IF7A 3FQWA 1WICA 3AS0A 3ZR5A 4HQQH 3X13B 4P4KA 1K2DA 4XMZA 1JVLA 3T0EC 3BVNB 1L9OA 3P4MB 2BINA 3V9CA 4LKCA 4RBPK 3DPBA 1K85A 2PYEE 1MREL 2YEZB 1WBXA 5KZCB 3KCPB 4LSSH 5FCSH 3E6HB 5CGTA 1MFEH 1IAMA 1WA2X 4TUOB 3WIFB 3ZHDA 2JFCA 4R84A 5IQOA 3BVDB 1NCUA 3CDGA 4PJEB 3VCLA 4U49A 2LQRA 2NY0B 1DQTA 3BSHA 4HOZA 3B7SA 5AZEL 2RH0A 4JVUA 4WSKA 1Y6NR 5D1ZB 3WDIA 5HHXH 2XG5A 5AUMA 5E08L 4R5XA 3AWEA 5AOKA 3Q01A 4NDMB 4PP2A 4UQAA 2J4WL 1NFIB 1QBMH 3HAEB 3MCLL 2NY4D 2YKLL 4GQPH 4N2FA 4UNVA 1U92B 3QJRB 4G1MA 2JJTA 4LESA 4BA8A 3KXFB 1AY1L 4KVPA 2FQDA 1O9VA 4D9QD 1Z9NA 4HKBA 3WMPA 5D7LE 4P2AA 2B5IC 1AZBA 3LRGA 1M42A 3HR5B 5HGBB 4L3EE 1E67A 4QRPD 4PH8A 2P45B 4RDQF 4URTB 2LU3A 2XX0A 3SYPA 1YECL 5F1IB 4NFDA 4HETA 4GAAA 4OM0L 3QC6X 4HIJB 4Z7UB 5GGQH 2D31A 3Q6GH 4H40A 1R0AH 1URIA 5CN1A 2VITB 2H6OA 1FJ1A 4EI5A 3WSQL 3GXMA 4QF1B 4QHNA 1QLFA 1HSBA 2O61A 4R5TA 2IMMA 5CN2A 1CCZA 4AQAB 1JN6A 2E3VA 1ERNA 4H5SB 1IGIL 2Q1EA 2JQMA 3VGFA 4LFHG 3ILEA 1JGDB 2WV3A 3IDNB 3CN4A 4G3YL 1XMEB 4XXCA 2KDYA 2YUVA 1AD9A 3DV6B 3WTVA 4WJKB 4Y19A 1CE6B 2J88L 3Q1SL 4K3JH 2X2UA 4K23H 4ODHH 2IAMB 5L7XL 2FWOB 3KLHC 2P8PB 2WKLA 5D7KD 5C09D 5A2JH 2DLTA 3C5ZD 5JIIA 1JTOA 4PTUB 1J10A 3BWUF 3L1OH 3O4LB 3DSNB 3PQYE 2BXYA 4XXWA 5AYQA 4K3DH 2K70A 4PGEA 3M1BA 3O8XC 1ZS2A 2PTUA 2XN9D 4BGDA 1Y0LB 1G7LB 1RK0B 1URZA 4X0KA 1IM3B 2Y5QA 3FB5A 1IMHC 2O6PA 3JV4B 3TCXA 5CZVL 5DTFB 1GY2A 2VN3A 1N7MH 3D2TA 4UBDD 3QJFA 1IGIH 4JBSA 1N2RA 1JPSL 4UDTA 3MUZ1 3UPRB 2CO3A 3PGCB 1TZOA 2IDFA 3JTTB 3O3BA 2W59A 1SBSL 4FQXD 4JFDA 4XE0A 5KN5B 3O8XA 5IJVB 1WZ1H 2HLAA 4K8RD 1K72A 3MOAL 1TU2B 4H44C 1ZDQA 4UQ3B 5DWPA 4Z5RB 1LWJA 1IGMH 3ARFD 2DMKA 3UO1H 2PYFB 2JMRA 3UIZA 2E76C 5IEHB 3DRQA 4WU7B 5E8OB 2P48B 4GP5B 3B9KC 1CXKA 5AVYB 1CDCA 3X1EA 1U8JA 2F8IA 3OB0H 1F1AA 5FFGA 4LDCA 4YDNA 3FW6A 4JG1H 2VAAA 4KRMB 3B1TA 3NZHL 2G2RA 5DHVB 4AKQA 4X9BA 4DHLA 4DP1X 1ZK9A 4Y2DB 2YKLH 2D7PA 1UWEH 4ISVA 1WBXB 3BYYA 3WY2A 3CPLA 2V0AA 6PCYA 5GGTH 5HHXL 5I8OH 4OGAC 3N6YA 1AOHA 2V17L 3QARA 4DOHE 2IALB 2W9DL 5IMLB 4AEHL 1WK0A 5E94A 1BJ8A 2FIKB 3CK0H 5E5MB 3KH3A 1MREH 4LVHB 3ELAT 4XVOA 4BCZA 2ZX9A 5J3HD 1H8SA 3QAZC 4Y4FC 2C1OB 4MB4A 4UZUA 3KCPA 4QD2E 1PPIA 5SX5K 3VFRB 5JDJA 4JY4B 2EDEA 4RGOL 5JHDD 3WGVB 4U1KB 4PG2A 2WWMC 2QSQA 5T3ZL 3WIFA 3KXFD 2DIJA 2SODB 4A7VA 2DM3A 5BCAA 2PW1B 3X11A 1ZT7A 2FLMA 3KS0H 4YVUA 1RU9L 4JRXD 3LXCA 3D9AL 1IE4A 1A7BA 3ABGA 4ERSH 1I7RA 3AU0A 4L0ZA 4I5BA 4RGNB 3TBVA 2FIRT 1SMOA 2KQNA 3JWNG 3AXHA 3MJWA 1F86A 4XNUL 3OGCA 4HA1A 4G6JL 4TVUA 4UT7L 5D96B 2MSPA 5MEOB 1A7QH 2Y2WA 3BFWA 5HI4D 2G5BB 4MJID 5F2FA 1G9EA 3LQZA 2ZUSA 3QDGE 3IMWA 2OMVB 4F58H 1QLFB 1YJDH 3PUCA 2E0PA 5ANMA 4F33A 1JV2A 1BAGA 4X9GA 3VX0A 1D7BA 4JUSA 1OAQL 1I8MB 3ZE0F 4P4KC 3FO0H 3S5YA 3ELQA 3D07A 4PJ9B 5GZNA 5BQDA 2P5ED 5HJDA 1BP3B 2GTZB 2VMJA 4IGBD 1KNOB 4FFYA 4Y4FB 1FZOB 4B9JA 3ISYA 3QEUA 3B3BA 4HUMB 2FO4A 4IIQC 5F3BB 5J1AA 1RUQL 3ZOAA 1EXHA 4AM0A 2X4SA 4GBXA 1KXHA 4NJAH 4ODWB 4HISA 1NCTA 1UXSB 4DPAX 3RWFB 2R7EB 1JGEA 5LGJA 2NXZB 2G9KA 2VDMH 4O51A 4U1HA 1JZ5A 5DUPH 2Z31B 1NFDB 1KTDA 3DBSA 35C8L 3C5SA 3RGVB 5MHSE 1A4CA 1QI3A 2ZYSA 2X0UA 4S1DC 1OARH 1MFDH 2QVIA 3K8KA 2AMGA 5T1MB 3MKKA 3R0MA 5H8DA 1HZLA 1DN0B 3HLKA 3L7FB 3T6QC 5JHLH 3GSNA 2TAAA 3KNBA 3U7WL 2X87A 4PJFE 4BFNA 4CKVX 1S9XA 1E90A 4DCQB 3W9DA 3HI5L 4L2YA 5B21A 3UTOA 4IU2A 4NS0A 1MFBL 3B7RL 4NM4L 4D8PA 1MLCB 3O6FB 1ZMYA 4G8GA 2R9HD 1A14H 1KGWA 2B3RA 4M5ZL 1DVFB 4G9FD 1IL1B 3KH4A 1VFBB 4P2QE 1N2RB 3GWJA 1UB6A 2IPTL 2J72A 3S37L 4MXWH 4GW1A 4QR7A 3UGXA 3SDDB 3FXIC 3T0DA 4KZDH 4XTRD 4ZX6A 4QYOA 1ZGLB 1NAMA 3O3EA 4ZG1A 3PWVA 5JNYB 3OAYH 3VX1A 3KYMA 4LKXA 5TFSL 3WD5H 4BIKA 4CC0A 5BZDB 4WWID 3ALXA 4RFOH 2CJUL 4YOKA 5JOPD 2L7UA 1AGCA 1ZS8A 5HP5A 5FS5A 1IC7L 3B9EA 5I1LA 3O6LH 5KW9L 2FT8A 4FQ1H 2C34A 4NRXA 3ULUH 2HMID 2Y7OA 3RUGE 5KBMA 2WWNA 1JV5A 2PO6A 4U1MB 5B39A 1GSMA 3EJYC 1NGYA 5SWQA 3X17A 5HGAB 4GW4B 3T4AA 2HKHL 5F70A 4JGNA 1UYWL 3S3PA 3L5XH 4OFPA 3RJDA 2J5WA 2OQJA 3HR6A 1ORSB 1CDHA 1FZKA 4XN7A 5I5RA 5FK9A 3GZPA 2NTFA 3LPPA 1E4WH 3M6DA 1E8ZA 3D50A 5AW8B 4JFXA 4PMFA 1CG9A 4LCWA 4I4WA 3S5ZA 4LSPL 3P2TA 5AKTA 4LCCB 1HU8A 1ZLVH 4WTZG 3CMOL 2ZNWA 3GSVA 2KMWA 1GC1L 4A37A 1NGXB 1PKQE 1GCYA 3GJFA 5AW0B 1Z0NA 3QHFL 4P46A 5IBTL 4A66A 4YWGH 1IBZA 2WQXA 1FO0B 1GZHC 3Q2CA 5FYLD 5JPMC 3G04A 2ZP9A 1SXNA 3NN8B 2EIZB 2ID5A 3DX0A 4QRPA 4IU2B 2HX9A 5HDOA 4DAGL 3KCWA 5F8QC 3BZEB 4Z6AT 4WFED 1GAFL 1M2VB 1LQBC 1VRSA 3GSUA 3NBNA 3GD1C 5D7EA 1S46A 5FYJE 4GXVL 3L3JB 3M1CA 2NY2B 4F7PA 2A9BA 3FU7A 3TEUA 3VG9B 4DVRH 5FHAH 4FD0A 4JQXC 2FHFA 4XP4L 4FQJL 4MB3A 2NXYC 4XOEA 4QAWA 5EZOH 1UD8A 4Z3FA 4OZFH 3HZKA 4A68A 1WJ3A 1GPOL 1Y0LA 2YEQA 3QHZH 2JSFA 3QNXB 5DMGC 5IBLC 1ZGLA 2F15A 3TTYA 5JR1H 3PGDA 1T22A 2JH2A 1YG9A 2DYPA 1SOKA 1RUKL 3K8MA 1C9SA 3F58L 1FDLL 3TA3D 5IB4A 2K6WA 5LN4A 4ZYKA 2BNQD 2IFGA 4XO3A 2IXQB 5SWZB 1Q9LB 3QGVA 4UILL 1NEZA 2EIBA 1A6VL 1CFNB 4JDVA 4E9QA 4BJLA 1C12B 4UT9H 4IYKA 5GGSA 4NQVB 5I1KL 3B2MA 4K4KA 1EGJL 4H8WH 4Z95L 3CCHA 4X0NA 1KTDB 1EFXD 1DO6A 1DQJA 3QQXA 1V3MA 1R3HA 5AENA 2BVTA 2BC4B 3HMWH 4R90H 4FCHA 1S7WA 3PNWB 4FFVD 4H8PA 1FFOA 4IKLA 3ISWA 4XWOC 3PWUB 4PTTA 3S35L 1YZZA 3EF7A 4Y2LA 4M7LL 4Z1PA 4LDEB 3B5HA 5H94A 4MA3B 4GS7B 3QNYA 1I8AA 2DICA 3UABA 4UM8A 3MRQA 1T04A 1OM3L 3QIUA 2VXSL 2PYED 4Y8DC 5DMIH 2F74B 4MZRA 3DO7A 2WAQA 4L3EB 5AG9A 2W0FB 1J8HB 1GC1H 4H8UA 3LHPL 5D1QA 2OXHB 1KTKE 3JWNC 3KD4A 2UZYA 2ZSVB 4AVIA 3VFGH 4I9XA 2CM5A 2FX7H 1CE1H 2XY1A 3ENEA 4GBXC 1JWMB 1E65A 2ADJB 2EDBA 5I17A 3OHXB 1WPCA 1BLIA 5I73C 4BKTC 4OGQC 1M71B 3ALPA 4ZUTB 3L9EA 5CD3B 1JMXA 1JNNL 5CSZA 2Z0UA 3DVGA 4DEPC 5JOEA 1NBYB 1XD1A 4HJUA 4PJDF 2FJGA 4FDWA 3MODH 4YC2C 4XN5A 3I9PA 4P05A 2HT3C 3UPCA 1UATA 4MNQD 1AGEA 1WS7A 4FQ1L 3FCTA 1H5BA 3KHQA 1ZLUH 3WLBB 2DMGA 6PAZA 1U6AH 5FYKU 4KX7A 1G0DA 4C55A 1DJXA 3BLPX 3WFCL 2E6PA 5TE7L 2C3WA 2PP9A 1MAML 4PR5A 3AGWA 3DVIA 2P24B 4Z7IA 5SWSD 3QIUD 1AH1A 1F97A 4KHXH 1YNKL 1HYRC 3AT0A 3M88A 5EA0L 4D0DA 1ORSA 5K9QG 4FQLH 1BA9A 3EAKA 3IJHB 5EOCH 3TCTA 3V6OC 1D5RA 2BJML 1CB4A 8FABA 1DYZA 2WNKA 1R19A 3KYOA 4ONFH 1NC2A 3FO1A 1WFIA 1RJZA 1R17A 3MR9A 5CP3H 5DVPA 2X41A 3UG3A 4TTGA 2D7TH 4WI2A 1KJMB 3GSXA 3VFVB 3MV11 4Y4FA 4LIQH 1NGXA 3V0AC 5EEYA 3AMKA 4MAZA 3PJLA 3APCA 3BPOC 5J1AB 4J3VA 3U6XA 2IAND 2BSDA 2X5PA 4Z9KB 2KZ1B 1NDMB 3PIQA 3UTQB 4D94A 5J13B 3QNZA 1QRNA 2PTTB 1TCRA 3OAUL 2P49B 1F8TH 1TQWA 2GKIA 1LO5B 4M9OA 1JPST 1AIFB 4W4OA 5KTEH 1D2PA 1XR9B 2F74A 5DFVC 3DO7B 1G7JA 3INUL 1BMGA 3CLFL 2IO5A 1TJXA 1YY8B 4MA7L 3WHXB 1CQYA 4N8CH 1OTSD 3JVGC 4Z78B 2NUPA 2AVFA 4BE5A 1LMIA 1GKOA 1P9MC 4PV9A 3OPZH 4FN0A 3MLPA 3K1KC 1W6WA 4HOWA 3BCDA 3Q0HA 2ADGB 4TNGA 3ARZA 4I0PD 5EZLB 5D8JL 1RZ8B 5C0JB 2V2WA 1NMBL 3NIGB 3POCA 3QNXA 4PP1C 3CFJA 3VA2C 3KLKA 1AFVH 3UAAA 1V3JA 3MREB 5HYJD 5GRZA 4XMKH 3TYFB 3D39A 4ODXA 3RKDC 5CSZB 3SZKC 3V4UH 1UD4A 1JZ3A 1JYWA 3RDJA 2XZQL 3N91A 3SKNB 3ZL2A 4XMUA 3D25B 4DGVH 5JXAL 1G1OA 3BIKB 4PIBA 4X6CF 3G5XA 3GRWL 1YPZE 1GIGL 2CMRH 3G5VB 2FSDA 3A0OA 1K6QH 4G8GD 1J1PH 3QXDA 2HFGL 3EFFB 5ICYA 2YWZA 4XC1L 4P46D 5L9DH 2DIEA 3SPIA 5DJCB 5FAAA 4L3EA 2X4OA 1OCOB 1S7QB 1QWNA 1A7QL 2Y7QB 1I3RA 2VLMD 2PWGA 3ZUNC 1IGCL 2MCG1 1NCHA 4N4YB 4AYFB 3MRJB 5DYOA 3GNML 1LD9A 4QKTA 4YVNA 3A6CH 1HYSD 3NACL 4M1CC 2F54E 1KCVL 5T3ZH 5DC0A 5KVEE 4XNBA 3SIKA 5AW6B 5CCJA 2FEJA 1UJTA 2Z8RA 5FOBA 2O61B 3ZIYA 5JIHA 4KJYA 1P4BH 4JN2B 3VRLF 4LSQL 4Q9RH 1G1YA 2WBJD 3FH7A 3PJSB 3PL6D 2YKKA 2DI9A 3SO3C 4JVPA 3P4MA 1NCAL 3ZTNH 3WLBA 2W9EH 4K7PL 5K9KA 1H0DB 1T4WA 4XP1L 2FWOA 2OS7A 5E56A 3SE4A 3R4RA 3LH9A 2A77L 3VJ6A 3ATAA 5I8OL 3GSOA 2WTRA 1SF3A 4MQTB 1R34A 3ZQWA 3S35X 2B3IA 1NBYA 1YMME 1YJDC 3QIWD 3U46A 3CD4A 3N1GC 1T7YA 4XNYL 3M7FB 5GGVH 3APDA 3P0YH 3GZOA 5HDRA 2JXMB 1U2HA 4G7YL 2X2HA 1M3JA 2COQA 4JG1L 5GGUA 1TJMA 4H0IA 2AS5M 4LOUD 4QRRD 3VVWA 2AP2A 2H7WA 1J8HD 1J48A 3Q8CA 4PCTA 1OP3H 1FP5A 2R1XA 1TZIA 1ZIAA 4XN9A 3TN0A 3P2BA 3JT2A 1ROWA 4JMXA 4XMLL 1S5HA 3QJTB 4YAQA 2G30A 1V10A 1V3KA 3RWHA 3WEAA 1DJSA 1OE1A 2D3JA 3UYRL 2EVGA 2YD6A 1BPLB 4WQOA 2ESVD 3BDYH 4U05A 4NEHB 5ICYB 3UTTB 1PEZA 3DX8A 4P9HL 2WBJA 3H3PL 4QUOA 2UVFA 5DEGA 4NNPL 4QY8A 3UBXG 2V8MA 1BOGB 2EXWC 4IQHA 2ZOKB 4L1SA 4DP2X 5EB9A 2J3SA 1N7ML 1YY9D 4MD0A 3LVEA 5FWQA 5ECGA 1KDIA 1FCGA 4KKAC 5CZVH 3HNTL 2UXGA 3D3VD 5KEZA 3RHWF 2DLEA 3CFBB 5DYOB 4Q6IB 3U4EA 2A1WH 4M8UA 1CK0L 5F1SA 5CGMA 3H7BB 1KXQE 4PRIE 1LO5A 2IDQA 4RISL 1TQBB 4XB3A 4CGTA 2CDEB 1THCA 3D18A 4BINA 2YA1A 4APQC 4X8JB 3CPLB 2N7SA 1MJ7L 4WUUD 4ZXBC 4ZT1A 2CR0A 2FBOJ 5CFHA 1AACA 1X5MA 2APBA 2E7MA 3QO1B 4K23L 1KPVB 2NUPB 3S36L 1AXIB 1RJCA 1WA1X 2ZOTA 1BECA 3O2DL 2W1NA 4GAYA 3RDTD 2C9RA 4MCYA 4YSAA 4V11A 3QCTH 2PPAA 3NDYE 3R1GL 3VVVA 1I82A 2DMBA 2PNDA 3VI4E 3HEIB 4Y9GA 1R3LB 5CWSB 4NQQA 4KY1L 2VDOH 4JFDD 5I75C 2GJ6B 3QEHA 4MX7B 1JXKA 3FUDA 1BD2D 2D7QA 1EIBA 2QHRL 4ODXB 5GRUL 5DWUL 1S5IH 2GK0B 5FB8B 5D7JA 3D5OF 3NCXA 1FNSL 4I0KA 3FQNB 2C1PB 4QXUH 3Q48A 1TDQA 4IS6B 5KSBF 2Y4SA 1GR7A 2XWBB 1ZLWK 3W39A 2W0LA 4AJ0A 3AWGA 4YHKL 3SPHA 4HIIA 1G9NC 5DJ0A 3CHPA 4HFUL 5D7IA 3ZE2E 2NZ9C 2O6FA 2W5PA 4IMKC 4AXWA 1A6ZB 1SOXA 2AJUH 3ZY7A 3MQIA 4F8LA 2XWCA 5MI0B 4YJZL 5EZIH 4NAJA 3RNQB 3VWKD 2EVFA 4GB9A 1TG8A 1IEBA 1I75A 3MV7B 3BPOB 4Z3IA 4BFIA 4CILA 4KH9A 1CU4H 1Z9MA 4HKJA 2ZOKA 2MOVA 1RZ7H 5DJAA 3OZ9H 4XAKE 3CHRA 1ZJAA 1MFEL 9CGTA 4IKIA 3RIAK 4F7CB 1IT9L 2JE8A 2PW2B 4H20H 1U41A 3SDYH 1E30A 2YA2A 4MZ3A 5JDSA 2R69H 1XCWA 4HZLB 3ZE1E 4FMKA 1NCWH 1W0VA 4RESB 5LGJB 1BZOA 4J8RA 4DQOH 2GEEA 3F12A 3IM1A 3PPSA 2WLHA 1SEQH 4AYDC 1L9MA 4GLRI 4X4YB 3WE6B 3OVUB 2FO4B 4KOBA 1SRDA 3HZYA 5KS9F 1S7VA 1UOLA 2K8MA 4UIKH 2AABH 4L8SB 4LCUB 1NC4D 2ICES 1IAKB 1YO4A 1MRDL 4AIXA 4OFQA 1FC1A 3IDIB 2OA9A 3AU1A 2CSPA 3C5SB 3L9YA 1JWUA 3QZWB 1XH1A 2B20A 3I02B 3WLWC 3ULUF 5E9DB 1CBJA 2YAEA 5KJRL 1NOLA 4AL8C 1UB6B 1RIHL 3AUVA 4HGMA 3O4OC 2HVJB 1UM6H 2MCAA 1JGLH 4ADGA 5MERB 2EH8L 3C09C 3LSOB 1SPDA 1Z9SA 5T1JA 2O6EA 1MCRA 1QKZL 3MLYL 3RP1A 2NY0C 4NUGL 3WDHA 2NY3D 4AEIL 1ZIBA 3QRBA 4BEIA 1SM3L 2WYTA 4E68A 4N86A 3OZKA 4PLJC 5DVLA 1H3VA 4WTXA 3E3QC 2HTLD 4GS7C 1FNLA 2GAZA 4HT1L 3II3A 2OJZL 4U1NA 3U7YH 1RULL 3G6JE 4G1EB 1HXYB 3HLAA 1A9BB 4F2MA 2H0EA 3D2UB 3PJNA 3MLRL 4F33B 5DS1A 4O2FB 1A21A 1MCFA 3QPQD 4EEEA 5IVOA 1FO0L 4CAGA 2A9AA 1WC7B 2CUHA 3EO9L 4U1HB 3L95B 1A6UL 4X5XA 4BSVA 4EOWH 3UDWA 1RUMH 2DWTA 3N2JA 4NOBA 2DRUA 4P5TB 3N1FC 4DESA 3B8YA 5EO0B 2NYYD 2ESVE 5T1KB 5HPOA 4XRCA 4EIGB 3T6ZA 4DOHB 2FR4A 3RUGA 4XPHL 2GSMB 2BRQA 4CKQA 1AD0A 4HG4K 2K9FB 2XZAL 3L2NA 4KTDL 3D0VA 1PVHA 4EUPH 4F8NA 2B4CH 3L3GB 1Q90A 1KYOK 2JELL 2Z9TA 4YE0A 3LB6C 4U1MA 4XNMB 4JZNA 1QLEH 2GBUA 3IPEA 5CLTA 3SE6A 2YO3A 1Q0EA 2HJKB 2R0WH 1YRKA 1IE5A 1VGKA 3D2UD 2QPFA 3QDGA 1EO7A 4FZ8H 4TM9A 3AROA 1FCCA 4TPRL 3ZN6A 4OFIA 5EU7C 3TS8A 1KG0A 3MX0B 3AU1B 4OTXL 1HFUA 2PCFB 5ESQB 1ZV2A 3KPRB 1NAMB 3MLVH 4JRYD 5TH2A 4D8OA 3HE6D 2YRPA 3UYOD 1UB5A 3T5WA 4MJ5A 4XOAA 3VXMD 4ES9A 1NKRA 4ZMLA 5K69A 3N85L 1K3ZA 1PW3A 1X5JA 2WXGA 4LLWB 3V4VL 5IR1B 5IB1B 1M7IB 2IGTA 3UGEA 2DWEA 1RPUA 4M7LT 4J2QA 4DTGL 1BXAA 3LIZH 4FP8H 5MENE 1WP6A 3KW7A 2M2DA 4Y9CA 5C7ZA 5IWLA 2ROYA 5EU6D 2C9AA 2ED6A 3O2DA 4I48A 2HAZA 5I82A 1KJVA 5ESVB 2UUDK 3FTGB 4ALAL 2XTJC 1CXFA 1ZA3A 5D71L 5G55A 3S8WA 3LRSA 1EAJA 5DSCA 4YNYB 3D39D 1NEUA 1MQKH 2G9HA 3NIDE 4G1EA 1PFOA 1EXUB 1WZMA 3KGSA 4YHPB 2ED9A 2DQUH 4X5PA 3A23A 2J8UF 1H3PL 4JFWA 3MJ9L 3DOHA 1KBKA 1S3RA 4LVOB 1AKPA 1E3XA 2AEPH 4V1DE 1FYTB 2JJUA 4KK6C 4P2OD 1RSYA 4FZEH 1CLOH 4H88H 4OJEH 4WGWB 3A4EA 4MD0B 2IVFC 1TF4A 4I3RL 2DWDB 1L3NA 1LDPL 2K45A 3QJHB 4ENEC 3K2MC 3N55A 4D0BB 4I18A 4M43L 2O4EA 3P69A 1ZANH 3RJOA 1D5IL 1AZZC 1I8IB 1BAFL 1ZWIA 4NQSB 3T3ME 4WO4B 3E8UL 2E75C 3LAFA 4X5RA 4POZC 4N87A 2ZUQB 1N8ZA 1CLOL 4H88L 4E9WA 4NZTL 2D3VA 1N4XL 1TO5A 4ZUSA 3O2VH 3UTSE 5EUOF 2XWZA 4OLWL 3HCVA 1IEAA 3WE1A 2PXYA 1Z9SB 3DHUA 3ZXAC 5ENWA 2DTML 3UZVA 2WCPA 2OTPA 3SGDI 2PKDA 3EJZD 1I7UB 3FCBA 3WEXB 5KSAD 3LS5L 4A7GA 3VH8A 4ENED 1RVFL 4C47A 5D96C 1H5BC 5GRVK 4PCYA 5AFAA 4MCNA 1T0MB 1AE6L 4CMHB 1JPGB 3L3DA 4LLDA 1OCWH 2BW4A 5HI5D 1WO2A 2IANE 3TO4B 4P2OC 4LU5L 4ZSOE 5JHMA 4PRBB 4ORZC 4W4NA 1N67A 3GJFH 3IDUA 1FI8C 4PBWD 2LU4A 1JXFA 2W0PA 2JKJA 2DBJA 4JFSA 1HDMB 2P8MB 1LMKA 5ISZB 5D1XD 1BX2B 1SJHA 3DX1A 1TMCB 1NCOA 3RRQA 3HE6A 1WRFA 1KF9B 2DQJL 2VC2B 2DIAA 2P80D 3N1MC 4TL5A 5DJ2B 4J39A 3QISA 3HN8A 2WXLA 3N43B 1NCCL 2KI6A 5LBVA 3VACA 1AQ8A 3TV3H 1UFGA 5SV3A 1AGBA 5E6RB 3NCWA 1TSHA 3QDAA 3GJEB 3QFDB 5DJ6A 4MB1A 1KTRL 2HJKA 1XR8B 4L05A 3KWWA 4X6FA 3I3EA 2O93L 1CR9H 1JK8B 4NQDD 4PJ8C 5G4NA 1BZ8A 3ULVE 3NIDF 2I85A 4AQAA 4LHUA 3WNKA 1ZT7B 2JELH 4F20A 5DZJA 3B9VA 1N6QL 3HE6C 5FXCH 1EANA 1I8LA 5BO1L 3O41A 1NIFA 4X7TA 5D2LE 2E9BA 2PPFA 2ZX7A 1JZ8A 2B1HL 4KJPD 1PLAA 2WQWA 4WWNA 3BO8A 1Z5LA 2VMEA 1VCAA 3FN9A 3QW9A 5T33L 3HG0A 3JZYA 3KPQB 2CO7B 3ZGHA 3ETSA 5LCVA 3V4PH 2NX5E 1AGEB 3NPZB 5ERWB 3RAJH 4URKA 5EF2A 2X3AA 1MWAL 2FRGP 3SCMC 2B14A 1WFMA 3VFPA 2VW7A 3QEGL 1FGNH 3CZUB 1X3DA 3TIEA 3U6RA 4AE1A 1PL3A 3QDJD 2WHVA 1NCIA 2JB5H 1P4IH 4WY7L 3LQAH 5DJZB 1MG3C 3CDZB 1JUFA 2NDGA 2XZCL 4ZOAA 3TC9A 4D9LL 2IPUK 1DQVA 2EYSB 2X70B 2IPUG 2DWDA 5E2WL 2WXHA 2O5NA 1EK3A 1PLGL 1R3JA 1X7SA 5EEXA 2BNRA 4KH2A 1VDGA 4L9LC 2NY5C 1GGCH 3KPRD 1N8OE 1MEXL 5E1AA 1TU2A 1TEGA 1KJ2H 1NCBH 1MVYA 4L1DA 1B3IA 5GS0D 3P9WB 3DGGB 3BT2L 2DI8A 3CTTA 5E00B 1EBPA 5EF0A 4YQXL 3OQRA 5A6IA 1BQUA 4HEPA 5I1CL 3TBCA 3RNKB 4XE5B 4R7DA 3UACA 3FTYA 3IS0X 4JFDB 3D2UA 3HE7C 1SEBB 3FUMA 3MAWA 4PLJD 3X1NA 3WNPA 2XJKA 2C5DC 4B9FA 5KWYC 1AI1L 3B9KB 1EDYA 3IDGA 4GI8A 5GRYA 3CFMA 1ET7A 1XF4B 1MRDH 2HG5A 3LKRA 3OX8A 1BM7A 3Q6FA 5AAMC 2C9PA 3QUHA 1IRAY 1XR9A 2ZTBA 3O11B 3OJVC 3OKLA 3B5GA 2VXTL 3GEWB 2OSLA 1F2QA 1LLAA 2VZ3A 5AAPA 1I9RL 3MTRA 4JN2A 1TVHB 4XBEL 2UWEB 5DK3A 4TQPA 4FA8A 4JJ5A 5DK0B 4M6OL 5TDNB 1KTLB 1HINL 4XPBH 4OCYH 4N2IA 5C0FB 1WF5A 5GJSL 3EZJB 2UY6A 4I0CC 2PO6C 4EXPX 3FFDB 1KFAL 1LWRA 1UEYA 3SDYL 3OHXC 4H20L 4WFEE 2OPCA 4UANA 1ND0B 4EI5D 2QQLL 5MI0C 4YR6B 3FQ1A 4CJ0A 1MUJA 4TNEA 2W65A 3MXVH 2NXYB 4LF3A 1EEZA 4QOKD 4KRPD 4JFQB 4Y7OC 5HVFB 2VJ0A 3VGEA 5B39B 3ZK0A 3QG6B 2AJUL 4X5LA 1ZSDB 2FWLB 2FSEB 3R4DA 4J6RL 2PN5A 1MF2L 1PIGA 1ZLSH 2Y7QA 5I0XA 5FEBA 2N3JA 2BRRH 3IDMA 3MRJA 2BY1A 4NO3B 1KCRL 3UADA 3WAKA 4JLRA 2V5SA 1EPFA 4PCSA 3LX9A 1PZUB 2VN5A 2Y22A 3UPAA 1P1ZA 4B9PA 3K6SB 1XL6A 2R2HA 2GVYA 2XLLA 2J57A 2MHAA 3MHZA 3KGTA 1VACA 3VM7A 4ABWA 1O7SA 1H6EA 1JNHB 3NSDA 4PVBA 4P3WA 3DMMC 3ML9A 3IRZA 4PGDB 1IC4L 1I1YA 3NEEA 5AKSA 4JX0A 5BVJA 1SDDB 1O0VA 3KL5A 4WV1B 5JW4R 5K9JH 3KL0A 2ZE0A 3P77A 1SQMA 3QYCA 2NZ9D 4PRDA 4FA6A 4BE6A 3RA7L 1HXMA 4QOKB 5DK2A 2CXGA 3QJUB 3W0WD 5IK3A 1HH6A 2YIHA 2ZPKH 1LWHA 3QQ3A 2H2PC 4OFYA 1QFPA 4QY8B 2CNZA 2X53A 1T66C 2HX8A 3B9DA 3O11A 1DQMH 3D0LB 1QACA 1FN4A 3VSTA 1OL0A 3GSWA 3K80A 3NCJH 4OLXL 4Y5VB 4M8RA 3A6BH 4AM0B 3WOVA 2WTRB 4MMZB 1EJ6A 1JWSB 4ZK8A 4LAQL 2H32H 1BQ5A 5ALCH 4OLVH 4JM4L 1Z3RA 1HOEA 5B38G 1S9XB 1RPQA 1G9HA 1MCHA 4CVXA 3H7BA 1F45A 1X6LA 1G9NL 3QPXH 1TVDA 3T4YA 1WFOA 5L4MA 1HNGA 3STZA 3K71B 1JZJA 2NZ1A 4Y1TA 1IZJA 2ZAGA 2ZKYA 1A1OA 3EFOA 2ZUWA 3F7YB 1CTOA 2EDMA 3FUIA 4RVBA 3BKJL 2VDOB 5A43C 3CXFA 1A0QL 4KAQH 5EDSA 2F7OA 3B37A 3MJ8B 6TAAA 4NSKB 1Z9OA 2WN2A 3CDGB 4P8QA 5CZXD 4AGPA 5AB0A 5KVDH 4H4NA 4ZFGH 4HUCA 5GZOC 3MNWB 4TQEH 1WIUA 2C9SA 3K5SA 5AVUB 4GMTL 3IJSB 3GSNH 2GSGA 3POHA 2O5ZH 5HTSA 1CLZL 2NUTB 4Z7OB 2ARJQ 4AG4H 4XH2B 2DEXX 3REWA 4NJ9H 3V4LA 1YHPA 2VLKA 4WHYH 3CN1A 3RL2B 1VCBC 5I1HL 1JS4A 4OM1L 4MJHA 4BH8B 3FZUC 4XP9H 3ZDYB 2VN6A 3HI6L 5ESAA 3SQBA 4J23A 1MAJA 5HGHA 4OFDA 5D9SB 1LO4H 4ZNEE 3RNQA 1E5BA 4HLZH 5CJOL 4ACPA 1QPXA 2B2XH 1S7RA 2X7LB 5E9AA 4BUQA 1HJCA 5GZOA 4AE0A 1NTDA 3AY2A 5DYFA 3WJJC 4L1TA 2E5EA 3K6IA 5HHMD 4RGMB 2WVSA 3WIIL 1EQWA 4DFHA 2OTUB 2P5EE 2LW3A 3DUSB 3GI9H 2EVIA 3NESA 1C08B 5PAZA 3SYAA 5A7BA 4XP1H 1IB5A 4FABH 5L88L 2IDCA 1K8DB 3UXFA 3SQOH 1J88A 2W9EL 4H1LH 1CJYA 4O00A 2P5WE 5EBWB 4ZJ9A 1TETH 1NCAH 1B4RA 2H9GA 1QFUL 2BFVL 1ADWA 1TKWB 3BAEH 3OB8A 4FEMA 3X14B 4UV7H 5I0ZA 5JHBA 3UTTD 1FJ1B 4KRPB 2NY6D 3QG6A 2K3TA 2QFPA 5HYJA 2NQDA 3EUDA 5L4JA 1R5VB 1QBBA 3KE0A 3MFGB 3WTWA 4AH2A 4JRXE 4PJBF 5KYYA 3ZDXF 3EXJA 4I8DA 5E6SB 1V54B 4XX1G 4ZAKA 3LS4L 1UCTA 4HLJA 1SGKA 4CVZA 5AOZA 2O6CA 4JJHA 3UEZA 2YBRB 4AGNA 1IGCH 3F7YA 4AMKL 4BZ1H 2P8PA 5AW4B 3CH1B 3EH3B 4F7TA 3HC4L 1AAJA 2Q3ZA 3GSQA 4KUZL 1U36A 3LIUA 1U3YA 4AXWB 1AZUA 2UV3A 4R96B 1SHMA 3SYCA 2HRGA 3IJ8A 4WW2C 3ZMEA 4FQQB 4N2EA 1M6UA 1F3DH 1JOIA 3MRDA 5C8JA 4N2DA 3RWIB 1YN7A 5D4JA 1TUPA 2XFGB 3VMNA 3MNVA 1HYSC 5CNHA 4Y16D 3WKML 3ZO0A 3IPBA 1WLHA 4JHUA 4LBEA 5D5MF 3MRMB 3FB6A 2C9VA 4JO3L 1HILB 2HFTA 4M48L 4NB7A 5TQ0L 4Y88A 3V4UL 1Q9LA 2NY1B 1A3QA 5EH1A 3VI4A 1B2YA 3UTQA 5I6NA 1A3RL 2ZOWA 4LPYA 5D8JH 5C0GA 4YE4L 2XKUA 1T22B 3VXTA 1O6TA 2NR6C 5F97E 1CF8L 1N64L 4EN3A 3ULVH 1UKTA 3QXVA 4R0LC 3NSXA 3O9WC 3BVXA 4HLZG 4P48A 2BVOA 3NJGA 3GSWB 3CLFH 4P59H 3GC3A 5D1XA 5KTEL 4S1SH 1HAUA 5E8EB 1C12A 1C5BL 2ZWYA 5DHVA 2P5WB 4BDVB 1YEWA 3U4AA 1XB8A 4Y8AA 1L5GB 1NMAL 2E4FA 4HJ0D 2WW8A 5JUEL 2VUKA 5IESL 4OZHE 4GAJH 3ULVC 4RBPH 3BDBA 2WKOF 1J8HA 1H8NA 3QR0A 1D3CA 2WSKA 5DCCA 1XH0A 4KVNL 2XN9E 1M9WA 3ZDZE 2D7TL 2XWEA 1XCQA 4CU7A 7PCYA 1EFXA 2YAQA 3QNYB 1X9LA 2MPVA 3ULAB 5HXMA 2XTJB 2JJTC 5EDXA 3QRGL 5IJCC 4N26A 5M95B 5EA0H 2UY6B 3HC3L 2Y6SD 3MRFB 3EO0B 3IMBA 4WSGA 1TITA 1U91B 3FUHA 4M5TA 2Z7ZA 2MPAL 4N5UA 4TUOA 2Q8AH 1G6RH 2ZSVA 2BWQA 1U8JB 3EFDH 4U1NB 4UINH 5FF6A 1Y18B 3MLWH 3BI9X 4AYFA 2GJRA 1DBKL 4S1RH 2VLME 2X7LA 2OX5B 3KJ6L 4LL9A 2WNXA 4AX3A 4OQTL 4ZMNA 3HRZC 2A3TA 2CUIA 3K74B 1CT8B 4UAOC 4FJYA 1TTUA 2R0KH 4X5XB 3P73A 4PB9H 4HPOL 1NIBA 4AT6A 5F3BA 4QRQB 4WHYG 4AK2A 3BGMB 3DETD 3IS1X 3QZBA 3VI4B 5BJTA 5D1XC 4NO0B 4OI7A 4F7MA 4FHJA 3ARQA 2WLLB 3DIFA 1BXVA 1VZIA 1EO8H 1CE1L 4OFVA 5DJYB 4NNYA 1FORH 1NFKA 3VFGL 5AB9A 3PV6B 5CILH 3KWXA 3E80A 2VR3A 1NGPL 2Q6WA 1PX4A 2IIJA 2OMYA 2C1OA 1NBZB 3KYNA 3TBTB 4NQUA 5CSBA 2CHDA 1I7ZA 5I15L 3Q13A 4NKIH 4PGZA 2VXSH 5KYYB 2ORBH 1OM3H 3RWDA 3B6SA 4LPUA 1BIHA 4A1RA 4WTQA 2IV9A 4D2NA 2JKLA 1MCPH 4NZRL 4JMNA 5C0AB 3RB7A 2D3NA 3RGVA 1OF0A 1YQVL 1MDTA 1VFUA 4U6HA 5ITFA 3V6BR 1OGSA 4AGLA 1KPUA 2CD0A 1AKJD 4LBEB 3IKCA 3ECBB 4OGYL 5EU5A 1HVXA 4UOJA 4LGSB 4A2MA 5T1KD 4OJFL 1HHHB 2XXCB 4E41D 2YPVH 3WKPA 3SDDA 3VWJC 2ZWKA 4KJQD 4CADB 2XXFA 3NG5A 4UT9L 1F11A 5BQ7A 5CKGA 2DJUA 3FB5B 1A1MA 1Q0YL 1CXEA 3Q5TA 1BOGA 5CS7A 5EPMB 1VPOH 3LRSB 5HVWA 1FDLH 2O5XH 5EBLB 5CJQL 3MV8A 4P5TD 2AJSH 5F6IC 4DIXA 4DZBB 5I6XB 2JNZA 4MNHB 2FGWH 4DEPB 1CFBA 3CZJA 2ENYA 2F58L 3I6LD 1TLKA 2EEDA 4N0UE 1N18A 1FF5A 2KZWA 4RGND 4PJ5D 2A6JA 2H4EA 5FHAL 1F4XL 4ZMWA 4L8DA 3ZKND 1RZFH 1DANU 4NN6B 3SQBB 1GRWA 5FK9B 4MBRA 1IO4C 1JZ7A 3ZTDC 5F9JA 5E8EA 3F2LA 2CDFB 5E9DD 4YFEA 5BOJA 4NZRH 4GW5B 3KMDA 1HSAA 2UWEE 1CFTA 2FNWA 1R3LA 3VXQB 4AQ8C 2P47B 5IBLD 3OXRB 4BWUA 3LKNA 4NRYA 4KKCC 1UM5L 2HKFL 1KYUA 2X4UA 3RWEB 3OLIA 4N0CD 2F54B 1XR8A 3BAIA 2CKBA 3COOA 2HXAA 3D08A 2NXYD 4J3WA 2QQNH 1NZRA 4TV3A 5CLZA 1DDTA 1QEWB 3VE0B 4H7VA 1A7RH 2HPTA 5IG7A 1IGYA 4LLMA 2I24N 4G2AA 1GZPB 1E4WL 3FRUA 4PRHE 2NXZD 1CDBA 4Y5XB 1UA7A 1LVEA 3S88H 4WENB 3WEXA 4KTEH 1BDYA 1ZEAL 1TIUA 2HKHH 5TD4A 1A4AA 3FFCB 3P3RA 1D6VH 3WKYA 4ATWA 1BPVA 2NQ3A 2Z93B 4R7VA 1ZVSB 2WVTA 2WMPA 4EVNA 2YN5A 4N2KA 4S1RL 1IC7H 2OCFD 4U6YA 3TIEB 3WUWB 5HBBA 5I19L 4X98B 3GMNA 3K4DA 2BCMA 5IHUL 2CJUH 3JXAA 3BP6A 4H8HA 4A6YH 2VMFA 1B2WL 1BQHB 4MXQD 4P4RB 3C6LA 4WDIB 1W16A 2FH6A 3L81A 1AS6A 2VZUA 4JDZA 3QZLA 2W94A 3QRGH 4RH4A 2ICWI 4R3SB 1KT2A 3US0A 1R3JB 1TQUA 4G8FA 4N2OA 2NTFB 4O5LH 1JXJA 3H9ZA 4NP9A 2QSVA 3FT4B 5JW5B 2IWKA 4M7KH 5DU7A 2GK2A 4KVNH 3RX7A 4B53A 4R4FL 5EN2B 4MXWL 6FABL 3US1A 4HK0B 4M3JA 4KU1A 4EI0A 3CHQA 3QH3A 3ZLQC 3M86A 1CFNA 4LPVA 1EX0A 2XRAL 2XZZA 1VF5C 3GMRB 4QKXB 3QG7H 4R83A 2GJ6D 4LFHD 2GHZA 1HQ4A 2GT9B 4HUWB 3KLAB 1KIPB 2NY2D 1TZAA 4X9FA 2NY3C 5C0DA 4HWBH 5FW8A 3BWUC 4HV8B 3VXMA 1NUFA 2X42A 2BWDA 4PLKD 4PGJA 3LZPA 4GMSH 1R1CA 4P59L 5E1IA 2IAAC 4JRYA 5T1MA 3C8DA 2VE6A 3MA7B 3QK0A 1OARL 1QQDA 1OAZH 1OCZB 5IVNA 2W60B 2PPEA 3UL4A 3HUJA 4NQDE 3ULVD 2E7BA 3GIZL 3WLWD 4CADA 1AGFB 4M6MH 3SJVD 4HJ0C 5JPNB 4J3TA 3BWAB 4WUKH 2F1EA 5JQIB 3EGXA 4M61B 4QGYA 3ARDA 2BNRD 2HKAA 3MSPA 1EV2E 3HAEG 3B43A 2XV3A 4M48H 2QZQA 3FQWB 3HZMB 1HQRB 3VM5A 5IB4B 5HVHB 4D0CB 5JW4Q 2DL9A 2YPVA 3MV8B 3GJFK 2ICWJ 1IARB 4TYUA 4GAGL 4BRVA 5DJXA 4K07A 3O9WD 4JJ5B 1KELL 3ZSSA 1ANUA 3KGRA 1GGBL 2EXTA 2XACC 3C6LC 5F7LB 5HJ3A 3GDBA 3OHXA 4CC4C 2Y24A 4JO1H 3QUXA 3RPBA 5CEZE 25C8L 2GJ6A 3QEHB 5FFLA 5DRNA 1R3KA 3JWDC 2ISDA 5AKVA 1U3NA 3QQ9D 1U8PA 4DN4L 2JWYA 1SJMA 2DLFL 2TRYA 32C2B 3DK0A 4W68A 1XF1A 1XIWA 3OR6B 2DLIA 4G6JH 3DIDA 1PD0A 4Z3HA 2YAHA 1D5MB 4DETA 2A6DB 5HGBA 2QTEA 2EYTB 1K4DB 1SEBA 5BV7C 3D9AH 1BF8A 1RU9H 4N3UA 4QRRB 4ZMYA 1DQDL 3LS4H 2GTWB 4PJIF 4ONOA 3WIHH 3FF7A 2ERJB 4N0YH 2LHAA 1AZNA 1FVDB 3KXFA 1EAPA 2OAAA 5AWNL 1CICC 2KLTA 2IJ0C 2XUWA 1Y1UA 3N41F 3CX5K 2QV4A 3QIBA 1VB9A 4IBSA 2CO4A 1USZA 1DSFL 1LGVA 1X9QA 3P30H 3GXIA 5I1JH 3CQFA 3DVNB 4UQEA 5F89B 1J05B 1DLFL 3A24A 1TCRB 3QRLA 3QCVH 2YAFA 4LNRA 5CMAB 4AEHH 1QSZA 3T4AC 2RQ8A 5FHBL 5HDQH 2FCBA 4MTMA 2G75B 4X98A 3PFQA 1IILE 3KPLA 2A74A 3AG2B 4HCRH 3GI9L 3RWGB 2A4EA 3IGLA 4YXKH 3D06A 3WIIH 4XBGB 3S48A 4YBHA 1UWEL 5ACZA 2VDQH 4X80L 3BD4A 4LARL 4LO9A 1SY6H 3H9SA