2LT9A

The solution structure of ca2+ binding domain 2b of the third isoform of the na+/ca2+ exchanger
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
HAGIFTFECDTIHVSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure note: solution structure of Ca(2+) binding domain 2B of the third isoform of the Na(+)/Ca (2+) exchanger.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
molecule keywords Protein Slc8a3
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2030 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lt9A00
2FWUA 3GINA 3E9UA 3E9TA 3H6AA 2LT9A 2FWSA 2QVKA 3RB7A 2QVMA 2DPKA 3US9A 3EADA 3RB5A 3FSOA 2KLSA 3FQ4A 2KLTA
chains in the Genus database with same CATH superfamily
4YO0A 5C9JA 4F9PC 4KMTH 3QDJD 5D70H 3OV6A 1X5KA 1WS7A 5C0FB 3ZTNL 2Z34A 2IFFH 1ORQB 5LN4A 43CAA 2H8PA 4UNVA 4NP4L 5DD1L 3RPIB 2DMKA 3B1UA 4Y1AB 3EYUH 5DRZB 4D9RE 4ZMLA 5CEZH 4G3YL 3BEVB 4J3BA 2Y1ZA 4OLUH 2ICWB 1SXSA 5TQ0L 1E4WH 1UFUA 2J8UE 2VL5A 1XH3A 3OR7A 4KBPA 1I7RB 4WO4D 2ZOTA 4OV5A 4WU7A 3THML 1KYFA 3R18A 1INEH 2EKSA 4MB4A 3RILA 5FYLE 4EQ3A 4LSQH 1COBA 1UZ6F 1D2PA 2FZ3A 2XZQL 4UAOC 2R23B 4JFDB 4NCC1 1NCOA 4WNSA 4LPVA 2BP8A 4MCZB 3CX2A 3WJLC 2YAHA 4C54A 3TJEL 5LDUA 4N2OA 3TIEA 2BZDA 3F00A 1F41A 3ARFC 5GSVB 4JFXA 3EH3B 5CM1A 2EZ0D 2X4QB 2V2TB 1V7MH 3HNTH 4IRSA 2FBRA 3T0WA 3LKSB 1KB5H 2MCMA 2AJYH 4Z7QF 4JG0L 4LDLB 2CIIB 2OP4H 5K59F 2WXRA 4KZ0A 3T4YB 3QEQB 2B5IB 5F9WB 4LT7A 2J4WH 3U9UA 1PEZA 2VDOB 1SYSA 4OM0H 3X13B 4DKEL 1PAMA 5EF0A 3F58H 1INQA 4HH9A 3S36X 3TNNA 5DR5L 2GBTA 5A1AA 3ULVH 2VM4A 1N64L 1ZHKB 2WXLA 4JFZL 3L3DB 3GSXB 5IVXB 5TE4H 2ROXA 4AYBA 5FO9B 3FH5A 4JFQB 3GZKA 4WU7B 1AGDB 3MLZL 4D3CL 5L8LB 5AZ2L 3MYZA 1WIOA 4X5XB 4F92B 5DJCA 2CD0A 5G55A 1LTXA 4ZS6C 1J0YA 2KS0A 5AAPA 2A6KB 3BP7A 3LRHA 3HG2A 1Z9NA 3D85D 2BC4A 4I0CC 3OM3B 5IMLA 4W81A 3FTZA 2A74A 2EXYC 2VXUL 3CN2A 3WKML 3NSYA 4M7LL 4POZD 4PY7A 4RRPA 5D7KD 5AQ0A 1HQRA 3DV4B 3QIWB 1E30A 3DOIA 4F9PA 1RMFL 4TSCH 5IR1A 3APNA 2IBZX 3INUL 2CXGA 1YG9A 5DEGB 4FZEH 4FG6C 5T1KD 4IBWA 3EH1A 2E7LC 1D5ZB 4PJFE 4XN2A 2A4EA 2DKSA 4LRNH 4PW3A 4ZSOB 1J8HE 4C83A 4LE8A 3UXFA 4S2SA 5C0CB 3V6OE 1N9PA 4OFVA 4CBZA 1F4XH 1WBYB 2JIXA 4PJGF 4QTFA 3GXIA 4PB9H 4A63A 1ESOA 5AVXB 2CUAA 4JKPH 3U0PA 4BRVA 1LK3L 4XN8A 2X89A 4TVPE 4YSRA 3TYGL 4J6RL 4GG6E 1I8IA 2QHLA 1REIA 1LO0H 2VN4A 1MCBA 2ODIA 2ZP0T 3FPXA 2A9DA 3RTQA 5AL0A 3SEPA 1RJLB 1AMXA 1TTGA 3E6HB 3FQ4A 4KDWA 4TXVB 5GS1B 3LIUA 4E9QA 2ZXAA 2WLIA 4LOUC 1HKFA 1HCVA 5L88L 1D5RA 1T6VN 3LD8C 1ZA6A 2G3MA 1GGCH 2VDLH 1F6LL 4NKMA 1U8CA 2AW2A 2C4XA 5CP3A 3U7YL 2AVFA 4BZ2A 2N59A 2VM9A 1BGXL 2BIPA 3AWGA 1ES0A 2YGQA 5C0GB 4PY7B 3CC5A 3IJYB 4ZG1A 4GS7C 3SDCA 4TTDC 1BXVA 4NZUL 2GY5A 1GS8A 4FI7A 4G3YH 1FPTL 3SPVA 4OGXH 1WZ1H 1HIML 3A6OA 1IC4H 1J05A 2YUXA 1F97A 3HR5A 3OLIA 1ETZB 2E3VA 3QO0B 4N0YH 5JQ6L 3ZMRA 4YX2H 2ATKB 2QGDA 3WE6A 3OAYH 5IFAL 1MI5A 3GDBA 2R2CA 1ZS8B 3ILDA 3TBVA 2BP5M 4NPYB 2XJLA 3IF1A 5JA9A 2CNZA 1CDBA 3W82A 5AUMA 3RVUC 2WBJD 3VD3A 1KDJA 5DLML 4UBDD 4FQIL 3CMOH 1I8AA 4O2FB 1WT5A 2Z31C 3MRPA 4QHKJ 3HZMB 3UH8A 3MRMA 4GKOA 1KV7A 4LKXA 5J12C 3ARVA 2H1PH 2UX6A 4OGAD 2G3NA 4F20A 1JD7A 4JFVA 1HOCB 1L5GA 3E1ZA 3U4EB 4P5TD 2AQSA 3PWLA 1VSCA 2AQPA 3SE4C 1KB5L 4WTQA 4A7VA 4JHUA 4B9FA 1M3IA 2TAAA 1QBAA 3OKEA 5I8OL 5I1LA 4GFTB 3N43B 5DJYB 1LDSA 3ENEA 4Z7AA 5HYSG 5A2FA 3NBNA 3D85B 1NDGB 5EZJA 5I6MA 3HAEB 1IQWL 2P3YA 3NMEA 3UMTA 1YSOA 4NN7C 1E4KA 3KBEA 2WWMD 1GH7A 3FUHA 3ISRA 2FLMA 5KYWA 4BHUI 4DCQA 2Z4TA 3S3CB 1KJ3H 3EGXA 3BJ91 3NABL 3I6KB 4JFWA 4XP1L 2H2SC 5J13C 1CZ8L 4N2BA 5IJKC 2QSCL 2IWGA 3QQ4A 4UQIM 1BVKB 3QAQA 3OKNA 4MSWA 1C1EL 3OMIB 1FG2B 1C08B 4LSUL 1P4LA 4W9EC 3MGAA 2PLTA 1ZJAA 5BZWB 1QRNA 1IM3A 1ZHBA 5CZKA 5FDYA 4PJBF 1VZIA 5EHFA 4NBXB 3ZYOA 3Q48A 2X2HA 3GHEH 1AZCA 1VPOL 4QRPD 3NRQA 5INDA 1JPSH 3BOVA 1BQHG 5DF0A 4K3EL 2GJZA 3S35X 4ALAH 1SMDA 5TQ2H 1UZ8B 2CKNA 1HAWA 5KN5B 2AZAA 3KJ6H 5GSRB 5KSBB 4CVUA 1JZ2A 5E6UB 1MCWW 5FUOH 3KEHA 1J7VR 3QNFA 2IQ9L 1RVFL 3GWJA 1WFOA 1XF3B 5HHOA 1JZ3A 1KEGL 4ZTPL 1IC7L 2CJTA 5BZDB 4R2GB 3BIKB 2Q76A 1G6RA 2JCCA 4JFSA 4UDUA 1H15B 2DIJA 3V4LA 3QDMA 1NGPL 1A6VH 3QC5X 1JPTL 2Z3FA 2NXZC 1XIWC 1F4HA 1FQ9C 4OW6A 3QDGD 1BIIA 2KDGA 3VFSB 3GMRA 4JVUA 4JO4L 4GQPH 5FV1L 4GI6A 1UURA 2VLRD 3OKDB 4LAQH 5L2KB 4LOUD 4Y8DC 5SWZB 3FH8A 3MLUL 3IRCA 4YDNA 4TYUA 1HZKA 2DKMA 1JGDB 3L45A 2P5WA 1BHGA 5BV7C 1UUNA 2OJZL 3HN8A 3LRKA 4NO2A 4UTAH 1KGJA 4LZKA 1SEBA 1L7IH 5IP4A 2OXGA 4HK3J 4YHKH 1E90A 5I6OA 1DJYA 3WIIH 3KCPB 4HHAB 4PCKA 4OFYD 1S7SB 1S7UB 5EIIG 2R2HA 1VHPA 2DIBA 3D12B 5GGTH 3ZLQC 4AZ8B 1P84J 4XNXH 6FABL 1T5KA 4LLYA 2HZHA 3I84A 4M9PA 4PJHB 2VERN 4OQTA 4XBGB 5IQLA 3FT0A 5A6IA 1RHHA 4KKCC 5I75B 2JJVA 2AK4B 3CDCA 3L4VA 3RX9A 5HDBF 5E9DA 3SBWA 1RSFA 4QNPF 1GL4B 2PR9A 4N2EA 5MENB 3PL6D 3O3BB 5E9DE 1QPPA 1M7XA 2A7BA 5JORB 1XR9A 4XWGH 1M6OA 4Q89A 1YYLL 3WJMB 2WINB 3ARTA 4JB9L 3U4AA 4ZMYA 5KS9A 2AXGA 1ZEAH 2IANE 3ILPB 1EJ6A 4U1LB 2BSRB 1A6TA 5DO8A 3HI5H 4NHUA 3IXAB 5IQ7L 5KYYA 1UCBH 4QRUA 5DMIH 1OAKL 3DTDA 1QX1A 4LCIL 4OM1L 4POZC 2HT3C 2WYZA 3SDDC 1X7QA 3ZXAC 4BZ2H 3Q8EA 5HYIA 2YEQA 3WAKA 2ZAHA 4EDXB 3P40A 1NCDH 4GG6B 2G9KA 3OD3A 3QO1A 1F3RB 5J3HD 1IEBA 1WBZB 3SBPA 2BP0A 3HNVL 8PAZA 3KCPA 1TG8A 2C7UB 4FKHA 1JTOA 1FVDA 3FU5A 2DDQH 3VH8B 1AZVA 2ZF8A 3IK2A 3KDMB 4IBQA 4ODWB 3D3VD 5TF1L 3HE7A 3NCYS 3A0OA 1P4UA 3T0AA 5LGKA 2R4RL 2XRAL 1OAKH 3E2HB 4PBDA 5E2TH 5BRQA 2DQMA 3O9WD 3IFOA 7FABL 4NB7A 4WI2A 5IB5A 1FGVL 3H7LA 3G5XA 1EZSA 4HG4J 1FE8H 2K8QA 1KB5A 2FTAA 3KL0A 4FNPA 3FSZA 2F74B 1S2EA 3PJLA 2A9AA 3AVEA 4IHOA 4QRRE 3BD5A 5AZEH 5GS2H 1KCBA 3ARDB 4RDBA 1Q9WB 4B60A 1KJ2B 1A2YA 2VWEC 3R7RA 1EO8H 2G60H 2QVTA 4M7LT 2D0FA 1Q0XH 1AACA 2DLFH 3HKZA 3DDFA 4GUOA 1MJ8L 2PTTA 1ORSA 1P69B 3CPUA 3GMPA 5E6ID 4EIGB 1R24B 1DQKA 3GUFA 3MBXH 3N91A 1Z9SA 1VCBC 3BWAB 5E6IB 4A2LA 1B4TA 3A4FA 1NCWL 3IAQA 4H20H 5HTSA 5DD0L 5FO7B 3ZKXC 5I73C 2J21A 4HV8A 3BKMH 3QARA 4AGOA 3EJPA 2WTOA 3OKNB 4OCWL 5EU6A 5DVOA 1TTUA 1OHQA 2IGLA 2FO4B 5DEFB 1CLYH 1PFOA 1XIWD 3KPRB 4UQBA 3TM6A 1QO3A 3SE3A 3DHUA 4DUXA 3ARDD 1B0RA 4L37A 2BERA 4IMLA 3RNKA 4OCLC 2F7IA 1DN0A 4F3FB 1MUJA 3TFKD 3FU0A 5BS0E 3G3LA 3P2BA 3QULA 5E95B 4HFWA 1IVLA 5LGJB 3GSQB 4DGUA 4HOMA 4KX9A 1PMYA 2AQQA 2WLYA 2ZUQC 3EOBB 3SOBH 1P5VB 3UJJH 1SDDA 1MIML 2ADIB 2DBLH 3MSPA 1VEMA 5TH2A 4BK8A 4ODXA 1NPJA 1Z6JT 3UYOD 2LV4A 2Y6TE 3ULUC 1KGYE 2IPUK 3HFML 4MDIA 2JKNA 4OZHF 4AQZA 2NY4B 3R4RA 2Q7YB 1KTLA 3WMSA 4M5YH 5DJ0B 1FSKC 3DXAA 3AT9A 3KPRE 2VSMB 5EEVA 1TJGH 3HFMH 4EUPG 2CJSA 1DSFH 5E6IA 4XGZA 4JE0A 1NCCH 3H9SA 3C60C 4OI9A 4CBPA 1N3NA 4WLCA 2M83A 2MPAH 4GMSH 3VFTB 3IPEA 4GKSB 4P2OC 4TPRH 1E4HA 32C2A 3EH2A 2OZ4L 3QNXB 4YC2C 5D55A 4AQEB 3D0LA 5HPOA 3HN5A 3TVMC 5HGBA 4PJEF 2Q3XA 3QZWA 3WXVH 1BECA 3RNKB 3TURA 4ADGA 5I0XA 4GSQA 4TQEH 3OJDB 1S7VA 4PJ5B 3QULB 5K33A 5TJWK 4U1GC 3WFCL 4ODUB 1FO0B 3GSWA 3K8LA 3ARBA 1A6PA 3DMMD 2CSPA 4C58B 4QYOA 3FXIC 4TTGA 3LZRA 1RERA 3APCA 2OL3A 5J1AB 1F1AA 5K9OB 5B1AB 3UG5A 4IKKA 1DANT 1T2JA 4ZMVA 4UUJB 2QSQA 1IQDA 3P0GB 4OQTH 2AJYL 3S4SG 2Z64C 4HUCA 3OC8A 3U82B 1S7TB 3FRUB 1C16B 2C3GA 4GP5B 5CWSA 4KRPD 1RVFH 4PJEB 1KN4L 4TLKA 5F88B 1RZ7L 5EF3A 1TF4A 5AZ2H 3GEFA 4FQ2H 2WTRA 5HI4D 4GSRA 5IZ7A 2NZ9D 5KBKA 3MI6A 4LHJB 5F1IA 4XODA 3HLAB 3KW7A 3WLBB 4DAGH 3P0VH 4JFZH 4R7NB 1ZVHA 1GPOL 4HS3A 2GBVA 3VFTA 5FS5A 3LPOA 5EH1A 4UV4L 3IMWA 4UMGA 2QSTA 5HDRA 3H9ZA 1R5WA 3MLWH 3NRFA 1BBJB 4J3OF 2C7UA 1VA9A 3W0WE 4DEPC 1O5PA 2E27H 1UT9A 3W37A 5BOZG 3B5HA 3N50A 5AWNH 4ZFFA 4WUUB 4XXDB 2CPUA 4IM8A 5EUOA 5K5YA 4J1UA 4PCSA 1QW8A 4BH7A 5J12B 3VXRE 1A9VA 4OCMC 4JQXA 2C8NA 3NH7H 5EU7C 4AH2A 3D87B 3D05A 2HTLD 3L3OB 4N0CC 5I8KH 4LMQE 3VXUE 3NFNA 3S98A 4EBQL 2HH0H 5BJTB 1O7DC 3Q13A 1DJSA 2APFA 4KXBA 3L1EA 2QHRH 3CWGA 1KCUL 3GJFH 1SZNA 4I5BB 2VJ8A 1OSEA 1BOGB 2VABA 5L6YH 2BNRA 1FIEA 4BD4A 1WJ3A 4OLUL 4L8CA 3OZLA 2J8UF 5AW4B 1SRDA 1NCBH 3HZ3A 4JL2A 2I60H 4MYWB 1WFIA 4NDMA 5B3JF 5PAZA 3NJFA 1NJ9B 4K9EC 1BLIA 1PGRB 4JB9H 4JM2D 1I1AA 1UJ3C 1H5BC 4RZCB 5KEZA 1K4DA 1MAJA 3NEEA 5CF3A 1NC2D 5KW9H 2BVOB 3EOYG 3UCQA 5GRJL 4L9LB 2GCYA 4A2HA 4JY5H 1PAZA 1W72B 4AT6A 2I07B 1NGWA 3I3DA 4TSCL 1JP5A 4GUPA 3KW8A 5GJTH 5EOQH 4GW4A 1R9FA 2GFBB 3SD2A 3L3OA 5J9PA 4RLDA 1LWHA 2AXFB 5I1JL 1BV8A 1XDTT 3NQIA 3MLYH 4X6BB 3UJTH 4H0HB 4F15C 1ZSDA 1TKWB 2A0LC 2UY6A 4HUWB 4I3RL 1CE6B 4NFBA 3Q6GL 3OJ2C 2YWYA 4HOZA 4JHVA 2LVEA 1CLYL 4MXWH 2X70B 2CLRB 4L8CB 1XWVA 2APVA 1KFGA 1CD0A 2CGRL 4KK5C 4KQ3L 5IM7B 3ME0B 4XCYA 4NKOA 1L9RA 4YDKH 3ABLB 3A22A 3V4PL 2VJ0A 3C6EA 1I9JL 1JPTH 2XQ0A 2JKTM 5F6IC 2R51A 3MJ9H 4AQAA 1OAYL 3AY2A 1HCZA 2R1XA 4OBSA 4OZGA 4WTXA 2G5BB 3BKYL 3WEXB 4OZGE 3PL6B 4JHWL 1F8TL 4PJ7F 1DSWA 1X5YA 3KLDA 4Y89A 5KSUB 5L6YL 5IB2A 2AEPH 4E9TA 2EQDA 5ABDE 2AXJA 1FNAA 1UT2A 4XC1H 3T0DA 2NW3A 1KGXA 1PY0A 3QXAA 1IC1A 1BQLH 3DOSA 4RMUA 3A23A 4HIHA 4QXGL 3LQMA 2WGXA 1LDPH 2V3DA 1D7DA 5C0CE 1L0QA 3ZKSD 1WTLA 3TBTA 4XNMA 1IT9L 3HVNA 3MLXL 2YPLE 4GRLB 5DJ2A 1ZSDB 3CVDA 3WMPA 1FGVH 3D3VE 3CXHJ 3JUZA 5D1XB 2BOBA 4W9CC 4QYOB 4ZSOA 4F2ME 3QQ3B 5J1AA 2DYPA 1M7UA 3KLLA 1Z5YD 3P3YA 1DO5A 2ZYSA 1IQDB 1XVSA 1RCYA 1QPKA 3U4BL 3QDGB 2P5PA 3W2DL 2BWDA 4NO5B 5FYKL 5I1CH 4D3CH 3MV7D 2IH3B 3D4GA 2HT4D 2QQNL 1FP5A 5F88A 15C8H 4LCWD 3VW3L 1XH2A 5B39G 2Z9TA 3DX7A 1IQWH 1JDAA 3WHE0 2HVJB 3CHRA 5EN2B 3PWVA 1SJXA 1P1ZB 2PP8A 4XI5D 4CMHC 3NPSB 4G42B 4FHJA 1U8CB 4XPFH 4JDEA 3UO1H 3GXPA 2MNWA 1KN2H 4IU3A 4NLHA 1CBVL 43C9B 1TZAA 4A2MA 2ZP8A 4Y5XA 4X9YA 3CDZA 5DUML 3VRIA 4Z0XB 3O6LL 4XPFL 1BBJA 1JXDA 4W68A 3NESA 5IIEA 3AM8C 2F1AA 5CKAA 1LQSR 3N42B 4KUCF 3EXJA 3GBML 3ULUF 2UYLA 5FOBA 2ATKA 2GJ6D 4NQEA 2FWOA 3IT8D 1WFJA 4F2FA 4TUJA 3EBAA 5FUCE 5HHOD 5KJ7E 1ASQA 4NWTL 5E8PB 1A4JB 4U6HB 4EVNB 3GBMH 1UH4A 2Y4SA 3DNKA 4Y4FD 1HWGB 4QLRA 1IAKA 4BGDA 3SKUD 4F8QA 4E9YA 1ZPLA 2XC8A 4G8GD 1I9RH 1XCQB 5BJTA 4L4TE 4ZMPA 4X5PA 5ABAA 2F5BH 2EIJB 3VXSA 4L29A 3BW9B 3L1OL 4CGTA 5H37A 1AQKH 1DBAL 4OKVB 5D1ZB 3OJMB 3O3EA 3QRLA 2ZUWA 1GHFH 3NOIA 3SDDA 2APBA 1Z7JA 1GKEA 4FFVD 3G6AB 1JYVA 2P4AB 1NLDL 1RJYB 2XQYA 2GJPA 4YE0A 2OSXA 1OCWH 3CSPA 1SDYA 5E9AA 1P7QB 3ZUCA 5T1JA 2YFNA 3D39A 3RFRA 5BNXD 4QXTA 4Y0GA 4ZXBB 1HHKB 3NA9L 3HI5L 3FFDB 2EVGA 1RH8A 4PV1C 3NJVA 5SV3A 5I74C 3TBBA 3WGUB 4G8GA 1PLGL 2UYLB 4ZMZA 5FOBB 4K71C 3V0WH 3ILPA 1MLBA 5ESQA 5E9DD 2QPEB 2GUOA 4JR9L 4YVUA 3RWEA 3IXAA 4Z7NE 2NYKA 1RZIB 2D03H 1JNHB 3QWNA 4BA8A 1U8LB 2DM2A 3REVA 4DPCX 3OAWA 5FV2A 4KTDL 2XWJB 3L3GB 2BVUA 5A2BA 1SUHA 2ZP9A 1C5DA 4LCWA 1MCSA 2V17H 3O3DB 2B0SH 2NYZA 3D9AH 4LEBA 2Q86A 3BUYA 2HFEB 4TULH 5EOTB 4XE0A 1KYOJ 1OIOA 3DXAD 4QHNB 5IV2B 3MMEA 5FUCC 2YZ1A 4LF3B 1D5IH 3N1QC 1OAJA 1FZJB 1IEAB 2CDFA 4XCEA 1FVDB 3QORC 4JG9A 4NO0B 4Q6IB 4U1SA 3HC3H 3S37H 1P7BA 2XBZA 1L7IL 4AC4A 3WI9A 3ME0A 1HL4A 4NFCA 1KIPB 4F9LC 1KJVA 1DDHA 2J7LA 3BESR 4N4YB 1T1ZA 4O5LH 3MLTB 4PVLA 4EI6A 3CCHB 4ZFOL 2O93L 4YDKL 5I30L 1MLCB 2JCCB 4RGNC 5C0AA 1TFHA 5DJAB 5C9KA 3EH5B 1AGCA 5LUMA 5HDBB 4DK6A 3IJ9A 2Y5QA 3EXLA 3GI8L 4XHQA 2RMNA 1KB3A 3MV7A 2PYEA 5IKCB 4MBOA 3S3BB 1GMIA 2ROYA 4IBSA 3UEZA 3ETBF 1ES0B 1D5MB 1E50A 1V5JA 4AG4H 3DOSB 3H3BC 2AC0A 3FTGA 3OQRA 4WUUD 4L4VA 3BZ4A 4PJ9D 1JL8A 2P49B 4R26H 1S7WA 3OHXA 2E74C 4NQDB 4F37K 1R24A 5T1KB 2BOBB 1U58B 4Z3GA 2CCWA 5HY9B 3EJZC 2P8MB 2JB6B 4FJYA 1OWWA 4RX4A 1ECZA 2BNQD 4LF3A 4YGVA 5F9JB 2HKFH 3O8XD 4PRHD 4P46D 4JVWA 1HEZB 1EO8L 3WE1A 5A43C 5BXFA 1QATA 1AXSA 1QD0A 4R7DA 3DX8A 4XBGA 2WD0A 1QFWI 1OZUA 3UG4A 1A4KA 3M6DA 4JZOA 2VDPL 3MOAL 1OCOB 4LKXB 3LZNA 1B3JA 2YBRA 1DFBH 5CGBA 5JORA 4BE5A 3BE1L 4X98A 2FB4L 1KELL 2J44A 3M1BB 5FGBC 2EDLA 1A8JH 5E2TL 1AGCB 3LOWA 4XO5A 1PSKL 2C34A 2WXNA 3DLQR 1B0IA 1CO1A 2G0LA 3E2HC 5I1LB 4KV5E 3FQNA 3IETA 1F56A 4BK4A 4HCGA 5I0WA 1X5GA 4ODSL 3VFRB 3SCMA 3KJ4B 2ZX8A 3MX0A 1UB5B 2B3RA 3D85A 6PAZA 5CU5A 2SEBB 3ZL4H 5JW3H 2PYFB 4U3XA 2CCLA 4XPBL 4ODTL 5DS2A 5F3FA 1J0ZA 1IILE 3UTTA 4QRRA 4MA3A 4G1MB 3O8XC 5DD5H 3CVHA 1ND0A 5LBVA 5E8DL 5HY9A 1KY6A 3EOAA 4YK4B 2DJ4A 1N6QL 4KXAA 3SKJL 3IMBA 1A9BB 1A0QH 1RZ7H 1UA6L 2VMCA 3W38A 3TV8A 2OMXA 4ZW3A 4PVBA 2F19L 3BP5A 4OFKA 4YSOA 2H0FA 4LPCA 3Q1EA 2L0DA 5J89A 2NXZB 2YPVA 1IM3B 1A0QL 1QTSA 2N7SA 4P0DA 3US1A 3G9VA 3MLUH 4ECNA 1GGIL 4JHAH 4NI6A 4UT7L 1X5MA 4WI3A 4UV4H 5DMJB 4JKKA 5D7HA 2BVQB 2G75A 3QJSB 5D1QB 3F04A 1OXYA 5L0QC 5IB4A 3X12B 3FW6A 1I3RA 3DWTA 3G6AA 3GMOB 5G5DA 2KBGA 3G5WA 2DQDL 1Z3RA 3LN9A 1WAEA 2UXVA 3BPCB 4JRXB 4NQEE 3RZCD 1I4FA 2DWSA 5CR1A 3E3QC 1TYJA 1FA4A 2BDNH 2CDEB 3DI2B 1OY3B 1RSYA 5EFIA 2N3JA 3GSNL 5HYJE 3I02A 4FJZA 5D1QD 1BJ1J 3UYPA 4XNAA 3O2DH 4HAGA 4KH9A 5KAQG 3EJYC 3FRPA 5HDLA 3L7FA 3B6SA 3PAVA 4A38A 4MD0B 1MCOH 2DWXA 2NYYC 1PFCA 1IT9H 3MVSA 1CMOA 2H8PB 2KQNA 3U30C 3NGBB 1U8LA 1KFAH 3REVB 4AVKA 2LQRA 4OJEH 2ICCA 4AIZB 2MFNA 2CDGB 4GBXC 4ALAC 5JOPE 4Z3HA 3O0RH 4IKLA 2ILLA 3DMMB 2CGZA 2J4WL 1KYUA 1U0QA 3S8FB 3H9HA 4DEWA 5FGBA 1T1XA 3IN0A 4XP4H 1A3LL 2FATH 5CZVL 2CO7B 1PLGH 1S7QB 1OSZA 1EO7A 2OZ4H 3CVIL 4Z3EA 3NABH 4XP1H 4ONGH 3BQUA 4JCMA 1RZKC 4RWYL 3B9KC 4MNQA 1YPZA 4G7VH 4ONHA 1TJIL 2FGWH 4AUYA 1DBBL 2ADIA 2OZNA 1USQA 3QHZL 1JPSL 4FNTA 1AIFB 1USZA 1U4EA 5JNYB 2DM4A 2WXIA 3BIAX 1E42A 3NIFB 1UQSA 3MR9B 3WSQH 1KTDA 3GJEB 3I02B 4M3KB 1YNLH 5DJAA 5JIPA 1HWWA 4Q7DA 4NWUH 3HNSH 3Q2LA 5I1KL 2AAVA 1BF5A 5IREA 5BV7H 4LNRB 7PAZA 2A9NH 4HXBL 3NJMA 4L9LC 2NY2C 4QHKI 3LXUX 3ZTDC 4L8DA 1T7WA 3IJSA 2L8AA 1TQSA 3GM0A 4PG9B 1N0LB 3D39E 1UD3A 1CGTA 4R5XA 2VDLB 1TVHB 3L1GA 3WD5H 2E9JA 3TNNB 5JW4Q 3UBFA 1PG7H 4X4ME 2AP2A 2E9BA 3U0TB 5LN8A 4K5PA 1G84A 4NN5B 5B4MC 2UXTA 5J6GB 3DVGA 3QQ9D 2HX8A 4ODHL 2ZWYA 1GC1C 4UNIA 1Q9KB 1OP3H 4NZTH 1Y18A 5I24A 1GYAA 3QQNA 3LKNB 5IQ9B 2L3BA 1A1MA 2OYMA 3UTQB 4UT6L 4HSQA 1T4WA 4P3DB 3QISA 4JUSA 5AOLA 2VSCA 4CILA 2A74B 1TZOA 4N2IA 2BVEA 2V33A 3BD4A 3UO8B 1CT8A 4DN4L 1OQOA 4N9GB 5BZZA 2H1PL 2X4RA 4GQZA 2WBXA 1XV8A 4MX7B 5JMRA 3T4AC 2H7WA 3WV0A 1AG0A 2ZKYA 4YK4C 3ZT6A 2FL5A 5JR1H 3WN6A 5E6ZA 1HH6A 2FJUB 1GAFH 4WW2F 3FQNB 3IETB 5F21B 3U25A 4EBQH 1NCIA 1Z3GH 5D6CB 4JFED 1WBYA 2BNRD 2JIXB 3LXCA 1RIUL 4F27A 4OZHB 3WNMA 4ODHH 3CZEA 3BSZH 3FB7B 3QGVA 5EU3A 3V0VB 1R5VB 5C0RL 5FCUH 5B38B 3EYVB 3KPNA 2APSA 5KYUB 4NRXA 4KI5D 2X4SA 4Y9BA 5KOVC 1DZBA 2DWTA 3UIYA 3B5TA 4JRYB 4YXLL 1FCCA 2BIQA 3BWAA 2CKBA 4Q52A 1UD6A 1A9BA 1CTNA 3QS2A 1H3TA 4L4VE 2H45A 5EZIL 2ZQKA 4QTHA 3CVHH 3T1FA 4PRHE 4QHUB 4ZFZB 2OMXB 2NW3B 3TA3B 1G4MA 5D71H 5GHWL 3WSQL 5A3IC 3DURA 4OAWB 3CSTA 4HLJA 4X7DC 4MD4A 1FSKB 1MI5E 5CKGA 1P53A 1T6BX 1U8HA 3FT3A 3L95A 4GPVA 4QGYA 4XNMB 2X4QA 3RFZC 2I24N 4ZZKA 2DH3A 3IRPX 3CBKB 4MJ5B 2ZZUT 3OX8A 4QOKD 3U30B 2H1LM 1J48A 3NFPB 3O6LH 3MA9H 2X9YA 5DO2C 2WV3A 3M46A 2BPBA 1TYEB 1YC8A 1A7NL 4Z7VE 1OLZA 5IMOA 3B7YA 3PG2A 2X7LB 1EX0A 3KPQA 1PQZA 3MRLA 1D3CA 4NDMB 1QFHA 2ESVD 4R4BB 3JVGA 2QQQA 4X4YB 3ARQA 4OGYH 1R6VA 1GW0A 4GG6F 5JUEL 3E1F1 1YEJL 3NIFF 4NM8H 4FOMA 3UJTL 1U8QB 4XGZB 3VUAA 4QGTA 3SYCA 4AYDC 3TT3L 3WKMH 1P1ZA 5BOPA 4I0PD 2GCYB 4LESA 2MQ3A 1F90L 5DUJA 4ADIA 5I1DB 1MQKL 3V5KB 1I31A 5HHNB 1CXIA 1NC2A 5EUOE 4HBCH 3X1BA 3CDYA 1ETB1 4GH7B 2XWCA 3X3FH 2VLJD 1KTKE 2W8CA 1ACZA 3TZVC 5L2JB 4PJDB 4Y2DB 3QDAA 5I75C 1CURA 1IGFH 4NNXA 3HAEA 2LHAA 2AQNA 4P4KD 1TITA 4HPOH 1PU0A 3ULUH 1D5ZA 2JCWA 1G5GA 1MCEA 4HJJH 5B4MD 1L7TL 5KBNC 5J57B 2X87A 3FB8B 4N5ED 2O1AA 4I88A 2OMZB 5D71L 5BS0B 3T6VA 5E8EA 4UUJA 4LQ1A 4HCFA 4OIIL 3CG8A 1NGZB 5IM7A 5J5EA 4PYHA 4I0PA 2D7OA 3CVIH 5AB0A 3RI5F 3I3BA 4FFWC 3BW9A 4N26A 3EGDB 4EIBA 1JTTA 1W0YT 3J7HA 4Y1TA 1CN4A 1FH2A 3L5XL 4HPYL 3RDTB 3KJ6L 2R0LL 1BXUA 4PJDE 4HK0B 3C5ZC 2TSBA 2X6AA 1DBML 5JPMB 2YQ3A 4K07A 1EAJA 3OR6B 3TH4T 2VO5A 3JTTB 1JPST 3QORA 3NFSH 4NENB 3NAAH 2YOCA 1YQVL 5J6GA 3T3MF 1UXWA 4XC3L 5J1SC 4HJIA 1ACXA 1G7IB 4MQ7B 2DB8A 5LBSH 1FG9C 2NZIA 4OV6F 4U33A 5MEND 4PRIE 1NAML 4EN3B 5CSGA 1H15A 4WI8A 1SVZA 4LSTH 3LPGA 4PRIA 4JPWL 1QUPA 2OS7A 4JZNB 2HUHA 4F9LA 2F8OA 3OGCB 4NEHB 4Z7OE 4IEFA 3BZFA 2XKUA 3EYUL 1XH0A 4JDVB 3OKOB 2E9IA 3OPZL 5FLUA 1JNHA 5I1AA 4HP5A 3TIEB 2PWHA 1BREA 5BS0A 5D5ME 1FORH 1SBBA 2JKXA 1ZDSA 2WVTA 4OFQA 2EH7L 3VXQA 5D7EA 1EIBA 3B3BA 3RJQB 4BDVB 3MRFA 2GTQA 4FFYL 2XKSA 3RGVD 3S3DB 5JW5B 5CCKL 4AKPA 2H32H 4ES8A 5LBGA 1CJYA 3QR1A 4R7VA 1FL3A 4XMVA 4L8BB 4AEIL 1IKFL 2VC2L 3T4YA 2FJFB 1FE8L 4NBYB 5I8OH 3VG0H 2XYBA 1AGEB 5LCVH 2WB1A 4NCC2 4X8XA 4LAJH 4LSRH 5IT2H 3ECBA 4KMLB 4K8RH 1RHHB 1JAEA 1KJ2H 2D7MA 1LWRA 3MUGB 5I66B 5DUPH 4AQ8A 4OVVA 4XE5B 2YD3A 3CQPA 2H3NB 3IDJA 3VNYA 4ZNEE 4ELDA 2H26B 4Z7OB 1TQCC 1PIFA 1ZE3C 3V9EA 2BLFA 2AV7A 1KZYA 1ID2A 3LEVL 1MLCA 5CJBA 3A4DA 4PGJA 5LLIC 3FFCE 4WFEE 5B1JA 4JW3A 1MFDL 4M5ZL 4R96A 3WN5B 1X5IA 1HEHC 4ENEC 1UH2A 2W0FB 2WBJB 1S3RA 4P5KA 4FQJH 4U05A 4ZOCA 4PRDB 4CSSA 4MSWB 1Q0YH 3HVDA 2MRYA 3IS1X 1LK2B 3TA4D 2W9DL 4HJ1A 5IESL 2Q87A 1IMHC 3RX8A 2BS8A 1BMGA 1N19A 2NDGA 1O9WA 5CJOH 4TOYH 2G3XA 4IRJA 4N0UA 1PKOA 2OZ4A 4R4FH 3SGJA 1YNKL 4ORZC 2LLGA 3RVXC 2FJFA 4U0RB 1MPAL 1A3RH 4BH8A 3QUML 2XPGB 2Z4QA 1MY7A 1F3JA 4HETA 3ZE1B 3BH9B 4R7DB 2X53A 1TXKA 3QIBD 5GSRA 3BUIA 1T5WA 3DK2A 3WTXA 1D6VH 5DRNB 3ZR5A 4H8HA 1JNJA 3QCUL 2AV1A 2PWDA 5I9QC 5J6HA 1X9RA 4S10A 1BDYA 4F5CE 5ANME 1BF8A 1YEKH 2YJLA 4AL8C 2MIZA 5CAYB 1LE9A 3FKUS 2UXFA 1F4XL 2ZWSA 3N42F 3P0YH 3BGFC 4XOEA 5CJXC 5EORL 4FXLA 3WN5A 1D5IL 4KQ3H 1A25A 2WP3T 2WBJA 3F84A 4D0CB 1T03L 5HJ3B 4YL4A 4FFZA 1MCRA 3IJYA 3OXRA 4MHHG 1HKLH 4QHPA 2FJSA 3PJSB 3MBEA 4IBZA 1FZMA 2PW2B 1CL7H 4PRBA 1UASA 3OWEA 4GRLA 5I1EL 1KC5L 3HC4L 1Z66A 3OVUB 1MG3C 3MODL 4HZAA 4TQEL 3HS8A 5EIVA 2XWTA 4QHNA 1FO0H 1MI5B 1U8KB 3SYPA 2MHAA 1YJDL 1G9NC 1UA3A 2ZCLL 3DETD 4KROC 1DVFD 4M8RA 1S8DB 5DHXB 2VAJA 1C5BH 2WO4A 4NIYE 4Y1AD 3BH9A 3DJ9A 3RUGA 1SLUA 2NY0D 4XP9L 4LSPL 5FGCB 4PLJD 5KANI 1YEEH 5B3NA 2CJUH 3UAJA 1PZDA 5GGRA 2XV6B 3KAAA 1BD2A 1K3ZA 4D7PA 3BVVA 3QJZA 4NKIH 3WNOA 2GBAA 4HFWB 4A55A 3PF2A 4BUQA 2HUEA 5CN2A 1Z9LA 5JO5A 4AIXA 2VDKL 2H0PA 4OD3H 2LABA 4NZ8A 3H7BB 4PR5A 3ALXA 5L8JB 4XBEH 5EZIH 5DFAA 2LE9A 2ED7A 2JCCE 3D2UA 3V4UL 4YS4A 3L48A 3Q1SH 1KCUH 3W0WA 4JY4A 1XSIA 4ETYA 5G4NA 1OTSC 3V5HA 4EDXA 1EJOH 1I82A 4I18B 2RGSA 1WA2X 4OCRH 3QW9A 4FTVB 4MD0A 5LBSA 1MAMH 4S1SH 1U58A 1X6LA 4XBPB 4ENZA 2UX7A 3T77B 1UWYA 4M6OL 3VFMA 5AB2A 2IQAA 4BM7A 4IKNA 4PJIF 3UBGA 5IEHA 3TU6A 3BJLA 4LPWA 1KLUB 4LPYA 3GYRA 4WNQA 3D06A 5JW5A 4LXFA 2VUKA 4YHIA 3LEXA 3O3EB 5FIEA 3AG2B 1BVLA 1S7QA 3H0TA 3QJHA 1AHMA 5DTFA 3M1BA 3TCLA 1DE4A 2EDNA 2ZCLH 1SN2A 1FFQA 1KB5B 2WBJC 4OCXL 3C60D 1R3KB 1GGBH 1KXVC 4K2UH 2YD7A 3TYFA 2RTTA 1KCRL 1AOHA 4RMBA 4JO1H 2E4FA 5FW6A 6TAAA 3N0PB 1L0XA 3QEHB 4FKEA 4QTIL 1RZ8B 2P26A 3CHQA 1P7QA 3IJEB 2IDCA 3MX0B 2QPSA 5DLMH 3V10A 3KPOB 3WO4B 4Z7IA 1X5FA 1W8EA 4LHUB 3BQUD 4Q6IC 1P4IH 3WEOA 1W8NA 4L3CA 2YN5A 1AXTL 2X4NA 4QRRB 3HMXL 2P52A 1SEQH 3RWCB 3CVHB 2D0HA 4HIPA 1MLBB 4N1EA 3HPLB 4PREA 5DDHB 3TO2B 5K69A 3N44F 1HVXA 1ZGLM 1AAJA 2CBQA 3DECA 4P5KB 5MI0B 2IQAB 3CC1A 4HV8B 3MU3A 4M7JH 5I1GL 3KYKL 1BVNP 3RPIA 3T4AA 2VIRB 4Q0XH 3DSFL 4QJ5B 2YOAA 4WEMB 1F3DH 2GIYA 1DN2A 3U0TA 4WFED 3V6BR 3RBSA 1HHGB 3KPRA 1AD0B 1XEUA 2ZXEB 3AADB 1JE6A 2VL5B 3QJVB 4FYSA 4K8RC 4PJGE 5BW7C 1XF4B 3CBJB 4HDIA 1ZV2A 4XMZA 4XPHL 1RLWA 2YD6A 3D07A 3ARSA 5GISH 3P9LB 2FCBA 2FIKA 3NIGE 1GZPA 1K4CA 4I3RH 3D30A 2CMRH 5CLXA 5HVHC 1DP0A 6CGTA 1IC7H 5KUMA 4AX3A 2VITB 4J1UB 4ZUUA 2HJFA 1YEGL 1DDHB 3LQAH 3MFFA 4ONFL 2JJTA 4AITA 3EDJA 2CBMA 3P4LA 1BYOA 2NLJB 2DAVA 3B8SA 1UADC 3N1MC 4ZOAA 3RTQD 1AD9B 1ED3A 1JJUA 4H8WH 4MDIB 1M6OB 1VPOH 2VDOH 4OGQC 3GS4A 4DKFH 2LTQB 2V6HA 5B7EA 5CZRA 5C92A 1HHJB 2H9GB 3W5MA 3P4NB 5L0QB 4YHML 5DHDA 4PJGB 3EFFB 1MEXL 3CVHL 1HHIA 4TUKH 4P2RA 4JMNA 3BHBB 3I75B 3VXTA 4AIZA 1DQQB 3FB7A 5JW4R 3KWXA 3L3DA 4XP5H 3P3RA 1S5IH 4KZEL 3KPNB 4ZFGL 5GQBA 4GG6A 4Z0BL 5FYLH 4G5ZL 1TO4A 1BFVL 5D8JL 4TSBH 3EZJB 4JGJA 4KZDH 4Z6AT 4XVUC 5AKTA 3SB3A 3VXMB 4YGVB 2ZKXA 1A14H 3F7YA 4AUJA 4M1GL 4F7CA 3NCMA 1T89C 4Z3JA 1HQ4B 3LRMA 4KXDA 4QHLB 1FO0A 2M1KA 3DJZA 1W72A 3GSWB 4HUNB 3ZTEA 1OSYA 5F7WC 2NNRA 3Q5TA 4H0GA 3QFJD 2KMWA 1F4YL 3ULUE 3L9RB 1XXDC 1SVBA 3FTVA 3OKLB 2YBRB 2ZJSH 3GPEA 4UQDA 5F7AA 3EG9A 1A65A 2X4TA 5ABZA 4PJ5E 4JY6B 4OD1H 1U33A 5C9JB 5KWYC 2O6PA 3PHSA 3WIAA 4LSRL 4P2RD 4Q2ZA 5IT2L 1XGQB 3U2SA 2L04A 1JZ7A 1CQYA 2VM3A 4R7NA 5IUSA 4DP5X 2BWIA 2K4AA 4WFGE 4ZW7A 2F61A 5F44A 1FC1A 2EC8A 1ZV9A 2WZ5A 4GINA 2BOCA 4YBQD 5FGCE 2ICWA 1LILA 3AAZA 3GRWH 3US9A 4ALAL 1F5WA 1FGNL 1ZHNA 3ZRSA 1K5WA 4FTVA 4K3GA 3SE3C 1ND0B 2G5UA 4JM2A 4XPBH 4G59C 1JNLL 1IAOA 4BKLB 3KGSA 5FO7A 2FZ3B 4EKXA 4S0HA 5J8OA 1T20A 1FBIH 1F58H 4WUUA 4XXDA 1QACA 2ZSVB 3V4UH 5JHDD 2OBGA 5F1NB 3OJVC 4CJ0A 1FL6B 2V5RA 2EEBA 4LGSB 4ZX3A 5JXAL 2DDQL 1E9QB 4NWUL 5KS9E 2DH2A 3EBGA 3EHBD 3FTXA 3VXPB 4RGNB 5ECGA 3QCVL 2IO5A 2OYKA 1OP3K 4OZFG 2HG5A 2MCG1 1DE4B 1J86A 4MX7A 2DLEA 1XT5A 5IFJB 5A2LH 3OG4B 3FCSB 3KYMA 2FL5B 5C8JB 5MI0C 4MS8C 1HINH 3AG1B 2YD2A 4PTUA 1KBKA 3CGTA 2WLHA 4N0CD 2MOGA 1HYSD 3ZHDA 3VMNA 3DX4A 3K6SA 4APQD 3ZKXB 4RMQA 4NGHL 4I0PB 3MCKA 2X0WA 3CN4A 3QT2A 1F8TH 3V6FA 4DEUA 2F8XC 2FK9A 1D7BA 2BCKB 1F2QA 1CDCA 1YYLH 2J5LB 3CSYA 2ICEC 1T89A 1NH6A 5CD5D 2HMID 1HILB 1YUHB 5BO1H 1NLBL 2XKNA 2YS4A 4HUXB 2DY2A 4AGNA 4DFIA 1KLFB 4KK8C 5C3LD 5IMMB 3H9YA 3LH9A 4FG6D 3JQOB 2P48B 4FTVE 4GEIA 2FX9H 4PSRA 2XBTA 4J12A 1EAPB 2F54E 1RP9A 1T1XB 1JF6A 1WA1X 3BFQG 3CHXA 1G7IA 4MQ7A 4G9FB 1PL3A 4O02H 1A3QA 3BLPX 3N2JA 3KWWB 3DUUB 5HYQA 4P23A 1RXLA 3GGWA 3UTPD 2X2JA 2RHEA 3RLSA 4MA1B 1BAWA 2NY3C 1FYTA 1SF5A 3B9AA 4WFHE 3PDOA 2W0LA 1WHPA 1YO4A 3AXLA 4FQPA 4F2MA 1D9KD 5L7XL 3HC3L 1A4JA 4U6HA 5TD4A 3S37L 3QQ4B 3TA3D 1IGML 5I1IH 2EYTB 2JKIS 3PYCA 3UTTE 2VZ1A 1XQ4A 2X7LA 5B1JC 5HI4C 3ZRFC 3V6FB 3NRPA 2VE6A 4FF9A 1NGQL 1ZHBB 2HRHA 2R8SH 4P5SA 2PPFA 1R3JA 2XWBB 5F7EH 4MAZA 5F1IB 2DBLL 1YUHA 4QD2E 1ORQA 4D8OA 1T7XA 5INDB 3K80A 2IQ9H 4Z7WF 2FEJA 3IWVA 1CBJA 5I1DA 1WFNA 1RQ5A 3OL2A 2FRGP 3NEOA 4X0KB 3QEUA 1DSFL 5E2UL 4AOFA 4WI9A 2P24B 2VDML 5E94B 1TQBC 4L3EB 3SGJC 3WLWD 3QZMA 3M88A 4UOJA 2UZXA 2FLBT 3KXFD 4KY1L 2ICES 1MFDH 3WU1A 3SPVB 2C7FA 1YY9C 1J5HA 1JGVL 2FECI 2QFRA 4XNUH 4YPGB 3FFDA 3PQYE 4K5OA 2ADJA 2DTSA 2F54A 3FONA 2EABA 4PJAF 1D5BB 5T3ZD 1G87A 1OPOA 4P2QD 3AXLB 4JPKH 2YSSA 2NY1B 1XCTA 2XXCB 3IDGA 3VXUD 3L3KA 2FBJL 4NC2B 5GGVY 3MROB 4HS6B 1P9MA 5AUMB 3OKDA 3BVNA 1MJJA 4K8RL 2YPLB 5T5NG 5E4EC 5CJXA 1JK9B 1UOVA 4XCCL 4HU8A 2CLVA 3HZMA 4AGQA 3ZHNA 4DHLA 1T66C 3MMEB 3H56A 1JHLL 1I1AC 1K8IA 1UJ3A 2OL3H 2BS71 3MBEC 4U1IA 5D4JA 1FV1B 1NEZG 5KVGH 5D6CA 1F3JB 3P1VA 4XZ4A 3OWRA 2A6DB 4HH9B 3SJVD 3K4DA 1T3FA 1TSHA 3W9DB 2P80D 1MG2C 3N44B 2OPCA 4JAMA 1KG0A 2ZG1A 2WZPD 1MXDA 3V4VA 1WAPA 5F8QC 4I0KA 4HC1H 1HC1A 1DCLA 4XN4A 4JE4B 1EUUA 4QAWA 5E9NA 1FFPB 1MJ8H 3QJQB 5ICXA 4A2EA 3MRNB 3N40F 4NAMA 1OE1A 1ET5A 2IXQB 3HMXA 3JBG7 4JZNA 4LVEA 5JTWA 2EE9A 5B3SB 5FW8A 1HYSC 5CNHA 1A3ZA 3I6KA 5DZAA 1DLHB 4HIJA 3IGAA 1BVKA 3QFGA 5D1ZD 5F7MC 2IWFA 2NOYA 4KK6D 5IB1A 3DROB 3QAZB 1GRWA 5M95B 5E2JA 1SHWA 1TJXA 3GJFK 2CAKA 4GEJA 2FUTA 2BINA 3ARRA 4H88H 1F11A 4JL1A 3B3IB 2MJWA 2EVHA 4MMXB 3TEUA 4X5QA 2QGBA 5AW0B 4U1IB 4IU2A 4AEHL 1CS6A 1HEZA 3BAYA 4DW2L 1BQKA 2DQFA 3QNZA 5DVPA 2Y7QA 2K3TA 3Q6FA 1AP2A 1UZ8A 4GY4A 5H4ZA 1N10A 5F96L 1WVZA 5GRZA 1BOYA 1E4XH 3RURA 2WZ6A 4LAQL 2XA8H 1ZXKA 1KXQA 3V4VB 5F7UA 1UCTA 3F6JA 3D9AL 2G5BA 3EO1B 3FT4B 4X4MA 2Y1YA 3S48A 1ZTMA 3HC2A 1KNOB 3P3SA 1E4XL 4U1KB 3G6DL 3BPLC 4XNZB 3ZUNC 2X9WA 4C56E 3LZOA 1Q9WA 5E56A 2MCPL 3N9GL 3S8GB 2WLNA 2BVYA 1MH5B 2YJQA 4G7RB 3ARFB 4NO3B 4PGCB 4DZ8B 5HVFB 5IF0A 2GK0A 2QVMA 1DZ0A 1U8OA 1MCJA 5EDSA 4XAWL 4LCWB 1SBSH 3KGRA 3MYJB 4PJBB 1ETZA 4OFDA 3ATDA 4D0DA 3DJRA 5DLLA 5KVFE 3T2OA 3HN3A 2EDOA 2YFOA 4HHAA 4MMXA 5T1LB 1AGFA 2ZNWA 1EHLL 5B21A 1PPIA 1MCPL 2HYMA 5ALBH 2DZEA 1KIQA 4H2AA 2Q6WA 3CFJA 2EIDA 3O45B 1AHKA 1H3PH 4MJIA 2JB5H 4QRTA 1UM4L 5GZNC 4GRLD 3KDPB 5L4IA 1KJVB 3QDHA 1QO3B 3PWPD 2DQEH 3BP6A 3TPUB 4J4PD 2HKAA 1TT6A 4UWQB 3KPTA 4O2EA 4QR7A 5I1JH 4W9KC 4NP9A 3SDAB 2H6OA 4LLMA 1NFDE 4TLSA 3IGKA 3GMOA 4Y7MA 2WINA 5HVGB 5IBUB 3UMNA 1QFUH 4WCYH 3EYQD 1IVTA 3WNIA 1FHGA 5A40E 1OQXA 4ODXB 5EBMB 3VXMD 4S1RH 4FFZL 3VRIB 3UZEA 3BUBA 2RBLA 3JT0A 1YNKH 1X7SA 4AW7A 2IPKB 1OALA 1CLOL 5DMGD 5AB1A 1I3GL 2JLPA 4OLWH 4X5WA 5DJ0A 3D08A 3K71B 1WBZA 3BZFB 3F12B 3QWRD 3RUGF 1U91A 3ZY7A 2VLKA 3K2UL 1XCTB 4WY7H 3BI9X 2B4CC 3MRGA 4NQXB 3LQZA 4MAUH 2C4FT 1JDDA 1SVCP 1CE1L 3NCCB 4GXUN 4O2CA 4QOKB 5FK9A 3U7WL 2WLJA 4LGRB 4L3FA 2YPLA 2Y2WA 3UTTD 5I19H 3SODB 2ZAGA 2Z0BA 2WWMC 3EDFA 4H25A 2BSBA 3U1PA 4OZIF 3BP6B 3TPUA 3CBRA 4P59L 2X2IA 1QEWB 3VH8G 1L3WA 1VZGA 4JFFD 3ULAB 1Z32X 1QMUA 2PO6C 4OIFA 3QWOB 3VQMA 1BQHA 1JV5B 1E4JA 4FQLH 4O58H 1IIKA 2PW1A 4ZUSB 4LVHC 2HLEB 1BM3H 1HI6A 1T21B 2I85A 4M8QA 4W9IC 5FF6B 2A77L 4FP8L 4N2GA 1SY6H 5HSFA 4HKXB 5AOMA 3LZLA 3EO0B 4QXTB 3FAWA 3FUEA 2IC2A 3Q3GA 1GCFA 4WV1A 5D9SB 3DYMA 2IPKA 3BYYA 3MJ7A 4W9ZA 3MRNA 4RAVA 4QXGH 4KPHH 2DQJL 5GGSA 4K94C 3HJEA 2ZPKH 3RWEB 3QEGH 4H4NA 1KYOK 3EOAB 3O9WA 1WQVT 3V0IA 5C0JA 1NMAH 5DHVH 4JFYA 5C2UB 4IS6B 4S1DD 3BUQA 3HRZA 4KK8D 1OTUC 3HBQA 4NQXA 5JYLA 4FZ8L 2WSPA 2IDTA 5DQDH 2YEZA 3MJWA 3BZEB 4PRNB 1FPTH 5DHMC 4WNQB 5EOTA 4HWBL 4G7SB 3HS9A 1SEBB 4D7BA 1RPUA 2QTEA 2GBUA 3ET9F 4Y5VA 4X8GA 1M9WA 2JI2A 2KT6A 2WNWA 1LO4L 2JJSC 3LHAA 3LKNA 2IDQA 1HQ4A 1S4IA 2K3HA 5I6NA 2H32A 1NMCB 4Y16D 1MXGA 3TF4A 1N5YH 4Y4FA 1L9TA 4K15A 1RZKL 4PB0L 5I73B 2PW1B 4K71B 1EHLH 2B0SL 4L3EE 5EIQA 2UWEE 3L3JB 2YLHA 2CDEA 2LW3A 3J8F7 5DGRA 1QZNA 4KNTA 4YX2L 5EOCJ 1M2VA 1BJ1H 3CX5K 4A7GF 1W0VB 2BRRH 2Q3AA 4OGAC 2GVYA 1NFDA 2ITEA 1HL8A 2WVSA 4LBAA 3STLA 2V5SA 3UYPB 4DGYL 3CDGB 1FFOB 2AGJH 4GKNA 1KTLB 1ADQL 2APTA 3T8XB 4FMKA 4MAYB 2VZOA 1JK8B 3GI9L 4HD9A 4AVHA 1F4AA 4J8RA 4JM4L 1DQLL 2GK0B 2G9HB 2ZYHA 3X13A 4OLVL 4QNPE 5TQ2L 1XF1A 3ECVA 3FULA 4KRPB 5D7LA 2Z92B 1H19A 3V2AR 2QVIA 2VN3A 1AD0A 4D0DB 4XOAA 3D4YA 1KSRA 4HJGB 1FH5L 1U8KA 3WCYA 3D34A 5D1ZI 1P5UC 5A16A 4E5XG 4KHTL 5JHLA 3OKYA 3Q05A 2P44B 3LKOB 3P30L 2MWCA 2Q6WB 1L9NA 3BGMA 4EVNA 4B9IA 3QORD 1J1OL 3QVAA 3CPLB 3UPCA 4Y4FB 5CEZE 3HE7B 4O9HH 1EFXB 3W9EB 5HGDA 4C56A 3I50H 5INCA 1QR4A 4RMTA 3DV4A 1E9QA 3QIWA 4N25A 3G5XB 1KXHA 4JQVC 5AOZA 5LAPA 5J9PB 1N7MH 4OLYL 5EBLB 1N26A 3ZQ9A 1F6AB 4LCWE 4HWNA 2GUYA 4NM4H 4L8SC 4TUUA 4NHCH 5B22A 1FFOA 3O6FB 1Q0EA 2YXFA 4GKNB 4EN3D 5D7SL 1MCQA 3ZDXB 4HD5A 5GS0D 4E0RA 4IBUA 2W65B 3GSVB 3KR3L 2WYTA 3RWIA 4HQQL 5SX5K 3SDDD 3DV6A 4R83A 1A21A 1G9NH 2K9FB 3K6OA 3LS5L 4EN2A 5JXAH 2DM3A 5IMOB 1J0JA 4ZS6D 1AQKL 3U0PB 4P23C 2D31B 3U1SL 3FO2B 4Q9RH 3UO1L 3MA7A 1HXMB 2NY4D 4GIPD 5D7LB 5ETUA 2IPTL 2KKQA 5DA4A 4FFZH 2PETA 4HC1A 2D3NA 4HJGA 5HHMB 5SX4H 2AJ3A 1BZ8A 1E67A 5LGHH 4D9QE 2VLKB 1O7DE 1EXGA 3RIAK 4ZMAT 5IQ9A 2OX5B 4S11A 1T1WB 3RL1A 5DQ9A 1G0YR 1JGUH 3SBQA 3CFEA 5FECA 4GQ9L 2NUTB 3QCVH 3QRBA 5B7MA 3QXAB 3JVGC 5FXCH 4AJWA 3QA3B 4PGEB 1J9QA 1N0XH 4PW4A 1Q9OB 3ZDXE 3A3YB 1P4BL 3A24A 1AYOA 1M6UA 3OTTA 4UTAA 5KSAD 4IMLB 5LO7A 2BH0A 4KKAD 5C07A 4HJ0C 1CR9H 2VN5A 4MYPA 2R7EA 5HYQB 1AANA 1FYHB 3RI5K 1EAOA 3TYFB 1IGIH 1L0YA 3PDOB 3S2AA 1ZK5A 2VXVL 5E4OA 1TYRA 2DYPB 5H37H 3AREA 3LZPA 1UHVA 2BFGA 1OM3H 2EYSA 2B4CH 5I74B 4DQOH 3HNVH 5T3ZE 1ACYH 4FG2A 1SDAB 4XCNB 3LNEA 2WHVA 4JFEE 2BSEA 4RX4D 3B6SB 4X7FC 1HSAA 1WCBA 1GSMA 4PWHA 3ULVE 3RDTA 4RH4A 2HFGL 3MGOA 3H9SB 3KXFE 1UYWL 3R0MA 3L4CA 4OZIE 2ZUVA 4IIZA 5F3HB 1OM9A 2KLSA 2VXQL 1T1WA 5DMIL 4YZWA 2MKLC 1AHWC 2QV2A 3JWNG 2XQBL 1FI8C 4X4KA 5IHUL 4WHDA 2NY5C 1OT4A 4XBMA 5KOMC 3LIZA 2BZ7A 4ZBJA 4JRYE 5E08L 2BY2A 2DWDA 1XF4A 1CF8L 3OF6A 2QADC 3SQRA 3SE8H 4S0TD 4FKKA 3Q6GH 1MFBL 3BX7C 3DTXA 1LEGB 2IH8A 3QZWG 3WKPA 1JRHH 4CSPA 1GZPB 1MCKA 4MJ5A 3B56A 3EZ8A 2NXYC 4K3JL 4IEFB 3LVTA 3U9PL 4YJZL 2VITA 1M2OA 4Z5RB 4L23A 3Q5YA 3ERXA 4C8XA 2LU4A 4XO9A 5K9OA 1EXHA 3LTVA 3G08B 4HAKA 2WQSA 1YYML 1QG3A 3MROA 4HS6A 3WIFA 4K94L 1JGIA 3ZVVA 4YBQC 5DFVD 3QIBC 4ZAKD 3EJJX 1Y1UA 5CMAB 5C08E 1QQDA 5BZWA 4L2YA 1ONQA 3RGVB 3S4SA 2F7PA 1C12A 1LEKA 3VB9A 2JQAA 4ZMOA 4IRZL 4PV8A 1KCWA 1JK8A 1QUNB 3QJTB 1X4XA 4FQHA 1N5YL 3EF7A 1VEPA 3PV6B 4YFLF 5C2BH 2FX9L 2WQAA 4TLTA 5I82A 2NY1D 4IRZH 1EEZB 3CAFA 4OI8A 3LEYL 4ABUA 1XZ0B 4M3JA 5IMMA 1FFRA 4MA7H 1CU4H 1RJZA 3SDYL 2JIXD 3TLRA 4DKAA 5MHSE 3A21A 5EULV 1RK0B 3JXAA 3HRPA 3BKJH 4UM8B 2I25N 1A6VL 4RWYH 4HIHB 2H0JA 2WTPA 5DQDL 1GZQA 2W59A 4GB9A 4LASL 4P2CG 1N4XH 1V7ML 3G7TA 2FQFA 4GMTH 3QDMB 2WNXA 1M9SA 5GZOD 1ANUA 5DJ2B 2QHRL 4XP4L 4EZMA 5JIIA 4P3DA 2VMDA 3ZJAA 5EUOB 1G4RA 4XPHH 4U3HA 1UWEH 2V2XA 3LNFA 1LD9B 3K4AA 3QUMH 4N2DA 3HTLX 5E00A 1CT8B 4TULL 5C7XL 1FYTD 3B9VA 3H4FA 2NY4C 5EMYA 1DQVA 2I7OA 5CD3B 2OTWA 3GIZL 4WU5A 1C12B 2XTSA 2W95A 3TPKA 1MKFA 3K74B 4PP1D 5CS7A 4OB5H 4DOHB 1PNCA 3T04D 4NUMA 1GYCA 4QIRA 1S3KH 3L9YA 3TBCA 3RJDA 4XBEL 3AITA 3P9MB 2BDNL 4I4WA 1E28B 1VFUA 5JPMA 1QPXA 2XVKA 3X3GL 5K9QI 5ETUB 4LMQI 3L4YA 3FT9A 1UXWB 2YAPA 1TEFA 2AV1B 4XO8A 1NBYA 4KVCH 4YH6A 4FXGA 3DXAE 4NQED 5IBTH 1KCRH 2HLFD 3TBSA 5J6HB 3HZYB 4G6KL 2E75C 3EFDH 3O3AA 4BFJA 1KYAA 5T1DH 1OGPA 4RDQG 4RFOL 4U1KA 1OT1A 4Z7QE 1CCZA 1XZWA 3D0VA 2F08A 1ZWIA 2WUBH 4FXTA 2V2XB 4XZUA 1VENA 1L9PA 4GUPB 5BRPA 2HWZH 1ZLVH 2NUPB 2F5AL 3SOTA 5CEXB 4RIRA 4UT9H 4BCXA 1YNTB 2XBDA 3OHXB 4NQDA 4YL9A 3K1KC 3HHRB 4XPAL 5A6MA 3H4HA 1BFOA 2XFXB 1UZ6E 4Q8BA 3WFCH 1U3YA 3PCYA 3WFDH 1W0WB 3QJFB 2VUYA 2P47B 1E3ZA 5EBGA 4U6XA 5FEBA 3QZOA 1A7BA 4Z18A 3V52H 3QG7H 2PWFA 1H3UA 4CVXA 4ODWA 2DKUA 4J3SA 1DVFC 4XCYB 3W9DA 2R1YA 1RJYA 4G80B 4ATWA 4Q9BA 2F68X 4R4BA 3PHOA 4BGLA 3AUVA 4M8UA 2CA4A 5IB5B 1QHOA 3LS5H 4NQUA 2WN2A 3HNSL 5I1KH 1O6SA 2O6EA 1WZ1L 3N1GC 2J88H 4M1DH 2MQCA 5AVYB 2OAAA 1XGZA 2XZAL 3MTXA 1NFDF 4ABWA 1LQBC 1OCCB 4JANA 5F9AC 1EHAA 5H2BA 3FPYA 4POUB 1YY9D 4ERSH 1W8OA 3RYMA 3MXWL 1DLHA 1XSOA 4G9FA 2VH5H 1H8NA 4AMXA 2JKJA 3RL2B 1G1CA 1VFMA 2E46A 4IRJD 3SBWC 4HG4K 2E7CA 2WWKO 2DQCL 4Z9KB 3VACA 5JHBA 2V2WB 2HFEA 1SJEB 4MZ2A 2QFPA 1NFKA 3P30H 4ZXBC 4NYLB 4WHCA 3ZE2F 3SN6N 1LK3H 3S37X 3BLKA 5JPMC 2AITA 3HBZA 5IOPB 2YD0A 4V11A 4W4OC 3GSRA 3VWJA 4N2HA 4WV1C 5HJGA 4PWGA 3C5ZA 2Z31D 2ZKHL 3RVXD 2W88A 2W9EL 1NWPA 2IH1A 1WH0A 1AMYA 4EE2A 3ECUA 2G3ZA 3MXWH 3N41B 3PGCA 4L05A 2YAOA 2PXYC 3VTTA 4DVRL 2AJXH 5DO2D 4LSUH 1KTRL 2DN7A 5CSBA 2AMUA 1I85A 3TCLB 1RUQH 5C0AB 1AC0A 2FNBA 2P5ED 2Z0UA 5EN2A 1D6EA 4QO1A 2FD6H 4M7LH 4OLZL 3ZR6A 1JFHA 4AJVA 4EXKA 1OTSD 2JJSA 3CFKA 5FB8B 2XX0A 3QORB 1Q0YL 4GAGH 3O11B 3EADA 2GITB 5IBUG 4L3EA 2GSIB 3TN0C 2OCJA 5CSZA 5EC1A 2XDHA 1FGNH 3J2PA 4OF3A 4OVUA 1IJNA 1FIGL 1U3ZA 4KJPD 2DJMA 2H5UA 4L3CB 3CFDB 2VJXA 5FDWB 1OEZW 1UWGL 2F54B 2DMGA 4P3CH 3F85A 1FDLH 4TUJB 4X80H 2DPKA 4HX1B 3W11C 3O9WB 1LNUA 4MNGB 3QUXC 2FBOJ 5E8PA 3HRZB 3EDEA 3GEWB 1X5ZA 3MA9L 3UGEA 7FABH 2CDGA 3E6FA 5AAMC 3BPOC 3RUGB 4YXKH 5GGRB 4JPWH 2B1OA 3RWGB 3FQ1A 3RPKA 3QUMB 3TP4A 3NZ8B 3PNRB 2KDYA 5BCAA 1TENA 1QP1A 4WI0B 2DJUA 4FQ1H 1NGXA 1JHLH 1YEIL 2R83A 4JO2H 3TEXA 4M6OH 1A14L 2CM5A 5CXPA 4CU6A 1XGYH 2W07A 4OJFL 1P5UA 2AEOA 4HHGA 4MAUL 4JFHE 4U1NA 5JZ7C 1NBYB 4JG5A 3RIAF 1KJ2L 4F7PB 2Q76B 5DD3L 5E7BA 4I2XE 4LDCA 5TPWL 1INDH 1CK0H 3V5HB 1QR1A 2F58L 3F2LA 4PRPD 3JV6A 3L3HA 4N3UA 2VB5A 4IIQC 4TUKL 2IOMA 3FUKA 1EXUA 4I85A 2R39A 4X9IA 2XVGA 2YN3A 3TWCL 4ZRGA 2D7PA 5CEZL 1X9UA 1YHPA 3MAWA 4XWGL 4CAGA 5CJ5A 5TDPB 3GMRB 1G9EA 5DUBB 5A2IH 3MNZA 1U8IA 4LL4A 4XC3H 4HIJB 5JHDE 2I9LA 1HDMB 2F6AA 2YQGA 3WGVB 2WQVA 3E6FB 3DROA 1OSPL 3SDAD 3LIZH 2XN9B 1DO6A 1YNTA 3BUYB 4M62L 4NO2B 3FK3A 3I9GH 3BVUA 1I85C 4HA1A 4PWKA 4AW4A 1BXAA 1HESA 5E0QA 2ZOLB 1J9CT 3H0TB 3QJFA 3NGBC 1T1YB 3ZPDA 3K8KA 2WIIB 2GJ6E 1J8HD 4IU2B 3X12A 2J2ZA 4P3WA 2Y7NA 4H1LA 2IDFA 4RGOH 3ZBMA 1NWOA 1PZAA 2VERA 2Q5BA 1TZHA 5LQBH 1S78C 4PRPA 3T6XA 1DHKA 5DS1A 3WN5C 3IDIB 3QXWA 1BCIA 2XNAB 2H3KA 3VO0A 4XVTL 4F91B 4PJ7A 2XY2A 4HKXA 3QG6A 4I77L 5T33L 3S34H 3WHXB 3TVMA 1ZLUK 2BIIA 1QR1B 4MQXC 2XSKA 3L7FB 1OD7A 2Y7OA 5BPPA 3HI1A 4M7JL 4XNXL 4R2GD 4I7ZC 3WD5L 3WXVL 2E0PA 4BSWB 1HN1A 1XCWA 2EVFA 1UOKA 5F0MB 4AMKH 3N43F 4PD4J 2WM0A 5HJ3A 3ZE1F 5GGVL 4IRZA 1J87A 3LPWA 1MQ8A 1BFVH 2C3VB 3N9GH 5D8JH 4O02L 3U0WH 2V3EA 5FUOL 1Q38A 3K5SA 1WUZA 4KHTH 1AY1H 3EYVA 1CLZH 2FX8H 5GZNA 5IROA 5I5MA 2ZX6A 3S5YA 4HCRH 3QI9B 2H6UA 3GM8A 1PZCA 2UWEB 4JGUA 4KFZC 5IOPA 2BVOA 2OW7A 4K0OA 3EUUA 4PPTA 2EDXA 2J2ZB 3BDXA 3FO1A 1WWAX 3VGAB 1ZOXA 4QHUA 5T3XD 2NX5E 1A4CA 1ZTXH 4PRPB 5LXGL 1SBSL 1SYVB 3PRZA 5IJVA 4JRFA 2FGZA 4KX8A 3O6KL 2TRYA 1SF3A 4ORGB 3RDTC 1GTNA 4TOYL 3VXNB 4E9RA 4P2AA 1J1OH 3DGCR 4ZJ9A 1G0XA 3I9AA 1A4AA 1GZHC 1WHOA 1W16A 4NT6B 3UZEC 3FBQA 3APFA 3EHBC 3PWPB 2WXKA 3QPQC 1BPVA 4JQIL 1ZVYA 3MLSH 5C0ND 4UOW0 5C8JA 5TTRA 2NY0B 3PWUB 3HB3B 3RWDB 3BAEH 4FCHA 1RZFH 4MMZC 3QXDB 1XSJA 1OGTA 2WYHA 3FQWA 1MWAL 1QAWA 5IQOA 5MHSD 2XA8L 4MBRA 5CSZB 5T1LD 1U3JA 3LYRA 3NTCL 3TZVB 2J88L 3ZHFA 2DS4A 1LO4H 1AQMA 3Q7JA 4NQSA 4NFDA 1LE5A 3TCTA 3JWDH 2BHZA 2BMKB 5GS0H 2W0KA 3F7QA 1BG1A 3D4CA 1IGIL 1PBYA 2K7PA 3WUWB 3MC0A 4EZJA 2XWXA 2L7UA 3QIBA 2I27N 4H88L 5EOQL 4W1TA 3S5LG 2XHNA 4HMCA 2YGNA 3CPLA 4B9ZA 2K6YA 3UJIH 3IMVA 4RFNC 4UILH 3VD0A 3CSFA 2EEAA 2G60L 1MCHA 2GI0A 4D0BA 4W4NA 1J5OH 1NINA 2ENSA 5AENA 4WWID 5E03A 5EBLA 3P54A 5AYUH 4QF1A 3ZDZB 5D72H 1YPZF 5DD0H 4YSAA 3T65B 2NMSA 1FYTB 4NBZB 1R3HA 2XQBH 3C8KB 3Q2CA 4LL9A 4NZFA 1W2KT 5C09E 4M8QB 1MZYA 4KOCA 3O9WC 1B3IA 2IPTH 4BFBD 4ELKA 3FU7A 4BHUA 1XSKA 4GRWE 2NY5L 4C47A 2JKLA 2V9TA 3QPKA 1YEHL 5IBTL 3K8MA 5AVSB 4O00A 4UOQA 3FRPB 3JV6B 4Z1PA 2C5DC 2X4SB 1VKXB 2YRPA 4PS8A 5E1GA 2GYSA 3HPLA 2B4CL 4JRYA 4PREB 1HH9A 3TO2A 4AEEA 4B95C 2VT0A 2GAZB 3OAZH 4P2OD 3CZUB 2F0CA 1A6WH 4P9HH 3G04A 1EEZA 3FF7A 3NH7L 4IMKC 5IFAH 4GKZB 1GOFA 1M1XA 1NIEA 1VAHA 1SY6L 2CBTA 5B38G 1RIVH 4PJ9C 2XN9A 4BQ9A 3FMGH 4NENA 2C3HA 1I53A 3ZZSA 1D5XB 3VD1A 4KRLB 2CPCA 2DQUL 1CR9L 2GC7C 4XNQA 1YPZE 43C9A 4OLWL 4FQXD 4GKLA 4GOSA 1MFEH 3DRTB 1ZLUH 1E2VA 4EN3A 1T1YA 2AVGA 4LLQB 4ZAKB 2HFFB 2AK1L 2FIKB 4FXGC 4GRWB 4J3OC 4EPSA 4N9OB 2R8SL 2AJXL 4BE6A 4K7FB 1EEQA 3RGVC 3K72A 1IJ9A 4ONHB 4L1TA 1KB9K 3EYSH 3JUYA 3UDWC 3MFFB 2W9EH 5ID1A 1ZV5A 2IDUA 4AKOA 1RU9H 5E00B 1IBZA 3NDYE 2CHNA 4XX1E 2DF3A 2RH0A 4PJ7B 3BEWA 3VXQB 1I1FB 1DBBH 2DYSB 5IW1A 1AFVL 5E99H 4AGPA 4G8IA 3BGFB 3S36H 4XCNA 4XRCA 2N56A 3CDGA 1T0NB 1ZT4B 4ONGL 4PLKD 2RACA 1HHJA 1KY7A 3M8OL 3RWFB 2WXPA 1KDIA 3MTRA 1Q72H 1NAKL 2DW5A 4MNGE 3HLAA 3SY6A 3S3JA 3ZGHA 2J8UA 5IBLD 5HYJA 2NNFA 4XVJL 3DO4A 1YEFH 4I2XB 4M5ZH 1MFNA 3MLVH 4I4WB 4P2QB 4PP2A 3T0EC 3HC0B 4U1GB 4NQCE 5I66A 5KVFL 1QLEH 3DUSA 1XF2A 1IKNC 3ZQXA 3QUZB 1DVFA 1I7RA 4XNQB 3UERA 3VFPB 1FNHA 1LGVA 2KLRA 1JYNA 2OMTA 1TJIH 4RQQA 4XTRD 1IC5H 2KZKA 1EEUA 1UWXH 2IXQA 2JTYA 3FFOA 5BZXA 3SQBA 1Y6KR 4AXWA 4DQAA 4LVHB 5ESQB 1NAKH 4AQ8C 5TK2A 1JF5A 5HHVH 4MJ2A 1A6ZB 5E4IA 1F3DJ 1J8HA 2ZUXA 3RZWA 5DRXB 1EPFA 1JHTA 2RR3A 5KVEL 3L9EA 4X8CA 3WTYA 5EO1A 2XWJA 3ZZLA 2F53E 2X4RB 3SKMA 3O3DA 4XHJC 4JN1L 5ISZD 1JN6A 2NX5D 1J1PL 2WOYA 2NZ1A 2EDHA 1BFSA 5IWLA 4FGMA 3MRBB 1EZVY 4BCYA 3TEZA 1UA7A 1JV2B 2IMMA 3QEQA 3U2SB 4WO4B 1FZJA 1IEAA 1NPNA 3JSSA 4KPHL 4AVIA 4BFFA 2OR9L 4DZBB 3UACA 2ICWJ 5BOJA 4K4KA 5HJDA 1G9MH 4Z7UE 3GI9H 3RIFF 4NQQA 3JTTA 5D1XD 3MA7B 2BSTA 3AWEA 1RJZB 5C7ZA 3SHSA 3VTAA 4MFHA 1CZ8H 1NAMH 1AE6H 3GIVB 4JHBA 5ISZB 1P7HL 1I75A 5T5FH 2ARJA 1IEHA 1J0KA 3I9PA 4F15B 2Y07L 2AJ3B 2VXQA 3VWJC 4DQOL 5C0RH 2QPFA 4WTWA 4IRJC 1LE9B 1DUZA 2EYRB 3TZVD 4YSEA 1SLWA 5EO0A 4A37A 1R5IB 1MVYA 2ALWA 2PYEB 5IKCA 1U3HB 2UV3A 4H40A 1NCHA 4KNUA 1KJMA 1EDYA 3KHOA 3TA3A 5IMLB 1TU2A 4D0CA 1E4XI 1ID5I 4UQ3B 3W81A 3GSOA 3AGVA 2XZCL 3QHFL 3H9SD 3RVTD 2DICA 2CUMA 3SGDI 2WBKA 2F19H 4F5CA 3TN0A 5KBDA 4TNFA 2ZG2A 1S9YB 3QYCA 3O4OB 1RUPL 4G72B 1MVUB 5AW5B 3VFNB 4GQ9H 2YK1H 4N22A 1BFTA 1CG9B 3U9WA 5C0CA 2P80A 3NIDF 4I1NB 3GSRB 2QBWA 1A9EA 4GT0A 4WI7A 3OAYK 4HJJL 1FDLL 1TJMA 3KPLA 3DX8B 4UMSA 2H41A 5IHZB 1AHWA 2CHWA 5EG6C 1KXTA 1YDPA 4C55A 3A4AA 4N8VA 2PYEE 1UATA 3KPPB 4RCAA 4MLSA 3R06B 1X6NA 1SMOA 1A22B 3U1SH 1QFUL 5HHVL 3WEXA 1FFPA 1I7ZA 1ZA3B 3MZGB 4FJ6A 1V3LA 3N6YA 2W1NA 4YXKL 5LG1A 3F8UB 3UAFA 5DHVB 4JCWA 4JKNA 1G9NL 5HHQA 4V1DD 2DQGL 3BN3B 4R84A 3IFNL 1JDCA 1UG9A 1CGSH 1NOLA 2HPOA 2A1WH 3CFKB 3CZSA 5D2LE 3ABMB 4LSVH 2MTPA 2WZ0A 2ATPB 4GXVL 1KC5H 1OOWA 2GSIA 1FVEB 2C9PA 4JRXD 1MCDA 1PG7W 2NUPA 1VFBA 5D7JB 3PHAA 1F1GA 3D2UB 5EPMB 2PTUA 4DVRH 2JB5L 5K39B 3DRTA 2H47C 1GOGA 3Q01A 2PO6A 4JY4B 2ITDB 1KZQA 4G7QB 4ELMB 4RISL 4KTGA 3GKWL 4YDJA 4QRAA 3ECQA 4YHPA 5D96B 1AZNA 2XLLA 4KY1H 5GXBB 1T0OA 2X1WL 3WS6A 2J5LC 1PCXA 3QQ3A 1NFAA 4CMHB 4J4PC 5EOCH 5JIQA 4HOWA 4HALA 3WIFB 2DQFB 5SWQB 3MRJA 4Q97A 3FO9B 4O5LL 4M29A 4O02B 5MEOA 3G6JF 3PXLA 1S9VB 5ITFA 1FYTE 1T0MB 4P2RE 2Y5TA 4BSJA 1JZGA 1DBJH 4Z8FH 4M48H 4XVSH 4GRWH 1LO5A 3HUJB 1I8KA 2FSDA 3MRMB 3KPPA 3EGDA 1N5AB 3JWNC 4Q4EA 4KRPC 2WO3B 1ZT7B 5CCGE 4ZS7H 3IYLW 1DQJA 4NRYB 1EJFA 3N3EA 5KZCB 4M9OA 3JZYA 5KYXB 3UBXG 5I0YA 4XX1G 1IAIL 3RJOA 3BSZA 5D1XC 3UADA 2Z1KA 1E9OA 3QQDA 3LV3B 3US0A 3LRGA 3KYKH 4CDGC 3BWSA 3FN3A 4PYGA 4AENA 2ITFA 3KPOA 2ZCHL 4AYFB 2N01B 3VCLB 2I26N 1AXIB 3AU1A 3CE1A 4PRBB 2ITDA 4IRSC 2DLIA 5DC9B 2VLLB 1YY8A 4FG0A 3NA4A 1TIUA 4RAVB 3U79A 3X3FL 4AEHH 4DP8X 3SQBB 3HE6D 4YHPB 2IDSA 3CUPA 4JRWA 5KYWB 5AL8A 2MHAB 1U93B 4N3TA 1H3PL 2OA9A 4TS6A 2YSSB 3IDGB 3FN9A 1JHTB 1KIUB 1J0HA 1HSBB 3ZE0E 2I9LB 4PV9B 1V8HA 2WAHA 4O02A 4AM0Q 5G4OA 2YD1A 4KXZI 2CK0H 3DVNB 4PJIA 1HHGA 4JDTL 4HIQA 5E1QA 4WU5B 2CLVB 2VAAB 1FL3B 2JNZA 4OLXL 3H6AA 1OSZB 3AGWA 1NBVL 1SGKA 4FYQA 5AAWC 5BRZB 1CBVH 5FYKU 2CRIA 4QO1B 2QKSA 1KIRB 3W1ZA 2VC2H 3FTYA 1T2QL 3DI3B 3NIDE 4A7TA 4WFFE 1T3FB 4HUVA 4WUUE 1QASA 1P4IL 1E9OB 1JZFA 1WUNT 3GNML 3V4VL 1FZKB 1U9KA 3J27A 4G71B 2FYYA 3C08H 4Y4HA 2Z1PA 3RQ3A 4CVWA 2YRBA 2ODHA 1NFDB 3STLB 4LDOB 2L7QA 4W6YB 15C8L 3VW3H 2YIHA 5GS3A 3NYKA 1U8JB 2GTZA 4R96B 2VXQH 1JWMA 4A2DA 3RFZB 2KZ1B 2HJLB 3HHSA 3KVQA 1G6RL 3W2DH 5HYSA 2WGNB 4N0FA 2WLLA 4PG9A 2WP3O 4XCCH 2F58H 2C1PA 1XEDA 4MMZA 4H44C 5JW4M 4UIKL 3TFKC 1J5CA 3CK0L 3KR3H 4R5TA 2O26U 3EKCA 1MN4A 1M7IB 4XCFL 1AKPA 5T1DL 4WWKA 4U7KA 4X9GA 1F0LA 3L5IA 2NDFA 4N24A 4Z7UF 1NUGA 4EJ1C 3LB6C 4NO0A 4U1SB 2L7JA 3F65A 1PLBA 3EO9L 2W5PA 1BWMA 4JFPA 1T83C 2GPZA 2MSPA 5FGRA 1INEL 1EFXA 2XG5A 3MV9A 5D7JC 1KXTB 1YDPB 1K85A 5HXMA 1IFRA 4WHTA 1C5BL 3IDUA 3N0AA 3RKDD 1HJCA 4XWOD 4N9GA 5K93A 2O5NA 1G9ML 1XF5A 3B2DC 3AWFA 4LVOB 2Y2YA 1THAA 1ZD6A 5D9SA 2ICWI 3ASOB 3QSKB 4X6EB 4FFVC 1LVEA 3DDGA 1U8JA 2GTZB 4UOZA 5E1HB 1F00I 4O4YH 5GJSL 4N5UA 5AD0A 4Q2ZB 3ZTNH 3LEYH 5H2BB 2R4SL 5AYUL 1QYGL 1RFDL 1QTYT 3MNZB 3DA0A 2WJ5A 3V4VH 4MZ3A 6FABH 1VFBB 3DUHA 2J8HA 3NP4A 4HEPG 1FVCA 1JPFA 2Y3NA 2YXVA 3BUDA 1HJBC 3WDHA 2LTQC 5L9DL 1HHHA 3EJZD 3O81A 1M7IA 3HZVA 2J6EH 3IJ7A 3TO4B 2BP0B 1RJCA 3WUWA 2ESVA 1AGFB 4XH2A 1KBBA 3JTSB 1CGXA 3FZUC 2IBZY 2PCFB 4OD1L 3VTMA 3SYOA 2EDWA 5AVUB 3HKFA 3KDMA 2BS9A 3CFJB 3O45A 1VF5C 4X6DB 1AS7A 2Y5TB 2WIMA 3IM1A 5T33H 1FL6A 1U21A 3BZDA 4ANKA 3MNWB 1BPLB 4JZOB 3C2AL 2K8MA 3BSGA 4GQRA 1YNLL 4ZUWA 5FX3A 2EXWD 1NM4A 1KWKA 4OD2A 4QXVA 1B0GA 4B50A 1NGYA 2UXGA 4IOFC 4QF1B 3K91A 2R7EB 5ANMA 3VX0A 3PL6C 3WFEH 4BXSV 4DKTA 3SGDH 4TSBL 5I5RA 1X5AA 4OFPA 3BH4A 1KJ2A 1UYWH 3LV3A 3LMJH 3HCVA 3KNBB 1QSFA 1TETH 2WXJA 3G6DH 4OJDH 3SCMB 3BKCL 4NQVB 3IPBA 2FJHA 2X1QA 1QWNA 4WJG3 2AJZA 2OMVA 1G1KA 4OIBA 3WEAA 5T5FA 3CXDL 1B6DA 1IGJA 4BJLA 4RFNB 4KI5C 1MCWM 4AIOA 3H8NA 3FU9A 3K71A 3T9WA 4QRQA 1PZBA 4BIKA 1PJ9A 4XXWC 5ID0B 3T77A 1CGUA 3MGOB 4HZ1A 3VXUA 2QVKA 1KIUA 4GXVH 5T5NF 3D69A 2BHUA 5DMKA 3SOBL 1Z0MA 3P2DA 4YDLC 3B5GA 5D7IB 2CR6A 2OSYA 3H2QA 4ZTOH 5HHNA 4BFKA 1KELH 3ISYA 1YAZA 1MRFH 4B0MM 3MN8A 3Q5OA 3ZIMA 3K6NA 4H25B 1FL5A 3GSNH 4L5FH 4ZOEA 5KSAA 4JFOA 5B1KA 1HT6A 3WXWL 1G1OA 1PY9A 1PCSA 4LLQA 2WO2B 2QZ5A 3F7KA 2LU7A 5IB4B 1ADWA 3HHMA 3F62A 1HNFA 1XD1A 3GGWB 4B3VA 3RVWD 3JT2A 4XPGL 1E3XA 3EOBA 1E5CA 4R3SB 1QI5A 2MKWA 4Z5RA 1RV6X 4Z78B 2JV6A 1I4FB 4JJ5B 3RA7H 3WTUA 3KL3A 5C09D 1A6UL 4Q74A 4XPAH 1AI1L 3DGGA 1SN0A 3ZE0B 2VO8A 4NQVA 3TZVA 5IW1B 4NNYB 4DN3L 3AMLA 5CMAA 4TSAH 2OMVB 3VQ1C 4YSQA 4G82A 2BOCB 2VMFA 1K8DB 2FJGA 1GMEA 3L3OC 3C5JB 3RWCA 1BJ8A 1R3JB 2XWBA 3QJXA 1A7PL 4R6UA 4WW2A 2P42B 2HJLA 3CFMA 3FRPG 4FX5A 4PJCA 4WW1B 5DUBA 5IWLC 2ENYA 3EYOA 4M03A 5I18L 1KTBA 2CO6B 3P4OB 2ZXDA 3F7VB 4ZO7A 3TF7C 4YEEA 1L4IA 1PLAA 1J8SA 2DEWX 2Q0ZX 3TASA 5D7LE 3IJHA 1FUNA 3DMMA 2PCXA 3HZKA 3MRRA 1QYGH 4PRNA 1ZLSL 1XF2B 4LVOC 4NM4L 1O9VA 1GPOH 2YA0A 4HUUB 1M71A 5HHME 1ZSHA 2C1OB 3BLBA 1TJHL 2FNWA 4KQ4H 3GXDA 4A2FA 2CO4A 3RUGE 4BRJA 4F8PA 4G8EB 3NZSA 4RQQB 4V2CB 5DFVC 1UVQA 2FBJH 5IFJA 3ZT7A 1Z2KA 2A0LD 4HIIA 1EVUA 3MLWL 3CIQA 1GJWA 1RIHH 2OMBA 1ETJA 3LKPB 4ZUUB 3B4NA 3SJVB 3EDKA 1D9KB 3IDIA 4DSYA 1RD6A 4HCIA 1BZOA 2BVTA 4P5TA 1VACA 4QRPB 5DD1H 1RI8A 1KLGB 4PBVC 1B88A 1WSST 4IK7A 2VR5A 4XPTH 3S6CA 4JRLA 4AI7A 1UC6A 3WKYA 3E9TA 1XGYL 3II3A 4P4KB 4ZD3L 4NKIL 3HBPA 3TA3C 3P0VL 1E0OB 3UAEA 2JH2A 4X50A 5IROC 3MCYA 1N7ML 4NQTA 1RY7B 4I89A 4R4NC 1SXZA 4G7VL 1JV2A 1G7HA 3CH8A 1XBDA 1YEEL 4CL7A 4WWPA 1MCIA 2G9HA 4FRWA 4EEEA 5F3HA 4WSJA 4HS3B 3V0WL 3UJJL 3L6FA 2J1WA 1N12A 1P9MC 2VUOA 3FU6A 4KO6A 1C5CH 3TCXA 3UROR 4ANUA 4G7YL 2Z92A 3LMJL 4JFEB 5IB3B 2ZUUA 2ZG3A 4X6CE 1XGUA