5D7JA

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNFQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jA02
1JNJA 1YUHB 4GG6A 4GG6F 4XCFH 5TPWL 4YBLC 3VJ6A 5BOPA 3X12A 4OKVB 4QHKI 3GM0A 3SOBH 1QO3B 4KROC 3RGVB 1HWHB 1C5DA 1UZ8B 4QYOA 3HNSH 2YUWA 4GAGL 1ZHNB 1KTRL 1BMGA 1JGLL 2EIBA 1L9NA 2YRLA 3JVGC 4OZIB 4TNVK 3PHOA 3U9UB 3PNWA 5I8CA 4G3YL 1QKZH 1ZVHA 4DK3A 3BPOC 2VLJE 2DQIL 1YJDC 2X4RA 5ID1B 4C56A 2HH0L 3D69B 5DJAB 4PJAE 4MQ7A 1YA5A 5IEKB 2JJSC 1L7IL 2GSIA 3DTXA 1TZHB 3DMMA 3DECA 3GM8A 1Z5LA 1A5FL 2GTWA 5JPNB 3PGDB 1T2JA 3QUZB 4LLQA 3RU8L 1J9CT 3MO1A 3FQRA 3IU4L 1FZOA 3BPCB 3BKMH 3ULVD 4JVPA 1P5UA 2X4QA 3IXAB 5CWSB 2MOVA 4GKSA 5I8KL 5EBWA 4H0IA 1FBIL 1QLEH 1SYSB 2FATH 2PYFB 4MNHA 3TA3D 5T3XE 5HY9B 2CKBA 1DQQB 5CKAA 3T0XA 1M71B 2A74A 3HB3C 3RUGA 4G6KL 2E3VA 3OF6A 4NRYA 2VC2L 1AGFA 1FL6A 4LGPB 2EDQA 3MRLA 1D5XA 1D5BB 1NFIB 2Z93A 3F7RA 4MD4B 3VXTB 3MXVL 2R0LH 1FIGL 3REVA 2NW3A 5FUZL 1JPGB 3ARBC 5D7KE 3SE8L 1HZHL 2V5MA 4XAWL 5FYLL 4ZSOE 1VPOH 3S36L 3T0VA 4O9HL 1QBML 1OP5H 2JE8A 2PW2A 1X5JA 2A6IA 4HKZA 1CIUA 4R96A 5FGSA 4YHIB 2X09A 3DI3B 4P4KA 4JFEE 4PJ8A 2WW8A 5E99L 5HGGS 2NY2C 1BQHG 3LCYA 5E6IA 2Y07H 3IDYB 5LXGH 3KPSA 4JHBA 2HAZA 1S7SB 4MD0A 4AM0A 4HZLB 1AE6H 2BNQA 1Q0XL 1T1WA 3CZFA 5LGHL 5CZXD 1BFSA 3BRGC 1CS6A 1FZKB 5FAAA 3ARSA 2WUCL 4MMZC 2BNRA 3S37H 5IB2B 1AD9A 3P9MB 3X3GL 3NIGF 1OPGH 1FNEA 1JPTL 5EOTA 3H42H 2BRRL 1HXMB 2R4SL 1IC4L 1I9RH 4LNRA 3HZMA 1I7RB 3C08H 1PZ5B 3EZJB 2YUVA 1HQRB 4Z76B 2P8PB 1J8HE 3WL9A 3ELAT 2YWZA 1HHJB 5JA8B 3D39E 4NWTH 3BKCL 4P9HL 4Y2OA 4FQHA 3KG5A 3BEWB 5FK9A 1OAXL 2JELL 4G7YH 4RA0C 3LEXB 4KKNA 8FABB 4WJ5B 5KSAB 4H25A 3RPIB 3QXAA 4RAVB 2CDEB 4DK6A 1PQZA 3SDAA 2X42A 2EYSB 4KMTL 9CGTA 2MKWA 4XPTL 5L88H 3OF6D 4AEHH 3VFGL 4IOIA 2W60A 1NAML 1IFHH 2IFFL 1YEDB 3GRWL 1CE6A 1UENA 4BKLA 1I7TB 1MHPH 2F53A 5JNYB 3B83A 3LZFH 4O2FA 5IHZA 3IKKA 3UBXB 3FB8A 4UQ3B 1VEMA 1JMZA 2XWTB 1MCDA 3PWVA 3TA3C 1L0XA 1R24A 2F8VA 2BHZA 2VSCA 1QVOA 3SO3B 4JFHD 1QA9A 5DJDA 2XY2A 3QDJA 4PJIE 3I50H 4JPWL 5LGJB 4QRSA 1G9EA 2YRPA 1EHNA 3MBEB 1U6AH 4QHKJ 2GK0A 1EVTC 1I1CA 1UA6H 1CFTA 1RJYB 5ISZB 3MROA 3QHFH 5D72L 5DZLA 3KPSD 3I6LE 3EGSA 4CMMA 3I85A 3JV0A 1HCFX 3F7YA 5DUMH 5L2KD 3LHPL 1MUJA 1T7XA 4HT1H 1LEGA 1OGAE 5IJKA 4U6YB 4IBLT 5DQDL 1DBBH 4EN3A 3KPNB 1BBJB 1TETL 4L4TB 5EZLB 5DT1H 3GMQA 3HR6A 3EJYD 3ZDYE 2YMXH 5I1LA 1Q1JH 2ID5A 1JGEA 1RIHL 2AQ3A 1RUMH 2WANA 1A6PA 2HT4D 2B7DT 2IPKB 2J12B 5BV7L 4ELMA 5F8QC 1VADA 2AS5M 2CIKB 5CZXC 4YDIH 3WD5H 3PDDA 3SDYL 4ELKA 4M3JA 1A1OB 3LB6D 4XCEA 4N0UE 1J0KA 2K9UA 4GKZB 2F9BT 4RMTA 1LO4L 3FMGL 3KPRA 5EPMA 4YQXH 4Q6IB 2P5EB 4OZFA 4XP5L 1BEYL 3O2WL 4KMLB 1LD9B 2BFVL 4WWKA 2WV3A 2ED7A 5IBLD 5I76B 5F9WB 1CGVA 3WNOA 3QIBD 3GSVA 4YPJA 5SWQA 4FQXA 1B4JH 1WAAE 3KYKH 4PJGF 1ZTXH 2ZWLT 1GJIA 5DUPH 2NY4B 5D9SB 1YEJL 3KXFD 3U30B 3G04A 1ODAA 1S8DB 2ZCLL 3MRRB 3EOYG 1FL5A 4M93B 2F15A 2X41A 3KLAA 4JLRA 4EI6B 4R26L 1CXLA 3CSYA 5I8EB 2AXGA 5EUKA 2PO6D 1RZIA 4QHLB 4UIKL 1RQ5A 1MFDL 4NBYB 1RHHA 5T3ZL 2YZ1A 3QDJD 2WWKO 4OLWH 5DD3H 3VXNB 1TFHA 4WHYG 2XZQH 3RWHB 5FO8B 5J0BA 1AGDB 1KIUA 4PRAA 2NY7L 3WUWG 4KHTL 1ZHKA 2DQTH 5GPRA 4Y89A 4N1CA 3GIVA 5C07E 4YEFA 3C6LB 3GK8H 1GHFL 3O9WB 2XWBB 4XX1E 4H1LB 1A7RH 5E94B 4BQ8A 4P2QA 5C0EB 4L4JA 4MJ4A 5C1MB 5FA3B 1YY8A 2J2ZA 3QJFB 1NUDA 1I75A 4PFEA 4PRHD 5SV4A 2CPCA 4I4WB 1CXHA 1KCVL 2GJZA 3EOAA 3CZJA 4HF5L 4IDJH 1CFVL 4EN3D 3RFZC 3FB7B 5T1KD 3SE9L 1FO0L 1JNNH 5KZCD 1KCRL 5ADOH 3MLUH 5HHME 3U9PL 4YUEH 3MLTB 1NDMA 1BZ9A 3QG7L 4YPGA 3V52L 1RIUH 1F4HA 4LVOB 3BZEA 1KGCD 4ISVA 2Q8BL 4WFGD 4EXPX 4O51B 3C60B 3REWB 1HI6B 4U1SA 2OJEB 3IJYA 3LN9A 4DN3L 3MRMB 5D1QA 2HG5A 3NZ8B 3MV8E 2E27H 2C1PA 1HHIA 1MCWW 2F5AH 4MA3A 2AGJH 5AEAA 5TDOA 1ZWIB 2WINB 3KPRD 5F9AC 4PJ7E 3KYOA 2NY3D 3EJYC 5K9JL 3TBTA 4M48H 4WWKD 4XZUB 4Y19E 3IVKA 4NNYA 4OD1H 3WFBL 2ZJSL 1VEOA 4Z0BH 2FZ3A 4XI5D 4ODSL 1MAKA 1I3RB 2HT4C 1RSFA 3BAEH 2D03H 4L9DA 5F88B 4G8GA 5BVPL 3HPJB 4A2LA 3T3PF 4I3RH 2AKRA 3VWKB 1FFPB 4MB3A 4PGDA 2EKSA 5DMYA 1V3MA 5GGTA 4RMQA 5IBUG 4PJDE 3LB6C 3T3ME 4M7ZC 2ITDB 4R97C 4OQ1A 5ICZA 1A9BA 2WIIB 4M8QB 3OJDB 4PLOB 2YKLL 3BP5A 1TPXC 5IBLC 4AY0A 1A1MB 1NGZB 5FHBL 1JNHB 1C5CL 3QIBC 1MH5A 1J86A 1UKSA 3DRQB 1FSKC 1RZFH 4XMPH 2E9IA 3HCVA 4JG1H 3AMKA 2D0HA 5JW4N 1WGOA 3N50A 3WNKA 2EDKA 4MXVE 5EBGA 3R06A 1LO2H 4NKDB 1WITA 4FZ8H 4LSDA 5I1CH 2YOCA 3SQBA 4F80A 1JZ5A 3WIHH 5DD0H 3IGAA 1KJ2L 3U1SL 2FO1A 3QI9D 1ZGLM 1CDBA 1DR9A 3B43A 4M7JH 4Y4HD 2PO6C 1CL7I 1D9KD 5FF6B 3BZFB 4OCSL 2YPVH 3QZWA 4KJYB 1I1AD 1EHLH 5D7LA 5LBSH 1XMWA 2XI9A 4GW1B 3UTSA 1NCAH 5ETUB 4LASL 4JG0L 1G1CA 1WVZA 3Q6GL 1A4JA 1JNLL 2DLFL 3S6CA 4QRRB 2ORBL 3GMOA 3HI6L 2AXFA 2DOCA 3QDGB 3AY4A 1KPUA 1A7QL 2CDFB 4HIJB 1OW0A 4M1DH 3STLB 1WEJH 1FIEA 3BD3A 3VWJB 2CMRH 1KBGH 3ZKXC 1PEZA 3TV3H 4MXWH 5D1QD 4LRNH 2SEBB 4ODWA 2EXWD 5GJSL 1FVDA 3WUWA 4EIZC 4M43L 1FVCB 5IJKC 4JO1L 3N9GH 3RY5A 4EN3C 5I1IL 4XPFH 1XEDA 1KV3A 1LP9B 1HDMB 2HRPH 1YEIH 3FQNA 4R4ND 4F37K 1PD6A 3WNNA 4NJAL 4OLYL 1JPFA 4UDTA 5B3JF 3BI9X 4LEOA 3E6HA 3EO0B 4FMKA 3NFPA 1IGIL 1TTFA 3O45A 3T4YA 4L8BB 4P46D 4A6YL 2FIKA 3MNZA 3T65A 5GS2H 3ARED 5L8KB 4I0PB 5DQJB 3BYTA 1W2KT 3AUVA 4MCZA 2NY3C 5F97E 4HX1B 1D3CA 2F5BH 1E4XI 4WWKC 3HA0A 4X7CC 3ZDZE 4L1HA 3RIAK 4ZXBA 5JTWA 1MVFA 4P59H 3OR6B 2DI7A 1MCFA 4FQJH 35C8H 3P73B 4XI5C 1RPQA 1J1OL 1K2DB 4OJFL 4N8VG 4NO3B 3G6JE 4LLWA 2VB5A 3QUMA 1V7NH 3C8HA 1LNUB 3BH8B 1SY6L 4P5TA 4JRYE 5EOQH 2YC1A 1ROWA 4JREB 3O41A 2QV2A 3WHE0 1MAJA 3KGRA 4L3CA 1FZMA 4LSQH 4XMLH 3ROLA 6FABL 3KR3L 2A1WL 1FJ1B 5GS0D 3U82B 3H9SE 5D7LD 4KKCD 4GMSH 5F1NA 4WW2C 2J5LC 4HBQA 5DVOA 1KIQA 2ZUVA 4JZNA 5LCVL 2OZ4H 2R1XB 3EYSL 1INEL 3FFCB 5BS0B 1HQ4A 2FEDD 2PR4L 4F7TB 2DKMA 4YIQA 1EEYB 2OK0H 5TDNA 4PGJA 4X83A 2GTZB 1RU9H 4PGBB 3VDCA 4Q9CA 3LD8C 4YDKH 2OXGA 5D7IB 1KLGB 2W0PA 3GSWB 3QUKA 4NZDA 4XNQB 4LCCB 3Q5TA 4C59B 3T0AA 3QI9C 4P49A 1GIGL 4Y4HC 1D9KC 1G9NH 3GRWA 4JDVB 4MQSB 1I1AC 1FNSL 4GBXD 1U58A 2WLYA 4I9WE 2DM2A 3QWOB 4MLIA 2BSED 2XKNA 3BE1H 4IRZL 2P1YA 3BGMB 2IG2L 1RJZA 5EOCL 4XPAH 2EICA 2I5YH 4NQVB 4XP9H 1GGTA 5ICXA 2XQBL 2NW2A 2DD8L 1L9MA 4M03A 3ZTJG 1RJCA 4RIRB 5D1QC 1ULVA 5JOPD 2EXWC 5IMOA 4ZQKB 3VXUD 1Q94A 2GY5A 3WFEL 1OSPH 3HI1B 4ZS6C 3RVUD 4DGIH 4K7PY 1HH6B 5F9JA 4FTVE 2Z31D 1J8HD 1YEGL 5E2VL 1RVFL 3B9KD 4JY4B 2OP4H 1EJ6A 1T03H 1R3HB 5I16A 5F3BB 4R4NC 4RFNB 4LCWB 1LHZA 4ZXBD 1ACYL 1FYTE 4QF1B 5I0DA 2G2RB 5EZIL 1EEZA 4WHTA 4P46C 3WXWH 4EQ3A 3DLQR 4WW1B 3QFJD 2HKHH 3W9DA 4L1DA 3QXUA 2CLVA 2FBJH 4B0MM 3AREC 5CJ8A 4EUPB 2WAHA 3EIFA 2L7JA 1G1YA 4OLVH 3L5IA 3GUTB 1KN2L 4E41A 2KUTA 3X3FH 1EXUA 5SWSD 4TVPH 3G5VB 4TQEL 4ZD3H 5JXAL 1ADQH 3TVMA 3L6FA 3TIDB 4ORGB 1I85A 4P2CG 3WXVL 1H5BB 5MP6H 4O02L 4D0CA 1JWMA 1KELL 3NZHL 4OGYL 1NCBH 1NGXB 5C6TH 4ODUA 4N8VA 3S9DB 1FVEB 3MRCA 3DV6A 4BQBA 3BH9B 2XN9B 4UIMA 5IHUL 1J1XH 3IB4A 1MRDL 4UB0L 5BZWA 5F7EH 1S7UA 2QQQA 5GS0C 3MODH 4DVBA 1A47A 4KKCC 1DCLA 3I6LD 5ICYA 2OR9H 3INUL 1I7UA 3U2SA 1C12B 3UJJH 1GGBL 2R9HD 4MA8H 2R0ZH 2OX5A 3AY4C 2FEDC 5D2LF 2YN5A 3V4VH 5CJOH 5HJ3A 5C0JA 2X4UA 1JK8B 5DHVB 1KYOK 1I8MA 5KBNC 5B8CB 2IPUK 2H8PA 3CVHL 4OQTH 1HIMH 2I9LA 3BIAX 3C5JB 1JP5A 1FH5L 4QXWA 5HGHA 4K8RC 1F6FB 4PJCA 4PJCF 5JOFA 4GBXC 1X5FA 5I71B 4U1MA 3LN4B 1GAFH 4HPOH 5DVKA 5E5UB 5IKCA 1QOKA 3PQYA 3F8UB 1S9VB 5CD3A 3KS0J 1W72H 1U2HA 5DR5L 1J1PL 1KTDA 1WT5A 3KPLB 4UILL 4PTTB 3B4NA 1GZPB 2BOCA 4C58B 1T1ZA 5DJXA 7CGTA 3LKNB 3GSQA 1OM3H 3QH3B 2A73B 2AJVL 1IGYB 3KPTA 3RVUC 2Y06H 2OI9C 2Z31C 4M8VA 4UQ2A 4PY7B 1E4KC 3L3KB 1LDSA 3F65A 3RBGA 3B9KC 4JFDA 4RCAA 3VG9C 4E41D 4PLKD 1K8IB 5EBLB 2JB6B 3BFOA 4ZXBC 4DKFL 4WUUB 1QACA 4Q9QH 1B4RA 4HPYL 1GVIA 3TVMD 4RGND 3E6FA 5F1IA 2CJUL 3OZ9H 1QPPA 4R90L 3GSRB 3L3IB 3QCVL 4MAYA 1T2QH 4NHCL 2X1XR 1JV5B 3CD4A 4ODHH 3TNNA 1MCBA 3KVQA 5T1LB 2VDMH 2QBWA 3HAEG 4HDIA 1XGPA 2F54A 3JWOH 1CFSA 2EDRA 4X4MA 1OVZA 4MSWB 2ICWB 3LQZB 1G7HB 3NGBB 1IAKB 2FJFB 4J8RB 5HHPA 2LU3A 1CL7L 2DLGA 5TFSL 1ZEAH 2LTQC 4CRPA 4HIEA 5EUOA 1DBKL 2P42B 5GQBA 5EUOF 1Q9OA 2YBRA 2K7PA 3WLBB 1KN4L 3RZCD 3BVNB 2XNAA 3CFIC 5DEGB 4XCCL 2AK4E 1A21A 1N7ML 3GMLA 1KJ3L 4QXUH 2Q8AL 2YA2A 1MIEH 2COQA 3DV4B 3SQOL 5IVNA 1PSKH 2DMCA 2XG5A 3MLRH 1WCBA 4WI3A 4Y16D 3C9NB 4OZHA 2YN3A 3IAGC 4OZHF 1VERA 2R0WH 2CKBB 5A16A 5BVJA 3VGEA 3X11A 1D5MB 3MUGB 1TXKA 2W9EH 4PIRF 3ULSB 2R9HC 3NAAL 3CC5B 3MV8D 2V2TA 3RL1A 5F1KC 3TN0A 4Y4KB 4WU7B 4NRZA 5HYJD 4HZAA 1KJ2A 4GRWF 5I0ZA 4N0YL 1U8IA 3DSFH 1AIFB 3P4LA 1UWEH 5INDB 3SCMA 5HYQA 3VFOA 4XPGL 3CH1B 1P69B 1P7QB 1MFEL 2X4OB 4V2BA 1NUFA 3QXVA 4EKXA 3MRQA 1JRHH 4ODTL 5HPMA 4QRRE 2W0KA 4UT7H 5C71A 2Y5EA 2H26B 4MWFB 5CBAB 2A77H 3QDME 2GK2A 4W6WB 4QKXB 3CLFH 3ARGB 1NC2D 3GHEH 3L7EB 5TQ0L 1AO7B 4KVCL 3K1KC 1T5XA 2X4PA 25C8L 4Q7DA 1U3JA 3OB0H 1S7RA 4RFEA 1YECL 1BZ7A 4IS6A 5IROA 1T0PB 5DS8A 3WKML 1GSMA 1CCZA 4MAYD 1UM6H 5DK3A 1LP9E 2VZTA 4U05A 2ESVA 4N1EA 1TQBB 1CK0L 4MJ5A 1MCJA 5I17A 1JUFA 4PLKC 1CFNA 3D48R 3FOLA 3L3GB 5E5RB 2QSCL 4JKPL 5IM7A 2F54D 1KYOJ 1R3KA 1P6FA 4KPHL 3FAWA 4R7DA 1LK3H 3BSZH 3QNZB 1ERNA 4LSRH 5FM8A 4A6YA 3HC3L 2YPLE 1KIRA 4PG9A 1IGJA 1AR2A 5EU6D 4EUPH 3CMGA 4F57L 1D5ZB 3TVMC 3OKLA 2ADIA 3H3KA 4RGNC 1VEPA 4X8JA 1CG9A 3MNWB 4Y5YB 4M7LH 1I85C 4OCRL 3O3DA 1WISA 3I3EA 1NJ9B 4G6JL 2P5WE 5F70A 3IFNL 4MQXD 1RJLA 4KVNH 1K6QL 2D4DA 3TJEH 3BWAB 3NPSB 5CEYA 1IC5L 3OG6B 4NGHL 4CVXB 1TTUA 2RHEA 3ARFA 4UU9A 4KQ3L 5KS9E 4WU5A 1CF8L 4BK5A 3GMRA 3AXLB 2K3TA 1KJVA 2BDNL 5ABDE 1SY6A 4Q9BA 5IMMA 2X9XA 3N1PC 3L5HA 3HC4H 4F7MB 5ITFB 4OV5A 1T4KA 1RD6A 1JGVL 3P4NA 4JO4L 1O0VA 1FE8H 4AENB 4TNWK 4N5UA 2YXMA 2HJKA 4KTEH 2A6DA 2MQCA 1S5HB 3RZCC 1A3RL 3PWLA 3WMSA 1CR9L 2GCYB 4KHXH 1NCTA 1A6ZA 4D9RD 1EFQA 4PRPB 1AQKH 5DJZB 5SX5K 4XCNB 1KTLB 2BVEA 5DJCA 1P1ZA 4DOHB 2W59A 1MCWM 4Y16C 4FQ2H 2WMPA 5D1ZA 3RIFK 2AI0H 4AIZB 1JGUL 1N5AA 4FXLA 5GGQH 4K23H 4WCYH 4L9LC 4HWUA 3BKJL 4OD3L 3ESUF 4QHUA 3ROOB 5BS0E 5DMGD 1N6UA 1JWUA 3UTTA 5JHLL 1MJ8L 3S5LG 3UZQA 1KXQE 2H9GB 3X13B 4NHUA 5I1DB 4F15B 5CINH 1XR8A 3DVGB 2Z4QA 4M7KL 4LLVA 5DD1L 5AZEH 3BYYA 4BK4A 1CGTA 2IH1B 3TH4T 4K7FA 2P47B 3MROB 4G7VL 5F7DB 3H3PH 5D93B 3VXSD 2ZCHH 3LY6A 5DJ2B 5AZ2H 1TJGH 5IVXA 1OAQH 5IVXF 1UWGH 2CXKA 2R2HA 4OZGA 4LCYA 2BVTA 3JV6B 1J12A 3SDXB 4U1HA 5E00A 2VR5A 5E1AA 5F3HA 4PRIA 5C6WH 4XVTH 4IRJA 3H9YA 2WBJB 3HE6D 4KV5E 3FO2A 4JFYA 4PJ9D 3OKEB 1MOEA 4UV4L 4ZFGL 5T3XL 5D70H 1T0MB 4LSUH 3DRTA 1RZKL 2Z8RA 5EU3A 4JQXC 4MAYC 5JZ7D 5E4EB 2VLMD 4R4BB 1VGEH 3H7BA 4Z7NF 1BBDL 1BQHB 5I1AB 4AEFA 4OFPA 2I9TA 1DUYB 4XCEB 2C4FT 4LDEB 2ZKHH 1F58L 3O6MH 2HA1A 3D85D 1YY9D 2A83A 4X7TA 1FFNB 4HXBH 2Y5TA 4YHPA 5JO5A 4Z78A 4MQXC 4PJGB 2C4FU 3GJFA 4KRLB 5CZVH 1YYMH 2IBZY 4GRLA 3BN3B 4Z7OF 4NN6C 3HNTH 1I7ZB 1MEXH 1C08B 4OM0H 1UCBH 3PXJA 3LKOB 3G9VA 3C09B 1DLHA 4RAUA 5EO1A 2EDNA 4J3UA 1QQDA 3AU1A 3G9AB 1PG7X 4ETQB 5HYEA 1EO8H 4U1IA 5BRZA 3D25B 5MERB 3FJTA 3D3VB 2FO4B 5HHNA 3ZKND 1EV2E 1FDLH 4YFDB 2ARWA 3MREA 3TZVD 3BEVB 1P4IL 3H0TB 1NSNH 2J6EL 2E9BA 5J13B 2GSGA 5FA4A 4FTVD 4NYLA 5AYQA 1E27A 4Z8FH 5E95B 3SGDH 4I2XE 1CU4L 2DQGH 1EEQA 5C0AD 1AGBB 1L0QA 2W92A 1RUAH 3RBSA 1T21A 3WLWD 5IEHA 2CKBH 4JO3H 4LRIC 4CVZA 3C6SB 5L2JB 1FV1A 3OKNB 1ZT1B 3DBXA 4Z5RA 4JFFB 4OUUA 4K3JH 5CJXA 5J1TC 4YDJA 3VFTB 3OMZA 4NQCB 1S7QB 5JDSA 4DTGH 5J06A 3FCTB 5ACZB 1X3DA 3PWPB 4XCFL 1Q72H 3IDIB 3CVHA 4IRJD 2QTEA 3LRSA 2DBLH 4V1DB 3SE4C 3CCHB 1NDMB 4G8EB 4PJ5E 3FAXA 2IQAB 4HG4K 2DYPD 4HWEL 3JZ7A 4HUVB 3SKUD 3GHBH 1MWAL 1CGSH 4U1SB 2DKUA 5KW9H 5D1XC 3TT1L 3T0DA 2F8XC 3IDJA 1FZJA 3U0PA 5MENE 1HNGA 3MLSL 4B50A 4RFOH 15C8L 3PHQA 5A2KH 5KSBA 3W11D 3HE6C 5KSBF 1YYLL 1MPAH 5TE4L 3T0ED 4JANA 3DUUA 3ZDXF 4PJEA 4PJ9C 3LEVH 4PJEF 1D6EA 2IQ9H 4K7PX 2WBWB 4G42B 5GRXG 1OTUD 3FRUA 1U95B 4WEBH 1DQDH 1ZSDB 4GRLD 5JZ7C 1XF2A 3M17B 2FATL 4GOSA 2Q86B 5A3ID 3O4LA 2NXZB 2XZAL 1BOGB 3F6IA 3MRDB 4UV7L 4BA8A 1S7VB 2VQ1B 3CPLB 1N3NA 1G7PB 2HTKD 5CLWA 4WTZG 4WUUE 1ND0A 5C0BB 3GBLA 2FWOB 1OF2B 3V6FB 4CU8A 3AROA 2NY5L 3BUYA 3MV7E 4KUCD 2A9NH 3FKUS 4LMQE 4NJ9H 3MA7A 1YY9C 4X7SH 5H35A 3ZE1E 2YXFA 3DVIA 3IYLW 3FT4A 3K1DA 4MJ6A 1TJIH 3P11H 2PYEE 4XBGA 3HE7A 4F9LA 1WZ1H 2EIZB 5JHDB 2ZOKA 3UBXI 5HYFA 1F3DH 1QSFB 4M9OA 2XA8H 4OCWH 3LS4H 2XFXA 1IC1A 1NC4A 2GJJA 5HSFA 3DGCR 3ZKNC 1YPZB 5AUMA 1QTYT 3ZKMD 4C83B 3SGKA 1W8NA 4XXDB 3WYRA 2IGFH 3TZVC 3O6LH 3W0WE 1CVRA 1CDUA 4IJ3B 4HHAA 4WO4D 5I74B 3HS0B 4KJWD 7FABL 2Y07L 1OLZA 3NFNB 5LXGL 4IMLA 5F89A 1H0DA 4UI2A 2PKDA 4ONGH 1MRFH 1U8OB 3QO1B 4OF8A 5EORH 2Y4SA 3ZHDA 2EKJA 3DIFA 3WLWC 4YNYA 4DVRH 1OPGL 4LAQH 5FDYA 1KOAA 3UP1A 1FRGH 1QSEA 2OTUB 1TLKA 5ID0A 1KPRA 4Z77B 1PY4A 1OOAA 1A6UL 4ODWB 1JN6B 3DVNA 3C08L 1AHWB 1UC6A 3KYMA 3PP3H 5DK2B 5IB1A 2EDTA 2LAAA 5JIKA 3SN6N 5C08B 3SKOA 1UB6A 5F6HJ 4UUJB 3CFDB 1IKFH 4IRJC 4XNZB 4XBEL 1ZK9A 3MV9E 4LSPH 4YBHA 4OSUH 5ITBH 2YD6A 2O5YH 1WLHA 1XZ0B 4Z7VA 3E8UH 4G8FB 3T09A 1K5NB 3E6HB 3C5ZB 3EYOA 3O45B 4K9EL 2GEEA 1F4YL 1BVLB 1A3LL 2MKLC 4K3DL 1IAIM 4JFXB 5CP7A 4AEHL 3EO1B 5KSVB 5IFAL 5DQ9A 1HCVA 2EEDA 2EE3A 2VDOH 3U0TA 4X6CA 2IANB 5H94B 4X6CF 3W11C 4LSSH 4J6RH 3T0EC 3BHBB 1QZ1A 1MHPL 5DFTA 1J0ZA 1ZE3C 1JZ7A 1M6OA 3V5KB 4NPYA 5FUCE 1G9MC 1OTUC 4OV6F 2HMID 2IAMD 1RMFL 5KVEH 4GRLC 4LLWB 4PJHA 2J8UA 1OLLA 3IF1A 5A3IC 4RBPH 2BXYA 2VLKB 4FFZH 4DKAA 2LE9A 4YHOH 1H3UA 4CW1A 1RURH 1X44A 1T7WA 1CDHA 2HTKC 2FB4L 2Z0BA 3FO1A 1NMAL 3ARDB 4FXGA 5KVGH 5I8OH 3I50L 3KDMB 2W65A 2DL9A 3ES6A 4U7MA 4OTXH 4HG4J 5SWZB 3ROLB 1U6AL 4XNMA 2R1WA 3KYNA 4G43B 4E42A 1UA6L 5IOPB 4BELD 4G5ZH 3O8XB 1MI5A 2GY7B 2I25N 3VXOB 2AABH 4WTZA 4EQ2A 5C0FA 2H41A 3DX8B 3QSKB 1LO3H 4LHUG 5E8EB 4YWGL 3QIUB 1XF3B 5DUML 3IFOA 4NQED 1JHKH 3LKRB 3VA6A 3BXNA 3WN5C 2RAMA 3IJSA 1UM4H 4OCNC 5I15H 2NTFB 3ZT7A 4ZDHB 1QSED 2FR4B 3OJVC 5DT1L 4MA7L 3MCLH 5M94B 4P2OA 3BUTA 3ZKMC 2GFBA 4BSWA 1NAMB 3V6OA 4U0RC 4NKOA 3T8XB 2DICA 2IADA 1DDHB 4LLUA 4WO4C 4NCDA 3EKCA 4KJWC 1RZJC 5C2UB 1IGFH 1A6WL 4O58H 3WV0A 5CEXB 2Z92A 3C5SA 4OZ4B 2XKNB 3UDWA 4PRPE 2CRMA 2JCCE 2AEIT 4APQA 5E9DB 1MCQA 2R1YA 3WD5L 3NABH 4NN5C 4BFIA 1T6VN 3FFDA 3PGFH 4Z95L 2APXA 4XAKE 2APWA 1T5WB 3V0VA 5K9QG 2WIMA 5EC2B 4DN4H 5DURB 4ONHB 4WDIA 3O0RL 4U1JA 3AB0B 3QEHA 3V8CA 1E6JL 43CAA 4EDWL 4HUWA 2M26A 4OI8A 2YHGA 3W2DL 4KY1H 3BQUA 3O4OB 3BGFB 5MEQA 5FYKH 3G5YA 5L0QC 2VLJA 4I5BA 1MFCH 4NO2A 5DUPL 3B2VH 3W39B 3HC0B 1ORSA 1EHXA 4PJAA 2JJWA 2F58L 4PJAF 3BP7A 1S3KH 2B4CC 2BCKA 1CLOH 1RZGB 5DSCB 3TWCH 3DUSA 2AK1L 1XGRA 3SDXE 4YHKH 5FDWA 1S7WB 5GJTH 4D9QE 3WJJC 3K2UL 2FGWH 5GS1B 3SDCA 2AW2A 1B0RA 4EVNA 4NQDD 1XGQA 4QT5B 2VMFA 4LLYA 4YHLH 3WS6C 5B39B 3A6CH 4HUXA 1MQKH 5EA0L 3GO1H 5AG9A 2EIEA 5GRVL 3GK8L 2HMIC 1CE1H 1XT5A 2IAMC 5I1GL 5BO1L 5JW5B 5A2IH 1KT2B 3HZYA 1EFXA 2QEJA 1A7NL 3UMTA 4F7PB 1UZ6E 4ZNEA 5B3NA 2EYTB 3AAZB 3K81A 1AH1A 3QEQE 3CDGA 3I6KB 2X1QA 1G7LA 1CDYA 4LVNB 2YD1A 3QCUH 3L5XL 4N0CD 1A2YA 4GAGH 4P2OD 2UWEA 3MRCB 1MVUB 3SGKC 2UWEF 1JGLH 3MLUL 4YUEL 4S1QL 1J0IA 5KVDL 4XGZA 4ZSOA 2G60L 1RIUL 5HVWA 3JV4A 1X4ZA 4G3YH 1QYGL 2DQIH 3KPMA 1XIWB 3OG4B 5L7XL 1HSBB 5INCA 2HH0H 5D2LB 3G08A 4JFEA 5DMKA 4GT7A 3L5WB 4APQD 1DEEB 2F5AL 4X6EB 2NX5B 4LHQB 5KVMC 1AKJD 5TF0A 1DN2A 1MAMH 3WUZA 2J6EA 4G9DA 3IU4H 4M48L 4LHUA 2X89A 4B7IA 4Z0BL 5IVZB 1NPUA 4MNQB 1WFNA 3BAEL 2AJ3A 5I8KH 1FBIH 3MOQA 1MF2L 3QWRD 4X4XB 3QO0B 2DQHH 4A2MA 3DO7A 2LAGB 2Q76A 3M07A 2Y72A 1KUMA 3F5WA 4E0RA 1AGCA 1RFDH 3BT2L 2I24N 2KDGA 1ZLUK 2WWMD 2XG4A 5E4IA 3VXPA 5GGUA 3D39A 3IAQA 4RZCA 4D0DB 1B6DA 3WNLA 5AG8A 4JRXD 2DQJH 3MXVH 1FO0B 2BX5A 1FIGH 3MJ7A 3WO3B 1WWCA 4HUNB 3SE8H 3TO2A 4QTIL 1AGEB 1HZHH 4MA1C 4P99A 4XAWH 5FYLH 3S36H 2PTVA 1DQJA 3VRJA 5LG1A 1QBMH 4XX1G 4X98B 3Q6FA 1J05B 2X9YA 2YR3A 3D0VB 4BJLA 4KROB 5CCKH 1IQDB 5DD0L 3V4PL 5BJTA 3HNVL 1EFXD 1I1YB 5E99H 5T1DL 2XZZA 2D31A 5FECA 3K8MA 4JGMA 1RIVH 4HIXH 4PP2A 4RWHA 4PRDA 4Y1AA 5F7LB 4KDWA 1EHLL 3O11B 5LBSL 3KWWA 5ESQB 5IB3A 3ESVF 4G9FE 3WS3B 1LDPH 3BWUC 4G8IB 1Q0XH 4JFQB 5LGHH 3P4OA 4HGWB 1EIBA 3EOBB 1L0YA 3EYQD 1CQYA 3PWJA 4EI5A 2YD9A 1JPTH 4HUMB 4M1DL 1ES0A 2R2BB 1WEJL 2Y9RT 2CMRL 3VI4E 2BRRH 4ZS7L 4PJIF 2R4SH 4CVWA 3T2PA 4N9GB 2ICCA 2EDOA 2EO9A 5I75B 5C0BE 1G0YR 3LQAL 5I1HH 2XWJA 1J8KA 1ED3B 3L3OA 4U2ZA 3N9GL 4MD5B 4XPFL 1VA9A 1S9XA 3BKCH 4N0CC 4P9HH 1VFOA 4P2OC 4R0LB 3ARYA 3SDDD 3V6OC 3DXAD 4YFEA 2X89D 3CFBA 4XH2B 4YH6A 4IHOB 4LLDA 1OAXH 2JELH 4XMKL 1AC0A 2VDRL 3D2UD 3B6SB 1CXIA 1B9ZA 5GHWL 4HAFA 1QG3A 3RNQA 1QRND 1I9JH 1VFBA 2V2XA 2OMNA 1JRHI 3LVEA 4KMTH 4PTUB 3VXMA 3IETA 4APQC 2VRAA 4ACPA 1KB5L 1VFUA 1G7IB 4FQ1L 3ZDYF 3VFGH 3NCEB 1NAMH 1XF4B 1R5WA 4GRWB 2IFFH 4XNXH 3GRWH 1KF9B 3ARBB 2AV1A 3EDEA 4HK0A 3RHWK 3RWJB 4OCXL 5F1SA 5HYQB 3MRKA 4XWGL 4KJPD 2VDLL 3IKCA 1FFOB 4FQJL 4E9LA 3B9AA 4ZAKB 3D9AL 3QXTA 3ZYOA 4ZUSA 1KTKE 4ZUVA 1XR9B 3O2DL 1G0DA 2E7BA 4KU1A 3V0WH 5EOQL 5JLZA 3V2AR 1IL1A 3EOTL 5GGVY 3I2CL 2WWMC 4HBCL 1T5XB 5E7FA 4JPWH 4GAFB 5T1MB 3QUXA 4ZUTB 2CIIB 1FC1A 2BMKB 4S0TD 3QULA 1F02I 4Y1AD 3RDTA 4U1GB 4U1KA 5DHXB 1ZGLA 1KNOA 4GMSL 3RVVD 5D72H 3DROA 2OZ4L 2FJGB 4JAMB 1EPFA 1JWSB 3FOLB 5T33L 3B8SA 1OP9A 5BQ7A 1RZKC 3VMPA 1WK0A 2BZDA 3RTQA 1AY1L 1UWXH 5FYJE 1OY3B 3GMPB 1RU9L 1NCCL 4JEGB 5DQDH 1TETH 3UJIL 4MNGB 3SJVB 1LO5A 2VLRD 2OQJB 1S9KC 5IB5A 1IBGL 2FX8H 3W0WD 1RK0A 1RIHH 3IAPA 3QNXB 4UOW0 5C07A 2I07A 3VDBA 2O61B 4NSKB 5EU4B 1EK3A 4OCLC 3FHQA 4JDTL 3P9LB 1U93B 2G9HB 3VMNA 1YMME 1HHGB 3EYQC 4BFGA 3IDNB 4XPAL 3SDYH 5J11B 3GB7B 1W0VB 1LO4H 4OV5B 2CRZA 1E28B 4XP5H 3QIWD 1WIPA 4NKMA 3A6BL 2BFVH 5DDHA 3HAEB 3VXMD 3GFUA 5D6CB 2H2SD 3VXRB 4K94H 5FUOL 1OSPL 1PX3A 2UUDK 1CI5A 2ATPB 4ZO9A 2OBGA 3KNBB 4LQ1A 4JZOA 4HMDA 4MJIB 4S10A 2OP4L 1NQBA 2H1PH 1Y18A 4J1UB 3GJEB 5HHOE 1S5IL 3O3AA 3SDDC 4P5KB 3WJLA 4HUUA 5EZOL 2MSPA 1HNFA 1I9IL 1NAKL 5D1ZB 2ZCLH 1N59A 3SKMA 3VXQA 3KYAA 5F96H 4DW2L 5J6HB 2HKHL 4LFHD 1YN6B 5IWLC 4HLZG 4PJ7F 3QFDB 5TGBA 1MFDH 4S2SB 5T3ZH 1TJHL 2MFNA 5GGRY 2QQNH 2MNUA 1TENA 2RFXB 1HHKB 3QUXD 1U42A 2NY7H 1ZA3B 4KHTH 4UDUA 5D5MA 1U3YA 4OF3A 4KJPC 4I13B 5GSRB 3MACL 1GHFH 4ZFZB 3RDTD 4X6DB 1KFAL 2EXYD 2X40A 3NIDE 3OBAA 4POUB 3OSKA 3ILPB 1CYGA 3N1QC 1KB9J 5HHVL 3T3MF 3AM8C 3HG1A 5CZKA 5E2UL 1NFDE 4JCMA 5E9DE 3HLAA 2AJZB 4JZJC 2P24B 1BAFH 1YUHA 1KCVH 5MP6L 4HF5H 4OKVA 4GS7C 3MRNB 1QO3A 3RGVA 1NCBL 5HI5D 1UZ8A 2JJTA 4W68A 4I0CC 3SE9H 5D2NB 5HGBB 1FO0H 1ZHNA 3U9PH 3GIZH 4WFFE 3QYCA 3MJ6A 2HFFB 3V52H 4OZIA 5IJVB 1U8JB 1IEAB 5F7EL 4MXVF 3ZTJH 1A6VH 4OZIF 3SGEH 3RVVC 1WC7B 3U9UA 1ONQB 2Q8BH 3PXHA 3U46B 3BPNC 4DEPC 2OR9L 5ID1A 3PP4H 4DN3H 2ZPKL 2ICWI 4MA8L 2R0ZL 3D69A 1MFNA 5DJAA 3F7VB 5CJOL 5CBEB 5IEKA 4JKWA 4AYFA 5IR1B 4GW5B 2BSRB 5GGSB 1TZHA 4Z7UE 5FV1L 1X7QB 4AEIL 3ULUE 3MPCA 4OQTL 4YBQD 4JHZA 4TULL 1HIML 4HS6B 5JPNA 5GXBB 3PGDA 5K9JH 3QUZA 1YJDH 3BPCA 3J8F7 2ZJSH 2E7HA 3WHXB 2XQYG 3PABB 4GUPB 5F9DC 5JMOC 1OB1B 3IXAA 4ODSH 5CWSA 1T04B 4JB9L 3C2AH 2OSLB 1GAFL 5BVPH 1SYSA 2PYFA 3SGDI 1DLHB 1CT8B 1DQQA 1P7KB 1M71A 1IAMA 2HKFH 4GG8B 5CSZA 4XAKD 4XBPB 5HHNB 4UTBH 1TZGL 1U91B 1MRCH 3QIWC 2DI8A 1ZAGA 1ORQB 3RWIB 1NFIA 2B2XL 1LO0H 4PUBL 5C09E 2H2SC 5DK0B 1NGYA 1CXEA 2Q20A 5FHBH 5HDOA 1BGXL 4MD4A 3VXTA 5IUSA 3OKKB 4QOKD 4OF7A 1S7TB 1JPGA 4M5ZL 4CN6A 1A6TB 5DVLA 2DWDB 4LDOB 4L3EE 3UX9B 4I48B 5DRXB 1CTOA 3PIQB 3GDBA 2ZG3A 4YHIA 1KJ2H 3U1SH 4GRWH 3VGAC 2DLEA 1GGUA 3NIFE 3QQNA 3TIEB 4OCSH 2ZOLB 4D9QD 3ZDZF 5F7YC 3Q6GH 3RGVD 1JNLH 1S7SA 2EDYA 2ORBH 2VDML 4HZLA 3HI6H 3QUXC 5L2KB 1BD2B 1A7QH 3JWOL 2R4RH 1FZKA 3L95B 3CSBA 3BISA 3RDTC 3E2HB 2BY0A 2EXYC 1HINL 4FXKB 4HMCA 3P9MA 5IB2A 5MHSD 3S5LB 4L4VB 1DFBL 5BZDB 3JV5A 1HXMA 4H8WL 5GGSY 1PZ5A 4EEEA 4M43H 4MX7B 1HQRA 4Z76A 3QP3A 2P8PA 3JBG7 4JO1H 5KSBB 2XYCA 1MCOH 3M1BB 5DRZB 1HHJA 5HI5C 2NTSP 2ZNXA 3X14B 5MEOB 4QRPB 3ARQA 3QUZD 3P3YA 3MRHB 4NJAH 1LEKB 4OLYH 3BEWA 3GKZA 1N2RB 4P2RD 3LEXA 8FABA 4WJ5A 5KSAA 3O4LB 2VIRB 1IGIH 2FBOJ 1MNUL 1U41A 4P0DA 3HUJB 3BKYL 2VUOA 3MYJB 4RRPG 4RAVA 1FCCA 2CDEA 1TPXB 2EYSA 2EYRA 2MQ3A 1SHMA 3NCBB 3QUYB 3W9EB 3WEXB 4H1LG 3QIBB 1SJHB 4M1GH 4J3XA 4PV9B 5ADPH 4JJ5B 2V5YA 1FSKB 1YEDA 1WBZB 1PKQB 4BSVB 4YBQC 1IARB 3DSFL 4X0KB 1I7TA 4NT6B 3KXFB 1INDL 1U2CA 5HI3D 5JNYA 1MHEB 3PL6D 3BJLA 3BZDA 4HLJA 1J1OH 3UBXA 1JRHL 4OJFH 4UQ3A 2VO5A 2XWTA 2A77L 3GSUB 4P4RB 1Z2KA 3LH2H 2MJWA 1UKQA 4P57B 3CLFL 1UXSB 3S97C 1T7VA 3OJ2C 4NQSB 3HAEH 1HEZB 3RY6C 5D7JB 5LGJA 3ILQD 5HDBE 2BY3A 3MBEA 6FABH 5FGCE 1ZLWK 1YQ2A 3KR3H 4XP1L 5C0CB 2AP2A 2DRUA 4BUHA 1RJYA 4IMLB 5ISZA 1E4JA 3ZKXB 3NCYP 2DQFB 5LCVH 4FQPA 3EYSH 1INEH 4PRHB 2FX7H 4MZ3A 2GHWB 2PR4H 4YC2B 1JF5A 1JCKA 2ZUSA 4IEFB 1P5VA 4CU6A 4BYHA 3K46A 4ZOBA 3WDHA 4U6YA 4NNXB 2HVJB 5T1KB 1YEHL 3KPNA 1BBJA 4L4TA 3DVNB 5EZLA 1WTGT 5KZCB 3ARTA 2W1NA 5DO2D 4YFLF 1CLZL 2ADJB 1AXSB 4XRCB 5EIVA 4KVNL 3QDHA 4EBQL 3CDCA 2FH8A 2Z91B 4MDIB 2BVOB 3RGVC 2IPKA 2JJTC 4PJXB 3DHMA 1F45A 4IRZH 4Z7QE 1MHHB 2CIKA 3MZGB 3VI3E 1A1OA 3UROR 3MGOB 3O2DA 4GKZA 2MMXA 2DD8H 4FZEL 4Q6IA 2P5EA 3VA2C 1LD9A 5C70A 2DAVA 2X10A 4JN1L 4XHJD 5DQ9B 5I76A 1OT2A 3CJJA 3B9VA 1YEGH 5E2VH 4BQCA 1RVFH 5DYOB 3CX2A 4RMVA 4URTB 1BVZA 1AQKL 1RZ8B 4PD4K 1B6UA 4PREB 3QUZC 3QA3B 4D8PB 5D9SA 1ACYH 2AJYL 2D9CA 2OZ4A 1R5VB 1S8DA 4ODVH 1TQCC 2G5BB 1CGUA 3I02B 4K23L 4WCYL 2CUMA 4CAGA 1A8JH 4O5LL 4EI6A 1EMTL 4LAJH 5I8EA 4QHLA 1K3IA 3CFCL 3PF2A 3K4ZA 4B7LA 2FECL 4WW2B 2J5LB 1AD0B 5J9PB 4Z9KB 4TUJB 5K9OB 5CINL 3NCFB 3GJFH 1IAIL 3VXNA 5IBTL 3RWHA 5FO8A 1U8QB 3LIZL 3TNMB 1AGDA 1BOYA 1BJ8A 5HI3C 4AK1A 5HYIA 5CEZH 5EWIH 1MI5B 4YHNB 3PL6C 3FN3A 4LCUB 1U8MB 3C6LA 4TQEH 1NCWL 3O9WA 2XWBA 5B22A 5JXAH 2NNAB 4H1LA 5AZ2L 5E94A 5C0EA 2D3VA 1UWGL 1K4CA 3MJGX 4PJFB 5FA3A 3QI9B 3QJFA 3CVIL 4Y4HB 4WEMB 1QHOA 3LKPB 1D9KB 3UXFA 4I4WA 1NGWB 4XB7A 3FN0L 3E3QC 5FM5O 4O02H 2NZ9D 5C0DB 1XF1A 2GFBB 4OGYH 3NZHH 2GJ6D 3P2TA 4BSWB 4L4TD 2MPAH 3FB7A 3V5DB 4WI4A 5GS2D 3ILQC 5HDLA 5H2BB 2GUOB 3ULVE 4JM2F 3MLTA 2FLRT 5IHUH 5D70L 1MRDH 4UB0H 3TYFB 1ZGLP 4Q58C 1XGYH 3IDYC 1VGEL 2F8OA 4N0RA 4O51A 1DP0A 3C60A 3REWA 1VSCA 3RKDD 1HI6A 2OJEA 3CDYA 3MRMA 2FYYB 3NZ8A 4R9HA 1FN4A 4BH8B 1WIUA 4F7CB 4IRSB 2L4OA 1ZWIA 4DKDC 2WINA 3O6ML 3CVHH 3RWDB 2P5ED 5TDPB 3QEUB 4HXBL 4S1RL 1FH5H 3MGTB 5DO2C 1Z9MA 3NA4A 4XZUA 4ZNCD 1V3LA 2CH8A 1OAYH 3OHXB 5CZVL 5ACMA 1YYML 3G5ZB 1I3RA 4P46B 3B8YA 5F88A 1UCBL 3KLDA 5CUSL 3SGJC 3HPJA 3D6GA 2YK1L 1K8DB 3VWKA 1FFPA 2NY4D 3AREB 4M00A 2W0FB 4UILH 3NFSL 3TBSB 2QKIB 2VN4A 2ITDA 1L7TL 2WIIA 4M8QA 3KJ6L 5CGTA 3OJDA 3WKNA 4RQQB 2AJVH 4AIXA 4XHJC 1A1MA 5M95B 3AGVA 5CAYB 1NGZA 5GZOD 1JNHA 1MREH 3DRQA 3OR7B 3VFSB 4CN4A 4LLAA 1BLNB 2MHAA 4DKFH 5HBBA 4LGRB 3WFZA 4NKQB 2RQ8A 3CUPB 5ESVB 4NKDA 1AQDB 3C6LD 2BSTB 3VFNB 4HPYH 4MB5A 2FHFA 4HH9B 1KPVB 4GO6B 4R90H 3SO3C 2VL4A 5FF6A 3BZFA 1UT9A 4KJYA 1BQUA 1Q72L 3QCVH 4OQTA 3FB5B 4KKBD 2DBLL 4MDJB 5ETUA 1PX4A 5A43C 3I9GH 4QRRA 3HRZB 4W4OC 5FM4A 1B0GB 4PRBB 4ZMAT 3QDGA 1JHLL 1GOGA 3JTSB 4RMRA 2CDFA 4HIJA 1CICD 4MMXC 1X5KA 4F33B 3STLA 3VWJA 3T08A 1MY5A 2V7HB 3C60D 1KCSL 5TFSH 4F37F 3RUGE 4LOUD 3BX7C 2SEBA 1FORL 2UY7A 2HWZL 1DBKH 1A7OL 4RFOL 1IKNA 4G6AD 3H7LA 2NZ9C 1FVCA 3VGDA 4PD4J 1KN4H 2XTJD 4CADB 2IALB 4XCCH 2ZUTA 1LP9A 1N7MH 2ZUQB 4DAGL 4FABL 1LP9F 2Q8AH 3LEVL 4ZTPH 1HDMA 1DVFD 2B20A 4HWZB 3EO0A 2E9JA 1TITA 4L8BA 4TVPD 1V5JA 3RKDC 4X8XA 1AP2B 3NAAH 4JFHE 1NKRA 1BJ1J 5I66B 3GI9H 3RIAF 3VWKD 5CHNB 2VDNL 3D0LB 3FQTB 2DTSA 5GISL 2Z31B 1J8HB 4GLRH 4I0PA 2CR3A 5DQJA 3B9KB 4PG2A 4QRQB 3NVQA 5C0GB 1DBJH 4N0YH 1DJSA 3V5HB 1R3JB 4HX1A 3QAZC 4MAUH 1C7SA 5HGDB 5IW6B 5F9WC 5KS9F 3OR6A 1MFEH 5TQ2L 3KPSE 4HFUH 3L3HB 3P73A 4KK6D 3SE3A 1K2DA 3QFJB 5L2KE 1LNUA 1QBBA 3BH8A 3G6DL 4U6XB 1MWAB 5F44A 2NY4C 2XA8L 4OCWL 3U30C 2IPUG 4KUZH 3LS4L 1NCDL 4X80L 5TQ0H 5EH1A 4KVCH 5MI0B 5H37G 4Q9RH 25C8H 4M93C 1JJUA 1UEMA 2CUIA 5IHLB 2D31B 1XF5B 2IGFL 3O6LL 4X7FC 1CGXA 1GOFA 4X99B 3TO4B 1ZXQA 1FJ1A 3P0YL 1LK2B 3WKMH 2ZUUA 4LPCA 1OGTB 5GZOC 5DJ0B 4ONGL 2Y6SD 1MRFL 2R1XA 4KJQD 1G9NC 3EYVB 2LTQB 3KLSA 3FFCA 4JKPH 3PWJB 5BS0A 3F58L 4KPHH 4NNPL 4Z7WB 1E4WL 4F7TA 2DM7A 3C6LC 1EEYA 4ZTOL 4PJIB 3HC3H 5F7UA 2GTZA 4PGBA 2QQLL 2JIXD 3HFML 3HUJE 3U4AA 1QR1B 3T77B 4F57H 1ZT4B 3OX8B 1KLGA 4XNQA 3GSWA 5D7IA 4LCCA 5D7IF 1JGDB 5BXFB 2WSKA 4G6JH 4JDVA 4IIQC 1G7QB 1K6QH 1TNNA 3C2SA 3QG6A 4KKBC 4ALAL 1PKQE 2BP3A 1IC5H 4OSUL 5ITBL 2MCPL 1YQVL 3QWOA 1WWAX 4KQ3H 3VMOA 2QADD 3E8UL 1CF8H 1OAKL 3BGMA 4TRPH 1OGAB 5DHYB 5KSUB 2BDNH 2YS4A 4HCRL 4F2MB 4C55A 4NQVA 1CICC 3DX9B 4NM8H 4W6XB 4L8DB 4OFKA 3C60C 4O2EA 2HLAB 4RIRA 4JO4H 4YR6A 4LOUC 4KV5F 3TESA 4UINH 1NEZG 4PJBB 4ZQKA 5ALCH 3TGXA 3MXWL 4P23B 1IE5A 4G6AC 3HI1A 3QDJE 4XP4L 2AV1B 1HH6A 2XTJC 1A3RH 4LSSL 3V9FA 1CR9H 4N90D 4JY4A 3IDMB 1R3HA 3AVEA 1DVFC 5F3BA 3RX5A 4Y0GA 5FO7B 4LCWA 4LPVA 1A14L 4GXVL 4KAQL 4F3FB 4N0UB 4QF1A 5KVEL 4ZUSB 1JGUH 2G2RA 2NCMA 4FFZL 5KANI 5E24E 3BKJH 4OD3H 1EGJL 4WW1A 5JHLH 3VWKC 3GEWB 4NUJB 1GC1L 1E0OB 2XRAL 2OR7A 4X9IA 1KACB 1MJ8H 5KVGL 4EUPA 1IEBB 1PEWA 3ZE0E 1BVKB 4L29A 1V7MH 2KKQA 3GUTA 3UPRB 2XA3A 4GAYB 4U3XA 5DD1H 4LKCB 4G7VH 2D2OA 1KGCE 1RV6X 3G5VA 4WFGE 4KK6C 4AIOA 4ELME 2M1KA 3SY0B 1LO3L 4PJXE 2C7UB 1JHKL 2NQCA 3TIDA 4ORGA 5KOMC 1H5BA 3WBDA 3MRIA 3KPRE 2AEPH 3PJSB 1UM5H 5ACLA 3N0PB 1NGXA 5DVNA 4JFZH 1QLFB 1FVEA 4UV4H 4ZFGH 1NKOA 3BH9A 5T3XH 2XN9A 1JF1B 2BSSB 3GBML 3P4MB 1DQML 5C8JB 3MRBB 1VESA 2Y6SC 3RRQA 5IT2L 4KJQC 1C12A 1ZOXA 3DX7B 4DFIA 3NABL 4HKXB 4D2NA 1A6AB 3TF7C 3PGFL 2Z35B 2IPTH 1F42A 1JK8A 3RZCB 2A9MH 5DHVA 1VKXB 4U49A 5B8CA 4LFHG 1EO7A 3FT3B 3OXRB 4ZOEA 5AAWA 2FDBP 5EO0B 5BMFL 3C5JA 4PJ5A 2ZUYA 2DIJA 2Z8WC 4NO0D 4Y16B 1II4E 4NRXB 4HK3N 5C3TA 4QCIB 2Y7QB 4L9LB 5CGMA 3LN4A 1P2CB 5FYJU 3B2VL 3MV8B 2QADC 3NMEA 1S9VA 5J4MA 4LCWD 2ERJC 5HYJB 1CLOL 3KPLA 3EFFB 4K8RH 4P2QE 4PTTA 1TTGA 3TWCL 3UAJC 4PJ7B 4PJFE 3LKNA 2QJDA 3QH3A 4Y19B 1Q38A 4YHKL 2N56A 2A73A 5GJTL 1IGYA 2BNUB 4Y2DD 4PG2C 4LVHC 4YHLL 1HH9B 4UDUB 4JE4B 3A6CL 1MQKL 2CRYA 3GO1L 3OKMB 1K8IA 1NC2B 1WCQA 4HIIB 5EBLA 3M8OL 1CE1L 2JB6A 4PJDB 3MC0A 4WUUA 4S11A 3SGEI 3RVTD 2PN5A 2HFEB 4GW4B 4DCQB 5EZJB 3GSRA 3L3IA 4KGJA 1L6ZA 1DL7L 1ZVSB 5IMLB 1T1YB 1JV5A 3QCUL 1SM3L 5ILTL 4MLSA 3R1GH 4CNIB 5T1LA 1HE7A 4HWEH 1EX0A 2XN9D 4MSWA 4CL7A 2ICWA 5I73B 1MWAH 3LQZA 4G80B 1K85A 1G7HA 1I4FB 3HRPA 5CP3A 1GPOH 2JK5B 5EU6B 1J0YA 3TT1H 1H8OA 1IAKA 1OD9A 2FJFA 4J8RA 4OM1L 5JXEA 4P3WA 3UTOA 3LS5H 3MLSH 4MB4A 3RX8A 1CWVA 2R2CA 5LWYH 1QSVA 4OCYL 3UO1H 2RJMA 5IG7B 15C8H 2H32B 2FRGP 2DLHA 4NN6B 5IGXH 3WLBA 2A6JB 3BVNA 1MAML 1YYLH 5DEGA 5TE4H 2MTPA 4LCCC 4RGOL 4TYUA 2C3HA 3DV4A 3BZ4B 1I9EA 2DMKA 4OGXL 3THML 3KPOB 2NPLX 3C9NA 1OP3K 1FNFA 4CMHC 4WY7L 3BP6B 1I3GL 2DQHL 2XZAH 4UV7H 1D5MA 2Q87A 3MUGA 3ULSA 3OGCB 5CSZB 1RFDL 1TVHB 2D7TH 3CC5A 2R39A 4OF6A 4Y4KA 4WU7A 5IQ9B 1HYRC 1J5OL 2IWGA 2NY5H 3TPKA 4ZFOB 5T5FL 1TCRB 1T6WA 1AIFA 1N0XH 3H9ZA 3KPQB 4WNQA 1MIML 2DJSA 5INDA 1NGYB 2DQJL 5D7LE 2UZYB 3CH1A 3CSPA 1P7QA 4K3HA 5JR1L 2R8SL 2X4OA 4GQPH 1X5AA 5IK3B 5FYJL 4P3DB 2H26A 4MWFA 5CBAA 1CD1B 2EE6A 5A40E 1NBZB 4RFNC 3QBTB 3ZYIA 2LABA 1BX2B 3ARGA 5CCKL 3L7EA 3OKDB 1WZMA 1YMHB 2QHLA 1ZLVK 1AO7A 3L9RB 3QPXL 3JTTB 4OLXL 4WHDA 3WNPA 1RIVL 4HIXL 2X4SB 3VXSB 7FABH 3STZB 2YSSB 4Y2DC 3CFJB 2Z9TA 5D1XB 3G6JB 2XT1B 1LDPL 4X5XB 1HHHB 4JRYB 5FIEA 4LCIH 5B3JE 3L3GA 4X5WA 2A0LD 3QNZA 3HE6B 5B21A 4C56D 1EVUA 1A6UH 1ZVYA 3K74B 4PJ9B 5JOPE 3VXUE 3RVTC 1D5ZA 1UCTA 2Q7YB 3MNWA 4Y5YA 2X1PA 5CJBA 4L5FH 3T0WA 2V9QA 5I1HL 3DMMD 3H9SB 1NJ9A 4XBEH 5JMRA 3JUZA 4RGMC 3BWAA 1DQTA 4Y5VC 4CVXA 1DUZB 3MGAA 5KVFL 3WIFB 3AXLA 4K9EH 4IM8A 4GKNB 1I9JL 5C86A 1F4YH 4WI9A 1A3LH 3QFJE 3D85B 3LPFA 4F7MA 5ITFA 2EYRB 4QGTA 4K3DH 1DN0B 2LU4A 4AENA 5IFAH 4HC1L 4Y4KD 3RIFF 4XNXL 4NC1C 1IT9L 1R6VA 3U4BH 2CQVA 1S5HA 5IESL 2KQNA 3IU3B 2GCYA 1YDPB 4PRPA 5SWSE 5DJZA 2F74B 3ULVC 4XCNA 4FP8L 1KTLA 3NCYS 5KJRL 1MLCB 1RMFH 2E7LC 1P7QD 1HILB 2HT3D 3RI5K 3VU2A 5J12C 2I27N 4AIZA 5I71C 1R5IB 4M61B 3O3BB 4XPHL 5L8LB 1T7YA 3V0WL 5DZNA 3ROOA 5C0IB 4CDHA 4Z7WE 2FB4H 2AJUL 2VZSA 1UGNA 3ARGD 1NMAH 4FTVB 4DZBB 2G5RA 2H9GA 3X13A 2J8HA 1AO7D 4P4KD 1Q9KB 3OPZH 4PJ8D 5C0AB 5I1DA 3HHRB 5M7QA 1LE9B 3DVGA 1ZANH 2KPNA 3VE0B 2VZVA 4ODXB 5E6ID 1U8NB 2IH1A 4Z0XB 1FYTB 3JWDL 1BHGA 4H20H 5F7DA 3U36B 2OL3L 3GBNH 4DUWA 5DXWA 5DJ2A 3FONB 5IF0B 3N1FC 2BNQD 4YWGH 3ZT6A 2VYRE 3OKOB 4G6FD 1P9MC 2VDPH 3ULUL 1BZQK 3JV6A 1VB9A 1XGTB 2BNRD 4HCRA 2VE6B 3SDXA 3BDYL 1ZHLB 3SDXF 1URLA 1F90H 3F7QA 2WP3T 4FRWA 4RWYH 2A2QT 1KB5B 4MA7H 2QSQA 2WBJA 3RL2B 2FX8L 2DYPB 3QEGH 3S4SB 1UXWB 3FQUB 4PJBE 3OKEA 3EDJA 2D7OA 4QNPF 5ERWB 1T0MA 1A6WH 1B2WL 2FX9L 4AZ8A 5ENWB 3GSNL 4PV8B 2VAAB 4R4BA 3IDUA 5E7BA 2C3VB 2X5PA 1BQHA 5I1AA 2AAVA 1H3PH 4JPVH 1DUYA 1UZ6F 2A0LC 4Z95H 5C3LD 1CXKA 1ZA6A 1EGJA 4QLRA 3T0EB 3O0RH 5EB9A 3SDAD 1BP3B 1E6JH 3I6GB 4EDWH 1GOHA 1FFNA 4K94L 3W2DH 3DMMC 4PS4L 5F21B 4PJGA 1PYWA 2H1PL 4E41E 1I7ZA 3K80A 1C08A 1N64L 2F53D 5ECJE 3LKOA 4OGAD 2F58H 1A4KB 5HPOA 1B0WA 2ADGB 2Q3ZA 5CGYD 3FTGB 3LN5B 4J3OC 4LLMB 2WK2A 3MFGB 4ETQA 3D25A 5MERA 1RY7B 2DS4A 2K1MA 5F96L 3D3VA 2FO4A 4RGNE 5LGKA 3F6LA 2AK1H 2H32H 2J1KA 5DD5L 3OXSA 4O2CB 5HD8D 3BEVA 3H0TA 4KDVA 3K2UH 3S35X 3SBWA 4Y4KC 3KHOA 4UOJA 2VABB 2QQNL 3ARXA 2GT9B 4QRUB 1X4XA 5EA0H 1CQKA 1AGBA 2OTWB 3WN5B 1D6VH 4KTDL 1WBXA 3C6SA 5L2JA 5EBMB 5I1GH 5BO1H 4JQIL 3OKNA 2HT3C 1K4CB 1ZT1A 4Z6AT 3OAUL 1A7NH 2DIBA 3EO9L 4JFFA 1F11B 3T4AB 4OLUL 2FCBA 3VFTA 1T0NB 4NQCA 1S7QA 4WO4B 1BAFL 3FCTA 2AXJA 4ZUWB 5ACZA 3PWPA 5FM5M 5I1EL 3ARGC 2BHUA 3IDIA 4WI6A 4UZGA 4TTGA 4P4KC 3L5XH 4HKBB 4PJ8C 4V1DA 4JM2B 1O7VA 3QDAA 4EJ1C 3CCHA 4S1QH 3GIZL 5KVDH 4G8EA 4PJCE 4Y5XA 5CIPB 4NN5B 1KCKA 2G60H 2IQAA 2W38A 4MHHG 5E6IC 4WI5A 1A6VL 3QXDB 4HUVA 1T89A 1QYGH 1FG2B 2P8LB 5L7XH 1FAKT 3Q3GB 3PP4L 5IFJA 2ENYA 1FN4B 5HYJE 4JFOB 4KK9D 3QJHB 5L0QB 3HN3A 5CKGA 3ZL4L 1T2XA 1EZVX 1YJDL 3RWEB 1YNTB 1BQSA 2GITB 4G42A 1U95A 1Q9LB 3C2AL 4HLZH 4FQXD 1PG7W 1MF2H 1ZSDA 4JFDE 1FFRA 2Q86A 3M17A 3VFRB 4CVUA 3VI4F 1BOGA 3MRDA 5I18L 1IM3B 1S7VA 2BHYA 1B88A 2GKIA 2VQ1A 1GRWA 3CPLA 2HKFL 2E7CA 4WEUD 1G7PA 3BT2H 5C0BA 1SVZA 2FWOA 1OF2A 1YC8A 3V6FA 4P3CL 1P4LB 2KQMA 4UTBL 2AK4B 1MRCL 3D3VD 4JKKA 3SDAC 2UVFA 1WZKA 1LO0L 4MS8D 2FSEB 2IAMB 1ETZB 1M7DB 1P4BL 1XGUB 4IOSD 2EEAA 4IMKA 4QTIH 1A64A 2MHAB 1T22B 1CDCA 3SKJL 2EIZA 1P53A 2F54E 5JHDA 4OGAC 4X4ME 1QSFA 3LSOB 1MCPH 4YDVB 3CK0L 5F9OH 4P2QD 5CGYC 3V4PH 3HNVH 5EU6E 5EIIB 2ARJB 5EOCJ 2OS7A 4LBEB 4JFFD 5T1DH 1YPZA 4C83A 4HULB 2FIRT 1YPZF 4XXDA 1G6VK 5HD8C 4NQCD 4YO0B 3ECBB 3PWPD 2R23B 2VZ1A 5JORA 3HS0A 4OT1L 3NFNA 2DDQL 4DKEL 4YDLC 4V1DD 4ZPTB 1U8OA 3QO1A 4NQEB 2W9LA 3QDMB 1F3RB 2ZG1A 1ZT7B 2R4RL 4CKVX 5HVGB 5A1AA 1TIUA 5FYKD 5D93C 3K8KA 4KDTA 3MUZ1 1N8ZB 2OTUA 4ZS7H 3KPPB 4Z77A 3PGCB 1SQ2N 4PRNB 1JN6A 5KANG 5C9KA 1AHWA 3SEPA 5DK2A 2HJLB 4I1NB 4J4PA 3LQAH 4R2GD 4MGXA 4PYGA 4QY8B 5C08A 4W4NA 1U3HB 3TBVB 4UUJA 1MCOL 3CFDA 4GLRI 1MCRA 4D9RE 2C3XA 4CDGC 5CMAB 3A0OA 3OTTA 4ONOA 1XZ0A 4XMKH 4G8FA 3DURB 2VDRH 4TOYL 1OAZL 1YN7B 1K5NA 5GHWH 3C5ZA 3ZSTA 4LPWA 3MV11 4G8GD 5E4EC 2YPLB 5B39G 1BVLA 2W91A 4HGMA 3QRGL 2CSPA 1KB5H 3VG0L 4FQ1H 4HFWA 4JFXA 2UZIL 1RAMA 1MFAH 3SHSA 2P5WB 4LSVL 4M1GL 5ADPL 4KK9C 4JFPB 3EO1A 3OGOE 3RJDA 2DQDH 5KSVA 2DWEB 2IANA 5H94A 4OCXH 3BHBA 4JY5L 4XWGH 3NCJL 5A2FA 2DI9A 5KS9B 2VDLH 1OARL 5CJQL 5FCUL 3OAZK 1W8OA 1YMMA 3V5KA 3VXSE 3D9AH 4FQXC 4JDZB 2ESVE 3U7AA 1JPSH 3O2DH 2VLKA 3BRFA 2QL1A 3LH2L 1HKFA 2VZUA 3C09C 3G5XB 4X9GA 3EOTH 3UTQB 3S98A 4FNLL 1AXTH 3I2CH 4NQDB 4HBCH 3ARDA 4Q74A 2X70B 5DJYB 3KDMA 2HFTA 5SWZA 5EU5B 4G43A 2KH2B 3TEUA 4MS8C 5IOPA 5DRNB 4OKDA 1QSZA 3A67H 1M7IB 1KCUL 2VLME 3ISWA 3O8XA 3UTSD 4F7EA 3VXOA 5J13C 5K59E 1MHCB 2XV6B 5T33H 3DX8A 1F3JB 5E8EA 2FX7L 3TBWB 2EDJA 3QIUA 1XF3A 2V9RA 3FO9B 3LKRA 1A3QA 1AY1H 1NCCH 3DYOA 2NTFA 3UJIH 4ZDHA 2FR4A 1NMBL 4WGVB 1IBGH 1NAMA 2FJHB 4HC1A 1CTNA 4U4BA 3L3JB 3T8XA 5E1HB 4J4PD 1DDHA 1C5BH 2G75B 2ZCKH 3QG6B 4KMQA 1C7TA 1I8LA 1RUPL 3NIDF 4HIHB 3ZSSA 5CEXA 4POZD 4JDTH 4OZ4A 4H1LH 4FN0A 2YWYA 4GXUM 5CSBA 3V0AC 1NFDA 5E9DA 4NZTL 1NFDF 2VKWA 5JOEA 3V79C 5E03A 1PVHA 2E6PA 4YXHL 1FL3B 3KAAA 1AKJB 5FYLD 1CXFA 2ED8A 4I18B 1T5WA 4O2EB 1X5LA 1Y6KR 4K71C 5EC2A 4YR6B 3A6BH 4ONHA 1LE5B 4ZPVB 1Z9OA 5FUOH 5ESAB 4KI5F 4MQTB 4R2GC 1FC2D 2C1OB 5IQ7L 5CIPH 4YGAB 2VH5L 1NBVH 2IAND 5DI8B 3NA9L 5C0AE 1OD7A 4NO5B 1S5IH 1NBYB 5L8JB 3W39A 1QHPA 3HC0A 5EZOH 5HVFB 4Y8AA 1I9IH 1NAKH 5I6XB 4ODVL 5HYSG 4RNRB 5IVXE 2IEPA 3ULUF 1RZGA 4OZGE 1TVBB 5DSCA 4DW2H 2VSDA 4P5TD 3MNVB 2EDEA 4U3HA 4FG6D 5HI4D 3ZKSD 4PRIE 1S7WA 3V8OA 1J88A 4U6HB 3MJ8B 4L29B 5GS1A 3ARDD 1TJHH 3QHZL 4XVSH 4QT5A 2V17H 4ZOCA 4BM7A 5SWZD 4J23A 5B39A 5DRWA 4LARL 3MACH 5CEZL 5EWIL 4X6BB 1JTOA 2X05A 3U7YL 3WDJA 3E0GA 1KFAH 1IC7L 1I8IB 4M5YH 1NLBH 5JW5A 2ADFH 5HHVH 1KT2A 1BIIB 5E2UH 4BZ2L 1X9QA 2BY2A 2FHCA 1WWBX 4F7PA 2Y1VA 3NACH 3MRIB 2EYTA 4LF3B 3U6RB 3AAZA 4Q2ZB 3S88L 3JUYA 4WI2A 4WFEE 3I6KA 1CD0A 1T83A 4I2XB 3T0EE 2MPAL 1UACH 3U79A 1MVUA 4IJ3C 5D96B 2M8XA 2QR0B 5I74C 1PG7H 1XGYL 4GJTB 5K9KB 4D0BB 4TSCH 8CGTA 2ICEB 1XIWA 1HSBA 5D2LA 2ZPKH 4K3EL 4HW6A 3L5WA 1DEEA 3P77B 4LKXB 4WWID 3NIFF 5IMKA 4X6EA 4AEIH 1OW0C 1MCKA 2NX5A 4WTWA 5A2JH 1FLRH 1RK1B 2BY1A 2FHBA 4TULH 3D5OF 3GSOB 5DURD 5DEFB 3SDDB 4PJ5B 3DXAB 3L1OL 3D2UB 1OAYL 4J4PC 5JIPA 5KAQG 4Y8DC 4JB9H 3IDGB 5IVZA 3U0WH 1MSPA 1QRNB 4MNQA 4DWHA 1KIPB 5D6DA 4X4XA 2CGRL 4POZC 4J7RA 3QO0A 4OFIA 5MENB 2BVYA 2R2EB 3TBYB 3UTZB 2PCPB 3OB8A 1TZGH 4DGYL 5DZOA 4NDMB 4XB8A 4L8CB 3VD7A 3N85L 1T3FB 2B2XH 4D0DA 4PUBH 3PHSA 1F97A 1SJXA 1GGCL 3QCTH 3L7FB 1BGXH 2HT2D 1MREL 4TUKL 5B4MD 1FO0A 4N68A 4KI1A 5AYUL 3EUUA 4HS3B 4M5ZH 5C7XL 1AGEA 4JZJB 4S0SD 1NEZB 5K9QI 5D71H 3EYUL 4X98A 4GS7B 1J05A 3D0VA 3MRGB 1IQDA 2JJVA 3MV7B 5HVHC 2EC9T 4I77L 2P8MB 4P5TC 1I1YA 4ZO8A 4BH7B 1WZLA 4FG6C 5HI4C 1QNZH 1T7ZA 1R3LB 4K7PH 2VWEC 3FQXB 2PYEB 4KZDL 1SMOA 3O11A 3KS0H 3ARDC 3DGGB 4HEME 2DTMH 5ESQA 3BPNB 4DEPB 2EC9U 5FB8B 3WS3A 3I9GL 2VXTL 4G8IA 3H6JA 4JFQA 4HGWA 3EOBA 3MR9B 2JJSA 5FKPB 1NBQA 1QEWB 1HINH 4P9HC 3WDIA 2R2BA 1DFBH 2VLRB 4H8WH 3PDOB 2BOBB 2V7NB 2NLJB 5TE7L 3W0WB 4N9GA 4RAHA 2VISB 5E2JA 2ZUXA 5DC4B 1NEUA 5IB4B 3QB7C 1XCQB 3AFLA 3GMNB 3BIKB 3MRPB 1RULH 5DEZA 1ED3A 4MD5A 5F1OB 4JPIB 1SJEB 3GKWH 3SKNB 4R0LA 4ZTPL 5T3ZD 3AMLA 4XH2A 2UYLB 1H15B 4IHOA 4JY6B 3WFDH 1G7MB 4X4YB 5HDQL 3B6SA 4AL8L 4MNQD 1MNUH 4RISL 2RBLA 2VDQL 3QIWB 3HTLX 3BKYH 1UVQB 3CLEL 3PQYD 1NGPL 4PTUA 3GI9L 4XWOD 4DQOL 2R0KL 5F71A 4ERSL 1G7IA 5E08H 4RX4A 4JQVA 1XF4A 1FLTX 3MV9B 2WUBL 3ARBA 4UT6L 5KG9B 1DBJL 5I9QC 2VXUL 2X4NB 4WNQB 3O6FB 1INDH 3RWJA 2EECA 4MAUL 2JB5L 5DJ8B 1L4IA 3MZTA 5I2IB 4GAJL 1GL4B 2MWCA 1OP5K 3J7HA 1FFOA 4HFUL 4XC1L 1R0AL 4ZAKA 4OBSA 5TE6H 4QWWD 4JFDD 3VI3F 1DTUA 4NQEE 1XR9A 1O7SA 5I19L 1JZ6A 1W0YT 3S3SA 1S7XB 1H3WM 2HYMA 4KUZL 1Q0YH 3VGBA 1Y0LB 1QSEE 3VRIB 5KAQF 4Q9RL 1QFUH 3VGGA 5T1MA 2DQEL 4ZUTA 2CIIA 2BMKA 2KZWA 4XP1H 4WGWB 2D7PA 1KENH 4Q97A 1KULA 2HT2C 5B4MC 5GS1C 4S1SL 3BPLB 4NQTA 2FJGA 4JAMA 1JWSA 2CRIA 4Z7VE 1BWMA 4X5WB 3EJJX 3MOBL 4XP6L 3UYOD 3FO0L 5BV7C 2CLRB 4YK4B 1H3XA 1Z9LA 3GMPA 1YEHH 1HOCB 3EW3B 5E0QA 4MNGA 3SJVA 1Q9WB 5EFIB 1IGTB 4ZG1A 2OQJA 3VFMB 1CLZH 4QTHB 4X9BA 1JYVA 3QNXA 4ZYKB 2Z8VC 1CBVL 4FQQB 4HXAL 4X6CE 4EBQH 2O61A 4NSKA 5J6GB 5E8OB 5EU4A 1OSZB 3P9LA 1U93A 2O5XL 2G9HA 1ZLSH 5JPMB 4TRPL 4U1LA 1HHGA 2BC4B 1MQ8A 3IDNA 4PJHE 2J8UE 3GB7A 1W0VA 4NM8L 1K4DB 4FZEH 4M4RA 3CFEB 1E28A 2NR6D 3HAEA 4UINL 5ANMB 5D6CA 4JN1H 5ALCL 5ALBL 3TN0D 1A9EA 3VXRA 2GAZB 3KLHD 4KK8D 4KXZH 4NQDE 2ATPA 4H5SB 3KNBA 4HS8H 4MJIA 3MFFB 4W81A 3VH8B 2JCCB 4J1UA 3GJEA 3BJ91 3NOIA 1UADC 3SCMD 4P5KA 3VRLE 4LIQE 2FL5B 5H37H 4PB0L 2F19L 3WFHB 2AJYH 4ONFH 3N1GC 4ZAKD 1EHAA 4GQ9L 5D6DC 1C1EL 5DHVH 2H3NB 4O5LH 1I1FB 2WZPD 5J6HA 1EMTH 1YN6A 1LQSR 4XWOC 1WT5C 2A6KB 3CFCH 3QFDA 5L6YH 4S2SA 4NFCA 2WQ8A 4PBWD 4YX2L 1U8KB 4QOKB 1V7ML 1W0WB 4QO1A 1IAIH 5IBTH 3V6OE 3F12B 3LIZH 2RFXA 1HHKA 1ZA3A 5GSRA 3LKQB 5E8PB 4ZFZA 1NCWH 4X6DA 3VFPB 5GGTL 4X6DF 1M05B 4QWWC 2VTFA 3ILPA 2ESVD 3P0VL 3RNKB 3MTRA 3GNML 1U92B 2WLZA 1XH3B 3CVIH 4I0KA 1RZ7H 4AQOA 2AJZA 4XT1C 5DFVD 2P24A 3FN0H 1F4WH 1WUNT 2AEPL 3QNYB 1A1NB 1UM5L 3MRNA 4OGZA 3SJVD 4JFZL 2P4AB 5D2NA 5HGBA 5AD0B 1KXTB 3CMOH 5BCAA 2HFFA 4N0FB 1U3ZA 5IJVA 1U8JA 1IEAA 5DD6B 1WC7A 2X4TB 1ONQA 3U46A 5EC1B 3ARFD 5GSVB 4YHMH 4AT6B 4JHWH 2OYPA 1AJ7H 3F7VA 3LV3B 5DTFB 5CBEA 3W82A 3QEQB 2IPTL 5IR1A 1ZA6B 2YEZB 4GW5A 3S35L 2A9ML 2BSRA 3RWCB 5GGSA 1X7QA 4LPUA 2B1HL 5GS0L 3TP4A 4HS6A 4WFHD 4S1RH 1C16B 4JRXE 5ELIA 3IDXL 3WE6B 5I75C 1T20B 1CLYH 3VXRD 3WHXA 4P2RB 3PABA 4GUPA 1PYWB 1OB1A 1TQCB 1T04A 2OSLA 2XPGB 4MJID 5CUSH 3CU1A 5CP3H 4R0LC 2YK1H 1CT8A 5SV3A 4LHJB 1JI1A 1P7KA 3RUGF 3NFSH 2GQHA 4GG8A 4K8RL 2JLLA 5D1ZD 1HXYB 4XBPA 3U4EB 1L7TH 2CR6A 1U91A 3OXSB 3HI5L 3KJ6H 4M6NL 3HMXL 4ZNEE 3UTTD 1ORQA 2NR6C 5GRVK 1DZBA 3RWIA 5JIHA 1K9TA 3TN0C 3PL6B 3C8KA 3KLHC 5DK0A 3B3IB 4JQVC 4KK8C 4EDXB 5KOVC 1MFBH 2BVQB 1X5YA 2IMNA 2P49B 2UWEE 3OKKA 2AERT 3HPLB 1S7TA 2GW5A 3QPQD 1DBAH 1A6TA 3SCMC 1YEFH 1F8TH 1WBXB 2DWDA 3MLVL 2BXZA 5TH2B 1LVEA 4HQQL 1H8SA 4ZAKC 3O3EB 5F93C 4I48A 5DRXA 2BRQA 5LKNA 5JQ6H 2B5IB 3PIQA 1BECA 5HGAB 3VFVB 5DMGC 1ZS8B 3N1MC 3TIEA 4PRID 2ZOLA 4NZJA 3KJ4C 2C3GA 3UYRL 4TVSa 1ZMYA 4OZFG 4UTAH 4KRMB 1X5IA 3R1GL 3S8WA 4Y5XB 3DXAE 5L2KA 3RZWA 1BD2A 1JHLH 5IROC 3QUML 4QXGL 5CS7A 3FT2B 4QXTB 3L95A 1KJMB 3T0BA 1TVDA 4U1GC 4FXKA 2ICES 1QRNE 3S5LA 1GPOL 2FD6L 4L4VA 5IFJB 5BZDA 1KCSH 1SEBB 4RMUA 3LS5L 5LWYL 1FORH 3UO1L 2HWZH 1A7OH 5DFVC 4FQIL 4GRMB 4MX7A 5IGXL 3LDBB 1DE4B 4OAWB 4C4KT 4WFED 4NZUL 4G9FB 3M1BA 4TUOB 5DRZA 4DAGH 4FABH 3X14A 5MEOA 5JUEL 4QRPA 5FCSH 4LU5L 3MMEB 3MRHA 3PWUB 4LGSB 1LEKA 4WVRA 1N2RA 3GSXB 2VIRA 1HK6A 3F62A 4BUGA 3ARFC 3HUJA 5CEZD 3FQWB 3MYJA 5E8NB 3HUJF 2D7TL 3FB6B 5GRWA 2VDNH 2WNGA 3TM6A 3QUYA 3W9EA 3WEXA 5GISH 1UQSB 5BRZD 5J11C 3MSPA 3Q1SL 1SJHA 3QIBA 4KGLA 4PV9A 5GRYA 4JJ5A 5E8DL 2GIYA 1WBZA 1PKQA 4BSVA 4CGTA 5J56B 3S96B 4J3WA 5IW3A 4X0KA 1N0XL 5E5MB 4NT6A 3KXFA 4NC2B 4Y1AE 5J8OA 4W6YB 5C0ND 2FEEI 3MJ9H 1MHEA 5TQ2H 5AWNL 3ME0A 4XCYA 32C2B 1VACB 3G6DH 3GSUA 5SX5H 4P4RA 2PO6A 4F58H 3NN8B 4P57A 1UXSA 2X7LB 3Q48A 4NQSA 4P5MB 5D1ZC 1NCDH 4X80H 1FPTL 1HEZA 4EIGB 4KWUA 1AI1H 2VLRE 1QRKA 1NLDH 3ARVA 5D7JA 1PKOA 4R3SB 1YZZA 5JORB 5C0CA 3P0YH 2ZUWA 1UH2A 2J88L 3V6ZB 2C26A 1UH3A 2XQYK 2DQFA 3QPQC 4YAQB 4IOFD 4PRHA 1WFOA 4LCIL 1BD2D 3F58H 4NNPH 1E4WH 4M9PA 3EJZD 4ZTOH 2Q6WA 1SBSL 1WBYB 4NIKB 3EYFA 1J18A 2GJ6B 2QQLH 3HFMH 4L4VD 4HWBL 4NNXA 2HVJA 5T1KA 3ZE0F 3IXTB 3U7WL 3VXME 3DI2B 1P6AB 4XNYL 4L5FL 4B5EA 4YFLI 2ADJA 3WSQH 1AXSA 1D7FA 4XRCA 5E70A 4ALAH 4XNUL 2NY6B 3CGTA 3MRFB 2Z91A 4MDIA 2BVOA 2MCPH 1YQVH 4ELMF 2DJUA 4PJXA 4QRPD 5D2NC 4D9LL 1L6XA 1X5XA 4PJXF 1OAKH 1MHHA 3MCG1 1SBBA 1F2XK 4YZFE 3EDFA 3CXDL 4HCRH 5EO9B 5D7SL 2VXVL 4NQXB 2V2WA 3O4LD 3MGOA 4P9ML 1QUNA 1TCMA 1ZKAA 2NY1B 5IW1B 2ZSVB 4HFWB 3VCLB 3QAZB 3NTCH 3HZKB 2C5DC 3MXWH 3QUYD 1YEKL 4XP4H 3U4BL 3CFKB 1I1RA 4JRWA 3VD5A 5DYOA 2ARJQ 2AQ2A 2JKXA 3BP4B 1RZ8A 1MCEA 3QZWG 4PREA 1YMMB 2YUXA 3QA3A 3K3QA 4D8PA 3QQ3B 1A14H 4GXVH 4KAQH 3ZKQD 1A7PL 1JVKA 3HE7D 4CU7A 1R5VA 2G5BA 5F72S 3I02A 1JHTB 1EGJH 5BW7A 2PXYB 43C9B 1GC1H 4PB9H 5DMIH 4N8CL 2XRAH 1PZUB 3OWEA 1NC4D 4WW2A 4WW2F 1AD0A 3OPZL 5FHAH 5J9PA 1A0QL 4TUJA 5K9OA 2BJMH 2VQUA 4KQ4L 5HHOB 1ZANL 1WSST 5D7JD 1U8QA 2YD5A 3TNMA 2CXGA 5C0NC 4ZFFB 2VR4A 4H20L 5C0CD 4F7EB 4FQCL 3I75A 1CN4A 3MLXL 3L5JA 1FP5A 4YHNA 4LCUA 4Y4FB 1U8MA 5DLML 3GBNL 2HLFD 1NUNB 4RA3A 2NNAA 4QHNB 2W9DH 4YHYB 2VDPL 3WHE1 3QT2A 4PJFA 4PYHA 3QI9A 3UTPD 1NMCC 4PJFF 4Y4HA 3LKPA 1D9KA 3H9HB 3ZHLA 1F90L 4IIQB 2IF7A 1I1AA 3PWNB 1NGWA 4NBZB 4RWYL 2ZP0T 5C0DA 3ZE2E 4JGJA 1HYSD 1D5IL 2OLDA 4FFVD 2WP3O 5CJXC 4NQUA 3V5DA 5DC0A 1IAOB 3QEGL 5ANME 5H2BA 2GUOA 1P7HL 2IBBA 5F7FA 3TYFA 3GBMH 2EEBA 1DQMH 3PE9A 1CICB 5C9JB 5IIEB 3FRPG 4NZRH 1PJ9A 5IT2H 1NFDB 4IOFC 1G84A 1H3PL 1TZIB 2FYYA 4JPVL 1VFMA 3EJZC 5EN2B 2AJXL 3E2HC 2XTJB 2HVKB 4BH8A 4F7CA 2EH8L 4IRSA 1Z0NA 3RWDA 1OQOA 1DVFB 4GH7B 5TDPA 3QEUA 5BMFH 3MGTA 1K3ZA 3ZMRA 4R7NB 3WO4C 5DA0B 1RI8A 3OHXA 4QOKE 1EO5A 3G5ZA 3RP1A 1IM9B 4P46A 5D5ME 2OL3B 3BDXA 1K8DA 2EIDA 2AQ1A 3AREA 4YJZL 2W0FA 4Z7UB 5IFHL 2QQKH 3G6AB 3HG1E 3TBSA 2QKIA 2IH3B 1GGYA 4HGKC 1IVLA 3HZVB 1UB5B 1QFWH 1EH9A 4RQQA 4MZ2A 2FLBT 3QUYC 3B9EA 5I1JL 4C57C 1F6AB 3GMMB 4YGVB 1X5HA 2QLVB 3IT8D 5DRWB 3OR7A 3VFSA 4QRTB 4X6FB 4PLJD 4WV1B 2QSVA 3ZT5A 1G6RB 3QHTC 4OZIE 1D6VL 1BLNA 3GSNB 3M8OH 4BZ1H 4DGVL 5MHSE 4B41A 1MI5D 3IJHA 3CUPA 5ESVA 1AQDA 3HE7C 2BSTA 3VFNA 4F9LC 2HJFB 4RSVA 1HKLH