5D7JA

Structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
200
structure length
200
Chain Sequence
b'GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVMDSNFQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M33.64 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7jA02
4ZXBD 3O8XC 2A74A 2X4UA 4D9QD 4P46D 3S37X 2V2XB 4UT7L 2IPTH 2WWMD 5J6GB 3RX5A 3BD4A 1MRCL 3K8LA 4FQJH 4LKXA 5FYJU 4C57C 5ILTL 4Y7MA 4UBDC 1NGWB 1OT1A 1LP9A 3NMEA 4B7LA 1G7QB 3ZE0F 1NMAL 3A67H 5GRWA 4Y4KD 5KAQG 4JVUA 4OCXL 4PJAA 2OS7A 1BBJB 1VFOA 1IVLA 1NC2A 2FBOJ 3QFDA 4JY4B 3TH3T 3UAJD 1IM3B 3RJDA 1RUAL 4Z7OF 3GMPA 5DDHB 3W2DL 3RQ3A 1J10A 4OZHA 3RWEA 3QNYB 2PYEA 5IM7B 3GSQB 4EUPA 3QIUA 3M45A 1GSMA 1JPTL 4LGRB 4ZD3L 2DQHL 4NGHL 5DFTA 5JHDA 3TCLA 5IFAH 5I16A 2DAVA 3DROA 1F3JB 1ZE3C 4ELME 3P9WB 2A0LD 3M1BA 1SYSA 3RGHA 1G7MA 2YPLE 4WFHD 1MFNA 3WUWA 3HI1A 5JOPD 2XFXB 4R90H 4R3SA 3MLWH 3T77A 3AS2A 1DN0A 5TQ2L 3MODH 3V5DA 5F70A 5J9PB 3BZEB 4E0RA 3GO1L 5IMMA 2AQ2A 4JFFA 1NGZB 4NUJB 3L3JB 5DYOA 1SYVB 3INUL 3LS4L 1QKZH 4IOFD 4QHUB 4Y0GA 2CSPA 1GPOL 1UZ8A 2DS4A 4F58L 4K3JL 3LOWA 4XAKD 5F1SA 2CLRB 1ZA3A 2LU3A 5F7HA 2H26B 3OXRB 5IWLC 1A7QL 4HULB 5KSAC 1WIUA 3FQRB 4KMQA 3V5KA 5C09A 1Y18A 2XZCL 2XOTA 1N59A 4X80H 4F57L 4JKLA 1P7HL 4NP4H 4TSBL 1NGYA 4XCEB 3TBYB 2E7MA 2EYSB 2G9HA 4CN4A 4LEXH 2DBJA 5DD3L 3T3PF 4RGOL 2DMBA 3NAAH 5I2IA 3VXQB 4K7PL 3WIHH 3AS0A 4KMLB 3FO0L 5DR5H 1KEGH 1W72A 4I18B 5J1AA 3VXOB 4EI5B 4JCMA 3BT2H 4O2FA 2DMCA 2NLJA 1ZHLA 3PJSB 4JKKA 4LCWB 3P2TA 4NQSB 2VSDA 2A77H 1XR8A 1F02I 1ZS8A 5HGAB 1PQZA 2YWYA 4AK1A 4XNUL 2AS5M 5AWNH 2ZUTA 1LO2L 3ZHLA 1U93A 2X2YA 3R0NA 2D0HA 5JIKA 2ZOLB 2DB8A 2YPVH 1X5GA 4LQFH 4M62H 2N4IA 3ILPB 4EKXA 2GHWB 1CE6A 4A6YL 1BOYA 4OV6F 2HT4D 5F89A 5E00B 3ARFB 4RNRB 1Q1JL 5I8KH 4LSVH 5CBAB 4OIBA 4OZIF 5B38G 4MQ7A 4F9PC 5D7IA 5D70L 5FGCB 3HRZB 1RZ7L 4PR5B 3HAEA 1MH5B 2DQUH 4GAGH 2VE6B 4LRNH 1YPZB 3WS3A 2W0LA 5H94B 4NQUA 3MRFB 3FB8B 4CAGA 5DK2A 3WCYA 3VXMB 3WMSA 3OQ3B 3BP7B 2FJFB 2OJZH 5GGSB 2NY7H 3X12B 3SN6N 4LLUB 2W60B 5DLML 3WLBA 1WBZB 2D03L 1OQXA 4JM2D 4ZFZB 1S7UB 1VEOA 4UTAL 4YDJB 1QFWL 4HEME 1T21B 4Y5XB 4EBQH 1SHMA 4YFEA 3BKCL 3CGTA 3I9GL 4JRYA 3SKJH 1WBXA 4UT7H 3QWRD 4NFDA 3U83A 3S36H 2EEDA 2AK4D 2JB6B 1D9KD 1MRCH 4NKMA 3WL9B 2AXFA 1ZVSA 3SOBL 2X9XA 3R1GH 4PJ5D 4G8IB 2A6KB 4NCC2 5DD5H 4JPWH 1J12A 3DXAA 1LNUA 1I1FB 4FQCL 3S8WA 4J4PC 4X5XB 3NTCL 3RDTD 4XBPB 4PTUA 4QXTB 1RY7B 4OCXH 4P57B 1JE6A 4LVHC 5ISZE 1F4YL 2V2XA 1MREL 4HWUA 5J6GA 5B4MD 5ALCL 4OFVA 1EO7A 4YPGB 1IBGL 5MENB 2APWA 3MUY1 5D7JD 5EU4B 1RUAH 1NGWA 2QLVB 4JHBA 1OL0A 1AI1H 1G7QA 5GGUB 4N9OB 2MQ0A 3KYKL 1SBBA 3NPSB 4ZUSA 1HHJB 4ZD3H 2DQHH 4WIQA 1BBJA 3OWEA 2FHCA 3IU3B 3C60B 4P4KB 1OTTD 4OIIH 4YLQT 2G5RA 4WW2F 4X98B 5SX4H 3MLPA 1IM3A 5D2NA 3ULVL 5HI3C 1EA9C 2J8UB 5T3ZE 3ARTA 3GBNL 4UT6L 5IM7A 4Y19B 3OV6A 4ZSOB 5I66B 4EN3C 1B4RA 3VFPB 3STBA 1CD9B 1S5HA 4YE4H 2EO1A 2ERJC 2Y5EA 5MHSE 1F3JA 3BP5B 4U0QB 3MZTA 1ULVA 3GO1H 4RWYL 2V7HB 1OAKH 3INUH 4KTDL 1OD7A 4JLRB 5DVLA 1WZKA 1UEYA 2BHYA 2XFXA 3ARDB 4F58H 3GFUA 3BD5A 4K3JH 3VFSA 3HPLB 4PJDE 2WUCL 2AQ1A 4YDVB 2XN9E 4PRDB 1A7QH 2WZPD 1E27B 3BZEA 3VG9C 5GRYA 4BH7B 3T09A 3FCTB 2ESVD 4JB9L 3BKML 1IFHL 1RIVL 4NUJA 1URLA 5HVWA 1SYVA 1SJHB 4M4PA 1KGCE 4QHUA 4WW2C 2BVOB 4RZCB 3B5HA 4K7PH 4MD5B 2H26A 3FO0H 3OXRA 2COQA 5C0GB 3E8UL 5D1ZB 3FQRA 1RSFA 1OSPH 4XAWH 4NBYB 2KKQA 3W0WA 1HXYB 3HZYB 4XNZB 2QSTA 2QSCL 3C8HA 3QI9D 4XCEA 3TBYA 4JFDE 3WN5B 1CXHA 1ORSB 1QLFA 4XTRC 1FG2B 3UTSA 4EDWL 4PJXF 4ZQKB 3VFTA 4X6EB 4D9QE 3WXWL 1C7SA 3QDAA 3CAFA 4XHQA 4M7LL 3J8F7 2DLIA 3VA6A 4EI5A 3GKZA 5DK0B 1LO2H 5CUSH 5EBMB 3PJSA 5IHBA 3HC4L 4PBWD 4A6YH 1NDMB 5D7SL 3RTQD 4XWOC 4OLEA 5HYIA 4R4BA 5CMAA 4OF6A 4PGJA 1T3FB 2JCCB 4IS6B 4WFFD 4RMTA 1CD0A 4JO1L 2W07A 1Q9OB 4P5TC 1FAIH 3EOAA 4Z95L 1DQLL 1O0VA 5L9DL 1VACB 4UNUA 3IYLW 3U9PL 5KVGL 2ZOLA 1AQKL 3T4YA 4RAHA 3B83A 1B0WA 3I02A 2H2SC 1EFXD 2IAMC 5JLZA 3AREB 5E00A 3ARFA 4JN2B 4QHLB 4RNRA 2J3SA 2ITDB 5CBAA 4HKXB 3BDYL 2ADGA 4JFPB 1HDMB 5E99H 4P23C 1JPST 2LFGA 4L3CA 3ARGA 4G43B 5DLMH 3HRZA 5F9AC 2IFFL 4PR5A 3UC0H 3KYMB 1MH5A 3QIBB 3VXRD 2VE6A 4WFHE 2E7BA 4U1GC 1INQB 5JOPE 5H94A 4WHDA 1EXUB 1QFWH 3MRFA 3FB8A 3FO2B 4IOSD 3VXMA 2FJFA 4Y4HD 5GGSA 2HMIC 4LLUA 1HQRB 1P2CB 1OAZL 2XIDA 5K9OB 2W60A 2F5AL 2NTFA 3K4DA 3UBXB 3NBNA 3MV9E 1WBZA 1IQDA 2G2RB 5DO2C 3BKJL 1FYTD 1MJ7L 4R26L 4F37F 2DI9A 2CRIA 4ZFZA 1G9EA 1S7UA 4FQCH 1YY9D 4G6ML 4XAKE 1T21A 1TLKA 4Y5XA 2V9RA 2YUWA 4U1SB 5TDPA 1OM3L 3DX6B 1F4YH 1MREH 1NKOA 5F6IB 3WL9A 5ALCH 3WKML 4WCYL 1YNKL 3EJZC 1AGBA 4G8IA 25C8H 4WEUD 4J6RL 5I76B 1I1FA 4PJ8C 5EZIH 4KC3B 3ZT5A 3DLQR 4MAYB 1C08B 3BUTA 2XRAL 4QXTA 3STLB 4P57A 3I6LD 4PV8B 3M07A 3MNVB 1CGSL 3EBAA 3P30L 3S7GA 2NY4C 1GGTA 4YPGA 4BELD 5MENA 1XF1A 3DX9B 5EU4A 3ULVH 3WIHA 2LTQB 5EWIH 4PRPB 3GBNH 5GGUA 4KJQC 5IHZB 1Q72L 5ESAB 5F7YC 4Z7UF 1MCOH 1UKSA 5GRUL 4YH6A 5FM8A 3IU3A 3C60A 4P4KA 3SE4A 1CIUA 4NZUL 4A6YB 5IBUB 3ULUL 2J8UA 4Q6IA 3MJ8B 3NZHL 5E56A 1B9ZA 3V6ZB 4ZSOA 5I66A 5IJVB 5MEQB 3VFPA 4ODUB 1EK3A 5FCSH 4QOKB 5IB4B 3SDAC 2WUCH 4EDXB 5CHNA 2BSRB 5IB1B 1ZVHA 2HFFB 3BP5A 4UV7L 3TIDB 4Y16C 3D3VE 4JB9H 3BKMH 1IFHH 3MV8B 1IGTB 3NCJL 3EYSH 1RIVH 2ZG2A 5CS7A 3EO9H 4PJDF 5IGXH 4JLRA 2FATL 4WO4D 4QWWC 1ZTXL 2F53E 3CDCA 1UB5A 1CICC 2P5WD 2XKNB 3TBSA 3ARDA 3WEXB 3BSZL 4JKPL 3HPLA 2W0FB 4HGWB 4YDVA 1J9CT 1UEMA 1E27A 3E8UH 3FOLB 3CLEH 4BH7A 3MFGB 4O02L 5DTFB 3I75B 3OG4B 4LLMB 2QSCH 1SJHA 3U36A 1KLUB 3QT2A 1LO0H 1FLRL 2BVOA 2R29L 4NQCD 5DJ8B 4RZCA 3PP4L 3TPUA 2RB8A 1IMHC 4MD5A 2PF6A 2M26A 1T1YB 1KLFA 5C0GA 4HUUA 3WXWH 4KHXL 1FZMB 4PJIE 4M7LH 3HZYA 3BIKB 1DSFL 2AK4E 1BQHB 3F7VB 1ZGLM 3E1F1 4YGVB 1GGCL 2Y6SD 4PJ5E 4BZ2H 1CS6A 1ORSA 4TVPD 1FG2A 4YHOL 5E9DB 4JG1L 4ZQKA 4BZYA 1MCRA 5KSUB 5AZEL 4X6EA 2GQHA 5E8DL 3DI2B 3TVMA 5DUPL 2R69H 1YEEL 3C6LC 4GAJL 4M3JA 1DQLH 2CMRH 4QCIB 3U46B 5C7XL 3EJJX 3U9PH 5KVGH 5DD1L 1AD0B 1AQKH 4WI3A 5L0QB 1S7WB 4AIOA 1NDMA 1VKXB 2Q6WA 1T3FA 2YA0A 5L2KD 2E7LA 4IS6A 5EZOL 4OFIA 1VACA 3MUJA 3TF7C 3FTGA 4S1QH 1MI5A 5JPMA 2IFFH 3QDMD 4DVBA 2VZUA 3C5ZD 2X10A 1HEZB 2M1KA 1ONQB 3ZDZE 1NGQL 4LSDA 5DMGD 3FFCA 3R06B 5D9SA 4ZXBC 3AM8A 3D1MC 5DD6B 4QHLA 3CFCL 4MCYB 4LL9A 5D6CB 2WWMC 2ITDA 2DWDB 4HKXA 2OQJB 4RIRA 4S1DC 1CN4A 4JFPA 4J7RA 1HDMA 5H37G 5F9JB 2BOBB 2F5AH 1XF3B 3KYMA 1T0PB 2WWKT 3QIBA 4R26H 1UB6A 3F6LA 3W82A 1BF2A 1OTSD 4G6MH 2QQQA 4Y4KC 3FO2A 1OM3H 4I2XA 1HQRA 4DEPB 4JFYB 5K9OA 2ESVE 5HD8D 3UBXA 1MRDH 2W9DL 3NIGF 4WCYH 3UAJC 2G2RA 1YNKH 2VH5H 4ODHH 1KLGB 3DARA 3QUZD 4J6RH 1IAIM 2XA3A 5KJRL 2XRAH 1MCEA 4U1SA 4RAUA 4NWUL 3RVWC 5EB9A 3F7YB 4OZ4B 1YEDB 2A0LC 2X6MA 3WO4B 4FFZL 1CD1B 1BEYL 5I76A 4I8DA 1Q72H 2DQCH 4MAYA 1C08A 3QRFM 1CVSC 3STLA 1H3WM 4P2RA 2ATKA 3OF6D 4PV8A 5GRUH 5HDBF 3MNVA 3HE7B 4ZUVB 2DYPD 2ICWJ 2GSIB 2VR4A 4WGWB 2ICEB 4ZFGL 4YHIB 1NBVL 4NZUH 3V95A 1RZJL 2JIXD 4GBXB 3ULUH 1N2RA 4IOFC 4P9MH 4WU5B 5IHZA 1T0MB 3KGRA 3E2HB 3Q1SL 2HLAB 2DTSA 4KY1L 4BQBA 3NACL 5HI5D 4WFFE 5HHMB 5D1ZD 1MHHB 1J0YA 3VRIA 4A6YA 3AGVA 3NCJH 4GRWF 3MRBB 5FCUH 3MJ8A 3L3IB 5K9JL 3V6ZA 1RQ5A 4BZ1H 5CCKL 2FATH 5IJVA 1ZTXH 2X70A 1HHGB 4ODUA 5E8EB 4KTYA 4JKPH 4YXKL 5IB4A 3O3DB 4EDXA 1T7WA 1KIRA 2BSRA 3BDXA 5IB1A 2HFFA 5CGMA 3BRGC 3TIDA 5JA9A 3NCCB 3MV8A 4OT1L 4M7KL 3VE0B 2JELL 1KCKA 3MJGX 1WT5A 3VXRE 1YMMB 1FFOB 4EOWL 1FLRH 1K8DB 4P5MA 2R29H 4Y88A 4PJAF 3SO3B 2W0FA 4NRXB 3RZCD 5T3XL 2GYSA 1H8OA 1FO0H 4BFBD 3H7BB 4KHXH 4YJZL 3QPXH 4H8WC 1ZXQA 3TJEL 2O5YL 1DSFH 4CMMA 4H1LH 4AIZA 3I75A 4OZHF 4LLMA 3EGSA 1GGCH 1KLUA 3PWNA 5FXCH 1FYTE 4M5ZL 5FEBA 3TO4B 1AKJA 1OCWL 4U6TA 5DJ8A 1QFOA 1YMHB 4Y2DB 4YHOH 3ZHKA 4L8CA 1PLGL 4JG1H 1U8MB 2ZUWA 1OQOA 5I17A 1UADC 2C1PB 4NO0D 5AYQA 1FNGB 5DUPH 5EUOE 3BIKA 1YEEH 3F7VA 1BQHA 3PGFL 1LE9B 4R0LC 4GAJH 4FG6D 3WFDH 1U8JB 4YGVA 3V6BR 5C7XH 1B0GB 1OP9A 5DD1H 4Z7WE 4E5XB 2HVJA 3HR6A 4MHHI 5E9DA 3LDBC 3C08L 5KSUA 3U7AA 3PV6B 3I6LE 5C0CB 5EZOH 2BNQD 4QCIA 3U46A 4I3RL 4MS8D 4ZS7L 1YECL 1AD0A 3K3QA 3U7YL 4MNQD 1S7WA 4L8SC 3TYGL 2OP4L 1NGQH 1VKXA 3IJHB 4QHKI 4RWHA 2IGFL 2AGJL 1BHGA 3CFCH 1T1XB 2P42B 3GMNA 4F33B 1SVCP 3SDDB 5GHWL 5IW6B 1D9KC 1I1RA 4WENB 5IMLB 2GY7B 3CCHB 1A64A 1RHFA 5IVXE 3WJJA 1ONQA 2JTDA 3PWPB 1T1ZB 3RVVD 5EU7E 1JZ3A 3RDTC 3R06A 3TP4A 2WBJC 5DD6A 1KJVB 5D6CA 1XFPA 1QD0A 2HFTA 4BQCA 4WW1B 3S35X 3QQ9D 5B4MC 5F9JA 2BOBA 1FIEA 2Q3AA 2W9DH 4CVUA 2WQRA 5D7JC 2ZSVB 4PJ9D 1XF3A 2FEEL 1I8MA 1KT2B 3RWIB 3AVEA 2R2EB 4PRPD 5FO7B 2P5WE 3RWHA 4CMHC 5AD0A 2Z31B 4JFEB 4NOFA 1YNLL 3RGVD 4OD2A 3LQAC 3P9LA 4O9HL 1GGUA 2AW2A 4JFYA 3O4OB 2Z9TA 3I85A 4LCIH 3TA3D 1FRGL 1KLGA 3REWA 4IJ3C 4FFZH 1BEYH 4NQCE 1RZ8B 2R56L 1ZWIB 5EUKA 4NQVB 1RUQH 5TDOA 4H1LB 2N56A 4G7YH 3R8QA 2DL9A 4QOKD 3UMTA 5D7IF 3F58L 1FFNA 4OZ4A 1AE6L 1YEDA 4Y1AB 2X1PA 1JF5A 3MCG1 1RZJH 3BD3A 2FO1A 1CD1A 1EO5A 4V2CB 2EYRB 2ICES 3UPRA 1G84A 4KTEH 5DQJA 4HIXH 4KY1H 1FAKT 3QG6B 2AJXL 3NACH 4ZUWB 1CCZA 3HE7A 3QCTL 4ZUVA 2FCBA 4G8FA 1T7VA 1LMKA 5J3HD 5DWUL 5F1NB 4ZFOA 3WFBL 4LPXA 4HK0B 5SWSA 3VGHA 3BN3B 3WDIA 5K9JH 2ATPB 3TNNB 4V1DB 1K6QL 1P1ZB 5CCKH 2VUOA 2HLAA 1RPQA 3D85A 3LKPA 3Q3GB 2XI9A 4YXKH 3GHEL 2YRZA 1PX3A 3U9UA 4LPVA 2YMXL 1FH5H 1MHHA 2QEJA 3O6FA 3JTTB 3CD4A 4GRLD 3NCFB 1BZ7B 3PQYD 3QRGL 3MRBA 4M7KH 5F7DA 3QI9C 3QDME 4FTVD 5B38B 2H41A 2I9LB 4EOWH 3TH2T 1HHGA 5E8EA 5AAWA 3ALWA 1NANI 3VGGA 3O3DA 5T3XH 1A7OH 5HVFB 5CGTA 4I77L 3VW3H 1HH9B 1HIML 3TN0D 1JIBA 2O5YH 2PO6B 1MAKA 1LQSR 3VE0A 3SGJC 1GRWA 4QRRB 1X5AA 2VMFA 3OKMA 4QRUB 1VGEH 1YMMA 4N8PA 1FFOA 1K8DA 1OCWH 3IXTB 2DOCA 1JGVL 5HI4D 4PLNC 4NRXA 4I0PD 1PLGH 1YN6B 1KPRB 3RTQC 5JDSA 1I8IA 2E27L 2KL6A 3VXUD 1KTKE 5DMJB 2ILLA 1H3GA 1S5IL 3BZ4B 2XWTA 3UP1A 4YK4B 2DF3A 4LNRA 4BSVA 1P6FA 4UIKL 3TO4A 1YMHA 3DX7B 5EU6D 4Y2DA 4AG4L 4E41B 3C08H 4MSWB 5JIHA 3N1GC 4P59H 1U8MA 2AXGB 4R2GB 4S2SB 2J8OA 2C1PA 2VOTA 1NUDA 2XKSA 4G9FB 2BNRD 1ZSDB 1LE9A 1MVFA 1U8JA 4I3RH 4ZS7H 5JW4Q 4E5XA 1YECH 4M4RA 4LMQE 1RZKC 4G6FB 3WE6A 3U7YH 3TT1L 2NXZB 3EO1B 4MMZC 2OP4H 2QQNL 5DF0A 4ZYKB 3PV6A 1I3RB 2AGJH 15C8L 3MRIA 5C0CA 2E3VA 2C5DC 4HKBA 2GTWA 5JXEA 3O2VL 2NY2B 5GSRB 4R9HA 4DZ8B 4XBGB 4EIGB 2ED8A 4GKSB 1HH6B 5CEXA 3SCMB 1YY9C 1XGTA 4OI7A 1XGRB 3IJHA 5FFLA 5J6HA 1JI2A 4ZUUB 4F33A 5IW6A 1K4DB 5FGBC 3MA7B 5IMLA 1QRNB 4LCCC 3I50H 3GMRA 1QP1A 2VTFA 2VLJB 3PWPA 1T1ZA 2PUQT 3P4NA 4KKBD 1YNLH 4JRXB 3O6KL 3RY6C 1KJVA 4QLRA 1UXWB 4WW1A 1H3UA 1NLDL 4NNYB 1MCDA 2W9LA 3IETB 3GUTA 1BWWA 3EYUH 2J7LA 5T1KD 2ZSVA 1FYHB 4AYFA 5E2VL 3UO1H 1FRGH 1DDHB 1KT2A 3RWIA 2R2EA 5FO7A 4NNPH 2YRPA 2R56H 1BFVL 4K94C 2VC2L 4XXCA 3ARXA 2F8VA 1NCNA 3CVIL 2BCKA 3QUKA 3MLXH 1E6JL 1AE6H 3U2SA 1RZGB 4S1RL 3ZE2F 1CL7H 4MLIA 2IEPA 2I5YL 1FO0A 1RUPL 1RZ8A 2CDGB 1ZLUH 2CUMA 1ZWIA 4NQVA 4G8GB 4RBPH 5EU7C 5HYQB 4H1LA 1F13A 1T89A 3MRGA 4U0RC 3SE9L 2AJXH 3N06B 2F58L 3QHZH 3QCTH 3V0VA 3W5NA 4Q74A 3VWJB 1B6UA 5DWUH 2BX5A 3WFBH 4I18C 4UIMA 2OMBA 3DSNA 5D7KE 1YPZF 1CXEA 4G5ZL 5M94B 4R96A 2EYRA 4APQA 2X89D 4OD3L 1K6QH 5LBSH 4DKDC 1U8OB 2VDQL 2AAVA 1U91B 5I1AB 5D5ME 4ZUWA 3GHEH 4TSCH 1WCQA 3FN0L 5F1NA 5DSCB 4RFEA 2YMXH 4L29B 4KVCH 2BNQE 1QOKA 4HGMA 3FQTB 4HK0A 5D93B 5ADPL 3QRGH 3SE3A 5EOCJ 1KC5L 1AGFB 3TNNA 4V1DA 4MNQE 3NFSH 4CJ1A 4KKCD 1BP3B 4UB0L 1YYLL 5I8OL 2FSEB 3Q3GA 1CDYA 4MZ3A 3RX8A 3MUGB 4PS4H 3O4LD 4I77H 2X4SB 4PGDB 4PJEB 5C07B 1GGIL 4RGNB 4S10A 4K7PY 4X4XB 4JE4B 5HHXL 1GZPB 1KJ2L 2Y6SC 1Z2KA 2VLKD 3E3QC 3HC0A 2ZG3A 3U4AA 3IDYB 1JGVH 3LN4A 5HDQL 1TPXB 5HDLA 2E27H 5D8JL 4N0CC 4M1CD 1AQDA 4ZTPL 3BZDA 1S5IH 4WWID 1RZFL 2PO6A 4N0RA 1NCAL 3K1KC 3T08A 5GRVL 3TBVB 1G9MC 4OUOA 4QRUA 1KULA 4BK5A 1YUHB 4UIKH 3IXTA 1FCGA 4UOW1 4AG4H 4Z0BL 1FP5A 4OCNC 4OM1H 2VJXA 1C12B 4AL8L 4M5YL 3V0WL 4HWBL 4YZFE 5EO0B 1IC4L 2R0KL 5J11C 3Q6FB 3DX7A 1PKQB 5CIPB 3TT1H 2F5BH 3QUYA 4AMKL 4E41A 4GW1B 4PV9A 2QQNH 3BGMA 4HMEA 4PRNA 4S2SA 4ONFL 3MOBL 5C0BD 5KSBE 2F74A 1ZSDA 4L9LA 1UCBH 3CFKB 4O58H 3LB6D 1HINL 2YZ8A 1A6WL 2IFGA 3O2VH 4JFZL 4NRYA 3EO1A 3BQUB 2Z92B 4W6YB 2P45B 3EW3B 1F2XK 3NPSC 1N0LA 1AD9B 1HYRC 3HS0B 3TO2B 5FDWB 4NN7B 3SDXB 2IWGA 5B8CA 5HD8C 3G9AB 3SE4C 3L3KB 1NC2D 5A2KH 5GSRA 4OF5A 1UJ3A 4U6YB 4DZ8A 2DWEA 2EIDA 3SCMA 4KUCD 2PW1A 3HFML 1XGRA 2IH1B 4NKDB 4H25B 4UOJA 3LKRB 4Y5VB 5JHDD 2VDLL 1QR1B 5EDXA 4OF7A 1K4DA 1SQ2N 1CR9H 3MA7A 3PQYE 3T04D 1JN6B 1YYML 5E2VH 4FTVE 4GG6B 3MRPA 4W4OC 5KS9A 4LSQL 3BUYB 1S9YB 4WTZG 5DHYB 4PGBB 1S78C 2VC2H 5KANG 3F12B 2OTWB 4UT9H 1UXWA 1A1MB 1MJ8H 2CLVB 4U1MA 4L8DB 4M7LT 3LEYL 3OGCA 4IHOB 1REIA 4NNYA 4NC1E 4HUWB 3IETA 5CINL 1CXLA 4RAVB 4UQ2B 4FA8A 5KZCD 2I5YH 1DDHA 2PR4L 1A2YB 4NJAH 2JCCF 3X3FL 1TJIL 1HHIB 3VXUE 3SE9H 1JPFA 1KB9K 4M43H 5HYJB 4OLUL 5D1ZC 2P5EA 1RZGA 1CLOL 2V5TA 4G5ZH 2HTKD 1J05A 4QRQB 2CDGA 4NYLB 3WN5C 2YC1B 4KJWD 4G8GA 1D5BA 4LVOC 3QXAB 2FLBT 4FHBD 2VDQH 4YXHL 5JIPA 3HNTL 4MVBD 1GIGH 4ZNCD 2BRRH 3EOTH 2YUXA 5DFWH 2MCG1 2YA2A 5I8CA 1R5WB 3KLDA 2R2CA 5ADPH 1CQKA 1F4XL 1KC5H 4KK9D 5F97E 5JR1L 2CLZB 3FN9A 1J0IA 4UB0H 1I9RL 1YYLH 4KKLD 2X1QA 3CDYA 4BFIB 4HT1L 1U91A 2D4FA 5I1AA 1CF8L 2OSLB 1B3JA 5E24E 1EZVY 4L29A 1GGIH 2EO9A 3PDDA 3C5JA 1BWMA 1QSZA 4K9EH 1YEJL 1QSED 1QBAA 1U42A 2QADD 1KJ2H 1FC1A 1AGFA 4OLYL 5GZOD 4XT1C 1BQSA 2W92A 4LSRH 2FSEA 4GMSH 5HDQH 5JORB 5BW7A 1Q8MA 1OB1A 1RJLB 4HJJL 4PGDA 2X4SA 1KXTB 4PJEA 3AREC 3ES6A 4UDTA 4X4XA 1MCJA 3EHBC 4KVNL 4ZTPH 4YAQB 1RZFH 4FG6C 1NCAH 1OSZB 1QSFB 1UWXH 3T3MF 2MPAL 3PWLB 4I4WB 3PIQB 5FKAB 4Z0BH 1B2WL 5DVNA 3UTZA 3WXVH 3D2UD 2VDNL 1KYOK 3NIFE 3EYQC 4B5EA 3MX0A 4AL8H 1UA6H 5IFJA 4M5YH 4MXWL 3RRQA 3V0WH 3TBVA 5J57B 4MS8C 4PJFF 5EPMB 1IC4H 4WU7B 1JGEB 1ZANL 2VZSA 3EOYG 1YUHA 5ID0B 3NZ8B 3T2QA 2WSKA 3L3GA 1NBYB 3PWVB 4HZLB 3K1DA 4AMKH 3H8NA 3NN8A 4LHUB 3VI3E 1CFVL 4UUJA 1ADQL 4MQTB 3MOBH 3HKFA 4YZFF 5ANMB 4KZEH 2EDHA 2UZIL 4GLRH 3CH1B 3KPRA 4JRYD 5CD5D 4PJGF 4RGMB 5EO0A 4D9LH 1J86A 1HINH 1TTUA 1A6WH 1ACZA 4L1DA 4JFZH 3VG0L 2HWZL 5HGDB 4GW1A 3RVVC 3IFLL 4JY5L 4LIQL 3DXAD 5DJAA 5CP7B 4R6UA 5IBLD 3VH8B 4GW4B 3MJ7B 5ESQB 3CFKA 3GIZH 4FQPA 1EH9A 4PJ9C 4OB5L 3GKWL 2B7DT 3BQUA 2BHZA 5FYJL 2Z92A 3OKOB 1MCSA 3HFMH 5F7EL 3MBEA 2BC4A 1IAKB 4HK3N 4FRWA 3MRNB 3MO1B 1YN7B 5AG8A 1UCTA 5JXAH 3TO2A 4HH9B 4F7PA 1JYVA 2VDLH 5J56B 1JGUL 5DMIH 3L3KA 1ZT4B 4NQEA 4QRPA 1JZ7A 4U6YA 3TA3C 1BAFL 5F8RC 1YYMH 5MEPB 4LSQH 5FA4B 5CGYD 1TITA 2HLFC 2IH1A 3ZHDA 4PGEB 1Q0XL 4H25A 4NKDA 3UBXI 1WGOA 3LKRA 3O4LE 1KJ2B 4Y5VA 3VRJB 3LEYH 3RFZC 3MRQA 1QR1A 4WFEE 5ICYB 5CINH 1ZHKB 2Y25A 4MJIB 2VXUH 4PJBE 4GG6A 3R4DA 2PR4H 4H26B 5E2UL 4YDLB 2VLKE 3D39D 3DVGB 4PGBA 1WT5C 1JF1B 3LMJL 4HPOH 3F12A 3X3FH 2OTWA 4LOUD 5LJYH 1UT9A 4R4ND 2CLVA 3QUXB 1S9VB 1UQSB 5J3HC 4OLUH 4HUWA 1S7TB 1CLOH 2IH3B 4O5LL 4UQ2A 3VMOA 3PDOA 1DUYB 4WWKB 4K3EH 5HYSB 2J2ZA 5I73B 3ULVF 2FYYB 2H3NA 5J1TC 3FHAA 3VD4A 1MAML 1TJGL 1DQJB 1FV1A 4YXHH 4NFBA 2AXHA 3B9KD 4N0UB 4PJCE 5IP4A 1CVRA 1S7SA 1XIWD 4JDTH 4YHKL 4NIKB 1DBBL 3VD3A 4TN9A 1KJMB 4FFVC 4MCZB 4RFOL 1RHHB 3W0WD 1F4XH 1QZ1A 4LARH 4X7TB 3HMWL 4LDEB 4YIQB 2YD9A 1RULH 4HMCA 2E6QA 5JR1H 1N5YH 1I9RH 3J7HA 5TF1L 4HUNB 4HT1H 1CF8H 5FUOL 4Q9RH 3UTSD 5C0BE 5A2IH 2W0PA 1VFBB 1AO7B 2PXYB 3VRLF 4OCLC 3ARBB 1MCQA 1R5WA 1YEJH 5FYLE 3HNSL 3NIDE 4X9IA 1BFSA 1JGLL 4ISVB 1DVFA 1KFAH 2CLZA 2CR3A 5HI4C 5L0QC 3QXUA 4BFIA 4RBPK 3IDXH 4DFHA 2OSLA 1JHKL 3O9WD 3PUCA 1IZJA 1SJEB 4G3YH 4PLKD 4UOW0 2WP3T 3T0EA 3KS0J 5I1IL 4QO1A 4KVNH 4C56D 2YOCA 1BVKA 4DKEH 4YUEL 3VDBA 1KG0A 3WNLA 3CU7A 3HE6A 2GSGB 2RQ8A 1XF2B 2MPAH 2PYEE 4LEOB 4MNGB 1J0HA 1RJLA 1QFWI 2CD0A 1DBKL 1HN1A 5JHDE 3IFPB 1DBJL 1GL4B 2I26N 4YAQA 1HCVA 1EEZB 2GTZA 1OSZA 1ZANH 3I6KB 1QSFA 2G75B 3NIFF 3EFDH 3PWLA 1AHWA 4ODSL 3WO3B 1Z5LB 3IU4L 3PIQA 3BVNA 5FKAA 1J8HB 1GC1C 3NPZB 1CFVH 4LCYB 3SJVB 4M02A 1ADQH 2Q3ZA 3LSOB 1OGAB 5D1XD 1D5IL 2UZIH 2VXVH 4PJHB 4DEPC 4OLWH 5EPMA 3C09B 4WU7A 2DBLL 1X5JA 3Q5YA 5GGTL 3VG0H 5ID0A 2JJSA 5DHVH 2YN5A 1NBYA 2MTPA 4HZLA 4FS0A 4UU9A 3MYZA 3T1FB 4LHUA 4JY5H 2XG4A 1GAFL 3LV3B 4ZS6C 3CPLA 1I3UA 4LFHG 2ADIB 3NCMA 4HKJB 2VDOH 1ZKAA 1FDLL 5C09E 4OB5H 3MCKB 3MNWB 3H9SD 2IBZY 3GKWH 4FMKA 1P84K 5FYJH 5F72S 5FHAL 4KKBC 4KGJA 5DXWA 2GT9B 3KWWA 2IBGA 5FAAA 5F7EH 4ZFFB 5CP7A 1RJYA 4GS7B 4GW4A 5LVEA 3MROA 4J12A 1I85A 2FJHB 3MJ7A 5ESQA 1JGUH 4F7TA 1MVUB 3S3JA 4DN4H 5ID1B 4XNMA 2I07B 1QPPA 2ARJQ 4KPHH 1KF9B 1BAFH 2VQTA 4PREB 5ECJE 5TE6L 1IQWL 4OBSA 4GBXC 2MOVA 4X0KB 1CT8B 3N1FC 3OKOA 1V5JA 3O6ML 3E2HC 1IAKA 2Z35B 3CLFL 5K59E 4ESKA 3MRNA 7CGTA 3MO1A 1A3QA 3TGXA 3DURB 1CWVA 3QWOB 4HH9A 4H5SA 5IV2A 3G9VA 1KJ3L 4TULL 1M7DB 2ADJB 2P43B 1ZT4A 1S8DB 5I1CH 1FSKC 2B5IC 3O8XB 5MEPA 5BRZB 4QNPE 2J6EH 5E2UH 1DN2A 5FA4A 2FZ3B 4LRIA 3LMJH 4POZD 3ZDYE 5FYKH 2XACC 4X6DB 4PGEA 2FNBA 1KJ2A 3KPQA 5GJTL 1N4XH 1RURH 5E8OB 1T5WB 5ICYA 4XCNB 2EC9U 1FZKB 1VADA 3L1OL 2D9CA 4MJIA 1KCRL 1GZQB 1IGMH 4O5LH 2WBWB 3RVTD 2VIRB 4TNWF 4OLVL 3DVGA 2CO6B 2VWEE 5KAQF 1MAMH 3S98A 3SO3C 3QUXA 4GFTB 1KN4L 1U8LB 1S9VA 2XQYK 1UQSA 3SPVB 5E95B 3FO1B 1S7TA 2C3WA 5E8PB 4YHKH 2IH3A 2H2PC 3OX8A 4UDUB 2N7BA 4WWKA 5HYSA 4FQXD 1X7QA 3HMWH 4PRIA 3OZ9L 1FG9C 5TF1H 4M8QA 4JJHA 3ULUF 3BPCB 4Y2DC 1JZ2A 1VGKB 4N0UA 1AJ7L 4Q9CA 1F3DH 4HAFA 4JANA 1FL3A 2KZ1B 5DHVB 4JRYE 2FD6L 2BXYA 1QFPA 4MCZA 1QHPA 4Q7DA 5HPMB 3HNSH 4IRJB 4QXUH 1JGLH 4X7TA 5DZNA 1EPFA 4YIQA 3VFGH 3VCLB 3NFNB 5CJOL 2B1AL 1FHGA 4NHUA 3ZDXE 1E4XI 3DXAE 2BVPB 1VFBA 4NRZB 1AO7A 2PXYA 4PP1D 3Q5OA 5I1IH 3TVMD 4NO5A 4ISVA 3NCYS 1QG3A 5IW1B 4JG0H 1CI5A 5D2LB 5DZLA 5KSAB 2DKUA 5EZJB 4P5KA 3MRJB 2M2DA 1SJEA 1YY8B 1DBKH 5ITFB 2AJVH 5LWYL 2R15A 5TPWL 3SDDC 4KUCF 3ARWA 5GS0L 1S3KL 5D2NE 1CIDA 3QDGA 1ZAGA 1MJJB 2C3GA 1MI5D 3QO0B 4FXKB 1XF2A 4ODSH 3CVHL 4JDZB 3IU4H 4MNGA 5TF0A 4PB9L 4C4KO 4FQHB 4JZOB 1VFAB 1D5IH 4KK8D 1T83C 3GNML 3VDAA 3WJLA 4WV1B 5I1JH 5CBEB 1K3ZA 1WAAF 3S37L 2RBLA 4JPKH 1W0YT 1Z5LA 1KXVC 4K2UL 2Z31C 3JZ7A 5T1MB 1GAFH 3ZKQD 1OGAA 3VXTA 2DJSA 4X4ZA 1MEXH 4PJHA 3KNBB 4Q2ZB 3I3BA 2MJWA 1CXIA 4BM7A 2WINB 5GRVK 3SKOB 1FDLH 2IANB 4MYWB 1VB9A 3VWKD 1ZEAL 5D6DA 1UWXK 4MLSA 3QZWA 5GS1A 3T1FA 5FHAH 1A1NA 3PHOA 4JZJA 4Q9QL 1IC1A 4XPHL 1T89C 1A21A 2MQCA 4DJMA 4OCWL 2ADIA 4HKJA 2XWJB 3LKOA 4XP4L 4RISH 3B5GA 4DAGH 3W0WE 2Y36L 3MCKA 1IQWH 4I9WE 5E5MB 5SX5H 1V3KA 2XPGB 3IDIB 3O6MH 4ZFFA 5L8KB 2GKIA 3CLFH 3MLVH 3UTSE 1Z6JT 5E1HB 3FQUB 1LDSA 2XQBL 3G6JB 4P2RD 3RBGA 5FO8B 1KJ3H 3OKEB 4KRPD 4TULH 2F54D 1U3HA 3BIAX 4BH8A 5T3ZL 4PREA 3NOIA 3OB8A 3S4SB 2ZWLT 4HCRL 3KXFB 4X0KA 4U1IA 1IEAB 4NQDB 2Z35A 2OYPA 4PD4J 2DM7A 4FOMA 4OLZL 1Y6MR 3QWOA 3AU1A 4XRCA 5JO5A 5GJTH 3QXWA 1IJ9A 4QNPF 3HMXH 5IKCA 1CFBA 2ADJA 1S8DA 4C56E 1I1AD 5JZ7C 2AJYL 3S36X 1N5AB 2FO4B 3O8XA 1NCDH 2BDNL 3CMOL 2DLGA 2HTKC 3QDJB 4RMRA 1TVDA 2FZ3A 2UWEE 4MZ2A 4P2QA 2FDBP 4RMUA 4YWGL 2EDDA 1KN4H 5I30L 1FVEB 5E8OA 1T5WA 3BJLA 5F7NC 4XCNA 2VLRB 3ARBD 1GZQA 2PO6C 3L5IA 1MCPL 2VIRA 5F6HJ 5CZKA 4KK9C 2KZWA 1T04B 3OZ9H 1FFRA 2ARWA 4KKLC 1R0AL 3NCEB 1B4JL 1EEUA 1R3JB 3FT4B 1U8LA 3U6RB 3PXHA 3SPVA 4J3UA 3L7FB 3FO1A 3N85L 4Q9BA 2FD6H 3B43A 2BFVL 4UDUA 3PGCB 1WJ3A 2QADC 2CIKA 3P4MB 5DRNB 1KIQB 3VD7A 1ADQA 3RHWK 5GZOC 1RUML 5BV7L 5CJOH 2B1AH 3BPCA 1AKJD 5FF6B 1H0DB 1R5VA 4MA3A 5C6WH 3MCLL 1I7TA 2RGSA 4XCFL 5DHVA 1GJIA 3B8YA 2JJVA 5HPMA 1TTGA 2P47B 3MRHB 1FVDB 2LABA 2EDBA 1WCBB 4U1JB 2NPLX 3VCLA 4L1HA 4D0BB 3NFNA 2VWEC 1MCIA 1CK0H 1IILE 2ZUXA 1P4IL 1EGJL 1TVHA 1HHHB 2DI7A 1J8HD 2BVPA 1DEEB 4NRZA 2F8OA 2PYFB 1RZJC 5EBLA 2P1YA 4MJ6B 5TPWH 3UCRA 1TMCB 4P4RA 4WI7A 3IVKB 3IAPA 5GS0H 2NY2C 5DUBB 5IWLA 1LO3H 1NBZB 4I1NB 5F9DC 5KSAA 3P4OB 4KV5E 1XGPB 5EZJA 1JZ8A 3CVHH 5K9KB 3MRJA 4ELMB 4HG4J 2FGZA 1YY8A 3NFPB 4OFYD 4G6JL 1X5YA 4NCDA 5CJQL 2CKBH 1TTFA 5ITFA 3GSOA 2YPLB 3GNMH 2D7TL 5CD5C 1L7TL 3C2AL 3U30C 4ODXA 5H35B 2FRGP 2F8XC 1MJJA 3QO0A 1X44A 5KSVA 4HDIB 4QHKJ 5C9KA 4K2UH 5J89A 4FQHA 3O41A 3VXSA 3X3GL 3K46A 1JV5A 1VFAA 5IBLC 2J6EA 1TZHB 5IOPB 1VFMA 1UM6H 3IFNL 5E94B 5CBEA 1JYXA 4JVPA 3SDCB 1WQVT 2KH2B 3RWJA 1XH3B 2ZUSA 2NY6B 3FB7A 5FM5O 4Q9QH 2R1YA 3WNKA 1A3LH 3GIVB 3O2WH 3AMLA 4XP4H 5CLTA 5E1AB 2WINA 5AUMB 3SKOA 3W11D 2P24A 1RFDL 1NGPL 3MSPA 2KQNA 3RI5K 2A6JB 5CGYC 4F9PA 4PJEF 3SO5A 3BH9B 3OJDB 4U1GB 8CGTA 2OR7A 2XWJA 3VWJC 4U1LA 2O93L 4JQIL 1A6TA 3KYNB 5T3ZH 3U0WL 4HCRH 1CLYH 4O2EA 2WIMA 3V7AG 2XPGA 5GSVB 1IT9L 3F6IA 4O51B 3DHJA 5TGBA 4R4NC 4DVRH 4OLZH 3FQUA 3MRMB 3DTXA 3OKEA 1BIIB 1VSCA 1T2XA 1ZLWK 3BGFB 3UJTL 1CDBA 5D93C 1B6DA 3RUGF 2VZVA 3S4SA 5I1KL 5I1EL 3CMOH 5SWSD 2FEDD 4M48L 2LU7A 5B21A 4NQDA 4CVXB 2B1HL 1CLCA 5BS0B 1JRHI 4YWGH 5SV3A 4JFHE 3B9KC 1MPAH 3D85D 1JPSL 5BW7C 5I30H 2H32B 4OZIA 1XIWC 4KDTA 4S0SD 3ULSB 1IL1A 2F19H 4HFWB 4J4PA 4RGNC 4NM4L 1N5AA 3CVHB 4XXDA 2IMMA 1FZOB 2OBGA 3O6FD 1AGEB 1MCPH 1N6QL 1TCRB 3BP6A 4Z0XA 3A6CH 4GW5B 1MI5E 3ARSA 2QHRL 3LKNB 3QQ4B 3IDYC 1R0AH 2CIIA 1HQ4B 1FVEA 3FFCE 1NC4B 3RVUC 4HMDA 1BVZA 3ZLQC 2VLRA 5KG9B 1M7IB 1RJZB 4WHYG 4NHCL 2EDLA 1T04A 2EIZB 1RUMH 5BOPA 1KCUL 2ORBL 1IAOA 1R3JA 3MGOB 4ZDHB 3SDXF 2VXSL 5EIIB 2X4OA 3L7FA 1B88A 4P49A 1BJ8A 3MCLH 4EN3A 4I2XE 1J87A 3C8DA 3JV0A 3P4MA 1KIQA 5ISZB 4P3WA 4OCMC 4RDQF 3QIWD 5FF6A 1H0DA 1P4IH 4FZEL 2BY2A 4ERSL 2WLZA 4D3CL 1TJHL 4HLZG 1CICB 4GG6F 3M8OL 4JQXC 2NY1D 2CRMA 3MRHA 2EIBA 1FVDA 3E6HB 3NVQA 4U1JA 5LGJA 1CDHA 3TT3L 4JDVA 1F4WH 5EULV 2PN5A 1IM9B 4Z7NE 3W81A 1HHHA 1I8KB 1DEEA 4G6JH 2PYFA 5CJQH 5D1XC 5L6YL 4P2RE 3WDHA 4MJ6A 4YDKH 3Q48A 1SM3H 2D7TH 4NN7C 3OJ2C 4P9HL 3IVKA 3C2AH 4MB4A 1CGXA 1Z9MA 4MWFB 5DUBA 1NBZA 3IDGB 4FFYL 2IAND 3D87B 3ZKXC 3P4OA 4BSWB 1C5BL 1XGPA 2FEEI 5K9KA 4P2OD 5IHUL 1NH6A 3NFPA 5C0AA 3X3GH 4WNQB 2CJUH 5B39B 4OV5B 3X13A 3L7EB 2YD1A 1D6VL 5HHVH 3IFNH 4PJDB 5H35A 1DLFL 4D94A 2XN9B 3BPOB 4RCAA 4HDIA 1MHPL 3C6LB 3HMXA 3BDBA 5HHNA 4J23A 3PL6B 2DI8A 4L4TD 4DOHE 5DRZB 2HVKB 1TZHA 2LVEA 5IOPA 1CFQB 3GI9L 3L5WB 5E94A 4K71C 4QRTB 4NM8L 1EFQA 5GJSL 2DMKA 1XH3A 2NY0D 4PG9B 2WNGA 4P5TA 2ZG1A 3RU8L 4F9LC 2J88L 3OKLB 2NR6D 2YK1L 1A7NL 1G7IB 1HNFA 4JFDB 1F90H 2O61B 1NL0L 4FZ8L 1XGUA 5C2BH 5JIIA 3KLHD 5E1AA 5AUMA 3IDNB 5BV7B 4JQIH 3QNXB 1AFVL 4P46B 3QDJD 4PJXA 1JCKA 5CFHA 1V05A 2NY3D 1IT9H 5E2JA 4YDIL 3BH9A 4H8WH 2ARJB 1I9EA 4BYHA 3OJVC 3OJDA 1SVZA 4HWZB 1KBGL 4M1GL 3KHQA 1A6PA 1DQQA 3AB0B 3CFBB 5HSFA 1AP2A 1RU9H 4M48H 4MD4B 2H45A 4GRWH 5ETUA 5GSVA 3VXPA 2BVEA 4APQD 4FN0A 1OTUC 1U92B 1JPSH 5BCAA 1BIIA 5DC4B 1KACB 1J88A 4NM4H 3PWJA 5BZDB 3OKYA 2CK0L 3BEVA 1A6AB 1N6QH 2GUOB 1U8HB 1BZQK 2XZAL 1JFQL 1X5LA 2B4CC 5IF0A 2QHRH 2R1XB 5BS0A 2YKLL 4IRZH 1UWGL 3DNKA 1A7BA 4HW6A 5HGHB 3IDUA 2QQKL 4PJ8A 2FH8A 3W5MA 4HFWA 4Z8FL 1I1YB 4G9DA 3CVHA 4J3XA 3G6DL 1TCRA 4GW5A 3DX8B 2CKBA 1TNNA 1YNTB 3LKNA 4WUUD 3QQ4A 4O4YL 1KCUH 2ORBH 3FOMA 2VXSH 4KJYB 2MNUA 5KVFL 1NC4A 4Z76B 3DUHA 3K0WA 3IDMA 5KG9A 1M7IA 3NGBC 3S5LB 3QFJD 3MRLB 1XGYH 3K4ZA 1TFHA 3H0TA 2VAAA 1GGBL 2R4RL 2EIZA 2AEPL 1Y0LB 3MGOA 1HI6B 5D7LA 3SKMB 5LGHL 4IIQC 5DJCA 4PRAB 2NXYD 3LD8B 4D3CH 4LLAA 1AC6A 3M8OH 4RGMC 1QFHA 4PPTA 3TT3H 5INCB 5JW4N 2D2OA 3V8OA 1KV3A 1KN2L 5FM5M 3LQAH 3QUYD 1A4KB 5IBTL 2Y9RT 1A9EB 3I3DA 4KK8C 5I15L 5L6YH 1CICA 1NANH 2WUBL 2EEAA 4E42B 3O6LL 1KTDB 2PW2B 3E6HA 1KPVA 1KB5H 1T5XB 3SDCD 4K94L 4S11A 5DS8B 4FFYH 4OD1L 4I13B 4PJ7E 1PAMA 2W9EL 5IHUH 4QYOB 1MIML 2HG5B 1I8KA 4HCRA 3ZE1F 1AGDA 1M1SA 1NDGA 2RR3A 4GRWB 4BKLB 1D6VH 1FVCB 1L4IA 2XICA 4MWFA 3CSPA 1DLFH 3IDGA 3LPWA 5SWSE 4EQ3A 5IQ7L 3VWKC 5DRWA 5FA3B 3E6FB 1MHPH 4R0LB 4URTB 2V2WB 2C4FU 2NY5C 3RWFB 3KVQA 3WYRA 4WI8A 4OV5A 4HS3A 2F53B 3LRHA 4OCRL 1X5KA 3LDBB 3HI5H 4PJDA 4U1KA 1BBDH 1WTLA 2XN9A 4NM8H 1A6UL 5GJSH 1E28B 1A9BB 4L4VD 3C6LA 4Z78B 1T6WA 3RU8H 4FFWC 1PEWA 2YK1H 4LF3B 4IRSD 5DRZA 5C6PB 4QHNA 4JM2B 4YGAB 2HVKA 1U8PB 4L8SB 5DQDH 4KRPC 1YEKH 1CD8A 1CFQA 2AV7B 3ZSSA 4FZ8H 3GMQB 1MF2L 2IPUG 4QRTA 4FQIL 1UVQA 3E0GA 2D31A 4JFQB 1AFVH 3F7RA 1VFUA 4PG9A 1UZ6E 3HB3C 4PJIB 5C08D 5FK9B 2AK4B 3V6OC 1N7ML 4YXLL 4F37K 4PJ5B 3D69A 4NZTL 1G7IA 3Q5TA 4JFDA 1OF2B 2O61A 1PZ5B 1CE1L 4FNLL 3RDTB 3V9FA 3VFVB 4WRLA 3ZTJG 4ZXBA 3BPNB 5D72L 2P5ED 4IDJL 4OZFG 4M1GH 4P46A 1IC5L 4TVPL 4JJ5A 4UV4H 1T4KB 4PRHA 1DBAH 3FT3B 1UFUA 3UYRL 1F11A 4ETQB 5F7MC 4M00A 2ARJA 4CU8A 3RPIB 1U6AL 1Z9LA 3ARBC 3U7WH 5GGRB 4F3FB 4HWZA 4Y4KA 3WV0A 2RAMA 3VDCA 2CK0H 3GMOB 3CFBA 4HBCL 2AVGA 1NCBH 5IB5A 4S1SL 2XZAH 4G8EB 2EDRA 4B41A 2YKLH 3RHWF 1U92A 2BY1A 1UWGH 4F8TA 1MJUL 3DVFA 3MLRH 2QQKH 4Z8FH 5E70A 5BZDA 1KCSL 2A38A 4GKZB 3MXWL 2IJ0C 1RZKH 4Q0XL 5ENWB 1A6AA 1J8KA 5H8DA 4DFIA 3HNVL 1ITBB 2GUOA 4J3SA 4AQ1B 2EZ0C 1CGYA 4D0CB 2R1XA 1GH7A 5HXMA 1HSAA 4K07A 5HGHA 3T8XB 4CDHA 2P8MB 2QR0B 5I71B 5A1AA 4X5LA 2FBJL 3S88L 3PG2A 3GEWB 4NKQB 1KIPB 3DX8A 1GGBH 3HZMB 3PDGA 1YNTA 4LAQL 4CDGC 3KPSD 1U8IB 1SJVA 2B0SH 1FIGL 2ESVB 5F7UA 3GDBA 1T66D 2UVEA 4L4TE 1MFAL 4K8RD 4JGUA 3ILQD 4KJYA 5LGHH 1PDKA 3LCYA 2VRAA 2BP3A 4Z76A 3VGDA 3ZKMC 3C87A 1UM4L 1CFNA 1U3ZA 3S5LA 1NEZG 1RK1A 1D5XA 4TSAH 4QGTA 3C09C 5L2JB 2YA1A 5T33L 1IKNC 1KTLB 1XCTB 1QHOA 1LEGA 1AXIB 3BXNB 1KN2H 1HI6A 4ZOBA 1IGYB 3QI9B 4POUB 5IBTH 4OGZA 4PRAA 5C0DA 3H3BC 2V6HA 5I15H 2WUBH 4LSSH 3MJ6A 1K2DB 4NO2A 1P69B 2XKUA 3O6LH 3VD9A 3HLAB 3WFZA 3K8KA 1A0QL 1IC7L 4RMVA 4K94H 4X6DF 3T2OA 2GI7A 5INCA 4OD1H 3UTTA 1A4KA 3GI8L 4Z6AT 1A9EA 2HRPL 4OGYH 4DCQB 1CQYA 4WHTB 3WIFA 1JBJA 4E42A 2Z4QB 4PJ7F 5K33A 1KTDA 4JRWA 4HUVB 3RTQB 4CVWA 3MRKB 4MQXC 1DZBA 1T5XA 2O5XL 5EC2B 3P77B 5DS8A 3QH3B 4NBXB 3ESVF 3S35L 2CK2A 4OI9A 4QYOA 5JW4M 1NMBL 2HG5A 3RI5F 4YEEA 4EXKA 4HXBH 4P2CG 3TV3L 2A83A 3MBED 2FECI 5EZLB 5JUEL 2UYLB 2R4SL 4BKLA 4ZAKD 1EFXB 1CU4H 1FL6A 1XZ0B 2B2XL 2AJSH 3W11C 2DQIL 1A4JB 4NQED 3LEXB 3O81A 5CEYB 1F58H 2FX7L 3MBXL 4ELKB 3GSRB 4I3SL 4R0LA 4ODWB 2V2WA 4M7ZC 3UJIH 4AH2B 4A2MA 4OF8A 3RWFA 4B0MM 3KPLA 1BF8A 3ECBB 4OM0L 3VXRB 1S9XB 4TUOB 3OAUL 2WIIB 5B22A 2GCYB 1Q94B 1MF2H 5DVOA 3GZKA 4N0YL 5GRJH 3UTQB 1YC7A 2I24N 4Y4HB 1E28A 1EEYB 4WUUE 5T1LD 5DJDB 3R8BB 2VAJA 2HH0L 4YXLH 5I9QB 2OK0L 4JM2A 1V3MA 1U8PA 1FYTB 1INDL 4BQ9A 4L8SA 4YFLF 2V5SA 2AV7A 4XP9H 4R7NB 1MCHA 1NJ9A 3QFJE 5D2LF 2EE2A 4JFQA 2FX9L 5AZ2L 5D72H 4XPFL 1IC5H 4TVPH 1EEQA 2IQAA 3GBML 1QUNA 4N8VB 3QHFL 3FRPG 5EUOB 5FK9A 2AK4A 1D9KA 2HJFA 3MUHL 3JVGA 1IGIL 4ODVH 1IARB 2FWOB 2OCFD 3EYVA 3UYRH 5I19L 1UXSB 3MLZH 4LCCB 1HWGB 3IRPX 4Z7WB 1M05A 1OF2A 1U6AH 3RDTA 1G9MH 5C0JB 1FNLA 3VFVA 35C8H 4GG8B 2WBJA 2BSTB 2VISB 1WEJL 4IRJC 2OXGA 4DKFL 1ITCA 4S1SH 4NJ9H 2OL3L 5D7JA 4OSUL 3MMEB 2V7NA 4ETQA 3LEVL 3MV9D 1DCLA 5MI0C 1MJUH 5FDYA 4FXLA 2O5ZH 2OR9L 1IEHA 1MIEL 4F3FA 3MXWH 1EJOL 5EO1A 4Q0XH 1CFSB 3O0RL 1CDUA 4H0GA 4G8EA 2CDFB 1MRFL 4ZOEA 5FUZL 1NEUA 4E9LA 2QQLL 1K4CB 4L4JA 5IVXB 3JUYA 1KB5A 4EUPG 4DGVL 3OJMB 4GKZA 2FBJH 3S88H 4PP2A 4U0RB 5ENWA 1OT2A 3HCVB 4LFHD 4HJ0D 3HUJE 4CU7A 2IADA 4LSTH 4LAQH 1EIBA 5LCVL 5IG7A 1KEML 3HE6D 3HZVB 3FL7A 4TPRL 1MFAH 1ZVYA 3T65B 4WO4B 1WF5A 2QR0A 4U49A 3U79A 3BIBX 3WUWG 2P5WB 4J3WA 1IE5A 5BQ7B 4WV1C 1P4BL 5DJ0A 5DA4A 2V17L 4KROD 5DJXB 3WLWD 1KIPA 1HZHL 3DV6B 3HZMA 2AJZB 1N8ZB 4L4VE 5T33H 4XNYH 5JOFA 1ND0B 5KS9E 2ESVA 3G6JF 5IB2B 3O3EB 4BJLA 5GGQL 4RMQA 4NQCB 4MXQD 5DEGB 1FZJB 4RA0C 3JBG7 1SEBA 1G1CA 5EBGA 3TBTB 3MOQA 3HC3L 4M7JL 5BXFB 5L2JA 1A0QH 1WC7B 1UH2A 1AH1A 1IC7H 3BMWA 3S34L 3LIZH 4WY7L 2E6JA 3MACL 4HV8B 1KTLA 3KYOB 5C08E 1HWHB 4KRMB 1NGXB 3D3VD 4MA1B 1IGYA 3QI9A 4AM0B 2F53D 2D4DA 3QEQA 1MELA 3HLAA 2V5YA 3MPCA 2P5EE 3UPCA 1DUZB 2ZKHL 2O5XH 1C7TA 3OKNB 3MC0A 1T22B 4HFUH 4MJ2A 2D3VA 5CKAA 1XT5A 4XNQB 1CFTB 1NMBH 3SGJA 2RIKA 3X14B 4G8GE 4OCYL 5ACZA 4UINL 1CZ8L 1C16A 1LGVA 1N0XH 3TV3H 4Z9KB 3H2WA 4WHTA 5JUEH 4KHTL 2Z4QA 3FZUD 4JN1L 4HUVA 3RTQA 3OKKA 3MRKA 1SY6L 2DQIH 4MA7H 5L2KB 3QH3A 2FX7H 4JCLA 2NY0C 4I3SH 3L95B 2FGWL 4G42B 3GK8L 2NR6C 5J11B 3QDMB 4RFNC 3G5YB 2HP4A 3C5ZB 5ILTH 4JFOB 4YHLL 1LEIB 3BE1L 1BD2D 2VXQL 3OAUH 4QY8A 2UYLA 3RY4A 5C0ND 4LSPL 3EDEA 4KDTC 1EFXA 1NMAH 1XZ0A 4GXUN 1A4JA 2DQTL 3MXVL 5CEYA 4ELKA 3EO0B 5LG1A 4FQ2L 4ODWA 5FV1L 4ORGB 3W39B 5ABDE 4XVTL 4AH2A 4U31A 3FB6B 2HH0H 4L3ED 2OK0H 3ECBA 1A1OB 2Y23A 4XMKL 1S9XA 3HAEG 3BHBB 2WIIA 1JTPA 3W2DH 4C83B 2J8HA 2MQ3A 2GCYA 1Q94A 4POYA 2GITB 4MX7B 1JPTH 4U2YA 2FX9H 3UTQA 2IQ9L 4XPFH 4NGHH 3GBMH 4M6NL 1EEYA 4FXGB 2PKDA 3KPSE 5DJDA 2VQUA 3QQ3B 1IGIH 1L0QA 1MCWW 4JY4A 4KRNA 5D1QD 1FYTA 5DDHA 3QUZB 3AFLA 3QNYA 4XH2B 3SY0B 3GSQA 4Z7VE 4R7NA 4HIIB 1V3JA 1JTOA 2M8XA 1Q9KB 4UAOB 4ELMF 1I3VA 1WEJH 3FO9B 3ARQA 3KG5A 5TQ2H 1EUTA 4XPTL 2EIEA 1PG7X 5FGBA 4PRID 4Z7QE 3DV4B 4OSUH 3JV5A 4LCCA 4QRSB 3X11B 1IGFL 1LD9B 4W70A 4AENB 3LS4H 2HN7B 5C0JA 1GPOH 2OR9H 1MIEH 2NX5D 1L6XA 4GG8A 3RY6A 3KPRE 2R0WL 1OAQL 1N3NB 2FHBA 2VISA 4X4MA 3O0RH 2DYPB 3FRUB 3MGAA 5J9PA 1GC1L 4HK3J 1MRFH 3FB5B 5FUZH 3QG7L 3FN3A 3OXSB 4WI5A 3GMLB 2JIXB 2XZCH 4OAWB 4F57H 1NGZA 1ZA6B 1DBML 4HHAB 2DQFB 3L3JA 2QQLH 4UI2A 4TSBH 3QCUL 3QBTB 4MD0B 4DGIL 1T80A 2DQJL 4DGVH 5DD3H 4RGOH 4WDIB 4DN3L 3C2SA 2ZUQB 4OFKA 3ZL4L 2CLRA 2CDFA 2PNDA 5AYUL 1KUMA 3B9VA 5DT1L 5CSBA 1F42A 2Q1EA 1OAXL 4DQOL 4TPRH 4PIRF 2EC8A 1K4CA 2DICA 2EYSA 4PUBL 2NXYC 2NYYD 5GIRB 3HUJF 2P44B 3LH2L 4XC3L 4LVOB 1P4BH 3VXQA 1P4LB 2JJWA 1J0KA 2V17H 1NFDE 4NQEE 3T0XA 4QRPE 4PYGA 3T0BA 1QLRB 5F88B 1HZHH 1BGXL 4I18A 5ESVB 3HZVA 5DJ2B 3VXOA 3QDGD 4XNUH 1OWRM 4V2BA 3T65A 1OPGL 5GGQH 2MHAB 4WO4A 1IAIL 4LCWA 2P5WA 4NQSA 1AY1L 1DE4B 2IG2L 3ALXA 5BQ7A 5ERWB 3RZCB 2O26U 3CJJA 1A3RL 1AGCB 3UZEA 3QNZB 5HGAA 3HC3H 3SDCC 2AJZA 3S34H 1ND0A 3MACH 5HGBB 1Q1JH 4MNHB 4U1NB 3CSBA 2NY6C 3RIFF 3L5HA 1E0OB 3O3EA 2E7HA 5D70H 3DPBA 5FB8B 3WFEL 4NQCA 4X5WB 1RZ7H 1FZJA 3ILPA 5C0EB 1E4XL 1BM3L 3FQXB 4C54A 1KELL 2X1XR 2YD4A 4EVNB 3TBTA 4NUGL 5BXFA 3T0VA 1F4HA 1WC7A 3QXTA 4HC1L 3MLSL 4RQQB 4NO0B 3KYOA 1NGXA 1VPOL 1W0WB 2XA8L 4LQ1A 4OCYH 2D03H 1Z9SA 3I3EA 3LKSB 5T1DL 5BVPL 1YPZA 3EDKA 4KJPC 4QXGL 4JN1H 4KI5E 1YEIL 2BMKB 2E9BA 4UTAH 1SY6H 1DUZA 5D5MB 2OL3B 1LK2B 3IF1B 3BKCH 3RAJL 3I9GH 3BP7A 4XVJL 3X12A 5JA8B 1IGJB 2BNQB 4XNQA 2FGWH 3X14A 4Y4FD 3GK8H 3SEPA 4NQTA 4KUZL 1FFQA 4IRSC 5I1HL 3SOBH 3F65A 1FE8L 4YHLH 2ZPKL 4MNQB 3BE1H 2VXQH 4YDJA 2BSSB 3B9AA 3BGFC 3NTCH 3MRCB 1U3HD 5L2KA 2DQTH 3MXVH 3VXNB 1P7QB 4NN5B 4UTBL 4FQ2H 2APVA 2V2TB 2LAAA 5EU5B 2JB6A 1QR4A 3K2MC 4Y5YC 3F5WB 1IBGH 2ZOKB 3QDMA 3G5YA 4XC1L 4XMKH 2VQ1B 3ARYA 2A6KA 5GS0C 3JWDC 3T0EE 3KYKH 4X5XA 1VERA 4XBPA 5IVZB 1I8LC 3P3YA 3ZT7A 3BRFA 4PY8J 3CSYB 3W39A 2BVYA 4HKZB 3FB6A 5B3JE 4PJ9B 3UDWC 1A1OA 2DRUA 1HCFX 3PF2A 1ZLSL 43C9B 1M71B 4UT6H 1ACYL 4PJFB 5ALBL 2GITA 2CRYA 1MUJB 3SQOL 3RGVB 1HHJA 4HS6B 4LLYB 2EE3A 4YC2C 4FXGA 1WITA 1JYWA 1YEHL 1LE5B 4H0IA 4PLJC 2DD8L 4XPTH 3KR3L 3QQ3A 5J12C 5EOQL 4X98A 3TA3B 4Z7VF 4RWYH 1F00I 2OTPA 1U0QA 2RHEA 3QUZA 4LVEA 1K5NB 4MDJB 4PJGB 4M6AA 4XH2A 3SY0A 3W9DB 4Y19A 4KTDH 1I3GL 4H0HB 3MR9B 4HIIA 2R0WH 1OAQH 3NCBB 4Z7QF 5JHLL 5KSBB 3LPGA 5DC0A 1F5WA 2A9NL 1GC1H 4JR9L 4N68A 2ENSA 3QG7H 3DV4A 4S0TD 2DLEA 2V7HA 4W4OA 4XGZB 3DUUB 2ICWI 1LD9A 3RX7A 1PYWB 4LU5L 1WFUA 1FJ1B 2HN7A 4DGIH 3DUSB 4WI2A 4NZJA 4DN3H 1MHCB 2QTEA 5HJ3B 1N3NA 3ZL4H 1V8HA 1F6FB 4MXVE 4PRDA 2EDEA 1DEDA 5AYUH 5DT1H 3FB5A 2BNUB 3OXSA 3FCTA 3GMLA 2E8YA 2MFNA 4K8RC 3ILQC 5E6IB 1R24B 4HHAA 3RJQB 2HT2D 3PABB 2HAZA 1PX4A 4MD0A 3LH2H 3P73B 4WDIA 4XC3H 4NNXB 3PHQB 4M03A 4EDWH 2LQRA 5D1ZA 1A02N 2J5LC 1HXYA 4GRLB 3PQYB 4P3CL 4U3XA 4FTVB 4O2CB 1OPGH 5GIRA 1NFDF 1BD2E 4XX1G 3WN5A 4HIJB 3HC4H 3V8CA 4LVNB 5D7SH 3QXVA 1G6VK 5EBWB 1QLRA 3BPOC 5SWQB 3JWOL 1JUFB 2LVCA 4K7FB 5ESVA 3TN0B 4U7KA 2OX5A 4BA8A 4JO1H 5DK0A 3AROA 4L3EE 4Z95H 5L9DH 5F1KC 3PL6C 2FHFA 5EBMA 1U36A 2MHAA 3CIQA 4AEEA 3WFEH 5IESL 3BOVA 5GGRY 4TNVF 3T0DA 1DE4A 3VXSD 1ZGLB 1LVEA 2C3VB 1E4XH 4I0PB 4UILL 1AGCA 3VXUB 3Q6GL 3QNZA 1H5BB 4NUGH 2L7JA 4HC1H 5FYKD 2C1OB 1UM5L 3MLSH 5KOVC 2JCCA 5HGBA 2PTTB 3SGEH 3LAFA 5JMOC 4U1NA 1Q9OA 3EZJB 3BDYH 4HD9A 4X6FB 4YBHA 5EO9B 1VPOH 5FUCE 2XA8H 5FB8A 2DIAA 1R6VA 1XF4B 3T4AB 5EU6B 3FQXA 5DC9B 5T1DH 5BVPH 4ZAKC 1Z0NA 4EVNA 3V52L 2CPCA 1M7XA 4U6XB 5BV7C 4OZGE 3SGDI 3AREA 3DECA 1QBBA 4JN2A 4RQQA 1Q0YL 4NO0A 4P46C 3RAJH 2BNRB 2BSED 1OLLA 4PRIE 1W0WA 2K1MA 1OAZH 3TESA 1JWUB 4G43A 5E4EB 5I1HH 1FE8H 2ZPKH 3BKJH 3LKSA 1MJ7H 1INQA 1UJTA 5E6YA 1OGTB 3ALPA 2NX5E 4X6BB 2BMKA 1EXUA 1LK2A 3IF1A 4HH8A 3AB0C 4P3DB 4UTBH 4ZO6A 2BNQA 2EEBA 1P2CA 2OTUB 3WKMH 5DURD 4MNQA 2ITCB 3LVEA 3T1WA 5K9QG 3DX6A 3VXNA 1JP5A 1CGSH 2H6PB 4KK6D 3OBAA 2V2TA 3P30H 5EU5A 4R7DB 1XEDA 3MREB 2ZOKA 3OR7B 1HHKB 4XP1L 2VQ1A 1ZLSH 5TFSL 4Q6YA 1ACYH 5ALBH 5IVZA 2WWKO 2DJUA 3DVIA 1JI1A 3Q0HA 3LN9A 1CGUA 4HKZA 3KR3H 3QDGE 1WFTA 1FL5B 5T1KB 2EECA 4PJ9A 5LQBL 4LGPB 3DX9A 4PRPA 1M71A 3NZHH 4PJFA 5GS2D 1CGTA 1I3GH 5ESAA 2P48B 3U4BL 2GFBB 4WTWA 4HS6A 3UTPD 1INEL 2R0ZL 1OWWA 3VMPA 1EHLL 1D5MB 1LE5A 5HHOD 4UV7H 3QA3B 3UBXG 4JR9H 1FSKB 5BZWB 3TA3A 2B5IB 2E8ZA 3ZYOA 2EDYA 5T5NG 4PJGA 4LU5H 1F45A 3LD8C 5DZOA 3RNQB 3MR9A 5DI8B 5MEQA 3VI4E 3QJFB 3BSZH 4FQQB 4EN3D 4QOKA 2G5BB 5ICZB 1JZ4A 4Z77B 3L6FB 4O02H 1IGTA 1PYWA 3V4PL 4J3TA 1JK8B 1FJ1A 4TQEL 3DUSA 1JRHL 2XKNA 3WEXA 3PP4H 1MHCA 3FQWB 5HJ3A 5DVKA 4KROC 3WLWC 1A22B 4HGWA 1PSKL 5HHPB 4RRPA 3B9DA 3FOLA 3N1QC 4JM2F 4IM8A 5DTFA 3VGAC 3GBLA 2ZJSL 4HAGA 4P3CH 4XVSL 1R24A 2VDKL 9CGTA 3PABA 1SY6A 4GUPB 1QBML 1A14L 2VLMD 3M17B 2DIBA 4NKIL 3P73A 1TZGL 5CZVL 3TBWB 4NNXA 3PHQA 3CC5B 4PJIF 2DQEL 1MFEL 4XZUB 5AZEH 5CLWA 1T1YA 2HT4C 2OI9B 3O4LB 4JPIB 5IHLB 1NLBL 3JWOH 1FZMA 3GSNL 5E8DH 3QJHB 4KAQL 4GRLA 5A2FA 4L8BB 4NKOB 5IBUG 4PJBB 4FTVA 5D7KD 2W1NA 2VLKB 5IESH 5FKPB 5C0AD 3JTSB 1BJ1H 3WFHB 5GGVY 4UILH 3BJ91 1BLNB 3UJJL 5KW9L 3Q6GH 3MFFB 5SWQA 2WBKA 1JUFA 3GSWB 4K7FA 3TN0A 1EMTL 2CUHA 4P2QE 4BUGA 1EBPA 4KDVA 1J0JA 2BK8A 4JM2C 1ZGLA 1W8NA 2C3VA 3FZUC 4I0PA 4U6HB 4PGZA 3VXUA 2WK2A 4PJCB 3EOBB 3IB4A 3D18B 1Q0YH 2PTTA 4NSKB 2VDPL 4YPJA 1P7QD 3MNZB 2XYCA 4X6FA 1UACL 3JVGC 4P5TD 3ZDZF 2R2HB 1MAJA 3HI6L 3L9RB 3T4AA 3CUPB 3TPKA 5EU6A 4DUWA 1HEZA 2HFGL 2Y7QB 1RK0B 2IALB 3EYFB 3TC9A 4CW1B 5INDB 1WWAX 4H88L 1HILB 2R2BB 3N9GL 3BPNC 2H2SD 5C0BB 4MCYA 2IAMD 2BNRA 2DWDA 2OQJA 1BQHG 2H9GB 1ZK9A 1J18A 3QWQB 1JWUA 3MRDB 3DJ9A 4P23D 1OP3H 2DLFL 3K8MA 1QFUL 1OGTA 4P2YA 4X6BA 3TNMB 4UZGA 3I6GB 3KPTA 5KJRH 4NWUH 4P3DA 1OAUL 1DQDL 3ZE0E 3WUZA 12E8L 2HMID 2IPTL 2OTUA 1NC2B 1OTTC 1UC6A 5TH2B 5D1QC 3LN5B 1CDCA 4P9HC 1UG9A 2YXFA 4JO3L 5DO2D 1U9KA 5TFSH 5IFHL 1N6VA 4CADB 4EUPB 2YEZB 3QIUB 3S97C 4Z7OE 1DANU 5CZXD 3MTRA 1F6LL 3F7YA 5JHDB 2A6DB 2H6PA 1JVKA 5E2WL 3WS6C 3TCLB 4R7DA 1X9QA 3MREA 3PV7A 5C92A 4ZFGH 1HHKA 1NBVH 1E6OL 4U3CA 2APXA 4P0DA 3EJZD 4HS8L 2VKWA 2Q76B 4DK6A 5I71C 7FABL 2GJ6D 5JW5B 3Q1SH 4PJ8D 2ED9A 2R0ZH 3PHSA 1EHLH 3T77B 5C6TL 5IFAL 2GSIA 2ICEA 5T1KA 1CYGA 2NY4D 4YHIA 5KZCB 4E0RB 1U8KB 3V7AE 5IMMB 4GBXA 5E6ID 1QACA 4WU5A 3VXSE 1X4XA 4HUXB 1T0MA 4KJQD 3TH4T 1UZ8B 1L0YA 1H8NA 4R90L 4PRBB 5FYKE 4KI1A 1P9MC 1WUNT 2A2QT 1P84J 1ZA3B 3QA3A 3LZFL 4DUVA 5EG6C 5BZWA 2L4OA 4LP5A 5C09B 4OT1H 2JELH 3L3IA 3DRQB 3HG1D 4HC1A 1L9MA 2X42A 5D7LD 1QKZL 3RNQA 2R0LL 2G9HB 1JRHH 4HF5L 5DI8A 1U8QB 3QJFA 4FQQA 2G5BA 5I2IB 5ICZA 4Z77A 1OARL 1PSKH 3L6FA 1FLTX 3SDAD 2XT1B 3T3PE 1M6OB 3TJEH 4Y16D 5FGRA 2VDKH 4H20L 1CTNA 2EH8L 3L3DB 5AG9A 1QBMH 1A14H 4O2FB 5I1LB 1SEQL 3GJFH 4M5ZH 2AEQL 5CZVH 3DRTB 1XR8B 2DQEH 3WIHL 3MJ9L 5HHPA 1OOAA 5DR5L 1NLBH 3H7BA 1PQZB 5E7FA 3GSNH 4KAQH 1QSEB 3PGFH 2VITB 2QADB 3D0LB 3M17A 1N26A 1S7VB 3CC5A 2A77L 3P0VL 5EUOF 3UJJH 5KW9H 4XZUA 2KBGA 3QAZC 4WVRA 4X8JB 2WMPA 5F8QC 3QJHA 1FNGA 1EMTH 4XNXL 4Z7WF 4L8BA 3MV7D 4PJBA 5AWNL 4JQVC 4NQDE 4KMTL 2VLKA 1B0GA 5TJWK 5FKPA 3WBDA 2YD2A 5IJKC 1QBLL 2EE9A 3HAEB 3TYGH 4OZIE 2P49B 1BLNA 3WS3B 3D2UB 1ZLVK 1KCVL 3MFFA 4PD4K 4XPGL 2IGFH 3GSWA 4XB7A 4Y4HC 2VDPH 2HT3D 4Y4FC 5GHWH 5IROC 1UACH 4ZG1A 3CDFA 5I9QC 3HI6H 4X7FC 1U2CA 4L5FL 2HFGH 4U6HA 4PG2A 5IQ9B 5CJXC 1CGWA 3DMMD 5CSGA 4YHNB 3UTPE 1K9TA 4PJCA 3EOBA 2B4CL 3D18A 4WEMB 1T1XA 4NSKA 4WFGD 5HHOE 2KUTA 4JRYB 2OJZL 1Y6NR 3SDDA 5IVXF 3U30B 4ENED 2ZNXA 3CCHA 1XGQB 2AXFB 3QO1B 2Y7QA 1RK0A 2IALA 1MOEA 3EYFA 3VGFA 3EDDA 5JQHC 4CW1A 4XMLL 3DXAB 1LNUB 1HILA 2R2BA 4OKVB 5C0BA 4EBQL 1T83A 2VZ3A 4PTUB 3SKJL 3P40A 3ROOB 1OAUH 5A40E 2H9GA 1DQDH 12E8H 4O9HH 3K80A 3MRDA 4S1DD 4PRHD 3S36L 4OCSL 3IS1X 2X40A 3R1GL 4BFGA 3DO7B 3ZKND 4RMSA 4JO3H 5IFHH 3TNMA 5DD5L 2Z31A 4JPWL 4JFEA 3I6GA 1WFOA 3JUZA 4ZUSB 5EIVA 5CIPH 3F58H 5E2WH 3EFFB 3GJFB 2XXCB 3JV4B 3BISA 5TH2A 1E4KC 3LN5A 4HBQA 1E6OH 5D2NB 2VLME 4HS8H 4LPYA 5JQ6L 4CRPA 3TZVD 2XY2A 5HTSA 1AI1L 3AXLB 4CADA 2N7AA 3GSNB 2YEZA 7FABH 3MZGB 3K74B 4OBRA 2A6DA 1S5HB 5C6TH 3RVWD 4RX4D 3D25B 4Y1AA 4OIIL 4BUHA 2WV3A 1LWRA 3D39B 2ENYA 5FYKU 5C0AE 4WO4C 2Q76A 1QTYT 1MLCB 5JW5A 2ADFL 1D7FA 1WAAA 3QG6A 4HG4K 4Q58C 3VFSB 2AI0L 4YE4L 2VZTA 3LZFH 4TNWK 1ERNA 4DGYL 1U8KA 2HT2C 3P11L 1YEFL 1OAKL 2ATPA 1P1ZA 4HUXA 4YHYB 3WHE1 2R0LH 2R8SL 4HF5H 2I60L 5J13B 3B9KB 4PRBA 1OARH 2CXKA 2C3HA 1XIWB 3N50A 2NY5L 3JTTA 1HIMH 4WFED 2GW5A 1BZ7A 3W0WB 4MA1C 4H20H 4A2LA 3DRQA 5B38A 1QYGL 2EH8H 2I9LA 1SEQH 2YPKB 1U8QA 2AEQH 3QB7C 4H1LG 1QLFB 2HKHL 3UTSB 3MJ9H 1UH3A 3VFTB 5KVDL 1HH9A 2VSCA 3GSUB 1OSPL 1M6OA 4HUMB 4XAWL 1RVFL 4PJXE 1JNLL 4QRRA 3UTTD 3L3DA 5I1LA 5A43C 5K93A 2CR6A 3DRTA 3RUGB 3OKDB 3O9WB 3FAWA 1YN6A 1KPRA 3P0VH 4TVSa 4HX1B 3KPNB 2CXGA 3V7MA 4R4BB 5CMAB 2NW2B 4N1HB 1WK0A 4XNXH 1QSEA 4C56B 4OTXL 3BZ4A 2VITA 5E0QA 1TCMA 3BO8B 3D0LA 3EOAB 5SWZD 2VR5A 2Y1VA 1F8TL 5CUSL 2ZCHL 4KMTH 5CD3B 3WD5L 1S7VA 3C5ZC 2WAHA 2UWEB 2F9BT 3T4YB 1QBLH 2FIKB 5DVMA 5DMGC 4MSWA 2AXGA 1KCVH 3I02B 4X8JA 2D0FA 4XPGH 3SBWC 15C8H 3TFKD 3I84A 5JLZB 4G9FA 4JVWA 5GS3A 1BZ9B 4N1EA 1HXMB 1FAIL 5F3BB 2ADGB 5FYLD 5BS0E 4L3CB 3ARGB 5GXBB 2YWZA 1FPTL 2DJ4A 5LXGL 4L5FH 1G7PB 3N0PB 2GJ6E 4ZYKA 1OTSC 3D2UA 1PFCA 4M9PA 1I3RA 5D1XB 1Z0MA 2B4CH 2AJUL 1P5VA 1QQDB 5A16B 5E99L 3CX5K 1O5DT 1MQKL 2NTFB 4XBGA 1RI8A 4GKSA 2WLYA 5DHXB 3FFDB 3ZKXB 1IQDB 3UC0L 1JPGB 3CXHJ 3QUZC 1HH6A 5IQ9A 1XAUA 4KFZC 5H37H 4YHNA 4XMLH 2PYED 3DHMA 3O6KH 3QIUD 5HYFA 4OGAD 4UAOC 4ZUUA 3RWGB 4KK6C 5TDPB 4ZO8A 1NLDH 4UNTA 4DUXA 2BRQA 4OCSH 1XGQA 1QRNA 3H9SB 3DI3B 3HG1E 2A6IB 3QO1A 1AGBB 5D7LE 2VLJA 3VFMB 2X4QB 1BFVH 3ZKSD 5J4MA 5C2UB 4JRXA 2FECL 4OKVA 4KWUA 3CVIH 2WBJD 3ROOA 2NTSP 4LBEB 3WKNA 2DQGL 1E6JH 4EJ1C 4K71B 3LKQB 4YHZL 4S1RH 5D96B 3DO7A 3BN9D 3EYOB 5JQ6H 25C8L 4JFFD 1RUPH 5EZIL 5IW3A 4ZPTB 2ZUQC 3T2NL 3U48A 1IRAY 5HI5C 3JWNC 1NSNL 2F58H 3EFFA 3GJFA 2GK0B 3JV4A 4Z7UE 2XTJD 1G6RL 1OP3K 4N5ED 3V4VL 5C09D 5EWIL 1H8SA 4Q6IB 4N5UA 4OD3H 3AXLA 3GSNA 2ADFH 5HYQA 2E9IA 4PY7B 1MCOL 5HVHC 1EHXA 2AI0H 1OLZA 2JJTC 3VWJA 3FN0H 5CHNB 2OXHA 3D25A 3MV7E 4DGYH 3P11H 5CEZD 1YEFH 3D39A 2V5RA 1X4YA 2XXMB 4KU1A 5D5MF 1MLCA 1U8OA 2R8SH 2I60H 5I8OH 3TBSB 1UB5B 3RZCC 3FHQA 4LMQI 5DSCA 2NY5H 5IMKB 3FQTA 2UUDH 4UNVA 2N1KA 5HHXH 2DM3A 3ETBF 4FQXB 2A73B 3JSSA 3EYSL 4PB0L 1QYGH 5ICXB 3EO9L 3U36B 5IGXL 2R23B 4KGLA 3KPMB 3B9KA 1MFCL 1KNOB 1MLBB 1A7RL 2HKHH 3TPUB 4AT6B 4MJ5B 4R97B 1XIWA 3MUGA 4G6AD 4WFGE 2VYRE 5C07A 1ETZB 5D8JH 5AAMA 4HUUB 5KVDH 3CLEL 3OAYH 1RVFH 2NNAB 1JNLH 1GZPA 2YPKA 4XHJD 1WFNA 1LO0L 4WJ5B 3RIAK 3K4AA 1LO4L 2YUZA 4OQ1A 3QEQD 5DGQA 1D6EB 4JHZA 1EDQA 3BWUC 1WLHA 3GSUA 3NGBB 1L9NA 2JE8A 4CJ0A 4PRHE 3TVMB 4OTXH 5IVOA 4HWBH 4XCYB 2R0KH 1SBSL 4EIZC 4TTDD 1F8TH 4BZ2L 2ZCHH 2J1KA 2Q20A 3WD5H 4XBEL 4JEGB 3RUGA 3OKDA 4ZFOL 3O9WA 1O7VA 2EC9T 4HX1A 3KPNA 4HWNA 4ONFH 4IIQB 4OKDA 2Q6WB 2NW2A 1C12A 4NN5C 4LCUB 4C56A 5DGRA 4P48A 2R69L 3P9MB 4M1DL 3U82B 3BO8A 4DWHA 1V7ML 3Q6FA 2CMRL 3DSFL 3FTGB 4NZRL 5CD3A 2R9HD 1FPTH 1MI5B 2DIJA 5JPMB 2UWEA 1PKQA 3GJFK 5CIPA 4DVBB 1CDIA 1JNNL 2FIKA 5LXGH 5KSBF 3AC0A 4NWTL 2VB5A 3FFCB 5D9SB 2AJUH 3QQ9C 4JQXA 1X5XA 1BZ9A 4RIRB 1HXMA 5F3BA 3LHPL 1RIUL 3HPJB 1MQKH 4S1QL 1CDGA 1G7PA 1UKTA 3FT2B 1CXFA 1F6AB 1PZUB 1UB6B 3H9HB 3RGVC 5D1XA 1AD9A 3HS0A 4U4BA 5FDWA 2P46B 3IS0X 1QQDA 3SDXA 5A16A 1I7ZB 4I2XB 3UX9B 1JL8A 3FFDA 4RSVA 3VWKB 2FJGB 1JPGA 5EFIB 4AEIL 1LEKB 3NIGE 4IOIB 2Y07L 3GJEB 5CZXC 3O11B 3RWGA 2HYMA 4RAUB 2DQGH 5GZND 3RZWA 1H3XA 4YHZH 1JN6A 1MRDL 4W6WB 1P7KB 3H9SA 4TTGA 5MEOB 2FLRT 1F3DJ 2VH5L 3BUYA 2A6IA 1S9YA 3QQNA 4ODHL 5DHYA 3VFMA 2X4QA 4ZNEA 2VZ1A 1TJIH 3MQIA 3T2NH 1A1MA 2F15A 4L8DA 1NSNH 4P2RB 2ATKB 4IHOA 4LBEA 1NFIB 4KRPB 2F54B 5I18L 4AZ8A 2J4WL 3LKQA 4RAVA 1DL7L 3RP1A 5HDBE 1G6RH 5FO9B 3EYOA 3UTTE 3V4VH 5E6IC 4Y8DC 4ONOA 1T20B 3MJ9A 2X1OA 1N2RB 4F9LA 1A2YA 4NPYB 4ZPTA 2DQCL 3WHE0 1X3DA 1HHIA 3HN3A 4NO3B 3L3OB 3HNTH 4MB5A 5HYJA 1T7YA 2GK0A 1I1AB 4GRLC 4X6CE 5SWZE 1HKLL 4JHWL 2X05A 3VRIB 3SGKC 4QRQA 3L5XL 4I9WD 4NYLA 2YC1A 4P9ML 1F97A 2VUYA 2EDXA 3AS3A 3QXAA 2X70B 1ZOXA 4LVNC 4GRWE 4PY7A 4DOHB 4RDQG 3RNKB 3BI9X 1KIRB 1H3PL 1QFWM 4NC1C 3TN0C 3LQZB 1RIHL 4X9FA 1DP0A 1WBYB 3V0AC 4EI5D 4PB0H 5FCUL 1MSPA 4OLYH 4NQXB 4BZ1L 3BWAB 2DLHA 1LP9E 4LCWD 1WVZA 4P5MB 4I0PC