4LOVA

Crystal structure of fimh in complex with heptylmannoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Study of the Structural and Dynamic Effects in the FimH Adhesin upon alpha-d-Heptyl Mannose Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4lovA00
4X5RA 5AALA 3ME0B 2UY7B 4AV5A 3JWNG 4XOCA 4AVIA 3RFZA 5F2FA 2XG5B 1ZE3H 3BFWA 1KLFB 4XOEA 2J2ZB 4XO9A 5AAPA 4X50A 3ZPDA 5AB1A 2W07B 4LOVA 5IQMA 1KIUB 1N0LB 4X5QA 2VCOA 4AUYA 5IQOA 2JTYA 4AVJA 4X5PA 4AUUA 4CA4A 4J3OF 5LNGA 1UWFA 5FLUA 5JQIB 4ATTA 5ABZA 1N12A 3ZL2A 4J3OH 1TR7A 4XO8A 4CSTA 4XOAA 2UY6B 1QUNB 3BWUF 3JWNE 1PDKB 5LNEA 4J3OG 4CSSA 5IQNA 4AUJA 2XG4B 4XODA 5FWRA 5FX3A 3MCYA 5FS5A 3BFQG 5F3FA 4BUQA 4XOBA 5CGBA 4AV4A 2JMRA 3ZL1A 3JWNH 2WMPB 3SQBB 4AV0A 4AVKA 4AVHA
chains in the Genus database with same CATH superfamily
3TBTA 1D7CA 2XN9E 2V2TA 3S4SB 2JCWA 2VWEE 1T83C 1WA0X 4ZAKA 4TVPD 3WENA 2GSGA 1ZGLP 4GKSA 1AG0A 1YPZE 4XCCL 4PY8J 5C7ZA 1T4KB 5JPMB 1H3WM 1YEHL 4NOBA 5IQ7L 2NRDA 3KR3L 5KAQG 1PG7L 5K39A 1XGRA 3RDTB 5B3JE 3SBWA 4ERSL 1FYTE 3Q6GL 1HINL 1CI3M 2G75A 3FZUD 1RZJC 2VN7A 4Y4HA 5JHAA 3K2UH 2EXYC 1G4MA 2DQTH 5F96L 5EU6E 4AQ8C 2EIBA 3B2XA 3CFJB 2GITA 2V5SA 2WOYA 2EIEA 4JZNB 1AD9A 4X99B 4LFHD 4FAAB 1S9YA 4M5ZH 5HPOA 4OD3H 3IBEA 3MUZ1 2H32B 4GXUN 4MAUH 3UTQB 4HWZA 3ZE1E 4DN3L 4JANB 5J56B 4UTAH 3O2WL 3SDCB 2CXKA 4QYOB 1GOHA 1QNZH 4X4ZA 1UA6H 3UYOD 1UOKA 2D9CA 4HLZG 2CRZA 3UJIH 4AKOA 1A1NA 3TT1H 3I2CH 3ZX1A 1UZGA 4IBWA 5JQIB 2NY5H 1RULL 3QIWC 2QQLL 2F7OA 4EJ1C 2DMHA 3UXFA 3GRBA 1L9NA 2F54A 2G60L 2QSCL 3QDGD 3VFWB 3IRCA 3O3EB 1HHIA 1IGMH 2PP9A 1O6VA 2CK0H 2AEQH 3UOAB 1CU4H 1TLKA 3VXMA 3LKPA 3NFSL 4IBTA 5D2NC 4XZUA 3BAJA 5FUZH 4F8NA 2KERA 3I02B 4OUOA 2YD8A 1NKOA 3RWGA 3ZYIA 3U46A 2VLJA 2W81C 3OC5A 3OXRB 4MZ2A 3UBGA 1KCSL 4FQXD 3WNIA 4DEPB 2WVVB 1TZHA 2C1PA 3L5HA 1XH3B 4E2OA 2F1AA 5HHOB 2VLME 2F6AA 2OXHA 4ZD3L 4RFNC 1CDJA 1E4HA 4KUCD 1Q9OB 3VXQB 1FBIH 5D1QB 3MV11 3M8OH 3AS0A 5JPNC 5EO0B 3FCUB 3IJSA 3CZEA 4ZG1A 2H32H 1RPQA 3QQDA 2H9GB 3BEVB 3MBXL 1MJUL 3SQOL 4Q9RL 4IGBB 2VXQL 4EUPB 1I9IH 3OF6D 1QSEA 1HHHA 1MFDL 1WPCA 3EJZC 1MOEA 2ZUYA 1FVCA 3MODL 4JX0A 4M9PA 3ULVE 1TU2B 2A7BA 1PJWA 4JFTA 1DO6A 4HZ1A 3I3BA 4AJVA 2O5NA 2VR4A 4P5KB 1KENL 2VDLL 4LVNB 1XCXA 4YVUA 5C0BA 4B9FA 4GAYA 5LB1A 4OLYH 3D3VE 4ICWA 4QAMB 5FA4A 3DX7A 1NCHA 4ONOA 5KYUA 2TSBA 2W95A 5JIPA 1MEXL 4GG6F 3KMDA 1W91A 1CLCA 4M4RB 1G7LB 1F90H 1KPUB 3DX2A 3TP4A 3IDUA 3A4EA 1U2CA 3SO5A 3AAZA 5I8KL 3ZHDA 3FT3B 2P8PB 1E9OA 1E4XI 2E8YA 4WI5A 4F7MA 5CLXA 3ZYJA 4LHJB 1T04B 2FB4L 3SE8H 4BHUA 4DSYA 2R4RH 2KPWA 1QLRA 4WU5A 2X6UA 4RAVB 1XBRA 3TM6A 1H6FA 4BZ2A 4M1DH 4QO1B 5DC0A 5DCCA 3TFKC 4TF4A 1L4IA 2ZNWA 4HWBH 3HE7B 1JS4A 4E9RA 3TIDB 2ESVD 5EUKA 1WQVT 1WE5A 1JV2B 4LZKA 2WXGA 3PWPE 4PI2A 3S3PA 5ACMA 5HYJE 5IVXA 4JY6A 5DUJA 4FFYL 4EUPH 1QFOA 4EN3D 1T1XB 1NCBL 3D18B 2ATAA 3DJRA 1XB6A 4JFFB 3W9DB 1G7JA 4Z7NF 4H8QA 3HG1B 3TEYA 4Q7DA 3HS9A 3D51A 4YSSA 1NFDF 3INUH 3KYKL 4EXPX 3WNOA 3F5WB 4BFGA 1PSKL 1C8PA 1AQ8A 1M1SA 4LLUB 5DRNB 3UACA 1YEFH 3C12A 1MIMH 3CHXA 4AYEC 2PWGA 1BFVL 3HR5A 5GGSY 4XC3H 4JKWA 1PBYA 3JV0A 2XN9B 3QH3A 3KCPB 3ERXA 3LPWA 4UM9B 3EYSH 4X2UA 4JMNA 3F8UB 4MJ5B 3BLBA 3CSTA 2G3NA 35C8H 4LLYB 3DYPA 3DBSA 2ADGA 4AC2A 2JB6B 4OQ1A 4XMPH 3OD3A 4Y4FC 1ZEAH 2WJ5A 1YPZB 2J7LA 4FG6D 4LKXB 4KXDA 4XP1H 1S8DB 1OE2A 1QASA 1WFOA 5T3XD 3UBXI 1J87A 1NCAL 2J5LC 4YSAA 3H56A 5I6KA 2OR9H 4BUGA 3S5ZA 2PW1B 1FYTB 2D4FA 4PJ5E 1ZTXL 5J1AB 4B3EA 1QRND 4YIQB 5HVHC 5E8PB 1J11A 3L3IB 2OZ4A 2WVTA 3ATFA 4G3YH 5EOCL 2YMOA 5MEOB 2ATKA 1MAMH 2OCFD 3QI9A 5EU6B 3TBBA 1NGZB 4ADIA 3KHOA 2V9RA 1D5XA 3P3UA 4MAZA 2BC4B 3NEEA 5FYJD 4FXKA 4ZMQA 5A2CA 4MJ6A 1PU0A 4LVHB 4FHKA 1HNGA 3EGXA 1FC2D 3VI3E 2PABA 4G42A 2WXJA 1PLGH 1XF5B 1W0VA 1JK9A 3BKCH 1ZHLB 3VXME 4JHWL 1RL1A 5DGRA 2X1QA 5EB9A 2E74C 5F1IB 4WFED 3MJWA 3ARFC 2NCEA 4TN9A 4W6XB 3WDHA 2A6KB 2VDQL 1DQML 1WIOA 4N6RB 4WO4C 4XMKL 3TO4C 2I07B 3M17B 4TNWK 5D7IE 1H3UA 3QJSB 1I4FA 4HPOL 5GSVB 3VXUB 4YHKH 2EP6A 3THML 3X1NA 5L88L 3TO2B 1T1WB 3P2BA 1H19A 1U3HA 3MRFB 3WUWA 1JHTA 3DOSB 3MBEB 3NMEA 2FEDC 2FIRT 4CMMA 3DX6A 4FEIA 1E4KA 3ESPA 4XX1G 4XP4H 5KYXA 3MJ8A 1IT9L 3ZE2F 1M4KA 1FZJB 1SJHB 1SYSB 3NA9L 4TTDC 4N25A 3BAWA 1GW0A 1ZRUA 2DZEA 3T71A 5MENE 5C3LD 4P2RE 5T5NF 1BG9A 2LE9A 2OL3A 4X8CA 3ULUD 4A2HA 3GXNA 2LAGB 1HJBC 3T2PA 4K5NA 2D0GA 1ECYA 1OF2B 4KI5E 5AZEL 2WIIB 5FYKL 2DEXX 1U8CA 3PHAA 4OZGE 4NKDB 5FGCE 1HWGB 2CH8A 4N68A 5TH2A 2WBXA 3UGUA 4WENB 3U6XA 1RU9H 2GFBA 4MAYC 5AWNL 3TZVA 1IC7H 3NT0A 4XH2A 3O3BA 2APWA 2H3KA 3KBEA 1MHHA 4HBCL 5TE7H 4F9LC 3CN1A 1IV8A 5FF6A 1AVAA 5FOBA 5CEXB 1AC0A 2DQIH 4W9IC 3ZDWA 3SCMA 2EXYD 3D3VB 3GSRB 2NQ3A 1CFTA 4M5YH 3GUTB 4NYLA 2A6JB 3BKYL 1IAKB 4QLWA 1KB5L 1HSBA 3ZR6A 1HE8A 4J3OC 2KZKA 2HT3D 4N2AA 1KSRA 1FAKT 4TL5A 2YRBA 3FSAA 3C5XA 2EKJA 1NGWB 4JFEE 4W9CC 1XB3A 5KBPA 1H8OA 4Z3JA 1MRFH 4ORGB 4HC1H 2X42A 4GUCA 3MYJB 4MNHA 2HFEA 1G7IA 1SM3H 1JF1A 3MUJA 4PM1A 4JFDA 5G4MA 2F15A 1G9NL 3GGWA 5TPWL 4JFXB 3V6FB 1CTOA 3BQVA 1TQBB 1OGPA 3BZEA 1H6EA 1LXMA 1XCTB 4KK8C 4Q52A 4QXTB 2XPGB 3B9AA 3QIWD 1LYQA 3VQ2C 3JWOH 4M48L 3OM3B 4PI0A 2QVKA 3QNYB 1FLTX 3H9SA 2BRRL 4LEEA 2NZIA 4KJYA 3PWPB 3HJ0A 3F7PC 5HYJB 1I8KA 4I0CC 3VYPA 4LL9A 4RAHA 3N2JA 3RFZA 1CDBA 3LZNA 3OAYH 4JO4L 2X2JA 1I82A 4ZAKB 4NRZB 2X4TB 4Y2DB 4Z1PA 3ULVH 5KBMA 4R97B 1XR9A 4D94A 3L7EB 4EI5B 3UC0H 3ABMB 4JN1H 5BMFH 4KXBA 5FECA 4HKZB 3KYNA 1G9MC 3MGAA 1CPUA 2AK4D 2G75B 2BP5M 1DBAL 1KTLA 1QSFD 1ZLVK 4GI9A 4F3FB 4KKZA 5M94B 3WS3A 2E59A 3D5OF 5EIIB 2A6IA 1K5NB 5D7JA 1BZOA 3N41B 1ADQH 5T1KB 4IKLA 4F9PA 1HQRB 2XN1A 2PWEA 4GW5B 3DARA 4BZYA 3OR7A 5T1MA 5F1NA 3O3DA 1UKQA 4ENZA 2FEEL 1T5WB 1UOVA 4GI6A 2JXMB 4KX7A 4HJGA 2VZ3A 3EJZD 4TSCL 5E5MA 3E8UH 4YWGH 2BZCA 4PJ5B 1AZNA 2EDKA 1AACA 1A21A 2EIZB 4R84A 2GQHA 4YAQA 1RLBA 3O3AA 5I66A 3QRFM 5E94A 2Q2LA 5CJQL 5F44A 1Q0YH 2DJSA 2ZWKA 2EDHA 3QARA 3FUHA 2CHNA 5K5YA 1KLGB 1SUHA 4WWNA 4NP4L 4YZFF 1J8RA 1MRDL 2D7OA 1OAQL 5GHWL 4M7ZB 3J2PA 3F7YB 5JXEA 2FWUA 4BRJA 4BWWA 3CFCH 2Q87A 1P4IL 4JO5A 4K8RC 3HC3L 5CILL 3HZMB 3RX9A 4EBQL 3RE0A 3QUMB 2X3AA 4P46C 3VI3B 1CGWA 1N26A 3EO9H 1R5VA 3UP6A 4ZMZA 1GCFA 2X4OA 4KRPC 2D0FA 1G9HA 2MEJB 4DWHA 1U91A 1X5KA 1D9KB 3VXMB 1BBJA 3H4HA 4H5SB 4G7YH 3TFKD 4ZBJA 2EYSB 4X7FC 4Y8DC 5IHZB 4Z8FH 5GGVY 1ZV2A 3HE7C 3U46B 2YGVA 1O9VA 4JREB 5D7IB 5FUCE 3WMPA 4AYMC 4LBEB 5DJAA 2C1PB 5IM7B 4BSWA 4JZJA 2PUQT 3SN6N 4FTVD 3BGFB 4WGVB 3NGBB 1YY9C 4G9FE 1NEZG 3HC2A 4WTQA 3RAJL 3GHPA 3K3QA 2VR7A 5I1EH 4AG4H 1HAWA 4BK5A 5GRWA 3CSFA 3S35H 4KTGA 1N3NA 1KPRB 4N2HA 1CBVL 4B95C 4HLEA 5J6HA 3Q2LA 2NSXA 2J21A 5FYLD 4XPFL 3B5GA 1PYWA 1DDHA 4I3SL 2HLFC 1D5MA 4XNUH 5MENB 4L0PB 4P2RB 4N8PA 2WBJC 4RH4A 5JOPD 1I3GL 2FD6H 3LRSB 4JHBA 3BP7A 5LBSA 4JM4L 2OMYA 5IJCC 4X0KB 5F6IB 1AYOA 2DV6A 2ED6A 4G6JH 4GAYB 2ZOLA 4BFJA 4Z3IA 5FA4B 5FGCB 4OZGB 4Y4FD 3ZDZF 1M1XB 1M6OA 5E6RB 4M9OA 4PUBL 5T33H 1P6WA 1WWCA 1JVOA 2A9AA 3AVEA 2BDNL 2AC0A 2XXGA 5BPPA 4F57L 5TTRA 2D03H 3KWVA 4QHPA 1IGJA 5DGQA 1RIVH 1F4YH 1F02I 3MR9A 1ORQB 1E9OB 2IGTA 3QXUA 4FYTA 5CS7A 5LVEA 3IGFA 3IU3A 1USQA 3I6KA 5BZDB 2MSPA 4NKOB 5JUEH 2P5EA 4FD0A 2OYMA 5LUMA 2AJZB 2FSEB 1JPGA 4F2ME 5FKPB 2A73A 2CO2A 3V10A 4MWFB 3S5LA 2A9NL 3NJLA 2FJGB 2YGQA 5SWZE 4QWWC 1KJ2L 4LHUD 4KXAA 4TQEH 4JUSA 4I9WD 2P45B 1MNUH 4QTHB 3H9SE 2WZPA 4XNZC 5KVEE 5BOPA 2CA3A 4JFEB 1IGCL 5F7NC 4HH9A 3LHPL 1U8IB 1DCLA 5ALCH 1CBJA 3QZWB 2ICWA 2Z8RA 3VFGH 3VGHA 3EG9B 3D85D 3U25A 5BVPH 4DUVA 1DUZA 3ZIYA 3DRQA 4XP6L 3RVTC 2XRAL 1A02N 2VN4A 1SF3A 4CU6A 2QKIA 3ARFD 4LSUH 4LKCB 1C5DB 1OSEA 2R1WA 5AB2A 2ICEA 4E5XB 2WSPA 5AZ2L 4PS4H 4WO4D 3TO4D 3BRDA 4P9MH 3BP6B 2DEWX 1XX9C 3LXUX 4FQLL 1IAIH 4UINL 5BQDA 3RP1A 5EO1A 1VAHA 2FT6A 3KE0A 1BZ7B 1QO3A 4KJPC 5FWRA 2L4OA 3MLWH 1FRGH 4N8UA 2OQJB 2KLRA 1YEDA 2FEDD 3W5MA 2CM6A 3TEUA 5FV1L 2Z65C 4U7KA 1UWGL 3OZ9H 4ZSOE 2JKJA 5HI4C 1P84J 3WHE1 2DW5A 2VDOB 4TTDD 1EHLH 3WO3B 3H3KA 4Z5RA 3UG5A 3VMPA 1J9CT 1J0KA 4Y7MA 3J7HA 2ZXWB 4DH2A 1TVHA 1ORSA 4ZJ9A 3FTSA 4YLQT 2C26A 3JWOC 1LEKB 3QCTL 2OMVA 1BEYH 1FIGL 5CNHA 2YRLA 4JFUA 1P5VA 4OSUL 5GGRA 5C8JA 5DRXA 5DO2C 1V27A 4JO3L 1OANA 1BSIA 1T6BX 1UACL 1CDGA 2KUTA 3D4CA 4FHBD 4MAYD 5G5DB 5BJTA 4HJ0C 5H4ZA 3RIFK 3TC9A 5D8JH 3WEBA 4AGOA 2ZOTA 3S8GB 2C7UA 1TMCB 2V5YA 2V8MA 1XAKA 5EO9B 3L1EA 5H4YA 5BNXD 3EGXB 1N7MH 1WF5A 4G42B 3BAEL 1YDPB 1JK9B 5SWQB 1PZDA 1UATA 4UILH 1YMHA 1GMEA 5F21B 1TXKA 4YHOH 4FG0A 4O02A 4PP1C 5DS8A 3SYQA 3UPCA 1W9XA 3EKCA 4A7GF 4J3OD 5I17B 4ZMOA 1KIUB 1ML0A 2AI0L 2ZSWB 3DV4A 3FOLA 1WEJL 2W60A 4Q4IA 3CGTA 2X70A 4N0YL 4RWYH 2IOOA 1J8SA 2VR9A 3ARDD 5JW4R 3S88H 2VDOH 4OY9A 1Y1UA 1QQDA 5KSAA 3TEZA 4JFWA 4LB8A 3LKQA 4U1JB 4U3SB 3K0YA 3RUGE 2LLGA 4LIQE 4YDIL 2OZ4H 5C09A 1TETH 1TQBC 1HXYB 1PKQE 3AB0C 4XMXA 2FJHB 5JW3L 4XT1C 4H8UA 4KQ4H 5CR8A 3A5VA 4FQ1H 4LSSH 3UYRL 4HJIA 1YLBB 4G9FB 2F53E 1NICA 2E3VA 1MFEL 4ZO8A 5E8OA 4YSDA 5LAPA 1KIPA 2EC8A 1E7VA 2JB5H 1U8CB 4A2LA 4POUB 3JWNE 5EBMB 4PGCB 3ZYZA 2NY6B 3ZKQD 1LO4L 4A2DA 4OCSL 5C6TL 2VXUH 3O2DL 3O3BB 2XBZA 3MLUH 1B4JL 1MHHB 3GEWB 5I76B 2D31A 2YGNA 2A9CA 4OUUA 5FX3A 3OWEA 3QEHB 3MCKA 1HU8A 4HEME 1RZQA 5IJKA 1PD0A 2XVGA 5FA3A 4QHLA 2Z8WC 3PP3H 2RB8A 3QJZA 1GS7A 1CTMA 3WEAA 5FO8A 4XBEL 2O6PA 4YXLH 2YJQA 4O2CA 3QDAA 3PQYE 2X4QA 2EECA 4HSQA 4P5TC 1QUPA 1Q90A 1JFQL 4NCC2 3JZ7A 1MWAL 2Z0BA 4IRZA 5B7EA 1PZUB 2A9DA 1T5KA 2EYRA 4X9BA 5BV7B 1CXIA 3ASWA 5GGSB 3QJQB 4MNHB 4HP5A 1SJVA 4PB9H 2V0AA 4NPKA 4WSKA 1IAII 2C7FA 4F2MB 3FU7B 1ASPA 2XZCL 2OL3H 4K3JH 4NIYE 4HQQL 3TX4A 4ZFZB 5SWZB 2L7QA 1A6UH 5F7HA 3F58L 3H9SB 4NRYA 4KZ0A 1ZE3H 3KJ4B 5CSBA 4NO5B 4XCFH 4K8RD 4KJYB 3NJGA 3MV9D 1QTSA 2O5ZL 4OM0H 4P46D 1NGPH 1EJFA 4PWEA 4LU5H 5KUMA 3P9LB 1KF9B 3EBGA 1Z3GH 4GS7B 1V05A 2W0KA 2DQFA 4PV9A 1P2CB 2HT4C 3PAVA 1U8JB 4KRPD 4G8IB 5D70H 3MNZB 3EJTA 5AAWA 2YPKA 3VI4E 2XY2A 3CDZB 1HWHB 4F7KA 4R7LA 1AGEA 2P3YA 2DKMA 3HNSL 4DW2L 2FIKB 3HFML 4HISA 3MMEB 1D5BA 4TUJA 1FPTH 5EZLB 2VC2B 4GRWF 3QAZC 4HK3J 1KTLB 3GI9H 2IXQA 1YY9D 3CIQA 4KDTA 1WRFA 4DGYL 1CFVL 3N9GL 5D7JB 3B5HA 4U4IA 1A6TB 4K5OA 4DP0X 4F15C 3CFQA 4YS4A 3QW9A 3PNWA 4BFKA 5BV7H 3O3DB 2ITDA 4R7DB 4ZSOB 3RPBA 4UDTA 2YC1A 1AJ7H 4QRAA 4PV8A 1RK7A 4CSTA 2VO8A 2F5AL 1QP1A 3ZGHA 1M57B 4LLWA 5BZWB 2WBJD 3O3AB 1WZAA 3QWOB 1NC2A 3RHWF 1ZV9A 2FSDA 3DGCR 5D1XC 4KKQA 3GHEH 3VSQA 1NTDA 2BVQA 5KVEH 4AMXA 4OM1L 4KI5C 3X13A 1P7QD 1WH0A 2BNRE 2XZQH 3VG9B 2F19L 3QXTA 3ARSA 1BZ9A 3ETTA 1PZBA 3RNQA 5CWSA 1ONQA 2DWTA 1AXTL 3VDCA 4BUQA 2XXMB 4KNUA 4FLQA 4MMYA 4L1SA 2ZJSL 1V7ML 3H7LA 32C2A 1ZLSL 4YHYC 5KSVA 3HAEG 3ZJAA 5JLZB 2M1KA 4JRFA 4DP4X 2Y5QA 4DKDC 3POHA 4IS6A 1LWJA 2TAAA 3K80A 3QR0A 5GZNA 3VSTA 5GGQL 1IRAY 3DNKA 3F12B 1UZ8A 2KYIA 4GG8A 4OD1H 1MFAL 2XVLA 5C3IA 2A38A 2DBLH 2WINB 2ZUVA 3IU4L 3L3GA 2Q86A 2AV7B 1HDMB 3DO4A 4WU7A 4JN2A 4UZUA 2QMJA 1JWMB 3VWJA 5C9JA 4KO6A 3RUGB 1UYWL 2PYFA 3QC5X 2OMBA 2ZUSA 3RVTD 4CBZA 1NJ9A 4I85A 3FSZA 1PKQB 4NQVB 5TF0A 2NLJA 3L4ZA 3CBKB 3VX0A 1GSMA 4NNYA 1PYWB 4XGZA 3IK2A 2ARJA 3UTSA 2GBTA 2VT0A 1QYGH 2PTTB 1U8QA 4ANXA 4G6KH 1G7HA 3QFDB 5J89A 3BP7B 2F53B 2OMYB 3KEDA 4KJPD 4R0LA 3VXOB 2WV3A 3P30L 3L2LA 3M86A 3FHEA 1IFGA 4CNIB 4R8WL 4S0HA 1TVBB 4KTDL 4AUYA 4AEIL 2W5PA 4PWJA 5CP7A 3G04B 5AVRB 5HI4D 3OR6B 4FL4C 4Z7AA 3RX8A 5FC9A 4Z7QF 2Z1KA 3STLA 2DWDB 3EYOB 1FH2A 2XIIA 4ATTA 3MJ7A 3IU3B 2VLMD 4HIQA 4BDVB 1PL3A 2RFXA 3CDYA 3IKKA 2FYVA 5DD3H 3VGEA 1RFDH 1ZXKA 3PDOA 4PJAA 2BY3A 3O9WC 4FULA 2VUOA 5DO2D 4O2EB 5EORL 3S5LB 5EPMB 4XOAA 7PAZA 3PQYB 3MRLA 5HGAA 4HJ0D 1GKEA 3LOWA 4K23H 2P5WD 5KW9H 3U7WL 3BX7C 4LIQH 1UVQA 4WI4A 5I1JH 4WWPA 3L54A 3L5XL 5DJXA 2ICWB 2VQTA 1JNLH 4U6YA 4ELDA 3KPTA 3RIAF 1MFCH 3SEPA 2ZUTA 1DQLH 4PP1D 1TTFA 3DRQB 1XO8A 4ODUB 1MW0A 2GTWA 3BWUC 4CN4A 25C8L 3L3KB 1TYJA 5E4EC 3NSJA 1M42A 1RPUA 1GZPB 1RUMH 5EMYA 5BW7A 2R29A 2JE8A 3JWNH 2MCPL 2XZAH 5ISZA 3MU3A 4CN6A 4UIKH 2QELA 3NRFA 5DI8A 1DL7H 5K69A 1YEDB 4R2GC 2NW2B 4OKVA 3VI4B 4JDEB 3LPOA 1XL6A 5CEZE 3ABZA 4CDHA 5C7XL 3D87B 2YEZB 4OQTH 5CBEB 4NJ9L 3FO2B 1NAMA 3A23A 3VJ6B 4YO0A 2E56A 4NC1E 5HHVH 2PCFB 2CO4A 2DF3A 1F1DA 2Q76A 2AXFB 1DDTA 3LZQA 3S36L 5CD3B 5IESL 3D4ZA 3T0WA 3VXSA 4R7VA 1AY1L 1BJ1H 1M3IA 1P5VB 1MCNA 5LCVA 1BAFH 3MNWB 4XOEA 4YNYB 4PTUB 1X4XA 2GW5A 1BZ8A 3MAWA 3P9MB 5JXAH 4XX5A 3NDYE 4AQEB 5C70A 4JCLA 5KYYA 3BLKA 1S9XA 2C7UB 4IIQB 3D2TA 1FFOB 2DLHA 2FJUB 1LGVA 3L81A 1J8HA 2VMFA 4HGMA 4OFPA 4JHUA 4PRHD 4QCIB 4H8WL 2HZHA 4WQOA 4ONGL 4HCRH 4OZHA 2R15A 2UZYA 1PCSA 2BNRB 1DBKL 1XIWC 4AYFA 5KVGL 1NCOA 4Y2LA 2RH0A 1T22A 4P5TD 1BAGA 1MW2A 4KAQH 5TDNB 3FOLB 1G6RA 2W60B 1H3VA 4QOKE 1X6LA 4M43H 3MOAH 3HPLB 1KGYE 4PJ5D 4WFFD 5J13B 1JGDA 4JG1H 3F84A 5GRJL 3QYNA 1MLBA 5L2KE 5KSAB 1QQDB 3OAUH 4H0HB 4BCYA 4P23A 4Z7UA 3LKQB 1SN2A 1SY6L 4G6FB 1F8TH 2A77L 5F9OL 1SLWA 2HJKA 4PJCF 4JFPA 4DVRH 5IVZA 1Y07A 3DHPA 3QJTB 3EF7A 4JY5L 4KFZC 3Q48A 2OCCB 1KN4L 2PETA 3TJHC 5EZIL 2IEPA 3FQWB 5C2UB 3EH3B 3JXAA 2P46B 4G8GA 43CAA 1A7PH 2HT4D 2XG5A 5GZOC 5DUMH 4MMXC 4GS7C 1UM6L 3KPOA 2W9LA 3A3YB 1NKRA 3S3JA 3SDAA 3P1VA 4NIKB 1GC1C 3OKOB 2BY1A 1S9WB 5FLVA 4LSRL 1ASOA 2PTUA 4GW1B 4MDJA 1S7QA 1MSPA 5DHYA 4O02H 1ZANH 1OO2A 1EMTH 3FOMA 1FZMA 1PZ5A 2WMPB 4F8QA 2EDRA 4JGMA 5CIPA 4FXTA 2K7QA 3LV3A 5BQ7A 1OZTG 1A9VA 1PZ2A 2VR8A 3QIBB 5DFTA 1DQVA 5FA3B 5T1LD 4PWKA 4QHLB 3FUJA 2VR5A 5KANI 1YJDL 3MNVA 2CQVA 4FI8A 5T1DH 3BQUC 3DVGA 1PZSA 3K1KC 1NAKH 5B3NA 4YXHL 2X4QB 2FJSA 1CE1H 4RZKA 5LQBH 1NIEA 3BMVA 3OG4B 4XHJC 4AJYV 1BGXH 4AZ8B 4RFOL 4P9HL 3ZTJG 1KBGL 2EYRB 2WYTA 2C3VB 3T2OA 5D1XD 1NCCL 3CLEH 1CIUA 2DWSA 1HESA 1IJ9A 4XAKD 1UQSB 2A6DA 1MLCA 2JKRM 2PWDA 1I8MA 1HKLH 4MA8H 3RWIB 5E00B 2FWLB 3R18A 1B0WA 5AYTA 1TZIA 2VLLA 3LZOA 3WTSA 1ZDSA 4NRYB 2R0LH 2NMSA 3GBML 4BH7B 1KCLA 1NLDH 4GJTB 4OAWB 4PSRA 3QULA 2Y6SD 2ZG3A 1W0WB 2WBKA 4PV9B 2AERT 3I3EA 3IBOA 1E8XA 1A47A 4P3CH 1PD1A 2H3NB 1DUYA 2MPAL 1ET5A 4L2LA 4ZOAA 3BVXA 4GAGH 4Z0BH 2EE2A 2YPKB 3TNNB 2FUTA 1MNNA 1OSZB 5SX5H 4YHMH 5K9KB 1JIBA 1AGEB 1B2YA 3T77B 3LKRA 1TDQA 2YUZA 3MYZA 3WMQA 5JIIA 3B9EA 3JV5A 5HYEA 1D5BB 3Q8BA 3I50L 3V4VA 1J5IA 2CMRL 4LCIH 4O4YL 2IQ9H 3FRPG 2ICWI 5HGBA 3KGSA 6TAAA 4KITB 3A4FA 3A47A 2APVA 4NO0B 5E56A 3L5JA 3TTSA 2D4DA 5HYQA 2XN0A 1S2EA 2YD9A 4OCLC 3T0EE 3JBG7 2DQCL 4HT1H 3PNWB 4A6YL 5FM8A 4IW4C 2L3BA 5DA4A 1ED3B 2E86A 4PV8B 2EVJA 1ES0B 4N0CD 4G80A 5I1HL 4LLWB 1EDYA 2YQGA 4JKLA 2XZZA 3LAFA 4Q6IA 1Z9NA 2NY4C 3HC0A 1CL7H 4GYBA 4D7BA 3Q2CA 1NL0L 4RGNC 3ROOB 2ZWNA 5CEYB 3SBRA 1P4LB 4L4TD 5I8CA 4WV1B 3WV0A 4LLMA 3QQ4B 3RZCA 1HZLA 3APFA 1VA9A 3HG4A 4WJ5A 1YNTA 3VCLA 1BCIA 1TYEB 2OK0L 2YARA 2W9DH 1S4IA 1UGKA 2I60L 4BZ1H 1YQ2A 3PL6D 4XRCB 1TJHL 1W2KT 3FTUA 5BZXA 3RNQB 4MCZA 4JM2B 2ZCHL 3CU7A 1GMIA 1AZZC 2EDFA 4FLOA 1XH0A 1NCTA 2IPUK 3LS5H 4LRNL 4XI5C 3ZL4L 5C08D 4RGMC 1E4WL 5F7EH 5FCSH 1XH2A 2YOAA 4IRSB 2ENPA 4K94C 1C12B 1HIML 3MGOA 1CD9B 3O2VH 3PWNA 5CMAA 4A7UA 3O9WD 4QRSB 4DFHA 4YXKL 4I1NB 4R4BB 2MKLC 3UPAA 3WJMB 5GS1B 2OFQA 3FUFA 4GKNA 1M2VB 1O7DC 1RSYA 3CBJB 1RIHH 3LNHA 4GIPD 4QOKB 4GG8B 1XSIA 2GI7A 1NEPA 5FW6A 3VO0A 4X42A 3MLZL 3L3GB 1RUKL 3CZLA 5CEZH 2NDGA 2Y72A 1QI3A 5HDLA 2X6BA 5L2KB 2J2ZB 3MV7E 5MP6H 2P26A 5F97E 2DQHL 2DLIA 2B1OA 3PAUA 1R3IL 4GMSH 1I31A 2G5BA 3GMLB 5I16B 5I8EA 1UXSA 1AQDB 1TO4A 5E08L 5B38B 4JFQB 2Y9RT 3OHXC 4JPIB 1FLRH 2IOIA 5JHBA 4LRIC 4XVUC 1IKFL 3L5WA 3CZFB 4L2YA 4IU2A 4UZGA 3H2WA 5EG6C 3JWDL 4M4PA 1IEHA 1DLHA 2KDYA 5F88A 2EXSA 1SDYA 3X1FA 1WZMA 2SEBB 1OP9A 5E5UB 1FNSH 1LEGA 4FP8L 3U82B 3UTZA 3EXLA 4R2GD 3GMRA 5ID0B 3KM2A 4WWID 4HXBL 5I1DB 3QEGL 4JBSA 5E6UB 2X7LA 4YHZH 3D2UB 2G9HB 3A67L 1DQKA 5D1ZC 4NBXB 1L7TL 1N5YL 1H8LA 1OPOA 3LQAC 1OGAA 1ZTXE 4OLXL 4PD4K 3GSUA 5I1KH 3HMXA 1WC7A 3RWHA 4LL1A 2BVEA 5MI0B 2OR8A 5E9DE 5JW4Q 3ARPA 4KO9A 2XX0A 4ZW5A 3TCLB 3UADA 1YNKL 2P80D 3MFGB 5ADOL 1PD6A 3KW7A 4KY1L 1UOLA 4JJ5A 3TH4T 2CIIA 2YZ8A 4FFTA 2W9EH 4X7SL 1SN5A 2O93L 1MQ8A 1CF8L 1MCHA 2XG4B 4UM8B 2B08A 4IIQC 1N8OE 4E42B 1UB6B 5AZUA 3VU1A 1D3CA 5DVOA 2IH8A 4U6YB 3NZHL 1BBDH 3WFZA 1E5CA 3FULA 4WTZG 5IB3B 2N3JA 5L4FA 1BYPA 1V3KA 3D69A 3IFNH 4E36A 3NCBB 4MZIA 1XIWD 3BWZA 3IDIB 3ZQ9A 5HPMB 2MWCA 1ZT1A 3JTBA 2OMTB 4PD4J 3SY6A 4KUCF 1WGVA 3FCBA 1KXTB 4PIRF 1JUFB 2GY7B 4XO5A 2IBZX 4OGQC 3PFUA 3FU3A 5F7LB 3U9UB 4GG6E 3TBSA 1GPOL 5IQ7H 2Y07L 4IEFA 4TQIA 5IROA 5DI8B 3SYAA 4AT6A 3WNJA 5J13C 3DA0A 2BP8B 5TDPB 3Q6GH 4OKVB 1HINH 2GKIA 1IUZA 1CL7I 4WI7A 1DQJA 5DXWA 3VFUA 1MDAA 4M3KB 4OZFA 1WG3A 4ATWA 5TF1L 1S7RA 2WP3T 1CG9A 5FGRA 3TJHD 3VFVA 2IH3B 1N2RB 4OV5B 1XGTA 4K9EL 2P28B 1BFTA 4YO0B 5D7HA 5KSUA 1ACXA 3ALXA 2MNJB 1IE5A 4P3DA 1GJUA 4GRLA 2QFRA 3QJHB 4U6XA 5L6YL 5FYKE 3UAJA 4CSPA 1JDCA 2GBAA 4DN3H 1USZA 3P9WB 2BSEA 3WS6C 4Z7NE 2IDTA 3CJJA 1NFDE 1BVNP 1FZKA 1RULH 3MRNB 4YEEA 4ZX6A 4FG4A 2VDLB 4UYPA 2BOCA 1OCOB 2AJXH 3T1FA 2QV4A 1UADC 2G60H 2QSCH 1FN4B 2LV4A 2R29H 5AW7B 3O45A 3BQUD 2BPBA 4X4MA 1JPFB 5CINL 1LE5A 3LQMA 4PJEF 4HHAA 4XHJD 2DMCA 3CN4A 4N8VG 3IJ8A 1YN6A 1FE8L 5IJVA 2CIKB 1JGDB 3FQ4A 3RWFB 3ENEA 5ECJE 4N90E 3OMAB 5IHUH 1ZSDB 5BS0E 3AREC 1NAMH 1YEWA 5KS9A 1E43A 4QHMB 3KCWA 1IZJA 1OSYA 4ZD3H 2BNQD 2RACA 2DQUH 1EEYA 4J4PA 3DRTA 2QSVA 3BZ4B 4PTTB 2YWZA 2B4CH 4YSRA 5GRUL 3U36A 1KCRL 4DP2X 4Y19D 3BW9B 2HA1A 3SQOH 4Z77B 5FFGA 1IBGL 4PJDF 1RZFL 4N86A 5CHNB 1TOXA 3P4MB 3FFDA 3MV7B 1MFDH 5EBLB 1Z9OA 3EJUA 3MODH 4BQ6A 2W07A 3SDAB 3ULUC 4RMTA 2CR3A 4AVKA 4PJ9A 4TRPH 2R1YB 4ZO7A 1VCAA 5GGTL 5K93A 4DP1X 4EDWH 1IAIM 3SE3C 3VFRB 1UWXK 3KLAB 5F7KC 2VDLH 4CN1A 3GM8A 4MDJB 2Z4QB 1EFXD 4XXDB 1ZWIB 4KXZH 5DHYB 5EWIL 2V4LA 3OKDA 3H3PL 4WSGA 1AR1B 5CCKL 2FRGP 1EZLA 2R8SH 1T5XB 2YFNA 3L9YA 3HI6L 1MEXH 5CIPB 1R6VA 2V6HA 2Y5EA 4KKAC 4M00A 4P2YA 3HRZB 5ICXB 3T5WA 5HHQB 2WW8A 3PWJB 4PJIF 4KWUA 4JQIL 1QR1A 2AS5M 3D39A 4O58L 5I8KH 1HNFA 3RY5A 3D48R 3IDMB 2FB4H 2VLKE 3K4DA 3J07A 4X5XA 1I8IB 1CMOA 1JNNH 1DVFB 4OLVH 1QLFB 3M1BA 2V17L 5B7FA 2J3SA 4PY7A 4YDKH 2NY4D 4K3GA 4XBPB 5I2IB 3H4FA 4AL8C 3ZE2E 4RGND 1NSNL 2HH0H 5E9DB 3SODB 3WAJA 3AY4C 3O8XA 3CFMA 3GJFB 5INCB 5EBWB 1X4ZA 2BFVH 4GXFA 5JMOC 2QDVA 4O51B 1FZOB 5E8NA 4NUJB 4BA8A 4Y2OB 1I8MB 4FFYH 4S0SD 1RZ8A 3WE6A 1NCBH 3LH2L 1NIDA 5DHMC 5BRZE 5FO7B 2DIBA 5GGUB 5ICYB 1VPOL 4UTBA 1JZ6A 3H0TA 3PP4H 4UQBA 5LNGA 2NTFB 3KYKH 4Z23A 4XI5D 2UYLB 4AX3A 1FL3B 2ITCB 3LIZL 3BJLA 4F8LA 2E46A 1DUYB 2A74C 2R2CA 4IRSC 3FCTB 3QDMA 2GB2A 1H15B 2XA8H 3GXPA 3RI5K 2DDQL 2ICES 5CIPH 5HJ3A 4PCKA 3ULUF 4F7PB 4YHIA 2BS9A 3IS0X 4PMFA 3BC9A 3UBXG 3MRQB 3QUXB 1TMQA 3WEXA 1HEJC 3V4VB 3IMTA 2AITA 1AFVL 1NCAH 4Y5XA 4GG6B 2E9IA 5D9SB 1BOGB 2HJLA 3ESMA 4FNQA 4YX2L 1FG2A 3S4SG 4IBZA 4MCYA 4YSPA 5CCHE 1WT5C 1ZTXH 1B0GA 4A67A 1R46A 3QJFB 4XCNB 3ZDYE 1RLWA 1OTSC 4N0UA 2BOBA 1AGDA 5EOCH 4OJEH 4IU3A 3BPNC 4P2OC 1AG6A 3BGAA 3GJFH 1RZ7L 5ANMA 3WSQH 3GSWA 4U1LA 4JPQA 4XVUD 1N8ZA 4GSRA 5IV2B 2YXVA 4NHCH 5JDJA 4E41E 1E67A 2WWKO 4HLJA 3CC5B 3VH8A 4HKBA 3RVWC 4Y1AE 2A83A 3QJXA 5CJBA 5I8CB 2I9TA 4L4JA 2YD3A 4PRPA 1UUNA 4WJ5B 4J8QA 5T3XL 3REVA 4YDLC 3T2LA 1WD9A 1HILB 2R69L 2IDFA 3Q13A 4MD0B 5D1ZD 4Z7NB 2MNWA 4AV5A 1AQKH 5FHBL 1NFDB 2Y1YA 3S98A 4WIQA 1DQMH 1EWHA 4GNKB 4XMKH 4Y5VB 3JYCA 3QGVA 4EQ2A 5JQHC 4KKCC 3EW3B 3KVPA 4A2EA 3LIUA 4I8DA 2CGRL 4HPOH 1UZ6F 5E1GA 3V4VH 5MI0C 5D7EA 2ZG2A 3DROB 1DVUA 2Y7MA 3WL9B 1T21A 1KB5B 5JA8B 2WXNA 3PP3K 1PY4A 3HN8A 5DQJA 4N6QA 4RMSA 4W1TA 5FYJL 1HQ4A 3MDJA 3RTLA 3WCYA 4TTGA 4UV4H 5C0CD 2ZYIA 4JVWA 1X5FA 1PFOA 5SWSD 3RL2A 1IT9H 1IGTA 1OQXA 3MLXL 3NA9H 3ALWA 1JTOA 4KXZI 5TDOA 5BS0B 4PJ8C 4I48A 2W0FA 4OGXL 4UB0H 4P4RA 1RKRA 3VU2A 4ZW3A 4IHBA 1H3PL 1F4XL 2WLJA 4NZTL 4I5BA 3W9EA 2IAMA 5AZEH 5JOFA 5FYKH 4PW9A 2HVJB 1I1RA 3TYFA 4LSQL 2W8CA 1J48A 4FFZL 4YZFE 1KB9J 4IHOB 2DM3A 2EAEA 5AWNH 4L3FA 2G30A 2IIJA 4KKPA 4PQXA 3SDYL 4HBCH 1IBBA 1H0DA 4X4YA 1X4YA 3CSYB 1RUPH 4DOHE 4DTGH 5E9AA 1ZHKA 1HOEA 1AS6A 4EUPG 2ZZUT 5AB9A 1CQKA 3LH9A 1VEMA 1QBLH 1VFUA 3OLDA 4KXCA 3GSUB 3BKYH 1WC7B 3RWHB 3GRGA 2WNGA 1DJHA 1KB5H 4NN6C 1XWVA 4CSSA 4AUJA 4XVTL 5INDA 2XNAB 3WFHB 3V0IA 3E6FA 3V5KA 1RHHB 3HHSA 1SHWA 3CMOL 1U4EA 1YEEH 1M05B 1T89C 4JRYA 3T0EC 2OP4L 2EE3A 3C5ZC 5DFWH 1DVYA 1JCVA 2VLKB 3B5TA 5ESQB 4F5CE 4HIEB 5SV4A 3V2AR 1G9NH 2H6OA 5TPWH 4DP8X 1IC4H 4BGDA 4ADGA 2FECL 3FF8A 4RWHA 3TS8A 3CDCA 3ZE2B 2G2RA 3OC8A 4QEGA 1RVFL 2OKMA 1X3DA 4YGVA 5EZJB 1H5BA 5A16A 2BRRH 2C9AA 3UEQA 5EEWA 1J5OL 2R2HB 3P2DA 3UX9B 3OQRA 4I0PC 3C6SB 3D0VB 3NH7L 5KBLA 1PGRB 5GRVK 1ZT1B 4RGOL 3LKSB 3AITA 5BRZB 4JO4H 1NDGA 1KGIA 1FWXA 3H3BC 3B2UC 3CHQA 5F9DC 3ZDZE 1L6ZA 2BVTA 2X53A 3D0LA 5IF0A 3IGLA 2PPDA 4DKEL 1IM3B 1YYCA 3SJVA 4X8JB 1N6QL 2CRMA 3U0PA 1TZGH 1EFQA 1UC6A 2BSRB 1XF2A 3RY6C 1JI2A 3ARED 2XPYA 3QORB 3VDBA 3DURB 2VYRE 4ZUUB 5LGJA 1DBAH 2XSKA 4UQ3A 5IJDC 2PWFA 4OZFB 4OZIF 3FFCE 2WY3B 2WQXA 1PIGA 3NZ8A 3KH4A 4ES8A 4AQZA 3VD3A 3UMNA 1XGTB 3APCA 4XVOA 4OGYL 4MMZB 2DEYX 4HJJH 4PGBA 4DP9X 3P02A 3HVDA 1Z9SB 2Y2YA 5F7DA 4MNQA 1RZPA 1R5IB 1OB1A 2VNCA 1OSPH 1YUKB 5I1GH 3K8KA 4JKMA 1WBYA 1HH6B 3GRWA 4RDQF 5I28A 3FQUB 2OX5B 3MHZA 4Q2ZA 4D0DA 5D5MA 4NP4H 3HI1B 3OAZK 5M7QA 2ED8A 4BA0A 1MRDH 4XXWC 1FZKB 2PCPB 4L8SA 5D6CA 5GHWH 4E41B 1CWVA 1XD0A 2ZXCA 1CGSH 3DXAD 4KKAD 4F7TA 1UB5B 4Y1AB 2BOCB 4WTWA 1S7WA 4JFYA 1P4IH 3HRZC 3S37L 5E8EB 3HC3H 5CILH 3S3BB 2HP4A 5I74B 4MXWL 2HX9A 1Z0NA 4U6TA 5BUPA 1LE5B 2Q8AL 2Q20A 5IVNA 4OVVA 2QGEA 1RMFL 3BEWB 4JEGB 3ML9A 1DN0A 4ZX3A 1GZHC 4OZFH 2DLTA 1CDIA 2EH7L 4WW2A 3PGDB 1NEZA 3PWVA 2XFXA 1KTDB 4JFSA 1T20A 1CVSC 2YPLE 1VGEL 3PWLB 3HS8A 4TLKA 1UKSA 3K91A 4IKKA 1KJ2B 3RAJH 1OP5K 5BRQA 3VG0L 3SKOB 4PW4A 3WJJA 1TT6A 4UNVA 5DQDL 1NGQH 4BGLA 4FN0A 1CBVH 3EZ8A 3F6JA 4X6BB 1X5HA 3LEYL 4NQDA 5DMGC 4XPFH 3VXTA 1IC5L 3GIVA 4XPHL 4FQIH 1I3GH 2LT9A 4JM4H 2HKFH 4K3EL 1GW6A 3VGFA 1N19A 3MV01 2DWYA 2RMNA 4CC4A 1LE9A 4TSBL 2VJ0A 4XWGL 3F05A 4WO0A 1CICB 1B88A 2XACC 4PUBH 2PCYA 4KKLC 3U4EA 4QI3A 3B9KA 2F8VA 1Z0MA 4F57H 5I8OL 2MTAA 2Y5TA 3EFFA 5EU5B 1E5BA 1RJZA 3D9AH 4ZYKB 2J5WA 3GMPA 3MLTA 3OPUA 4MVBD 5CJOL 4WK4B 4DOHB 3BO8A 5GISL 2GJ6A 1SOQA 4JE4B 4P2OD 5DEFB 4YUEH 5E4OA 3WKNA 4DUWA 5FYLL 5B3SB 5KVMC 3TBVB 3HOGA 4AJ0A 2A9NH 1FORH 4UOW1 2X28A 3GEFA 4XZ4A 4EIUA 2AJ3B 2ZX5A 2AQPA 4J39A 3CPLA 3RVWD 4JDTL 4J3OF 5DVLA 1ITBB 3GB7A 3BVNB 1KXVA 3KPSE 4Y9EA 2ENSA 1P1ZA 4AMKH 4QRQA 3BZ5A 5LWYH 3WOVA 3WTVA 4YSTA 1KTRL 1NGYB 4PGDB 4X8XA 2GK0A 4D0CA 5FW8A 3KH3A 4Y9FA 1I1AC 3H0TB 4XP6H 2XRAH 4EI6A 4HIXL 5EDSA 1T0MA 1MREL 2WZ6A 3CXDL 4RDBA 4ABVA 5I71B 4DZBB 1P4BH 3VE0B 5K1VA 3ROLA 4L4VE 3ZU8A 4PJ7A 1T2JA 1SNRA 3QQXA 2XQ0A 1OE1A 2XWRA 4KKCD 1JK8B 2HSIA 3BHBB 4FQLH 4Y5VC 3T4YA 2VDRL 1IU1A 1SFDA 4UINH 1A3RL 1K8DA 2FEEI 4Q0XL 5CU5A 3RGVA 3NN8A 1UD8A 5F93C 3WFDL 1MCCA 3QCVH 4QRRD 3UTPD 3WEXB 3DHMA 3ZDZB 4TMPA 4NGHL 4PP2B 2FQFA 3W82A 5L7XL 2BVOA 4JHAL 3DK2A 1HEZA 4QYAA 3LN9A 1T7YA 1VB9A 2AQRA 3VFOA 3TN0A 1FG2B 1IEAA 3L3OC 2IPTH 1BJ1J 1B6DA 4PJ8D 1JZ5A 5JNYB 4D9QE 3QNXB 1B0GB 2QVMA 4ODXA 2VKXA 2ICWJ 1AGDB 3FFCB 3ZUCA 1ZDQA 2OULB 4CC1A 2YN3A 3T3PF 4OSUH 1K2DB 3QEQE 5FAAA 4JO3H 1UACH 4RFEB 1XTLA 4K7PY 3VQ1C 3VH8B 2UY7B 2I9TB 2RD0A 4QMEA 5B8CC 3DIFA 3VGBA 4E9YA 5EIIG 4XB3A 4QRUA 3EIFA 5D7LD 5LLIC 1FL5A 4IOIB 4J1UB 3TASA 4AEFA 4GUOA 1BXVA 3BAEH 4CRPA 4LOEA 4NERA 2CHWA 4OV6F 2AEPL 2X6MA 4F2EA 4IKJA 3FKUS 1FA4A 3CD4A 3UTTE 1MFUA 3WDJA 3VFTA 4L23A 4WRLA 3VAEA 2Z31A 2BCKB 5FCUL 3W3BA 1THAA 2AI0H 2AQ2A 2VERA 4C57C 1SLVA 1OW0A 1WEJH 3O6FB 1BZEA 3SBWC 1BIIA 1Q8MA 1YVLA 1T21B 4GRWE 3C5ZD 4MS6A 3FHAA 3HIZA 4KO5A 3T0ED 3VXNB 3CSBA 4M7LH 4CMHB 1IKNA 5EEXA 4F8PA 4P4KA 4NQEE 4Y4HC 3KXFD 5E0FA 2D3JA 3S9DB 1MWAB 1HQ4B 3KWTA 4YDIH 1T0OA 1KIRA 2J73A 3NABH 3MUGA 5ALBL 3QWRD 2EDLA 3EYUL 5JW3H 1BVKA 4NKIL 1TSRA 5TDOB 2NZ1A 1N5AB 3BH9A 1N12A 4AXWB 1AO7A 2WQWA 3EOTH 4HH8A 4KROB 2YPLB 4JHZA 3SDDA 5AOZA 4I0PD 4R7NA 5E6IB 5IIEA 1P5UA 4YBHA 3W9EB 2WQVA 5A2KH 5IREA 3SGJA 4MJID 5CCJA 4FNLH 3OKMB 2J12B 4ODWB 3QPXL 43C9B 1CURA 4HX1B 3B2UD 2YD0A 3K2MC 3TYFB 5KWYC 1QRKA 4I88A 4JB9H 5DC2A 3L7FB 1KJVB 4J6IA 2K7PA 2WLIA 3QJVB 2P7TB 4OCSH 5C6TH 3O2DH 1ZT4B 2WXKA 5AW2B 4X8GA 4YPJA 3BJ91 3NTCH 5EU4B 2PN5A 4YK4B 3QDJE 4JPKH 5EIQA 3KPLB 4WWKA 4RQQA 3D09A 2XWZA 1N6VA 3QFJA 2E76C 3LPGA 2ZXQA 3VTTA 4NEHB 4XAWL 2DYPA 3O6ML 4PJHA 4XCYB 3DUUB 4B27A 2JMRA 3ECWA 1E5YA 1LQSR 3NJVA 2AW2A 3Q3GA 4HW6A 4NM4L 2MCMA 2BINA 1FFQA 3ZKXB 1MWAH 4UT9L 3HE6B 5JIDA 2RGSA 3QIUB 3KLHD 4FNTA 2YRZA 1JPSH 1VKXB 4G7QB 5HJBA 2YSSA 1U8LA 1M6UA 1X6NA 2Y3NA 1YY8A 2XZCH 4HQQH 4JO2H 3N1GC 3E2HC 3D07A 1OQOA 1MIEL 1KWKA 1JXDA 2A9ML 3HUJA 5I9QB 3VD0A 1H5BB 2VR3A 3K71A 4KX8A 4WEEA 3KPSB 2E4TA 2V9TA 3LVEA 2O5ZH 1A4JB 5I74C 1KBBA 4OB5L 4GQZA 2AJVL 5H37G 5DHVA 3KJ6L 4UF7C 1WAEA 3TESA 4D8PB 2YLHA 1N0LA 1QEWB 3ZE1F 4ZTOH 1GZQB 3WIAA 3AM8A 1T7ZA 2R27A 4MQXC 3D0LB 3G5YB 2K3HA 2X38A 4MLIA 3VGGA 2E9JA 2H0EA 2WLLB 4G2AA 4N3TA 4L4VB 5EEZA 3ZY7A 1MI5A 3HFMH 3QZWG 2P42B 2D7QA 3MLSL 3P4OB 2GTZB 4Z7QE 1U42A 3FO0L 4PRNB 5LGJB 4JLRA 4R96A 4AH2A 1BWWA 1UFGA 4ETQA 4NZ8A 1UCBL 1L6PA 2X5PA 1CFNB 3AY2A 4DGYH 1M3JA 1CFVH 3N9GH 5KJ7E 1JMZA 4E5XG 1Y0LA 1KTCA 5KSBA 1A6ZB 1MJ8H 2J6EA 4LAJH 4URKA 4K8RL 1UWFA 3V6ZA 4BK4A 4NNXA 3SKMB 9CGTA 5F7DB 3BUDA 3GHBL 5DMGD 3CFEA 2IO5A 3U9WA 1F3JA 4Y16B 1DQQA 1E40A 1KCBA 1MJ7L 1WBYB 4HMDA 3FQXB 3ARBC 1KTJA 2NUPA 1GH7A 3FYEB 5C86A 4Q2ZB 1NCGA 3C8KA 3CN2A 3HZYB 1NPJA 3QEQB 4WEMB 1KCVL 3X1GA 4KKLD 1TPXB 3U79A 5IB1B 1W72A 4N1HB 4AIZA 2KLSA 4X6CF 3QG7L 2PXYA 4RSVA 4CGTA 5CGMA 5DMIH 4GB9A 2VAAB 4YHNA 3REWA 3G5ZB 4CDGC 1CZ8L 4FI7A 3HAEA 1AXTH 4PWFA 2QADC 2X10A 3ARRA 4OTXH 3WFBH 2ZJSH 4I3RL 5F3BB 1JDDA 4ZPVB 5C0DA 1JHLL 3ZR5A 1Y1DA 3FU8A 4BH8A 3UTTB 1XGYL 5EF0A 4X98B 4B9YA 2TRYA 3TV3L 5GGQH 3TIEA 3PF2A 1ZK9A 4NT6A 4W68A 1J1PL 2Q7AA 1MFAH 4YPGA 3VWKB 3PREA 3S3SA 3IU4H 3QA3A 3U4BL 5JHDD 3FB5A 4GRWB 1ACZA 1S5HA 2AVFA 1EK3A 3KYMA 1SJEB 4G5ZL 3EOAA 4NQEB 1K4DB 2H26B 2FBJH 4N24A 4PJGF 5E1HB 2RHEA 3Q6FB 3V4PL 1UEMA 3G08A 2WUCL 1UYWH 1I1AD 4MFHA 3ZVVA 2CBQA 3ZO9A 4LF3B 2PPCA 3GRWH 5HGDA 1IO4C 1FVDA 1G4RA 2YBRA 3VXTB 1LJMA 4W9ZA 4FXKC 2IAND 2YQ3A 1KB3A 3FO9B 4KJQC 5GPRA 2JKNA 2CJTA 5F7AA 2H1LM 1O0VA 2CSPA 5AOMA 3P30H 4YFEA 1T6VN 1JV5A 1JP5A 4B97A 4YSEA 1KG0A 2PO6A 2WO3B 4R8WH 2WUBH 2JQZA 3EBIA 4DP6X 3B9KB 4AEIH 4BV1A 1VFBB 4ETYA 1RJZB 2AP2A 2GUOB 1OIOA 4IOSD 3RGHA 4ZMVA 3MLTB 4Y5YA 3AZUA 3QDJB 2V7NA 3IKCB 3QUZB 2FX8L 1CVRA 2YGOA 4YJZL 1SBSH 3BPCB 2DJ4A 4V1DA 2I24N 4HETA 5K9QI 5EORH 2V8LA 1FO0A 4GRWH 4PJCE 4EDXB 1PEZA 3PL6A 3VFNB 3N1QC 3EO1A 1G1YA 4HZLA 4IRJB 3CPLB 1DQDL 1FH5L 4OJFL 4KDWA 2IGFL 3RKPA 3GB7B 3U7WH 5ACLA 1NBZB 1UG9A 4G9DB 3L5XH 2A1WH 2CUHA 2A0LC 4Q4EA 3H7BA 2DQJH 3GIZL 1AKPA 1O6SA 4ESKA 5DJZA 5JW4M 4N85A 3I75A 5FEBA 25C8H 1L7IL 2MOVA 3BSZA 1I9RL 3K74B 4HFWB 4QDGA 4KZEL 1HHJB 3EJQA 4W9GC 4IKIA 3SYPA 4B60A 2NX5E 2Z1PA 3TZVC 2NXZB 1A4KA 5K9OA 1SDDA 4QT5A 1AHWA 4K2UL 4B9PA 2CJ3A 3PJSA 3QE5A 4PREA 3OTTA 1WITA 1RH8A 1JF6A 1JXJA 1SF5A 3FAXA 1VJSA 2NSQA 2B3IA 1OAXL 4BFBD 4G6MH 4Y4HD 1UHVA 2R7EB 2ROYA 2VLKD 3SCMC 3D0AA 1ASQA 3WIHL 2YSTA 4GXUM 5JW5B 2ZCLH 3FB6B 4S1SL 3MROA 1SN0A 2DQDL 4AV0A 4NPYA 2RR3A 1X9QA 1HEZB 5C7XH 3TN0B 4KQ3L 4GW4A 4LO9A 4HOMA 4EKXA 4LCWE 1F6AA 1NCNA 2X4RB 4Z7QB 2GC7C 5J57B 1VGKB 1GHFL 4I89A 4MCMA 5C0AE 1E8YA 1FFTB 3V52H 4F37K 1EHNA 3G6JA 4ISVB 5EUOF 3S36H 5IESH 3C60A 3CZJA 3MI6A 2UWEF 3P3SA 1AY1H 5BRZD 4M93C 5ITBH 1NA8A 1IVLA 1BIHA 4C4KO 1A3ZA 2XKNB 3CSPA 2DKSA 3FSVA 2AK1L 4YDZA 1L5GB 4WI3A 3S96B 3ARZA 4ELMF 3S48A 5A7EA 1UOWA 1QLEL 2JIXB 4Y7OC 3CXHK 4OLZL 4PG2C 4WUKL 3PV6A 2F54D 3EGSB 1GSKA 1FL5B 2I27N 4XN7A 2GAZB 3WNKA 3F3HA 3OKNB 4H8WH 1JGVL 4ONGH 3O41B 1HL5A 4BD4A 4ELKB 2WKOF 4TULL 1QA9A 2R2BB 2UXGA 3I6GB 3RFZC 3CQPA 1IX2A 4FQXA 4C55A 1RK0A 2Y7OA 3UAFA 2H2PC 3SOBH 3B6SA 3IVKA 3IDYB 3JSSA 3W2DL 1E9QB 2EE6A 3IN2A 2YKLL 2VLJD 1I9JL 2XWBB 3FUNA 3HE6C 3CNKA 3KBPA 4HULB 3QIUC 4KRMB 4MLSA 4FF9A 5GRJH 1OTUC 4F58L 4P4KB 5AG8A 5KYWA 5H35B 2WB1A 3CSGA 3Q44A 4HUXB 1EDHA 3RZWA 3OF6A 2EQDA 2Z64C 1SY6H 1TCRA 2J56A 2XVKA 2V33A 2A77H 4MA1C 3H9HA 4I18B 1AGFA 2ZAHA 3CVIL 3ZE0F 2K45A 1RZGB 2QQKH 4FQJL 4ES9A 3X11B 4JY5H 5DJ8A 3BH9B 5CSZA 2NY2B 5I9QC 2C34A 2YPVA 1QSED 2X4PA 5EZIH 3X17A 8FABB 4DF9A 2C3XA 3T09A 3DMMA 3PE9A 2X41A 3VTMA 1BECA 1JSYA 2GT9A 3TJEL 4WNQB 4NRXB 4GO9A 2NQDA 2ADFH 1UM6H 4AIOA 3U4AA 4CW1A 1MHEA 2WQRA 3U2IA 1JVLA 5C0BD 1T66C 2APBA 3KVQA 4MQXD 5CCGE 4WTXA 1DBML 2ZOWA 3W38A 4XHQA 4LSRH 5EULV 2FLRT 3MCYA 4CBPA 1KLFA 2K0RA 3BP5B 3CDGB 4J3WA 1S3KL 1U92A 1H9VA 1YYLH 4P49A 5F8RC 1K85A 5LBGA 5EF1A 1HHKA 4P2QD 1UD2A 1TENA 3GNML 1IGYA 5E9NA 2ESVA 3IWUA 1DSFL 1O7VA 4UUJB 3BUIA 4UT6L 1YJDH 1KGCE 3VXRE 2R1XA 1EO8L 5T5FL 3HN3A 4K55A 3W39B 2AANA 4YXHH 4L8BB 3Q3GB 5DEGA 2KZBA 2VDPH 3HB3B 4XP9L 1BHGA 4TNWF 1YECH 4P9HH 5D2LA 1WFIA 1X5ZA 4NWTL 4TVPE 1AH1A 1ZS8A 4A6YB 3HFFA 4JZJC 4MQTB 3TTYA 3JWNG 5CLYA 1V3MA 3OG6B 1NCCH 1FV1B 3ZGIA 3ARBD 3FONB 1U8LB 4H8VA 1AKJA 3UDWA 1T3FB 4PJBF 4DCQB 1EAQA 3MXWH 5I75B 5AVSB 4OCYL 3GYRA 4LAQL 4PJCB 4I77H 5EN2B 4IMKA 2D8KA 3X14A 2FATL 4ALAC 1UT9A 5ILTL 1T7XA 2NNAA 1FL6A 3R7RA 4KTEH 4IK6A 4B7LA 2P24B 2WVSA 4GI8A 5GS2H 2YD1A 2HLEB 2QADD 2E27H 4AITA 5EFIB 3S5LG 4M61A 2VQ1A 1N0LB 2H0FA 4RA0C 3L3JB 1VADA 2VM4A 4HWEL 4Y8AA 3UPRA 1B0RA 2HN7A 3IPBA 2NT1A 1KYOK 3FRPA 4YSOA 4I1PA 5FGBA 1DHKA 2XWTB 3T8MA 3CBRA 2AJYH 2NX5B 3NFNA 1NMCC 2RTTA 3BXNB 4HXAH 3H2QA 3MVSA 1KWGA 5JOEA 1HZHH 1WAAF 2CMRH 2K4AA 4O4YH 3FMGL 3ARWA 3KDPB 5IGXH 3RWJB 1O9WA 3VWKC 2XQYK 5EOCJ 3V0EA 1BWMA 1P6FA 4ETQB 1YNLL 1GGTA 3CFUA 1AHKA 3QI9D 1QFWL 1WBXB 5C0NC 3MLYL 5E0QA 1F1GA 2DQCH 4FA8A 5IW6A 4A6YH 4D9LL 3QDGE 4IMLB 1TEFA 4DAGL 3TLRA 4J8RA 3CFEB 1BZDA 1OVZA 1F3JB 4J6RL 4LCWB 2VL5A 1TQTA 2FNBA 1F1AA 1DSYA 4M6NL 5CO1A 5F7MC 4PGEB 5C0AB 4KJQD 1FGNL 3WJLA 1NL0H 3RX5A 1WAPA 2FL5A 3BSGA 2LFGA 3QUKB 4PAZA 3KPQA 4JDZB 1U58B 4FNUA 3NCYS 1I7ZA 1W72B 2ZCKL 1OGSA 4PGZA 2QKIC 3I9GL 3MJ9A 3N44F 5DVNA 2GYSA 1TJHH 1JVKA 2ICEC 5DJ2B 3NPSB 4LLDA 3CC1A 1AGBA 2ZCHH 4B9IA 3E38A 4KZDH 1A7OL 3ZL4H 3P69A 3QB7C 5F0PB 3K2KA 3UJTL 1E4WH 5IEKA 4U6VL 1BVLA 1R5WA 3QUZC 2X0WA 2KKQA 1HIMH 4AM0A 1U3HD 2EEDA 4PRIA 3X2QB 4OLWL 3L4UA 3PHQB 1RUAL 1G87A 4YXKH 2LLNA 3I6SA 3TNMA 2QT6A 4BSVA 2Y36L 4LP4A 3HKZA 1BFSA 3SPVA 4NT6B 1C5CL 3OWRA 4LEBA 4YPGB 2GIMA 3MLZH 1RUKH 2FGWL 1N70A 3QA3B 4WFHD 4NX0A 2WXRA 1S5HB 4JGNA 4GLRH 4W4OA 3KYMB 1S7UA 1T1ZA 3BAKA 2A0LD 2G2PA 4S1DC 5CKGA 2ZSVB 3G08B 12E8L 3IAQA 3NSFA 5D4IA 4KI1A 3RTQB 1PJ9A 5IQ9B 2QLVB 3NFPA 5FYJU 3IXTA 2X40A 4AENB 5E08H 2N56A 3DX4A 5E2VH 2O1AA 2DQGL 1J86A 3TZVD 4B9GA 2FHCA 2X0UA 5HHNA 4HAGA 4NWUH 5DSCB 1FAIL 2X9XA 4AQ8A 1MCSA 4X9HA 2ADJA 5B1BB 1L9SA 3UIYA 1W72H 3TL5A 3JWDH 2IVFC 3L5IA 1X5XA 2KHAA 4C8XA 3S2AA 2CO1A 5E5LA 3T4AA 4FP8H 4X6FA 2ESVE 3SCMD 2GSIA 1KG0B 3M1CA 3HHMA 3QXWA 4RZCA 5D7SL 2C4FT 2H4EA 4HXBH 2EEBA 2L0DA 3BIBX 5IMKB 5I1IL 5FLUA 2WK2A 4P57A 3A6OA 1A6VL 4AQ1A 1OAYH 1A8ZA 4PJEE 1L7TH 5AFAA 1N5YH 4N3UA 3K6OA 5E7FA 3ZDXF 1FFPA 3V5HB 5C07A 4XCEA 3BUPA 5TE6H 4NUQA 3L9EA 1PDKA 4KK9C 4ZMLA 2CBMA 1L9RA 4JFDD 2CA4A 1YNKH 1YQVL 4L9LB 3VXRB 3ZT5A 1FO0B 4KY1H 4OFDA 3ARGB 2D7TL 3H55A 3QQ9C 3ISWA 2CWRA 5E95B 5MEPB 3WKYA 2FX9L 1FHNA 1SXSA 1AE6L 1DEEB 1U95A 5GSRA 2CO3A 5ITFB 1ILUA 1KJ3L 1WZKA 4WTZA 2FR4B 1F2QA 3DO7A 4TOYH 1XMWA 1JZEA 1QTYT 3MRJA 5D2NA 5T3XE 3RY4A 4PJDE 3KPNA 3C6LA 3NZHH 1CYGA 1SJMA 3AXIA 1YYML 4M5TA 1BVZA 1O6SB 2ZKHL 2B1AL 5ENWA 4B50A 2H2PD 2X87A 3NCCB 1QRNE 2NY1C 4OCWL 5J6GA 2ZWSA 4LCCC 2JFCA 3IDYC 3WDIA 3QG6B 1I7TB 5LBVA 3UIZA 5JR1L 5D7KD 5JQ6H 4E9WA 4PREB 4XVJH 1ZVYA 1BX2B 1RJYB 2FJFA 3AWEA 3GLAA 1OTUD 2Y07H 4HUKB 4WEBL 1A9EA 4UQ9A 2G3MA 4PJIE 3UJJH 4ZT1A 2DTMH 5FYJE 2HTLD 4HV8A 3SZ6A 4BFRA 5C0IB 5IJKC 3JVGC 1QKZL 4I18C 2E9GA 4FJYA 2H6PA 4GSXA 3PXJA 4PHXA 1FCGA 4NSKA 4UAHA 2VITB 1F6AB 1CJYA 4JO1L 1EQWA 3FRUB 2NY2C 4K9EH 5KJRL 1FO0H 1VENA 5FDWA 3C2SA 4G1EA 1TYRA 4WFEE 2I69A 3TYGL 5C0GA 3CWGA 4NNPL 2EILB 5TGBB 3C5JB 1QHOA 1EPFA 5DQ9A 3CQFA 3GTNA 5L6YH 1MCQA 3G6AB 1T66D 4XO9A 4A37A 4JZOB 4TVPH 2ADYA 3ZKMC 3QDGB 2UY6A 4A7QA 1EJOL 3AXHA 4Z7VA 1AOZA 1JDAA 1SOKA 4DCQA 4B7IA 1A5FH 1MHCA 1WICA 4L5FE 2CO6A 3O11B 1GA2A 3NQIA 1I7RA 2VM3A 4WI0A 1F56A 1HZKA 3ISRA 2IG2L 2Y06L 3Q7JA 4YDJA 2QZ5A 3PFQA 4GLRI 4N8VA 3AADB 5I30H 4P3WA 4RAUA 5CINH 5B4MC 3GK8H 3OV6A 1OHZA 3WIFB 4KH9A 1KDJA 3BZFA 3FTGB 1D5IL 4QJ5B 1GC1L 2J8UA 3IF1A 4MQ7B 5KVDL 1XXFC 3RPIA 4YDMA 4KDTC 4MD5A 1AGFB 1DVTA 2BZ7A 1OGTA 4TPRH 5I75C 1OT2A 5MERA 4WUUD 3MV8D 4NQCE 2OMZB 1LP9F 4PYGA 4XBGB 4LQFH 5GRUH 3F65A 5CSZB 3OKLA 1KCRH 1BQUA 3CX5J 3HZKB 5I6XB 3B9DA 4Y4FA 1IBGH 2GT9B 3LNFA 1UUSA 3ZTEA 4PVNA 3S97C 1H3XA 2FK9A 4KQ0A 3U6RA 2DD8H 1YUHB 4NKMB 1HVXA 2FT8A 3T2NL 4LESA 3EYFA 1EAPA 4Y9BA 1Q0XL 2SODB 5GGTH 1E8ZA 3RIFF 2BSTA 4L8CA 4H0GA 3MRPB 1U92B 5EWIH 3T65A 3H3PH 4DZ8A 5CCKH 5IHWA 1W6LA 1URLA 2BY2A 4XNMA 3HI6H 2N1TE 3VWKD 1BQLL 2AV1B 3RNKB 3GBNL 5CM1A 3DHUA 1GGUA 4LCUB 5B38G 2ESVB 3MRGB 1N18A 3OKKB 2P5ED 4O58H 1JWUA 1UM5H 4Z3FA 1UZ6E 1KC5L 3WE1A 4F33A 1XHHA 4EIBA 2Z3FA 3MPCA 5F9JA 3BWAA 3WN6A 4EN3B 3RWEA 2C3HA 4PJEB 2L7EA 5GZNC 5IG7A 2BXYA 5F3HA 2V17H 2WZPD 4ONHA 2BJML 3IFOB 1B3IA 2E4FA 2X4SA 2EXWD 2YAQA 3MLVH 1WGOA 1YN7A 2N01B 4QF1A 4C83B 3BKJH 2OS7A 4U6HA 4GAJL 4DJMA 3MUUA 4UV7L 4O2FB 3VWJC 4OCXH 3S0PA 3QHFL 2H3XC 2CHDA 2AK4E 3RWDB 4QXGL 2IADB 1WCBB 1MF2H 3KPRA 1JWSA 1QSFE 3LH2H 4WI6A 3GZQA 1NH6A 2G4GA 4QHUA 3H53A 3DGDA 5DEJA 2EDTA 1YO4A 5DUBA 3O3UN 5DHXB 4PJDB 1MG2C 4U0QB 5HI3D 1FYHB 1ND0B 2H1PH 3QUYA 3QUZD 3FU0A 4R0LC 1KDIA 4UTAA 2IBBA 3TT3H 3MKKA 4JFOB 4MDIA 3UBXA 3IMRA 4ZFOA 2DDQH 3LZLA 2HN7B 4JPVL 4DPCX 1QRNB 1U3YA 5L4MA 3HNVL 3HS0B 4LCYA 4YBLB 5IMMB 2VM9A 4LSPH 2EDXA 2CDGB 2WSKA 1T4WA 2KS0A 5J6SA 4ECNA 4FTDA 4ODBD 3ZTJH 2QGBA 4H7VA 4PWIA 1HCVA 4YX2H 5F0MB 4PJIB 1MJJB 2AGJH 1T4KA 5JPMA 2BHZA 4S1DD 3N1FC 3V0VB 2M83A 2FWSA 2CDEB 4F9LA 3BD4A 2ZKYA 3SHSA 3FUIA 1UXMA 3RDTA 2B3RA 1M9WA 3CLFH 1NCJA 1D6EA 2EO9A 2VL5B 5I18H 2YEQA 4DN4H 2G2NA 4OCRH 1UD6A 4RIRA 3NJKA 2EVGA 4OZ4B 2VDML 5J12C 1BXXA 2FL5B 2VIRB 3CFJA 1XAUA 4JRXD 1SRDA 4L29B 4JZNA 4ZS7L 5TK2A 4OR1A 4X99A 3D4YA 2BWQA 1NBCA 4KVPA 5T3XH 3AS1A 2R69H 2Z34A 4FTVE 5A1AA 3LNEA 2IDSA 2MRYA 1HJCA 4UT7L 3UTQA 3IPEA 1UASA 2R0KH 4JANA 3BPLC 4BKLB 3SDCA 4EO5A 5FHBH 5IB4B 4QYOA 4KZCA 2NNCA 1W16A 3U9PL 1L9PA 4ZX4A 5BW7C 3O0LA 4JFVA 3C09B 4EZLA 3NJHA 4NXSA 1BVLB 2MKWA 3BIAX 4KK9D 3T0XA 3WO4C 5FYLE 2CGRH 4ODVH 5KBDA 1UJ3B 5DT1L 3QXAB 3LEVL 2BSSB 5AKRA 4L9LC 3QQ9D 4OZIE 5C09D 2K9UA 2XBTA 2FX7L 3O3EA 2M26A 1DO5A 1EZVY 4HEPG 4MS8C 5FYJH 3B7RL 4NZRL 4M7KL 3P0YH 2Z35B 4HS6B 3MREA 1A8JH 2PNDA 3NCMA 3EGDB 5GS0C 5I19L 4PB0H 3PIQA 2AXGB 2EDEA 2HB0A 5FKAB 3I02A 3BYYA 3T2QA 3IETB 2VDNB 4HSCX 3NFPB 3LQAL 1F4WL 3OXRA 4FNRA 2NY1D 1XH3A 5HHOA 2H8PB 1QVOB 3SPGA 4U1NB 4PJXF 2Q0ZX 1Q9OA 2I7SA 1BLNA 2ADJB 5KVFE 2WC7A 2WAHA 4NUMA 3BH4A 1ZD6A 4JNXA 2H9GA 3NJFA 1KXHA 1VRSA 2HRPL 3SDYH 3DSNB 3T08A 4I9WE 5IB2A 4PR5A 2Z92B 5DDHA 4MSWB 4LL4A 4FYQA 3VRLF 4L5FH 3JQOB 5GGVL 3TH2T 1E2VA 3CFTA 3V6OA 3C2AL 1LLAA 3OLIA 4MASA 1LWHA 1TU2A 3ARVA 3GC3A 3X3GL 3HI5L 4A2GA 4P5KA 1EBPA 2NY2D 1OWRM 4HK3N 1K8IA 3S3CB 1C5BL 1E90A 3AMKA 4Z3EA 5I1LB 3ULUH 4XCEB 4CILA 3L4WA 3QIWB 1Z5LB 1EJ8A 5DU7A 1CXFA 1PDKB 4DUXA 5HHXH 1CN4A 3BYTA 4HG4J 3Q2WA 4JPWL 4P23C 4M4RA 1G7LA 1HCZA 2QTVA 1KPUA 3OJDB 1QPXA 4K9JA 3KD4A 2NW3B 3IDJB 1CLZL 4A38A 2P8PA 3X12A 4FEMA 1RURH 4JR9L 5ID1B 3TBYB 1T04A 1D6VL 5IEHB 1NIAA 2VDNH 5D2NB 3MRJB 4RAVA 2YUWA 2NY7L 2ZTBA 4HALA 1XV8A 4QO1A 1RVFH 4G43B 1RZJH 2ZNXA 4RMVA 4HDIA 1B2WL 1SFHA 1U8HB 4GBXB 3HE7A 2C3WA 4NCDA 1QFUH 1C1EL 4U0RB 2BERA 5KZCD 3AC0A 2C5DC 1RPKA 4KK5C 2AK4B 1ULVA 4XNBA 1JV2A 4RGOH 2WZAA 5AD0B 5B4MD 1JJUA 1QSFB 4RFNB 4LVEA 3R06B 3S2CA 1DLFH 5JPNB 4XMVA 2H41A 1T1XA 3D18A 3KWXA 5B1JA 4DKEH 1Q72L 2FJFB 3HG1A 1QWUA 1HXKA 2W88A 2CO7A 2CDFB 1L0PA 2HFGH 5LXGL 1ERNA 3F5WA 1MCOL 4LLUA 5DRNA 3ZMEA 3N43F 2ZUQC 2WBJA 2H6PB 4F1ZA 3LYRA 4KMTL 1CFQB 1NANH 2XN9A 5T1JA 3KCPA 1H8SA 3VW3L 1OAUL 4B0MB 2BHYA 2YAPA 4X6DF 4LLYA 4OGYH 3L9RB 3TBCA 3ZUNC 2JB6A 2OYLA 4E9SA 1NC2D 1YPZA 4LKXA 1KGXA 1S8DA 3OLEA 4UQDA 1A6WL 2HG5B 4X5QA 3KNBB 5C3TA 4J2XA 2EDWA 1J0ZA 3ILPB 1WWAX 4WKZB 4J27A 3V0JA 1FYTA 5J1AA 4F8TA 4F27A 4YIQA 5E8PA 4IDJL 3L3IA 3OX8B 3NAAL 3V6BR 5MEOA 5ABZA 1FNAA 1U30A 5EU6A 3EDDA 1NGZA 4HWUA 4BWTA 3MACL 5LDSA 4LPUA 3S37H 1QUNA 2O61B 2WXMA 4LSVH 3SO3C 5C6WH 2BC4A 1CUOA 4OFYA 3SKJL 3FQ1A 4FTVB 3BVDB 2HKHL 2R56L 3GXFA 2ZAGA 3Q1EA 5GZND 2IPKB 3IM1A 5EOTB 4ANKA 4E68A 1RMFH 3BZFB 3PLYA 3ETSA 4EN3C 1XF5A 1S78C 2EEAA 1QPPA 3NQKA 1ZHLA 4K3DH 2WWOA 4YDNA 4CKVX 5F1IA 3CVHL 3HHRB 3UH8A 1UH2A 4GEIA 2A6KA 5DTFB 3VWJD 4N6RA 3GI8L 1OGTB 5DHDA 3EO0B 2I07A 3M17A 1CC3A 4I4WB 1QATA 3D33A 1I3UA 3LN5B 2VQUA 1PZCA 4OZIB 5GSVA 1A7RH 4NZDA 4GH7B 3VG0H 2GPZA 5IK3B 5JTWA 3IDGA 5ICZB 1JOIA 3T3PE 4H0LC 3MRFA 2K8MA 4Y4FB 3DOSA 3MBEA 3UTSD 3WN5B 1A7QL 4FRWA 2B2XH 2J5LB 4HIJA 4JGUA 4O5LL 4YL4A 1XBDA 3BDBA 4HC1A 4XPHH 1PX8A 2L8AA 1SJHA 1SYSA 1G5AA 1EAPB 3RZCC 1E5UI 1YEIL 3IWVA 5A6LA 4K3EH 5HVHB 2X6VA 2CJUL 5I1AA 4TSBH 4AL8L 3NSYA 4XWGH 2FGZA 3T65B 1UXWB 1J0HA 4LNRA 2VDRB 1EEQA 3MFFB 1JYNA 1OF2A 2WIIA 2BMKB 4URTB 1LL1A 1NBQA 4NKDA 1AQHA 5I15L 2OA9A 4LHUB 2CKBA 3APDA 2QHLA 3RJQB 3DWTA 3TA4D 3PYCA 1JWUB 5PCYA 2EADA 4U2ZA 3MV9E 3ABLB 2PLTA 3KLLA 4MBRA 5CJOH 3DX1A 3O6LL 3ZPDA 2KLTA 1QHPA 2EIMB 4HU2A 5FYLH 3D85B 5IG7B 5CEXA 4L37B 1BVOA 3TVMC 2ZX8A 3PDGA 4D3CL 5KUKA 4ONHB 1OPGH 4KVCL 2AAVA 3GSRA 3ARFB 4YMPA 4JDTH 4QF1B 1OLZA 2A6JA 1IAKA 4WO4B 3TO4B 1AXIB 1NGWA 3EJRA 1ADQA 3GBDA 1JWSB 4U4BA 3PJNA 1IZKA 3E9TA 4PJGA 2L7JA 4ZOEA 2FWOB 4ORGA 3T3MF 2HUEA 4ZMXA 1J5HA 3MYJA 3K2UL 2WGNB 2H6UA 4HIXH 1ZY9A 3CXDH 1MREH 2CU9A 4TNFA 3K8LA 5AW5B 5ISZD 1XF4B 5D96B 3V6FA 1NANI 3IMSA 3KGTA 4Q9CA 3EFOB 4QXTA 2XPGA 1CQYA 2VDRH 4MDIB 1IC1A 1HTYA 5KVFH 5AYUH 3QNYA 3N1MC 2BY0A 1Z2KA 4OD3L 3RJDA 2N1KA 4NCC1 4YL9A 5HGHB 3PWPA 3E6HB 4MAUL 5HYJA 4QIRA 3WFDH 3N50A 1GR7A 1S7VB 1XGPB 4MS8D 2E6QA 1AP2B 1FNGB 3E80A 4NGHH 5T5NG 5I0ZA 4NUGH 4FA7B 4NRZA 5GS0D 5L7XH 2X4TA 4WI2A 4Y2DA 3UJIL 4MAYB 3TT1L 5FO9B 4GINA 2IFFH 2ARWA 2Y6TE 1BF5A 3L7EA 3BSHA 4DNLA 4EI5A 3G5XB 1AAJA 5FR3A 2EUWA 4HFUL 3VXSD 1CCZA 4N2DA 4HKZA 4X4XA 1EXUB 4MA7H 2NPLX 1KJMA 4PRHA 1XR8B 2OMNA 1CR9H 3LH8A 1D6EB 1G0DA 2QDWA 3GMOB 5CXPA 4F3FA 2AABL 2PP8A 2E7CA 4GT7A 3CHSA 5EIIA 4RIRB 4JS7A 1K5NA 4Y9CA 1ZPUA 3U30B 1J8HD 5T1KA 1HQRA 3GO1H 3D52A 4OZFG 4GW5A 3ARQA 3ATDA 5DD5L 2GC4C 1BLIA 2DM4A 2HT3C 1T5WA 3FBQA 5ES4B 2JXMA 2BNUB 3BMWA 1S9KC 1P6AB 1RI8A 3GSNL 1ETB1 4PJ5A 3ARDB 4GP8B 3QISA 2EIZA 2AEPH 2IV8A 3PAZA 1ZLWK 1V10A 2W0PA 5D72H 2BP0B 4JRLA 3G5VB 4FS0A 4I2XE 3F7VA 5ABDE 3AQXA 4ZTPL 1KLGA 4U1IB 5IFHL 4PEEA 4CVZB 5CGTA 4KUZH 5IROC 4DVBB 1A2YB 3FCSA 5FIEA 1MPAL 4P23D 3VM5A 1KCKA 3F7YA 1I9IL 2JCCF 4U1SB 3VXPA 4P5RA 1XQ4A 3HZMA 2X0VA 2W59A 3QUMA 4CL7A 4NQSB 3VI3A 1EX0A 3FXIC 4N2EA 3MREB 3WKQA 5ALBH 3DX3A 4YHLH 1BOYA 1NMBL 1D9KA 3R1GL 3PIQB 4H5SA 3N6YA 4FYRA 4G8GD 2EYSA 5IVOA 3FQTB 2O5XH 4YDVB 1BA9A 5IHZA 4JAMB 2FHBA 4GBXC 1F90L 4KK5D 4U0RC 5E2UH 3VD2A 1OHQA 5D7IA 4LBEA 5IM7A 3IDXL 3W0WD 1A1MB 3B37A 4J3OH 1U8MB 1U4FA 3NK4A 3T3PB 1TJIL 3B2MA 3SE8L 1BLNB 5J3HC 1P7KA 4ZMPA 3ISYA 4M1DL 3OXSB 3K6FA 4YVNA 4X6CE 2XN2A 4TSAL 1KPRA 4HWBL 5IB2B 4RETB 4PR5B 1JE6A 5DDHB 2P5WE 3PRZA 1M9SA 3V0DA 5MENA 1XGQB 4P2RA 1HHGB 4ODTH 1KTBA 2X88A 3N3EA 4DGWC 5D1XA 3LRSA 2P52A 3NCJL 2WYZA 4UQIM 3RB7A 4X0KA 4NP9A 5BXFB 2WQ8A 3O6MH 1K8IB 3NIGF 4QJ4B 2AZUA 4OZGA 1M1XA 1QOKA 2AEOA 3UEZA 4NM4H 1Q1JH 3INUL 2ZKMX 2VSDA 4LK4A 4UT9H 1CB4A 4V11A 3M88A 1U8KB 2EDJA 3MV9B 1MIML 3MRDB 4P46B 1NMAL 3MZTA 3UROR 4Z95H 5IUSA 2O6CA 1ORQA 3P73B 4KRPB 4PJGE 1S7SA 5LN4A 3X12B 2EEXA 4IM8A 3S6CA 1CGTA 1G9MH 5BZDA 4NKOA 1ZPLA 4FLRA 2EZ0C 2AJZA 1MIEH 2FSEA 1WJ3A 1ZEAL 2A9MH 5FKPA 3DUSB 4HDIB 1LNUB 5H37A 3WY2A 4MWFA 2FJGA 2RALA 1JXFA 3V7AE 3T0DA 2OR9L 5IJBC 2O4EA 4OIIL 3U4KA 4QTHA 1KCWA 2AJVH 5CZVL 4JFEA 3VYNA 4PJ9C 3KJ6H 1EA9C 3MO1B 1U8IA 2F74B 5CF3A 3QZWA 1S78D 1TITA 5LO7A 3EG9A 1QFHA 3IMWA 1IQWH 4YHPB 2ZAIA 3FB7A 2CO7B 4Z7WF 1WVZA 2I9LB 4LKCA 1C5DA 3SDXF 2CALA 4E5XA 2C1OB 3FO0H 1EXHA 1NZRA 4K7FB 2WBJB 3L2NA 4FZEL 3NBNA 3BP6A 1R3LB 2WZ5A 3ILDA 4PRHE 1U0QA 4FCHA 5ETUB 1EDQA 4ZRGA 1BZ7A 2F1EA 1PLGL 2CLVB 4K8RH 2IH9A 4Q6KA 1HE7A 4OFQA 1P7QB 2OQJA 3NCEB 3OB0K 4LLAA 5AEAA 4CA4A 1I7UB 2OMXB 4LVOC 2PR4L 3EHBD 2WOBA 4GAFB 2OZNA 5HY9B 2VRAA 3KEHA 1MJ7H 4HGWB 2XCMC 3RZCD 1QBBA 2Q10A 3MXVH 1AS7A 2UZIL 4WFFE 4TNEA 4YHKL 3FT4B 4ACPA 4OI9A 1PPIA 5AAMA 1BPVA 4HUUB 2YKKA 1KCUH 3SE4A 4HK0A 2H45A 2NXYC 3FH5A 1LEKA 3NDZE 3QG7H 2AJSH 3W81A 2E0PA 1QUNB 3CFBB 3U0TB 4QTIH 5G5DA 1DJSA 1CZ8H 4JCWA 4XNZB 1QG3A 1W8NA 2JLPA 3OZLA 5EO9A 4EZKA 3EJYD 3ZE1B 3RG1C 1NCWL 3VH8G 3ZHLA