4LOVA

Crystal structure of fimh in complex with heptylmannoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Study of the Structural and Dynamic Effects in the FimH Adhesin upon alpha-d-Heptyl Mannose Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
molecule keywords Protein FimH
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4lovA00
2XG5B 5F2FA 4AUJA 5JQIB 3MCYA 3JWNH 3ZL2A 4XO9A 5ABZA 2XG4B 2JTYA 3BFQG 1PDKB 2UY7B 4X50A 4J3OF 1N12A 3BWUF 4XOAA 4XOBA 5IQNA 5AB1A 1TR7A 4LOVA 4XOCA 4AVIA 5FX3A 3ME0B 3JWNG 4X5RA 1N0LB 4J3OH 1KIUB 2JMRA 5FS5A 4XO8A 2W07B 4AVKA 4BUQA 3ZL1A 4CA4A 5IQMA 5CGBA 5FLUA 2WMPB 4AVJA 5LNEA 4XOEA 4X5QA 4AV0A 1QUNB 1ZE3H 4AUYA 4AV4A 3RFZA 2J2ZB 5IQOA 1KLFB 4CSSA 2UY6B 3JWNE 4J3OG 3SQBB 4X5PA 4AUUA 4CSTA 3ZPDA 3BFWA 4XODA 5F3FA 4ATTA 5AALA 4AV5A 4AVHA 5AAPA 2VCOA 5FWRA 5LNGA 1UWFA
chains in the Genus database with same CATH superfamily
5EO0B 5HHNA 2YZ8A 2Y06L 3AWEA 3A21A 3M46A 1HL4A 4XO3A 3L13A 1XGZA 1OT2A 2VLRA 3TVMB 4PJGE 1T1ZA 2VE6A 1AI1H 2VLME 4XCYB 3DHPA 3Q6FA 3UYPA 3QXDA 3FUFA 3NFNA 3U2SB 1RHHB 2IJ0C 4UTBA 1AGDB 2AABL 1XZ0B 3HAEH 4HKXB 4X6DE 4GO9A 1SEBA 1K2DB 5EBGA 2IV9A 2BNRE 2PCXA 2Q3ZA 4B9KC 3QRGH 3S98A 5JDSA 4P49A 3WSQL 2WNWA 3OG6B 4N6RB 4L4VA 2ESVB 4B27A 3EJCA 4KJYB 4QOKA 4CU6A 1MJ8L 2LFGA 3GYRA 5EEWA 1B2WH 1XCWA 4Z7UA 5HHVL 5G55A 2AZUA 3IM1A 1KGXA 3MA7A 1U6AL 2VO5A 1AXTH 4HGWA 1EX0A 4LP8A 1ID5I 1ADQA 5IB1A 1PYWB 3IU3A 4KDVA 3VFVB 5HVHC 3WFCH 1NIBA 2IWEA 2GJZB 5DJXB 3QYMA 3FUKA 5EBWB 2JKSA 2X09A 2NNAB 3HFML 2NNXA 1DEDA 1X7SA 4N1HB 4NIKB 5A2LH 3RWGA 1YUHB 3VM7A 1SXZA 5BUAA 3TBCA 1HHKA 3VFUA 1FH2A 4YXKL 2R4SH 4I18C 3D06A 3KWVA 5DSCB 3SD5A 3NJIA 5DF0A 3TFBA 1FNAA 5AWNL 2XG4A 3HZVB 1BZ8A 4LVOB 2XNAB 5F9JA 2BS8A 5DD1H 2EINB 4AMXA 4Y7MA 4BFJA 1D7DA 1TITA 2E8ZA 2VW7A 4GKNB 2FH6A 2QHRH 4P2YA 4LCWE 2H0FA 4OGYL 4IU3A 2GG1A 4P4KA 4WU7B 3VGAB 5LGYA 2A9NH 3KPQA 4MD4A 4U3HA 1E8WA 3FT0A 1MIEL 4GKZB 5DD3H 4WI4A 3AZUA 3J07A 4NQSB 1HH6A 1NCCL 2DMBA 5FXCH 3C6LC 1OLLA 1HKFA 4EJ1C 35C8L 2CKBA 4MCYA 4U1GC 3FO0L 4QHNB 3D33A 3WCYA 1B4TA 2CE6A 1RIUH 4XP9L 2PTTA 4PRPE 4A04A 3MNMA 2VLRB 3T0EA 2A6IB 3HMXH 3IN2A 4ODUB 4X6BA 2D31B 1BVZA 1A9BB 1MY5A 1YECL 1IBDA 3DRQB 3AREC 4XMTA 1HOCA 5FX3A 3UBXA 4PH8A 1TSHA 1QBAA 1UWGL 3MREA 4DHLA 5HGDA 2JELL 3UJTL 2F68X 3F12B 2Z65C 5KN5A 2WV3A 3ASOB 5DD3L 3LB6C 2BMKA 3MLVL 4NGHH 4UM9B 4DVBB 4KGJA 4Z8FL 1NLDL 4OGYH 4LHQB 3HAEA 1S7VB 2JWYA 5AUMA 4QRRB 2A73B 4PJDF 2F7RA 5F7WC 3NRQA 4MKTA 4NKQB 4HAGA 2UUDH 1DVFC 1X5IA 1PKOA 4YDKL 2KPWA 5IOKA 3VSUA 2OBGA 4MXQC 2OYPA 4OKVA 2BIPA 1I75A 2WUBH 3QWOA 4FQ2L 1P5VA 3KPLA 3B2UD 1DP0A 3CDGA 5I18L 4GQ9H 4Y2OB 2ED6A 2XFXA 1QPXA 2X4OA 2VMJA 2EXWD 5B7MA 3J27A 4YJZL 4HCRA 3VXSA 4E41B 4I87A 3B9VA 3FQUB 2QLVB 4JZJB 5JYMA 2FIKB 4FLQA 5F7AA 2D2CC 5CEYA 5T1DH 1VEPA 1G9EA 4YBHA 2O61B 3INUL 3WE1A 4KKZA 1BBJA 3I6KB 3U30B 5L2KE 2A74C 1FFOB 3NSYA 5J1AA 3WMQA 4HJEA 3BP7B 3CZJA 2UZIH 1OF2B 3ZTJH 3MRRA 1N5AB 2G2NA 2Z0UA 3DA0A 2ZWKA 4K0OA 4CKQA 2XNAA 5A2CA 3P73A 5IQ9B 2D9CA 3FUDA 2EKSA 4BELD 1MW2A 2OPCA 5EBMB 4L1HA 4AYFA 3PFUA 4PJ9A 2P44B 3C5ZD 3QFJA 4X83A 5C0ND 1ZJAA 4R7LA 2H3NA 2GY5A 3ESPA 4FCHA 1NGQH 4NO5A 4IU3B 1DBKH 5BOZG 1MAMH 2F8OA 2GEQA 1OGAE 4FQHB 3O41B 3ULSB 3V4PH 1XF2A 1AVAA 3BH8B 3NPZB 3N0PB 2WXGA 1GZQA 3SO3C 1JWSB 5JW4R 4AQZA 2Q3XA 3O2DH 2K4WA 4XXCC 2R51A 4JRYB 1U33A 2VC2L 4B7LA 4O58H 3GLZA 1SDDA 2ZNWA 4WNSA 1CVRA 3EH4B 1GZHC 1ZLDA 3M17A 4QLRA 5CEZL 5LGHL 4MCYB 4PGBA 2B16A 4DPCX 2K0RA 4E0RA 1XV8A 1YY8A 3R4RA 5FYJU 1F41A 3FTGA 4ODXA 3I2CH 1FAIL 1E27B 1NMCB 1YSOA 4UI2A 1T1XB 4HYTB 1KJ2A 4IRZA 4DPBX 5I75B 4OJFL 2EDLA 4M9OA 1EGJA 4AYEC 3H42L 3W0WB 3UBXB 2AEOA 2P49B 2ED8A 2J25A 3OAYH 4R7VA 4EF3A 2IQAA 4OCSH 2ZUSA 3FUNA 3MLYL 3P9MB 1NCAL 4HKZB 2UY6A 4HV8B 2HVKB 2OR7A 2YAOA 4TLKA 4IKJA 1EGJL 2BIOA 4RMUA 2I25N 4FFVC 4YIQB 3IGLA 1CLYH 2GJPA 1LK3L 1VFUA 2C9UA 4DKFL 2LV4A 2BHYA 3MNZB 5D70L 3GSVB 3BVVA 3K8LA 1FP5A 4DZBB 3KCWA 1NGXA 4I7ZC 5HJBA 3PP3H 3KVDD 4UQ2A 1O6TA 2V17L 5BZZA 2PP8A 5GSVA 4G9FB 3MLUH 5JHBA 1ZV9A 3KDMA 3BC9A 4X9HA 4LSVH 3A67H 4RETB 2CCVA 4DW2L 3JUYA 1FGVH 2DBJA 2I24N 4U2YA 4HFUH 5F1NB 4GRWH 2PR4H 4JREC 4NX0A 1NLBL 2FE0A 1CDCA 3CHSA 3GBMH 4W9CC 3AG4B 1UEYA 3P0GB 1SJHA 2BW5A 2WXHA 4MDIB 3P73B 3A47A 3S37H 4WZ9A 2NQ3A 2C4XA 5L2KD 4N24A 1WICA 3GS7A 3MV8D 4G1EA 2XBDA 5BZDB 1KPVA 4G5AA 5MEQB 3BZFA 4Y89A 1H6UA 1IAKB 2VDML 4PRIB 3X11A 4GRLC 7PAZA 5GRUL 4U33A 1HYSD 5B38B 1P1ZA 4B7IA 3D2UB 3HCVA 4HFWA 1SGKA 3WNNA 1J0JA 5D72L 1TZHB 4KXAA 3GSQA 4KAQL 4P5TD 3ZUCA 1SDDB 1A4JA 3SQRA 1IQWH 1HQRA 2FHBA 1KPRA 4KXDA 4ODTL 2YAPA 5ESQA 2R0WH 1R3IL 2XIIA 4LLAA 3K6SB 3W57A 3D08A 2A3TA 2F54E 2VC2B 3DMMB 3W0WD 3EDFA 3H2QA 1IC0A 1KTCA 4Q9BA 3IAPA 3NPSB 4DESA 3G9AB 3AB0C 1KTDB 1NDTA 4L8CB 2XXGA 1KJ2B 1BSIA 1GYUA 4KI5F 2PW2B 1I1AD 1V7MH 1HAUA 2APTA 3OC8A 3IDYC 3T0XA 1F4AA 2EC9U 2R2BA 2P5WB 4QTIL 1CLVA 3G5ZA 4LO9A 1IBHA 4EIZC 4GAAA 2OAAA 3TPUB 4QF1A 4NO0A 3AUVA 3MSPA 2FQGA 5E6RB 1QEXA 1XSIA 3BISA 3TN0B 2E27H 3SKMA 4XZUA 4ZFFA 1N6UA 3CTTA 4X8GA 4ZSOB 2VNCA 2L7EA 3AREB 3C5SB 5HI3C 2IAMD 4AM0A 5HDBF 1S3KL 1PX4A 2HRPL 2P46B 4I18B 4S0SD 5KS9B 1VFBB 2BK8A 2EABA 1P84K 3DVIA 1EZUA 3QO0B 4B9CA 3MACH 3LMJH 3AMKA 1VZGA 5DQ9B 5K9OA 1I1AA 1SBSL 3CFEB 3CSGA 2I07A 4GP4B 1JYWA 4HX1A 4DOHE 3W2DL 4UB0H 5CWSA 3NJFA 4WV1A 4Y19D 1FZOB 1U8PB 3GC3A 3L2NA 3ZL2A 3FCUB 3OPZH 3VAEA 5CM1A 4JGMA 4KK6D 1DVQA 5IQ7H 5I15H 1IAIL 5IEKA 1I8AA 1YEWA 4PJ5D 1UXWA 4DTGH 3K2UL 3PQYB 4XXDB 4F8QA 4LF3B 1T20A 4HXAH 5FCSH 2OJZH 1NDMA 1SY6H 2XWBA 3WY4A 4F2ME 3CSBA 4Q6IC 2PR9A 4POZD 5JPNB 5FM5O 3IS0X 3M8OH 2YJLA 4NCDA 1MY7A 4IRJC 1W8NA 3PWUA 3VGEA 2V7NB 2DWDA 4CAGA 3NA9H 3P40A 1WFIA 1PY0A 2JJSC 5GS0H 3QUZA 3I9AA 3BHBA 3IWVA 2EDRA 1IEBA 1MHHA 2WYIA 1D6VL 2GSIB 2VLJB 3MJWA 4IHOB 3SBWA 3T77A 3RWDA 1BAWA 1CGWA 4FRWA 3D4YA 3TT3H 1UOWA 4LVHB 5CFHA 3GJFH 4YUEL 1GJWA 4X4YA 1JFHA 4OTXH 1T3FB 3BZ4B 4PGZA 1KPRB 1NDGB 4IYKA 3MX0B 5AAWC 3PP3K 1BWMA 2NDGA 2R27A 1TZIA 5GRJL 3U0WH 5DLML 1S78D 1I31A 1TFHA 3OMNB 4F27A 3D50A 3PWLA 5B21A 1MZZA 1OV8A 2MCG1 4EKJA 5IHLB 4JFED 1FFQA 4EUPG 4UANA 2VLRD 1C8QA 1TYEB 3V8OA 5EEYA 3U6RA 4FG6D 3L1OL 4UB0L 3LN5B 4Z77B 4IQHA 4FTVB 1DVFA 1RUPH 2R2BB 1JRHI 3BH9A 4HUXA 4Z7VA 4ZMZA 1B88A 3CD4A 2D73A 1PEWA 4LSTH 3DWTA 3GSRA 4BEIA 2DJMA 2F8IA 3SKJL 4JPWL 1HVXA 3WY3A 1LNUA 3BQUC 3I50H 4NO0B 2GK2A 4NO3A 3CFJA 4JHAL 4PV8B 1IE5A 3E7JA 2X1OA 5E6UB 3K3QA 2EVIA 1YEHL 1QLRB 4RSVA 4XZUB 3AS0A 4MQSB 2QPUA 4JCWA 3UIYA 5DO8A 2CIIB 1QZ1A 3FSZA 4TVPL 5F9WC 5GSRB 3K2IA 3X17A 4PB0L 2VAAB 1TF4A 3NH7H 1MQKH 1AZNA 2PYEB 3ESMA 2APXA 2O5ZH 3PJLA 3RAJH 4GSXA 1CR9L 5CZRA 1K2DA 1Z5LB 5DO2D 1M6OB 3ZU8A 1E5BA 1O7VA 3ALXA 4HOZA 3ZGHA 2VB5A 3TYGH 3FU8A 5C08E 4OGXH 3OJVC 3D85B 3NMEA 1A7RL 2CLZA 4BZYA 1JCKA 4J6RH 3TEXA 2PWEA 3QAZC 4N0FA 3DX9A 3EHBB 4XXCA 3UH8A 1XB3A 4HULB 4KROB 3SE3C 4M6MH 1MEXH 2VDOB 5CN1A 3QNYA 5FCUL 3T1WA 3PIQB 4WUUE 2NNAA 2H8PB 1TLMA 1D2OA 1E4KC 4TOYH 3TLRA 4A6YB 4WW2B 3GS4A 2EC8A 3LKSB 1OK8A 3QUZB 5I23A 1PZDA 5TD4A 2UZYB 1UM5H 5CJXA 2VT0A 1JRHL 2GSMB 3LRKA 1TVHA 5JOFB 3AVEA 2X4SB 4YSRA 1JF5A 4GW5A 3HNVH 2AP2A 4PBVC 1HCYA 1OB0A 2DY2A 4IIQC 1M2VA 3K6DA 4LP5A 4M8QB 1H5BB 3CC5B 3IRCA 4P3DB 2J4WL 3HJEA 4JZJC 1TYJA 5L8JB 4DGYL 1I3GL 3A6CL 3EH5B 3BPLB 4KKAC 3UBGA 3F01A 4NM8H 5E94A 4ODSH 3JWDC 4U3SA 4RFEB 5D7LE 3S3JA 4L8DA 4LCYB 3PJSB 4PJ7B 3PDOA 3TIEA 4WI5A 1DLHB 3OLEA 2VITA 1UG9A 1W6WA 1MCQA 1QW9A 5IM7B 5IF0A 5ANMB 1FZJB 1WUNT 4QRPA 4BSWB 3ZQWA 1S8DA 3DRTB 3JWNC 5JW5A 2KPNA 3LNGA 1CLCA 4NN5B 1E5YA 1QVOA 2VXVH 2Z9TA 1FNHA 3CFQA 4LLMB 5E03A 3SIKA 1XF4B 4LXFA 3KLHD 3UTSD 3ALWA 2ICEB 4KY2A 4M5YH 1T22B 3JYBA 1YN7A 3MV7D 4AVHA 4XC3H 1KCUL 1OOWA 3QUXD 3ZT7A 1D7CA 2FO8A 3GTVA 5FHAL 4W6WB 3MOAH 3VWKD 4ZMAT 2NY1D 2MWCA 3OTTA 1SJXA 3H2WA 1NEZA 1P6WA 3ILDA 3F12A 5KBKA 5E24E 3QIBD 4JUSA 3NFPB 5E1IA 2BMKB 2D03H 4P46B 2AQPA 3OKOA 1T7XA 2JLPA 1Z9NA 3MCG1 4OCRL 3GWJA 2J5WA 1NWPA 1GXEA 3GBEA 4JFDE 4UOW0 3MLXL 1AH1A 3CVHH 4OSUH 3I75A 1BV8A 5CF3A 1K3ZA 3CIAA 3WNKA 1M7XA 1EJOH 2FGWL 4AJWA 1XMWA 4AL8C 2O5XH 4Y19B 2DTSA 2H6PB 3C60A 2FGZA 3VFRB 1BW8A 2D3NA 3AADB 3QJFA 3ARUA 4Z7WF 4XP5H 2V33A 2VDLL 5LHDA 1SXCA 3UTSB 3MRMB 4E9TA 2HG0A 1M1XB 3GSUB 4FD0A 4IMKA 4R4BB 5DWUL 5B39B 5HY9B 1KLUA 5GS2D 3VXTB 3X2QB 4Z7QB 1P7HL 4FKEA 4BD4A 5CZKA 3KLDA 2DQUL 4KWUA 4YFLF 5LNGA 7FABL 3BP7A 1D5MA 4V33A 4Y5VC 4K7PH 5A3IC 4ZT1A 4OLYH 5AL8A 3TYGL 1NGQL 1W15A 4P3DA 3EOBA 4L1SA 3JTSB 1VACB 1QLEB 2HKFH 3FK3A 3MA7B 3WHE1 5C0RL 4NUJA 1IM9B 4NKDB 1WZAA 4NQDB 5D2NE 1R3JA 3AGWA 2MNUA 1XGQA 2XDHA 3H7BA 5TH2A 3WNJA 2Y07L 1QLFB 3RBGA 1DANU 3DO7A 4H8HA 4NDMB 3UABA 3ZK0A 2JIXA 2W0LA 3OMIB 4X99B 3HMWH 3RTQD 2O6EA 3UTOA 3VD7A 2FX7H 3CFMA 5L6YL 4EI5C 1TCRA 3NBNA 2YXFA 3Q6GL 3CFBA 1U8CA 3OZKA 1FNEB 2IXQA 3HE7C 5GJTL 4ZAKA 4I1RA 5D7JD 3PJNA 3WMPA 1UHVA 3IFPB 4W6XB 3PABB 4Z3JA 2WC7A 1JNLH 3DXAA 5GGVH 1A0QL 3RUGB 3CSFA 1EMTL 1SOKA 2ENJA 2WQSA 1RJLB 4K2UH 4OZ4A 1YYMH 2HFFA 5C0AE 2TSBA 3UZEC 1WRFA 2IVFC 1T66D 4HIQA 1A1OA 3Q8BA 4NN6C 4WWID 1W72A 2X9XA 3VI3E 3SKJH 4KH9A 3C8HA 5B3SB 4BBWA 4OZGF 3G3LA 1TTGA 5KOMC 1IM9D 4N22A 4UTCA 4NP9A 2OXGB 4CSSA 4GKNA 1JK9B 2PF6A 4WCYH 5SWQA 4Y7OC 2FLRT 3C6LA 2X9YA 3SDAC 1IUZA 1MWAL 1ZTMA 3D9AH 1EDHA 6FABH 2DMGA 2VXQA 4POYA 2C1PA 1CVSC 4ODVH 5L2KA 4TQHA 1ASQA 3MO1B 4FNSA 2FWLB 1B90A 4IRJD 1KT2A 3EJSA 4ZO6A 4X80L 1UWEH 3LNIA 3P9LA 4M4RA 1W72H 5KVDE 5T1KB 2HTLC 1RUQH 4Z7UB 5E6IA 4JUTA 1RERA 2AAVA 2JKJA 3UYRH 1A7PH 5T5FA 3SJVB 1G0DA 3GB7A 4HUNB 5DMIL 5F7MC 4ZX6A 3PWPB 2CO7B 3OB8A 3NYKA 1BG9A 3HE7A 4PJAA 2VXVL 1SFDA 2YEVB 4FQ1L 3V0GA 2D31A 5C9JB 3SE9H 4HF5L 3PL6D 5ID0B 2HRLA 4IBTA 4Y1AA 2QJDA 3GSNH 4ACPA 5IB3A 5MP6L 4BZ2L 3PHSA 1EHNA 5KN5B 4MD5A 3R1GL 4CMHB 3QJQB 1C7SA 2ZG1A 4U4BA 4XPFL 5EU7E 3GFUA 1BVLA 1ORSA 1H0DA 3L16A 1BAGA 4FGMA 4JM4L 3GHBL 4PRAB 1A14H 4HMDA 4LKXA 4QHUB 2ATKA 1YEDB 3MXVL 1WZ1H 3HZVA 4HCFA 5IVOA 4Z3TA 3PP4H 2IAMC 1N0LA 5HD8C 5C0JB 1D5BB 4J4PA 3H3KA 1VKXB 4BE5A 5D7LD 3T0EE 3JVGC 3FXIC 1TZAA 1A4AA 2PPEA 4NI3A 2Y7QB 2CUIA 4KUZH 1QLFA 3SKOA 1YEKL 1E9PA 4YK4B 4JK0D 3FRPB 3LXCA 4AOFA 1AO7A 1PKQA 4MNHB 2LTQB 2XJKA 2EVJA 2BIMA 4HS6A 4D8OA 1NAMA 4ZRGA 5LCVL 4YXKH 3F85A 3QUMB 1DSYA 2WWMD 1I1AC 3FZUC 2RTTA 4NQSA 1IKNC 1DVYA 1CD1B 4W81A 5SWZB 3U82B 4ZUTB 4NZUL 5HHXL 2O6PA 3FB8B 1U3HA 1SVBA 1B2WL 3RUGA 2X4NA 4F5CE 4P4RB 2HRHA 5F1IA 1PDKB 2HUHA 2X4PA 2WLHA 4K5LA 2B4CL 5HVWA 5E9DA 1PY4A 2CQVA 1RZ8B 2PTTB 3HE6A 1J0IA 1PX8A 1TZGL 1XFPA 3Q13A 4JQVC 4QAWA 1IKOP 4AIXA 1XDTT 5AW0B 1DLFL 1PFCA 1DTUA 2VL5B 2P28B 3OXSB 1U8HA 2BVEA 5KYYB 1IGCL 1UACH 2W65A 3LQAC 1XCTB 4N28A 1BYNA 1Q94A 4ZW3A 5EZIH 3KZ8A 4N2MA 1HHHB 1YEFH 2I7OA 5B1KA 3CBKB 4BFIA 2GB2A 1V7NL 4DETA 4ZFOL 3FMGH 3C5SA 4QRRE 4ZMOA 4PJCB 4ORZC 3JTTA 2F61A 3FRUA 3WTUA 4FQIL 5CCHE 4PRDA 5MENE 1ROWA 3SJVA 3NCYP 4IMLA 2ZX6A 4DEWA 2HT4C 1O0VA 2WZAA 2NNCA 5BQ7B 1XX9C 3BIAX 5BJTA 1ZGLP 1F4HA 5LB1A 4M43H 3AUWB 4YS4A 1AY1H 1TXKA 1ZDSA 4AKQA 3RVVC 4HHGA 4X9BA 5HJGA 5IREA 4JFQA 1RUPL 3VFTA 2LVCA 4HZLB 2XFGB 5IVXA 1PZBA 2FBJL 4M1GH 3TWCH 4M43L 5J1AB 2X28A 5E0FA 1J12A 4GRLB 4S1DC 4GFTB 2WXLA 1I8KB 2ZP0T 4F33B 1YEDA 3E38A 1ZDQA 3G6AA 3IK2A 4YHLL 3HN8A 4LLQA 5C0IB 4OM1H 4FQIH 3GBNH 5E5UB 1IQDB 4FYRA 1RPQA 1YYLH 5D2NC 3VXQA 3WFDL 2N3JA 2VLRE 3S35L 3HNTH 1KC5L 4NT6A 4WWKB 4WSJA 4YUEH 3V0VB 2C3GA 2P5PA 3QQDB 2Y23A 3HR6A 1QWUA 4NC1C 3I74A 4AEEA 5I6XB 3VXRA 4YFEA 1AO7B 5I1IL 4PLJC 3CQPA 1FYTB 4KDTA 1TVBA 2QADD 1G7QB 2V2XB 4LSPL 4D3CL 4OFDA 1U92A 3SOBL 4WW1A 1T5KA 3U7YL 1NBYB 2HT4D 2LW3A 1OAUL 2OQJB 2W92A 3M8OL 4LVNB 1KJ3H 5GS1A 2AW2A 4YC2C 4CC0A 2VDKL 3KYNB 2ZICA 5IMMA 3V2AR 4ZS6C 4H8UA 4GXVH 3TTYA 3U2IA 3WE6A 4YSUA 4J8QA 3VH8A 2RR3A 3IPEA 4N8CL 3BUDA 3NAAH 1KN2H 3RUGF 2R1XB 1FFRA 4PYGA 1XVSA 2VL5A 3EH1A 4HUXB 5F7EH 3QULB 3UZEA 2IIJA 3QISA 1PAZA 4LSSL 2DLTA 3MNWA 5I71B 4JRXE 5D2NA 4LPYA 3C2AH 5JQ6H 4PV8A 1IIIA 4WGKA 2E47A 5DHVB 4AQ1A 5CEXB 3EH3B 1M57B 5FYKL 1ZSDA 3O6ML 3U9PH 3ZT5A 5B3NA 1P4LB 2NY2D 2WWKT 2YD4A 3BZ5A 4NM4L 2WQVA 2XPGA 3B4NA 4WUUD 5D55A 3RY6A 1M7UA 1BXVA 4XBMA 2F18A 1J9SA 5I1HL 2XHNA 3W39A 5I71C 1T7ZA 1FG2B 3ESOA 5C7XL 3MZTA 1NGYB 3VQLA 3FZUD 2ADYA 3B2VL 3UJIL 3FB5A 4G8FA 2WTOA 1NGXB 4E9QA 1FZMB 3DROB 3QP3A 3TWYA 2EADA 1EFXD 2WAQA 3ABLB 2YOAA 1VERA 3HI1A 3GSNL 4LCWD 4N85A 4QTIH 1QFPA 3KPPA 5MP6H 2OSWA 4H13C 3C5ZB 3R8BB 4YHMH 3G5VA 2VR8A 3CSPA 5D7HA 4LCUB 1X5AA 3QDAA 4HIXH 4QF1B 2DKSA 1DCEA 1INQB 2ESVD 5HVHB 1ZHNB 4YE4L 3S3DB 8FABA 5DMIH 3KG5A 3MLSH 1AXIB 1MXGA 4CMHC 2ZX7A 4HC1H 4QT5B 3FUMA 3ZE2E 1T21B 4P3WA 2EDXA 4XNZC 3MRHB 5DZOA 4H5SB 4Y9CA 2G3XA 3ENEA 5D1QA 1B6UA 1BFOA 2UXFA 4B53A 1N0XH 3GIZH 3IT8D 4G5ZL 4PJ8C 3X11B 1I85A 5IFAL 2YQGA 3QG6B 1AD9A 1MCKA 3WS3A 3K80A 5TPWH 1P53A 1X7TA 3JZYA 3IETB 3GMPA 5MEOB 4Q6IA 2Z7YA 2HZHA 5MI0C 1IU1A 5TDOB 2IQ9L 1E50A 2VLKB 2XUWA 4NQXB 4XHJD 3HFFA 5GGSA 4GG8B 1WP6A 1MHEA 1GGBL 2BOLA 2R29A 4U6XA 4ZODA 1EH9A 5AKSA 4PS4L 5I17B 4RFOH 5ACZA 3DX0A 4EDWH 1H3PL 5IKCB 1YUKB 1RU9H 5J6GB 3EOYG 4L8CA 5BRPA 2KHAA 1D5XB 2K7PA 4PJDA 1CO1A 5FW8A 3QUYB 4OB5H 2X0UA 3Q0HA 3PJSA 1QYGL 5EOTA 1I4FB 1G9HA 2CCWA 5EF3A 4GI8A 3RWCA 3GMOB 3CDZA 4JDEA 1RZFL 4TLUA 5TK2A 1WFJA 4DPRA 5E2JA 1NAKL 1GAFH 2NY2B 3AT8A 3OJ2C 3BWSA 5ANHA 3L95A 2WOBA 2VLJA 3VDBA 3V10A 2V17H 1PAMA 4HQQL 3VXOA 1N0XL 2XXFA 5FC9A 1A7QL 4QD2E 3ZE1F 3OKYA 3FFCE 5JNYA 1FV1A 3P1VA 4M6NL 1M53A 3G5WA 5KG9A 1G0XA 1TU2B 2F7OA 2O30A 3DIDA 1F3RB 2I60L 1NBZB 3G6JB 5LWYH 3FULA 2ZKXA 4FULA 5K1JA 4ENED 4L8SC 4X7CC 2G75B 2GY7B 3W39B 5C70A 3WFDH 4YDZA 4YSOA 2H47C 3RURA 3DPBA 2N7AA 2QSQA 4IKNA 5CD3A 4MMZA 4DKEL 4WENB 3MUJA 4GAJH 1CIDA 4JO5A 2C1OB 4PS8A 2VKWA 5FYJH 3UO1L 2BJMH 2W0PA 3AU1A 4YDJA 5EO1A 4RSYA 3H9SD 1MQ8A 3VWJA 2VJ8A 4Z7OE 5BOPA 5KSBA 2K6WA 4QCIA 3D07A 3RGBA 3BVNB 5C2UB 4JFXB 3B34A 5BZWB 1DBAL 4AUUA 2ICES 3NIGF 4GINA 2MTAA 3P77B 4CW1B 4MBOA 1NFDF 2AJVH 1QBLH 3O0LA 1G9NC 3O2DA 3VRJB 1E5UI 5DRXA 4KTEL 2ITCA 1DEEB 4CVZB 5A6MA 2VLJE 2Q8BL 1OPOA 4X7DC 1TIUA 4OSUL 1JDCA 3NIFB 3HNSH 1AZRA 5LGKA 1SUHA 2A74B 3WLWC 2VAAA 3MJ8B 1E5ZA 4LHUA 1RMFL 4OLVL 5EU4A 3ROOA 1CLZL 1E40A 4WEEA 3DV4A 1NTDA 1C12A 1U8JB 3D0VA 3EBGA 4FYSA 4ADGA 3X1EA 4AUYA 1TETH 5EN2B 3T77B 4MXVE 1CC3A 1LM8V 4Z0XB 4L29B 3EO0A 5HXMA 1GPOL 1F11B 4D9QD 4K3JH 3WFBL 1WWCA 5FR3A 2DQEL 1UXSA 5DK2A 1BDYA 3GMLB 1XMEB 3QFDB 1OGSA 1FL5B 4HIJB 1C5BL 1MJ8H 4RMRA 5B8CC 1MJ7L 1JF6A 1HKLH 4NZTL 4Z18A 5I8CB 4NRZB 3DTDA 3QIWD 4C56E 4V2CB 2Q7AA 2UZPA 5FKPB 2HFTA 2XY2A 4HISA 3IFOA 4MTMA 2WIIB 2F5BH 5EZLA 1IBBA 1OAUH 1TNNA 2DN7A 4HH9A 3ZKXC 3N9GL 5EOTB 1OCWL 1ADWA 1LEIA 3QAZB 4GLRI 4DZ8A 1CGSL 3UTTE 3EGDA 2JJWA 2VISB 2WVTA 3LKSA 4WO4C 1B0RB 1NICA 2DYRB 3Q3GB 1EDYA 1KV3A 1M05B 1VJSA 2J8UE 3DDGA 2QKIA 4JHZA 3DXAB 4KTEH 1KYFA 4U0RB 5I19H 4LLYA 3FBKA 5CIPH 3BXNA 3FQRA 3J7HA 4NQVB 3U0PB 4OLVH 2DD8L 2Y24A 1YEKH 1TQBB 3WN5A 1GGYA 2Y7LA 2XZCL 1DDHA 1BF8A 5E6SB 1AIFA 3UGUA 3W9EA 1IZJA 5FGSA 5SX4I 5K9KB 2FBOJ 2WZ6A 4JO2L 4NAQA 4KZEH 2FYYA 3PHAA 3C6LB 1ZV5A 4I85A 4OBSA 4A7GF 4I3SL 4AQ1C 2IANE 2QVKA 3IDUA 3S34L 3T4AA 1DBAH 1IT9L 1YMHB 1F97A 4FEIA 3VXME 5F88A 4F7TA 3RY6C 2MOVA 4XOAA 4DNLA 5CP7B 3QQ3B 4YSDA 2IDQA 1GOFA 4PGDB 4L3EA 2G9HA 2P43B 2OP4L 3B7YA 3FOLA 4RISH 4XB7A 2AF2A 3JWOC 3UZQB 1WWWX 5ADOL 1GW6A 3ISYA 4FQ1H 4KKBD 3HS0C 1A6ZA 2OI9B 2L04A 4FXKA 4BH8A 4KXBA 5I6XC 2ZYSA 4X5PA 3HE7B 1HH9B 1JWUB 1BX2A 4JCMA 1NAKH 3ME0A 1QBMH 3EFOB 3OKMA 4X7EC 1MCIA 3E2HC 5JPMC 3T3MB 1E5AA 1MUJB 4J3OF 3IBOA 3TZVA 4JO3L 3NFNB 4WHDA 4ICXA 1AQDB 4DP9X 1M3JA 1UM4L 1S9XA 3DTXB 5J7CC 4RWHA 4RLDA 4FABH 3WXVH 2AJXL 2CIKA 1UACL 4JQXA 2ADFH 4L3ED 4QXTA 4UNTA 4Z0XA 3SKNB 4U1MB 1BOYA 1KB9K 3IDXH 2OCFD 1UXSB 5DK2B 4UYPA 1U95A 3F58H 2BNQB 5E2TH 2X05A 1AGEB 4BM7A 3H9YA 1EJ8A 1TJIH 4YL9A 3PQYD 4LSDA 2DM2A 3F7YA 3L3IB 4ETQB 4G9FD 5B1JA 1I53A 3L3OC 4N2AA 4XCCL 2E0PA 3WGUB 1PPIA 5JW3L 2QSCH 4X6CF 3I50L 1YYML 3BX7C 1CFNB 1L9RA 2GJZA 4HH9B 2H3XC 1GSKA 2A7BA 3D39B 3FQWB 5HI4C 4WFFE 3MRMA 1OT4A 1ZT7A 1PFOA 2FWOB 4M1CC 1FZJA 1MCFA 4QRPB 5KBLA 3BVXA 2QHLA 5IROA 3VW3H 1MJUL 4NZRH 4IS6A 5BRZB 4B3EA 2CDGA 4QXWA 2R1WA 5JXAL 5J4MA 4OCXH 1TENA 2XG4B 2ZKHH 3TZVC 4NNXA 3WN5B 2AV7B 2A5UA 5D96C 1N3NB 4IJ3B 5IK3A 3CZNA 3GO1H 4HMEA 2Z8WC 3K8KA 3BQUD 4TSBH 5EA0H 4F7PA 3DUHA 1WBYB 2VDOL 5BS0B 4H8WL 1U8HB 4F37F 3MLZH 3BKMH 1SJEA 2HLAA 3DYMA 1R5IB 1WQVT 3Q01A 4K7PL 2YLHA 4F37K 4JPKL 4NQDD 3DJ9A 5JIKA 2FUQA 5JMOC 1BJ1J 5H2BA 1GOHA 3P4OB 5D71H 1KEGH 1Q8MA 2AQTA 1T6BX 4XPHL 2L7QA 5FM4A 3NFSL 4JY4B 5DJCA 1FQ9C 3L5XL 2EIJB 1BXUA 4L4VB 2ICWB 4LMQE 1IVTA 1UUSA 2J72A 3EYVB 1M2OA 4FNQA 2LR4A 3OHXC 1ET7A 4HJTA 3SCMB 4JE0A 1K5WA 5BRZD 1ZLUK 2RIKA 3KJ4C 4X8JA 1DN0B 1JPTH 1I8IB 4OCNC 4PWFA 4LRNH 5EUOF 4HALA 5EZJA 4PGEA 3C08L 1MSPA 2GJJA 5J11C 3VFVA 4MJ5B 3SGJA 1AGBB 5EORH 4Z3EA 5IROC 2V2TA 1CYWA 4G9DB 1NC2D 1Y07A 3O6MH 5C0CD 5SWQB 1J1OH 3DIFB 3RG1C 1KBPA 4X7SL 1ZT4B 2H4EA 4B6ZA 3IFNH 3UEQA 1IGFH 1KLUB 5TDNB 3SPCA 1OP4A 2CO6A 3OPUA 4PSRA 5D5ME 4YVUA 1RLWA 1GGTA 4PWIA 3NQIA 2OMNA 4JHBA 3QCTH 4AQ8A 5CCKL 1M71A 3U4BL 1IAII 4F7MA 1EAPA 3IDIA 5IQMA 2VR6A 3RVTD 1PLAA 2NY2C 2PTVA 3QHZH 5C0DB 5E6IB 4CSPA 5E2UL 5IJDC 4NI6A 4CVWA 1IM9A 1KCUH 4OFPA 3JWNE 3BPOB 5HYJB 2QQLH 2CO7A 2OYLA 3BQUB 3FT2B 3ARDB 4Q2ZA 1LEKB 3CN1A 3VXUE 1AO7E 3FQ1A 4B41A 1D7FA 4IKIA 1U58B 4MMXC 1ZV2A 3S96B 1JP5A 1QASA 5I5MA 4GAGH 3L08A 1U8CB 1HH6B 2KQNA 3FN0H 1DBML 1IM3A 1BLNA 4ZMQA 2O61A 1DUYB 1EHAA 1K9TA 2DBLL 2MQ0A 3HPLB 5CILH 2JFCA 4M56A 3RL2B 2J88H 4FZEL 5HGHA 32C2A 4MASA 5HI3D 1AFVH 1E43A 2LT9A 1EFXA 2COQA 1A1OB 3LQMA 1ZHLA 3A4EA 1QABA 4FQJL 5DRZB 4FFWD 3OG4B 1HXMA 1PNDA 2EKSB 2PWGA 4HWUA 3MRDA 2Y72A 5E2WH 4UDUB 4YZWA 3EJZD 1UB6A 2E8YA 4JMNA 4AQAA 4CN6A 1DCLA 1MN4A 2H3NB 3EJYC 1DE4A 1JGEB 1N59A 5EU6B 1SY6A 3MR9A 1E9PB 5IVXF 2OLDA 1X9RA 1NC4D 1ZXQA 1TFPA 1QTPA 4JHVA 2C1PB 3RTLA 4OW6A 4OAWA 4WDIB 3X14B 3FRPG 3VTTA 5BZXA 3TX4A 1VB9A 3TEWA 2J5LC 3QFJE 4ONFH 5IMOB 5EU7C 5SWSE 3DVNB 2NY4C 1QFWI 5DZPA 2DF3A 2O5XL 1NCIA 5T1LA 1KIRB 4JRYD 1E28B 2N4IA 3DPDA 4H25A 4RZKA 2H1PL 3VO0A 5A2BA 2WGNB 2APBA 4YGVA 3ET9F 4N25A 4G8GA 3GZOA 2NCEA 4EE2A 4FP8H 4FAAB 4WO0A 2QFPA 3MCKA 4P23B 3KEDA 3QNZA 1YPZB 3QEQE 1XR8B 4GQPH 1V3MA 1T83A 1R5WA 3WKML 1QSZA 2NW3B 1U30A 4C4KT 4URKA 3DUSA 2A4EA 2C9AA 2Y3AA 4QHPA 4NOBA 4TPRH 3VI3A 3KVQA 4U1KB 4U6VL 5HYFA 5INDB 1KMGA 4NHUB 1C16B 1H9DA 4HK0A 3DGGB 1A3LL 2ESVA 3E2HB 5IR1B 1G6RH 4NWUL 3WD5H 2A6KB 3QFJB 4TVPH 4U7KA 2G0KA 1FN4B 4H4NA 3G5YB 1KEMH 4U1JA 4CKVX 1O6SA 1WV7T 1TVDA 3FU7A 2QGBA 3WJMA 3HVDA 3D3VB 2Q6WB 3SDCB 5C3LD 3VXMD 2WMPA 1UENA 1MWAB 1UJTA 2OW6A 2R56L 2VCOA 2YUXA 4XNDA 4MXWH 3NJHA 1OP5K 3FH8A 4Q6IB 4N8UA 2HJFB 4PJXE 5DU7A 4LIQL 3QNFA 1I9JL 4JFQB 3WTVA 3L7FA 2GCYA 4Y5YC 4X5WA 1CE1L 2X6BA 3MROB 4DAGH 1BQLL 1WZ1L 3CH1A 1AR1C 5L9DH 2NYZA 4OLUL 4L9DA 5FO2A 3TEUA 3OSVA 5ACZB 2Z7UA 5B3JE 2JSFA 3ZDZF 3APNA 3KBPA 2VR3A 4X0KB 2ZUYA 2J4WH 2P9RA 3OWRA 1JTTA 1N64L 2AQ2A 1KB5H 2WWMC 4YDVB 1WFUA 4NT6B 2AS5M 4ODWB 1LWJA 4AW7A 2B1AH 5IMKA 2VRQA 2YO3A 5C6TH 3DV6A 3EF7A 5D4HA 5F9OH 4FFZL 3TBTB 2G5BA 4D8PB 3QYNA 4XX5A 2QQNH 4LBEA 4PYHA 4X6CB 3RP1A 2VDRB 4C56D 1NCDH 5JHLL 3VFWB 5FDWA 3KGTA 4M02A 4R8WL 5KG9B 1HQRB 3B3BA 3E9UA 3EJUA 4NUGL 3IMSA 3ZKXB 2MTPA 4HKBB 1BZ9B 1S7WB 2C3XA 5T1KD 4P2QD 3RI5K 4A67A 1OSZB 4KJWC 3NUKA 4TN9A 3TESA 3HRZC 4GAYB 1E28A 2UX6A 1VADA 2R0KH 2VRAA 3GDBA 3DPBB 5CD3B 5BCAA 2YD8A 1CTNA 2LOEA 4BKLA 4QRQA 4KNQA 5C08D 2GBAA 4Z0BH 1P5UA 2C7UB 3MDJA 3P3UA 3PL6C 3LS4H 4B97A 1E8YA 3HG0A 1AZVA 5B39G 3SSGA 2OI9C 5LVEA 5MEPB 5CHNA 2J8UB 2R0ZL 1KJ2L 3MA9L 1FCGA 2CDFB 5TE6H 5E2VL 3PAYA 4GBXB 5F1NA 1OP9A 3IDJB 3VTMA 5ICXB 2ZIDA 2ARWA 4G6KH 1XBDA 4S1QL 4PN6A 1IGJB 4G6AD 1KBVA 3QDGD 5TQ0H 1JJUA 1SFHA 4YDKH 2P8MA 1EVUA 4ELME 2XIDA 4FYTA 3VXQB 3ARTA 1UA6L 2DIBA 1XH3B 1LE9B 2HRPH 2ENYA 1N8ZA 2AXFA 4TLSA 1E4XL 4U1JB 2R1YB 4JHAH 5ABAA 4KY1L 1BD2D 4OZHA 3BWAB 4QNPF 4Y2OA 5HI5D 1EMTH 3F5WB 3K7UA 2WMPB 4DKAA 3MGOA 4NFDA 4RBPH 1UQSA 4BCZA 3RZCA 4LK4A 1JVKA 4PJFE 5EU5B 1P7QD 4M48H 3RL1B 5IWLC 2K7QA 3EFDH 2OQJA 3MROA 1PY9A 3ILQC 2H26B 5KBNC 4TVUA 3GSXA 3O2VH 3GMMB 5ENWA 4W9LC 2CJUL 1D5ZB 4UT7H 4YSAA 2Y07H 5AOJA 4APXB 2I9TA 4HPYH 1U8KA 5BUPA 5GJSH 2FEEI 3ZKND 2PXYA 4JAMA 2HKFL 2BSTA 3K0YA 1JPFB 3LB6D 5E2VH 5BVJB 3DUUB 5BV7H 4DN3H 1GGIL 2YUWA 5D4IA 5F6IB 3ECBA 2P8PB 4LPXA 3QG6A 5BRQA 3ARED 3EGSA 1WZMA 4JQIA 4MNGA 4F7EA 3V7MA 5CKAA 5FFGA 1UH2A 3ZRFC 4GS7B 3SBRA 2YRPA 3DHMA 3IPBA 3Q1EA 4M1DL 1QG3A 4C4KO 3D25A 1A3QA 1CFVL 2N1KA 3IETA 1QNZL 3V6ZA 2AVFA 4O51B 3ZR6A 3KXFE 4ZSOA 3W82A 4J1UA 3WLBA 1F6AB 1KGUA 4H88L 1IC7H 2WB7A 4K7PX 1TJGL 2XVBA 3ROLB 3DHJA 4AJYV 1LL1A 1A7OL 2D3LA 2AI0H 1BPVA 1RZGB 2V2WB 2DV6A 3Q2VA 2JTDA 4JQIL 3FB6A 3FKUS 4RBPK 1EJFA 4E9SA 5BS0D 3HUJF 4LMQI 1AIZA 4UOW1 3OKLA 4TUOA 4NZFA 1D5XA 3DO4A 3GI8H 4I1NB 3MV8B 3F84A 4QHLB 3DETD 4HUCA 3MJ7B 4O9HL 5FYKU 3TIDB 3ECUA 3L3JA 3L3KA 5IQNA 3MV7B 5IEKB 5LBGA 4Z5RB 4TSBL 2BOCB 5T3ZD 3US0A 4EUPA 2IPTL 1S7TA 2ZKHL 2WNKA 4OD1H 2QQQA 4WFFD 5DVMA 2BZCA 1OSEA 4QT5A 2SEBA 2X1WL 1JFQH 4ES8A 3D18A 1BCIA 1BX2B 2YEZA 4CSZA 2CRZA 1SYSA 2HUEA 1JFQL 4KITB 1IFHL 2D7OA 5JQIB 4F15B 4KK8C 2DWDB 4Y8AA 3FHAA 3BWAA 4GQZA 2LLGA 4D9LL 2XWXA 1BQSA 2V5SA 3ARRA 5I9QC 3QIBC 3CX5J 4PBWD 4YDLC 2O6CA 2WPGA 1JZ7A 1SN0A 3GBLA 1IARB 1MIML 1VPOL 2B77A 2WVVB 2YPLA 5L0QC 2NY1C 3QRFM 5F6HI 4IGBC 2P5ED 4N90D 4AEIL 2XWTA 1BVNT 1L7TL 3EYFB 4TRPL 4ZUSB 5FUZL 3TNNB 3TT1L 2E9GA 2Z8VC 4BFRA 3HG1D 4X4YB 3OKEA 4R2GB 1U8QB 1ZK9A 2Z6FA 4EN3B 3SDDB 3GKWL 4N0UE 2Q87A 1A6TA 2EYSA 4JB9L 2Z34A 1NFDA 4YHNB 1J9QA 1IC1A 4FZ8L 2F53E 5CEZH 4KAQH 4UQCA 4Z1PA 5C92A 2EH8L 2FRGP 1MCBA 2K78A 4N5ED 4GT0A 4OH2A 1GZPA 2WBJD 4TQPA 3V0WL 3ZTEA 4Z7NE 4JFHD 1JGLH 2GEEA 5KSBF 3RFZA 2RCSL 5GIRA 3RWIB 1P1ZB 4PWKA 1E6OL 4EXPX 3NDZE 1JRHH 2B1HH 2VMFA 5AW5B 5J89A 4FCAA 1XH0A 2VDQH 4K9EC 1ZVSB 5IB5B 3NZSA 4RMWA 1DBKL 1E4WH 4HLJA 1KFAH 1U8IB 1HCVA 1DQKA 4PJHE 4I89A 1CXEA 1CS6A 2VN3A 3T0BA 3N5AA 3L4ZA 1U8LB 4HEMA 4HPYL 1E6JL 5DMGC 3NIGE 5CLXA 2UXTA 2HKHL 2WIIA 3VJ6A 2RAMA 4YSQA 4NJ9H 2BP3A 1IKFH 2PWDA 4F7KA 4RCAA 5TDPB 1MFAH 5J3HC 5AVUB 2NXZB 2VLLB 1KTKE 1RZPA 4M7LL 5GGRB 4C8XA 3INUH 4MYPA 1P1VA 1DZBA 2QQKH 2J1KA 4FE9A 2NUPB 4OLEA 3N42F 3OR7A 1OL0A 1ULVA 4KVNH 3IJHA 4PUBH 1Z32X 2WJ5A 4OUUA 5EO0A 4W9JC 4AGMA 2HPTA 4NQVA 4Y2DA 3U0PA 5IOPA 1BECA 3FU5A 2XQYG 3EUDA 4P9HC 2WUBL 4FQ2H 2F7PA 3PUCA 1KJVA 3KJ6L 2F19H 4E9VA 4PJEA 1U4FA 3RIFK 4NSKA 2VE6B 4K5PA 1UFGA 1NCAH 4DGVH 4FTVD 5TFSL 2PO6C 3OSKA 1ACXA 1BG1A 4P23D 3WI9A 1SDAB 2BP0A 4G6KL 1D6EB 1I7ZB 2UYLA 5SV4A 2VM3A 1C12B 2AZAA 2Z35B 3IFNL 2A99A 2X0WA 3QXTA 1LO0H 4FNLL 5FO9A 4XAWH 4NLHA 4NGHL 2Y2YA 1BWWA 4FNTA 4N2DA 4YBQD 1BFTA 3NSDA 2H32A 3OGOE 2FSEB 5D1ZA 3S35X 1R9FA 4NBYB 2X1XR 4ZOBA 1FPTL 3LN9A 1ZKAA 3OKEB 3QGVA 4XVUC 4AYDC 5AVXB 5ACLA 1GC1C 2IFGA 3VD3A 2ROXA 4WHYG 3O6FB 5I1LA 1RZKH 4QMEA 3WKYA 2R4RH 3RWFA 1G1KA 3JT0A 3UOAB 5H35A 3QJZA 1U36A 1N68A 3DX1A 4RGOH 4ZTPH 4E9YA 4PVBA 5DJXA 4JJOA 2XZZA 3NA9L 3SE4C 1FFPA 4ZO8A 1MUJA 1SF3A 4YDIL 1SN5A 4J28A 3MBEA 2DQFA 4GIPD 3NZHL 3Q3GA 5DS8B 2PYFA 1P69B 2DWSA 3PGDA 3TASA 1CQKA 2BVQB 4CNIB 3L5JA 3HUJA 5KBDA 3QWNA 4NWTH 3HPLA 1HSAB 1WBXA 2ZCZA 5DQJA 4BQ9A 3IGKA 3TO2B 4P5TA 43CAA 4NOFA 3HVNA 1PL3A 2OJZL 4S1SH 2MSPA 3PNRB 2VZOA 3T1FB 3B9KC 1VACA 3AW5A 4DQOH 2WAHA 1RIHH 4I2XE 3WYRA 2DQCH 2AV1A 5MENB 4WJKB 4DH2A 1UCTA 3T6WA 4G42A 2EAEA 5KYXB 3IDGB 3ZKQD 1KULA 2Y3NA 3T65B 3DVGB 3UO1H 2ENPA 1EAJA 2NY0D 1G7HB 1D9KA 2F53B 5GGRY 3EYUL 3KS0J 3MACL 4KX7A 5F8QC 1T0MB 1DSFH 2DWTA 2YD7A 4MXWL 1L9NA 4S0HA 3MLZL 4J8RB 3K8MA 3FSWA 1O6VA 3BD4A 3MTXA 4Y16C 3TPKA 5I18H 2E4FA 2OJEA 3GQFA 4OZ4B 1NCBH 4XCFL 2OMXA 5L8LB 1C08A 5D6DA 3HBGA 4S11A 2A0LD 2CLRA 4FQPA 4WI2A 1TLKA 3QZOA 5D7JB 1YNKH 5CLWA 1S5HB 4UQBA 4NZRL 5F9AC 2F8VA 2WLNA 4WK4B 4TXVB 3NCBB 1YDPA 4LB8A 1I7RB 1SHSA 3WO3B 3E6FA 4JZOA 3QDJD 3H85A 4X6CE 3AG3B 2YPVA 2EEAA 3UCQA 4CBZA 1FNGB 3ZZQA 1QBML 3DARA 3G04B 4OI7A 1U95B 4XVJH 1R3IH 1MDAA 4AENA 4GUPB 4KVCL 1I9IL 1RSYA 3ULVL 1YEJH 3QBTB 2WQUA 2UWEA 4NKDA 3S48A 5I1LB 1DN0A 1KTJA 1ZT1B 4XI5C 4N5UA 3L3DB 4UQEA 2E75C 3RIFF 5BW7A 4LZKA 1NIDA 1URZA 2W9DL 3AWFA 2Z92B 3D3VA 3LDBB 4IOFD 5GS2H 4HLZG 4PTUB 4BK8A 2CR0A 2X4OB 1NCTA 4FHJA 3TYFA 3MLPA 2YD6A 2A1WL 4ODTH 5FEBA 5DK3A 2NR6A 4ERSL 5A2IH 3NA4A 3P4NB 3LKPA 4ZXBA 3RVUD 3QUXA 1QMUA 2LHAA 4H2AA 4Y1AB 4Y9FA 4G7SB 3K5RA 3OKNA 1KBGL 3N2JA 4JFFA 3N85H 3T08A 3BVDB 2NZ9D 4NKOB 1AKJD 2CO6B 2EIKB 1K4CA 3DX6B 1OWWA 3VX1A 2QHRL 3L4VA 4KU1A 1OF2A 3FQ2A 5I28A 3VFSB 2BP8B 4J2XA 2V7HA 4XN5A 1HIMH 1A6WL 4LEXH 2JKRM 2X42A 4F7PB 1CF1A 1MFCL 4R5XA 1WIOA 3DYOA 3KYAA 5A2AA 2CKBL 4NYLB 3TVMD 3WUWB 4PP2B 3SKOB 3LOWA 5A7BA 2PW1B 4NN7B 4RFEA 1BJ1H 4L5FE 4YZFF 2DEXX 5DUML 1AQKL 4TUJB 3N1PC 4L8BB 3V0JA 4Z7WB 1KT2B 4JY4A 5DJCB 1EO8H 1LEGB 1ZLSL 3O11A 4IM8A 3SODB 5DI8B 3SDXF 3UC0L 4GKLA 1XBRA 3M88A 3KPRD 4EDXA 4HK3N 4UINL 2KDYA 3LNFA 1WGVA 3WFCL 3FQNA 3SCMA 2L7UA 3KPTA 2V0AA 4XNMB 1FNSH 1PCSA 5D5MF 4LLMA 1A6PA 4P4RA 3ESNA 4NUMA 1C08B 2NT0A 3QUZC 1IAOB 4AIZB 2EVHA 1CLOL 3FT3A 1T1WB 2XC8A 2P47B 1SEQH 3NJNA 5D70H 4O5LH 2DM3A 1D9KD 1LP9E 2X1QA 3N41B 4PJFB 4YXHL 4BKLB 1LK3H 4QRBA 4YWGL 1IEAB 2NSQA 5KUMA 3RRQA 1UB6B 1FAKT 3QZPA 3ZX1A 5IUSA 4U0RC 3HZYB 1RSFA 4ZNEE 1QWNA 3ISWA 5F7DB 1DL7H 4Y4FD 1LE5A 4AEFA 1XZ0A 4HJ1A 4XH2B 5FK9B 1UOKA 2YA1A 4PRAA 4LASL 1HHHA 4N2LA 4HKZA 1JZEA 3IF1B 4KGLA 1G0YR 1YY9C 1LQBC 4HAKA 3N91A 5F7UA 3I75B 3LQZA 4Q6KA 1OTSC 4XRCB 1ZD6A 1RV6X 1F3DJ 2J57A 2VC2H 3NACH 2NQCA 3CHQA 3I2CL 3GSVA 3LKRB 4NJAL 4TSAH 1LO3H 1VIWA 4OZHB 3DECA 1Y18A 4OQTH 3IJSA 3MRGA 3TFKD 3SEPA 5GRYA 2W07A 3QJFB 5I2IA 4PG9B 1KCWA 3IMBA 3QWRA 3VD1A 4U1GB 3SY0A 4NKIL 3PPSA 1X5MA 3UTQB 4R0LC 1CLZH 3NFSH 4R4ND 1SLXA 1CD1A 5DZNA 3L2MA 2XWCA 2CNZA 3HNTL 2ICCA 4XP6H 2CPCA 3RX8A 4JPKH 1P7QA 1NFKA 4OM1L 1F5WA 2Z93B 4AV5A 2Z4TA 5DJDB 3W5MA 2ZONA 4OF6A 4A1RA 5F9JB 2KBGA 3AY4C 3EG9A 5HVGB 5EA0L 5ALCH 1MCJA 4JKNA 4XI5D 3BUPA 1JSYA 1Q0XL 5TF1H 3DUUA 3L8QA 4TQEH 3WJMB 1PD0A 1WA0X 3ARBA 4MJ6A 3R0MA 3DX8B 4XP1L 1R0AL 1NGWB 4U6TA 3BAEH 1DQJA 5ERWA 1CGYA 5DDHA 3HCVB 1X9LA 1DFBH 4GKZA 2QZQA 2W9DH 1IBGL 5K9QG 4JL1A 1KYAA 3N85L 3F65A 1E4HA 1U92B 3LYRA 2UXVA 4NHCL 4QI3A 1A8JH 3EADA 2OA9A 4A7SA 1Z3GH 4HJGB 4GI6A 3R19A 1SXAA 3NESA 3TH2T 5C3IA 1XSKA 3FRUB 2F1AA 2YXVA 5DJ8A 1H3PH 4BQBA 1E42A 3ARYA 3LNEA 4KKRA 4L4VE 3UZVA 5AFAA 3W1ZA 1MH5B 3A3YB 1ZTXH 4XXWA 1SHWA 3QB7C 3T0EB 5IEHB 2P3YA 5SX5K 1OAJA 5A2FA 2TAAA 5JO5B 3VGBA 4JG1H 5AG8A 1YMME 4LLVA 1JGUH 4ZW6A 1UD2A 1IGCH 3TC9A 5IBTH 4NC1E 3MREB 1UUNA 3VWKB 43C9A 2JKIS 3PYCA 5DHMC 3V9EA 5DJ0B 5IBTL 3UBFA 1A02N 4GSDH 4BFGA 4X6DB 3ULUH 3M86A 3WIHL 1XCQA 4JR9L 2UY7A 2ID5A 3KCPB 3SE4A 3VGAC 3O4LA 3CSTA 35C8H 4GKSB 3BUTA 4K8RL 4M61B 2HAZA 1QSFE 4QTFA 3C5XA 1EO5A 2JXMB 2YD0A 4FMVA 3UERA 2BC4A 2A2QT 3T4YB 1NCBL 4XCFH 4UU9A 4FXGA 1FZOA 1U8PA 3MFFA 3GJFK 4P2QA 1QTYT 4ZMYA 3UTQA 5B38G 2QGEA 4UQ3A 5BUGA 4AGLA 3GRWA 4HBCH 4KK9D 1QSVA 5I16A 1R3LB 1USZA 4QRFA 2H9GB 4PLKD 4LQ1A 3ZYIA 4N2BA 4WY7H 5EMYA 3FTVA 5C0AB 2XRAL 1IGTA 1AZZC 4QHUA 4N2NA 3T3PB 5EU6D 3HG4A 1CE6B 4LE8A 1WCQA 4LAJH 3BD5A 4YHNA 5C0JA 2XN0A 3GGWB 4WKZB 5T3XD 1NCWL 4GOSA 5IJKC 4NC2B 5E56A 4FQQB 1GKEA 1II4E 2Y36L 3HFMH 4FQLL 4XAKD 5CJ8A 3E1ZA 4Y88A 5D6DC 3GHPA 4EPSA 4Q6YA 4HLEA 3QDGA 5E6IC 4B9JA 2IADB 4YBQC 1URIA 5K1VA 4JW3A 1XB6A 2AXJA 4QRTA 4E42A 3REVA 2KH2B 2R4RL 1BEYH 3RL1A 4PJBA 5DEGA 4L3FA 5HHMB 1U8IA 4IRSD 3DXAD 4PW3A 1T04A 4J3OC 3MUZ1 4PGBB 5I1HH 1G7MB 2XN9D 4NNPL 2ZXQA 2YC1A 2X6UA 5FFLA 5J6GA 3CZUB 3ILPB 1KLFA 4JDZB 5CIPB 4GSDL 5HVFB 4PJ9D 2FJHA 2FX9L 4LFHD 1JGDA 5DJYB 4U1SB 4MJHA 3ZHNA 4V1DA 1QR4A 5BVPL 5I1DA 3VVVA 1K3IA 2EIMB 4JVUA 1SHXA 4GYBA 3OXSA 1ZLVK 3KPRE 5AZEH 3Q05A 3DX7B 3QFJD 1IMHC 4CILA 3ZHDA 2Y69B 3EGSB 3V79C 4PJ5B 3NCMA 5C09B 1CB4A 2X4QA 4QNPE 4UILH 3D2TA 1INQA 1ZAGA 2BSCA 3KPSA 4G6JL 2W88A 4Q7DA 3Q2WA 2DQDH 1HI6A 1RI8A 1IGJA 2TRHA 2BWIA 2Q2EB 4KOCA 4K2UL 4ZUUA 5TK4A 4X98A 1F6AA 1EDQA 1LMKA 2W9EL 5GSRA 2X3BA 2XPYA 3KNBA 4FFYH 1QFWH 2IWKA 5D5MB 2FT8A 3N3EA 3RKDD 5DHYA 5L6YH 1JHTA 2K6YA 3K72A 5F0MB 1X7QA 4LESA 4BINA 1D2PA 1P4UA 3U6XA 3T71A 3VWJB 1CBJA 5I1CH 3KS0H 2VDNH 2O5YH 4HS3A 4L4VD 4N1EA 5JORB 1N19A 1E5CA 4M7KL 1ZIAA 5HYSG 4Y4HA 1KC5H 3M6DA 5GRXG 5FYJL 3UTTB 3CDYA 5DRNA 1U21A 5GZOD 3RKDC 2EYRA 4I3RL 4LEEA 2EUZA 2HMID 3APMA 5DVOA 3GBNL 5H8DA 2R7EA 4N0FB 5KANG 3VRJA 4I3RH 1QHPA 2PXYB 3LEYH 2FHFA 4PVNA 4A66A 1G7LA 4M7KH 1WHOA 4HIIB 3PY9A 4ABUA 2FBJH 4NBXB 3TWCL 1PLGH 3C8KB 3PNWA 4M6NH 1KFAL 1IIKA 5D7LB 3TN0C 3CDZB 1BPLB 2D0FA 1XQ4A 1TYRA 2X2UA 4MZ2A 1RULL 1ED3A 1Y6MR 5E4EC 4EI5D 1F42A 3S6CA 4ZOCA 4QRTB 1DUZA 1LO3L 1NINA 5T33H 4NJAH 3ZYOA 5IHUL 4Z7NB 1TG8A 1N26A 1LMIA 4JBSA 4ZO9A 2ZUTA 1ANUA 1XTMA 3KHOA 2H0EA 3MKKA 4DP8X 1NC4B 3HHMA 3WLBB 4I0CC 3IVKA 1WS7A 4ADJA 1VZIA 2K9UA 4X0NA 1ASPA 3EOTH 3LEVH 3ZOAA 2X41A 5DA4A 2X6VA 1MFVA 3I9PA 4JANB 4ZI8A 1G6RA 2JB5H 5JMRA 4LL9A 3D52A 5E1AA 2JQZA 1U4EA 4JHWH 1OY3B 3MV8A 2R1XA 1TJXA 1MZYA 3CSYA 2CK0L 3D34A 4LEBA 3MLTA 2QDWA 5D1XA 3VFGL 4HCRH 4DZ8B 3EJJX 3WHE0 2K45A 4BFBD 4RA0C 4LPWA 1CFMA 1L7TH 2H2SD 4TRPH 4UMGA 3SE3A 3WIIL 5KVFL 4MFHA 1XXFC 3IFLL 4G11A 2P5EB 1HNFA 2YA2A 4CMMA 3ZKMD 1W8EA 3KPRB 1EJ6A 3PDGA 2VXTH 4H20H 4YO0B 3MUHL 5HGGS 2CBOA 3ZE2F 4D9LH 3RPIA 3VWJC 5ETUA 4HUMB 4PTTB 4X9IA 1J5OL 2HTKD 3ML9A 4HGMA 4DQAA 1KNOA 2X3AA 3QI9D 4TTDC 4ZQKA 1ZLSH 1EO8L 2YD5A 3CH8A 1C5CH 5K9OB 5HHXH 2AQ1A 4OCYL 5E23A 1BBDH 3I9GH 3LIZA 5T5FH 3KVPA 3DOHA 3KYOB 3T4AB 1U8JA 1KOAA 1NBVL 4PLKC 2ZOUA 3R1GH 2Z8RA 4KK9C 4NCC1 4TNVF 3RWJA 4LARL 2VLLA 4I13B 4CSTA 4WWKC 3TO4D 3JV5A 3NOIA 2BFVL 4LP4A 1NPUA 3EDEA 3OAWA 3DX3A 3NCEB 5KBMA 1NCOA 1XXDC 4EN3A 1NC2B 4GW4B 3ZZLA 2WXIA 4O00A 3FCSA 4PS3A 2X7LB 2WINB 1ZA6B 1CFVH 4I48B 3ZKNC 4JO4H 1PG7W 4EQ3A 1PYWA 2NY3D 3IU3B 5EZLB 2H0PA 2ZCKH 4XC1L 1J8SA 1FGNH 2RB8A 3KBFA 4JM4H 2V5MA 1FJ1B 5EHFA 4O4YL 4O2CB 3N6YA 2AJYL 2CGRH 4OFQA 3KLQA 3ILQD 4E2OA 1F1DA 5K9JL 5F3FA 4BSVB 4JKPL 4PWEA 1DJSA 1PW3A 5HY9A 1S9XB 1UWFA 3C2AL 3CQFA 1UURA 2VMCA 3TV8A 4OM0L 5F71A 1XAKA 5HDWA 3LKOA 3M1BA 4N9OB 3BAYA 4ZUVB 1R4XA 2FTAA 4XVTH 1ZEAL 5TDOA 2OM5A 4RMVA 1FDLL 4ZZFA 1HL8A 2OTWB 1J8HB 2Y7NA 2VLKA 4TULL 5IW3A 3ZIMA 1N5YH 4G80A 4OT1L 3UYRL 1XH1A 3BKJL 2ZOWA 2J73A 2XXCB 4X8CA 1RUMH 3SY6A 3ATDA 3AT0A 1E4XI 4M48L 2OMVB 5CXPA 1ACCA 3MUGB 5DHVH 2FQFA 3Q8FA 4TNWF 3QPXH 3Q2NA 3JZ7A 4AQ8C 1IFRA 3OV6A 2JIXB 5CAYB 2VZ1A 4YHZH 1Q90A 1OGAD 1F4XH 3BH9B 1NGZA 3B5GA 1MWOA 3LSOA 3R0NA 3ATFA 1KCSH 2YHGA 4EEEA 3KM2A 5ICZB 4WUKL 1BF2A 1P9MC 4NRXB 5JHMA 5A2KH 3B7SA 5TFSH 1Y6KR 2VL4A 3T4AC 3FOMB 1MRDL 3GXMA 3KD4A 4K71C 3BT2L 5AYTA 5KSUB 2OK0L 1TTRA 5TE7L 1ORQA 4ZD3H 1NH6A 4H0HB 5DYOB 2LE9A 4X6BB 4L0ZA 1VESA 4UAOB 4MQ7A 5I1KH 5BOJA 4NHCH 1OAXL 1RFDH 4UDTB 3DTXA 4K7FA 2WTRA 4PJBE 4CADA 1EV2E 2GJ6E 2ZOTA 1R46A 1C1EH 3GSWA 5AKRA 4R4NC 4NQUA 2ZOOA 5FA3A 5KS9E 4JPSA 3GJEB 4WHTA 3H56A 2ZOKB 2R0ZH 2ICWA 5DLMH 1G9MH 2A73A 4G3YL 1EHXA 4LSUH 4M7JH 3B56A 3RU8L 4ATTA 2YPLD 3TFKC 4PI2A 1NC2A 5TE7H 4M7ZB 3HBPA 1JOIA 3QA3A 4U3XA 15C8H 1OTUC 1IL1A 2VR4A 3FW6A 1L5GB 3T2LA 2PCPA 2WLZA 4MQTB 4XBPB 5IT2L 3TJEH 1NBQA 1YRKA 3K6IA 4K3DH 2Z1KA 1S9YA 4ZSOE 1MHPL 1AJ7L 2B14A 3GSNA 3Q6FB 3BGAA 2ZJSH 4ZMTA 4GP5B 4P5KB 5GS0L 3BN3B 2J8UF 2BIQA 5JXEA 4BE6A 1RHHA 3DV4B 2X12A 1MELA 3P2BA 4K07A 3EJRA 4L8SA 1JK8B 3HC0A 4HXBL 3T0DA 4PJ5E 1ZWIB 5LGJB 4YPJA 2ATKB 1O9ZA 1ESOA 5FHAH 5F72S 2OTWA 3LPPA 4OIIL 5GZNC 4G1MB 1LD9A 2HX9A 3AS1A 3PHQA 1VHPA 5JZ7D 2Q1EA 2HG5A 4NRZA 5HDBB 5IQ7L 5GHWH 4EI6B 3ARFC 5EV7A 2QELA 1JWMA 1RJYB 4KVPA 4DUWA 1LEKA 2VXSH 4NQTA 2XWRA 2MHAA 4XHQA 5KVEL 3ATEA 3HJ0A 3DX8A 3LN4A 3CC1A 3ABKB 5H2BB 1PKQB 4MZIA 4P3CL 1NGZB 1DJHA 3LSOB 5I73C 1QX1A 3E9TA 3O9WB 4PJXB 4PY7A 3LMJL 4PJIE 4U31A 4YOKA 3ARPA 4Z78B 5I0DA 2F19L 1VAHA 1S8DB 1X5HA 2X4RA 3DRTA 2FJSA 5EOQL 4M6OL 3MOAL 3O3EA 1UA3A 2OMXB 5C9KA 4F1SA 1P6AB 3FTSA 2YOCA 4X8JB 4HT1H 2FH8A 1ZHLB 1FIGL 4ODXB 3D3VD 3KE0A 4KZDL 4MJ5A 3QIUC 1ZGLA 2UX7A 3F7QA 3GMRB 4FOMA 2XA8H 5JO5A 3BDXA 3SDXA 4G70B 4B5EA 2ZXCA 2H2PD 4U05A 3K2MC 3SQOH 2IG2H 3KXFD 2EDNA 1X5KA 3FFCD 3HNVL 3P02A 4NYLA 1JGEA 4OF0A 2WLIA 5D8JH 1RUKL 4A2EA 3S37X 1X5XA 3N06B 4OD2B 3E6FB 3P11L 2MKWA 2FL5B 2V5RA 4XOCA 3GSWB 4PRHB 1DQVA 1A64A 5KTEL 4QJ5B 3LZLA 4A2LA 3QH3A 1MHCA 3TA3A 2GJ6D 1A6WH 1JI1A 5D1ZI 2EZ0C 1TJGH 2JCCB 2BP5M 3FT3B 2PABA 5GZND 5D1ZC 4ONFL 2NPLX 2O72A 1E6OH 1A7PL 4IBYA 4NS0A 4PG2A 2ITDB 3H1ZA 2APWA 3TYFB 4I88A 4JFPB 1IVLA 1O7SA 1JZDC 3GSNB 2GC4C 3VQ2C 4HJJL 4UOZA 4GSQA 3QC5X 2E86A 1V05A 1GTNA 3AS3A 3S37L 2ATAA 1AHKA 1WC7B 2ADIB 4UIKH 1ZS2A 2NY7L 1J8HD 3H3PH 1YJDC 2UWEF 5KWYC 2R8SL 3LPOA 2NCMA 3EOTL 1OAXH 1FC2D 5EWIL 1Q1JH 3MRDB 4UOJA 1MNUH 1FN4A 3OD3A 4RAVA 4AQAB 3FN0L 4R4FH 3EYSH 1FVDB 5B4MD 4H8WC 4G6ML 4KKCC 4P2CG 4U1HB 1YQVH 2XWZA 3ARGC 1U8NA 4FZEH 3MRKA 4TL4A 2ZSVA 5CMAB 4LSTL 5DEFB 3VMPA 4TUJA 2X70B 1DVTA 3VFPB 1OAQL 1MW1A 1CR9H 3D30A 4LVOC 1SPDA 3AY4A 1ZK5A 1UYWH 3O11B 1JD7A 2EIBA 4ZAKB 2APSA 5C0FA 1MQKL 3DVNA 1GW0A 4TQ8A 2EIEA 4QRUB 4JRWA 4ONHB 3QHZL 4PIRF 1X44A 1OGAB 2FB4H 1WTLA 1XF5A 3FB7B 2W0FA 8CGTA 1QI3A 2OMUB 3ILPA 3V6BR 2ZYIA 5C0RH 1S7SA 5FS5A 4AYFB 4TNWK 4P2QE 1DZ0A 4FI8A 4YDVA 2EUWA 2NY5L 1M9SA 3EJPA 2ORBL 5IMKB 1KIPA 4UM8A 3N1QC 1VGKA 3JT2A 5H37G 3LEXB 3B9KB 4JFWA 3R18A 1V27A 5HDRA 5I1GL 4UM9A 3TBVA 4F58L 3WV0A 1GTFA 4LLWA 1OAKL 1Q9OA 2A9DA 5T1KA 3NTCH 3IDYB 4ZUUB 5K9JH 3TJHC 3GEFA 3KBEA 5FGCB 5LGHH 1IGMH 2XN1A 3NTCL 5IG7B 4UTAH 2PP9A 2DQJL 1XL4A 2A6JB 3V52H 5EZJB 2HFGL 5ITBL 4HXAL 4TUKH 4XN9A 2G2RA 1MWAA 4K3HA 1IAIH 3HC4H 3K72B 4OD3L 4Y2DD 4XVUD 5I2IB 1G87A 1MCDA 5H94A 1I1YA 2FIKA 4P59H 2XETA 5ID0A 5ESVA 1QR1A 3C75A 2YKLL 3QEGH 5BW7C 1LP9B 1CICC 2VZ3A 4M1CD 4F58H 2CDFA 1UXWB 3VD0A 3EFFA 2BVOB 2DLGA 5AZ2L 3VU1A 2IOOA 3Q7JA 5T5FL 1BBDL 2PO6D 3FUEA 3I9GL 2NY3C 3BRDA 1GIGL 2E9BA 4X0KA 5FO7B 2JCCF 4H8WH 2C3WA 5DGRA 1QFHA 3VW3L 1INDL 4KTYA 1X4ZA 4HIIA 4Z9KB 1NUNB 4TLTA 4K71B 4R2GC 3IDNB 4PEEA 4OCXL 1TJHH 4JX0A 5T1LD 1WLHA 3FSOA 1KYUA 2X2YA 4HEPG 4FNLH 2GSIA 3O0RH 4RWYH 1UOVA 4AW4A 3KDMB 3BIBX 1DUZB 2WKLA 4KXCA 4XNUL 1RVFL 4P2QB 5KVFH 3FONA 3NSCA 3T2NL 1IV8A 3RPKA 4QRUA 1KBWA 5GGSB 5I8EA 3AU0A 2R8SH 5C0BE 5CGYC 3CZSA 1FO0B 1M56B 4EIUA 4OLXH 3E8UL 3BN9D 4IRZL 1U2YA 1ZVNA 3BE1L 4LLUA 3VWJD 2ADFL 2JI3A 1CICA 4J4PD 4PVLA 1DVXA 1MI5E 2HX8A 4KKBC 5ICYA 3WXWL 1KXTA 3BZFB 1DE4B 1P6FA 3GMOA 5AYQA 1RK1A 2ODHA 5C0AD 2DYPB 2YGQA 5J11B 1FWXA 2P5EA 3PV7A 3WIHA 3MQIA 4OF5A 4HUUB 3FU3A 2CRMA 4GMSH 3V0EA 4N5EC 1AQHA 1TQCB 4BZ1H 2EUVA 2AK4E 4UV4L 1VEOA 3VU2A 2EE0A 4RNRB 2BS9A 3N40P 2ROYA 4J1UB 4MKMA 1U8OA 2DL2A 4C58B 1JNNL 4OR1A 4PRNA 3JBG7 5IESH 1T04B 1I1FB 3F64A 2FD6L 2A6JA 3HLAB 2ALWA 5KVGE 4JDZA 3FCTA 4IHBA 1EEZA 1RD6A 4UQ2B 2B1HL 4GSRA 3MGOB 3T4YA 4AI7A 5ADOH 3RA7L 5SV3A 1QUNA 4DFIA 4LSVL 1XR8A 3MJ7A 2B1AL 2EDEA 4C59B 3LXBA 2IDSA 3ARFB 1XH2A 4A7GA 5I6NA 2AEWA 2XN9B 3PWPE 3EFFB 5DD5L 2RH0A 2CBQA 2ZWLT 4IRSB 2QMJA 4XN2A 4ZPVB 3IDMA 3O3AA 1J88A 4MSWA 1CLYL 1CE6A 3MV9D 1GC1H 3GKWH 4PS7A 2DICA 1I8UA 1IM3D 3FO9B 1M1SA 2J71A 3UP6A 2KL6A 5EF0A 3B3IB 4WTWA 3CFCL 4KZDH 1JPFA 2QGDA 1JF1B 2E7MA 2H7WA 3EUUA 3OF6D 1FGVL 4WW2A 1QD0A 3IDNA 5I5RA 2CUMA 2OL3A 3VM5A 1AS7A 3U46A 3BAEL 4P9MH 1JHTB 3F7VB 3SPHA 4Z23A 4YXLH 3BEVB 3K1DA 2AJUL 3D2UA 1XIWC 3OKKB 3MODH 3T6QC 5CZXD 3IXAA 1BIIA 3QK0A 5FGBC 4FMFA 3DETC 3BQVA 4WW1B 4L37A 4WNQA 4H1LA 4IDLA 3TO4B 3PQYA 4XXDA 2HN7A 3CZFA 3U25A 4DUVA 3FCGA 3BN9C 2OMVA 3H54A 5D7KD 1EFQA 3ARQA 3B5HA 4PJIB 2XQBH 2XTLA 4B0MM 2ARJQ 1MRFL 5FUOL 4QXVA 4KKNA 2X6MA 4NNYB 1MLCA 3C8KA 3PNWB 1OW0A 1OARH 1KELL 1BFVL 3D0AA 3HNSL 4WTXA 3EYOA 4J3UA 4FP8L 5C09A 1D6VH 3LZPA 4MYWB 3LV3B 3OMZA 4BFOA 1MJJA 2M8XA 4IU2A 1OGTB 2W5PA 4OQTL 5EORL 4R2GD 4PP1C 2OMBA 2GBUA 5D7KE 1KYDA 2BSBA 4RNRA 5FYJD 3VXRD 1RMFH 5G5DA 4KMTL 1OAYL 2JJSA 2XPGB 4AMKL 5A43C 2HT2D 1OVZA 2XYBA 3ZLQC 3PWNA 1Z66A 4J3OD 2Q8BH 5DTFA 1C1EL 4QTHB 4ZW8A 4LASH 1KYOK 3ULVF 4R7DB 3MCLL 1KG0B 1DBBH 2C8NA 2I85A 4NQCE 1PZUB 3V4LA 3HHSB 2XRAH 3L3OB 5JOEA 5GGTA 2B8OT 3P4MB 2BLFA 1ECYA 4DKEH 1IJ9A 1HE7A 9CGTA 4HBCL 3CBRA 5FFOA 1S5IL 2DTMH 2ED9A 1A9EA 5JTWA 3FOLB 5DR5L 2Y1ZA 1ETZA 1F18A 2V9QA 3FQTB 4YHPA 5JHDA 4ZBJA 4O2EB 1V54B 1CBVL 4RX4D 1GMIA 1SBSH 2X88A 1ROCA 2D7MA 1CLOH 1U2CA 5EF1A 2PCPB 3BLPX 1NFDB 2Q86A 5HYSA 2C3VA 1U93A 3ME0B 2I69A 1KNOB 2Z7WA 5H37H 2XT1B 4YHKL 1I9RL 4G6AC 1F56A 2GITB 4XHJC 5ICUA 4H40A 2B5IB 2LU5A 3QQXA 3PWJA 5AENA 3QUHA 1NUFA 3PF2A 3UROR 3X13B 2ERJC 2LGNA 2KT6A 4L8SB 1JNJA 2ADJA 2VTFA 3HRZA 4GRMB 5IW1B 2E3VA 2XV6B 4MVBC 4L2YA 4PRBB 1AHWA 3VGDA 3DX4A 1E4XH 4A2GA 1T3FA 3BZ4A 3EYQD 1ZHBA 1HQ4A 1KCVH 1QKZH 1JGUL 1MI5D 3QT2A 1OHQA 5EWIH 3NIDE 2Z0BA 1UWYA 1R3JB 3KWWB 3L3HA 3HUJE 2P24B 3OL2A 3LRMA 1AS8A 2IPKA 1UVQA 1WK0A 1JPSL 2GTZA 2VH5H 3PHOA 4MB1A 4X5LA 3RTQB 4FDWA 4X99A 2I9LA 2GIXA 1F2XK 5TQ2L 3HZKB 3KJ4B 3CSYB 3LVEA 4G7VL 1TCRB 2CGRL 2H8PA 3DK0A 1HILB 3BUIA 3KGRA 1UM4H 2AJSH 1M3IA 2Y1VA 3IRPX 4NIYE 4DP0X 3BSZL 4RFNB 3IJ9A 3EKCA 1KB5B 3BP5A 3T2OA 5EH1A 4NUQA 1MJJB 2H5UA 5BRZA 3O81A 4UQ9A 4BFFA 4G8EA 5IOPB 3S4SA 2VMEA 4G5ZH 1BAFL 2R29H 3RI5F 1OW0C 3QEHA 4JPVL 5T3XE 3S4SG 1F4WL 3L54A 3GK8H 3SB3A 1TMCB 1W2KT 3KR3H 1I7ZA 3BKYL 4W6YB 4C4UA 2AXGB 2VXUH 3GNMH 3KXFA 4FFZA 3RNKB 4FHBD 4UBDD 4Y4HD 5F9OL 1EZVY 1LQSR 5D2LE 2DAVA 2IG2L 3RDJA 2JLLA 2JMRA 3UL4A 3IJ8A 3ZTJG 5ISZD 1QRNE 3FQTA 5JHDB 2IGLA 5F6IC 2AGJH 3RGHA 3U9PL 4AIOA 1A7BA 3PWPA 4OFYA 1ZANL 1MJUH 2SEBB 4FLRA 2NOYA 2NY6D 2BVTA 2EH7H 4MAYC 5T8IA 2VN7A 1HZLA 3FTZA 5D4JA 2CKNA 2JTYA 1N12A 4OV5A 3DIFA 1YQ2A 2AK4B 1BXXA 3DJZA 1GYCA 2FJUB 4R7NB 4MLIA 4CNIA 4E5XA 1X5ZA 4JRXB 2X4SA 1SEBB 2XTJC 3IFLH 4NO0D 3RX9A 3P69A 4XCCH 4LSSH 3D51A 2O26U 1AI1L 4WHTB 3TO2A 43CAB 5IIEB 1Z6JT 1M2VB 4M3JA 2X10A 5FOJA 2ZUQB 1KEML 1LK2A 3FUJA 2XA3A 3H42H 3MBXL 5E99L 2BRRL 5B7EA 1AXTL 4P48A 4UT9L 3WUZA 3HG1E 1FL3A 2WXOA 3HG5A 4YN3A 2ZUXA 1FAIH 1OTSD 4LRIC 4BK5C 2P5EE 3GXTA 4YXHH 1IAIM 4LSPH 4D3CH 1YY9D 3HI6H 3PHOB 5DWPA 4PD4J 1OK0A 3UJJH 5AAWA 3S36H 4K3EH 4UV7H 5DVLA 2AK1H 4PJ7A 1TETL 1KZQA 2F53A 2F7QA 9PCYA 3NSXA 4Y4FC 1H8NA 4HK3J 1FSKC 3PXLA 4M7ZC 4X9GA 5CU5A 3P30H 5C0FB 1VZHA 4XCEA 1CDHA 1GOGA 1U3HB 2VLJD 2VSKB 4N0UA 4RGOL 4ZTPL 4JFVA 4P2OB 3VYOA 2WKOA 3JV4A 2OSLB 3EJYD 4G2AA 4QOKD 1D9KC 4WTZG 2XX1A 1YN7B 1VA9A 25C8L 4PREB 1OD9A 4UZUA 2O5YL 3N1MC 1S7QA 4FFWC 4LEXL 4P07A 4WTZA 1G1OA 2GI0A 1JGVH 2MFNA 3MRPA 4RQQB 1JWMB 3W0WE 2ZG3A 3S8WA 2IGFH 4CC1A 3CLFL 1THCA 3UCRA 2B3IA 3MMEA 3OXRB 5PAZA 4ZW5A 4JFOA 4KJQC 2P52A 5FHBL 1W91A 3GIVB 4R3SA 1LEGA 2VDNL 1NJ9B 3T0EC 1XF3B 1ZJBA 2V6HA 4I9WD 4EXKA 2X4RB 3WFEL 3ZZSA 4I0PA 4U0QB 5JW4M 1JPGA 3ARGB 5D7IB 2O6FA 1NOAA 1GC1L 2EO1A 1GGCL 1JV2B 1QFWL 4FXKB 4Y19A 1HHIA 1NM9A 3DYPA 4XBEL 4KVNL 4APQB 1W72B 4JMXA 3BUBA 4GEIA 1BQHB 4HQQH 3RVTC 3HS8A 5FGCE 1T2QL 5TE4L 1PZCA 3T5WA 3QIWB 1GZHA 3ZBMA 4Y4KC 4NCC2 1M1XA 3E6HB 5CBAA 3L4UA 2XVLA 4A7UA 3A6OA 2M1KA 2ZAHA 4JRXA 1U42A 5EZIL 2XV0A 4JKWA 4K5MA 4BA0A 4P57B 4NPYA 2HVBA 4BKSC 2D3VA 2X89D 3BP6B 5HHPB 1ZHKA 4ZXBC 4IOFC 2HX7A 3EOBB 5IESL 1E90A 4PJIF 2DQIH 4XP4L 4ZFOB 3UXFA 2WO3B 3N04A 2QPSA 4KOBA 4MAUL 3H7BB 1UH3A 1EVTC 4J23A 4LNVA 5HD8D 3ULAB 1YNKL 4RZCB 1X5YA 3SDCA 5H35B 3A5VA 1AHMA 4MA7L 2MRYA 4ZS7H 3CFKA 3SY0B 5IFJA 1H3GA 3EIFA 4P2OD 1LLAA 3EO9L 3P9WB 5CBEA 1ZLWH 2HLFD 4QRSB 4ZPTA 2Z64C 4TNVK 5DS8A 3CXDL 4TS6A 1U3JA 4IBUA 3MJ9A 3QJHA 1J05A 4MMYB 1TCMA 4MA8H 4B9IA 5I8EB 2EQDA 5EUOA 5I6LA 3QEQA 3QQ9C 2W38A 4HW6A 2CRYA 2IBZY 3QS3A 4BQCA 4PCKA 3V5DA 1AYRA 1YEEH 2QLYA 5A40E 1OE1A 2D7PA 2KMWA 2CDEA 3NDYE 1A9BA 1YEEL 5IB4B 2BWDA 3DURB 1TMQA 4X5RA 5HGDB 3G7TA 1BZOA 3MXVH 4FJYA 3SJVD 4BHUA 2EDHA 1AMXA 1BJMA 2G5BB 3MNWB 4KUCD 5CMAA 5TTRA 2VM9A 4JY5L 2IH1A 4P05A 1JWSA 5DGQA 5F7BA 3GIVA 4R3SB 2X89A 3BKYH 4M4RB 2Z1PA 2PCFA 1NMAH 2MOQA 3GMQB 1VCAA 1P4LA 4KO9A 3SDAD 1AC0A 2WUCH 1NM4A 2YA0A 3GHEH 4I0PB 4ES9A 4H0LC 2J2ZA 1XGRA 2O5NA 3FUIA 3FB7A 5IW6A 3S2CA 1BAFH 1HK6A 4LBAA 3MC0A 3OAUH 2Y7OA 2GYSA 3ULUL 2PCYA 4PJAB 2H1XA 2W07B 4PCTA 4YSTA 3CN2A 3F7RA 1WA2X 4N8VG 2H6UA 2ZKYA 3W0WA 2A6DA 1HXYA 3QJXA 3U2SA 1JZJA 3BJ91 1A3RL 3RILA 3B9KA 4PRHE 4K23H 1Q4NX 1Q94B 5B1AB 2FEJA 3PU7A 1ZHNA 3IDJA 4K94H 3QXWA 1CXLA 5LDUA 5DJDA 3P0VL 3RTQC 1IGML 2NLJB 5DC0A 2HTKC 2VDKH 4YIQA 3O3BB 3IJ7A 1CU4L 4Q8BA 3CFUA 2EXTA 3F58L 1FVDA 3LXAA 3QJTB 1NGPH 2FYVA 4CVXB 3VD2A 3ARDA 3BVTA 1MCWM 2BC4B 2JKXA 3IGUA 4Q2ZB 3WS3B 1P4BL 4U1HA 3ZKMC 4F5CA 3GRGA 5B8CA 4AZUA 4H8PA 4L4TE 2C34A 1NAML 1DQJB 2AJSL 5ERWB 5DQDH 4LIQE 3N0AA 4GAFB 3RNQB 4HS6B 3RX7A 3ABGA 3SE6A 3VFPA 4CU7A 4PFEA 1NCUA 1MFUA 3QUMA 2J1WA 1ACYH 1RUAL 1PG7L 3HG1A 5HHQA 2BHZA 3C9NA 4X9FA 1PKQE 3VSTA 4GG8A 4YHKH 3RLSA 3HN3A 3K5SA 4KRPD 5ENWB 4NJ9L 5EUOB 4AITA 2AHIA 4YE0A 4LNRA 4BRJA