4LOVA

Crystal structure of fimh in complex with heptylmannoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Study of the Structural and Dynamic Effects in the FimH Adhesin upon alpha-d-Heptyl Mannose Binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Carbohydrate binding protein
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4lovA00
5LNEA 4AVIA 4X50A 1PDKB 1N0LB 1KLFB 5JQIB 2JTYA 4X5QA 5AAPA 3BFQG 2W07B 4AVKA 4J3OG 5AALA 1ZE3H 5CGBA 2XG4B 4J3OH 4XOBA 4AV5A 4CSTA 4CSSA 3ZL1A 4XO9A 3SQBB 3BFWA 4X5PA 4AUJA 2WMPB 5F2FA 4XO8A 4XOAA 5IQNA 4AUYA 4ATTA 4AV4A 2XG5B 4AVHA 5F3FA 5FX3A 2UY7B 4CA4A 4X5RA 3ZL2A 3BWUF 3JWNH 2JMRA 4BUQA 4LOVA 5LNGA 2VCOA 1QUNB 3MCYA 4J3OF 4AV0A 3RFZA 1TR7A 5FLUA 4AUUA 4XOCA 2J2ZB 3JWNG 3ME0B 2UY6B 1KIUB 1N12A 5ABZA 4XOEA 5FWRA 4AVJA 5AB1A 1UWFA 3JWNE 5FS5A 5IQMA 3ZPDA 4XODA 5IQOA
chains in the Genus database with same CATH superfamily
1TTGA 1UZ6E 1WZAA 1FNHA 3EYUH 3RBGA 3CBJB 1A02N 2BJMH 1SUHA 3UFIA 1NTDA 2X4OB 1CVRA 1KELL 5I18H 4Z3IA 2DWYA 1WTLA 3X11B 1RZ7H 1BXAA 3KPSE 1FGVH 3IT8D 4LLMB 3F65A 3RU8L 2QPEB 2IWEA 1H15B 1T1YA 1M2OA 3GBDA 3ZGIA 4LARH 2VXTH 5IGXL 4W6WB 5IB1B 3QJUB 5C0JA 2ZSWB 5D1QC 4P8QA 4JDTL 3CVHL 3QDJD 5CEZH 4MMYB 4AYDC 2WYHA 2J1KA 2FECI 1QR1B 3QS2A 3D39A 3ENEA 4K8RD 1FYTD 4NKQB 4LL4A 1BF5A 1CDGA 1RHFA 2J3SA 4PRIB 4NFDA 1T5KA 4MZIA 4K5LA 4XMZA 4DKFL 4XB3A 3QORC 1FN4B 5DXWA 4PJHA 1S9KC 1G6VK 5FGBC 3AT9A 2EDBA 4O51A 4PUBH 3H2WA 1KCKA 1QQDB 1U8IA 4QWWC 3HS9A 3QWOB 4R6UA 4PRBB 2OBGA 2QELA 3E3QC 3IPEA 3JWDL 3MTRA 2WK2A 1JCVA 1G7JB 3DV4B 1LTXA 3KLAB 1W6WA 3KR3H 4G8GA 2I24N 2CK0L 4FG2A 5BW7C 3EYQD 4XE5B 4PGBA 2YLKA 4C4KT 5IR1A 5I9QB 3L54A 4PRHD 4K2UL 3RIFF 2IGFH 2BS71 3RKPA 1WD9A 4DGYH 4YFLF 3L1GA 4M00A 4ZFOA 3HNSH 1IBZA 2ZONA 2V2TA 4L37B 1UG9A 3SDXB 3W9EB 3Q0HA 1XH2A 3A6OA 5AYUH 4ZUUB 2VNCA 1FH5H 2X1OA 4YEEA 3GJEB 5EIVA 1MAMH 1N8OE 2JKLA 1V8HA 4OUOA 1VENA 4P3DA 4A2FA 2KC0A 1HZHL 3L6FA 5SWZE 1OGPA 4N4YB 3N42B 2ZSVA 3IPBA 4PLJC 2ZJSL 5MP6H 3MRPB 3RVTD 5EF0A 1U8HB 2F53A 4QHNB 2YBGA 2CGRL 4LAQL 4G7YL 4HEME 2XQYG 2BWQA 4WTXA 2AXFA 2UZIL 4XODA 5HGAA 3TN0A 3S3DB 4YFEA 1KWKA 3GM0A 2AJXH 4H0HB 1CTMA 4MLSA 1OPGL 2FT7A 4WFED 1RK0B 5K9KB 4QTIL 4HKJA 5E4EB 2D2OA 4YDLC 2CCWA 4M02A 5DJXB 5A6MA 4X0NA 1NOAA 3U0TB 1GCFA 2HWZH 1AXTH 3IN2A 4KFMA 4EI6A 1ONQA 1A6AA 2UYLB 4ZX4A 1NA8A 1PG7X 1DBBL 3MLZL 1NFDE 3RTQD 1ZS2A 1OGTB 3IYLW 5DZJA 3HBPA 4P4KC 2B1HL 2JNZA 4N2AA 4OF5A 4PG2C 3DRQB 3KWVA 5ID0A 2I85A 4QJ5B 1AQDB 3EG9B 1IIKA 3HG1E 3O3UN 1XF3A 1C5CH 1F8TL 1SLWA 4LRNH 1GHFH 3X1NA 1PEWA 4HIIA 1JHKL 4DGVL 3WEBA 5F3BB 1ZD6A 2KZWA 3N40P 4EJ1C 5H2BA 2YEZA 2AK4D 5CF3A 2XZQL 3UX9B 4X98B 3ZE0F 2BIHA 4YHNA 4ANUA 1XR9B 4R8WL 3EJQA 2DPKA 2GBUA 4YZFE 4W6YB 4Z95H 1VLXA 2DBJA 1CVSC 2VLRE 1S7RB 3DOHA 1CS6A 3QG6B 3DROB 4JHWL 4UTBA 3LRSA 1LNUB 4JRXA 2ZX8A 3QCTL 3C08L 1U8MA 4ZQTA 4L3CB 4PJ6A 3DX2A 1M2VA 3P0VL 3SKOB 5HYJE 1P4LB 5K33A 1RAMA 1TO5A 3QPXH 4DQOH 4WF7A 4FC3E 1T4KA 1OGSA 1UXWA 2YAHA 1SHSA 3A6BH 5FFGA 4XCFH 2KUTA 4C4KO 1KLUB 2RGSA 4U6YA 3M7FB 4BFNA 1IBFA 1EDQA 1IAKB 3J8F7 5E5RB 3ZT6A 3GPEA 1NOLA 5JXEA 4F7TB 2OTUB 1HESA 4NO0B 1MY7A 4OLEA 4OFKA 4X80L 5B1BB 1T3FB 1D2OA 5F6HJ 3P73B 2C9QA 5GS1C 1P9MC 2VMDA 1VFAA 4MZRA 2ZT9C 3KPQB 3QJRB 4Q2ZB 4G72B 1OQOA 5J57B 3LD8C 4LBEA 3S5LG 3HZMA 1XCQA 2OMUA 2OR9H 4BEIA 1JF1B 3ASNB 3ATBA 4UT6H 2V5TA 3UADA 3OWRA 3D08A 3FQ2A 3NIDF 3FXIC 3CN1A 2ZOLB 4OZFH 5IQMA 25C8L 3FO2B 2EVJA 3PJLA 4BQCA 4BCXA 4FNUA 4ZS6D 4DTGH 1I4FA 4L8CA 4OV5B 3PWPB 4YUEL 1GRWA 4XMVA 2JKXA 3SDDA 2AJVH 2BCMA 3LNIA 3QRBA 4M1GL 2DJMA 4BKLA 2KZ1B 2WINA 3P3UA 4H2AA 4NO3B 4NWUH 4V2CB 1LO5B 3GTTA 3Q1SH 4I9WE 3GMRB 1E4XL 4J23A 5DS1A 4FDWA 2WXLA 4HF5L 3MC0A 3TJPA 4PJ8B 4LLUA 5A2CA 3T0EA 4PJBF 3VD9A 1I7UA 4WU5A 2G0KA 4N8VG 4M7KH 4UU9A 1KB9K 5HVFB 5I30H 2FEEL 4F2MB 2N59A 4UINL 4TULL 2BVOB 1LEIA 1Q4NX 5HD8C 4CU6A 2XQYA 1F45A 4PJ5A 4OCXH 2ZWSA 4RBPK 5I8OL 3N43F 1C1EH 1DVQA 2WVUA 3BVNA 1NCCH 2NX5E 2GHWB 1MCOH 3LN5B 3GMQA 4Z7IA 1EXGA 3F7RA 5J9PA 2KBGA 5SWSD 2ZUTA 3VSQA 3JVFC 1NGZA 4OF7A 3H42L 3T6ZA 1PY9A 4ZSOE 4A6YA 3VD0A 4YHLH 4JFFA 4XMTA 5JPNC 5KJ4A 4NRXA 4NQDB 3SE9H 1MCEA 1WCBA 4DAGH 1XL4A 4XX5A 2XKSA 1EO5A 2F54E 3SCMA 1JPFB 3ZT7A 3H9HA 1JI1A 2E7HA 1JV5B 2O5NA 3CXFA 3LRLA 2GITB 4E9XA 5LDUA 2YD7A 3V52H 4I48A 5JR1H 3KJ6L 2DICA 2GSMB 3ZKXB 3F12B 4LKCB 2ZKHH 5GZND 3QIBD 2DEYX 2XHNA 5DTFA 2ZWNA 2A9DA 3VH8G 1KTDA 4ZPVA 1JFHA 4OJEH 5C07D 5B8CB 1BIIB 2G60H 1Y6KR 3KPRB 4HFUH 3B7TA 4TL4A 3MV9B 3FQ4A 3WDIA 5DJYA 1COBA 4LCIL 3V9EA 2JCCB 1QLRA 5FW7A 2NY5H 4CW1B 3ME0A 2R2EA 2UY6A 2FYYB 3K8LA 4N90D 5JW4R 2I07A 1RERA 3BD4A 4U6VH 1TVHB 2J5LC 1EZLA 1FCCA 1G1YA 1XV8A 2VAJA 3UBXB 3GSNB 5JIHA 1OAQH 4YPGB 3VFWB 2UZYA 1T1WA 4NC2B 4GLRH 2EE0A 2R9HC 2XWTA 4WI8A 4K9EC 5D1XB 1LE5B 4YL9A 1EHLH 2ZUUA 1HHKB 3N1GC 1UYWH 1F58H 2XIDA 1FLRL 3D39D 3OLIA 3MLRH 5C9JA 3TEWA 1GTNA 1Y7VA 4X9HA 4IGBC 4UQIM 3CDFA 2GHZA 3ZE1F 1YMME 1RUKH 3UJTH 3QDAA 2NXZD 4LOUD 3HZYA 3FMGL 4XVUD 3VG9C 3TBVB 2JB6B 2PW2A 4DF9A 4NKIL 1U4EA 2Y5QA 2YXVA 3LIZH 3R1GH 3PWVB 2VXQH 2X6CA 3MA7A 3P9WB 3ZDXE 3BKCL 4LOEA 1ZHNB 4OLWL 3DOSA 4D9LH 2EDRA 2F7PA 3GO1H 5L2JB 3RX8A 3RUGB 4AH2B 4ZMYA 5L4JA 2MRYA 1KXQE 5E56A 2PWEA 5D4QA 1VB9A 3EFOA 4IOFD 4NZUH 4BA0A 4N9OB 2VR8A 1EIBA 3FT3B 4Z7WA 3KW8A 2DQCL 5DD6B 1H3WM 1A4KA 1AGEA 1FV1A 1GY1A 2D03H 3BH8A 3QEQE 3EF4A 5F72S 4AIEA 3A4EA 2Y7QA 5ITBL 3SQBB 1RLWA 1K4DA 3D7PA 1KEML 2O5YL 2DYRB 1FJ1B 1C16B 5B1AB 1IM9B 3MRLA 1TJGH 5E8NA 3U4AA 2LFGA 2NNFA 4JQIA 4ZO6A 1G0YR 1T0OA 4X6EA 3CN0A 5HJ3A 4GY4A 1H0DB 2MNUA 5E2WL 5JIKA 3SDAC 1AAJA 1TNNA 2AV1B 3CFQA 1T20B 2A4CA 5I19L 2EIZB 1ES0B 3N40F 4CKQA 1WEJL 5KOVC 4F1SA 5ID1A 3HAEB 2EVFA 2NY3C 3MRGB 5J06A 1CG9A 2F53D 1XTMA 3GFUA 5HHPB 4LXFA 1MDTA 1YC8A 4XAKD 2VDOH 3SOBH 5D7IF 2B0SL 4HCRA 3TN0D 3QDMB 2PP7A 3LPPA 4WV1A 4ZFZA 3KPMA 5LGJA 4X8JB 3M1CA 3E80A 3ARTA 2DQEL 3ZO9A 1H9DA 4N0RA 5G4NA 4L1HA 3O8XA 4NQVA 3V5DB 4DN4H 4FMVA 4F3FB 1UB5A 4B3VA 3OG4B 4OB5H 3BYYA 2XN9D 2XXFA 4GSDH 4YDKL 5T33H 2ODHA 1YEJH 4I7ZC 2P52A 4TL5A 3B83A 2WXPA 3RVUD 1SJMA 3NZHH 4QHMA 3CCHA 3NGBC 4LPXA 3WUZA 1PZCA 4HPHA 3FNKA 4LCVA 4NKMB 5AD0A 4P5KA 1HAUA 2VISA 1MW2A 2X4TA 3HW7A 1AP2B 1V27A 1XF5A 4OD3L 4PRHB 5F6HI 2F8XC 1N5AB 4WTWA 3RURA 1N6QH 4OIAA 2DQIL 5INCB 1OXYA 2E46A 2XN1A 1HQ4B 3HFML 3VH8A 4PYGA 2EDLA 3KPSA 1UWGL 4J3OC 3GHEH 3S37L 1IFHL 3V4LA 4EOWH 5JYMA 1U8LA 1K5WA 1E2ZA 5I1LA 5KBPA 4EEEA 5A2KH 4ONHA 4X7SL 5IHUH 3DWTA 4APQD 1QABA 1I9IL 1UH3A 5IMKA 3HEIB 4JCMA 4BHUA 1G9ML 1UB6A 1T4WA 1KG0B 3GXUB 4ABUA 4FQLH 4M56A 4OZHE 4ESKA 4DETA 4U7SA 4J2XA 2IG2H 3KYMB 5EORH 5I5MA 3E2HB 2QDWA 5EOCL 4K7PY 1HHGB 2HRLA 2UUDK 1MZZA 3GSOA 4NN7B 4RA0C 1GGTA 3O3AB 2NW3A 1QLEL 2BCKB 5DUMH 5K1VA 2GFBA 1NICA 3LOWA 4ZNEE 5IQ9B 3VD1A 4ONGH 4ZPTB 5F97E 3T3PB 2BH0A 5CKAA 5CN2A 3X3GH 4KRNA 5KWYC 3UTZB 5FO7A 3GIZL 1HDMB 3FB6B 4Y2NA 3VGFA 3L5WA 1EXHA 5FA3B 4EVNB 5KYYB 4YHKH 1V3KA 1GMIA 5E8EA 4U1JB 4XNQB 1MAKA 2BIPA 4A68A 4MB3A 1UFGA 3AY4A 5CSBA 4K23L 5EBGA 1QSFB 2EYTA 3GT6A 5FWQA 1HJCA 1SLXA 3FAXA 3IFPB 2EYSB 4KDWA 3UBFA 5JXED 1LP9F 4H8WL 3DI2B 4U7KA 5KSAC 1KXTB 3EO1B 3JBG7 5TE7L 2HKHL 5J11B 4ZYKB 5A6IA 2IQAB 4I5BA 2KL6A 2E8ZA 3ILEA 5JQ6H 1SJHB 3KLHC 1QWUA 2LTQC 4MZ2A 1I85C 1E4KA 1QKZH 5IOKA 1P84K 4NN6C 4E9WA 1D5BB 4HHWA 4U1LA 4X6CF 3UGEA 5FHAL 3VTMA 4JPKH 1XR8B 5EN2A 1QFUL 4MA8L 4FL4C 2FJUB 4IOIA 4L9DA 5CIPA 3KPNA 2R23B 3PP4H 4POUB 5C2BH 2MCPH 3W2DH 4YHOH 1MDAA 3FTWA 3ILQC 4N1HB 1WGVA 3F58H 2XN2A 1KBGH 1B4TA 1JSYA 1WGOA 4YBQD 3TH4T 1DCEA 1ASQA 3SDDD 3IWUA 5SWZA 4IBLT 4AW7A 1KENL 5DD5H 4AV0A 4LDLB 2ZCLH 4E5XB 5IZ7A 2H3XC 5IOPA 1BVLB 3T0ED 3WHXA 2WO2B 3IGKA 3RWGB 1V3JA 2ZXWB 1PIGA 2EICA 1T0MA 5C7ZA 3FTYA 2XTJE 4HEMA 4HIEB 3WYRA 4F7KA 5AOIA 4X4KA 2GK0A 3UEQA 5DLMH 4WUUA 1E4WL 4JN2A 3ZK0A 3OMAB 3CPUA 1S7UA 4PJ5D 4WW1B 4YLBA 4ZW8A 5DQ9A 3V6FA 1OLLA 4J4PA 3UYOD 2X70B 5F7FA 4S0TD 1HKFA 1ANUA 3L3JB 6TAAA 3VMPA 4HUNB 3T2LA 1BD2B 2GCYB 3BAEL 3LKRA 3FFCE 2B5IB 3B4NA 3KPLB 4MVBC 1NFDA 4RIRB 1Q1JH 2AQSA 1VFBA 1SLUA 4Y88A 2ZYRA 1NAML 4AL8L 2YSSA 1SEBA 2OW7A 4JFFD 5EZOL 4HXAH 2IWKA 4Q4IA 3OKKA 3SIKA 1ZHKA 4PJEB 4JQVA 4KROC 2HRPL 3VVVA 3HG1A 3IMRA 1AJ7L 4Y2DA 5FV1L 4H20H 1CXFA 2H32B 3SCMD 2VDPH 1E9OA 5LAPA 5CNHA 1EQWA 4P4RA 1YAIA 4YDLB 3KXFD 4DNLA 5DS8B 2A73A 2XZAL 4OLXL 4U0QB 5HHMD 2EDYA 4AQ8A 1FQ9C 3NABH 3F7PC 2YEQA 2WSKA 3V0AC 3LPGA 5DU7A 5ICYA 1OP5K 3JVGC 5E2VL 2IFFL 4AVKA 1TTBA 2VLRA 1A7NH 3A0OA 1GSMA 3EFFB 3CLFL 2OJEB 4ELME 4JFUA 4PREB 1AOZA 3DVFA 1MJ7H 5EC1A 2E9IA 3U6XS 3TA4D 3FN3A 5HYJA 2XSKA 4MB1A 4MJ2A 5CSGA 3MGTA 5BXFB 4N2BA 4JO5A 1CGXA 2PMZA 3QI9C 5E70A 1G6RA 4DVRL 2VUKA 1NINA 3CSFA 3DJSA 1B2WL 4CVUA 1W0WA 2P26A 1DLFH 4ONOA 1LDSA 4P2QB 4F7PB 1IKOP 3DX8B 3P11H 5C7XL 3LKPB 1HZKA 2BERA 1BJ8A 1ETJA 5FKAA 2EEBA 5JHLA 2OL3B 3N91A 3P30H 1DVXA 1NSNL 2CBMA 3AUVA 3MMEA 4WHDA 4X9IA 5T3XH 2Z4QA 4TVPH 4RAHA 1NAKL 4M5YL 2VUOA 3LV3A 1F3RB 4K7FA 4OLVL 4X99B 3C5ZC 3S36H 1S7XB 1U4FA 2Y1AA 4IK7A 4KC3B 4NN5B 4PGZA 2LW3A 1INQA 1I1AC 1J5HA 1JGLL 4FNLL 3C60A 1DQJB 4R90L 5LCVH 3U4BL 1QRND 1E8ZA 4BFFA 2V37A 4YK4B 5GRUL 3A24A 3B3BA 1TVDA 3GUFA 5FECA 1Z3RA 3F3HA 1UQSA 4X6BB 1T04B 1GPOH 5C07B 2VXSH 3G6JE 3RJQB 4DUVA 3WGUB 9CGTA 4XI5D 1JYVA 2A6KB 3GSUA 2WVVB 1I1RA 1ZHLB 4L8DA 2HRGA 5K9QG 1LK2A 2FWOA 5CSZB 3Q3GA 5DJ8B 1WWAX 5EO1B 3TPUA 4JO1H 3UJJL 1HQRB 4RQQB 3MFGB 3O9WC 1D3CA 3M8OL 3WIFA 4LLVB 2A9BA 4XXWA 1PYWB 4ZUSB 2HJKB 2D7NA 3LZRA 5E7BA 1JDDA 4XNYL 3RAJL 1SXCA 2NY6C 3P4NB 5FUCC 4DVBB 5IQOA 2Z31A 5KG9B 2O30A 1VA9A 3ZHNA 4FABH 4XN9A 3OR6B 4FYRA 3ZQWA 2NX5A 1MNUL 3VI3B 2V2WA 4FRWA 4PW9A 1MJUH 1WISA 3UTQA 4R7XA 1BX2B 2VJXA 3O2WH 4JM2B 3TBSB 4PIBA 5DVPA 4DERA 4LAJH 4Q58C 5AKRA 1JPSH 2XCMC 5DEJA 3DRTB 3UMTA 1ZA6B 4CC0A 4Y5YA 4ZSOA 2BPBA 2VDNH 1ODUA 4XWOD 2JI3A 1N64L 3QHZH 3W0WB 1QFOA 4FKHA 4AGOA 1EVTC 1XIWC 2OR7A 4PBXA 5LDSA 3RX7A 1BZ9A 3D07A 3SGJC 5ACMA 2F5BL 2RHEA 3GTNA 4FFWC 3SPIA 3O8XD 3WMQA 2F54A 2AV7A 2Y36L 2P24A 4P2OC 1EXUB 3MLYH 1G7QA 3SB3A 2H2SC 1MWAB 2EACA 3K6IA 5EOTB 4OGQC 2PR9A 3K46A 1I7RA 3KYAA 3OKLB 4QD2E 4XNXL 5GISH 3RWJA 3WDHA 1RUMH 2EXWC 5D96C 2WWMD 4K3JH 1NCJA 5IVXB 1HXYB 3DX7A 3UZQB 5I1GH 4M1DH 1PZUB 4GP4B 3L3DA 1DDHA 5T1MB 5FYJH 2ZD0A 2Q86A 1NEZG 3E8UH 1F86A 3T08A 3U0WH 4J3VA 2JKWA 2Z0UA 3IF1A 1YHPA 1J5OH 1OP3K 3VD3A 4ZMAT 5EHFA 1WH0A 3UP1A 2WHVA 3KPSD 1S7SB 5IFAH 4MAYA 2DQHH 2ICEB 3LH9A 1A6UL 2JJVA 1RVFH 2ZE0A 1P6FA 2YPVH 5JDSA 3ZQ9A 1K3IA 1D5XB 1P5VA 3UTSE 3M6DA 4AZ8A 2QQQA 2L3BA 5FYLH 5JZ7D 1CXEA 2E56A 4J8RB 1ZLEA 4BK5C 2HLFD 1LWJA 2ZG2A 2BOCB 1JZ7A 2VL5A 4L1TA 2Z8VC 3VXOA 2PTTA 2ZX6A 1DUYB 4S10A 2V8MA 1M7IB 1OEZW 2XTSA 2JIXD 3DX0A 3VFRB 3IJEA 5EUKB 3HHSB 2YD2A 2AZAA 4OGYL 2FHBA 4R26L 4ALAL 5IMMA 4DJMA 1KEGH 3QNZA 2Z7YA 3MUGB 5F9OL 4EZKA 3CVIH 1YMMA 4BQ6A 4H1LG 3FN9A 4Y4HA 5DD3H 3QJSB 1RZIA 2WBJA 1KIUA 2XETA 4QRUA 3CX5J 2DLGA 2XN9B 1CFNA 3I6GA 1AR1D 1KBVA 5EZLA 5E2TH 1OHQA 2XACC 3RWFB 4HS8L 2MNJB 3C6SA 4Z7OB 2B3IA 2WGNB 2C9AA 5DFWH 3HB3D 4FXGA 1FE8L 1KXQA 2ADFL 2VZOA 3CK0H 3MRIB 3FT2B 1FZMA 4HHGA 3FB5B 4FQXC 5DWPA 5AW1B 4YXKL 3L1EA 1R33A 4PPTA 4Y4FC 1N8ZA 1S5HA 5ILTH 1I3GL 1VCAA 2ROYA 3DX6B 3FU0A 1KN2H 3KEDA 3QEQA 1EHXA 4B0MB 3EH3B 3E3QE 3E9TA 4EKJA 4JJ5B 4L3EE 1AO7B 3QIUB 4APQB 1YEEL 7TAAA 4BSWA 1ILUA 2FWSA 1FO0B 3T4YA 4Y9EA 4P5TA 1JPTH 2QGDA 3N2JA 1YMHB 3WSQH 1G7PA 4NQCE 3CFBB 3ZRSA 4ZFOL 3DUUB 5MEQB 1MCSA 2AMGA 1RJYB 4WHYH 1D2PA 1AIFB 4N0YL 4M8QB 4O2FA 1VCBC 3HI1B 5D93B 1HKLH 2K7QA 1XCTA 5EOCJ 5HHQA 5B4MD 2VABA 3QPQC 3RNKA 2GC7C 3REWA 4Y1AE 4M7JL 5TE4L 4IKIA 4PJCF 2ETWA 2XYBA 3RHWK 2TAAA 4KZEH 3LKQB 3EJZD 4M1CC 1E4XI 5JOFA 2WLHA 4PJGF 5IFHL 1JYNA 3F6IA 3CQFA 3PY9A 1LEGA 5IMLB 5JIDA 3S3JA 3BFOA 4I88A 1Q72L 4M43L 5DJ2B 3OHMB 4ICXA 3L3OB 3ZE0E 2AJZA 3ALPA 1L9OA 5BZDA 1I8UA 4J4PD 1ZLVK 2CKNA 1Z3GH 2FEEI 4LIQH 1UZ8A 2G4GA 2JKTM 1IC5L 3D0VA 1TJMA 4FHJA 3RA7L 1G4MA 4F24A 3D4ZA 4FEIA 3NJJA 2BY1A 3V0JA 3AS1A 3HS0A 1L9NA 2H2PD 1IE5A 2L7UA 3QAQA 3WCYA 5IWLC 4OIIH 3KDMA 4P46B 2AQNA 4FI6A 1UT2A 5FUOH 3HG1D 4WHTA 4Y2DD 1BXUA 1SHMA 3I50H 5JORB 5HDBB 4BFIA 2Q3AA 3ETTA 5GGUB 3UGUA 1NWOA 1IGJA 4H26A 3C2AH 1Q0YL 3MOAH 4OZHA 3RVVC 4BZ2L 3QUMA 3ZDYB 3WY1A 1ZGLM 5E6IA 1JHLH 1NEUA 4HZLA 4HDIA 3DURB 3B9KB 3MUUA 2VLRD 3AVEA 4Y2OA 5J3HC 2E6QA 4EZJA 3G04A 4OSUH 1AC6A 5F7NC 1LDPH 5DSCB 2GTWB 4WSJA 4ZNEA 3O2DA 4UIKH 4MMXC 3DOIA 2MHAB 4IJ3B 1KUMA 1O6VA 2BIMA 3MJ8B 4AQEB 4X6DF 5HYJD 2AFNA 1MCWW 4GKLA 2W0KA 1OANA 1FG9C 2E7LA 3BT2L 3QIWB 3T6XA 1PVHA 4ZUWA 4XNMB 3NIDE 3L4WA 1SXNA 2DI8A 3WE6B 2ENQA 1XSOA 1UFUA 3DTXA 4FLHA 3C09B 4AVIA 5GRYA 4YX2L 3O6KH 4HU2A 3QQDB 3NK3A 1JD7A 4XPBH 4MQSB 3CHQA 1P53A 5HDQH 2DL9A 4WO4B 4GW1B 3UTOA 1I8KA 1NZRA 2ZOTA 4FI8A 4PJBE 4GI9A 1WC7B 1BEYL 3F00A 1A4CA 2VB5A 1RUQH 1JDCA 1AHMA 1MQKL 4KDTC 2FJHB 1T6BX 1X5ZA 4JKPL 3MREB 4MNQE 5GGRY 2LU4A 4A63A 3EIFA 1Q9KB 3NTCL 2ESVB 4GQRA 5CLYA 5JHAA 2FZ3A 1AACA 3ECWA 3KXFB 5F6IC 1T22B 2ZKXA 1BQRA 5FGCE 4R7DA 3UPAA 3DVGA 4KKPA 2GUOB 1H6EA 2JJSA 1MFEH 1IQWL 4NKOB 3HPLA 4OM1H 1VADB 4XNUH 2I9TB 5KVDH 4KKLD 2AS5M 1QRKA 1NDTA 1MRCL 4G1MA 5T5FL 3BGFB 3DHPA 5I0XA 1M05A 1TZIA 3MDJA 4FTVB 4GRWB 4IHOB 2A6IA 4NRZB 2OMBA 3BUDA 4OAWB 1SYVB 1ZANL 1U3ZA 3I6KB 1CGUA 4RESB 5GS3A 1KB5A 4ONFL 3BP6B 5HDRA 3V0VB 5B3JF 1SFDA 1SVBA 5JIIA 3WNJA 4IRSA 4HWBH 5CINH 4NSKA 4O9HH 5E8DL 5F7UA 1H8LA 4GXVH 1JNHA 4FI7A 3P0YH 2Z31D 4PW4A 3IDNA 3VXME 5D5MF 3WFHA 3AXLA 5ISZE 3T0BA 1IFRA 5C0AB 3FFCA 3U30C 3B3IB 3TV3H 3L3GB 3BYTA 2JTDA 5KVGL 5DQDH 1A3LH 4RMWA 3PHSA 4KO6A 4JRYE 4PJAB 1AQ8A 3OX8B 3MU3A 1JZEA 3W56A 4G80B 3VFSB 2Q6WB 4QRAA 1DEEA 1D5RA 3KD4A 3GRGA 5EEUA 3C5SB 2F54D 4EDXB 3FCTB 3S5LB 3F2LA 5ESVA 2A6JB 4ZX5A 1EBAA 2W88A 3Q5YA 3ULVH 5HJBA 4KXCA 5ANMB 1JXDA 1EUUA 4ATWA 1QBAA 1R5VA 5LNDA 3AB0B 5D2NB 4JZNB 4YWGL 2YO3A 4JFDB 1INDL 1RIVH 3D85A 1ZPUA 3CC5A 3MV01 1UWXK 4YDVA 5DJZA 2N3JA 3ZE1E 3RIFK 4HMEA 4ZFFB 2QV2A 2CD0A 2YAFA 3KWWB 4ELMA 3NRPA 5KSVA 5IG7B 1F56A 1ILSA 2OXHB 4PTUB 4PJXE 2EDXA 1UWEL 1HJBC 3AS2A 4P3CL 4HAKA 1RZKL 1NCTA 4JB9L 3ARFC 5KYWA 4FXKB 4N8VB 5F1NB 3BE1L 4U33A 2APVA 5EG6C 4WU7B 7FABL 3ARBC 4XRCA 2JXMA 4JDVB 4ZAKC 4G71B 3V0DA 4UQ9A 2BSRA 2CUAA 4AM0B 2CK2A 1R19A 5AKSA 4DP6X 3WTXA 4RCAA 1DSFL 2ENSA 4N6RA 5JW4N 3QYCA 1OOWA 2RFXA 3EGXB 3ZXAC 1UD5A 3LZFL 5FV2A 1R5IA 3V4UL 3H4FA 2BWDA 1YMMD 4CMMA 5L6YH 5A16A 1LWRA 3LSOB 4Y4HD 1RUPL 4PJ7B 2YZ1A 3T5WA 2WBJD 4Y16C 3PAZA 1Y1DA 4KXAA 4GFTB 2XG5A 2DQDH 2PR4H 3P4MB 3PWLB 2BMKA 3PWJB 2BFGA 2O6CA 3L5JA 2NY0D 4FLRA 3ILPA 3N9GH 1BZ7B 3FC8A 5F7HA 2BP3A 4LEOA 5MERB 3AQDA 3FO1A 3ZL2A 1J0YA 3N04A 3FPYA 3HC0B 1SJVA 3VX1A 1AZVA 3VSVA 3G6JA 3PIQA 5LNGA 5MEOA 4OV6F 2KHAA 3QJVB 4NKDA 1MCBA 1ZT4A 2PYEB 2AEPL 4LSRH 1HL8A 3QEQD 4RETB 3K2MC 4NXKA 5EBWB 5AZUA 4ZK8A 3TOPA 2GEQA 2Y5TB 5F3HB 1T2QH 4JFWA 3CHRA 5TQ0H 2GI0A 1S7VA 3B2VH 4LSPL 4XP5H 1PX8A 4M6OL 4WK2B 3VFUA 2R4RH 4FYQA 4JGNA 3AM8A 4K3EL 5C0FA 1EEZB 2X40A 3ULVC 4JREC 1AZNA 3OQRA 2GIYA 1BYNA 1D9KC 4M4RB 2VMEA 3GSRB 1I7TB 5ABZA 1MREH 4JQIL 1SBBA 3TO4B 4GKSB 1SXBA 4IKNA 3UAJC 5DURD 3BPNB 3SJVE 3C5JB 1G1OA 3NMEA 4G8IA 3FT4A 3CLEH 5BS0E 3QVAA 3HN3A 1BYPA 5AL8A 4JLRA 4G5AA 5I24A 2ZG1A 4YBHA 2NZ1A 2OMXA 5TJWK 3H3PL 1XH0A 3ECVA 4R0LA 3GSQB 1AR1B 5GJTL 5L2KB 3FUNA 2DWDA 3SKMA 1J48A 1TETH 2Z7ZA 3JZYA 1DE4B 2IH8A 3SY0B 1K4CB 2I60L 2Y6TE 4WLCA 3EADA 5CCJA 3NCCB 1S46A 4OGAD 1KNOA 4B6ZA 4P23D 1CWVA 3S48A 3HNTH 3DV6A 1XWVA 3KLDA 5FXCH 2WBWB 43CAB 4YJZL 4M62L 3TXAA 2Z65C 1V7MH 1IBHA 2H8PB 2IF7A 3V6ZA 4ZTOH 2VN5A 3OKMB 5CR1A 5IB5A 5DHYA 2XXGA 4WNQB 2WWNA 3WHE1 4LDEB 1N2RB 3TZVA 3ULVF 5EZPA 2YD4A 1A4JB 1FL3A 8CGTA 3OBAA 1JFQH 4L4TD 4BUGA 4K3GA 1OAYH 4ZTPH 3UTSA 1LP9E 1RPQA 1X4ZA 3ML9A 2IADA 3QCUL 2X4SB 2HFGH 3DMMB 1CR9H 1SY6A 1TEGA 3BHBA 4L4VB 1CICC 5E6ID 5TF0A 4ABVA 5E24E 1QEWA 2Q7YA 1K72A 1ACYH 1UKQA 1L7IH 2Z1KA 4LNRB 1AYRA 1YNTF 4FQHA 4P5RA 3BKMH 2RH0A 1LQBC 2Z35B 4J6RL 4MBOA 5CWSB 5L9DL 1U8KB 2VR9A 5FGSA 1BAFH 5JHBA 5D7SL 3T9WA 2E74C 3QYMA 1B4RA 1KBPA 4X6CE 4YPJA 4PBDA 1WSST 1DVFB 3GKZA 3TGXA 3VFOA 4W9EC 1FZJA 1M57B 1R3IH 4LSUL 32C2B 4LK4A 2AJUH 4DPAX 3DTDA 5IV2B 1GIGH 5EU7E 5CGYD 1H8SA 2VQ1B 3B1TA 5EWIH 3MNWB 3WLBB 4F2FA 5GS0H 5DRNB 3QUXC 1U8QB 2WY3B 2P9RA 2CJSA 4F27A 4JFEE 1DBMH 4LPYA 4QRFA 3V4PB 1Z32X 2A99A 3WGVB 4XPGL 5EN3A 4BK8A 1G94A 1TEYA 1SQMA 1TQSA 2QPUA 3QORA 2EXTA 3DVIA 4L8SA 1XSKA 1PQZA 3OJDB 2BP0A 2A83B 3QA3B 1XGPB 1K6QL 3B5GA 4QLRA 5DT1L 1BQLL 3T8XB 3BI9X 4L3EA 3TVMC 1WZ1H 1PG7L 2WWKT 5FYJU 5F21B 2X1PA 3KBFA 5F7YC 3UL4A 2Q7AA 2QBWA 4NQCA 1DVYA 4KGLA 4B9GA 2RAMA 3DSNA 1YY9C 1J8RA 4WEBL 2ADIB 4LHUA 1CURA 1THAA 1FH2A 1JD9A 3CPLA 2R1WA 4UIMA 2QSQA 5DD1H 4NZJA 4YNYA 3PPEA 3ES6A 2WTPA 2FHCA 1KTLB 5MI0C 2MMXA 4Y1AA 4KPHL 1MCCA 3GEFA 1ZIBA 3MJGX 4WKXA 5CZVL 4AYBA 1A14H 2XTJD 3D2UA 1J9CT 2NSXA 2PCPB 1OGAE 3C8KA 1A22B 1KIRB 3D3VB 3HR6A 1X5LA 3EOAA 4MKTA 5FW8A 3ARGA 4UOQA 2XPGA 3U2SB 1L7TH 1AZUA 2EJ1A 4MWFB 1BVZA 3I9GH 5DLLA 1WPCA 3QRFM 4OUUA 1VFUA 3TF4A 2CGZA 1C5BH 2KLTA 2ZNWA 3JYBA 4KZCA 3RL1A 2W0LA 3WEAA 4HLEA 2XZCH 3AREB 1I3RB 3FFCD 3S3PA 4HIHA 4MJIE 2QFPA 2YN3A 2F0CA 3CZJA 5SWQA 4CGTA 5I5IA 1KULA 3CXDH 3V6OC 2NR6A 3ZHLA 2GG1A 2CA3A 3QXAA 3L3HA 5BNXD 3FN0L 3TBYA 3JT0A 1CLZL 3K6DA 1P2CA 3TYGH 1T5WA 3O11A 5CD3A 4QT5B 4MS8D 2ZXQA 5BMFH 3OR7B 5JPMA 4HD9A 5AB2A 3Q01A 5IHHA 3Q2VA 2YQ3A 4L9LB 4EI5D 3L4TA 1KPRA 3JWNH 4LKXA 2DYPA 2JQMA 2R4SH 3EFDL 2X6AA 4ZBJA 5IROC 3IFOA 1SJEB 5B1KA 3CN4A 4NEHB 2BY3A 4I87A 3K6SA 3MCYA 3O0RL 4YSSA 2BVPA 4W4OA 1J9RA 1HI6B 2EQDA 2BSEA 4KXZI 3VSUA 3U36A 5A43C 1PZSA 3JV4A 3OLDA 4XMLL 4AEIL 1AD9B 1OARL 1MIEL 5EULV 5H4YA 4K5OA 5IB3B 3E6HA 2W9DH 1JZIA 1ZT7A 3OTTA 4JFZL 2AF2A 4E41E 1GGIH 2YQBA 4FQIL 2H41A 2EXYD 3FH5A 2VH5L 3O81A 1E9PB 1G6RL 1E67A 1NBQA 3G5ZA 3OAZK 3P1VA 2Z92A 3LN4B 3MOBL 2WWKO 5ETUA 3UABA 2ICES 3LCYA 1AGFA 2YIHA 4OZFG 1E6OH 4PJBA 1H3PL 3TIDA 1DFBL 2FUQA 2ZX9A 4YDNA 2DQTL 1U92A 4RX4D 3O6LL 3ABGA 2NY7H 2X4PB 5FA4A 1IAOA 4MNQA 4WUKH 1JNJA 4PGEB 3ARZA 4H8PA 4ZDHA 2A7BA 2VQUA 1MVYA 1ND0B 1CLYL 3P3YA 3N42F 1CXLA 3ZTNL 1U8OB 1XZ0B 1QA9A 3WTTA 1H6TA 1P9MA 5F1IB 4JGMA 4XP9L 3NIGB 3O3EB 4NJAH 2RQEA 4G6KH 4JPIA 1T6WA 4HPYH 4N0UE 1FFQA 4CADB 1CI3M 4N2DA 4LDCA 1BVKA 4UILL 5C6WH 5FO8B 2R2HA 1E9QA 2R69H 3IGLA 4UQ2B 3D34A 4HVBA 3LHPL 5F9WB 2MQGA 1MRFH 4DO6A 5E9AA 1CC3A 4XT1C 2H0EA 3VWJA 4QXTB 1L6ZA 3QSKB 3VXNB 4DFHA 1T1XA 3ZL1A 2P49B 4D8PB 1IMHC 4WI3A 3BAIA 3C6EA 1LE9A 1RIHH 2XIBA 3MRRB 4U6TA 4Q14A 5ESQB 1WA1X 1NUGA 3IU4L 1A1NB 2XBTA 5JNYB 4I3SL 3VXMA 3FRUA 5DC4B 4HSCX 1JZ2A 2YR3A 3MJWA 3KBHE 1DTUA 4GP8B 5KJRL 5J13B 1XGYH 1L0XA 4Q6YA 4NJ9L 2ZOKA 3G5XB 5F7EH 3X14B 3MJ7B 2BM3A 4JRYA 4N8PA 3QHFH 2Q20A 2GABA 4KTEL 4ODHH 4YGAB 1QHPA 2Q7NA 1KLGB 3MO1A 3BEVB 3EJCA 3JXAA 4KGJA 3VGDA 2L4OA 2NY0B 2E47A 1MVUB 1AIZA 3BZFB 4Q4EA 3O6FC 4GUPA 4RWYH 2FRGP 3GSNH 4F8TA 1O0VA 4FQPA 3SDYL 3U0PA 2Z93B 3PF2A 1CGSH 4HBCH 5JPNA 1EJFA 2AXWA 4I18C 5F7BA 3LH8A 3CZGA 3PLYA 5FB8A 4ELKB 3COOA 4DH2A 3FOLB 3WUWG 3ZTJG 4EF3A 2O61B 3AG4B 2A1WL 1RJZB 4YSQA 3ESMA 1X44A 5DMKB 1YDPB 1A9BB 4OI8A 4P2RB 1BPLB 1CD8A 3TZVD 2X4QA 5F9AC 5CLTA 1KIPA 4QKTA 5FKPA 3SQRA 5L0QB 4JL1A 1MW3A 2VL4A 1KY6A 4DP7X 4I1NB 5TQ2L 4TUJB 5AB1A 1YRKA 3ELQA 5KZCB 4QKXB 2G3NA 5T3XE 5FS5A 1AE6L 3N55A 4LNVA 1J05B 4BDVB 1D7CA 3WS6A 4TVPE 3EKCA 5DD0L 2Y3NA 2EH8H 2QLVB 3PDDA 5CJQH 5JUEH 2ARJA 3QB7C 2F68X 4Q9QH 5C08E 2DQJH 1GOHA 1MUJB 2RALA 4U1HA 1A5FH 4UT6A 4IIQA 5GGRA 3BCDA 3MYJB 1A9EA 3OXSB 4OZFA 3JV5A 1QFWI 2FDBP 3B7RL 4OCSL 3EO9L 4JO2L 3BP5B 2C8NA 2WIMA 4TNVF 1YECH 3BZDA 1C7TA 3L9BA 3W39A 4P07A 4QYOA 1HOCA 4URTB 3MRMA 3LH2L 5FHBL 1LO0H 3T65A 2BSDA 4E9LA 4XCNB 4P23B 4N3TA 4XZUB 2OK0H 3TT3H 1JK8A 3IKCB 1C7SA 4K8RH 3S4SB 4P5MA 1U58A 2F8VA 5I66A 3HAEH 4GAFB 1J9TA 3QORD 3IDIB 8FABA 1EO8H 3DSFL 4JHVA 4PJCE 5I1IH 2AVGA 3UPRA 3V79C 3KCPB 5I0DA 4NUMA 4NP4H 4X9BA 3V5KA 4HKBB 2B4CL 4YBLB 1XX9C 5BJTB 1NEZB 4PJGE 1M4KA 3HCVA 3RGVA 4AV4A 4F9LA 1AH1A 4L3ED 2Y06H 2XWEA 4U6HA 3TNMB 2XQBH 4DK3A 1QO3B 4L4TB 1I9EA 2R51A 4F8OA 2ZP9A 4KJYA 4LVOB 2IBZY 4KKBD 4PGCB 1N70A 5KTEH 3IBOA 3MLWL 1CK0H 3CUPA 3TJHC 1N67A 1MH5B 4LHUD 3S36X 3V0WL 4XCCL 1A2YA 4IMLB 2BVQA 2WTRA 3FH7A 4LPTA 3PFUA 4PG9A 4OF6A 3HUJB 2B20A 1V55B 5BQ7A 3BO8B 3D2TA 4BH7A 2FX7L 3BWSA 3SEPA 5GGVH 3ROOB 3VCLA 3Q2WA 3SJVA 1FNGB 4ORGB 4M6NL 5AG9A 5BS0A 1SXZA 5JOPE 4KUCD 3D2UD 3G5YB 4TVSa 3BPLB 1ZTXH 4XAWL 4H1LB 2CPCA 3QUGA 4KUZL 4S1SL 4GW5A 5HYQA 3KHOA 3ARGD 5I1HH 4KOBA 3P2TA 3TM6A 1VERA 5F1SA 4PRPE 1CF1A 1TJIL 2M83A 2QADC 4W9ZA 5TGBB 4MMZB 1MN4A 4CDHA 5MENB 2PETA 4LQFH 4RGOL 4G6MH 2XNAB 5SX5K 4DIXA 1CYWA 4XP6H 3Q8CA 1JGEB 3H85A 5DK2A 5EC2B 4TQIA 4Z77A 5IESL 2WLLB 4FQQB 1YYCA 1G9MC 1QSVA 2JCCF 3DUSB 1FZKB 4X6DE 2YC1B 3K81A 5E2UH 1U8CA 2NR6D 2G2NA 4O5LL 4FZ8L 3WUWA 5IIEB 1FSKC 2BNUA 1MFUA 1CN4A 2F2HA 3QJTB 2APBA 4U1NA 4IK6A 4DPBX 4M48L 2FGWH 5FYLE 4E9QA 1J11A 1DN0B 5E1QA 3CZFB 1ZVSA 4YS4A 4MSWA 4RRPM 3KVQA 2AQPA 4JFPA 1MEXL 1UXSB 1MIML 3IXAB 4GO8A 4PLOB 5FEBA 1MHPL 2IDTA 1DR9A 5EU5B 4Z8FH 1XF2A 1LP9A 3ZYZA 1TOXA 2ATKA 3PV7A 2FWLB 4I1RA 1CFTB 1UD8A 1MCLA 1ZHBA 2DYPD 3DHUA 3FHAA 4FFVD 2O4EA 4K8RC 5D72H 2DIJA 3RP1A 1BBJA 3BIAX 1JF6A 3ZKSD 1H3TA 4TRPH 4TQEH 4O02L 3ZTEA 3VWKB 1BYOA 2ADGA 1ZSHA 3MRQB 3P9MA 2RA1A 1ZE3H 3D18A 3KE0A 3LIZA 4X6CA 2A77H 4DGUA 4JVUA 2BSED 2LVEA 3SYCA 4H8WC 2FQDA 5CEXB 3V0GA 2J12B 4OKVB 3O2DL 3RUGF 1BMGA 1UHVA 3CBRA 3PGFH 4PMFA 4QO1A 2WIIB 3H0TA 5KYNA 4HJTA 4YR6B 4IBVA 2AXHA 3EJSA 4NENB 4JFEA 1L4IA 3FTGB 2PTUA 4XXDA 1L6XA 1E5BA 1NLBH 1UD3A 3EYQC 3BVTA 2GY7B 1UH2A 3JWOL 4NIKB 5F3FA 4IU3B 4EXKA 4WWID 3CHOA 3NACH 3MRCB 4G6FD 3AXIA 1QLFA 4QHLA 4XPAH 2EIBA 5B3JE 4N3UA 3UTPE 2R83A 3WO4C 3F6LA 3POCA 2ITDB 3Q5TA 1RCYA 3ZKND 1RUAH 1AANA 5D9SB 2CBTA 5KSAA 3EGDB 3KPTA 1QYGL 2H1PL 2DS4A 5DRWB 5D5ME 2KH2B 4ERSL 2DWEA 4HWEL 2TRHA 2ODIA 2ZOUA 1MPAL 4BFOA 2YD6A 4EI5B 3AXHA 3I02B 3E2HC 1T7XA 4ZOCA 1I85A 1VFMA 1PEZA 3AT0A 3THMH 3RVTC 3DIFB 3P9LB 5DEGA 1NCNA 5PAZA 3P54A 5KBDA 1EANA 1PLBA 2QQNL 5EA0L 3ZL4H 4Z7NB 4RGMB 2HVJA 4H8HA 4UOZA 2R1YA 3MODL 5H37H 1U3HD 1KJ2B 3VJ6B 5ITFB 1LM8V 4NO2A 1EVUA 3VWJD 1KYOK 4MD0A 4GUOA 2H32H 4X7FC 1OGAA 4LIQE 5FWRA 3ZUCA 5F88A 1P1ZA 4IDJH 4Q9BA 2YXMA 2A9AA 1KB5L 4P9HL 1MCRA 1QTPA 4S1RL 4FJ6A 4Y19E 3VXMD 3AG2B 3MRJB 4EI0A 3CWGA 1ZY9A 1IC7H 5IW1A 3RTQC 2O72A 5ISZD 4MQXD 1KCSH 4PTTB 5E51A 5J11C 4NPYA 5CJXA 2L7EA 3CZUB 5C0CE 1PKQB 2YGNA 4MJIA 4K15A 1A47A 4MDJB 1NDGB 3HNVH 4JVWA 4DGIL 3RZCB 1AKPA 2VRAA 1ZE3C 4JRYD 4MASA 3WEXB 3K2UL 1X6LA 4IRJA 3FUIA 5GSRA 3T2PA 4UDTA 4KKCD 3IS0X 2IQ9L 3KAAA 3HVDA 3OKOA 2B59B 1OF0A 1I9RL 1MHEA 4GQ9L 5HHXH 3NFSH 3IU3B 2AP2A 4FG6D 3BN3B 1WITA 1JVOA 4ANKA 5BV7L 1MFBL 3VGAB 1TCRA 3MFFA 4HS3B 1EERB 1V54B 1R4XA 3T3PF 2AQ1A 4UBDD 1JBJA 3EJTA 5IJCC 1IKNA 1U42A 2OL3H 4RFEB 3CBKB 2OMTA 1F4YH 3OKEB 3OB0H 4QXUL 4A38A 3MAWA 4K7PL 2WXGA 4FFYH 3VXRB 5C0GA 4KRMB 4OLYL 1QFPA 4ATTA 1WP6A 4UT7H 3EYFB 4G70B 4F37F 5FC9A 1WBYA 3WXWL 4HSAC 1Q0XL 5HVWA 5HHOE 5KVFE 1OCCB 5SX4H 3UROR 1UVQB 3NAAL 1DUZB 5F7KC 4XCYB 4X8GA 1AVAA 3RZWA 5GIRB 2IMMA 1ZA3A 4N5ED 2GBTA 4LSSL 4F5CE 2QT6A 5FAAA 5E2JA 1F11A 4PJDB 4E41A 1KF9B 4MXWH 5IW6A 3MCLL 3BDYH 2I25N 2B5IC 3TCLB 3WJMB 3UAEA 5G5DB 3MRNB 4LGSB 1DANT 1KPUA 1P7KA 1USQA 4HIPA 2NTFB 2ZUVA 4PM1A 2ZCZA 4R96B 3BISA 1O6SB 4M9PA 1ZSDB 3RL2B 5C8JB 4JY4B 5AVUB 2VZUA 3QUHA 3MXWL 5KVDE 2O93L 4ZS6C 1TQUA 1WTGT 3AAZB 1WFUA 3FQXA 3MRFB 3IETA 1E90A 3LDBC 4XPFH 4Y0GA 4YDIL 3D9AL 4HQQL 2YXWA 3BXNB 4Z23A 4N0UA 1IGFH 3C5ZA 3P40A 5I0ZA 1OSPH 4AVJA 4ODTL 4N2FA 4D0DA 1I1AA 3UYPA 3BCFA 1AGCB 4NZTH 4TTDD 2ROXA 2A9NH 2PCFA 2EDWA 3DI3B 1QFWM 1IBGH 3CFKA 5A2LH 3RGVD 3O4OC 5AVYB 4UAOB 5CJ8A 5HI5D 5IM7B 3VXQA 1JYWA 4TTGA 3FUEA 3N6YA 1MWAH 3NOIA 3NSFA 1R3LA 1A3RH 3BH9B 3QEHB 3P77B 1T1ZA 5CU5A 4XBGB 5DMIH 3BUBA 1Y18A 2P3YA 2R56L 1IEBA 4KK9C 1E30A 2IFGA 1J1XH 3SKNA 1UJTA 4TSAL 1EAPA 1CFQB 3RWHB 4TOYH 2F74A 2ZXEB 4PJEF 1G7HA 1OW0A 1XH3A 2X6UA 3QZWA 4XTRD 5F96L 2RBLA 4C57C 1FA4A 3SJVD 2H6PA 1G0XA 1KC5L 2OP4L 5BS0D 4MD4B 1YPZE 3RB5A 4UV7H 3A4FA 4MHHI 1D5ZA 3FUMA 3OB8A 4KH2A 1AG0A 4NN5C 4HFWB 3LX9A 4NUGH 3REVA 1HHJA 1KGIA 1MHCA 2N7SA 1N7MH 1TJHL 3UBHA 4Z7UE 3PDOA 5JA8B 1F42A 1IGYA 1KCRL 3ERXA 5IBTL 1IL1A 2J43A 2HMID 3HE6D 4YK4C 5T3ZE 3LMJL 5GZNC 1YVLA 2AJYH 1QATA 1M53A 1PTZA 4M3HA 1FVEB 5AVSB 4BKSC 1YQVL 3MACL 1XIWA 3G6DL 5CUSH 5JW3L 1KCVL 1SDYA 3M07A 3OHXB 4OFDA 4Z0XA 3SGJA 4YSDA 3GZOA 5FM5O 4JX0A 3BWAA 3FFOA 5JLZB 1U0QA 5AZ2L 1ZOXA 2GTQA 1HEZB 3HZ3A 2XT1B 2ZUQC 4PV9A 1S9WA 4D0CA 2Y1YA 1W0VA 1IGML 3HZVB 2CDFB 1NL0H 3GUTB 2ED8A 2Y7SA 3MLSL 4MNGB 4ZOEA 3U7YL 3MBEB 5EBMA 3F7YA 5FCUH 3HG2A 3RFZB 1OM3L 4QRQB 3A67L 1UM6L 3AUWB 1YUKB 1JOIA 1WE5A 2AABL 3NPSB 5FUZL 1NBYA 1LO4L 2VAAB 4DN3L 5GHWH 3DECA 1GSKA 5GRJL 1E6JL 5AW9B 1E5UI 4ISVA 4M6AA 1NJ9B 5BRZB 4F8QA 3MBWA 1BZEA 1SY6L 3PGCB 4G8GB 1NC4B 2NXZC 1F0LA 5C08A 4LOUC 4N24A 4XVUC 4PRDA 3X13A 1GGBH 2R2BB 5E99L 5BZWB 3OPZH 5LCVA 1SN5A 4HGWB 1FO0H 4BK5A 4XNZB 1JZFA 4NAQA 4XVOA 2Z91B 5IHWA 1Z0MA 4ZTEA 3FO0H 1MW0A 3TA3B 3CDGB 1DZBA 5EEZA 3KYNB 4JFED 2QTEA 1HSAA 4K4KA 4XVTH 1MFAH 4IOFC 1MLBA 4MCYA 3OKNA 3DJRA 5DHVB 4EIGB 5BVPL 3TEYA 1PDKA 3EHBD 4F58L 1MQ8A 2A74B 4DFIA 1CE6A 5FFLA 5EEWA 1JZDC 4Y8DC 5DUPL 4AMKL 4PJCA 1S78C 5IHBA 4HOMA 2FX8H 1M7DA 4WHYG 3VDBA 3ZYJA 4D8OA 4PJGA 1A64A 4MA1B 2FWUA 3CZNA 5KSAD 4WJ5A 1ETB1 2C7UA 4MJ6B 1KBWA 3VI3F 5AALA 3QHTC 1Z9LA 2XG4B 3HLAB 1MAJA 3UZVA 1MFVA 4YL4A 4FQXA 4G1EA 5D55A 4TN9A 5J1AB 3I84A 5BOZG 4CSSA 1HCZA 1IEAA 2EC8A 3IRPX 4ZMZA 5TE6H 4E9VA 1UADC 3P3RA 2B2XL 3ATFA 3HC4L 3TT1H 3IE9A 1ZVNA 4HX1A 4PJHF 1CFSA 1K8DA 4KNSA 5E9DB 4BH8B 3D33A 1IGTA 1OT4A 3PHQB 4PS7A 1MCKA 1XEDA 4QNPF 3EGSA 4F9PC 1IAII 3OLEA 1RZFH 3TN0C 2DDQH 1MCJA 1NCDL 1NKOA 1SMDA 4BM7A 2Z34A 4W9CC 3VFMA 3BP7B 3VXUD 1OGAD 2BVTA 3FYIB 2X4UA 1MWOA 1NIEA 1P5UA 3FRPG 3M17B 1V3MA 1J5IA 5IVXF 3V7MA 4PRPA 5ICXA 3RVUC 3S2CA 4L2YA 1KT2A 4R4BA 2ORBH 2WUCL 5DJ0A 2AHIA 5EU3A 1RK1B 2K9FB 4PRIE 4L8BB 1DL7H 3EYUL 3JV6A 4MJID 5GPRA 5IVZB 3PREA 4PWHA 1R1CA 2BJML 4LRIC 3D5OF 2FT6A 3P3SA 4X6DA 5LHDA 4IBSA 4IRJD 3V5HB 1FVDA 4HP5A 1WBZB 2YPVA 3K1KC 3UO1H 2VRKA 2W9LA 1RZ7L 3GSWA 2C1PB 2ZUWA 3GMPA 1T0NB 1FGVL 3H6AA 4APQC 5I71B 4CN1A 3KLKA 4LARL 2VXTL 5H35B 2X0WA 3ATDA 4ZNCD 5LWYH 1J5CA 4MGXA 1PNDA 3NP4A 4FYTA 5AW2B 1M1XA 1SF3A 3IN0A 3UJIH 5CEZL 1NMCC 3HRZA 4M5ZH 3ATEA 5D93C 3C6LB 1X5IA 2EKSB 5CBEA 3SDXE 1WLHA 2DJUA 3BLBA 1KPVB 2OW6A 1U3HB 2W8CA 1O7VA 4KVNH 2H6UA 5LKNA 5J6SA 1HS6A 1ZXKA 2DLEA 5T1KB 3T09A 1E4HA 4Z7OF 1KXVA 3U9PH 5J12B 4PUBL 3V9FA 2ICCA 1L9MA 4OF8A 4HWZB 4X5QA 5K69A 1OWRM 4D3CH 3L3OC 3TJEH 5BO1H 3GSXB 4RMQA 4GSUA 3UG4A 3W82A 4JANB 4E41D 2KDYA 1CF8H 2JI2A 3KR3L 5DUJA 4Z5RA 2CIIB 4P2CG 1XZWA 4AQ1B 4RMVA 5E4OA 4AYFB 3SYPA 3D0LB 1ZEAH 3QEUB 4L8CB 4GRWH 2CSPA 2OLDA 4OF0A 1CT8A 3EOBB 5IQLA 1XGTB 1A7RH 4BKLB 5DRXB 4DP0X 3WAKA 2IGFL 3VFTB 2B1OA 1GGCH 2K9UA 2V7NB 4DGYL 3QEGL 3HNSL 2VDQB 2VDLB 1MFDH 1OWWA 5AYUL 2NUTB 1VPOH 5AUMA 3EUDA 1HAWA 4HV8B 1FYHB 3ZE2B 5B38G 1FH5L 1R3HA 1AZZC 4YBQC 5D5MA 1MAML 2Q2EB 3E6FB 2Q87A 1HHHA 3DGCR 3SDDC 3F7QA 3IJHB 5I23A 1JXGA 5FX3A 4I2XB 1BJMA 5IB2A 4KDTA 3KWTA 4YSUA 3C5ZD 4F80A 1YEDA 3EYOB 3T0EC 5ABDE 4ZZFA 1QVOA 6FABH 1I1AD 5MP6L 3MCG1 4ZFQA 3MGOB 2C4FT 2PW1A 4PJXB 4UTAH 4O2CB 4PU2A 5G4MA 1X5FA 3DPBA 4KITB 3QO1B 4KQ3H 2HX7A 3D8MA 3S34H 1M6OB 1EJOH 2AJXL 1Q1PA 3F8UB 2HG5A 3L16A 1NGWA 2WJ5A 4BUHA 5C6TH 5IEKB 4R2GD 4U6XA 2IDQA 4UZSA 2PCXA 3ZGHA 3B43A 4YE4H 5EF1A 2HH0L 1D6EA 4Y19A 5F9JA 1X5JA 2HWZL 3GJFK 1EJ8A 3EH2A 5IVNA 3S3CB 4UZGA 5AG8A 3Q9QA 1WO2A 2ARJQ 5C0CA 2JI1A 5ACZB 2D7TH 4LLAA 1L9QA 3GM8A 1FI8C 3TIEB 5HDBF 4EE2A 2NY6D 2GVYA 2EO7A 3CHSA 3PWNA 4KHXL 4YZWA 3RPIB 4ZPVB 1NM9A 3SCMC 1A7PH 4MNHB 3EOTH 5E0FA 1C5CL 1L0YA 1TFPA 4M4PA 1B3JA 4LRNL 3U83A 3ZDYF 1GHFL 2AQQA 5KBLA 3ZYIA 3JWNE 2P1YA 3HA0A 2ZXCA 4PGDB 1JV2A 3MLPA 1HWWA 1P7QA 4XN8A 4OD1H 3SDCA 4FD0A 4PB9H 3SE8H 3WXVH 5D7HA 2DI7A 4ODXB 1DLHA 2H26A 2OJZH 5AOZA 1RZKC 3P02A 3H3BC 4AKPA 3BGFC 1LXMA 1J1OH 2WYIA 4HC1H 4HCRH 2SEBB 3NK4A 4K9JA 1VHPA 3TTSA 5EBLA 4GAGH 1ZIAA 2H2SD 4NOFA 3TYFA 4OJDH 3Q8BA 3QJFA 5F7DB 4DQOL 3AACA 4PS8A 1V10A 3PWPE 2CH8A 3A6BL 3L9RB 4NZRH 4XNDA 1U9KA 3D87B 3GKWH 1G9HA 4PEEA 5DMJB 4MZ3A 5CP7B 3EO0B 3ESVF 1MELA 3FB8A 4F5CA 2OMNA 2VWEE 1QG3A 5LJYH 3FQWA 2XWRA 1NGPH 3DARA 1A1OB 2OV0A 4APXA 4E36A 1F3JB 4RAUB 4JCLA 4F2ME 3ARFA 4UQ3B 3BSZH 4IU2B 4MA3A 5C08D 1F1GA 4H44C 4X4YA 3II1A 3ARBA 3HG5A 3Q13A 3QXVA 1MCPH 3F85A 1OTTD 1FL6A 3Q43A 5GRZA 3WIIH 1A4KB 1QOKA 4FP8H 2OR9L 1T80A 5CHNA 5CZXD 3HE6B 1U8JA 4UT6L 3WL9A 1CO1A 1G43A 3IXTB 2C1OA 2WQAA 4WW2B 3CFDB 4U1MB 4X4XA 2J56A 4DTGL 4K9EL 5D2NC 1FFOA 4GRWF 4NQDE 5B38A 1FNEA 1Y0LB 2AJVL 4PRNA 1MCNA 2CO6A 4X7TB 4E9RA 4NWUL 4Y16A 4CMHB 1U2CA 2E5EA 4KO7A 1Z9OA 1BAWA 3PL6B 1ORQB 3Q1SL 4RNRA 3T6QC 3LQZA 5A2FA 1WIPA 4HWBA 3E9UA 2J2ZB 2J88H 1U91B 4PAZA 4TVUA 2GQHA 4HG4K 2CRZA 4UMGA 1UGKA 4M7KL 5I30L 9PCYA 4OJFH 4FXKC 4ZXBB 1S6NA 2ZTBA 3O45B 4FQXD 4Q97A 1RP9A 2A0LD 2HJLB 4WWKB 2WNWA 1C1EL 2EO9A 3IJYB 1HILB 1MCOL 3KPRE 5GGVY 1AGDA 3WENA 3MV9E 5K5YA 1S7TA 3RWIA 1JGDA 1OCRB 4PJAF 2JCCE 4WFHE 4K3DH 1IILE 3FAWA 4ZQKB 2ICWA 4YHIB 4XWOC 3U1SH 4YHLL 4F7EB 2ADJB 3INOA 4Y5VA 3G3LA 2BZDA 3NSYA 5GQBA 4DKFH 4ZFGL 5JOPD 5JW4M 2HXAA 3SE9L 4J3UA 4H88H 2IH1B 2HZHA 3O8XC 4DAGL 4OCYH 3EJPA 5JQIB 5HY9B 3ZRFC 5D1XE 1U3NA 2CUHA 4Z7UA 1SDDA 1U93A 4NCC2 4PRPD 2OQJB 4M8RA 2VKXA 2WWMC 4GJTB 3V52L 5JR1L 2WC7A 5IJVB 3MX0B 3STBA 2ZKHL 1YNTA 4AGMA 4FQJH 4WDIA 2K6ZA 4QGTA 3R4DA 1IAIM 4L1SA 2GIXA 5EO9B 3QUYB 3PHOA 3SPVB 2WOBA 3PXHA 4HH9A 2FSEB 1QBMH 3CDZA 4N2NA 1D7FA 2G60L 2VXUL 3F7VA 4OU3A 3RILA 5JHDB 1XF4B 4HFUL 1K8IA 1RJLA 2PWFA 3RUGE 1T0PB 2XV0A 1FL5B 5K9JH 3SO3B 4DZBA 1YAZA 2BSBA 3BQUB 2NY5L 1QWHA 2P8PB 4HK0B 4D94A 2NY4B 5DJ6B 2AW2A 3CV5A 2NUPB 4WSKA 5JZ7C 3TBCA 4U6VL 5B39G 5EO0B 5I18L 4J5VA 1NGYA 2HLFC 4YIQB 1OAQL 1S9YB 2OMWB 4L3FA 4OD2B 3SPCA 1N59A 3T0XA 3M1BB 3V4PH 4U7MA 4FQ1H 3RDTA 1EHLL 3ATAA 4DKEL 2ILLA 1UYWL 4GO9A 5HJDA 2CIKB 4PJ7F 4U1SB 3MLRL 1SN2A 2IBGA 3B7UX 3BUYA 4F1ZA 4ZMLA 3VACA 4E0RA 4G43A 3KNBA 3UC0H 3VDAA 4HS6A 1RUKL 3UJTL 3BEWA 3DNKA 3VXUB 1BZ8A 1T83A 3G08A 1UXMA 2R0KH 5E6YA 5AFAA 1AR1C 1A1MA 3DC0A 3R1GL 3LIZL 4G8FA 5DDHB 3PDGA 1UZ6F 2VXQL 4NQEA 1FFNB 2C5DC 4X5XB 1P7BA 2APXA 2M2DA 3DJ9A 2IDUA 4D9LL 3H7LA 3GO1L 2NXYB 3RWCB 4C83A 2IJ0C 1JUFB 4KY2A 2CMRH 1CCZA 3GYRA 1IZJA 2WLKA 3QDME 1IQDB 2CHZA 3U48A 2ZXDA 1E4KC 4NZUL 5DVOA 3F7KA 5C2UB 2Y1VA 5F8RC 3N1QC 3V0FA 4NLHA 5CJBA 3MNZB 3FL7A 2X2YA 2D03L 2E3VA 3LZOA 4M03A 3U6XA 3UTPD 4NDMA 1FNFA 4K94H 4ECNA 4ZO8A 4G9FA 1T0MB 3O3DB 1AZBA 1J7VR 1Q9WB 4PRHE 2CKBL 5JHLH 1XH1A 2B77A 1NIBA 3AABA 2X4OA 2JFCA 3JQOB 5J6HB 5DJCB 3VRJA 2YPLB 4FA7B 5DQ9B 3X11A 3PNRB 1ZTXE 3C08H 4LLMA 5ESAB 1H15A 4R5XA 3EJZC 4TYUA 2YK1H 2VDOL 1B9KA 1DVFC 4XP1H 5IB1A 3SOBL 1YNKH 2ZSWA 5AWNH 1X5XA 1FAIH 4JKWA 3FT9A 4MMYA 4UNUA 5IB4B 3WN5B 4DN4L 1QR1A 1A8ZA 3FUFA 3VD4A 1E5YA 4OB5L 5I16B 1BG9A 4GSDL 5T33L 3T3PE 1ROWA 4IBWA 3IGAB 1C8QA 1SM3H 3BSHA 3QQNA 5DJAB 1E9OB 4HUVB 1TSRA 3MUY1 4KH9A 4WK4B 2KLRA 2W60B 3TX4A 4PRIA 4F8PA 3NZHL 1ORSB 1ASOA 2IH3B 2JSFA 2H2PC 4HALA 5C0CD 1FN4A 1HNGA 2Y69B 3VX0A 5F1OB 4XCEB 2CG9X 4LHQB 2AJSH 1QQDA 1JWUB 4JQVC 4Q8BA 1N6QL 4KVCH 3QWOA 1FFTB 1UACL 4PRBA 4Y2DC 3K7UA 4N1EA 4TNVK 5HDLA 1QSFE 3VAEA 2QVMA 3T4AB 2NRDA 3GHEL 1NKRA 1G7JA 4EOWL 3DV4A 3KLAA 1FC2D 2EYRB 5IHUL 5K9OB 2O6PA 4IEFB 4AQ8C 3RBSA 4QTHB 2E4FA 3HE7D 4UDUB 3SDCD 2XBDA 4FQLL 1TTAA 2LAGB 4DZ8B 4I8DA 2IG2L 5EORL 2WB7A 2FIRT 2LLLA 5LUMA 5D7EA 2FE0A 5DUML 2AANA 1DJXA 4L37A 4MRCA 3SDXA 2IDCA 3W9EA 4ONGL 1X5GA 3X3GL 2CM5A 3BVDB 3D09A 4ZUUA 3GJEA 5I8EB 3FQTB 2RR3A 2VRQA 2IOOA 1N18A 3WIAA 4KZDH 2WXJA 5ADOH 5HHOD 2Y7LA 4FMFA 4P2AA 4QOKB 4K94C 2NMSA 4R2GB 4YHKL 5FOJA 2QHRL 1NFDF 5CGTA 2OSLB 2GJ6B 4LF3B 3U2IA 1QP1A 3QUZB 3CVDA 2GAZB 3MRPA 1BLIA 2G9HB 1VGEH 4YDJB 5HGBB 4H0LC 1U8HA 3NZ8A 4HXBH 4QHNA 5I1EH 1EMTH 5ABAA 1IBBA 4J3BA 1H5BB 1A6ZB 2GUYA 5D6CB 1BREA 1O7DE 1V05A 5FECB 1I8IA 2WNGA 1DFXA 3IGFA 3ARDB 3ZTCC 5TF1H 1GZHA 2G2RB 5JQ6L 1RK0A 2EZ0D 3CHXA 5K9KA 2BIOA 3AS0A 1QKZL 3UMNA 3ARBD 1VACB 4IM8A 5DJXA 4YXHH 4Y5XB 2JTYA 3U0TA 4JPKL 2JK5B 3KMDA 1BD2E 2UYLA 2XZZA 4TNWF 2H5UA 2G3ZA 3UOAB 2XLLA 3WTUA 3PP4L 3CH1B 5C2BL 2MCPL 4YHOL 1OGTA 2Q3ZA 3F58L 1KBGL 4KKLC 3GK8H 4L9LC 5KANG 3V95A 3DRQA 2QDVA 4BZ1H 2P5PA 3K91A 4YFLI 3WFEH 4PJEE 3K74B 1AQDA 1LMKA 3EG9A 1NLDH 4K71B 1TO4A 4Y16D 5DD5L 3P2DA 4OCRH 5BCAA 4XO9A 2ZCLL 2H9GB 3QWQB 2C7FA 4BELD 1YYLH 3AY2A 5F3BA 3CFUA 3QQ4B 4MJ5B 1M71B 3CX5K 1NCHA 5TH2B 3MLTB 4FA6A 4DK6A 4F7CA 4ODWB 5C0DB 4R3SB 3RWEB 2E9BA 3UTTB 4MA7H 1XR9A 4HMDA 4UM9D 5DLML 3QZLA 3FHQA 3V0IA 1S7RA 4YHYC 2WP3O 3DROA 3QG6A 1OO2A 2Q8AL 3EDJA 2C3VB 3KL5A 1LNUA 5AL0A 4HETA 4YDMA 5C6PB 3KYKH 4L3CA 1ETZB 2HT4D 3SKOA 1M6UA 2LOEA 4L1LA 1P4LA 3I85A 5BRPA 4Y5YC 2P28B 1DVSA 5A6LA 1Q1JL 1VEOA 3DX7B 1WAPA 4HXAL 4OLZH 1TZHB 4JAMB 1KLUA 4DEPC 3K0WA 1RPKA 3OLGA 4TXVB 2VQ4A 3FPXA 1WIOA 3BIKB 4P2QE 1IAKA 3HHRB 4F7TA 4H20L 2OTUA 1KGXA 3QISA 4NO0A 2VDPL 1NEPA 2DB8A 4PQXA 3PE9A 3SBPA 3PPSA 2ZUSA 1T3FA 5T3ZD 4HUXB 2CUMA 2WLNA 2HTLD 3P73A 5LBGA 1W72B 3TPKA 1JZ3A 3NABL 3VM5A 1TKWB 3KPQA 5EDSA 4Q2ZA 1GA2A 4KAQH 1FBIH 1A7NL 2QL1A 4TF4A 3UZEC 2I5YH 2VL5B 1JF1A 3ASOB 1AMXA 1J86A 1EFQA 1MJ7L 2ZF9A 3WJLC 5ITBH 4NRYB 3RG1C 4Z7VB 3UACA 2ZOLA 4B7LA 3IJEB 4QHUB 4X0KB 1T5XB 3E38A 3FO2A 1PGRB 3IDXH 4R97B 1UA6H 4QR7A 4UNVA 1UURA 3RPBA 3S35H 3PWPA 2VMCA 4OV5A 4LE8A 1QHOA 3ZN6A 3TEZA 3IMTA 3QW9A 4PY8J 5C07E 4BYHA 4NO3A 1LO5A 4JQXA 1J0IA 3GMRA 1SDAB 4PJ8A 1DLFL 1KLFB 3P11L 2J72A 1PBYA 3RDTD 1M7XA 3PGDB 4DOHB 4CN4A 2OMZB 5T1LB 3P30L 4F2MA 1EEQA 5CCKH 2BVOA 5T3XL 2FH6A 4Y4HC 1QW8A 1AZCA 2OYKA 1EAQA 2WBJC 3QR1A 4TVPL 3UDWC 1BV8A 3OM3B 3IJ8A 3LEYH 3BMWA 4JPVL 3S36L 2IWFA 3VI3E 2E86A 3LN5A 2X2IA 4P57B 2UV3A 2VDML 2NY0C 4G8EB 3NCJH 5D6DA 4B9JA 2ZICA 3K8MA 3NIGF 3QUMH 1G7MB 5DO2D 4ADGA 4UYQA 5FDWA 3NJVA 5LCVL 2VW7A 3FCSB 2WQ8A 4DPCX 1CMOA 3QYNA 4HCFA 2L04A 5I5RA 5E6SB 2XVKA 4FF9A 4LZKA 2R69A 3W0WE 3QAZB 2EDMA 4NQDA 1TLKA 4PWJA 1BMWA 4QHKJ 1GPOL 4S1QH 2VXSL 4NZ8A 4U05A 3WKMH 4QNPE 5HGGS 3L5XH 4MS6A 3B34A 1JPFA 2JLPA 2WPGA 3HFMH 1L9PA 4AYSA 1JV5A 2V5YA 3KDPB 2GITA 1BZOA 1G9NH 3ESOA 4H1LH 2YZ8A 4JO1L 4CBPA 2JMRA 3ZZ1A 3F12A 4LKCA 3NEEA 5DMGD 5IVXE 2VCOA 1IUZA 5L0QC 1TU2A 4HBQA 3TEUA 2FIKB 5AVVB 4ODSH 3BKYH 1UOLA 5MEPB 2V17H 2HPOA 5B8CA 3GS0A 1BIIA 3DO7B 2Y6SC 1MJUL 1R0AL 2LQRA 3KPRA 5CM1A 3DTUB 4X6FB 1EZVY 1N3NB 3MV9A 3O2WL 4D9RE 2XKNB 1SQ2N 2FUTA 3TWCH 5K93A 4ABQA 2JCCA 2XWCA 1JPSL 1ZRUA 4JRLA 4UZUA 3H7BB 4CW1A 1VEMA 4J12A 3D0VB 4AC2A 2VDNL 1T03H 2FYYA 2H4EA 1QPPA 5DYOB 1TVHA 3QHZL 4M61B 2ERJC 3UBXA 3GSNA 3AJ7A 4YPGA 2UXVA 3NPZB 1N26A 2Y72A 3I9AA 4C56B 4WZ9A 2A4EA 1KB9J 1FDLH 1L9TA 5D1XA 4XNBA 2VERA 5EDXA 1HHKA 1LE5A 3GHPA 3MLYL 3II2A 1OSEA 4N0CC 2DM7A 5EB9A 4TUUA 3IAPA 4KNTA 4OGAC 4NNXB 4LVHC 4P23C 5GISL 2HKHH 3VFPB 1RUML 5HHNB 4N2EA 2QR0B 4PRID 3HR5B 3QFJB 3HS0C 5F1KC 5E08H 1TQCC 4O02B 3TBVA 1DBJH 2WXHA 2JB6A 5I1GL 4M1DL 3ZTDC 4AIOA 2XN9E 2AQRA 4NAJA 4J2QA 3PWVA 5FYJL 3E8UL 2Y9RT 1JCKA 3U0WL 4YBLC 2K8QA 2JKRM 1J5OL 1ZHNA 5J56B 3ZIMA 4Z7OE 5L2JA 2BNRD 5IFAL 4XN4A 3B6SB 2DQHL 3RUGA 4AH2A 1WICA 2VZ3A 4QY8B 4LO9A 3MLUH 1RVFL 4WKZB 5E6IC 2HKFH 3N85H 1W0YT 1XGRB 3FT3A 5FYLL 4CU7A 3D52A 5DD6A 3CFMA 2CHWA 5JA9A 5ICUA 4J1UB 1C12B 1FLTX 2GC4C 1VZIA 3DO3A 3IDYB 4BJLA 5CO1A 4KI5C 1AO7E 2YMTA 3GC3A 3SQBA 1O9WA 4GEJA 4F7MB 1UJ3B 5J6GB 1KEGL 1FJ1A 1C16A 4S11A 1SZNA 1IM9A 2OCCB 2QSVA 3GS4A 1SEQH 4A66A 1WRFA 3CVIL 3PS6A 3OAYH 1VZGA 4PWEA 5DD3L 4JM4H 2VM9A 4A37A 5GS0D 3K71B 1E3XA 1H0DA 4GS7C 5FO2A 4E5XG 5CGYC 4ES8A 1XGQB 2AV1A 4M6MH 1T20A 2DOCA 5DFVD 4KKQA 2EIZA 1ES0A 4G42B 2R0ZH 3W3BA 4CA4A 3FRPB 3HAEA 5E2TL 5I8CB 3MRGA 4LCUB 2XFXB 3Q6GH 4B7IA 5HHPA 2YD9A 3D48R 2MH4A 3AROA 3QDMA 3CK0L 4PN6A 3L17A 2C9RA 3BAYA 4X8JA 2NY2B 4R4FH 4EUPG 1KIQB 3V5DA 3WELA 4U3HA 1B2YA 4F3FA 1KJ2H 5ILTL 5F0MB 2CLVB 3G6AB 4GMSH 1KN2L 3FU3A 3GINA 4AQAB 2X2HA 3QZNA 4N8UA 2XV3A 2VT0A 4C58B 4QRSB 2BHUA 3GBNH 3HE7B 2JJSC 2XZAH 1C8PA 4NKMA 1JPTL 1GGYA 4Q6KA 4KI5F 5H37G 2DQFB 1AP2A 3HUJF 4PRHA 3VSTA 3O41B 1FVCB 1N5AA 5F7LB 5INCA 1HQ4A 3WIHL 5GRWA 1VFOA 3CLFH 5E5MB 1HKLL 2VMJA 4L0ZA 1ZTMA 3OWEA 2JKSA 5HDBE 4X5WB 3SOTA 1PZ5B 2BIQA 4P9HC 2XTJC 2BRRL 4ORZC 4YN3A 1KG0A 5CU9A 3KBPA 1OLZA 3FF8A 4KZEL 1IE4A 5IJBC 1JERA 3KYMA 1K2DB 3ZDYE 2CR0A 1KN4H 2PO6D 4HT1H 4XB8A 4H25B 1HHGA 2OCFD 5LN4A 3ZJAA 3L4VA 1U8PB 3GD1C 3MA9H 3O3AA 2BCKA 4WWOA 2IAMD 1MY5A 3BAXA 5IQ9A 4ZPTA 1HEHC 2PWDA 1Z3GL 3ISRA 2FO8A 3EDEA 4LIQL 4OTXH 3UTZA 2IVFC 1EWHA 1HDMA 5EH1A 3FB6A 3FCGA 2Z6FA 1W80A 5FA3A 2HPTA 2WKOF 4JG5A 4N2MA 4EVNA 5KYYA 3I9PA 4U1JA 5I17B 4XNQA 4IKJA 3D85B 3CU7A 3FQRB 1NWPA 3C5XA 1B3IA 4OIIL 4ODVH 2APSA 5ENWB 1QSFA 3GMOB 3IFPA 2EYSA 4HZ1A 4RDQF 1DJZA 4MS8C 1KXTA 1INEH 3EO1A 3I50L 4G7VH 4NO0D 5IREA 5AW6B 4ZYKA 2IQAA 4Z7AA 3F6JA 1EZVX 4GAYB 3C2AL 4GXFA 5KSBB 4EI5C 4LQ1A 3MOAL 2MKWA 1GJUA 1SJHA 2P5WB 4XO3A 3BKJH 1IT9L 4V1DE 1DBAH 1D5BA 1JHLL 1MCFA 2YXFA 4NHCH 4AEEA 4Z3GA 4B96A 1RZQA 3ZOAA 3P69A 4G7QB 5BOJA 1AXSB 2BXYA 4QHKI 1FPTH 1XHHA 1XR8A 4Z78B 5D7JB 4BWTA 2ESVE 4A7SA 4OSUL 3CU1A 1LDPL 4LU5L 3KXFE 4XHQA 4JUTA 1P0SE 4UIKL 5E6UB 2R23A 4Q74A 4KHTH 4KTYA 5DK0B 2YUXA 3M8OH 5F89B 5HHVL 1BGXH 2DMGA 4UM9B 1VJSA 3GNMH 3X3FH 4IQHA 2COVD 3P4OB 3IMVA 1OAUH 4JE4B 5MHSE 2GT9B 4WWNA 2WSDA 3QQ9D 4E5XA 2EXYC 3CMGA 4FTVE 3O6KL 4MDRA 4GRWE 1BVLA 4PH8A 4PJ8D 2YQ2A 3RWGA 4F15C 1KCUH 2LT9A 4JY5H 4XPBL 2FLBT 3HKFA 2AI0H 2Y25A 3AWEA 4Y4KB 4Z3EA 5C9KA 1ACZA 3PP3K 4AGNA 4G3YH 3T77B 3ECUA 4JFQB 1VZHA 5JYLA 1CZ8H 2DMCA 4M7LT 1AY1H 1YPZB 2X6MA 3QDHA 1K3ZA 1RUQL 2R59A 4WW1A 1BECA 1DQTA 3PIQB 1GXEA 2OFQA 1XBDA 2X70A 1EDHA 1O5PA 4HJUA 3WFBH 3L3JA 1WA0X 1JNNH 1BD2A 1CLCA 5LQBH 3A23A 1YEGH 2DRUA 2GCYA 5C0AE 3KPLA 3KWUA 4XNXH 4RIRA 3IDUA 2A38A 4JFYB 3N0AA 3QT2A 3V4VB 3TU6A 5TPWH 3EOYG 3VGAC 1MFEL 4OR1A 3ZPDA 4OM1L 4Z7NF 1FNSH 4XNUL 2VITB 2ID5A 5KVDL 3LY6A 3QC6X 5H37A 4PJEA 1B0GB 1W2KT 1TT6A 2H32A 3NJGA 4B9PA 2BS9A 3AQXA 4TSCH 2YKLH 4MX7B 1CU4H 4ZX6A 1F02I 5CFAA 1YJDH 5ANME 2EEDA 3VQ1C 1B9ZA 2WBKA 5D2NE 3SKJH 4NBXB 3H54A 4HWBL 5CINL 4YSTA 5DJDB 5I0YA 4O9HL 4JFDE 4BSVB 4LGPB 4HULB 4MBRA 3FBQA 3MLVH 3CFEB 4GXVL 3C9NB 3P0YL 3EFFA 4JN1H 4GAJH 2OJEA 3QULB 4PREA 1HH6B 5HI3D 1QD0A 3EH5B 4DW2H 3MV9D 4OGYH 2ZYHA 2I69A 1AKJB 4QRPD 4WFHD 2VTFA 5BXFA 3TV3L 1E5AA 5F9OH 1X4YA 3NA9H 3BGAA 1A3LL 4HHAB 3IEAA 1QNIA 4N2CA 4KNQA 3KYOB 3VXPB 2OYMA 2IPTH 3W1ZA 3FTSA 1AYOA 4R0LC 4UF7C 2ZKYA 3C75A 1FFPB 1HIMH 4X42A 4P2QA 4F7PA 3DX8A 3LKPA 1MG3C 3ZT5A 5D1XD 4HS8H 1OTUD 2LAAA 1WA2X 3ECBB 2BS8A 2VC2L 2W81C 2OL3A 1HNYA 2G5BB 1HE7A 3ULVL 4BQBA 2ADFH 4FFYA 3L4CA 4DK5A 4KQ4H 5I8KH 1HINH 2NNRA 4PJ7E 3CLWA 4RZKA 4X99A 1RIVL 4PW3A 1RI8A 1S7XA 12E8H 2D3VA 2MQ0A 3NIFB 1ID2A 3BHBB 5I2IB 4FULA 3U25A 4BXSV 1I1YB 1OAKH 4MD5B 1DQJA 1PX4A 1S8DB 4R83A 2F8OA 5GZNA 1I8MB 2IPUG 2ZWLT 4JO3L 4Y9BA 4J8QA 3RGHA 2CRIA 4NHUB 4PJDF 4X6BA 1T04A 3LS4H 5D1QB 5C07A 3RX9A 1NCAH 3TCXA 1FP5A 4L2LA 2A6KA 2WVVA 4UQEA 1ZHLA 4GOSA 2P47B 4B9CA 3L95B 1JTTA 5DHVH 2PYEE 4X8XA 1QZNA 5CSZA 3X12B 3DK2A 5EO1A 4W9IC 1HQRA 4RQQA 2AVFA 4LFHD 2CZNA 1HSBB 4LLVA 1IM9D 2CHXA 1PYWA 4ZUSA 2HJKA 4JFOB 4LCCB 5L6YL 1M7UA 3P4NA 4DVBA 5KG9A 4NFCA 1YJDC 3OR6A 3RLSA 4JY6B 2G30A 3VI3A 4EQ3A 4ZI8A 2DQDL 2PR4L 1BX2A 3IGUA 2CXGA 3IE4A 4AJVA 1JNLH 3N9GL 5DFTA 3DRTA 1ZA6A 2NYYD 2NQCA 4ZUVB 1GYWA 3ZR6A 4CN6A 2JV6A 3W0WA 1LGVA 4HIJB 3QDMD 3RPKA 3T1WA 4L8SC 4TLTA 1EEUA 1CDBA 5L2KE 4BIKA 4FJZA 4BFEA 1EXUA 1DBKL 2BNRB 1MWAA 4LSRL 5EOTA 2IAAC 3OKLA 3S5ZA 2N0MA 2W0FB 1T2QL 3N1FC 1BXVA 3B2VL 4KKBC 5TQ0L 5J5EA 1T21B 3CSYB 5IVXA 4E42B 1HXYA 2VMFA 1GYVA 3UZQA 3WKPA 4GUQA 2QGBA 3MLXH 4YO0B 4BZ2H 5IQNA 2DIEA 2N56A 5T1MA 5E8OB 2E59A 3CN3A 4HCGA 5B39B 2AXGB 4ZW5A 2JB5H 1KJ3H 4FNPA 4MDIB 1TTFA 1MREL 2XQYK 1S7SA 2ICEA 3OJVC 5T1JA 2OI9C 3W11C 4LLDB 4N2IA 4OCLC 2APWA 2COQA 2VDRH 2V0AA 2WSPA 3EBIA 3CLEL 3IMBA 2QJDA 1D5XA 5D2LB 1AI1L 2KI6A 4L4VE 3RI5F 3ARGC 1JHTB 4J8RA 1YG9A 2BOCA 4Q6IB 4XNZC 1E2WA 1I1FB 1DUYA 4TMPA 1TETL 3NCYS 1M7IA 2WZPA 3A6CH 3D25B 3TH2T 3M86A 4FLQA 3VFRA 5EUKA 2X89A 3HHSA 5IKCB 2DY2A 4JRFA 2VERN 4IOSA 3MUGA 4F9PA 2XOTA 2FLMA 4XMPH 3Q6FB 1BEYH 2D3JA 2MOQA 4X9FA 2WXQA 5CGMA 2CNZA 1GW6A 4P4KB 2AGJH 1DO5A 1E5CA 3KJ4C 3S7GA 2YOAA 1V7ML 2NR6C 4PLNC 2XN9A 4ZTOL 4TSBH 2NPLX 3RWFA 3CXHK 5CMAB 1QSFD 4RFNC 1KJMB 3W9DB 1BF2A 2VUYA 3CTTA 4LLWB 2D0GA 4CILA 5DCCA 3FQ1A 1U41A 5JPMC 1L0PA 3MRIA 5EIIB 3FT2A 4AC4A 1KJVB 2BDNH 3FB5A 1JFQL 3WTYA 1HCYA 1OTSC 1OAYL 4ZTPL 5C0IB 1TMQA 4LRIA 1S4IA 4CDGC 2HFGL 1CR9L 2N4IA 4FFVC 1USZA 1IVLA 1EPFA 3DX6A 4KUCF 5T5FH 4ANWA 2HVKB 2AKRB 4WI4A 1ACYL 1L7IL 4JJ5A 5L4MA 4APQA 1AO7A