4LOVA

Crystal structure of fimh in complex with heptylmannoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate binding protein
molecule keywords Protein FimH
publication title Study of the Structural and Dynamic Effects in the FimH Adhesin upon alpha-d-Heptyl Mannose Binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4lovA00
4J3OF 1N0LB 5F3FA 3JWNH 4XO9A 4CA4A 3BFQG 5FS5A 1QUNB 2UY7B 1UWFA 4LOVA 5IQMA 1KIUB 4AV0A 4J3OH 3RFZA 3ME0B 4X50A 3JWNE 4AVJA 4AVHA 5JQIB 5LNEA 4XOAA 4BUQA 5IQOA 4X5QA 5CGBA 2JMRA 4AVKA 1ZE3H 5LNGA 5FX3A 4AUYA 2WMPB 3SQBB 4X5PA 3ZL2A 3BWUF 2XG5B 1N12A 4XOEA 2W07B 5AB1A 3BFWA 4CSSA 3ZL1A 2JTYA 2J2ZB 2UY6B 4X5RA 1PDKB 3JWNG 4AUUA 5AAPA 4XOBA 5AALA 5IQNA 5F2FA 4AVIA 4AUJA 4AV5A 5FLUA 2VCOA 1TR7A 5ABZA 2XG4B 1KLFB 5FWRA 4ATTA 4J3OG 3ZPDA 4CSTA 4AV4A 4XO8A 4XODA 3MCYA 4XOCA
chains in the Genus database with same CATH superfamily
1LEKA 2OMTA 4A2EA 3VXUA 4OB5H 4P4KC 3MHZA 5EF3A 1U8KB 3FOMB 4MDIA 5DMKB 4LF3A 2MCG1 2O6CA 4MWFB 4OF5A 4LSUH 5IGXH 4O9HL 2GTWB 3DGGB 4ATWA 3D0AA 3KYOB 4GQPH 3SKOB 4PS4L 4XP9L 2BIMA 4A39A 2MNUA 2CDGA 2O6FA 4LSTL 3O6KL 4F57L 1MCSA 2VIRB 4QCIA 1AP2B 4UTBA 1AHMA 2XV0A 4DP6X 3WEOA 4YFLF 4IRSA 4X8JB 2WXNA 3B37A 2E6PA 2XWXA 4OGZA 3K3QA 5D1XA 5D71L 5IMKB 1AXTL 3OKNB 4CSZA 4FLRA 1MQKL 4Q2ZB 3FCUB 4R7DA 2FWSA 3BW9B 3KEDA 5EZOH 3IGUA 4FX5A 1W9XA 4OQTL 1HXKA 1SBBA 4EQ3A 2BLFA 2B3IA 5IQ7H 3D3VE 4IW4C 3GT6A 2FSEB 2XQBL 3TTSA 1TFHA 3HCVA 2E7CA 1A7RL 1NL0L 1F4YH 2JKRM 2BSRA 1CLVA 1TTBA 3K6SA 4N20A 3WV0A 1JPTH 1MCLA 3D6GA 3ABZA 3BKCH 2W92A 4NAQA 4PN6A 5C0NC 1IGCH 4WI0B 2BNRD 4LARL 4PGDA 2XNAB 1E40A 4EQ2A 5T8IA 4JHWL 2CKBL 1CGVA 1NZRA 3QDHA 2JXMA 4QRFA 4D3CL 5I75B 2VDKL 4PJXB 4YJZL 5C07B 4DK3A 1J5DA 1S5IL 3S96A 3V6ZA 3HE6D 5T33H 4JKWA 5TE6L 5DYOB 3UIYA 5A2FA 4XMLL 1Q4NX 1ZPUA 1XB8A 2CGYA 1EHLL 1UZGA 2GT9B 3NJHA 2X28A 4RGOH 4HS8L 3S5YA 3TX4A 2DQEL 1P5VB 2AV7B 4XVSL 3MNWA 1DJWA 3S88L 1TVDA 2OTPA 2X40A 1BQUA 1EFXD 4FFYH 4PLKC 4R97C 2HTKD 5I0YA 3R7QA 5E9NA 5JXAH 3I75B 3S2AA 3QJXA 2P42B 4W4NA 1P7QA 3R06B 4Z7VF 5D72L 3TO4A 3Q3GA 5KVMC 1I8MB 5D1QD 2PXYB 5DWPA 1GPOH 1R3IL 3MR9A 4G7YL 4ODTH 5FDYA 5FO8B 2NY2C 2X09A 1WA1X 1LJMA 3UTSB 5CLTA 3HS9A 2IPTH 4LKXB 1FL3B 4O2FA 5IW3A 1WWCA 3AY4A 3EYFB 2C8NA 1YMMD 3OG6B 5EIIA 1WWBX 1X5FA 2NYYD 3SBWA 1E4XH 1RZIB 5E8OB 2CKNA 4KXZH 4YR6B 4QNPF 1MW1A 2R1YB 2GC4C 4JHVA 3VXOA 2IGLA 4JKMA 1KXQA 2FGWH 4XO9A 1BXAA 4YUEH 2FUTA 4CA4A 1FV1A 1GW6A 3RDJA 4C83A 5C09A 2XXGA 1IBGL 1F00I 1A3LH 4KX8A 1R33A 3BT2H 4JM2B 1I1FB 1F3JA 4CAGA 2VQTA 5ITBH 3JWOL 5CEZE 3O8XD 3NEXA 4HIJB 4NQCE 1GSKA 4ZW5A 1D6EA 3VRIA 4YHZH 2VDPH 5C0CA 3ZYOA 2Y06L 2LFEA 5FIEA 2ZSWB 2Z7UA 4HA1A 2VLJB 5JOFB 5K9JH 3LN5B 5E2TL 1WZ1L 4HW6A 1TOXA 4HSCX 3MLTB 2NXZB 4HWBH 4L05A 4AQ1B 3UX9B 4WFHE 3L2NA 4QRPA 4TVPL 5CO1A 1LK2B 1FGVH 1JVOA 3T2NH 3UBXA 2WBJB 2VW7A 3E8UH 1NSNH 3IFPA 4HU2A 1MELA 4MXVE 3ZQWA 4KJWD 2CBTA 3FBQA 1H8SA 3QI9C 4L3ED 4YPGA 5E95B 3S4SA 1UD3A 4DKAA 4EOWL 4YSEA 4YNYA 5DHXB 1QWHA 4PR5A 3DXAA 3LEVH 5CSZA 4BSVB 1QQDB 4BA0A 1E4WL 1QBBA 1XGTA 4NO2B 4F9PA 1F1DA 3KPQA 2G5BB 4ODBD 1ZHLB 3TBSA 3MV8E 4IMLB 3QPQD 3KE0A 3QFJE 3IDJB 3GRWA 3ABGA 4OQTA 2AABL 2WB7A 3GHEH 4GRWE 2QSCL 2XVLA 4TUJA 4MXQC 3NESA 3KM2A 3QEUB 4U1JA 1IKFL 4YIQA 1WE5A 2IFGA 4MAUH 5DQJB 1UZ6E 4OCSH 3VWKB 1ZXKA 1D7FA 2V3EA 3AG4B 3RTQD 4ZFFB 3QXTA 4I3GA 5GS0L 1PIGA 4ADJA 2ZXCA 1RFDL 3QHZH 4XNXH 2EC8A 2NY7H 1K4CA 4OKVA 4X5RA 2HT4D 2RCSH 2WYZA 4DPBX 4G43A 5EZLA 1TQBC 3FT2B 2NY3D 5DMGD 1TPXB 4GO9A 2JJSA 1TVHB 4JN2A 5AAPA 4ZXBC 4PTUB 4JG9A 2YAFA 1QZ1A 3D39D 2RALA 3B5TA 1N4XL 1CLCA 3S35X 4N8VA 3TEXA 4LQFL 4FL4B 4NRYB 5L2KD 1G84A 2QFRA 4U1MB 2R2BB 4EDWH 3GSWA 2MJWA 2IANA 2HLAA 2AJ3A 5TJWK 3VFNB 1LD9A 3VRJA 1N5YL 3B3BA 3D8MA 4RDQG 5JXEC 2OSWA 3I3BA 4AI7A 3L7EA 1U8NA 5E1QA 3K4AA 3EH5B 4KGLA 2G2NA 3TWYA 4TSCH 3RPKA 3V0AC 1AQ8A 1KLUA 3IFLH 2ZAIA 4FFZH 4Q9RL 2ZD0A 2YN3A 2IH8A 1QWUA 4JGUA 1NFDA 5BV7B 2X12A 1CMOA 1J9QA 5A7BA 3QEGL 4NAMA 4KK6C 4PV8B 4ENED 4OFQA 1IVTA 3RWDA 2L7QA 4IKIA 3QZMA 3IB4A 1BQLH 3W9DA 1AGFA 4GG6A 3SE6A 5K1NA 5D6CA 2R2EA 1E6JH 4G6AC 5H37A 3ZMRA 4GBXD 1CFSB 1HL9A 1TO4A 4HJEA 4TQEH 1MUJB 2V17L 5IT2H 2QVFB 3MREB 5BNXD 2A6KB 4J3OH 4Y1AB 3CSGA 3L6FB 4TL4A 1ZV9A 3N9GH 4XN9A 4XNUL 3MNVB 3Q05A 2EACA 3X13A 2FX7L 5KSAA 2X4SA 1N64H 1MI5A 1GIGL 1NFIB 1U21A 1NCGA 1UWXH 2Q0ZX 1JK9A 4M9OA 3SDDD 4UV4H 2MPAL 3ARTA 3RB5A 2YMTA 4I2XA 3HG1E 5J3HD 4U1LA 3BKMH 4JRYE 3U79A 1I3RA 5EWIL 3V5DB 1ET7A 1XMWA 1CJYA 3AITA 4XMKL 4IIQA 1SF3A 1PG7L 2BVYA 3K6IA 4PJ8A 5T5NF 2Y7SA 1XF4B 1N9PA 2X05A 4TYUA 2Q1EA 2ADJB 3APCA 3FRPA 5I8OH 1NAKH 3QUKB 2WWNA 4ZBJA 2NTFA 3SY6A 1PZCA 1X5ZA 1KPVB 3T71A 4HUMB 4G71B 4F5CA 4KTGA 4F7TB 1FZKB 4PJXF 4N90D 3BKJL 3EFFB 2BRRH 2DYPD 1MAML 2BHYA 2ZCHL 4LQ1A 1O6SA 4OCMC 3TBVA 3FKUS 3VXRA 4IOFC 1Y07A 4AL8L 4OGYH 5F96H 3F7RA 2R0WH 4AX3A 3JYBA 3LKOA 1AY1L 5JR1L 3BQUC 3OPUA 3BJLA 1EZVY 5E2UH 1AD0A 4ZFOA 3F6LA 4GQRA 4U1HB 1GZQA 4DWHA 1LEGB 2FJGA 4GKSB 1F11A 1Z5YD 3HNSL 1KEGL 3IXTA 1NGYA 1HL5A 5FGBC 2ICWJ 1ORQB 4KTDL 4PJ9B 5DK3A 4E0RA 4LLWA 4F7CB 4XWOD 2N1TE 5AUMB 4B27A 2JKWA 3QH3A 3RZCC 1BLIA 3GQFA 3SOBH 1HNGA 2GY5A 1BAWA 4KROC 1T0MB 3WMPA 1KPRA 3PYCA 4B53A 1KLFB 4YH6A 5CLWA 4MNQA 1BCIA 1A7QH 1DVFC 2ZUQC 1AGCB 1D9KA 3KHOA 2WCPA 4P2OB 3DJZA 3HG2A 3QXWA 1N10A 3H9SE 3M8OH 1CXKA 5IR1A 2W91A 5IMLB 2DQIL 5MEPB 2E9WA 3PNRB 2GI7A 2KMWA 1NLBH 4FMVA 5T3ZL 3DX7B 1WG3A 3MFFB 4AGLA 1DQML 2Y36L 2YQBA 4G5ZL 1FL5A 2VT0A 4AEEA 3QAZC 4LMQI 5IMOA 5BPPA 4YHNB 3EXJA 2VQ4A 1G4RA 2GG1A 4JM2F 1CVRA 2IBZX 4JY6B 3RL2B 4ZDHB 4XNZB 1L7IH 5DURB 4HZLA 4PB0H 1MFAL 4OZFA 3SEPA 4U1GC 4GEIA 1MFUA 4XO4A 4GRMB 5EEZA 3ARFC 4HD5A 3KPPB 3GJEB 1XZ0A 5HDWA 1VGKA 1QEWB 2NX5D 4LCIL 1KJ2B 4DGUA 3SB3A 4HH9A 4IRJA 1BZ8A 2PPEA 1JI1A 2DQDL 1QRNA 3HTLX 3D3VB 2NDFA 4I0PA 2W60B 2XTJD 3DWTA 2Q8AH 3NAAH 2OP4L 2F19L 5FUCE 1ET8A 5DJ6B 5MEQB 4WSKA 3PWJA 5I1AA 1C5DB 5I6LA 2VMEA 5E51A 1QR1A 4LL4A 1YEIL 2BNQA 3O2VH 3BSZA 4IJ3C 4M1CD 2ODIA 4CVZA 5TDNB 9PCYA 2KLRA 1JYNA 2Y4SA 1EGJL 1FE8L 4UQ9A 5HI3D 32C2A 4F8OA 4UCFA 4NN5C 3VD7A 5FKAA 5K9QG 4B6ZA 1RIHH 1M6OB 2ALWA 5LGHH 2Y0SA 3EUUA 2DQTL 1INQB 2HVKA 1UB6A 3U7AA 1LDPL 3PGDB 1LQSR 4PJ7A 2BSED 3T0EC 3S5LG 2ZX7A 4TLTA 1NBYB 3ESMA 4N2HA 1F4WH 5TDOA 3U30B 4F8TA 4QRRE 5LUMA 5HHVL 3LQZB 1P5UC 3LHAA 1AHWA 3TN0D 2GBUA 3HMXH 5D4JA 3U7YH 4YXHL 1MRFL 2F54A 5JNYA 4JO5A 2DQJL 5FHBL 5H94A 1H15B 3NUKA 3H85A 4OLEA 3RGBA 4Z0XA 4DNLA 3U2SB 4LPYA 3LN9A 3MBED 2ADIB 3G9AB 2EEBA 4K3EH 2NDGA 3L4CA 1RULL 2OR7A 4Y8DC 3MV9A 1F42A 3SSGA 5DJ8B 5TE7H 1BDYA 2VXVH 5DTFA 4BKLA 1NPNA 1OV8A 1HI6B 12E8L 2PWGA 3KPLB 5EZIL 5C3LD 5JW5B 3HI6L 4X7FC 2X2YA 4NQEE 2O6PA 1ADQL 4DEPB 3BP6B 4K5LA 1IILE 3ZVVA 2ESVE 3J07A 3MRJB 3QA3B 3B2DC 2XZQH 1DBAH 2EZ0D 2FD6L 3N2JA 4KUZL 3ULUL 4L23A 1OE1A 3QG6B 1ZA6A 3B9KA 2X4PA 5F9AC 1GGBL 2BIIA 4G6JH 1J9CT 1ZLUH 3PF2A 3QWRA 2J6EH 2ZSVA 4S1QL 2EE3A 4EN3A 2WQWA 4XODA 1NEZG 2YK1L 5AW0B 4NQCB 2E6QA 2B4CH 2DF3A 2HG0A 3JWDC 4OFVA 1HKLL 3VE0B 4Q97A 2NNXA 4PMEA 5TE4H 1U8CB 4EMZA 4N6RA 4XH2A 2FZ3A 2JB5L 4PB9H 1FYHB 3PDGA 4LSRL 1UM6H 1J0JA 3NGBC 3IDXH 4PV9A 5EEYA 1V7NL 3CBKB 5I1EH 4PY8I 3K2MC 5SWQB 2C9VA 3EH2A 4AEFA 2WN2A 5BVJB 5J6HB 3ECWA 3VGAC 5ECGA 5EO0A 3CVIH 5F0LB 4I88A 3W0WA 3T6WA 2GJZB 2WZAA 1NANI 2R7EB 5CWSA 1TCRB 2BDNH 1VESA 4RFEA 2CJTA 3BPLC 1XEDA 2WB1A 4ODSL 5I0VA 3MV8B 3DTXB 1HEZA 2O5ZL 5FYLE 3QFJB 5L8KB 4JFDA 5KVDH 1CWVA 2NZ9C 3QDMD 4GRWB 4JY4A 3DARA 3G9VA 4G3YL 1KBWA 3U9UA 3BGFB 2EDMA 4NM4L 3Q5OA 3AVEA 1L0QA 2Z7YA 3D7PA 1Y0LB 5E5LA 4S1SL 2WUCL 2JMRA 3FO1A 1BZ9A 4ZQKA 5F9OL 3VG9B 1IM3D 1T6VN 2Y72A 3IMVA 1A7OL 4KJYB 3U25A 1MPAH 3QIBA 4LNRA 2EIZB 2C1OB 4LLUB 5JHAA 1HXMA 1CU4L 3BP7B 1PQZB 1S7SB 3EG9B 3MUHL 4NZUL 4HCFA 4OFDA 4K3JH 1JTOA 1ZHNB 4KZEH 3MACL 1M3IA 4NCC2 4Z3GA 2ZUYA 1SJHA 1WBZA 2R56L 1VPOL 3RE0A 1SVCP 4MZ3A 4UT7L 5ANMA 4AOFA 1CFQA 4KVCL 3CDZB 3ULVD 4KY1H 1I1AA 1N59A 2O6DA 1T7YA 1AO7A 2B7DT 4PG9B 5BW7C 2FO1A 1A4KA 3PUCA 3JZYA 5I1IH 3LOWA 3LJ3A 3Q2WA 4PRPD 4PYGA 4OQ1A 3G7TA 2G3NA 2OXGB 2R2HB 4FNTA 2V4LA 4GKZB 4HKBB 5IF0B 2I32A 5HHPB 3WJJA 2XG4B 4NJ9L 4P5RA 1JZDC 3ILQC 4N2FA 1S8DA 1ED3A 1ZS2A 4K23H 3S5LB 2GY7B 1VACA 5EO1B 1MRDH 3REWA 2IAMC 3BZ4B 1BEYH 2A1WL 2ZYHA 3HAEA 7FABH 2R27A 3LRSB 4I85A 4GAJL 1G6RL 3AC0A 4UNIA 1YEDA 1WITA 1OAZH 3NZ8A 1SEBB 2PTUA 4XE5B 1NLDH 5GRVK 2J2ZA 2X53A 3ARGB 3CXHK 4LHUD 3BMVA 3JYCA 2EJ1A 1RJLB 1E90A 4YDJB 2I5YH 1LO4H 2VDQB 3QXDB 4UM8A 1QSVA 5AENA 3C8DA 2B3RA 3OXRA 4P5KA 2DPKA 4S1RL 2G3XA 3A24A 2APFA 2FBJL 2MH4A 5FGSA 2P28B 5DD6B 1J5HA 4OIIH 3HG1B 4JRYB 5D96C 1ZJAA 1T1YA 4QJ5B 1H6UA 1G9MH 5E5UB 3CIAA 5KYWA 1UJ3B 3KH3A 3BH4A 5IHZA 2HVJA 4RDQF 1Y1UA 4NZ8A 2DLIA 4KZDL 2DQGL 3WLWD 1NMAH 4ZOCA 3MI6A 3MOBH 2C4XA 4WNQB 4XNAA 5EU7E 3VVWA 1A6TB 4I9WD 2BM3A 4BK5A 1I8LA 3SDCC 3KLHC 3NCEB 1NEZB 3WNLA 1R75A 3FCSB 4G6FD 4KHXH 3OPZL 4UTCA 4G8IB 5FV2A 2F15A 4OFPA 5JHDA 2AXHA 1CGUA 3D5OF 5KVEE 1XB6A 2P24A 1AGEA 4POZC 3CFBB 4LLAA 3C75A 3QUYD 2HH0H 3F01A 4WHTA 3IK2A 2Q2EB 4BKSC 5HHOA 1QSEA 2YJQA 1R5VA 1D6VH 3L3JA 3NABL 2OYMA 2P5WD 2AJYH 4MNGE 1M3JA 2QL1A 4OAWB 3QUMH 3POCA 3U1SH 2XWBB 1MHPL 1P4BH 2CLRB 3BXNA 2QDWA 3RWJB 5DSCB 4FG6D 2CDFA 3QXUA 5HPOA 4PRHA 5GRJL 2N3JA 3QNZB 2DJ4A 1EDQA 3TA3B 4X7CC 1FQ9C 2H2SD 3O9WD 4HHGA 3RWFA 2COQA 4PRIE 4GSXA 3W3BA 2H1LM 3WS6A 4NM8L 4B9GA 4KX7A 5HHXH 4DUVA 4LDEB 3H9SB 4ERSH 2NY5C 1OGPA 4YHOL 1FJ1B 3TCLA 1OANA 3ARBD 3NACH 1KYAA 2XN9B 4FS0A 3SCMD 3OLIA 3C6LA 4IBLT 4P5TB 5E94B 5FHAH 3UTZB 1RURL 2ZKHL 4FQCL 1ZMYA 1ETA1 3MX0B 4O2EA 2LAAA 4ZS6D 35C8H 5T5FH 4RA3A 5E6IB 4BCZA 2ZPKL 4G72B 4Z0BL 3TJHC 1MVUB 3MJ6A 4XCCL 1HYSC 1R47A 1MWAB 3VXUE 3GB7B 2EYTA 2RA1A 4Y1SA 1Q38A 4Z77B 5EEVA 4L3CA 3VXSE 3MLWL 2QGBA 4F33B 1ZHKB 4ELKA 4R7NB 1OSPL 2UX6A 4QRQB 1BZ7B 4QXGH 2X9YA 1N6VA 5MEOB 1KV3A 4XO3A 2NRDA 1X4ZA 1XHHA 3Q6GL 2ZUUA 4YL9A 1INDL 5DD5L 4MXVF 5HYSG 3FOLB 4DEUA 1IGIL 1GY1A 3MUGB 1SDDA 1CDIA 5F7EH 1GGCL 2AP2A 3LKNB 1AGDA 1FCCA 1UQSA 5D7JB 3D85B 1G6RA 1CXEA 2VDLL 4ONGL 4DEWA 1FFQA 3M46A 2AQRA 4ZAKB 4Y9BA 1TNNA 2VMDA 3RVTC 2YPVL 2X4TA 3R8BB 3ALXA 2DQHL 4JL1A 4M1GL 4ZRGA 2D0GA 2V5RA 5CJBA 5EA0H 3NZSA 1S7XA 3OQRA 3SPJA 1BBJA 1XZWA 4GRWF 1WAAA 3SBPA 2WQXA 4JFXB 3T09A 3EJJX 1D7CA 2MWCA 4OV5A 2APBA 3IDNA 4OJAA 3MRBA 4XMWA 3WYRA 1JUFB 4QRRB 5FO2A 2ORBL 2IDCA 1UZ6F 1C16B 4L4JA 3G04B 2YBRA 4H26B 4PY8J 4R3SA 5IESL 1FHNA 4FFTA 5FWQA 3E3QC 3VFWB 2EDNA 3W37A 3FMGH 1S2EA 5F7DB 4IBQA 3IVKB 3FS9A 3IJEA 4GAAA 2DLFH 3NJFA 1KCLA 4IGBD 4ODUB 4QRSA 1E8XA 2WIMA 4UM9A 1NAMB 1OT1A 1XSKA 2C4FU 3S35H 3W5MA 1G7PA 4NQVB 4UYPA 1OGAE 4CSSA 4NQEB 3WKPA 1NDMA 2DM2A 5E5RB 3KPNA 1WH0A 2Z65C 4JM4L 4JQIL 4E9LA 4ODHL 2ESVB 3F04A 4N3TA 1CD1A 4Y7MA 3FPXA 4WWKC 4XZUA 2ZWSA 1Q1JL 3B7SA 4PY7A 5M7QA 2W07A 1I8IB 3KYAA 3QC5X 1AS6A 4GFXA 3RL1B 3TFBA 1F6AA 2MPVA 3B7UX 1TR7A 1FWXA 4PI0A 5C0GA 5GSVB 2QKIA 3IGFA 3CK0H 3GBLA 3AT8A 5JYMA 5A3ID 4L5FL 2Y5EA 5J12C 4XC1L 2FTAA 4RNRA 3L3OA 2XG5A 2VLMD 1D2PA 2FO8A 1UXWA 2AMUA 1G5GA 2YD0A 2O72A 4I48A 4KRPC 4L8SC 4GAYB 3WHE1 2WGNB 1F90H 2JJWA 1TQCB 3ASOB 3U4KA 5C09E 3C60A 4GRLD 4Y5YA 4G42A 3TVMA 5HVHB 1AVAA 3LNGA 4XP6L 3ULSA 2P49B 4H2AA 1DSFH 1BIIA 1FO0H 1SDAB 2OW6A 2YFOA 1MW2A 3MLVH 4MAYC 3K6NA 3D12B 3UG3A 4NLHA 3X3FL 1NCIA 1IEBA 4QRPE 5DHVB 5B21A 4TOYH 1ZKAA 1OW0A 5IFHH 4KK5C 3QNXA 3U1PA 2KYIA 1YVLA 4CKVX 2RH0A 5K93A 4YGVA 2B2XH 4WCYL 4LL1A 2VN5A 2OK0H 4NJAH 2YXFA 2HT3C 4BUQA 3ETTA 1FAIH 4JKPH 1J0HA 1RSYA 1UA7A 4R5TA 4X4ME 4X5QA 1ZGLP 4GMTH 4NCDA 2G75A 4AM0B 2BVTA 5FW8A 4FYRA 3V0FA 1T04B 5HGAB 1OAJA 1BHGA 3LZLA 3Q2CA 3VFSA 3MC0A 3VXTA 4LVOC 4YLQT 4NP4H 1PU0A 4PS3A 4A04A 4LDOB 2G9HB 2OYKA 5KS9E 3IWUA 3UO8B 1ZVNA 5HYSB 3APDA 1Z9SA 2YAMA 4D9LH 5F1IB 1ACYL 1OGTB 1VEPA 2UWEA 2XYBA 3WS3B 3EGDB 4J6RH 3CLEL 3FUEA 4JM0A 2QQKH 1R3HA 4TRPL 5C0DB 4X7EC 2V2TA 5ALCL 4ODVL 1P1ZB 1D5MB 3EIFA 4A2DA 5IROD 5HPMA 2DWXA 1KUMA 4AQAA 2WLJA 2ZG2A 4XBPB 1CDBA 4LPTA 1A5FL 1BVKB 2ENQA 3FQUA 4ACTA 1IC5L 5IQNA 2MRYA 3ZDYE 4AUJA 1PEWA 2AITA 3LMJH 3BUTA 5EUKB 1Q72H 3STBA 1IO4C 5DK2B 3N0AA 4I89A 4QHNB 2LTQB 4U6HB 1FSKB 4V11A 1K5WA 2IANE 3AACA 3ZT6A 4BRVA 3EHBD 3VXNB 3D2TA 1UM5L 2J88H 1ZHBB 2MOGA 3UACA 4FGMA 5BCAA 5DC2A 3HS0B 3CDGA 4K2UL 1H9DA 4G11A 1DJIA 4JRLA 3THML 3CGTA 2FYYB 4M6NL 1ZVSA 4NQDA 2A9NL 1FNSL 4R9HA 1OCOB 5I1GL 4YHLH 3IDMA 2K6YA 1NFDE 3UO1L 4A7UA 3W9EA 3SO3B 3KPRE 3LRMA 4M8VA 1QO3A 2CDEB 2K4WA 5F1SA 4ACPA 4DW2H 1NC4B 4YE4H 3ROOA 4D9RE 3K8LA 3ARUA 3HNVL 1GZHA 5DZAA 4RMQA 1C8PA 1J18A 1G9NL 2WSDA 1AIFB 5IFAH 3C9NA 4PBXA 4YSOA 4L8BB 3OV6A 4WI7A 1WUZA 2MEJB 4K8RL 5EU5A 2YPLA 1Z9LA 2A9CA 3GNMH 1CURA 1MI5E 5JYLA 3BD4A 1JZ8A 5FO9A 3RVVD 1L9RA 1ZDQA 2COVD 3JV6B 3VXMA 4RFOL 2VC2L 5E6YA 4ZUUB 3CDFA 1I7ZA 2ICEB 4FTVD 3TA4D 3P1VA 4I2XE 4QYOB 4QRAA 3OSKA 4KPHL 5EZJA 4FQ1L 3OHXA 4ELMA 2QGCA 4KJQC 3FT3B 4LRNL 1DQQB 1JGDA 4HWZB 4WO4C 1ZGLA 2Q7YB 2P8MB 3LCYA 1KIQA 1BYPA 2UXGA 4ZUVA 3U6XA 1CFMA 1GYWA 1LO2H 4WHCA 3TIEA 4MNGB 1FZMB 3IJ7A 2IGFH 4F5CE 4JZJB 1MFDL 4ZFGH 1AH1A 3C6SB 2A74A 3Q13A 4MYPA 2A6IA 5INCB 5JLZA 5CBEA 1U4EA 4JG5A 4ABQA 5SX5H 4F7MB 3QUZA 4E9WA 3IFOB 3KYNA 1KPUA 1MCFA 1GOHA 4HJ1A 4HT1L 1SYSA 4JFSA 3CCHB 4BUHA 3BZDA 4PRIB 3FQYA 2X4NA 4JDTH 1FYTA 1GJIA 1SM3L 3RLSA 1SYVB 3BVWA 1UM4H 1CLZH 1Z1WA 1V7ML 2R69L 5CGYC 5IWLA 3RIFK 5JW4R 5EBLA 3UBXG 4CVXA 5I30H 1OAYH 3E6HA 2CO1A 1L7TL 4OI7A 4F2MA 4XOBA 4AQZA 3J2PA 3S4SG 3OLEA 1C5BH 1ZVYA 3KWWB 5JO5B 4R4NC 3QDGD 4DKFH 4IOIA 1U8LB 3BZEA 3OR7B 1V55B 5B8CA 2WIIB 3RWHB 1LEKB 1O7DE 2OMTB 3MJ7A 4HFWA 3VXUB 4TSBH 4DGIL 5HDQL 5JPNA 4MDIB 4MB5A 4TUUA 3RA7L 1G7HA 2EILB 1KBPA 3BSGA 4LVEA 3VXSB 1CE6A 3DLQR 4EIUA 4N28A 1OTSD 4YBQC 4AV4A 1KGCE 1RJYB 5EBMA 3RWIA 5I1CH 4GXUM 2CDGB 2NY5H 4YWGL 3OJ2C 4NZTH 3MXVH 4TVSa 3JTTA 4RZKA 4WW2B 2YOAA 4QHKJ 4WHYG 2CIKB 5AW6B 3SKJL 3Q8BA 2DOCA 2CHNA 3BFOA 4IRSB 4OFIA 1PCSA 3Q48A 4MCYB 2VW6A 2XPYA 5F89A 2NCEA 1DFBH 5JIIA 3OMAB 4ONFH 1Z3GL 5F71A 4LSPH 1MFEH 2D0FA 4LGRB 1TZGL 3QGVA 1JPEA 4XHJC 5HYJD 2K7QA 2Q8BL 3NFNB 4R7DB 2KH2B 3EBAA 4OF8A 1HILA 3QORC 4JPIA 2AK1H 1QRNE 4CMMA 1NCWL 3HZ3A 4GS7C 3HCVB 4N8VG 4P59H 4M3KB 2R0KH 1I9IL 5CLYA 3UTOA 2BSRB 4Y16A 3NCJL 4XTRC 3K6SB 1NGXA 2IMNA 3LAFA 4DKDC 1KCVH 3O3AA 5I15L 4P46B 2BNQE 3QJUB 3VTMA 4BSWA 3U6XS 1REIA 1WJ3A 1T83A 4PGDB 2B1AH 4GG8B 2VTFA 4AYFA 2VE6A 2JXMB 4O5LL 5CUSH 3CSYA 5C07D 3V6ZB 1KCSL 2H4EA 4PJ7E 4OF3A 4WJ5A 4Q4EA 4FYQA 4YHYB 1BMGA 4HXAL 1C08A 4PVMA 1OGAB 2CCVA 2LGNA 2X9XA 3FQRA 4S2SA 1N8ZB 2WVUA 4WUKH 3FSAA 3O2DA 1J1OL 5AVQB 2W5PA 3CZKA 5F1NA 1UOLA 2BS71 5A7EA 3HE6A 1E9OA 5BQ7A 3MNWB 1YEJL 4M7JH 2JWYA 4ZMZA 3L9YA 3O4LE 3MJGX 3L5IA 3WN6A 3UMNA 5J5EA 2CHWA 2NNCA 4NZDA 4EDXB 2FLBT 2F8IA 3MV9E 2AQ1A 4H5SA 5DD0L 1YECL 3TO4B 3Q3GB 3V2AR 1JG9A 3ULVH 2PXYD 1RZKL 1MCCA 2ZCLL 3HUJA 2CR0A 3C5ZB 3DOIA 3L4TA 1NUGA 3UTSD 3HHMA 1ASOA 3CBRA 3CVCA 3H4FA 5DCCA 1QVOB 1ZLUK 3RZWA 1AR1B 2IOMA 2IH3A 4HC1H 5CJQH 5AAMC 3MOAL 5D1QA 2WGXA 4L37A 5FA3A 5DVLA 2R69A 3VXOB 1J5OH 3UG5A 1WIPA 2ED6A 3FRPG 2K78A 3HB3D 3T2OA 2VUKA 1OP5H 1SMOA 3ZPDA 1FV1B 4XPHH 4C83B 5C09B 3V6OA 3WLBB 4E2OA 1PFCA 4ZT1A 4ZZKA 5MI0B 4UT9H 2O5XL 2A4ZA 4CC4C 1D6EB 1MLBA 3VRIB 3CLFL 1BAFH 2Y2TA 2XCMC 1JGEA 3Q43A 4MMYA 4A7VA 2VLJD 1HSAB 4D94A 3K8MA 5FS5A 3DO3A 4XBEH 3O8XA 2BSCA 1X9RA 1KEMH 5EC1A 4QRPB 5GXBB 2PWFA 3UBXB 2WBJD 4V2BA 1PAMA 1OD9A 1M71A 4PG2C 1B2WL 1CTMA 3W0WE 1XXDC 3S4SB 3FQTA 4MXQD 2A6JB 3ECBA 2R0ZL 1JGIA 1NJ9A 4YNYB 4ZMWA 2D7TL 1QYGL 4PR5B 3PABA 5CSZB 1TEYA 1UKSA 1VDGA 5HD8C 4AEIH 1F41A 4UBDC 5LBSA 2HKHH 1XF5B 5IB1A 1RZJL 4OF0A 1VIWA 4L3EA 2VDML 1GMEA 4LLDA 1N6QL 2EADA 1DEEA 2DKUA 2FNWA 2HT2C 4MJ5A 3RGVC 5I0DA 3WFCL 4MA8H 4TQ8A 4JFDE 3IBOA 5BQDA 5CGTA 2CMRL 4Z7NE 2Z8WC 2OL3A 5KVGL 1CZ8L 3RIKA 5FO7A 4TUJB 2AHIA 1S9XA 5KS9B 5TQ2L 3EJYD 4L3AA 3OB8A 4YIQB 5ALBL 2PR4H 1INEH 4O2CA 4KTEH 4YSTA 3ALPA 1MFBH 2VERN 1OAQH 1SZNA 3RTLA 2B1HL 43C9A 2XWDA 4OKVB 1K4CB 3ZL2A 4F20A 3PREA 3SYPA 5AWNL 1F3DH 1F18A 4PJAE 1H5BA 4G43B 5DQDH 2KPNA 1AQDA 2YR3A 3CC5A 5G4MA 2UZPA 2R2CA 4OVVA 4FF9A 4OLXH 3VM7A 2YD5A 3ZDYB 3MV7D 3RY6C 4RMTA 4N8VB 1JRHI 3MLYL 4EO5A 4Q9QL 5ANME 1A3RL 1F2XK 5FYKU 1WD8A 1QA9A 3GSWB 4RH4A 2IANB 1AO7E 4DN3H 3I9GH 1NCBL 2AJ3B 1BF5A 1LD9B 3VRJB 4AVIA 5A2KH 4Y9CA 1KXTA 1CCZA 1Y1DA 3MO1A 2IDUA 4IMKA 4MD0A 4C56A 3L7EB 2VCOA 5FUZH 2NY6D 5L2KA 5DLMH 2YGVA 5T3XE 1AXSB 4MA1C 1JBJA 4ZNEA 4X4YA 4RFNC 3SBRA 4I3SH 4YSSA 3O3UN 1KLUB 1TEFA 3K4ZA 3PGFL 3UJJL 1DL7L 3WUWG 4Z3EA 1NFDB 1MIMH 3CMOL 2FDBP 3KPRB 4TVUA 1BPLB 2QVMA 3WNIA 5JPMA 3GBNL 4WW2F 5E1AA 3T3ME 4WWPA 3ULUE 4I3RL 3UADA 3T2PA 3W9DB 4P4RA 5D6CB 5MERA 1JHLH 2E4FA 1NMBH 5F44A 2YUXA 3N85H 4BD4A 3ZQXA 1J48A 1NCOA 1FVCA 2FLMA 4OJCA 5HGDA 4F1ZA 3X13B 5FF6A 3GO1H 2X4SB 1MI5B 4XPBL 4XXWA 2DICA 2GAZA 4RAVA 4JO2L 2AI0H 1QABA 1JK9B 1QBML 3RU8L 1AZVA 5BVPH 1UWEH 2ICWB 2Z1KA 4I2XB 4PBDA 2BVPA 5CLZA 2HFEA 3KMDA 2J1YA 4U1LB 1J8KA 4E42B 5JW3L 4FI7A 4NPYA 3V4PL 4IIQB 2Z34A 2R23A 4XPAL 4PJ8B 1RV6X 3WENA 3FRPB 3DMMD 2NTFB 3FL7A 3EDJA 4NB7A 4IDJL 4JFUA 5FDWA 2A0LD 5IQOA 5I76A 1JRHL 5IZ7A 5F1OB 4MTMA 4FP8L 1O6SB 4XVTL 1PLGL 1NBVL 1WF5A 5T1KD 5L88L 1JZGA 2H0EA 1HNYA 3LKOB 4PV1C 5E9DA 1WS7A 2XVBA 3L9RA 4KROD 3V52H 1TJIH 4NYLA 3UZQA 1Q0XL 1AD0B 4XVUC 4ZFOB 5M94B 2EIDA 4YLCA 2YMXH 1QSEE 1K3ZA 1GZQB 3JUZA 2FJGB 2NQDA 4HPOL 3MDJA 3GHBH 2G5UA 2N7SA 2VSDA 3O6LL 4U6VH 2E86A 2V7NA 4F7EA 4E0RB 5I17A 3L4UA 1W2KT 4WV1C 1MDTA 5I1LA 2QTVA 4PRHE 3ZIMA 3FNKA 2DIEA 4HFUL 4HKZB 1ADWA 4LEXL 4M62L 5F6IB 3ARDD 3QCUH 1BOGA 2BHFA 5F7UA 1KPRB 4R0LB 4FI6A 1F56A 4KAQL 4XMUA 3SKNA 4ZMTA 4CJ1A 1D9KB 4MMZA 2AGJL 1MREL 5K5YA 1FGNL 1NGQL 2D3LA 4RQQA 2EINB 2NYZA 1SLVA 1KTDA 4JM2C 4PLJD 3VFUB 2F5BH 4MQ7A 2WBWB 5EOCL 3VFVB 4KH2A 1Q94A 4HUUA 1I3UA 4K0OA 1XF3A 1LO5B 3M17A 3UYRL 5GS0C 5GGTH 1A7NL 4N0UA 4EIGB 3FQWB 3IETB 2Q76B 2Y1YA 1FL5B 4D0CB 4E5XB 2WWMD 3HZMA 4GP5B 5IMOB 1ICTA 1XO8A 3IDIA 3MUZ1 1D5XA 2NXZC 3WJLC 1CXLA 5JOPD 3U9PH 4AQ1C 3N1MC 4HZLB 5DURD 5FW7A 5C0AA 3LV3A 4A2FA 3ZIYA 3US1A 2F1EA 1KBVA 1IIIA 3P0YH 3WIHL 2LU7A 2ZWKA 1VGKB 2EDBA 1HH6A 5HDLA 4HH9B 4W6WB 4AGQA 4ZTOL 4IRJB 1YJDL 1QRNB 3NZHL 4P48A 2OA9A 5DMYA 3BSHA 1LYQA 4I0PB 3IE4A 1N7ML 3E2HB 1L0YA 2NX5A 5I1AB 3WKQA 2ROYA 1UASA 2E7HA 3ZL4L 4AKQA 1AC6A 4EI6A 4HSQA 4I5BA 2BNQB 3HHRB 2K3TA 2XZAL 4CVZB 4QXTA 3O0RH 32C2B 4NZRH 1BWWA 3T6XA 1GHFH 2VO5A 1OD7A 4JO1H 3DI3B 4GKNB 1KJ3H 4F9LA 4Y2DC 1A3QA 5EIQA 1NDTA 2CO2A 4GJTB 3VWKC 3WUWB 1TO5A 5IBTH 3C09B 2E3VA 2IQ9L 1PZ2A 4GW1A 4YXLL 1EHNA 5KS9F 3D2UA 5IB5A 5TDOB 2VZVA 5FEBA 4B7LA 4YAQA 2YC1A 4ZX5A 1I4FA 1EO7A 3MNZB 4J6IA 1CDHA 3HAEG 1T03H 5JNYB 1EQWA 5DU7A 3ZK0A 2P26A 4DQAA 2X6CA 3O4LB 3BLPX 5E4OA 4Z0XB 1AI1H 2EAEA 2KBGA 5I23A 1TMCB 1BP3B 2WN3A 1PX3A 1SY6A 3PRZA 1IBZA 4FNLL 1A1NA 5JQHC 3ZGIA 3MV9B 4Q52A 4BKLB 5DTFB 2GSIB 2EUXA 5C0BD 1RZ8A 3ZDYF 2VO8A 3GM0A 2JELL 4O58H 4M3JA 3M6DA 4UQ2A 4WW1A 3EYUL 5AYUH 1B0GB 1T80A 4MJID 1SBSL 5DS8A 3LH9A 4YSPA 5L6YL 4KK8C 4PGBA 3RNQB 3UYPB 2OMVA 3IT8D 2KC0A 1MCHA 4DP1X 2IFFL 1VZGA 2X4PB 4W9IC 1OIOA 2B8OT 3OAYK 1OK8A 1UVQA 2FSDA 2YZ8A 5F8RC 3VNYA 3OR6A 1KOAA 1A4JA 3ASWA 5J11C 5ADPL 1MLCB 1Q9OA 4EN3B 1YNKL 4UMGA 2NY4C 3H7BA 5CEZD 4Y9FA 2N1KA 1GKEA 3D51A 3EJZD 3WFBH 1NFDF 1DQTA 2FK9A 4GSUA 1J1PH 1B3IA 1R5IA 4L18A 2CGRH 4N6RB 2ZX5A 3RNKB 3QVAA 4MZ2A 4HETA 5CSBA 3AT9A 4M56A 1JPGA 2XXFA 2W9EH 1SQMA 4RISH 4WFHD 2J5WA 4PV9B 2PF6A 3QJFB 2V2WA 4I8DA 4X7TA 4FXGB 5E5MA 4WFED 3OF6A 3VSVA 1YEGL 1QFUL 5JHLH 5EO0B 5EDXA 3GS4A 3ZUNC 1J11A 3W0WB 1WZLA 1ZTXE 4NPKA 4UNTA 5J13C 2E7LC 3FO0L 1GL4B 1GSMA 1TEGA 5CWSB 4X99B 5JIMA 4Q58C 1JF5A 4TUOB 1HCFX 5FYKL 3BEVA 1FNEA 2WCGA 1GVIA 2BSDA 4LPUA 3WIHA 1HEZB 3D1MC 1IB5A 3AUWB 3QFJD 1B0IA 4JFDB 4PJIA 4Z7NB 4JY4B 2PYFA 3DVNA 3VFMA 3AQDA 5GGUA 1MKFA 4Y4HA 3GSQA 1QLEB 1SHMA 2WLLA 3MRKB 1MCPL 4IBZA 4Y4KD 1NCCH 2BSTA 2E74C 3B9AA 1DJSA 2VXTL 3KG5A 5I6MA 1OB1A 2BPBA 1MNUH 1N67A 1BZ9B 3CLWA 3FO1B 4MNHA 4MBOA 1DP0A 4Z95L 4AWJC 3UDWA 5IGXL 4LSUL 1E8WA 3G5ZB 4XCNB 1E8ZA 1HAWA 1VJSA 2TRYA 3QIBB 5HBBA 4LNRB 2VAJA 5ISZA 3DX2A 3MLXH 3VGGA 2WQAA 4Q6IA 4MQTB 2Z92B 3F84A 4PJAB 1HXMB 5DD3H 3WXWL 2OTUB 4UNUA 2J25A 3K6FA 3L3IB 4ORGA 4PJ9C 1NWOA 4PJGA 4TV3A 5B22A 3WEXA 1XF2A 4RA0C 5EG6C 1ZOXA 1IMHC 5CU9A 5L2JA 1D7DA 3DYMA 1URLA 1WBZB 1XX9C 1E4XI 1T1XA 4NLAA 2AKRA 5IHBA 2EYRA 4KXZI 4ZUWA 1CFQB 4M8QB 1I1AB 4XXCC 1AO7B 4XOEA 3VMPA 4UINH 3FQXA 4WEBH 5EZOL 4P2OC 5DMIH 5GRYA 4TLUA 5IQ7L 4O02A 4X6EA 3NTCH 1F6LL 3QEHA 4W4OC 2VL5A 4MAZA 3KLAA 1HHKA 3SGKC 1F4YL 4JFOB 1JPTL 1S8DB 3OLGA 3OZLA 1E0OB 3BKCL 4JDEA 5ESQB 1VACB 4NUGL 5EPMA 3T04D 5AW5B 4YDZA 1IGCL 1IAMA 2WXIA 2WHVA 4WI6A 1A6ZA 1XGQB 3T3MB 3FQ1A 1HXYA 4E41A 3HAEB 1PD0A 2ZKYA 1OSEA 4OW6A 1NFKA 2ZUXA 2ZOOA 3LKSA 1YEDB 2DQFA 2A4EA 3L2LA 3NZ8B 4JKKA 5DUJA 3KJ6H 4K7PY 3BEWA 1PY4A 4RMUA 5T33L 3ARGD 1CE1H 3GI8L 4R7VA 3VDBA 5D7LA 2HX9A 4FFWC 3V79C 4NQDE 2RR3A 4F7PA 3ZO0A 4RGOL 4CW1A 4AJYV 4TNEA 2ZOLA 1OGSA 2KDGA 4FFYL 3B3IA 4G6MH 4NWUH 5C9JA 2DIAA 1KWKA 3HG1D 2QHLA 1UWFA 2H26A 4JRYD 4XPTH 5GS2D 1T1YB 3DVIA 4KQ4H 3BN9D 5JXAL 1JHTA 1IAIM 2M1KA 5KYWB 3K2UH 5IHZB 4YOKA 2HVJB 3MGOB 3ILDA 3BESR 3V9FA 4WSGA 3PL6C 1GPOL 5CJXA 2YPLE 4IS6B 1VSCA 2WUBH 3F12A 3FYIB 1V3LA 2WVVA 5DHMC 3U30C 5C0JA 2WXOA 4YHIA 4HOMA 3VXME 1EVTC 2AEWA 1LL1A 5GRXG 1UGKA 4GMSH 3IDGA 4NSKA 2J57A 4GAFB 4HX1A 4A2HA 5F7MC 2OV0A 4L1LA 5BJTB 5GZNA 4JHBA 2FGWL 4ELME 2P5EA 1BD2A 4BRJA 5JIDA 1UYWH 1LTXA 3CPUA 1PF3A 1A3LL 3BT2L 5ITBL 4WHTB 4NQTA 5IM7A 3NDYE 3GEFA 5DEFA 4HJGA 3BQVA 1QSEB 1MCDA 1R5VB 4YHZL 2VDPL 1YO4A 2ZX6A 4NKOA 5K9JL 2AXGA 5BS0A 3QRFM 3DUSA 1UOKA 3I6LE 3QUYA 3LD8C 1U58A 4HWBL 2OR9L 4AH2A 1BOYA 2CDFB 3QR1A 4YDMA 1JGVH 4PRHB 3ILPA 3EDFA 4LSSH 4LSDA 1EDYA 5KYUA 4YHKH 5E8PA 1EO5A 3RWFB 2IPUK 1VCBC 3E8UL 4JG0H 1MF2H 1ZT4B 3LDBC 3QP3A 2CBPA 4FJZA 4JDVA 4ZYKB 1FYTE 2X0UA 3H9SD 4MMXA 3TCLB 3AGWA 4LZKA 2GITA 3ZO9A 5CJOL 5ADOH 3C6LB 2QV2A 4F2ME 1NIEA 4Z7UE 1QTPA 2NQ3A 3PP4L 2XVKA 5ACLA 2PR9A 4XMTA 5E6ID 5C1MB 2XZZA 5DUPH 5HYQA 3GRGA 5FUOL 3UTQA 5ABZA 4FLHA 3VYOA 1NEPA 4GKOA 2HWZH 2EYTB 5AZEL 2VITB 2WM0A 1ZLWH 3ZMNA 1BQHA 1IGMH 4FQPA 3DHUA 4L3CB 4K9JA 4OCSL 2JKTM 2XN2A 3RVTD 2HXAA 1RVFH 3P4LA 1ZLSH 4UAOC 2A73A 2YBGA 3HIZA 2WKLA 5LO7A 5IVXA 2NY7L 1ZIAA 4AIZA 2I9TA 1OPGH 1U3HB 4J3XA 4XMXA 2ISDA 3RHWK 1SDDB 1AGDB 1DCEA 3CFEB 4XB3A 5D7JD 3QQDA 5ACZB 2QT6A 4ALAH 4HIPA 5GS1C 5CINH 2KPWA 3VX1A 3VW3L 4U1SB 3N40P 3GSRA 4YDVA 1KGYE 2X4TB 1YUHB 5KSBA 1FVEA 1GC1H 5JMOC 4EDWL 3PDOB 4Y4FC 3CN4A 3VRLE 4Z7NF 3VG9C 5PAZA 2DV6A 3U7WH 3L7FA 2AJZA 4FEMA 4LIQE 4V2CB 1AKPA 2DQUH 2GSMB 4TSCL 3EF4A 3DJSA 1CTNA 1HCYA 3PAZA 1BMZA 3IFLL 4P0DA 3BCFA 4X9GA 3TBYA 4FFZL 1TYRA 4JJHA 2FE0A 3I6GA 5FAAA 3GMPA 2VSCA 3QO1B 3IJEB 4AXWB 4PJAF 4QRSB 2AJUH 3DO4A 3OB0H 3QUXC 4GYBA 4UM9B 2I27N 3HE7A 2CZNA 1E6JL 2BNRE 2Y1AA 3D9AL 1G7PB 1S7UB 3KWVA 4ZMVA 2XSKA 1G1CA 5IT2L 3KD4A 3LPPA 1BYNA 4D0DB 5I8CA 5A6MA 4K7FA 1NDMB 2X4QB 4MQSB 5CFHA 3KPNB 1I3VA 5E0FA 1KULA 3N9GL 3K91A 3NFPA 1CD1B 1DSWA 2BXYA 2WV3A 3C8HA 3DV6A 2BP8A 4WUUA 3T8XB 3TH4T 3UGEA 1N64L 2FAUA 3QZPA 4I0CC 4PY7B 3UBFA 4JPVH 3FU3A 2W07B 1IL1A 4MVBD 3RVUD 1AJ7H 2V3DA 1K5NB 4UV4L 1O7VA 3DJRA 3RKDC 1F6AB 1NUDA 2CUMA 4ZW3A 4N9GA 2OJEB 2QKIB 1WEJH 4JR9H 5DT1H 4D8OA 1EEUA 5ITFA 3V9CA 5E8EA 3HUJE 1H3TA 1O0VA 1RJZA 3B2MA 4AQEB 2GSGA 3BYYA 3KH4A 2CK2A 3W11C 3DSFH 3FK3A 5I8OL 4JPSA 4RNRB 3L3OB 3PAYA 4OJFH 2BHUA 3WIFA 1FZOA 2X4RA 2NQCA 5D1QE 1UXWB 4Q7DA 4X5LA 3T3MF 3FZUD 1ESOA 4PJFB 3ULUF 2LU3A 3APMA 4I48B 6FABH 3GXDA 4ADIA 4LCWA 2BRRL 4DZ8A 4S0TD 4KKCC 3CFQA 3QISA 4OGYL 5GSRA 3Q06A 3ARPA 2C26A 5F96L 5BV7H 3V6OE 3C60B 2CALA 2R0WL 3ISWA 4M8UA 2WW8A 4Z7WA 3TVMB 4LXFA 4LAJH 3AXHA 4DSYA 1JZIA 2X2HA 4XOCA 5A2AA 5E2UL 2P52A 3S3DB 1BIIB 4KQ0A 2J43A 3DO7A 4FQIH 1UJ3C 2QVIA 1DBBL 3TGXA 4XMVA 5JORB 4XXDA 4J4PA 3TF7C 3QFDA 1IEBB 5FYLD 1T3FA 4UANA 1IJ9A 2WSPA 2KZWA 4R90H 3ETSA 4X6DA 3QNXB 3Q6FA 4KC3B 1PNCA 4YGVB 3MJ8A 3SOBL 1XMEB 5C2BH 1G0DA 1I9JH 2NXYC 2XI9A 1IBBA 4H0GA 5I1HL 4OJDH 2V3FA 1L3WA 4N6QA 4WNJA 5AOZA 4AENB 4L3EE 4HALA 4NIYE 1I7RB 3QWOA 3FAWA 3KVPA 5GJSH 3HMWH 1QWNA 3VFSB 1CGYA 4YDLC 5FB8A 4DGWC 1U4FA 1KLGA 4PB0L 1SFDA 1Z9SB 3B4NA 4A2GA 2OAAA 3TA3C 3OX8A 1IT9H 2F53D 4L4TD 2OSXA 4TQHA 3C5SB 4HCRA 4R8WH 4GXVH 2VISB 4DCQB 1R3HB 2OMZA 2ID5A 3G5YA 3ARYA 3P4NA 1RUMH 2WLZA 4G8FA 1N0XH 5HPMB 2ZIDA 2C3VA 3QQ4B 4AQAB 4IM8A 3ZRFC 3NAAL 2DI7A 4P5TC 1DQJA 1SDYA 3KVQA 3UCQA 2K3HA 5IHWA 5GGSY 4EJ1C 2HTLD 2LVEA 3P9WB 1M05A 2VRQA 1CICD 2E0PA 3O2VL 4G9DA 2R8SH 5DO2C 1P4LB 3QJOA 4JFHD 4RRPM 2JVUA 5DJDA 3RBSA 1RIHL 2E75C 1GJWA 3D39E 1IAOA 5IEHB 2CCLA 3ABMB 4C56E 1S7VB 5FLUA 2B1OA 4ISVA 5L2KE 4L9LA 2CR6A 1Q0YH 3CDGB 4ZNEE 1F4WL 4F37K 2Z0UA 4MB1A 1X9QA 1ZVSB 4NQDB 5EU6A 5F7BA 3BDXA 5FUCC 3UC0H 4NT6B 3TWCH 3HMXL 4WKXA 1QO3B 2LE9A 3PNWB 2GEQA 1NC4D 3ESOA 3Q8AA 4ZAKC 4HWEH 2WXHA 1Z7JA 3TZVA 4K3EL 1JPST 4FCHA 3C9NB 4J3OF 3M88A 3MBXH 3U2JA 25C8L 5TE7L 1UD4A 3HKFA 1KJ2H 2DW5A 3HC4H 5F7LB 4MA3A 4XI5C 2AW2A 2YJLA 5FO9B 4UQEA 3VXMB 3NH7H 3US0A 2H3NA 2WYTA 4PQXA 4H88H 4BYHA 1JAEA 3S3PA 5I5JA 3PXJA 4QGYA 3TBBA 5EZJB 3AABA 3RAJH 4G6JL 4ELMB 5LWYL 1JGDB 2J6EL 3JWNE 3N43B 3CE1A 2R29H 2XJKA 2NR6D 4CU8A 1JNHA 4FTVA 4ZUVB 2B4CL 4PJDB 1DVQA 1EO8H 4LEEA 2Y2YA 2JE8A 1A6VH 5TE4L 2IADB 1QSFD 5E56A 2A74B 2A6IB 4KO7A 4HJ0D 4K5OA 4PB9L 5CBEB 4A2MA 5JLZB 2B77A 1UM6L 3ES6A 3IJSA 3BO8A 3QUZB 2J73A 5AOJA 3IDXL 4N87A 1RI8A 1BW8A 3KYNB 4YEEA 2QELA 1KPUB 1LMKA 4KXCA 4YFEA 2XDHA 5I1EL 1WWAX 5D2LB 1SYSB 5E9DE 1TTAA 3NN8B 2DZEA 1A1OA 3CVIL 1HTYA 4N90E 1J5CA 4K15A 1FYTB 3ZLQC 1KY7A 1MDAA 5EBLB 2BDNL 4CVXB 1TSHA 2BVQB 5D1ZI 3VFRA 3E6HB 3BAWA 3MQIA 4KFMA 2X41A 4GT7A 4F2MB 1RUAH 3INUH 4G7VH 1V5JA 2YGPA 4Z7UB 5H2BA 1IBYA 3FTGA 3RIFF 5GZOD 3SDAD 4P4KA 4UDUA 5CZKA 1WFTA 3CHXA 3ZYZA 4CC1A 3DX3A 4AYMC 4B9IA 1MCWW 3QIWB 4IOIB 5KVDL 5T1MB 2BH0A 1AE6H 4B96A 3BZEB 5J0BA 1DHKA 3MJ7B 4HFWB 4PRBA 1HOCA 1ODUA 2F74A 3P73A 4QXUH 5JPNB 2R1XA 4OLVH 5I74C 1G7HB 3RWEA 4DP7X 1CE6B 1PMYA 3NIDE 1VFAB 2CLVA 4J1UA 5AEAA 1HHIA 3U4EB 4PJFF 3VI3E 3KPTA 5EBMB 2FR4A 4HG4J 2QSQA 4Q6YA 4B9ZA 2Z4QB 5DVNA 5CEZH 4G8GA 4N0UE 1MPAL 2ZTBA 3G6DH 1VHPA 3JTTB 4KDTC 5JIQA 5DRZA 1U2CA 5KBPA 4NUJA 4KXBA 1TJHH 2X5PA 3APNA 1HWHB 2AJVH 2AQPA 4K3JL 4JO3H 4IU2B 4KRNA 5C0AE 5CEYA 5CBAA 4XTRD 5J56B 5KUMA 5D1XD 3LZFL 3LNIA 5SWZA 5I1DA 5DS1A 5EBWA 4Z7IA 2XKNA 4LL9A 5F3FA 2MHAB 2QVTA 5TTRA 2QBWA 1UTDA 3FTVA 3EGSA 4H0IA 1HILB 4NQSA 4LASH 3WE6A 1Q1PA 3TLRA 4ZW8A 4N5EC 4JPIB 4ZMYA 5JTWA 1P84J 4BWTA 4I18A 1JIBA 3IU3A 2YAPA 5FECA 4RGNC 2NX5E 1FVDB 4P2CG 1NGXB 1WLHA 4RGMB 5H35A 5FYJD 4BSWB 1EK3A 4X42A 4BZYA 3WO4B 4K23L 4OCNC 1MRDL 4AYFB 4GRWH 2Y25A 2J4WH 4RRPG 1BEYL 2JF1A 2ZNWA 4A7SA 3TL5A 4BSJA 3P69A 2ZWYA 3CSYB 1CYXA 4GSRA 4HGMA 1Z5LA 4W9ZA 4WJ5B 3KS0J 5IB3B 2BNRB 1UB5A 1OAZL 4I77L 1G9NC 1NLDL 2YRPA 3FRUB 1PVHA 3FQRB 3LRKA 4PP2A 2JI1A 3GUFA 2C34A 2FT8A 4JY5H 3TONA 3FCTB 2G5RA 3GIZL 4U6YA 5F1NB 5I8EA 4B5EA 2I5YL 1LO4L 2Q9OA 3BKYH 4MA7H 3HE6B 3T0XA 4FERA 5BQ7B 3LZRA 3UBGA 5GQBA 1LMIA 1ZLEA 2O4EA 4WU5B 3MUUA 5FK9B 3VB8A 4Z7AA 3L16A 4GQZA 4LPWA 4OIIL 1FG2A 2DTMH 1P9MC 4URKA 4ANXA 3X14A 1P7QD 1G9ML 2VDRB 3TO4D 4FXLA 5T1LA 1EFXB 1VERA 2D9CA 3L1FA 1AZZC 4HEMA 4Y2OA 2CO4A 4IKJA 3ARWA 2OX5A 5DK0B 3TEWA 3MOBL 1LLAA 3K0YA 3QG7H 3HS0C 2IH3B 1AR1D 1T66D 5D1QB 2Z8RA 3JWNG 5FA3B 1G7LB 4KHXL 2WYIA 2M83A 4IHOA 4NNPH 3KLSA 4JDZA 3MUY1 3EOAB 4LBEA 3HG4A 1QI5A 3IRPX 1JV2A 3ESVF 1A0QH 5AOKA 3EDEA 1A25A 4MKMA 5I5MA 1BVLA 2HH0L 1HHGA 2WVSA 2FQEA 5C0CD 4PVNA 4MMYB 3VFPA 1OL0A 1T2XA 1D6VL 3ARVA 1D5RA 5MP6H 1MXGA 2AJYL 3A6OA 4UDTA 1UOVA 5FKPA 3EJRA 3G6AA 3ORJA 3O8XB 3QUML 3U1SL 1P4BL 2QJDA 5MEND 1LWJA 4UOW0 3QI9A 5EC1B 4QRPD 5DEJA 3QT2A 4YVNA 1WTLA 2XWRA 2VDQH 3O4OC 4NKDB 1KJMB 1TNMA 5EOCJ 4GSDH 1HDMA 3MPCA 3FQTB 1E5YA 3ECBB 1NJ9B 4LESA 3H42H 3PABB 2ETWA 3DXAD 1X5MA 2L7UA 2VLRD 3AREC 4ERSL 2CHDA 1OTTD 4BFOA 1LDSA 2DBLH 2GUOA 1E6OH 1S5HA 4FG0A 5IB1B 3NACL 4L3EB 4LLDB 1DEEB 3AWFA 4CADA 4MJ5B 1IAKA 4ELMF 1P4UA 1XTMA 1Z9PA 5FHAL 5INDA 4HJSA 1DN2A 3CH8A 3N43F 2FEDD 4PJIE 3WD5H 5T5FL 1I7TB 35C8L 2OL3B 3OAZH 2W8CA 4OD1H 5FO7B 1N8OE 1OHZA 1S9XB 1A2YB 3V10A 4PJDF 4HXBH 5KSUA 2FWOA 5LNEA 1HZLA 2FNBA 3NCYP 4QOKD 3WTXA 3BDBA 1A3ZA 3K2KA 4G7RB 4PJ6A 5CHNB 3WFEL 1XTLA 1KCRH 2ODHA 2YQ2A 4R26H 5SWSA 43C9B 2BSSB 3ZZQA 4XCFL 5DFAA 4ZXBA 5ISZE 1MW0A 2VKXA 5LNDA 4QXGL 1NKGA 2WQVA 1H5BB 3QHTC 4ZO8A 5D2LF 1AQDB 4L1BA 1U8MA 3CC5B 3N55A 4DP9X 1EV2E 1MHEA 1UCBH 2ED8A 5F7EL 5J1AA 4PJGE 3ZTNH 2XQYK 2PCFA 3IPEA 2VR9A 3N5AA 4P23C 3SE9L 2Y5QA 1PKQE 4AG4H 5JXEA 2Y07H 2H0FA 1P84K 2APWA 4ZTPL 4X0KA 2I7SA 1QA9B 5BUGA 4WVRA 4Z7UF 4NS0A 4HUWA 1KGIA 1U93A 3D39B 2QPFA 2IXQB 3GMLA 5EA0L 3L4YA 2D3NA 3FUDA 2HJKB 5L2KB 1TETH 5JDSA 3F7VA 2K9FB 3KDMB 1QTSA 1T2JA 4X4YB 1YCSA 3JTBA 2XU9A 4ETYA 4WW2C 1PYWB 4PRPE 3L3GA 4J2XA 2CIIA 3BX7C 3LH8A 1A1MA 1C5CH 3Q8EA 4HMCA 5JPMB 4D9RD 1PDKA 2XWEA 4IRZH 1T21A 3MTRA 4RETB 4E41E 4NNXA 5CEXB 2DLFL 1MWAH 4P4RB 5MERB 4QD2E 4ECNA 4HWNA 2FEEI 3S35L 2DH3A 3D08A 1G87A 2NW2B 4XNBA 1FVCB 4XVOA 4WI3A 2VAAA 1MY7A 5D7LE 5FF6B 5KSAD 2YD8A 2YRZA 2VZOA 3GSXA 5ILTL 4G1MA 2CO6A 1ZWIB 1Z32X 3VRLF 5DJZA 2PCYA 4FJYA 4P46C 1MJ8H 1OSYA 4K9EH 4AT6A 4BZ1A 2BVPB 1E42A 3EGXA 2HFEB 3IGKA 3M1OA 4NPYB 3QZWA 2EEAA 2XWTA 4NBZB 2VR4A 5E4IA 1E9PB 2PWHA 4AZ8B 5DZOA 4FQHA 2IPUG 2CE6A 3GSNB 2R23B 4TVPD 3CK0L 4TNVK 3SDDB 4XX5A 3VD4A 3TNNA 3WNOA 4YHYC 3PPSA 1XDTT 3NPSC 5E08H 2BJMH 1J9TA 1RZ7H 4FQLH 5FFOA 3UTPE 2EQDA 1FNGA 4OGQC 1GGIL 3VXRD 4G80A 3BISA 4EI5C 3GZKA 5EC2B 1H3VA 2HVBA 4Z7QE 2P5EE 1F90L 1BEXA 1NWPA 1BD2E 5BO1H 2DEWX 4FXKB 2BIQA 5FGBA 3UZQB 3ETBJ 1W8EA 5EB9A 4W6XB 3VH8A 1DSFL 2PPAA 1FO0L 5T1KA 5C70A 1CDUA 1NAMH 1TITA 3C5ZC 3FCBA 1HIML 3MLVL 2X4UA 3FF8A 4NZFA 3RZCA 3NOIA 4LO9A 2V7NB 4F7EB 5I17B 4H2CA 5FOBA 2OQJA 2R9HD 4M7ZB 5I1LB 1DVFA 4TOYL 2AJXL 1NCAH 5IFHL 3UH8A 4P3DA 1BOGB 2EIEA 2FX8H 2YAEA 2B2XL 3JT2A 4FEIA 5CZVH 4MNQD 2FEEL 2XC8A 4ZSOE 5J6SA 4DP5X 1UT1A 3BOVA 3SD5A 4MMZB 1U2HA 3TV8A 2OK0L 1F1AA 2R51A 3NIDB 4NJAL 3X12A 3VI3B 1KTDB 5C8JB 2DM4A 4YSDA 4MQ7B 1CBVH 4WK0B 1KGCD 1Q94B 2QVKA 3ARDA 4HSAC 4HUUB 5MI0C 1AR2A 3M17B 2XWJA 3N1FC 2H32A 1QLFA 4GMTL 4N0UB 2LW3A 4TUKL 1GRWA 2OZ4H 2FHCA 1R6VA 3IDIB 3ARFA 1D5XB 2JIXA 4FA7B 1S78C 5HDRA 1EWHA 1F5WA 4APQC 2P8PA 1YC7A 1GW0A 5C0AB 2B14A 3GS0A 3LV3B 4AYID 4E9QA 2AV1B 4LE8A 1VZIA 1MFNA 3KEHA 4ATTA 2XXMB 5FA4A 1XCWA 4POYA 1L9SA 4KITB 3FUMA 1M4KA 4EF3A 4D9LL 1S9YA 4Y5XC 3TBWB 3BUBA 4XAKE 4J6RL 3L4WA 4K3HA 1G0YR 1ET5A 3GINA 3HRPA 2QQKL 3PQYA 4IRJD 1QRND 1SVBA 4UYQA 5IVXE 3KWTA 2VERA 3FF7A 1KB5H 2EUVA 5FLVA 1A7PH 3KJ4B 2NX5B 2MTPA 3DBXA 2J1XA 1WO2A 5IVZA 3ZRSA 4BKTC 4XX1E 4I5BB 4P9HH 2BNQD 4QXTB 2ITDA 4P8QA 5FYLH 3LMJL 5DHVH 3RDTC 1JZ2A 4W9CC 1Q72L 1GGTA 3T0EA 2VGLM 5KSBE 2AF2A 5AW9B 2VN7A 1WBXA 2L4OA 1P5UA 4CBZA 2J88L 1M2VA 4GW1B 3D2UB 2AEQH 3H4HA 2ITCA 3MROA 4YL4A 2IV8A 3GIVA 1OF2A 4XAWH 1I4FB 2GBAA 4RWYH 4D2NA 3FU8A 4ES8A 1A64A 4A55A 1JHKL 2F54D 4YHLL 2AQ2A 4ANUA 5FCSH 1OHQA 4DTGH 4UB0H 4DW2L 4YE4L 4NX0A 4RCAA 4H1LA 2Z8VC 3FFDA 3MV9D 2WINA 1J0KA 4N2LA 1BM7A 2UY7A 4YZWA 4L0YA 2VL4A 2VZUA 1KYOJ 4HJJH 5C8JA 1A9EA 3QPXL 1VCAA 5B7EA 4UQ2B 5AKVA 3B2VL 5KZCD 5HI4C 3SZ6A 3BDYH 3GNML 2DD8H 2XLLA 5E99L 3W2DH 5F0MB 2OMVB 4S1DC 3B9KD 4N68A 1FO0A 4D9QD 1UVQB 2W80C 3AWGA 3BH8B 3QWRD 2YD9A 4JFFD 1A4JB 4MJIA 5AVYB 3V4UL 3WDHA 3QNYA 5CCKH 5CKAA 1IIKA 1AG6A 4M7LH 4EN3D 4NP9A 3BUYA 2PTTA 4UTAH 1IC0A 3FO9A 1LO2L 4AIOA 1DCLA 2XN1A 3G5XB 1PLBA 1MH5A 2FATL 4KHTL 3QQ9D 1SN0A 4QGTA 2IGFL 1V54B 1E5BA 3KPOB 4C47A 2X70A 4PW4A 2E9GA 3AXLA 5FXCH 4DN4H 5BOPA 3FTSA 4GW5A 2Y69B 1B6UA 4X7TB 5E5MB 3WTVA 4QHLB 4LCUA 1TIUA 3UPRA 2V5TA 4CBPA 3W5NA 2HMIC 2VLME 2VM4A 3BHBA 4Z7WE 3W0WD 1G7IA 2MQ0A 1K4DB 1EAPA 2WLIA 1RUPL 4G1EA 3PDDA 1UM4L 1CLZL 1MJJA 3BD3A 4CJ0A 1ASPA 1FNEB 4QWWC 2AZUA 1A7BA 4WTWA 3X11B 5CCHE 3HRZB 1OAYL 3CDCA 3NJIA 3RRQA 4DVRH 5I30L 3BUQA 2QLYA 3FN0H 1PSKH 1R3JB 1C5BL 4PJIB 4ODXA 2Y3AA 4X6DE 2VLKA 4MFHA 4HF5H 5K33A 3VFMB 4DKFL 4R4BA 5GGUB 4FQQA 4Y4HB 3GSQB 4XGZA 2WLLB 4EZKA 1URIA 3IAPA 4JO4H 5F3BA 1BFOB 3GDBA 3L5WA 5KVEH 2CBQA 3D4YA 4TSBL 3WNNA 2GK0A 1PAZA 1OB1B 4MNHB 3QDMB 5LGJA 1UH2A 2IAAC 5IFJA 3VYNA 2LT9A 4HJTA 1QTYT 2E9JA 3QIBD 5ISZB 2UVFA 2WTRA 3KL0A 1QNIA 2NY5L 4NZTL 2EDOA 1YJDC 1BQHG 4PGZA 4JHUA 2AEPH 2P47B 3O6FC 1JD7A 4PJGB 3QR0A 4MS8C 1U8IA 3WEXB 5DVOA 1ZANH 5BW7A 5L2JB 5D7HA 5B38A 4J3BA 1DFBL 1PKQB 2AKRB 2EYRB 2DWYA 3IEAA 3LPOA 4FHBD 4LSPL 4ZUWB 1FLRL 5F6IC 1KG0A 3BIKA 3Q01A 4GIPD 1O7DC 2Y6SD 3MAWA 4NRXA 1I1AD 5ERWA 4R0LC 3GSUA 1JWUA 3FQXB 1J10A 1NM4A 2APSA 5H8DA 3LNFA 4XX1G 4Z18A 4IKNA 5BOZG 2AK1L 2NOYA 4O02B 3NJLA 4HJIA 4X6EB 5DFVD 3BI9X 4N0CC 3S3CB 5T3XD 4BINA 2X42A 2VL5B 4BDVA 2R0KL 2IAMA 1HHKB 3KLAB 3R1GH 2CK0H 4BH8A 1EHXA 4JL2A 2FL5A 3BWAA 1YN6A 3NIDF 4PRPB 3VI3F 1KCVL 5G55A 1CK0H 2X3BA 4JDEB 1NCDH 3NFSH 5E6ZA 4FFWD 5EPMB 2ZXEB 2EYSA 4GIAA 3GMQA 3U4AA 2B1AL 3FFCA 1A6ZB 4G6KL 3ZHKA 1YYMH 3CVHA 1HXYB 4E41B 3ULUD 1CO1A 5CUSL 5AZ2L 3LKSB 2DQFB 4Q9BA 1PY9A 5E9AA 2YWZA 4OCXH 5HI5C 1EZVX 3ECVA 3KGSA 1BYOA 3L95A 2AQNA 4OY9A 4WUKL 1RHHA 4C54A 5E4AA 5EU6E 15C8H 3E2HC 5L9DH 4QEGA 4QKXB 4MZRA 4F7PB 4UTBH 4CW1B 4CSTA 3G6JA 3QB7C 5DRXA 2ZOLB 1FUNA 4M7JL 4F2FA 3B3IB 4KBPA 3WHXA 4MRBA 5D55A 3H9HB 1FCGA 5DFTA 4HKJB 1M7IB 1PJWA 1WWWX 1D5BB 1JHTB 3BPOC 7CGTA 2Z7ZA 3SDCA 2Q6WA 3MLRH 3JTSB 3NRPA 3ULVL 1ZLVK 5GHWH 3F83A 1CD0A 3CWGA 4KO9A 4NO0A 1P6FA 4BWUA 4M93B 4D7BA 3F12B 3IPFA 1XIWC 1M7DA 5DYFA 3FC8A 4YHIB 3TPKA 1XGYL 4HC1L 2CBOA 3BAKA 3IN2A 4DP4X 2J56A 1EVUA 3VJ6B 2WLKA 3LZOA 5JHDD 4HDIB 1J5OL 3QFGA 1U8PA 1URZA 4Z7QB 2P5EB 4Q0XH 4BIKA 5CFAA 3FUNA 3DIFB 1BD2B 4XPHL 1YQVH 1JV5A 1PNDA 3WTTA 1IQDA 2GIYA 3WO3B 2NUTA 5IM7B 3NRFA 4FTVE 4UT9L 1OTUD 4ZG1A 3QS2A 1QSED 3NJKA 1DVXA 1I53A 3BD5A 5HHOD 1ND0A 4JAMB 3VM5A 4JHAH 4NKOB 3H3KA 2AXGB 3QO0A 2ROXA 1SEQH 3QUYB 1H6TA 1U58B 4AK2A 2EEDA 4XBEL 1LO3H 3VXPB 4F93B 5GGVH 2P5WB 5KYUB 2ZQKA 3T8MA 1ZLDA 3NSDA 5E8PB 4X9HA 4JDVB 2QQNH 5F3HB 3WIIH 2CRMA 3SE8H 1TU2A 4HU8A 4ZSOB 5DHDA 3EOTH 3IS0X 1IFHH 4OCRL 3V0WH 3S3SA 2EDRA 1ASQA 5KBLA 1QFWM 4N25A 3E8VA 3FO2A 4AEIL 4YC2B 5I24A 2GITB 2HKHL 3C6LD 2DMHA 3LQAH 1NTDA 3E1ZA 3ROLB 5D70H 3U0WH 1S7WB 3IMUA 3ZKXB 2CD0A 3VQ1C 5IIEB 3SCMB 5BXFB 5LGKA 3UTQB 1KT2A 4IYKA 2J1KA 4FXGC 4ZMQA 4LB8A 4OUOA 3FSZA 1SOSA 1BQHB 2OFQA 4RBPH 3ZZSA 3L8QA 3HZVA 2CA4A 2PR4L 1INEL 3MVSA 3QDGE 3QYCA 1GTFA 1MFBL 5F70A 1OAQL 3KWUA 1OARH 5AVZB 1YHPA 4A6YA 1KBGH 2EVJA 1XWVA 1RZGA 3KYMB 2A73B 4KWUA 2HFTA 1EJ8A 4FQ2H 5IVXB 4Y4FD 1HHJB 4AIZB 2PO6D 4Z78B 2I9TB 3O0LA 5DQDL 2ZG1A 2ATPB 4ZMOA 3WY1A 4HGWA 3MRPA 5IK3A 1SXZA 4OLXL 3WY2A 4NENA 3RHWF 1SQ2N 5SWZE 4AC4A 2GIMA 3LTVA 4O51B 4NZJA 4PCYA 4PS4H 5KSBB 1FVEB 1JZ3A 3P2DA 1UACH 1HQRA 1NUFA 5KSVB 4J3WA 1JFHA 3EO1B 4W1TA 1RK1B 5F7WC 4OZGE 2WNKA 3Q5TA 3I9GL 3IDYB 5D7IA 2MMXA 4PJIF 2XA8L 4DN3L 3GMOA 1QX1A 1QUNB 5ID1B 3IMBA 4P06A 3L7FB 5HYJE 1JWSA 4UQ3A 1JSYA 5DLML 1WGVA 2WLYA 5IHUH 3BH9A 1AXTH 4I3SL 5I5RA 4P99A 1CQKA 3TBYB 5DI8A 2X1QA 4KDWA 1X7SA 3GRWH 3MV11 5EOTB 3SYOA 1MIML 4OQTH 3GMPB 2F7OA 3BGMA 3T0WA 2XQBH 2X6MA 4L29B 2EXWD 3P30H 3HE7B 4UM9D 4ESKA 5IB2A 4RMVA 3OKOB 4WHYH 4PJGF 4Y9GA 3V4VA 1JHLL 1Z0NA 4WWKA 1NMBL 2CCWA 4BFNA 1T5WB 5I8CB 4K7FB 5CN3A 1SVZA 4IGBB 5I1KH 1IBFA 2FO4A 2BX5A 3RB7A 4D7PA 2R1WA 2PW2A 3GXUB 3NFPB 4R4FH 4XRCA 4L8CB 2ERJB 1IKNC 3GO1L 5DQ9A 3W11D 2GHWB 3TC9A 1JZ5A 1HFUA 5D5MA 4D3CH 2Z64C 1JF1A 5HHQA 5J1SC 2YAHA 5FFGA 5BVPL 1UWEL 2YUVA 4QY8B 1QHOA 2WC7A 4H20H 2OSLA 3NQIA 4I9XA 5ITFB 1B2YA 4PEEA 1JPSH 4U33A 5E8EB 1W91A 1RJZB 4AMKH 3SKMA 1JD9A 4L8SA 5BMFH 4XVSH 5AKRA 2W65A 3RWGA 1MCJA 3V0JA 3S88H 2UZXA 1T2QH 3WIFB 2W9DH 4YFLI 3LNDA 4GB9A 3WTYA 3A3YB 1RZFH 2HA1A 3A67L 4DZ8B 3TCXA 2VZ1A 3LSOB 1PL3A 5GSRB 1Z9MA 3HZKB 5I9QC 3C60D 3IDUA 4Z7WB 4LSVL 4MAYA 1B88A 1JNNL 1EAJA 3OKDA 3P3YA 2APXA 5F88B 7PCYA 5A6IA 3V52L 1D3CA 1TJIL 2WZ0A 2ZUWA 3B2PA 2HRLA 2VM9A 3N41B 1HH9A 4WFFD 3TIDA 2QQLH 5JIHA 3GHBL 1J05A 4XXDB 2BP0A 4PGCA 1T3FB 3SYCA 5HP5A 1MCOH 1BVZA 1GJUA 4X6DB 4YHML 2MOQA 3OKMA 3Q6FB 1D5IH 3DDFA 2HP4A 2XFGB 2XY1A 3C87A 3MJ8B 1OO2A 3ZY7A 5E2TH 5E8NA 1WZ1H 3EJSA 4LOVA 4YBLC 3FB8A 2R59A 3FH8A 1UGNA 2F5BL 2ZONA 3WSQH 1TUPA 1XCTA 3T1FA 5GGTL 2NY1D 1BBDH 4Z7QF 3QWOB 5B7MA 3HHSA 5TF1L 3P9LA 3GXTA 4X6FA 3U9PL 1KLGB 3MRIA 4M9PA 5CJ5A 3AS2A 3OZKA 2Q7NA 3OX8B 1RJCA 1QZNA 2IOIA 5BOJA 3ARZA 3P0YL 2HJLB 1S4IA 5SWSE 3ZX1A 2C4FT 2OMZB 4W70A 5ICZB 3G5YB 3GMRA 2GJPA 1A22B 3E0GA 1RERA 4JK0D 3CX5J 2C3VB 2VMJA 4XN8A 3JV0A 3D52A 4PP1C 4DHLA 3QR2A 3L4XA 1DLHB 4XPFH 1RU9H 3CZLA 5TGBA 3VTAA 5I1JH 4PUBH 3MODH 5HYFA 5JZ7C 2BS8A 1JCVA 1FC2D 1H0DA 1M05B 2YA1A 3LN4A 4BWWA 5LJYH 4G9DB 4U4IA 4NUPA 3ARSA 5K9KA 2XFXB 2ZOWA 3UG4A 1GHFL 1FLTX 5DJDB 5HHMD 4W9DC 3V0HA 3REVA 3MV7E 2V9QA 2WZ5A 4G8AC 4FKEA 1IAOB 3D50A 3WL9A 2K70A 2G0LA 3ZTJG 4L1TA 5IBTL 3TO2B 4ISVB 1RK0B 1AFVH 2WSKA 1QBLH 4KFZC 1R17A 4HKXA 3U48A 3DV4A 1HCZA 1M2OA 1U3HC 5EU6B 1RIUH 2LU5A 1UOWA 4NQDD 5IJCC 3V55A 4N8UA 1OKEA 3O45A 4J3OC 3PHOA 1T03L 4F37F 2A3TA 3B1TA 3GGWB 4KX9A 1N5YH 5IVXF 1AI1L 1WICA 3A6CH 3QQ3B 1USZA 4OZFH 2J8OA 4JRXD 2EDLA 4JVWA 3CXFA 1YNLH 4JFZH 2OI9B 2YPLD 4O58L 3GDCA 4L4VA 1BQRA 2WYHA 3VDCA 2CNYA 5KSBF 2PPCA 4HOZA 5AYUL 4OSUL 2PETA 1G5AA 2YZ1A 4HD9A 1M1XB 3SHSA 3VXMD 4WO4A 2H3NB 3F3HA 3LH2H 5DEGA 2A9DA 4PSPA 1XSIA 4AITA 1R46A 2Q20A 3BSZH 3N42B 2V17H 1LEIB 1YQ2A 4R2GD 4NC2B 2AVGA 5DZPA 4TPRH 1F58H 3BUDA 4PRNA 2OTWA 3PV7A 1JNHB 4FTVB 3TFKD 4RLDA 4XC3L 1BAGA 3MYJA 2IALB 3CZEA 4DUWA 5KEZA 3WFBL 1GIGH 3J27A 4XBGA 4QRTB 1J1PL 4HIQA 2Z4TA 1ZS8A 3R18A 2ZZUT 1WFUA 2BMKB 1TFPA 5C7ZA 1OP3K 2W9EL 4RISL 1JPFA 5A16B 3IJSB 1KY6A 3QUZD 1DQVA 5IOPB 2V5YA 5KWYC 3GZOA 2FJSA 3UGUA 4WGWB 4N2EA 4OT1H 3WEBA 2OMXA 1QSFA 5JHLL 1MJ7H 2BOCA 4LHQB 1FYTD 5IG7B 2D7OA 3OLDA 2NY0C 1UADC 1MW3A 3VSTA 4KRMB 1KTCA 3VFRB 3BKJH 4DP2X 2ZCHH 5F9DC 3QZNA 2RAMA 4HV8A 5DXWA 3TURA 1DVYA 1X5YA 5H2BB 3FTGB 4P4KB 4UDUB 2AK4A 3MRDB 4NO3A 1DQIA 3VSQA 3R0NA 3PGCA 4BZ2L 5HVWA 1KFGA 3TEYA 3T08A 3OD3A 3F6IA 2LU4A 3SDAA 4GPVA 1NCCL 1E2WA 3RWEB 1VADA 4LEOA 3HBPA 4J1UB 3QDGB 3TVMC 1I7UA 3WOVA 5I28A 3RWCB 1HHIB 1MNUL 4PTTA 4KTDH 3SYAA 2ZAHA 2FR4B 3HVNA 4B95C 1AKJD 2VABA 1T7ZA 2BIPA 2CH8A 4NCC1 2VZSA 4X80H 1HC1A 2OKMA 1HK6A 4N5ED 3MLXL 3R8QA 1FIGH 3ZDWA 3CXDL 5AAWC 1AIZA 1E27A 3OWEA 4NUJB 5DD3L 2GTQA 3ZKND 4Z7WF 5TFSH 4Y19D 3PLYA 4UAHA 4GLRH 2DQCH 2DIJA 5CBAB 3N41F 4OD2A 3AUVA 5SWZB 3QORA 3F62A 4YK4C 4CL7A 5I1DB 1ZEAH 5EBWB 2XKNB 4GW4A 1IQWH 2BZCA 3SYQA 3CX5K 4HK3N 5AW1B 4EVNA 3DETD 1T6WA 5IBLC 5JOPE 3QRGH 1MCBA 4FKKA 4WGVB 1GMIA 3DOHA 4G70B 1BZEA 4OZGB 4G5ZH 1TQWA 2YGOA 3PQYE 2UZYB 4UZGA 4WEBL 5TK4A 3S36X 4X6DF 2BY0A 3I74A 4I18B 3UAJC 3IU3B 3DRTA 3SGEH 2RFXA 5HYJB 3P11H 4QTHA 4P05A 5FECB 1MFAH 3NTCL 4X7SL 3QARA 1W72A 4Y16D 3DSNA 2X88A 2QADD 3MRNA 5EDSA 1MHHA 4RZCB 2ZF8A 2ICES 2AS5M 1E4HA 3SJVD 3N6YA 4K8RD 2K6ZA 4B41A 2PYEA 1QLEH 4YDKL 3O6MH 3AJ7A 3BZFA 1Z5LB 3U0PB 3OKKB 3V6FA 4WKZA 4YSCA 1EXGA 4IBTA 3MU3A 3KJ6L 5IQ9A 2W94A 2XUWA 1CE1L 3OGCB 4LU5H 4DO5A 3O3DA 2QQQA 1JYWA 1FE8H 4OZIE 4AYSA 3IXAA 3VDAA 5KYYA 2JLPA 3NK3A 2NSMA 5I73B 4FYTA 1IM9A 4E68A 2GJ6A 3MNMA 4N0RA 1AAJA 2DMGA 4G6ML 2H2PD 4NWUL 1T0NA 4NUQA 4ZNCD 3H2PA 5DC9B 4XPTL 2WWKT 3VA2C 4OCYH 2GJRA 4KQ4L 1UXSA 5T1LB 3OSVA 5AAMA 3K2UL 3J8F7 3CV5A 3RQ3A 4R96B 4Y2OB 1WISA 1UWYA 1XGRA 2VDNB 2E27H 1CLYH 5BZWA 5JHLA 2J3SA 1TZIA 2B4CC 3BZ5A 4JFYB 4JGMA 5C0BE 3UPAA 5T3XH 2OBGA 1RULH 3OXSA 3TEZA 5C0FA 4H25A 1HJCA 4IHOB 4CC4A 3KVDD 2UXVA 4FFVD 2X9WA 12E8H 4MJIE 4PI2A 5KVFE 5EZIH 4CC0A 1AD9B 4Z7OE 1CT8B 5GGSB 3W82A 4BV1A 3CFMA 1AQKH 2DTSA 1P7HL 1UYWL 4X5WA 1HHGB 4UZSA 3U82B 3HB3B 3HA0A 3ULUH 3HAEH 4BZ2A 2DI8A 3VFPB 5I6KA 3WN5B 5CZXC 3OKEA 1KDJA 4UDTB 3FHAA 3O3EA 3CZJA 4PG2A 1PX8A 2GBVA 5IQLA 3QI9B 3S0PA 4YDIH 1CFNA 1QLRA 4JB9H 3VH8G 1JGVL 1S7TB 4LSSL 2PCPA 3EH4B 4YHKL 4X4XA 1HDMB 2LQRA 1HKLH 1UXLA 1WAEA 1MF2L 2DLTA 1ORSB 4JG0L 5MENA 3U46B 5CSGA 3FB7A 2VDOB 3QDJD 4IBUA 4NBYB 2X44D 3UTTA 4F8LA 3RGVA 4WFEE 1A47A 3TESA 4K73A 4IOSA 5A43C 1R19A 1G7MA 2AFNA 4XNDA 5ICXA 1EEYA 3LHPL 4J2QA 2A6DA 1CF8L 3D0LA 3P4MA 4QO1A 5GRUH 5ADOL 3N42F 1IAKB 1T5XA 2I07A 3HN5A 1SHSA 4ES9A 1Y6KR 5INDB 2VLRA 3WAJA 5HGHA 2CO7B 2PTVA 1PCXA 4A66A 1IFGA 4AW7A 4AV0A 4N2BA 3ARQA 4H40A 5KSUB 3QCTH 3H3PH 1HE7A 5FGCE 5E00B 2HWZL 4NWTH 4P23D 4ZX6A 3P3SA 4UU9A 2D7PA 1IGML 3R19A 1BG1A 1XGPB 1FAKT 4DZBA 1P4IL 3GTVA 5SWSB 1KN2H 5IW1A 1ZLSL 4B5ZA 1KIUA 3M7OA 5LDUA 2W1NA 2VZTA 4K5PA 1MRCH 3DI2B 2HZHA 1M42A 3RY6A 4QOKA 3BMWA 1CDJA 2X0WA 1T1ZA 3I50L 3MJ9L 1OPGL 4CNIA 2GBTA 1MHEB 1XGZA 1G7JA 2G0KA 4X8CA 4NHCL 4Z5RA 1UFUA 4NM4H 5LAXA 3ATEA 5J1AB 2PCFB 4YLBA 3X1NA 1L6ZA 4M48H 4ALAL 2XY2A 2R83A 5CINL 4CUCA 4PH8A 3IFNH 3QIWC