4X98A

Immunoglobulin fc heterodimer variant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A01
5J4MA 4WIQA 2F74B 3Q1SH 4GH7B 4F58L 2VO5A 3W0WD 4HUVB 4OLYL 1DBKL 2Y25A 1B3JA 4PJHA 2NXYD 1S7RA 5CAYB 4BFEA 2CLZB 2HLFC 5DRNA 2YBRA 1OY3B 5GGSY 4ZD3L 3PDGA 2IADA 3B8SA 4QXUH 5GGUA 1QBML 4R7NB 2L0DA 2PTVA 4Z77A 1G0XA 5K9QI 3WLWC 1P4IL 4WHYH 3QP3A 5LAXA 1EZVY 1V3JA 4F7MB 4LEXH 1IILE 4OCYH 4P2RA 2E7HA 1F90H 1F3DH 4M5ZL 1JMZA 2CDFA 2QQLL 2R2CA 4PJHE 3OPZH 4OD1L 4L29B 1VHPA 3WNOA 3MNZA 3H2WA 1JK8B 4PJDB 1JGDB 4F33A 3QDAA 2AI0H 1G7IA 4MWFB 1FIGH 3QHZH 3REVB 4JFOB 4M1GH 1OP9A 5E94B 5KVGL 2XKUA 4I0PA 1IJ9A 3DUHA 3G08A 3MRCA 1D5XA 1IGML 4P9HH 1OT2A 3T3ME 2HT3C 4P2RE 3UP1A 1YYLL 1KCKA 3OX8B 1A6VH 5DD1H 3IDMB 1A3QA 2P8LA 1DEEB 4L3ED 5D7JA 5D7IF 5HDQH 5E99L 5I18H 4XNUL 3WO3B 5LGJA 4OKVA 4ZFZB 3EO0B 3CSYA 4P57B 4PR5A 4X4MA 4JO3H 1QFUH 1BPVA 3ORJA 1BQHB 1G7JA 4GMSH 4GRLD 5DJXB 5HHVH 3SHSA 3KPMB 4TSBH 4RRPG 4PJXE 5ADOL 3LQAH 1QRKA 5DA4A 3ALXA 3LKNB 2F15A 43C9A 1ZVHA 4HW6A 4OFYD 4M8QA 5E2TH 3MNWB 3D85B 4EXPX 3S88H 4ZTOL 3STBA 1KJMA 4V2BA 3JBG7 2E6JA 3T2PA 4X4ME 2BXZA 3P30H 5T3XE 5I66A 3VRIB 3QDJA 5ITBH 2C3XA 2GJZB 3CFDA 3VXOB 2BHYA 5D6CA 1M71B 4XAWL 4DVRL 4LDOB 1JZ6A 1VFUA 3CFBB 5F8QC 5JIHA 1RZFL 4H8WL 1J10A 1U3YA 3RRQA 4ODHL 5HGHB 3LVEA 4POYA 1EBAA 4KMLB 4PJHB 1S7RB 4RMVA 4XPBH 3FN0L 5DRNB 3DV6B 4OCRL 2P5EB 2RBLA 4IJ3B 4OBSA 5HVGB 3G5XB 5KJRL 5J3HD 4P59L 4Z77B 3QDJE 4LRIA 5F9OH 3T4YA 4UB0L 3NFPB 5FUZL 1FHGA 4P4KA 1MHPL 4M43H 1ROWA 4N9GA 4N8CL 3WUWG 1FE8H 3JTSB 5HYJD 1AJ7H 4HUUB 4APQA 2XQYG 1A7RL 2EYTA 3SGEI 1CXEA 2FCBA 1BBDL 4NYLA 4KDVA 1SY6L 2ARJB 3OKKA 1TCMA 4WW1A 4F33B 4PJXB 2JCCA 2HFTA 4P3CH 5KSUA 4D9RD 4Y16A 1FYHB 3G08B 5HD8C 1D5XB 1S7SA 2DAVA 4YUEL 4BSJA 5CSGA 3NZ8A 4RFEB 5TF1H 1YJDC 4JJ5A 1G0YR 1A9BA 4MYWB 1N64L 1BJ1J 1YN7B 3SDAC 2P8LB 5D7JB 2HN7A 1J0ZA 1U3ZA 3MJ8A 3KDMA 4DAGH 5LGJB 5GRUH 2R29H 4PR5B 5DC0A 3VGAB 3RZCA 1S5IH 5I2IB 3FL7A 4FFZL 4GG6F 2Q8BL 4UINL 4XC3H 1Z9LA 2JCCE 4ZUVA 1DVFA 2X9XA 4PG9B 3FT4A 5E8PA 5MP6H 2CD0A 4CW1A 3ARDC 1Z3GL 2FATL 1I9RL 3EHBD 3QJFB 4Z0BH 1A4JB 1IQDA 3ARED 4M8QB 2RCSL 3PABA 5E5MA 5H2BB 4OLXH 3VWKB 3ZE1E 5K9KA 1WICA 1MFBH 3NN8A 3CX5K 2YPKA 4J3WA 2MPAL 4R2GC 5DEGB 2F19H 5A16B 1OM3H 3GSUB 1KLFA 3QDJB 2OXGA 2VZTA 3NCFB 1V5JA 1YEGL 3CFDB 5GSRB 5HYIA 1A21A 1ZVSA 1WBXB 3BE1H 3LKRB 4KFZC 3AMKA 1HHHA 3TC9A 4EQ2A 3UZQA 3EO1A 3IGAA 2MQ3A 5C0RL 3F7QA 2DLTA 4FQHA 3RGHA 4JG1L 5TE7H 1VFBA 4KI5D 3FOMA 4R26H 3WSQL 4L4VA 1CL7I 5H94A 1YC7A 4GW4B 3GMNA 1MCLA 3T4YB 5GRXG 2LU3A 3VFPB 4DZBA 3W2DL 1AQDB 4LSTL 4P4KB 5IF0B 2AXHA 4IRZL 1BAFH 4JDVA 1LO4L 3A6BL 3FT3A 2A1WL 1II4E 3HNTL 5SX5H 1AXTL 4NYLB 5J12C 3OKKB 1U6AH 3CFCH 3I50L 5BQ7B 4L4VE 2BDNL 1SVZA 2OL3A 4WUUA 4UDUA 3D9AH 4O5LH 4XCYA 5CGMA 5GGRA 3AXLB 1OAKL 5KVEH 3VGGA 1YEJH 4TSAL 4CDHA 4AIZA 3S96B 3QCVL 4Y16B 1AFVH 4UAOC 1NL0H 5HGAB 1K6QH 1S7SB 1JNHB 4NN7C 5JW3L 5FGBC 3NCEB 3VRLF 2APTA 3ZKSD 1IGYB 1UKTA 2CRYA 1JRHH 1NCBL 3MJ8B 3KDMB 4KH2A 4YHZH 5ICYA 1P84K 5CP3A 1S7WB 3RZCB 2ATKB 5JOFA 3C60C 5H37G 4WUUE 1WT5A 3TT3H 5HBBA 1E4WL 1B2WL 1DVFB 3BGAA 5E8PB 3FT4B 3DNKA 4XGZB 3BYYA 4MGXA 2PR4L 1AIFA 1OAYH 2HP4A 1IQDB 5EWIL 1U8QB 5F44A 3TZVD 3PABB 5E5MB 3E3QC 2Q86B 2YXMA 1NFIB 1ZHLA 5GS1A 3LKSB 3TBYA 5GZOD 3A0OA 4I3RL 5K9KB 5L8JB 3K0WA 4ODWB 3C2AL 2CKBH 2YPKB 3HS0B 5DRZB 4I0PD 1AQKL 4G7YL 2B1AL 1UENA 4WFED 3GIZH 1ZAGA 3CJJA 5JNYA 4LFHG 4M5YH 1MRCL 5LCVH 3DROB 5TQ2H 3KPOA 2H2SC 2F54B 5A2KH 3A67L 2WBWB 3EO1B 2GSIA 3K74B 4JFXA 4ZAKB 1EUTA 3CDYA 4X6CE 2X70A 4BFIB 1JWMA 2FGWL 3ESVF 5GRWA 3ARFC 4IIQA 4JAMB 2UZYB 2IPTL 3TIDB 1NKRA 2F58H 3C5ZB 1RURL 3SKUD 5H94B 3NIGF 4YDKH 5JHLH 1RUKH 1INQA 1MVUA 1FNEA 2CPCA 1EJ6A 2A9NL 5J57B 4XTRC 3L95B 1OF2A 1SYSA 5B3JE 5JHDA 2ATPA 4DZBB 2HJLA 1PSKH 5L9DL 3CX2A 4K3DL 3KXFA 5ICZA 1JHKL 4GUPA 3UJIH 3TO4A 4IMKC 3IFLH 3MA7B 2N7BA 4WUUB 4UDUB 5FF6B 4QHLA 3UDWA 4EUPG 4DTGL 4JCMA 5GGRB 2W07A 5B38A 4AIZB 3CX5J 1PG7W 1FNSH 1ERNA 2FZ3A 5JHDE 1UB5B 1YQVH 5D1QA 1UM6H 2ZOLA 4Y7MA 4HCRH 3KXFE 2OR8A 1ZXQA 2D31A 3HB3C 5T5FH 4IHOB 1YNTB 1AD0B 5ICYB 4D9QD 4N8VA 4AT6A 2JJTC 1VPOH 5JUEH 1VESA 4Q2ZA 3O6MH 4KK6C 5A2JH 2B7DT 2RFXA 4JFPA 1U41A 4ZSOA 3NPZB 5IB2A 5GGQH 1L7TH 4N0YL 4N0CD 2CIIB 3MBED 3TVMC 4YH6A 1AIFB 4MSWA 4LL9A 4NFCA 5C6TH 2I60L 3LEYH 1N3NA 2KH2B 4HC1H 1QHPA 1NGZA 2X4TA 4DUXA 4X6CB 1ZHLB 4L4TD 4X98A 1WWWX 3GEWB 1KCUL 5TF0A 3Q6FB 5J0BA 1QD0A 1MAJA 2FR4A 3AROA 4JKPH 3S3SA 3PQYA 5E6IA 4XXDA 4L4JA 5JNYB 3TV3L 1I8LA 3KR3H 3RTQA 4FXKA 4ZSOE 2OSLB 4NN6C 3BP7A 1T7XA 2CUHA 2VDPL 2O5YH 2WUBL 4WI9A 2DM2A 2ADGA 3PDDA 4OLZL 4UV4L 2X1XR 2DQJL 3TO2A 4CKVX 3TIEA 3DHMA 4RGOH 3S98A 3TESA 2CO6B 2VDLH 3MLVL 4BH8B 2C4XA 2PYEE 2K1MA 4PUBH 1G6RA 1JWMB 2XQBL 5HI4D 5LGKA 5F1NA 3PQYE 3RUGF 4V2CB 3U48A 2UUDK 4OF5A 2NW2A 1MVUB 4WO4B 1CI5A 1WTLA 3BAEL 2V7HA 3UTZB 1OF2B 1SYSB 3B9AA 4GJTB 4U1JA 3C5SA 1OWRM 3MLSL 2VXSH 1P84J 4XCNA 5GJTH 1AKJB 2FX7L 1X6NA 4WHTA 2V2WA 2DQCH 4M62H 3FFDA 1KIPB 3HMXH 3K1KC 1NGQH 1EVUA 2DIAA 5FUCE 3V5DA 5C9JA 4M1CD 3STZB 1DZBA 3E6HA 2BRQA 4AMKL 5ISZD 2VXQL 3KPRE 4LLUA 2HKHH 4ORGB 1G1YA 1VSCA 5LVEA 4YQXL 2WM0A 1KPRA 5D1ZA 3SO5A 5DQDH 2BC4A 5D1QB 1IM9D 1JPGB 1UM4H 4ZXBA 2ZOLB 2XXCB 3IB4A 3I3EA 4GBXC 4LVNB 2D31B 3DO7A 1OARL 3QUYD 1RZJL 1YNLL 1MFAL 3NAAL 2X89A 4N8VB 5HI3C 4XPGH 4AT6B 1WZ1L 2A0LD 1GCFA 3I9GH 3GRWH 1WVZA 4YHNA 4X7DC 1I4FA 3BYTA 5DD0L 4ZSOB 1E0OB 4NWTH 4Y89A 2C4FT 3BZEA 2XWBB 4ZUWA 4MSWB 5HYFA 4HK3N 3SJVD 1N8ZB 4JFDA 4RIRA 5K9OA 1WZLA 1SM3L 1KEMH 4LLYB 2PYEB 2X4TB 3GMOA 1I8IB 4HWNA 2C3HA 5FHAL 4Q97A 5ESAB 5E95B 1YEKH 1WFUA 3QQ4A 7FABL 3KLHC 2FR4B 2CRMA 3O9WA 4LCUA 1J18A 3NABL 4OF0A 4XXDB 1YUHA 5JMOC 2FEEI 4FXKB 1NMBL 3PHSA 3K8MA 1CFNA 3BP7B 5L88H 1FC2D 2DI8A 5TH2B 1ITCA 1MY7A 2AXJA 3KYKL 1PJ9A 1T6VN 4JFDE 3WFEL 1JF1B 1DR9A 2PUQT 1HHKA 5AZEL 1IEHA 3NFSL 4HJJL 4OZ4A 5BXFB 1X9QA 3QUKB 4YHOL 2NPLX 3V8CA 2X2YA 3ZKXB 4BSWA 2PTTB 4MQXC 5I1JL 3VDBA 5EA0H 3KPRB 5E2WL 5GGSA 2DMCA 3GSVA 2V7HB 4HIIB 5J7CC 3GM8A 4BQ9A 4U1JB 4WV1A 2XWTA 4WW2B 5L2JA 4TSCH 4EN3C 3U82B 1G7LA 3TN0A 2SEBA 4JGJA 3QXDA 1KN2L 2RGSA 2V2WB 5DUMH 3L5HA 3QZWG 3MLXL 5ERWA 5FA4A 1W0WB 3NACH 3WNPA 2OJEA 1B0RA 2VDRH 4FQCL 4C56E 4G8GA 4IOIA 3IDUA 2GT9A 3V5DB 1CQYA 3E6HB 3MV8B 5FAAA 3HNSH 1FNHA 3RAJH 3P73A 4GRWH 3WXWH 1TDQA 4M7JH 1NC4D 1NCWH 2FGZA 3N1PC 1KPRB 5SWQA 4CBPA 3R06B 2D0GA 1PVHA 4ZS7L 2IJ0C 2IALB 2D7NA 3LN4A 3MLWL 4R8WL 3MOBH 1KCRH 4U1HB 2W9DH 2ZUVA 1FVDB 4UMGA 3QEQD 4GLRI 5ICXA 3ULUF 1MIEL 2LTQB 4WNQA 4JRYD 1I4FB 2HMID 4HUNB 1X5YA 2AEQL 1A0QL 3I6KA 4P4RA 3VW3H 4NWUL 1RFDH 3S5LA 1MCFA 4ZUWB 2X4SA 3DBXB 2EH7H 1KV3A 4JFDB 2EDRA 3BD5A 4RIRB 5JORA 5K9OB 1SBSL 4O2EA 4EI6A 2YD3A 4F3FA 1Q1JL 2P49B 3MMEA 4ONFL 4X80L 4JQIH 3QQ4B 2B2XL 2D3VA 4M7LT 2ESVD 4LARH 2P45B 3HMWH 1CXLA 5IQ7H 5IB1B 5F70A 1QYGL 3HAEA 1R3KA 4KKCD 2GW5A 4QO1A 4M93B 1MFCL 4JY4B 1Z9MA 2DJUA 3OG4B 2R0LL 2DQUH 4IRSD 2NNAB 4X6DA 4G6MH 4ODVL 3IRZA 1G7PA 1D5BA 5DQJA 4NZDA 5GS0L 1BWWA 3QA3A 2W9EL 4C56B 3HLAA 2YMXL 3NZHH 4G9FA 3FCTB 5MEOB 1E6JL 4X6BB 1CDHA 3VXNA 4BSWB 3ILQD 4QXWA 1U8MB 5GGSB 4X4YA 4EXKA 2MTPA 4XPTH 4NO0B 2AJYL 1KFAL 2BFVH 4P2QA 5DVLA 2AK1L 3QXUA 4PTUA 4X6DE 3DX7B 2IH3B 1RUQH 2NY4B 3FB7A 3FN3A 5FA4B 5E6ID 5ERWB 4AH2B 5DD5H 5HI5C 3BEVA 1QLRA 2DQHH 3CLFH 4OLVH 4FTVA 4XCEA 5I15H 4QXTB 2GT9B 3P77A 4G9FE 4JPKL 1A7OH 1X7QA 3LZFL 3LEVH 2FO4B 3WDHA 2DL2A 4S1SL 2VDKL 1WQVT 5CGTA 2ORBH 5HGBA 5SWQB 4JO4L 5C6WH 4P2QE 4HEPG 5CP7B 5DJ0A 4LHUD 5D7LB 5ESVA 2VUYA 4KDTA 3ULSA 2PETA 5E1AA 3W82A 4OQTA 3LN4B 4Z78A 4PRBB 4ZOCA 4X9BA 1EXUB 4LAQH 5ENWA 2QADC 1IL1A 4JB9L 4OLUH 1ZSDA 5KSAA 3B9KA 1CDUA 2OP4H 4KHTL 4XP1L 1F4HA 4K2UH 2JK5A 3QIWC 3JWDC 4HWBH 3I2CL 3I6KB 4Y2DD 3B8YA 3IDIA 1CICD 4LSPL 3QSKB 1RK1B 5A3IC 1A7PL 3G5VB 1HH6A 5J56B 4NKMB 3U30C 1T1YB 4EI6B 4MAYA 2PN5A 3DSFH 3RWJB 3ILPA 3MMEB 4P48A 1O7SA 4R4FL 3UBXI 4JM2A 3QEGL 3S37H 1FZKA 1W72A 1FH5L 3Q2CA 1T83A 1CD1A 3CLEL 2GTZA 5DMKB 4KY1L 4DQOL 2ICEA 2G75B 4JANA 1CE6B 2YC1A 2MCPL 5JA9A 1Y18A 5EIVA 2HFFB 4L8DB 4X6DB 2X89D 4OLEA 4K9EL 3SGJC 1HHIB 2FHFA 1JBJA 2XZQH 2DQTL 3QA3B 2NW3A 3GIVA 3S35L 1A7QH 5CILL 3HLAB 4F9LC 3GSQA 5JPMA 4G9FB 1OGAD 2CGRH 2IAMC 1ZWIA 4OD2B 4KHXL 1D9KA 1KJVA 2E7LA 3RVXC 5EU4A 1P4LA 4X4YB 5CKGA 2DOCA 1PZ5A 2FIKA 1HXMB 1T7ZA 2Y23A 4P2QB 2VLRA 1N6UA 3O9WD 4RQQA 3LKPA 2CSPA 4PTUB 4XAKD 2R0ZL 4YZFE 2VITA 3FB7B 4J7RA 5EO0A 1C5CL 2XY1A 5CJBA 5DVOA 2GFBA 4YEEA 4M03A 3H9ZA 2NYYD 5HVHB 4ONGH 1YPZE 1X4XA 4QTHB 2G5BA 2ENYA 4PRAA 5ACZA 4K7PH 3NIDE 2ITCB 3LN5B 3H42L 3WFHA 7CGTA 3F62A 3GM0A 3IFNH 12E8H 2OYPA 2DBLH 1AGBB 2VDQH 2VLRE 5DJ0B 5F3BA 5ESVB 1A6TB 3EOYG 3FO2A 4LASL 5IB5A 1FBIL 2C7UB 4WI5A 3AY4A 1QQDA 4PJCF 4GAGH 4X9IA 3RL1B 2UUDH 2P24B 3O2WL 4Q9QL 5ENWB 1KUMA 4G42A 4WI7A 5F6IC 1ZSDB 4HFWA 5CBEA 1WIOA 1I3GL 5KSAB 3B9KB 4PJ8D 1SYVA 3O45B 3TN0D 1T04A 2BVTA 3AS1A 5GJSH 3ZTNH 3UO1L 5F97E 1ITBB 5BZWA 5E2UH 1GGIH 1NGWA 2CLRA 3QQ3B 2OTUA 3UROR 4DW2L 3OV6A 4LQ1A 4Y4KC 1KGCE 3GJEA 3SE4A 1FAIL 2VR5A 5F7LB 3ILPB 2DLEA 2HWZH 4P9HC 2AVGA 1S9YA 3NPSB 5HY9B 3AM8A 1W72B 4NM4H 4X6FA 4OCLC 1BFOA 3MOAH 1OTUC 4LDEB 4YDIH 4U6VL 4NUGH 3DMMA 3FT2A 3CFJA 4JVUA 3LS5L 4QGYA 3TEUA 2YC1B 4PLJC 1Y18B 3VXUA 1MFEH 1BZ9B 5FYKE 1V7NL 4HEME 4NQXA 2VYRE 3GBLA 3LQAC 1QPPA 1KULA 1GOHA 3GBNH 5FKPA 3ULVH 3NGBC 4KROD 2XN9D 3FQWA 3OQ3B 3MRPA 1R5WA 1YPZB 5EUKB 2ICWJ 3N0PB 1D9KB 4XMKL 1YN6B 1KJVB 3SOBH 4M1DH 5D7KD 5EU4B 5F7WC 1PX3A 1CLZL 2G60L 1PZ5B 2E5EA 3GJFB 3MR9A 4NRXA 3MUGA 2D7TH 4CGTA 1CFQA 5I73C 1EFXA 1JGEA 1EEYB 1DL7H 3VXUE 4RQQB 1W72L 3RWFA 3TCLB 2H2PD 4L1HA 2VDOH 5EO0B 5JLZA 1CTNA 1NDGA 1X5JA 5AD0A 1J5OH 4NQEE 4J4PC 2GFBB 2YUWA 3V0AC 4NNPH 4PJIA 3C9NA 4PGEA 1QNZL 4DVBA 5E08L 4S1QL 5K93A 1TJHH 2R2EB 1ADQH 5I19H 2G5BB 2V5MA 5J12B 4KTYA 4MDIA 3GKWH 3VWJC 1MHHA 4AQ1B 4F15C 1OAUH 3WFHB 1DQLL 5ACLA 3L1OH 5KANI 4IBLT 3HN3A 1QFWI 3O6LL 1MF2H 2P7TA 1EAPA 4UAOB 3SO3B 5IB5B 2VLLA 4H0IA 4F2MA 2VZ3A 5I1LA 1QQDB 3EYVB 4E41E 4PJIE 3QXVA 4OM0L 2HTKC 4G42B 2QLVB 1R3JA 3NCYS 1CR9L 3DX8A 2B4CC 1YYML 3ULVD 4XCFL 1S7VB 5FYJH 4QGTA 4WFFD 4Q6YA 2PW2A 4NC0B 2HJFA 4L3CB 2DLHA 4FTVD 1FP5A 4OI9A 5IVNA 1WIPA 3V5HA 4Q9RH 3LQZA 3VXSA 4UTAH 3SGKC 1CVSC 1QLFA 1OAXH 3C6SA 3TA3D 3V4UL 3WEXA 1S9YB 4LSVL 3JVGC 1K5NA 4X6FB 2WZPD 1AGCA 5DJZB 1OAQL 4LGPB 2DN7A 3VI4F 3DMMB 4HPOL 4QT5A 2EE2A 4PJAF 5IIEA 4JDTL 4N1HB 1C16A 5JA8B 5EZLA 2EH8L 5J6HA 4N5EC 4OF8A 3VXSE 4PY7A 3UJJH 1EO8H 2OI9C 3JWOC 3WS3A 3KAAA 4NQEB 1YEHL 4RNRA 2OXHA 2GITB 3REWA 3MRPB 1TQBC 1QR1B 5E56A 3GFUA 3ARFB 2DF3A 4JQXC 1ULVA 3OJDA 5FYKL 4LF3B 1GIGL 3ARBD 2VNCA 5D2NC 2NX5B 2AV1A 1DUYA 2X10A 4YHPA 2R15A 3MUGB 4DKFL 3VJ6A 1JGEB 4ETQA 1UH3A 4NQTA 4Y5XC 3ZHDA 2Z0BA 3RWFB 3DETD 3LPWA 5FYJD 3LHPH 3EYQD 5JLZB 1NDGB 5AD0B 1UH2A 2VRAA 4PGEB 4E41B 3HZYA 3PIQA 2EIEA 4NO3A 5BS0D 3D48R 3LS4H 2DQEL 4G7VL 4LU5L 1KJ3H 4HSQA 3HA0A 4JDZA 1ZE3C 4XBPA 4POZD 3MCKA 2V5YA 2EDTA 4ACPA 5DJAA 5BV7H 1JPTL 2DLGA 3FQUA 4K3HA 2P7TB 1VGEL 1K8DB 4RMQA 4PP2B 4NKQB 5CUSH 1IC4H 3I6LE 1KIRA 4F2MB 3KHOA 2B1HH 4XNXH 4JQVC 5C7XH 5I1LB 5BVJB 1U0QA 3UYPA 1A6UL 3G6JF 1U58B 2BNQA 1NAKL 3QAZC 1QSFA 3FN9A 3DX8B 4K3GA 1MNUH 1A7BA 4OLYH 2ZUXA 3UJTL 2BVYA 3VG9C 3PL6A 4LBEA 5DD3H 4MD0B 2YPLE 5IW3A 4LHQB 3GMRA 2HJFB 1RJCA 2ARJQ 2DB8A 2YD6A 1FNAA 5DJCB 3MNVA 1LQSR 1QLEH 3V5HB 2Q6WB 3VXSB 4GAYA 1MREL 2R2BB 1PY9A 1NSNH 2EDHA 3QWRA 1JNNL 4QHUB 5CJQL 1U8HB 1E28B 4EJ1C 3EOBA 5CEZE 4L9LC 1ZT7A 1Q9KA 4MA1B 1FDLL 4ZTPL 1QSFE 2JKXA 3BGMB 1K5NB 4WHDA 4M5ZH 2QQLH 1YC8A 4Z7WA 1CTOA 1DEDA 1DTUA 4PGBA 3HPJA 3VA2C 1CZ8L 4I48B 4GW1A 2MNUA 1LNUA 5EBLA 5EZLB 1RUPL 5KVGH 4D0BB 3BDYL 2O5XH 1IGMH 5JXEA 2R8SH 3OKMB 2KDGA 5F1SA 4OCWH 3TBWA 1YYLH 5KG9A 4JHAL 1S8DA 2IANB 5IWLC 3OJDB 2WANA 4OBRA 4L8CA 3IYLW 3IAPA 4HUMB 5IHLB 5E99H 4PJ5A 4Z7WE 4XNUH 1MCCA 3IF1A 3P0YL 3OR6A 4YHPB 1TTFA 3WUWB 2V6HA 4ETQB 1WIUA 4X5LA 1X6LA 3LAFA 3BPCA 3T2NL 2VXTL 5DURB 2C5DC 2W60B 2KPNA 4F57L 3PIQB 2DI9A 4PJFE 4NO3B 3EBAA 2CUMA 3BN9D 4S2SA 4Z9KB 5JW4Q 3QFJA 2YPLB 1INEL 3UZVB 2GY5A 1CFTB 3E2HC 1NGPL 4YDJA 5DJAB 4MCZA 3QDMD 2VLKA 2VN4A 1GGCL 2BY3A 3WJJC 2WP3O 2XOTA 5FECB 3J8F7 4XAWH 3MBXH 4JRXD 4DVRH 5FDWA 4U1NB 4OGAC 1RZFH 4M48L 1ACYH 1QSFB 4NFBA 1EFXD 3SDDC 4P2OC 4LBEB 2DQGL 2HTLC 4OCRH 3QFJE 4WU5A 1NEZG 3GMRB 4HLZH 1D5ZA 4Y2OA 5KJRH 2CDEB 2R4RL 3MNVB 2VLKE 2YRPA 4MNGA 1HI6B 4HF5L 4Y1AE 1LD9A 3PDOA 3OKOA 5FUZH 3SCMA 4G6JL 2OQJA 5FGSA 1ZT7B 2ZUQB 1V7ML 3QNZA 4OT1L 4ZO8A 4KZDH 3UYRL 3BT2L 4Z7WB 1P7HL 1A7RH 4JZJA 4TULL 3HPJB 5C86A 2MMXA 1BBDH 1QVOA 1L0QA 1SY6H 5K9JL 4GW1B 2WBJC 4RFNC 4PD4J 5CEZL 1LNUB 2ZJSL 5EBLB 4EQ3A 4KKBD 5I1IH 3DVNA 4KGLA 3CCHA 2AXFA 2WINB 3C09C 1CK0L 3OR7A 5FA3B 2WAHA 5B22A 1NPUA 2IC2A 3HR5A 2ZCLH 4YUEH 3RKDD 4MXQC 5KG9B 5IMLB 5SX4I 2D7OA 4PJFB 3QUZA 1N64H 4L8CB 1YY8A 3A6OA 5J1TC 4B41A 3FQTA 3FQXA 5E6YA 3WYRA 3LSOB 3P4MB 3VDCA 4FFZH 1MCDA 3WE6A 2Q8BH 5LWYL 1OAZL 4EN3B 1BOYA 3QRGL 4RFOL 1Z3GH 2FATH 3EO9L 3ARRA 4R90L 1I9RH 2YN5A 5CLTA 2IPKA 4ZUTB 1KB5A 2P8MA 1TMCB 3S8WA 3RI5K 4B0MM 4ZMAT 4OCNC 2WQ8A 1N0LA 3T0BA 1NFKA 5EDXA 3RIAF 4S2SB 4ZOBA 5A2FA 3KPTA 2DD8H 3QJHA 4MVBD 4UQ2A 1TTGA 2XTJC 5HVWA 4MCZB 3RVUD 3EYFB 1T89A 4Y1AB 1ZHKB 1YEGH 3KVQA 5EC2B 1FG2A 5FDWB 4HJ0D 2J6EA 2CUIA 4L8SC 4NJAL 3K4AA 5DJYA 3X13B 4TVPE 3U0PA 5C0RH 4UNTA 5F3HA 4KRPC 2R1XA 2W59A 4GQPH 4NCC1 4MJ5B 3WSQH 2P5ED 2FD6L 2Z92A 4PBVC 1C1EL 3W9DB 5J11C 1ZEAL 2I9LB 4O58L 3WKML 4JR9L 5AWNL 3Q3GA 2M26A 3PDOB 1QG3A 1TENA 5T3ZE 3SCMB 4WU7B 3W2DH 1Q72L 3BP6B 3AGVA 4LSTH 2OQJB 1E6OL 4YHKL 3C2SA 4PV8A 1WCBA 4IRZH 4U1MB 3A6BH 5DK0A 1FL5A 1CFSA 2A1WH 2BNRA 2X4UA 3T3PF 5EIIB 2YD8A 4QRUA 4X9HA 1AXTH 4Y88A 4ERSL 2BSRA 3I50H 2BDNH 2I25N 3ARQA 2BNQD 4NUJA 3RY4A 1FV1B 1MCEA 1XGUA 3DVNB 3T2OA 1OAKH 5SWZE 4NBYB 3SKMA 4TSAH 1KLUB 5I1KL 4LVHB 3I3BA 3HR5B 3LRSA 3S7GA 4IRJC 4LNRA 3N1FC 2VAAA 2R2HA 5JW3H 5B21A 2IEPA 4Z76B 3QXAB 1VFMA 1NBZA 2D7QA 1IGJB 2BNRE 2BSED 3GZKA 3QWRD 1WBZA 3BRDA 3FQTB 2FJHA 1RI8A 3FQXB 2XT1B 4Y4FD 3QPQD 2HLAA 1UB6B 1PGRB 1BMGA 3G9AB 2MWCA 3WE6B 3HE6A 1YMMB 3QQ9C 1E4WH 1B2WH 2YWZA 4U7KA 4BH7A 2IPUK 1ZGLM 2PR4H 5C0JB 4LGRB 4EUPB 2QTEA 1JCKA 3ESUF 3IDYC 1CCZA 1KIQB 4EOWH 3FJTA 5JIKA 4YO0A 3VWKD 2BP3A 4I3RH 1AXSB 3BQUD 3BPOC 3EYOB 3C2AH 5DEFA 3PWNA 2YPVL 3UTPD 3QJHB 1DBMH 2VLJA 4G7YH 4GFTB 2B1AH 5B4MD 3RGVD 2CXKA 2NY6C 4HZAA 4HDIB 2Y6SD 4PJ5D 1FG2B 5D7IB 3X12A 1MJJB 3A67H 5DJYB 1EIBA 2AERT 1B0GA 1X4ZA 5FOBA 4YXHL 4ZPTA 5CIPB 3LN9A 2R1XB 5DI8A 1ZA3A 4NZTH 2DICA 2IPTH 3ZO0A 3O3AA 4MQSB 2VLJE 3RNKB 1RURH 3KLAA 3DX9A 1U3HD 5I71C 3K3QA 2A9NH 4G3YH 1FFRA 5SWZB 4DJMA 3MRHA 5F1KC 3Q3GB 1S9VB 4TVSa 4RDQG 5CWSA 3T0XA 2F53D 3Q6GL 5L9DH 1ZT1A 3K2UL 1R6VA 1WCBB 4K3DH 1E4XL 5DK0B 1NCCL 3F7VB 1JHKH 2EKSA 2BNRB 2EXWD 4Q6IA 4WWID 5EBMB 5HHXL 3TT1L 2ADFL 5T3ZL 2ADJA 4H1LG 5IESL 5AZ2L 4W4OC 1S5HB 1VKXB 2J6EL 4WENB 1LO2L 1BFVL 2DDQL 1XGUB 3CU7A 1TCRB 2FHBA 5J13B 4DTGH 1L7IH 2Z4QA 1QBLL 1I8KA 3SKMB 3S3PA 1F4WH 4LNRB 2VAAB 2R2HB 1XZ0A 4OUOA 1BGXL 1LK2B 5DTFA 1F4YL 5CD3A 4RBPK 2FJHB 2VUOA 3AFLA 2CK2A 1PQZA 3VD4A 2X4RA 3EOAA 4KUZH 1FZJB 3HRZA 4HBQA 4OQ1A 1EJOL 4U0RB 2Z8WC 2FJGA 1T1WB 5EBWB 4O9HL 2LQRA 2YOCA 4N0YH 2I60H 4GAJL 5C6PB 2VAJA 5KAQF 3O4LA 4KI1A 5C08A 4ISVB 2YHGA 1JE6A 1HNFA 1U92B 1C7TA 1KCUH 1BZ7A 4WRLA 3SKOA 1QFWM 3PWNB 2VLJB 5C0CA 1NLBL 3RVWC 1WBYB 3TV3H 4E9LA 2GKIA 3MTRA 3QUZD 3A6CH 3BIKA 4POUB 1WFNA 2VDPH 5I1HL 2WUBH 3X12B 4UV4H 1RZKH 4OLZH 2F54D 5EIQA 2DQJH 3QO0A 3TNNA 3ZKMC 4MAUH 3RWGA 1JPSH 1AY1L 4ZPTB 5FGRA 5C08E 3BN3B 3C6LA 2XQBH 4GG6B 2NY1D 5DI8B 1NFDF 2EDQA 4ZPVB 1G9ML 2R9HC 1LO5A 3O3AB 3UXFA 1UACL 4U1KA 4YHML 3ETBF 4L8BA 1MJ8H 3X14A 2DIJA 2YWYA 3HHRB 2CK0L 3VRLE 3T4AB 4AYFA 5L8LB 2JCCF 5J6GB 3MLSH 1EHLH 3E1F1 4NOFA 3ZL4L 1ZT1B 2QQKL 1G0DA 1QEWB 1T20B 4LEOB 4LPCA 3QB7C 4XNMB 1X5GA 2PW1A 1HH9A 4Q6IB 3WJLC 4ZNCD 1F2QA 3QIBA 3U0WL 3HKFA 4BKLA 3RIFF 4DZ8B 4XNZC 3RU8L 3F65A 4ALAL 4AMKH 2VXQH 2Z31D 2Z4QB 1BBJA 1JPFA 3GUTA 4ZQKA 4KVNL 3NGBB 2CDGB 5AYQA 1XZ0B 3UPCA 3V8OA 4NJ9L 3RA7L 1UXSA 2A2QT 2Q3AA 1DN0A 1BP3B 4AJ0A 3LB6D 1OARH 4I9WE 1YNKL 2AABL 3IFOA 3UPAA 3BKYL 1YNLH 5D1XA 5CD3B 1MQ8A 3QZWB 1MFAH 3NAAH 4D3CL 3MOQA 1WZ1H 4HHAA 3HRZB 5EC1A 4ZFFB 5I73B 3RWCB 4XWGL 3N9GL 4GOSA 1S78C 4LGSB 5FO8B 1RJZB 1H0DA 2GY7B 2HRPL 4EI5C 1HHJA 1QA9A 3ZDXF 1MPAL 4Y5YA 5CEXB 1FRGL 3W11D 3NIGE 5FHAH 3DIFB 3SKOB 5JOPD 1CQKA 5E00A 1CVRA 5IP4A 3NABH 3OKNA 3MLRL 2PXYC 5E2JA 5E9DA 4JFHD 1NMBH 1UKQA 3MZTA 1AHWA 3SQOL 1LO3L 3FB6B 3QG6A 3QHFH 2VQUA 3RWEA 5HPMB 4NBZB 1B6DA 3WFEH 4TNVF 4LNVA 3CDGA 4TUKL 5AZEH 1CLCA 2AJXL 3NFSH 4HJJH 4I5BB 2XZCH 4YFLF 3RHWF 1WGOA 3RY6C 1J1XH 4YHOH 2A6IA 1LO5B 2JE8A 4BUHA 4WWKA 5I1JH 5E9DE 5E2WH 4EBQH 4WO4D 3MXVL 1C08A 1U9KA 2P44B 3GJFK 3KYMA 3QR2A 4FFWC 3V0WL 5KBNC 1I85A 5HYQA 1EFQA 4R4ND 3SDXA 3CIQA 4B53A 4I4WA 4UTBH 1EDQA 2XYCA 4FQCH 1UFUA 3MX0A 3QIBB 3IETA 4BKLB 2IBBA 2MKLC 3BW9A 5M94B 1OLLA 1I1YA 3EZJB 1U8IA 2C3GA 4RGNE 1KN4H 4K8RL 3MA9L 5TGBA 5DUPL 2B4CL 3HUJB 2VE6A 1BQHG 1I1CA 2R1YA 3QNXA 1DBJL 4U6TA 3SDXE 2F5BH 1D6EB 3RUGA 3PGCA 3MLWH 4R8WH 4G9DB 3P9MA 1TQBB 1DP0A 3O81A 5D1XB 4LVOC 1JGUL 1MIEH 1JIBA 4KJYA 1I1AB 4X7CC 5D2NB 3VFNB 2JJSC 1TZGL 4X8JA 5DMIH 1IEAA 4JY6B 4YDLB 1JRHI 2AEQH 1A0QH 3VGHA 1H0DB 4NWUH 1T1XA 5DHVH 3L7EA 3HE7C 1BD2E 1L0YA 1NCAL 3BKCL 4Y5YB 5GXBB 3H3BC 3RUGE 3WLBA 5JW5A 3WL9A 1T22B 1BQSA 4X80H 1CXIA 2B2XH 5E00B 2GJ6D 2PO6B 3FOLA 3MRFB 5GGVY 4HGKC 4IDJL 3JWOL 3PE9A 3OKNB 3H9SB 1QYGH 1T2XA 2V7NB 2FJFB 4JFED 1HQ4A 1MFCH 4M6MH 5CCKL 3LMJL 2VZSA 4X4ZA 1IKNC 3QUXA 1AHWB 5IW1B 4ODVH 2Y7QA 4HAFA 2QSCH 1NBYA 3SDCD 3QAZB 5GS0H 4PREB 3PJSB 4NQCA 4M7KL 3UBXA 2YMXH 5F9AC 2A6IB 3MREA 4JFZH 4WWKB 1DCLA 5EU6A 4P5TA 1XCQA 4FN0A 5DMGD 3BP5B 3OAYK 3BVNB 3O4LD 4RGNB 2NXZB 4OZGB 2AJYH 2GEEA 5A2IH 1NMCB 2AK1H 4LHJB 1IZJA 2YA2A 3ZYIA 2X40A 4QHKJ 5C0CD 1QP1A 1KNOA 5SWSA 1OP3K 1MAKA 5HJ3A 5BOPA 2H1PL 1N59B 4NQCE 4NPYA 4QRPD 3ZSSA 2GSGA 5A40E 3VD9A 3ARDA 3KYOA 3MV8D 3X3GL 9CGTA 5F1IB 5L2KD 4S1SH 3QUMA 5EU6E 2VDKH 1MWAA 3O8XA 1I1YB 5C2UB 1OB1A 1R24A 3MXWL 5LQBL 3Q5TA 3BFOA 4JO4H 1L4IA 2VN7A 4ODSL 4P46C 2VE6B 1BD2B 1QRNA 1M1SA 4XP4L 3RUGB 3PGCB 3KPQB 5SWSE 3P9MB 1FFNA 1RK0A 3HI6L 1OTTD 4XBGB 5DDHA 1KPUB 4NKIL 3KPPA 3OZ9L 4JB9H 3D39B 3LKOA 1FFQA 1A6ZB 3W81A 4KHTH 4N5UA 4N0UA 4XP1H 1JVKA 4X8JB 2FX8L 1JNLL 2P5WA 1XH3A 4LP4A 1JZ7A 5CSZB 3I2CH 4PYGA 3KHQA 4JPIB 1T1XB 4J1UB 1UGNA 3U9UB 1QRNE 4JRWA 5KSVB 1A7PH 1JYNA 5JW5B 3UZEA 4LCCC 3MRLA 4R4FH 1QBBA 1WC7A 2BOBB 2VC2H 3QEGH 4P3DA 5KAQG 1FH5H 3PHQA 1AO7D 2ZG3A 3MC0A 3CLEH 4N0UE 4NZRL 4KY1H 4DQOH 2P5WE 1IAMA 3I6GA 1HQ4B 32C2A 3IDGA 5EORL 4J6RH 1XIWB 3V5KA 3VFVA 2Z93B 1M05A 1EGJL 1T7WA 3BUYA 4RBPH 2EXYC 2Y7QB 1F42A 1DQML 5GHWL 1D5IL 2GAZB 4QTIL 4EIGB 2DQTH 4HG4K 3MRIA 4NQCB 3DXAA 3S35H 3SDDB 4P2OB 1CIDA 2Y06L 4OGYH 4NQUA 2HLFD 2FYYB 4WI4A 2DRUA 5CJ5A 3AUVA 4KHXH 3N85L 3RP1A 3NMEA 4YXLL 4P5TB 3BGFC 1R3LA 4KU1A 4NO0D 4YWGL 1JUFB 3WLWD 2R0ZH 3CGTA 3VG0L 3ULUE 3CFEB 1C5CH 1KNOB 5SWSB 3C60A 4FQXC 3EFDL 5HJ3B 5CJOL 4NPYB 4MQ7B 2GSGB 2Q7NA 3O8XB 5E5UB 1OB1B 3GGWB 2R23B 1B4JL 1Y6MR 4PLOB 1XFPA 1IC5L 2H3NA 4MS8C 5D7LD 1FNFA 4LASH 1FBIH 2ED8A 2HT3D 1GC1L 3EYUL 4KRLB 1U95A 3O2WH 5FM4A 5FO9A 4LKCA 5TDOB 1G7MA 4Q9QH 2YRLA 3HG1B 4X4XA 3L6FA 4OZFH 3MJ7A 4DKEL 5I17A 3DUSA 1I3GH 3VFOB 4QRSA 4N0UB 1AGDA 4OCXH 4RISL 2P5WB 1XH3B 4MD5A 3WO4C 1E4KA 4LCWA 3LCYA 3QULA 1ZOXA 1KYOK 3ET9F 4DW2H 1FJ1A 1MI5A 2DYPD 5BJTA 3AU1B 4X83A 1FAIH 3BISA 5I8CB 3MRLB 2ZSWB 1I3VA 1AGFA 3MROA 1T5WA 1WC7B 5JXAH 3VFUA 4GXVL 5T1MA 1H8SA 4P3DB 1HQRA 3ZDZF 4UILL 3IXTA 3P3YA 1UWXH 4U6VH 4P23C 3QI9A 5F71A 3I6GB 32C2B 1LP9F 1O0VA 3LS5H 1YJDH 4GKNB 1ZLUH 2J88L 4LCWE 2E3VA 1J0IA 4PG2C 1M05B 1V7NH 3OL2A 1TZHA 4QNPE 3ZYOA 1MI5E 5IVOA 2AEWA 4Z7OF 4V1DA 4U1LA 3T65B 3MRIB 1D5MA 1I9IL 3D2UB 5I9QB 4X99B 5C09A 1DQDH 1U91A 1P4BH 1HYRC 1H3VA 2ED7A 2XTLA 3C08L 4IOSD 1P69B 3OKDA 1RZ7L 4J3XA 4XMKH 4G8EA 4KRMB 1FCGA 1CLZH 4HLJA 2G60H 4HKBA 3H0TA 3MJGX 3AS3A 4DFIA 1LGVA 1EO7A 1DQQA 2AAVA 1M7IA 5C2BH 3DECA 3HZMA 4XHJC 4Z8FL 1RQ5A 4V1DE 1P9MC 1QNZH 1UG9A 3SN6N 5E08H 4S1QH 3GMLA 4H8WC 2JJWA 4NQSA 2HYMA 3TVMA 1LEKA 3L5XL 4Z5RA 4XB7A 1MHCB 1CDCA 3NIFE 1H3UA 4O4YL 3B2UC 3ULUL 4A6YB 1A1MA 4DK3A 5IVXA 5E6ZA 2Z9TA 1DQLH 4HKZB 4XPFL 5ACMA 1RU9L 4PY8J 1KTKE 3O6LH 3PGDB 2H3NB 5HD8D 2Q7YA 1AP2B 2RQ8A 3WFDL 5DJDA 1VFOA 3O6FA 2EDOA 3HPLB 4J3VA 4R4BA 2PCPA 5C0IA 4OM0H 2N4IA 1G7MB 4KQ4L 2RAMA 4G6FD 3SDAD 1FORL 1LE5A 3L6FB 3GJFH 3MJ7B 1J1OL 1CR9H 5HSFA 4LSQL 3DVIA 4XCFH 4XVJL 2V2TA 3D6GA 4HG4J 2GJJA 4MD5B 1I9EA 1RSFA 2RIKA 3L3IB 5JMRA 5BRZD 3ARDD 2K7QA 4B7IA 4X7SL 5ANMA 3WNKA 4WFGD 3AMLA 4RZCA 4FFYL 4HS3B 1AGFB 1CD0A 1ORQA 5TDNA 3MROB 4A6YL 3SPVB 2WNGA 1BF2A 1T5WB 4PJGB 4LSVH 1XGRA 4IJ3C 4WEUD 4ELMF 3OAZK 3CXHK 5T1KA 2OK0L 4JPVL 5EZIH 5JQHC 3WFCH 4R2GD 4CNIB 1KPVA 3QI9B 1R0AH 4HPOH 1Z9OA 4JDTH 4Y4HA 4RMSA 5D2LB 2EH8H 1T03L 2QBWA 1U8JA 4PRHE 4XCCL 4NN5C 1UQSA 1TZHB 3VCLB 1GZPA 2Y5TB 1ES0A 3ULVF 2IG2H 3VFRB 4YGAB 4V1DB 4U1LB 2XA3A 2P8PA 1D5MB 2Y36H 1UADC 3LV3A 5F9JB 3WMSA 1KELL 3KG5A 4GG8B 4I13B 1U91B 5FEBA 3OBAA 3MLPA 5FYKH 4FQIL 1GIGH 3QO1B 4G8EB 3L3KB 2AJVL 3MFGB 4GBXA 4HKBB 4ELKA 5I1AB 5F96L 3CVHH 4PJCE 1IKFL 4FZ8L 2AEPL 1F6AA 3KPNB 3KPLA 5C0BB 1M7IB 2VSDA 3HZMB 5MENE 3IXAA 3U4BL 5D7JC 5B38G 1A1NB 1U93A 1C5DB 4GQ9H 5AG9A 5IOPA 3O2DA 5JR1H 2XY2A 2ZUSA 2Y72A 4Z5RB 2NY5L 1EPFA 2DQEH 3MGTA 4G7VH 4LU5H 2X1OA 1A1MB 4YNYB 2EZ0C 3DXAD 1V3MA 1JPTH 1JZ4A 3CH1B 4N8VG 1OCWL 5I8EB 3MRGA 4YGVB 4D9LL 1VGEH 4ZOAA 3EJYC 1K4DA 3O6FB 4AEIH 4HGWA 4R4BB 3VWKC 5C8JB 1RZ8A 2J12B 4EVNB 1NAKH 3OAYH 4H25A 4ESKA 3RWIA 3RDTA 1T0MA 5C3LD 3UJTH 1F3RB 1HSAB 5C0NC 5DQ9A 4ZOEA 3L3OA 1HIML 3C60D 3L5IA 3MJ9H 5T5NF 3O41B 3NH7L 2D0HA 4PRHB 1JHLH 1JNNH 2ZOKA 1CXHA 1B4RA 4RZCB 4HULB 1ORQB 5F1OB 2X05A 4ZTPH 1LE9A 5TFSL 3OGCB 5ID0A 1CYGA 4UDTB 1FN4B 1EHXA 1KPVB 4OLWL 2JIXB 1CZ8H 1S7QA 2XPGA 3QIUA 1UT9A 5A2LH 3U83A 4PJCB 4Y4HB 4KPHH 4P4KC 4YIQA 5I76A 5IVZA 1RUPH 3AVEA 4PJ9A 1X44A 2H2SD 1UQSB 3TWCL 1NEZB 3INUL 3OXSA 3BDYH 2NY2C 4UUJA 5MENB 1ES0B 4NQED 3Q0HA 4APQC 1HYSC 1A7NL 3LV3B 2G5RA 3DUUB 4MD4A 5IHBA 1PEZA 5CMAA 2HKFL 3ARFD 4N8PA 2E27L 1HDMB 4XPHL 4BZ1H 3B3IA 5F7FA 4C59B 5I1EL 5CINL 2NX5D 3KPSB 2QJDA 1P7QB 4KTDL 4Y16C 1KCLA 3TPKA 4XTRD 1IMHC 5E8DL 1DLHA 2ZCKL 4JLRB 1BEYL 3T2NH 5EZOL 5F72S 4LIQE 1MAMH 5IOPB 1RZIB 1CDBA 1CD9B 4F57H 4HPYL 3GSRA 3RZCC 4QRRA 1HKFA 5I8KH 4X6EA 2IH1B 2JTDA 3EGSA 4ZS6C 1AD9A 1INEH 4JFFA 1J7VR 1DVFC 3MZGB 2VJXA 2DKUA 3ARGB 5HHQA 1NGPH 4HJGA 5C09D 1GGCH 4OF6A 1P53A 1K4DB 3GSNB 4Q9CA 5MHSD 1UCBL 3VFMA 4XVSL 3D0LB 4PLKC 4X7FC 2N7AA 3EJJX 1RZ8B 4XMPL 2BY2A 4M48H 2XFXA 2WWKO 3VI4E 2Z8RA 3HB3D 4PJAE 3RWIB 3RDTB 1T0MB 3T0EA 4I2XA 4QRRE 3TM6A 3PP3H 5DQ9B 5KVDL 3L3OB 2DQGH 4LMQE 4JFFE 5F7MC 1EMTL 1I8MB 5IT2H 4KK6D 1SQ2N 4OI8A 2XA8L 2R4RH 1UWGL 2FHCA 3HNVH 1J8HA 1XGQB 3O2DL 1FYTE 3TVMD 4ZAKC 2BVPA 4OAWA 2J8UF 3IFPA 1Y0LB 1BLNA 4G6JH 1VCAA 3V6OE 1L6XA 5F7EL 3UAJC 5T1DL 1LE9B 4HUXB 2WV3A 3C5ZC 4OT1H 3T0EE 1I7RB 4I2XE 5ID0B 4NO2A 3ROLB 2EE3A 3UYRH 3BT2H 1UJ3B 3GSNL 4TULH 4CMMB 1S7QB 3QIUB 3NCMA 4NDMA 5K9JH 1SMAA 5CEZH 3G6JA 5C0FA 5H35B 3WN5A 5I76B 5IVZB 1N6QL 1J8HE 1CK0H 2HT2C 3BJ91 3HTLX 4LLVA 4NQVB 1IVLA 4UUJB 4AENA 4XH2A 2EYRB 2BHUA 5C0GA 1GGUA 3OJVC 3V4PL 3IDNB 4MJIE 3JUZA 4PJIF 2CO7B 2IAND 4DCQB 3V6FA 2O26U 3K80A 5DS8B 3VGEA 1PW3A 1ORSB 3W9EB 4YBQC 2PKDA 3G6JE 1MHEA 1JI1A 3U0TB 3UEZA 1HWGB 1DLHB 1OAZH 5D7SL 4RFOH 5C0DA 1S7TA 3EO9H 4R90H 2FSEA 5T1LA 3LEXA 3SBWA 5K59E 1CDJA 4OTXL 4PJAB 1SEBA 4QRRB 1NUFA 4X6EB 3W0WA 1WT5C 4Z7UF 1AD9B 5KSBA 5D6DC 4JFFB 5JTWA 2YPLD 2BY0A 4KK5C 1MCPH 5D8JL 5HHQB 4LIQL 4WTZA 3QWQB 1AC0A 4OFDA 3MO1A 1FYTB 2FH6A 3L5WA 4OCSL 2QSVA 1BOGA 3VFMB 1BVLB 4W4NA 5GS1C 3BXNA 3TNMA 4HMDA 5E4IA 4NJAH 3M8OL 5IHZA 4GBXD 1FPTL 3S5LG 2E6QA 4RMRA 5GGTA 4ETYA 1YA5A 3T0EB 3I02A 4U3HA 3S37X 3W0WE 1NCTA 3LOWA 5HI3D 3PWJB 1K4CB 1SHMA 3BIBX 2BOCA 3V52L 2M8XA 2RR3A 5DRWA 4U1SA 3CUPA 5FO7B 3ZTJG 2GQHA 4O58H 1J8HB 1KTDB 4HIJA 4JR9H 1QSEA 5B39A 3GMQA 3HAEG 1I3UA 5AWNH 3HE7B 2H9GB 2DM7A 2R56L 4G6AC 4PGCA 1Q72H 5HHOD 4DWHA 4MJIB 4JZOA 2R69L 4BZYA 4JE4B 3KLHD 4HWZB 3SEPA 2X9YA 2FL5B 1RZJC 4QXGL 5IEHA 4L3EA 4NDMB 3QQNA 5H37H 5MEPA 3G6JB 3Q5OA 1JL8A 5E4EC 3CZFB 3GI8L 4GRLA 5FYLL 4L3AA 3UTOA 3M1BA 2CMRL 1C12B 1EK3A 4MX7A 4AENB 3P0VL 1JHTA 2OX5A 5C0GB 1BQUA 3TO4C 5I0ZA 5F89A 4AM0A 4OFYA 3D0VA 3V6FB 2H26B 4OD3L 3UDWC 1OPGL 1P7KA 4MQXD 4K7PX 4L3EE 4RAUA 3DURA 2O5ZL 1Q0XL 2V2XA 5D1QC 1MHEB 4QF1A 3OAZH 1T1ZA 4H1LB 4EN3D 2LAGB 4LVNC 4MJ6A 3WIHH 2FSEB 4QOKB 5T1LB 5GGVL 3VFSA 4HS6A 3LEXB 1Q0YL 4XX1E 4ZO7A 2XIDA 3C8KA 4WDIB 3DO3A 5ITFB 3W0WB 2YPVH 2NXYB 3OHXA 4XVUC 3S4SA 4XWOC 5IG7A 5M95B 5IQ9B 4G6KL 1NMAL 4E42A 3EJZC 1ED3A 4R7DA 4E5XA 2GUOA 2OLDA 5DUBB 3BXNB 4DGVL 4LCYA 3EUUA 5IHZB 3RL2A 3UMTA 1JZ3A 2W0LA 3BEWA 1I8LC 1PKQE 5HHMD 1DSFL 3V95A 1FL6A 3RTQC 2VZOA 1F02I 1I7ZA 4UQ3A 2I9TA 2OZ4L 4JFYB 5DRWB 4EUPH 3CUPB 5C0AA 3WFBH 3HI1A 4NNXA 1A6WL 4LPYA 2R39A 1TIUA 1JYWA 2FEDC 4YFDB 4PGCB 3Q6GH 2V17L 4LCCB 3MJ6A 3P4LA 5D71L 5FUCC 1U8NA 5IB4A 3K2UH 4LFHD 2DL9A 4JZOB 1E4XH 3ZKXC 1NCCH 1BWMA 1KB9K 3OKEA 1NC2A 5I0DA 4QHNB 1DANU 1IGIL 1T6WA 3TT1H 5HHXH 5HYJE 1ZLWK 5IEHB 5T3ZH 4KZEL 4K71C 3H9YA 5AZ2H 3BP4A 3P4OB 4WW2C 2DDQH 2APFA 5GGTL 4GRLB 3M1BB 5CIPH 4I77L 2V5SA 1LK3L 4XC1L 4FQ2L 1IE5A 2ICWI 2KQNA 5KVFH 2Y1VA 4D9RE 3SKNA 3JWDH 3DGGB 1BGXH 3WD5L 4BK5A 3AREA 1D6VL 3RKPA 1F4YH 1UJTA 1P7KB 4DUWA 3VFTA 5D1ZC 1OLZA 3DURB 3F58L 5TE6H 1I1FA 2V2XB 4Z95L 2R1WA 2ZG2A 1YMMD 3K1DA 4QF1B 4ZXBC 3I75A 4O9HH 2MQ0A 5L6YH 5F9DC 2O61A 1NGXA 1UXWA 3BX7C 1BF8A 1OTSC 2BVEA 5HI5D 4GAJH 2LTQC 2QR0A 1MUJB 3VU2A 5IJVA 4AEHH 3HCVA 1GZQA 5GS0C 3V0VB 1PKQB 2OCFD 1YEEL 5FHBL 3OHXB 3KS0J 3S4SB 5IG7B 1NLBH 5JW4R 5HGGS 1CXKA 4E42B 3DX6B 4R97B 1ED3B 1RUAL 3QCUL 3QFDA 4QXUL 4E5XB 5I1HH 4K3JH 3T3PE 4LLWA 1NCNA 4LCYB 2L7UA 3RL2B 3VH8A 4CN6A 2C1PA 1AY1H 1V8HA 4MJ2A 2QADD 3BEWB 1JZ8A 2UWEA 4M93C 5DJ2A 1G9MH 5HYJB 2E8ZA 1UACH 3QIWD 4KI5E 4YHMH 1KG0A 4KXZI 4U4BA 5F7UA 4JQXA 4HZLA 5DD6A 4DGYL 1LEGB 4HKXB 5JW4N 1HILB 4X0KB 5SWZD 5A3ID 3IVKA 2AI0L 4JN2A 3VRJB 3ZL4H 4M1GL 2QQKH 4RMUA 5I16B 2DWEB 4G8FA 1TJGH 1CS6A 3KNBB 1SJEA 2A83B 3G6AB 3NVQA 5DD1L 1TVHB 4P23B 5I18L 3BP4B 3OKLA 3RU8H 2ZG1A 1IZKA 4ALAH 4CMHB 4BK4A 2NY4C 3S34H 4S0SD 1NANH 4E0RA 1U2CA 1DBBL 1DBAL 4KVNH 2ADIB 35C8L 3SKNB 3IJHA 4NJ9H 1NJ9B 3AREB 1H5BA 3RZWA 5FFLA 3TZVA 1QSED 2AABH 2BCKB 1YNKH 2IAMD 1XF3A 3BKYH 5IJKC 1FGNH 4P5MB 3VMPA 3RVXD 2VIRA 1LEIA 1T4KA 3EOTL 5CEYA 1MCBA 5FUOL 1Q94A 4XWGH 5TE4L 3N9GH 5DRXA 4U1GC 3P30L 4XI5C 3MRRB 4L5FL 1VADB 3O11A 1NGXB 4Z6AT 1CGWA 1UXWB 2ZPKL 4K7PY 3P9LB 4D0CA 1MPAH 4K9EC 4C4KT 5IJVB 2A6KA 1FRGH 1FAKT 1OL0A 1CF8L 3HCVB 4ENEC 3MRBB 3RNQA 3MRKA 4QKXB 3QNYB 1YEDA 1QTYT 3O3EA 3QH3A 3MLRH 4L9LA 3PHOA 3RWHA 1KB9J 2C3VB 1RD6A 3RVVC 5I8OL 3IDJB 3QFDB 2BVOA 3ME0A 3I85A 4H88L 3CSPA 4LLWB 3SQOH 5E8EA 5F9OL 4PJ7A 1JWUA 4EDXB 3T1FA 3VH8B 3EFFA 5IKCA 2LAAA 2C1PB 4RA3A 4TUKH 4PS4L 4U6YA 2CR6A 1HE7A 2FECL 4FXGA 5CZVL 1MCRA 3DRTA 1FE8L 15C8L 1FO0H 1AJ7L 5F6HI 5KZCB 5F88B 1WTGT 3PWVA 1KG0B 4JKKA 3PF2A 1T3FA 3MXVH 4RAVA 1RIHL 2EC9U 4Y4KD 1UZ6F 1IAKA 2CKBA 1DDHA 1IARB 4QRTA 2YBRB 3STLA 4G8FB 5TF1L 4WJ5A 3B83A 5CJXA 2IADB 2VLMD 1SJVA 5GGUB 5C0EA 4J8RA 1OTUD 4OZIA 1N4XL 3OKLB 2FWOA 1YY9C 5GRUL 5F9WB 4JG0H 5LAXB 2R29L 4PLJD 3OB0K 1S5IL 1BJ8A 5HYEA 4P2RB 5CKAA 1BX2A 4NN5B 1DFBL 2B4CH 5HVHC 2VZVA 1NFDA 2CDFB 5HGDA 3MBEA 3IJHB 1PEWA 3MNZB 5C0AD 4JN1L 1WUNT 3TZVB 3IU4H 1G7IB 4L4TA 3SKJL 1JGUH 4OLXL 2VIRB 4OZIE 2YZ1A 1S3KH 1MFBL 1T4KB 1LEIB 1RPQA 4I0PB 4KKLC 1Q94B 3KS0H 3MRCB 4D9QE 1K8IA 5DHYA 2HJKA 3V9FA 2J5LB 1OM3L 2APBA 4HIHA 4KTEL 1NC2D 4M4PA 3O11B 3OXRA 1GGTA 1OD9A 3G04A 3DVGA 1NFDE 4OFKA 3MRQA 4D0CB 4J4PD 2VL5A 1NCAH 3MGOA 5KSAC 3BE1L 4OKVB 1G7HA 3B9KC 2A6KB 3CSYB 2C26A 1G7JB 2GCYA 3MRKB 4ZDHA 2D0FA 4L4TE 3TJEL 2ZKHL 3JWOH 2H41A 3VWJD 3O3EB 3RWHB 43C9B 3IT8D 1PYWA 3U36A 2UZIH 5CHNA 3LMJH 4HCRA 2AKRA 4MAYC 2XRAL 4X8XA 4JM2C 3NPSC 1JWUB 5HDOA 2EE9A 3FB8A 3EFFB 2XKNA 2NZ9C 3EYSL 1KJMB 1T83C 2HTKD 1VACA 4U6YB 4RCAA 2XWJA 1F4AA 1BAFL 4YHYB 3PV6A 3DRTB 5I66B 4GKSA 5KTEL 3PWVB 5E8NA 1R3IL 5D6CB 4XB8A 1JN6A 4LAJH 1T3FB 1TZIA 3B2VL 4RAVB 2J4WL 3BH9A 5ISZA 5T3XL 5EPMA 2EEAA 1GYAA 1ZT4A 1IAKB 2DWDA 2VXVL 1DDHB 5KW9L 1P6AB 1A8JH 4RWHA 1NL0L 1F4XL 1K6QL 1IM9A 1D9KC 4HXBL 3STLB 2WW8A 2H1PH 3U1SL 4JREB 1G6VK 5C0EB 1MCWW 4J8RB 3QUYA 3X3GH 1KT2A 1TETL 2BVUA 2FWOB 3KWWA 2CRZA 3ZDXE 3MXWH 5LQBH 1RIUL 4N5ED 4PRID 2IQ9H 5ISZE 2EIBA 4N9GB 2NY2B 1CLOH 4APQB 1W2KT 3CNKA 2EYTB 3QWOA 4NZJA 4LPTA 4HWUA 3SJVA 3HI6H 1EEQA 4WW1B 1ZK9A 4L4TB 1Z6JT 4NKIH 3OZ9H 1JGVL 2JCCB 4L8SA 5KSUB 2FX8H 1JNLH 3SO3C 2F8OA 3NZ8B 4GAFB 4HIHB 4JJ5B 3AY4C 4CN1A 1A9BB 3HMXA 4HFUL 3PXHA 3OXRB 4K7FA 3G04B 5FYKU 5LCVL 4NNYA 1EH9A 1ZLWH 2HN7B 1UWEL 5CSBA 3M07A 2NR6C 3DI3B 5IB3A 1IRAY 2L4OA 3SJVE 2AW2A 2DJ4A 1WK0A 3R4DA 3OG6B 1M7DA 4ZUVB 4CW1B 1IAIL 3H9SD 3L3JA 3U36B 1KENH 2IGFL 4YDKL 4C83A 2CIKA 5JHLL 2AKRB 5EORH 3NA9L 5D93B 4IMLA 1EGJH 1QO3A 3FB8B 2ID5A 3AM8C 5DJ8A 3NN8B 2XKNB 1BM3L 1XGYH 2G9HA 2KBGA 1DQMH 2VWEE 5GHWH 1A14L 1PSKL 1ZHNA 3GRWA 4HXAH 4QTIH 4BQ6A 2J7LA 1BVZA 4MCYA 3DMMC 2Y06H 4PYHA 4IRJA 2D4DA 5E8NB 3N85H 5GRJL 4YXLH 1ZVSB 3C87A 1HHHB 3MRNA 1TZIB 3G5YA 4AL8L 1BIIA 3IGAB 5ISZB 3LKQA 4YWGH 4B50A 2AXGA 4OB5H 1NC4A 4FQHB 4OJFL 3U7YH 2W0FA 5ADPL 1HEZA 3VG0H 1VFBB 3UYOD 3FOMB 3QG7L 1XGTA 1IM9B 3EFDH 1UM6L 5CJOH 4ODTL 2VDML 4L4VB 1GXEA 5H8DA 3MSPA 4HCRL 3MUY1 4G43A 3GMNB 2DIBA 1M6OA 2JB5L 3X3FL 5F7DA 3QEQA 1MCOL 2W65A 1FNGA 3R1GL 4C57C 1B4JH 1I7TA 4JRYA 3BPLB 4JDVB 3FT3B 2K7PA 1IC5H 1HKLL 1BD2D 2F9BT 2YD2A 1H3PL 3T77A 3QWOB 1GC1H 4XBEL 2CQVA 4GXUN 3SJVB 3L3GA 2A73A 5ETUA 1XR8A 2OL3B 3T09A 4DKEH 3D39D 4XCYB 4OGZA 3O3DA 1JZ5A 4JKPL 3VXRA 3QEQE 2ESVA 1CGXA 4RISH 1F13A 4PV9A 1UH4A 4M7LH 2APVA 1FZOA 5JPNA 4JRYE 4KUCD 4K7FB 3CMOH 1T66C 4NNYB 3TYFA 2XACC 2O5YL 1J0HA 4IRSA 4KK8C 1L6ZA 2F8VA 1ETZA 4JPWL 4S1RH 4YR6A 5JOFB 5EULV 2VDLL 4MHHG 1JJUA 1ZS8A 4O02L 2I07A 4UILH 1AI1H 1M7DB 1IAOA 1J1PL 3DYPA 4KVCH 2ESVE 3LD8B 2BRRL 1K3IA 4C83B 2J88H 1KEGL 1GHFL 2OL3L 4ONOA 5GS1B 3TBYB 1QO3B 4MA1C 4OGAD 3SDXF 5T33L 4OIIH 1KJ2H 3KYAA 4GRWE 4TOYH 1I9IH 3LRHA 1AR2A 1QSVA 4M62L 3SDDD 3R0NA 3WXVL 2ZZUT 4P2OD 3ZZ1A 5FV1L 3NA4A 1Q8MA 3C08H 2HTLD 1RZ7H 3KPOB 1UYWL 4FA8A 3EAKA 4ZNEA 1HWHB 3FB5A 3U79A 5DZNA 3MRNB 4NT6A 4CU7A 2GSIB 2XNAA 4JFXB 4TPRL 3LKQB 1TJIL 1AXIB 2X70B 4OGXL 4U2ZA 1OP5K 2VB5A 4MNQD 4IIQB 1CBVL 3ES6A 1F6LL 4LHUA 5C70A 5F8RC 4BSVA 4Z8FH 5IBTL 3ARUA 4F7CA 5E1HB 4X9FA 2R0KH 1JGLL 1INQB 1FNEB 2ZUYA 2V9TA 3L5XH 1J0JA 3QT2A 5F7DB 4Y0GA 2COQA 5JHDB 4ZNEE 3ULUH 2ATPB 2WBJD 4KMQA 2HJLB 1ZHBA 4XPGL 3PUCA 4OV6F 2CRIA 5E4EB 3BRGC 1I7TB 4JRYB 2WMPA 4XPFH 1RU9H 1F2XK 3VXPA 3KXFB 5ICZB 4NWTL 4Y2DA 3WFDH 4GUPB 1CICA 3FAXA 3OB8A 3TO4B 3T77B 5EZJA 4PRPA 4MXQD 2VQ1A 4KQ4H 5ETUB 3TF7C 1FORH 5J89A 3HG1D 4QHLB 3CMGA 1J1OH 2HRLA 1UM5L 1PLGH 8FABA 3O3DB 5B38B 5INCA 1MJ7L 4LSQH 4XVJH 3L3DA 2FZ3B 3NCJH 4ODXA 1RUMH 2JB6A 4K94L 1RJLA 4X7SH 4DN4H 5GZNC 5L88L 1ND0A 4IRSB 5EU5A 2X4PA 4FFYH 5DFVC 3PL6C 3TFKC 3LH2L 4YR6B 4A6YH 4KK9C 4Q2ZB 1PKOA 2RFXB 2YRZA 4JFPB 2OK0H 1ZS8B 2I07B 5IB2B 4YPGA 1OGAA 4YHLL 2XTJD 1QFOA 1CFVL 1XEDA 1RIVL 4FQQA 1N3NB 2JELL 2DQFA 2D7MA 1D7FA 1NGZB 1T03H 1CWVA 2ZUQC 4X98B 4FG6C 4XCCH 2DM3A 4NO5A 3PQYB 2WUCL 1GAFL 2Z8VC 4HWBA 5E6IB 2BX5A 1KELH 4KRPD 3RTQB 4FQIH 1OGAE 2AJVH 5IK3A 3FB5B 2ADGB 3WKNA 2E8YA 3TO2B 3RAJL 4WY7L 5F96H 3TIEB 2AP2A 3F8UB 1IKFH 3WXWL 4Q0XH 4FZ8H 5JXEC 2AEPH 1FZMA 1U8KA 1G6RB 2FX9L 1T2JA 4DN3H 5EU7E 3BMWA 4XAKE 5F1NB 4HQQH 4BSVB 4QRQA 4WEBH 4K3EH 5KOMC 1LP9A 3TJHC 2NW2B 3MOBL 1R3HA 1JFQL 4EI5A 4WUKL 1QR4A 5SV4A 4K71B 3C5SB 4M7ZB 5JQ6L 3BWAA 4PTTA 1ZHBB 4PJ8A 4XCNB 5DK2A 2HVJA 4WHTB 4A2MA 1BZQK 1OCWH 3FFDB 5FCUL 2ICES 4D9LH 1JWSA 4HT1H 1RJYA 1K2DA 3K81A 4IRJD 3ZDZE 1IM3A 5EZJB 5C9JB 4NRZA 3IJYA 2UVEA 2VQ1B 1P5UA 2AGJL 4BQCA 1LP9E 4JVWA 5TDPA 5I30L 4LLUB 8FABB 4BYHA 3QDGD 1G6RL 5D1ZB 5MI0B 3FO9A 4MNHA 3L3DB 1A2YA 2BC4B 4ODXB 1Q9OA 4JKWA 2JB6B 3QQ9D 4ZXBB 4Z7OE 2YSSA 1CLYH 5BW7A 3DO7B 1XAUA 3L7FA 5INDA 4OM1H 4G8GE 1ND0B 1ONQA 5EU5B 4TTDC 3X11A 3U2SA 4YHNB 2GK0A 5TFSH 1B0WA 2XN9A 5E2VL 1PG7X 3BZEB 2Q20A 4OLWH 2NY6D 4JFQA 2IMNA 4ZUUA 2DQFB 3SCMC 3BJLA 1X5KA 3GMOB 3U46A 3IS1X 4JY5L 3FZUC 1OSPH 1NGYA 2BFVL 3TWCH 3INUH 3JUYA 3O9WB 3VXRD 4LCUB 2G2RA 5ALBL 1RUQL 1REIA 3MV9D 3CXDL 4JZJC 1YUHB 3MV11 4FQ1L 2HKFH 2E27H 4XPHH 1CFNB 3F12A 1QKZH 2XV6B 5CINH 3VXMD 2L7JA 3CD4A 4LVHC 4KTDH 4NQDD 1Z5LA 3H3KA 5D7KE 2ORBL 5DHXB 1HHKB 4ELMA 4ODUA 2ZCKH 4OZ4B 4D8PA 1F3JA 4FNLL 2J1KA 5C0BD 5EZOH 4LRNH 3S6CA 5EO1A 4QRQB 5IR1A 4Y5VA 4HPYH 1R3HB 3GNML 3GSVB 3GSWA 4M02A 4OSUH 3BDXA 2XWTB 4W6YB 4WV1B 3M45A 4OLUL 1H3WM 3BWAB 4YK4C 2EDEA 5HHNA 5L2JB 4PJ8B 1EVTC 2DTML 1H3GA 1G7LB 3TN0B 2SEBB 2HVJB 2UY6A 2UYLA 3MUZ1 3PWPD 3QXDB 5BO1H 5ILTH 4K2UL 3U7WL 4S10A 5FB8A 4HWBL 2Z91A 1QSZA 2OJEB 1B0RB 1JWSB 3T8XA 4EEEA 4ELME 25C8L 3CDCA 4FQPA 4G8GB 1IM3B 4IOIB 4JGMA 1FFPA 5IFJA 4QNPF 5JW4M 1RMFH 3FRUA 4XMPH 3P73B 2CJUL 3TA3A 1SVCP 5KVMC 1Y6NR 1T89C 3FO9B 4MNHB 4LLQA 1CT8A 3LRGA 5ESQA 1EMTH 1FVCA 2XA8H 2EEBA 3ULVE 4U1GB 4WFFE 2YSSB 5C07A 1UWGH 1GGYA 4PB0L 3O2DH 4PRHD 5DVMA 3L7FB 2BVQA 5INDB 4FTVE 3N1MC 4DOHE 5ICXB 3RIAK 1ZV5A 4LPXA 5F7EH 4WNQB 4LLAA 4JO1L 2GK0B 4KROB 4LPWA 3RVTC 1U8OA 4P4RB 1Q9LA 4YE4L 2CGRL 1H8NA 2NMSA 3GSNH 3S5LB 2X4SB 4HUKB 4ZUUB 2JIXD 3NIFF 4PRPD 3RVWD 3ARBA 4G80A 5E8OA 5FIEA 5JORB 4O2EB 3PWUA 3S36X 4F3FB 3U46B 1N6QH 1NGYB 4XVTL 5AAMA 3ZKMD 4JHWL 1RV6X 3VGBA 3HAEB 1R3KB 2WQRA 3QEHA 2VH5H 4P46A 2R9HD 3F12B 2YA1A 5J13C 1C8PA 4LK4A 4Y19D 5BS0A 1TNNA 1TQCB 3KPSD 4QHKI 1G7PB 5IVXF 4K7PL 4R0LA 3MV7D 1D5BB 5DQJB 1RY7B 3SDYL 1F3JB 4YDVA 5DSCA 3VXNB 1F8TL 3P11L 1P2CA 5LXGL 4WFHD 4OTXH 2AK4D 5DK3A 3UTSA 5EN2A 1JF5A 3OF6A 4U0RC 3FFCD 4LVEA 3HE6C 3MFFA 1BVKA 5BS0E 3GMPA 1G9MC 5IV2A 4LLMA 3P4NA 4S1DC 4LIQH 3BEVB 1QLRB 3T8XB 4OCSH 2EIDA 4GW5A 4FTVB 4XCEB 3MLYL 2FLBT 2KKQA 4UT7L 4WGVB 3TLRA 4KAQL 3SY0A 1A6PA 1FFPB 2A6DA 2NY0C 3P77B 3CVIH 4W81A 1X7QB 1NUNB 3M8OH 4LPVA 1FPTH 4UT6H 5J9PA 3UTTA 3WHXA 5HGBB 4R6UA 4BZ2L 1J05A 1CT8B 4OCMC 4RSVA 3V52H 3RBGA 3ULSB 4YDIL 5E1AB 1S78D 4NUGL 4Z78B 2FIRT 1G9EA 5EBGA 2BVQB 4EI5D 3B5TA 5DO2C 1IL1B 3D25A 1PX4A 4F9PA 4Y8AA 4EIZC 2E9BA 2JK5B 2R69H 4ONHA 3FKUS 1MCWM 1Q9LB 5FGCE 5TJWK 1R5IA 3F5WA 1D3CA 3IDIB 3CDFA 3MLUL 2OMBA 3SE3A 1OWWA 2PXYD 3UBXG 4FQXA 4G80B 1HH6B 2CR3A 3SOBL 3U7AA 1T5XA 2ZCHL 3VFWA 4MAYB 3QPXH 4Q9BA 4D94A 3GI8H 4S0TD 5FYLH 4JM2B 4J3UA 2CMRH 1FZKB 5C9KA 4NHUA 4Q6IC 1CD1B 5CBAA 2GTZB 1J5OL 2ICEB 4NNPL 4OQTL 3GB7A 1JNJA 4YBHA 4JANB 3VD5A 4ZODA 3WIFA 2H32H 2Q76A 5BS0B 4XMLH 4NZUL 2J8UA 2O5ZH 5KN5A 1Q0XH 4R0LB 3CC5A 2NW3B 1SEQL 4FFWD 3GIVB 4I18A 3L1OL 3QDMA 4NC2B 3GSQB 5JPMB 5SX5K 4HAGA 2MSPA 3BO8A 4Z7QF 2ICWA 1ZWIB 1NBVL 1P2CB 1WWAX 3ALPA 3G6DH 3JTTA 1Q0YH 4JRXA 1P4LB 1AC6A 3ZE0F 1TVBA 4B5EA 2FIKB 4MXWH 4AK1A 5IUSA 4HUVA 3MFFB 1RAMA 2FB4L 2VLRB 3LKPB 2Y5EA 4WEMB 4LLMB 2VITB 4HX1A 2CLZA 2J8UE 1RHHA 4GS7B 4H0GA 4G6KH 1NMAH 1HXYA 3QRFM 1JYVA 4GW5B 5DVKA 5EH1A 2EDBA 3MRJA 3QDME 1GGBL 4UTAL 1V05A 1LDPL 4WI2A 2D03L 2HFGL 3E8UL 4PRAB 4JRXE 5ACZB 2ZWLT 3ZMRA 4F7MA 5FYLD 3BKML 4ZFGL 1DSFH 4H1LH 1KF9B 5F3BB 2OZ4H 3FO2B 4L29A 1JK8A 4PJDA 2CXGA 1JGDA 1A6WH 3HE7D 4PJBF 3C6LC 4K8RC 4MWFA 1CXFA 4HFWB 1ZLSH 5CBEB 3REVA 5HHPA 4Z7UA 5D71H 5B8CA 4JFOA 1SYVB 5E94A 1T04B 4UBDC 1C5BH 3H7BA 1KCSH 4NHCL 3JSSA 4AEEA 5BZWB 1IGIH 2RB8A 1NGWB 2CLRB 1UVQA 3HI5L 2OTUB 2Z8SA 3O0RH 4KZEH 3FRPA 1DEEA 2Y9RT 3GJEB 3WIIL 4J12A 1A5FH 3EO0A 4H5SA 5GGTH 1K85A 2APXA 2J2ZA 3CFIC 5DJXA 4I77H 1LK3H 3SQBA 4FQ2H 1ZTXL 4FXLA 5FCSH 3P9WB 4TUOA 4Z7UE 3LHPL 1BFOB 3L5JA 3QIBC 1OW0A 2EO1A 2VL4A 3GB7B 3FT2B 3CFJB 5C07D 1D6VH 3MNWA 1I9JL 1NBQA 3WIFB 2Q76B 3VXUB 4NQXB 1IC1A 2J8UB 3F58H 5KN5B 2I26N 3CC5B 4NCC2 1BHGA 5FKPB 2OJZL 3FQWB 4I18B 3U6RA 3HRPA 3QDMB 3U9PL 1R5WB 3VRIA 4C58B 4CDGC 2VDNL 2GTWA 3BO8B 2VKXA 4CVUA 4QOKD 5D1XC 3RJQB 3VXOA 1T7VA 2J8OA 4JRXB 1KXVC 2B1HL 5C7XL 1SY6A 3L9RA 3RIFK 1I1AC 1J88A 1TVBB 3CFBA 4JGUA 4H20L 3MR9B 4FS0A 4NRXB 5HGHA 1YEEH 1CFQB 4PY8I 1EFXB 5FHBH 3HC4H 4YDLC 1MNUL 2DQIL 1AE6L 4DFHA 3TBTA 5IGXL 4HX1B 5DD3L 1RHHB 3DV6A 2P5EA 4QYOA 1HXYB 3O2VL 3LIZL 4PJIB 3C9NB 5ECJE 4P46D 4Y5YC 4DVBB 3G5XA 1RUAH 3MRJB 2A74A 3QCUH 1QLEL 2VISA 2NY7L 1NSNL 3DWTA 4MDIB 5KANG 3NFPA 2PO6C 1TXKA 1RZGA 1MHHB 3W5MA 3RFZC 5LBSL 3JTSA 3QCTL 4HUUA 5IBUG 1EAPB 2WK2A 1AHWC 2VLLB 5IBLC 2P5EE 4UZGA 2ARJA 3UTSD 4DGYH 3EKCA 3OF6D 4F58H 1R3JB 4HIEA 4PJXA 5ABDE 3D3VD 1DBKH 5HHPB 4Z7UB 5B8CB 1TNMA 3O4OC 4YJZL 3R0MA 2O5XL 4LSRL 5K59F 4WWKC 3H7BB 2R8SL 2PW2B 4ZD3H 4RFEA 4OCWL 4NKDA 4RGNC 1QBMH 3LQZB 2NXZC 4GXUM 1UVQB 1YN7A 5F6HJ 1FLTX 1NMCC 5CJ8A 1P4IH 2RJMA 4Y4FA 4KKAC 3WDIA 1QLFB 1I85C 1FCCA 2E7MA 3C6SB 4H5SB 3UTTD 3WEXB 4N90D 4TNVK 2BNQE 5I2IA 4K07A 3EDFA 4XP5L 2HH0L 5BOZG 3RHWK 1DBBH 2EXYD 1DBAH 1AGCB 4PG9A 4TUOB 35C8H 4OD1H 5FXCH 4JCLA 4RX4A 2BJML 3QJFA 4QT5B 1A4JA 5IIEB 1C16B 2EKJA 5H2BA 5J6HB 1CU4L 3VWKA 5KSBF 4PY7B 4MB4A 3BQUA 3EOTH 3WS3B 5FUOH 4RNRB 4XPAL 5TE4H 5DEGA 3RGVA 3REWB 3U4AA 2FNBA 5A16A 3U6RB 4L5FH 3GSUA 2X6MA 4N1CA 4ORZC 2GTWB 2ZPKH 2EDFA 4FQXD 5GSRA 3MBXL 1WBXA 3L9RB 3MRMA 3LKRA 2AV1B 1DUYB 1CF8H 1ACYL 3VJ6B 1B90A 5ADOH 4PP1C 4OI7A 1HINL 3TBTB 3WNLA 2WLZA 5IROA 3HR6A 3UTPE 4QYOB 5I8OH 4HS8L 3GHEL 3HZYB 2A74B 1U3HA 4GW4A 4H88H 4MS8D 2Q3ZA 2VISB 4ZTOH 5J1SC 4DKDC 4PJ5E 3VFPA 2F53A 4W70A 1RZGB 4JDZB 1AQDA 2WWMC 4PS4H 4XBPB 2C1OA 3MCKB 5IF0A 4M6OL 5CZVH 4IOFC 15C8H 1IGCL 3FQUB 4NC1E 4FFVC 4KZDL 3QUXC 4HUWA 1PD6A 1XIWC 1KIRB 4TQEL 4YEFA 5BQ7A 2BNQB 1YEIL 4H8WH 4ODHH 4KXZH 1RIHH 4HIEB 5I1IL 4RGMB 3AXLA 3BPNB 3PL6B 3S96A 3FN0H 1TPXB 2F53E 3MYJA 5HGAA 2ZCLL 1JNHA 1GC1C 4P5TC 1IGYA 4NKDB 3VA6A 4MLIA 4P59H 3W5NA 5KS9F 4GAYB 1JF6A 1ZANL 4KJQC 4P23D 3VMNA 1N4XH 4UB0H 4Y4FB 5AYUL 1S7WA 2ATKA 3EOBB 3EIFA 1F58L 3QHTC 1MHPH 1Q9KB 6CGTA 1MCIA 3B9EA 1DFBH 4N8CH 4OZHF 1J0KA 4XGZA 4PGBB 5DMYA 1OD7A 1X4YA 4JN1H 3O8XC 4F8TA 1U8QA 4KWUA 5DR5L 2Q86A 1NFIA 4MNGE 3SKJH 3LKSA 1IC7L 3BQUB 3ZSTA 4ODWA 3HS0A 5DRZA 1X5ZA 4I0KA 2DD8L 3RGVB 1XMWA 4MJ4A 3TBWB 4KTEH 5B3NA 1S8DB 1NKOA 4RWYL 4HGMA 3DROA 4A2LA 4XHJD 4PJ5B 3MRMB 2F54A 3IF1B 3OR6B 4U1IA 4ZAKA 3TJEH 4UINH 4BFIA 2ZKHH 3B2UD 4FQLL 4JAMA 3BPCB 1ZMYA 5TPWL 1U42A 3TIDA 4MZ3A 4KJPC 3C5ZA 3TYGL 1XT5A 1U3HB 2RCSH 2XRAH 3D85D 3MLZL 4P9ML 5GRVL 3L95A 1CIUA 2F53B 3EYSH 3QFJB 2F54E 2YD7A 2MPAH 4NP4L 1IQWL 2C1OB 4I3GA 4BELD 4YDJB 2D2OA 2VLKB 2HVKA 3VGDA 5KTEH 5EOCL 4GRMA 5KZCD 4HUWB 1R3IH 2EE6A 3ULUC 3MA7A 3ZT6A 3B2VH 1UA6L 2J4WH 1EA9C 5FF6A 1CGTA 2Z31A 4PRNA 5T3XH 5I9QC 2DI7A 2VXVH 4JG1H 3VE0A 2BY1A 5KW9H 1H15A 2E9JA 5BVPL 3MYJB 1LDSA 1UB5A 1F4XH 4WU5B 4HXBH 1OSZA 1D5ZB 3U1SH 4IDLA 5ID1A 4MNGB 5I1GL 2V9QA 5A1AA 1LD9B 2XZAL 1TETH 4IHOA 1MCQA 3KJ6L 1YNTA 3OKOB 1AD0A 4QWWC 3JWNC 5I6XB 1E4XI 1RIUH 4IEFB 4P2RD 1LO4H 1MFNA 3QNZB 1I75A 3ARYA 2AQ3A 3UC0L 5D6DA 3HNTH 2FLRT 4Y8DC 2CIIA 4JZJB 4MHHI 4PFEA 4CUCA 4M6AA 1QVOB 1F45A 4H26A 2YD5A 1FC1A 4EOWL 4X6CA 2YN3A 2I5YL 1JGVH 3CCHB 3Q6FA 2AXFB 2GYSA 3OR7B 4UOJA 3F6IA 5C3TA 3QCVH 4ZO6A 4KI5F 4D0DA 5JZ7C 2R0WL 1DBML 1G9NL 2HA1A 1OQXA 3CAFA 3CH8A 4HFUH 3QUZB 3DTXA 2OSLA 1NCBH 1YY8B 5D7JD 1UWEH 4GSDL 2YK1L 4N9OB 4U1IB 5T3XD 4BH8A 2OR9L 4CRPA 1E4KC 2UWEF 1LMKA 4YK4B 2NY1B 3HUJF 4NZTL 5JOPE 1IAIH 2EZ0D 1UZ6E 4RX4D 2IPKB 1XF1A 1KB5B 2P8MB 2IGFH 5L7XL 5EWIH 1IFHL 2UZXB 3NA9H 3EJYD 4JFHE 4WO4A 1CL7L 3LPFA 4G3YL 4RMWA 5FM5M 3UTZA 2GK2A 1BM3H 1NCDL 5CZXC 1A14H 4TYUA 1AKJA 4UQ2B 1AQKH 1L9NA 2FRGP 4U3XA 3RX8A 3QI9C 1KIPA 2HVKB 5C0ND 3QDJD 1MRCH 4NGHL 4GRMB 3IU3A 3QDHA 4U6HA 5GRJH 1BJ1H 4JJHA 2NY5C 3STZA 2I24N 4AL8H 3U0PB 2Z31B 4PRNB 3E6FA 4OJFH 4ORGA 1L7IL 5F3HB 2FGWH 5ADPH 3VE0B 1F4WL 1H15B 3WS6C 3U4EA 3QG7H 1FIEA 1JPGA 1DN2A 2Z92B 1OSZB 4ODTH 2VDMH 4LSUL 1KB5L 3T0DA 1MLBA 5ID1B 4TVPL 3THML 4TNWF 4TRPL 2JB5H 3X3FH 3NTCL 1MCOH 2X1PA 3R1GH 4KUZL 5D5MF 1IEBA 4P4KD 4HD9A 4PV8B 4MMXC 2BSTA 1FL5B 1T21A 1CFSB 3DYMA 2NY2D 1HKLH 5L0QB 4APQD 2X4UB 1HYSD 2LABA 4M6NL 1H3PH 2XWBA 4QRUB 3KLDA 3QISA 4XBEH 2BSRB 4H26B 1N8ZA 2DKMA 2V5RA 4LLYA 4NUJB 2PYEA 4OZGF 1I8IA 1NANI 5ESAA 3FMGL 2GJ6A 3LRSB 4D0DB 4Y16D 5K33A 4F37F 3O6FC 1KACB 4JFEA 1NBZB 3DTXB 4LDLB 3A6CL 4WTZG 2W38A 1VA9A 2MOVA 4PJ7F 5F7KC 1WBZB 1RZKL 5TH2A 4JPWH 4MAUL 5IMKA 2HLAB 3RZCD 1JPSL 5CGYC 3V6ZA 3SDCA 1JF1A 3ARSA 3HE6B 1BIHA