4X98A

Immunoglobulin fc heterodimer variant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A01
2CRYA 4D0CB 4FA8A 5CJOL 2IH1B 4DGVL 1AGCB 1GC1L 2MMXA 3SDXF 4A6YB 3BGAA 1MQKH 4KRMB 3WJJA 3Q6FA 3D9AL 4R26H 4P5TD 3V6OC 3UP1A 5I1AA 1A14L 4K8RC 4QRUA 3LSOB 1NCAL 4K55A 4D8PA 4ZFOL 1FE8H 3EJYD 1IC7L 3WIHA 4HMCA 4CGTA 3MODL 3QFJA 4KK6D 4H5SA 4GRLA 5ESAB 1CG9A 1MELA 1UWEH 2CDFA 3CZJA 1G9ML 2YR3A 4OZGB 5FGBC 4JAMA 4RIRB 5C0BA 1OT2A 3QHZH 1RIUL 3DSNA 4DKFH 2VDNL 4N0FA 3ELAT 3IU3B 4NO3A 5DQDH 4UQ3A 3ZTNL 1B2WH 1BFSA 4GS7B 2UWEA 4U49A 4KKBD 1FZJB 2G5BA 3T0BA 4Q97A 4OZGE 2XZCL 1BQHB 5ACZA 4LK4A 1P9MA 4X6DA 4WFFE 2K9UA 4XRCA 1IKNA 1G0DA 1XIWC 3TO4A 5EIVA 3UBXB 2VDOL 4OB5L 3H7BA 1QYGL 1OF2B 4KJYA 3TYGH 3P40A 3WFDH 1T3FA 2AABH 5ICZB 3L3IA 1Q9LA 4FFVC 5KSVB 1K3IA 4OTXL 3ZDXE 4U1KB 2GSGB 3KPNA 4Q9BA 4OZ4B 5FHAL 1P6FA 3QR2A 3TYFB 1ND0A 1FFNA 4JR9H 3WUWA 3RA7L 1J1OH 1LO3L 4GKZB 4XZUB 1KIRB 3UTZB 3RU8H 1UWGH 4MX7B 1IJ9A 4WWID 2NY2C 4PJFB 1HCVA 2DQUL 3RHWK 4N8CL 4XH2B 12E8L 3U7WL 1KN2L 3QA3A 3QXTA 4UBDC 5DQJB 5K9OA 4F8TA 3WIIH 1NUGA 1D6VL 3B8YA 4RGMC 3PP4L 3GO1L 4ZFFA 4I18B 3RIFK 3HE6D 5EO0A 4XXDA 3MBEB 4GKNB 4XC3H 2UZIL 1RIVH 4JQXC 4XWOC 2WBJA 5D5MF 4CJ1A 1A1OA 1NGZB 1YYLH 3B2UC 1FRGL 5T1LA 2B7DT 3HNSL 5CD3A 3I75A 3C5ZC 4J3WA 4DK3A 1MCQA 3F7VA 3GIVA 4ZUTB 1FC1A 4HG4J 5MHSE 1HH6A 4JN2A 5DZOA 5ICYB 3IS1X 2WINA 4HHAA 3O9WB 3JWNC 4AT6A 4YXHH 3VFMB 4J4PC 3S88H 4LASL 4TSCL 1IAKB 4ODHL 5JO5A 4PJIB 3IAQA 4NQEE 1I7TB 1U8MB 4K71C 4YHKL 2YD8A 4WY7H 3T4YA 3GI9L 4YNYB 2HMIC 3D0VA 4EBQL 3QUZA 1JMXA 3M1BB 4RGOH 2BOCA 1MLCB 4ZXBB 5M94B 4JFYB 4J8RA 4KZDL 4F7TB 5BV7L 5C0EA 4H0IA 4YDIH 4JG0L 4AIZB 1F97A 3I6LE 5SWQA 2Q8AH 1X44A 4PBVC 4OGAD 5CBAB 2JF1A 4C54A 3BO8A 4X6BA 4PJ9B 2W9EL 5CUSL 3EYFA 1N7ML 3OKYA 2AV1B 3MRFA 3EOTL 5F1NB 3T1WA 4XVJL 4JANB 1CE6A 4EOWL 2X1WL 3UAJC 3NOIA 2WNGA 4YBQD 4LLVB 3GSVA 3U4EA 4BKLB 1H3PL 4KAQL 4I77H 2V7NA 1KLUB 1QFWH 1AD9B 4FFYL 4F2MA 4X9IA 5FHBH 1Q9WA 3QIBC 1GGCL 1C5BL 1Y0LA 1LK3L 2E8YA 1MCHA 2R2BB 4MYWB 3GMRB 4WDIB 2BNUB 5C07E 3LQAH 3ULUD 3BIBX 4XMKL 5D6CB 1RHFA 2DLFL 1XZ0B 2HP4A 3BGFC 4ENED 1Y18B 4MXQD 5BW7A 2WQ8A 3K81A 2M8XA 2X6MA 4PIRF 4PRHB 5IKCB 2ZCHH 1E4WH 1T04A 5IB1B 3QBTB 3WXWH 2OI9B 2CKBH 1U42A 3GSUB 2X89D 4M8QB 2FYYA 4QHLA 4HT1H 4YPGA 4P57A 3HZVB 3RAJH 1NMAH 3QXWA 4RX4A 5KSBB 1IC1A 5L0QB 3MOBH 3C8HA 3P73B 4W6XB 3MRDB 2VXSH 4R2GB 3DYMA 4JDTL 4HBCL 4PG2A 4D9LH 3BPLB 5I9QC 2V2WA 4WHYG 4JPKL 5ITBL 4UI2A 5INCB 3IJSA 1JRHL 3R8BB 3W9EB 1H8SA 1L7TL 3KLAB 4BA8A 3V52L 3MJ9L 5JPMB 1NFDF 1B0GA 1ONQA 5BRZE 3T0EC 3VG0H 4XCEA 1RJYB 5TE4H 5DFVC 2R2CA 1GSMA 1TJGH 5DJYA 1IGCH 3KJ4C 3RVXC 3RWIB 3V5KA 3HE7C 1A7NH 1QBLL 2FZ3B 3LRGA 4U6YA 1BJ1H 4LIQH 1MNUH 3JVGA 5IB4B 2COQA 3S5LA 1N64H 1T5XB 6FABH 3SGEI 1QPPA 3MBED 4XHQA 3FOMA 4NN7B 4G80A 3JTSA 2VLJD 5HHMB 1QSVA 5J7CC 1XH3A 1JWMA 5A2IH 1MVUB 3BH9B 1EUTA 1KFAL 3RIAF 4UMGA 1NBVL 1B90A 1JFQH 4JRWA 1I3VA 5I19L 1TPXC 5E6IC 1CFNA 5EWIH 2JJSA 2MOVA 2OZ4H 1QA9B 5I73C 4JB9H 2APXA 4N5UA 5TQ0L 5D7IB 1J10A 2QLVB 3GSRA 3S34L 2RBLA 4M7KH 5F6IB 2ZUQC 4DAGH 2DQEL 4HH8A 1BOGA 3U0PB 1AQKL 1EGJH 5IOPB 3T2NL 1UJTA 1I9JL 2D4DA 1ZKAA 2VZ3A 1HXMB 1NGYB 4LVOC 4CVXB 4OLXH 4HK3J 4ZYKB 5C09B 2D7OA 1HE7A 1IGMH 1Q94A 4P46C 4QCIB 2AXJA 4X98A 1P5VA 4G6ML 4DK6A 1ZLVK 2ESVB 4CU6A 2RAMA 2GTWB 1CI5A 3GJFA 1CFTA 4Z95H 4ZUWB 3U30B 3F7YA 1SYVB 1XR8A 2R56L 2NW2B 4I3RH 5IF0B 1RK0B 5E5UB 4UV4L 5C09E 5CEXB 1HWGB 1LD9A 5EC1A 1DQDH 1LEKA 4PJ9D 3C8DA 5B38G 4HFUL 5I8OH 3VFOB 4JFZH 4MQ7A 3C8KA 2PETA 4G8IB 2DKUA 4PRBB 1EEYA 3UJJL 4R0LB 1MJ7L 5GRWA 1MAMH 2JJTC 4U1LA 1NAKH 3L7EA 4FN0A 3WV0A 3L5XH 1GHFL 1U3YA 4DTGH 4C4KO 1UM6H 5KVFH 5J3HC 4NO5A 3VFGH 3R0MA 1LHZA 2PXYB 3MJ7B 3S7GA 2B0SH 4HWEH 4H1LB 4FQJL 1UH4A 1FNHA 5DMYA 2VQ1A 3PDOA 5IMKA 5KSAD 3O2WH 5FUCE 1TTUA 1OCWH 4WV1B 1T1YA 4OZFA 4PRHD 1IEAA 3QJHB 3VRIA 1PSKL 2HG5A 3EW3B 1KOAA 4WHYH 3WE6B 1KXTB 5MERA 4JPVL 4K3EH 1TVBA 2PN5A 5J9PB 4JPIB 1JK8A 4PGZA 4M48H 3CDCA 3X14A 1CF8L 4L8CA 1A9BB 4OSUH 4Y5YC 5T3ZD 2MQ3A 2PTUA 4X7EC 1MCFA 1WQVT 3CPLB 3O0RH 3VXQA 2ZUTA 4ZFGH 1Q8MA 4R2GD 3BDBA 1UZ6E 1JNNH 4OCXH 3QFDA 1FG2B 1RZJH 3OB0H 2DLEA 2G75A 4JFEA 2JK5A 5C0JB 4OLEA 4YHYB 1C16B 4IMLB 1JGLL 1JZ3A 3A6BH 4YDLC 3SDCC 2IH3A 2SEBB 3QH3B 5DVLA 5HJ3A 1BGXH 3KVQA 1XF4A 2OTUB 1A5FL 4CMMA 3OKOB 2A74B 5ID0B 3VWKC 4U1GC 1X4YA 1F2XK 1N6UA 4X6CB 5C07A 2D03H 3DXAB 5HYJE 1U9KA 3BH8B 3PWVB 2W60A 1RULH 4YDVA 3EOAA 3T0AA 2JCCF 3FB6B 3QNYB 2Z9TA 5AWNL 3C09B 4EI5B 2FD6H 3N50A 3FQWB 4M8VA 5C9JB 5IT2L 5HDLA 1LVEA 2N4IA 3QEQB 1FNSL 1I3RB 2VSCA 4J1UB 3DXAE 4KHTH 4QHNB 4P2QE 5KTEH 5KVEL 5CP7B 1T66D 4H25A 1PD6A 3FCTB 3D85B 5T3XE 5HHMD 4MJIA 4D9QE 4MNGB 3OX8A 3EYOA 4DJMA 3PL6D 4LDEB 4NHCL 4E9LA 4GBXB 2XXCB 3VH8G 1CFSB 3RWHB 4LSVL 4JQIH 4M7ZB 3WMSA 4P5TC 4GFTB 2APWA 1WUNT 1KNOB 1JZ2A 4MNGE 3EJYC 4G8EB 4Q0XL 2YUZA 5GJSL 5J13B 1JI1A 2J8UB 4KK6C 1DBML 1A6PA 1DQTA 1WK0A 4MHHG 5DJ0A 5BRZA 5HHXL 3VFVA 3NFPB 4LOUD 5I66A 4NRZA 4E5XA 3GUTB 1MRFL 4ZS6D 1M7IB 3MLUH 1SJEB 2C7UB 1KYOJ 1Q0YH 4JKKA 3KPLB 5F7YC 3T0DA 5ALBL 3SDDA 1MY5A 3DGGA 1G6VK 4KKBC 2AQ3A 3SKMA 2R9HD 1IARB 2XQBL 1ZOXA 4A2MA 3O4LB 4UNTA 2GY7B 5GSRB 2MKLC 5BJTA 2WIMA 4JY6A 4NOBA 1NCBH 2ZUXA 2DM4A 5ENWA 3HUJB 3QRGH 4NQDB 1SEBA 4RDQF 1MFAL 3RWEA 1M7XA 2OSLA 3OB8A 3DV4A 1YNKL 4JDVB 4FP8L 3U46B 3HUJE 5I2IB 3GNML 5EU6E 3HI5H 8FABB 1BZ7A 4PJHA 1F6LL 3ZZ1A 4J6RL 1CK0H 4W68A 5GRUH 2D7PA 2QQLL 3MLRL 5J89A 3VXNA 5F9DC 5HXMA 2PXYD 1FJ1A 3L6FB 4M1DH 4X4ME 5K9KB 3P77B 1Q1JL 3GHEH 1RY7B 5ETUA 4H8WC 3WLWD 2AJ3A 1VACB 3JV6A 4OCRL 5D2NB 3WFCL 1DDHB 2GYSA 4P9HH 5FIEA 3HE6C 2AEQH 1U36A 4XPBL 4ONOA 1KPVA 3QDHA 2D7TL 2NXZB 3PWPD 1KTDB 3L3OA 3QJFB 3WFEL 4JY5H 2VABA 1EAPA 3GK8H 4JO1L 4Q6YA 4JLRB 3MRHB 3WHXA 3ARGB 2QKIA 1U2HA 5KS9A 5FYKU 4LLYA 5EOTA 5T1MB 3HMXH 3WDIA 5C0RH 2R1WA 4Y19B 3TO2B 5ICXB 5FYKD 2X4SB 3SDXE 3R8QA 5JHDD 2R0KL 5ECJE 3BE1L 1YEKH 1VPOH 3PHQB 2R8SL 1I1RA 2IALA 2MJWA 1LDSA 1YECH 1O5DT 2NY1B 3O3AA 5E8DL 2X9XA 4UU9B 2ICWI 1MF2H 2C3VB 3L9RA 1AJ7L 3DPBA 5ID1B 4TPRL 4WIQA 3SO3C 1D9KB 3VXOB 5DMGD 3QEQD 2P47B 3RUGF 1WIUA 4PJ8D 3RY4A 3NFSL 4TOYH 4N0RA 1NKRA 3TM6A 5IVNA 4OI9A 2LE9A 3MRKB 4OGAC 5JW4Q 4Z7VE 4M9OA 1BEYH 4PY8I 2VXVL 4MAYB 4YZFF 4KQ3L 5H8DA 3KPSD 4GBXD 4PY8J 3MLPA 4YBQC 4M6OL 3RTQD 3KWWB 1F58L 3FJTA 4AH2B 3MRQB 1U8JB 2J7LA 3LPGA 4DFHA 4WUKL 2H26A 4I48B 3QIUB 1GOHA 2A83B 4QF1B 5CGYD 4EVNA 5L2KE 2AV7A 2FWOA 3V6FB 4BYHA 1VKXA 1OLZA 5HYJA 3ZL4H 1UVQB 2QADB 4GOSA 3ULUC 1Q72H 2V5YA 2IEPA 2P48B 5J1AB 5FAAA 2IPUK 1B0RB 2EYSA 3Q3GA 1JN6A 4ENEC 2HJFB 3NCMA 4MXQC 5FKPA 4GS7C 3VGHA 4M7LT 4P2QA 2CLVA 2C4FU 2LTQB 3O4LD 4YHIA 1NGWA 5AD0A 4L3AA 1EO7A 1JZ7A 1I1YA 3D1MC 3C08L 2LVCA 1QQDB 3MGOB 5I15H 2P24A 3U48A 4ZTPL 3HI6H 4NQDD 2DAVA 2DB8A 2EKJA 2ADJA 35C8H 5HGDA 1IGIL 3CNKA 3QUYA 2ZUYA 2Z0BA 2BVPB 3TESA 3ET9F 2XI9A 3WIHH 3KJ6L 3LZFH 4XPFL 4LFHG 4FQXA 3K2MC 2AJUH 3OXRB 3OPZL 3KLHD 1XGTA 1X5XA 5IFHL 4MA1C 3B6SB 5ANMA 5I17B 4PJ5E 5BMFL 5ITFB 3BAEH 2P46B 2P7TB 4J3UA 4HK3N 4RQQB 5JIKA 3FT2A 4GW1A 1I9IL 2BVEA 2H3NA 4YIQA 3MLZL 4XP9H 4MMZC 3PQYE 3HZKB 1INQA 2JIXB 3NFNB 1I8LA 4R7NB 1UB6B 5L6YH 5CIPA 5IMOB 4P9ML 2GT9A 4GG8B 5GGSB 4EN3A 1DEEB 4XWGL 4XP6H 4I18C 5EZJA 1B88A 1D5IL 2EH8H 3B3IB 3MBEC 1KB5B 3W81A 1JGDB 3QWOB 4EI6B 5DJ2A 2PYEE 2ZCLL 4OUUB 2OL3L 1CLYL 1HIMH 4N8VB 3LV3A 3MMEB 1NCWL 4R90L 4IOIA 1F00I 2NNAB 4R97B 4NQVB 3ARGD 3VFPB 1IT9H 4LRNL 3HZMA 1FZMB 5CSZB 4X8JA 4Y19D 4I0CC 2YHGA 3ZT6A 4PBXA 1MCPL 3L7FA 4ZS7H 3CVHA 2P8MA 5EU6A 2CLZB 4WWKB 3IDMA 1NANI 1S9VA 2VN4A 5I8EA 3MXWL 3GIZH 3PIQA 4G9FB 1QO3A 2F74B 3C6SA 4OD2B 2B20A 1S7QA 1NMBL 1BIHA 4LCYA 1U3JA 3DVIA 1D5XB 4X4MA 4QXUH 5EBGA 2BVYA 1MFDL 1V7NH 1X5FA 4BH8A 5L7XL 3F6LA 4JHZA 4D3CH 3BP6B 3DO7A 4JN1L 4G8FB 1TETH 4OI7A 1UEMA 4Z0BH 2IFFH 3TBTA 4H5SB 4GRLB 4MB4A 1CG9B 5EZIH 4OD3H 3O8XB 4NZUL 4PJ9C 1P53A 4KI5F 1BX2A 4MAYD 4X7TA 3P9MB 3EYVA 4XNUL 5FO8A 5EU5A 4OLYL 1YN7B 5HGBB 3HC4H 1CL7H 1JGUH 2IGFL 2VTFA 1NEUA 5EU3A 5EU7E 3DHJA 3UTSB 3G5ZA 2D31B 2NTFB 3SDXA 4XAWL 4RWYH 1QBAA 5LGHL 2QQQA 5TDPB 4E41D 1EERB 4ZUSA 1KCSL 5DF0A 4XGZA 3I6KA 1HHHB 1J0HA 2HKFL 2IAMB 4LKXA 1GGIL 1CYGA 4U1NA 2I60H 2O5XL 3BISA 3E8UH 3TIDB 1D5MA 3UTSE 4N5ED 1PY4A 2DBLH 2QADD 5FDWA 3H7BB 4Y2DD 4OBRA 5TH2A 3J7HA 2BNQB 3MZGB 2HT2D 4K07A 4POZD 2V17H 1AO7B 1ZEAL 1VEMA 2Z92A 1Q9LB 2ARWA 5KSAC 1NFDE 5F89B 4CW1A 5IW6A 2OI9C 1FH5L 3RWJA 5F1IB 2J3SA 4QRRB 4U05A 2J88L 4WW1B 5HHQB 1KV3A 3RWDA 3MJ6A 1D5BB 4AL8L 2E7HA 3LVEA 3EOBB 5DR5L 5EZLA 3EBAA 4LHJB 3ZTJG 5L0QC 2BSRB 1KEMH 4R2GC 4FOMA 5ESVA 3ZKMD 3VRJB 3QA3B 2R1XB 4ZSOE 3BPLC 2DLGA 4R4ND 5DD3H 5K9OB 2KQNA 1W2KT 4WI5A 4OCMC 3GSNL 4NJAL 5DFTA 4ZFFB 2DMCA 4L8SA 2XTJD 5EO0B 1AXSA 3HG1A 3IF1B 5LWYL 2HLAB 2AKRB 4MDJA 4U1JB 4K2UH 3V9FA 4JFDE 1QZ1A 4QRPB 4OJFL 1ACYH 5DJZA 2F54D 5ELIA 5F6HJ 2UUDK 5T1LB 4P3CL 2DI9A 3UTTE 3GIVB 2LU7A 2E3VA 2YBRB 3U0WL 1FLRL 3OKEA 4JN2B 4ZPVB 4NM8H 1RIHL 2XZAL 4QRPE 2P5WE 5FDYA 1QEWA 4ZMAT 3C6LB 4PP2A 1MHCA 2FLRT 1T66C 5DK2A 4NKOA 4HF5H 1FBIL 1EUUA 3LKPB 4NN7C 5E9DE 4NT6A 3WFBL 3G5YB 2CD0A 1A7QH 4ZFOA 1F4YL 2VRAA 1MCWM 3KPTA 2DD8H 1J0JA 1S5IL 4XTRD 2ORBL 4EJ1C 4Y5XA 3VD5A 3LQZA 5D5MA 4MD0A 1W0WB 3Q2CA 4P2YA 5F6IC 2DN7A 2IQAB 2V2XA 2YUXA 3ARBA 4CMHB 5EOQH 2BZDA 4DUWA 3LKOA 3QZWA 3G6DH 4PJ5A 4NM4L 4RFOL 5SWQB 3H7LA 1BD2D 5HGGS 3UYPA 5HPOA 4G9FD 4X6BB 3ULSB 4QHKI 4PJXB 1KGCE 4LOUC 4ODTL 4HUKB 4HXBL 4ZS6C 3V4UH 3Q6GL 1Q9KA 1T20A 3BD5A 5HYSA 2F8OA 3GSWA 3U4EB 3KPMA 1UKSA 4O4YH 5IHUH 3CDYA 1PLGH 4KQ4L 3U30C 2V7NB 5CJQH 2R9HC 5CCKL 5FGCE 3H2WA 1NCTA 1TLKA 1NCUA 4CDHA 1Q9WB 1RFDH 2ARJA 3QFJD 5FKAA 5F7EL 4GRLD 2PCPA 3O6MH 4XNQB 2MHAB 1EEQA 2D7QA 2MPAL 3O8XD 2PYEA 2XWTB 1C7TA 2A1WH 5C0BD 4FQHA 2ZG1A 2ATKA 5IW1A 3VXPB 1PVHA 2FX9H 1MWAL 4P2RB 4M43H 4O51A 4QXTA 4I8DA 5HYQB 4Y5VB 1J11A 2J6EA 32C2B 5K9JH 4LDLB 1MUJB 5T5NG 2H6PA 4C83B 3TJEL 4R0LC 2FYYB 4KRNA 4NNYB 4HEME 5DHYB 5AEAA 4GXUM 3IDJA 1KT2A 5DJXB 4I9WE 2IAMD 3MUZ1 4UIMA 4D9RE 3ME0A 2ZPKL 1K5NA 4KZEH 3ZTJH 1U6AH 3MROA 2PXYC 2R2HB 4S2SB 2BNQD 1F3JB 1SJVA 1NLDH 1AO7D 3MOAH 4QT5A 3WLWC 4WV1C 3QXDA 2EDOA 2ITCA 3U4AA 1T1ZB 4EKXA 4DZBB 3R1GH 4GXVL 2CO6B 5DURD 5DUBB 5F96H 4QRRD 3V4PL 4PJGB 5FV1L 5I1IH 3BKMH 4YDKL 1ROWA 1KTKE 2EDDA 1AY1L 4KROB 1VGKA 1B0GB 1ONQB 3GKWL 4R9HA 3L3HA 2JB5H 4XCEB 3NTCL 3VE0A 1FDLH 1AE6H 5DYOB 5DJ6A 4R8WH 5DJYB 4PJGE 3KGRA 2X4UA 1ACZA 3ZHDA 1KN4L 1MJUH 5T1DL 1C1EH 2FGWL 2Y5TA 4M1GL 3BT2H 2CIIA 1F3RB 3CLFL 2WBJD 1TQCC 4LSRH 1QLFA 43C9A 1XH3B 4R4BB 1R3HA 5AUMB 4TRPH 3ULVD 1DBJL 4PG9B 3AM8A 4LSPH 3O6FB 4M7LL 5T1LD 4HFWA 5E56A 1IM3B 4HKZB 4WW2B 2Q6WA 1NFDA 3TH3T 4M9PA 4PJDF 3C09C 1TENA 3VI3F 5DMGC 4F57L 5DJ8A 4EI5C 5I16B 4MXVF 3GSRB 5HDBF 3BD3A 4KTYA 4PJ8C 4UINH 4NFDA 1V8HA 4NZTL 3EZ8A 3MXVH 4H20L 3UPAA 3RDTA 4TUJA 2HTLD 1DQLL 3QDGE 4LU5L 1NC4B 4LSUH 5IB3B 2ZNXA 2DTML 2VAAB 4KJPC 1RUAL 5GRVK 2VLLB 5L88H 3C2AL 4GBXC 4LHUB 4OCSL 4JFXB 4XBEL 1WFUA 4WTXA 3CLEL 3KLDA 1CICB 4KRLB 4M7ZC 3MRGA 4ZSOA 3RTQC 3HR6A 4AEFA 4PJCF 1FO0L 5JNYB 1WV7T 2P4AB 2WK2A 3PWNA 3GJFB 1OP5K 4DN4H 3F7YB 4PTTB 1AGFA 2F53E 4KVCL 5E8PA 5EB9A 5CGYC 3SO5A 5J13C 3JTTB 1R3KA 3MLVL 4JFDA 5EC1B 2OK0H 4XCNA 2X4PA 4YEEA 1W8NA 3G6AB 2D9QB 3OSKA 3QI9A 1JF1B 2X1QA 3UTTA 1DZBA 5BO1L 1I85C 3AAZB 4GAGH 2FHCA 4NCC2 3TZVA 3MPCA 4MQ7B 1HQRB 1NH6A 5GGTL 1X5KA 1RZJC 5HI5D 5GS0H 2E8ZA 3L1OH 4MD4A 3RNKA 2A38A 1E4XI 5EULV 3L7EB 1FV1A 5E9DA 1FCCA 2VL5A 4JM4L 1NC2B 2YD1A 3PGCA 1RUPL 3IXTA 3CX2A 1FPTL 3UPRA 4Y8DC 1KUMA 2VLKB 1DL7H 3MR9A 1P6AB 3ZE0F 1JL8A 1BBDL 4P2RD 2VQ1B 3IFOB 3IKKA 3JWOL 3MJ9A 3TIEB 4HUVA 4X7SH 2IPTL 4OIBA 4OZFB 5GRJL 4X5WB 5I1CH 1IEAB 3B9EA 4F9LA 1JNJA 5MERB 4KWUA 4GG6B 3KLHC 5DWUH 1M6OA 5LGJB 5ADOH 4JO3H 5E95B 1G9NL 4NOFA 3CVIL 4YHML 4RX4D 5DJAA 1T0NA 3X14B 3QRFM 2AI0H 4MJ2A 4F7MB 3ZKQD 2MTPA 1NUFA 2WANA 5EDXA 4HD9A 4ONHA 3N06B 3W39A 5BXFB 5J0BA 4NQSA 3SGKA 3WEXB 2QTEA 4JFEB 1A21A 1VFMA 1HYRC 1T21A 2BHUA 2UY6A 2CDEA 2FHBA 1JHTA 4HC1L 4OV5B 5D2NC 4O9HH 4TQEH 2C1PB 5HJ3B 3BZEA 4UUJB 2Z31A 1DBBL 2FO4A 3PABA 4L8BA 4QXGL 4Z76A 3VA6A 1KELH 3I85A 4KROD 1ZHBB 2Y07L 2C5DC 5DK0B 4OM0L 3RUGE 1PG7L 1GAFL 3ZKXB 3ARGC 3C60B 5T5FH 4K9EH 4PY7B 2ZJSL 4FNLH 3T09A 4ZNEE 1KJVA 2Z4QA 3OJ2C 4QOKE 4JRYA 1ORSB 4JGUA 3FB7A 2ILLA 1LE9B 5DEFB 4ORZC 1II4E 4HAGA 2QHLA 1VCAA 2DQTH 1F90L 3S4SA 1A6VL 1GOFA 3IJHA 4FQCH 4MJIB 5EN2A 3OX8B 3EYOB 1S8DA 5TDNA 1DLHA 5TGBA 2F5BL 5CILL 3UCRA 1NGPL 5BS0E 3D87B 2EZ0D 2I07B 4YHOL 4HJGA 3U36B 5EFIB 1SMAA 4HKBB 3OJDB 15C8L 1ZTXL 5E08H 4JPWH 5CLWA 2VKXA 4GSDL 4UNUA 5C6TL 5DT1H 1IGFH 1V5JA 3WXVH 5TE6H 4AEHH 1KCUL 4FQ2H 2W0LA 3FHAA 1KJMB 4YUEH 5IGXL 2JCCA 4S1SL 4OGYL 3U1SH 1ZE3C 1DQMH 1ZSDA 1NC4D 4MCZB 2DDQH 3S36H 4F8QA 4MAYC 3REVB 5DJDA 3ZHKA 4V1DE 4NRZB 5LCVH 3DHMA 4LHUD 5I1LB 1I9EA 3A67L 1E4JA 3X12B 3VMOA 1WZ1H 1UH3A 1CICD 3F5WA 1ZK9A 4CU8A 1IAOA 4XBPA 4GJTB 3DGGB 3SKMB 4PLNC 4PR5A 3HNVH 4U1HB 5HGHB 2EDTA 2EECA 4Z5RB 5CS7A 3N1GC 3LH2H 3OAZH 3O4OC 4PP1D 1M71A 2BRRH 3UJTH 3VXSB 4X83A 4N5EC 2QADC 4Y2DC 5KANG 4U33A 2HT2C 4POZC 1VENA 2OTWA 3BVNB 1CWVA 3LEXA 4FQLH 4JQVC 2HJLB 2IWGA 1PZ5A 2DLHA 3DRTB 4IDJH 4MS8D 4JZJA 3VXSE 2AGJH 1EK3A 1RURL 1ADQA 3I3EA 2FJHA 2LTQC 5FO7A 4IRJB 4YE4L 4K8RL 3B2VL 3QDGA 5CMAA 3ZSSA 1E6OH 1LP9F 2DQCH 4NO0B 3CDGB 3JBG7 5E2VH 1NC2D 2DQHH 2W38A 2IG2H 4OAWA 4M62L 2VLKD 2OMBA 1A6WL 4X7CC 1WWAX 3ZKMC 3MA9H 2RGSA 1UXWA 2NY4B 1YEJL 4OD1L 4WEBL 4R4NC 5F7DB 2AJSL 2Q8BH 3CFDA 4KK5D 5E8OA 3CUPA 3FQNA 5ETUB 4GAJL 3IFNL 1HQ4B 5JQ6H 2F53A 3JV6B 1DCLA 3PJSB 1U8PA 4LCIL 1EZVX 2FL5B 2XTJC 3P9WB 1I8KB 1WCQA 2NW3A 2ZKHL 1UQSB 3NH7L 5L9DH 2Z8RA 2Y72A 4PGBB 3QISA 4HMDA 3L3OB 4RBPH 3OZ9H 3CFBB 2F15A 8CGTA 4RFNB 4JFHD 4JO4L 3DETD 1HI6B 4LLYB 3I2CH 4F58H 1UYWH 1J1XL 4JFED 1I7ZB 3JV4A 4JFOA 4EDXB 1GGBH 5T3XH 1AGDB 2UYLA 1VFBA 1N5YL 3QPQD 1ZHKB 1RUKH 1Z5LA 4LLQB 1KJ2A 2O61B 3HNTL 1ZAGA 3BKCH 3FO2B 3WN5A 5DMJB 3N0PB 4R97C 2DYPA 4AM0B 3C60D 4XTRC 4CUCA 4I1NB 5FK9A 3NBNA 3C87A 1A7RL 1T2QH 2XA3A 2BX5A 1RVFL 1CZ8H 2BSTA 4TSAL 2BY0A 5SX4I 1SQ2N 1U41A 4JM2B 5GS0D 4PRNB 3ZDYF 4HIHB 4MJID 2FIKA 1DBKL 4O2CA 2XN9E 3BGMA 3ES6B 4Y4KB 1I3UA 2X2YA 4MA8H 2AJZB 1N3NB 3FMGH 3MRNB 3CFEB 4TSBH 1FL3B 5CIPH 1MCBA 3B5TA 4LCCB 4RGNB 5DVOA 1H3UA 4YEFA 3KYMA 1V3JA 4NGHL 3WFHA 5KG9B 1H15B 3S96A 1U8LA 3SE8L 5I0DA 1A02N 3QUML 1MOEA 4GRLC 5HVHC 3VFUA 3BJLA 3O8XC 4LCWB 5BRZD 1HHGB 3ECBA 3RUGA 4OIIH 3QHFH 4Z7WF 3GGWB 2Q20A 1U8IA 2VERN 1AQDB 2A77L 3CVHH 2NCMA 5IHZA 3N1FC 3S98A 4QOKA 3FFCE 4UT6L 5DD6A 3PDGA 2YRLA 4LCWE 3HZYA 3MUHL 1OB1A 3FO9A 4ONGH 1P1ZB 4LNVA 1OAYL 3QIWA 1NGWB 4YHIB 5HGAA 4G43A 4Z7NE 1P9MC 1F6AA 3F58H 3GRWL 2IAMC 2VH5H 3DSFH 1JYVA 5IVXB 2P42B 5BS0A 1GZQA 2P24B 4HS6A 5D8JL 3OXSA 3QCVL 2GJZB 4PTUA 1T6VN 4OUOA 1CGYA 3BD4A 4F7PA 1IBGH 3TVMB 3NZ8B 2XKNB 3F6IA 1UT9A 3SKUD 1R3JB 4MAUL 1FZOB 5E94B 1EO5A 2GSIB 2EDEA 2WLYA 1ES0B 1HILA 3EO9H 3JUZA 1F4WL 1XGTB 5DRNB 5CEZD 5ANMB 1KIUA 3D69B 4IRJD 2KPNA 3RX8A 4NO0D 5HHNB 2BDNH 4LGPB 3PGDA 4LVEA 3X11B 3RPIB 3ZLQC 4WO4B 1VEPA 5J4MA 3FT2B 5JIPA 1F3DJ 2H3NB 3WKMH 2BHYA 1X5ZA 1OAXH 4JHWL 2DI7A 3KPRB 3LKNB 5FM5M 2NY4D 4XB7A 1FZKB 3QO0A 2R0ZH 5E24E 3NGBC 2GT9B 3P2TA 2IMNA 3RWGB 1IAIH 1YNLL 3AS0A 5D71L 1NJ9A 5EZJB 4B7IA 1K8IB 3I6GA 2AEPL 4PRIB 4HGMA 2XKUA 2WBJC 1CE1H 2DQIL 5J6GB 5B39A 3MSPA 3IETB 3FHQA 4APQA 3ULVC 3QEHA 4EDWL 1MJ8H 3DLQR 2ADGA 1UM4H 1K6QL 1AC0A 1KTLA 5CWSA 1KEGH 4J2XA 3ROOA 3OKKB 1YY8A 2HN7A 4HUXA 3BIKA 1HXYB 1N0XH 3GSNB 3L7FB 3DMMB 1K2DB 3KDMA 3M8OH 5DQ9B 3UO1H 3QUXB 3MCKB 2HTLC 4HZAA 3Q5YA 3PIQB 5E8EA 1YA5A 1P4IL 1RZKC 3TBVA 1WCBA 1T22A 5GGRA 3TJHD 1KG0A 5EOCL 3GMLB 4QTIH 4E0RA 2WQRA 3SOBH 3STLB 3SE3C 3SJVB 3DURA 1WJ3A 1I1AA 2X70B 3T08A 3MFFB 1DFBL 2QHRH 4PV8B 1ED3A 3U83A 1OAZH 3BHBA 1QFHA 1F8TL 4IBLT 1JV5A 1WLHA 4U3HA 4MSWA 2R0WH 2N56A 1UADC 3BP5A 1FNEA 3FQUB 3TBTB 5BQ7A 2BNRB 1G7MA 5CZVH 1JHKL 2VLMD 3UDWA 5JORB 4JM2D 3PG2A 3SJVE 2FHFA 2OR9H 3ALXA 1P5UA 4FQ1L 5HI4D 5JR1H 3EYVB 4Y4KD 2BJML 5EU5B 4PB0L 4DGVH 1GC1H 2Y5EA 4RGND 1IKFH 5E00B 1RD6A 5D1XA 3D9AH 2IMMA 5HI5C 5TDOB 2BSSA 3K4ZA 1A14H 3F62A 1N6VA 3ZMRA 2ZSWA 3UC0L 1NCAH 2RJMA 1IC7H 3K80A 3FO0H 4MNQE 1F4AA 1BFVL 2FECI 1G7IA 1AXIB 1FYTA 3F12A 3MODH 1N8ZB 1J5OL 5IEKB 4JRXB 1YMME 3JWDC 4DOHB 1G9MH 5E2UH 1WGOA 1N5AB 4D0DA 1RIUH 1UXSA 4S0TD 3FB8A 4PRPA 1K4CA 3RVWD 5BW7C 4OZIF 1XGUA 3ZTNH 4ZO8A 2FX7L 4CW1B 4XNYL 4AQOA 2BVUA 3CZFA 5EBLB 1PZUB 3R06B 1DN0B 4JRXE 2VDPL 4DOHE 2YPKA 1Q9OA 5DHVA 1HNFA 1DVFA 1XF2A 3T1FB 3VDBA 1RZGA 3PE9A 3TA3A 1PEZA 1BF2A 2XN9A 4L29A 3IGAA 4XCFL 1T4KA 3DUHA 1AHWA 1BVKA 4X9HA 3VGDA 1BHGA 1MCIA 4K7PY 1MWAB 2JTDA 4URTB 2VDOH 5ESVB 2YN3A 3QUYD 4OB5H 3C2SA 4IMKA 3BEWA 2B1HH 1HWHB 3TVMD 3BPOB 2NX5A 3W0WE 4PV9B 2OL3A 4FQXD 1QFPA 4G8GA 3HR5A 3L3JA 4OTXH 1EVTC 3TGXA 1ZMYA 4ELMB 1FSKB 4H88H 1PEWA 4OFYA 5JMRA 5F70A 1V7MH 4HS8L 4PJDE 3S35L 4MDJB 3VI3E 4KROC 4HQQH 1K4DA 3MLXL 3MLSL 4L8DA 5B8CA 3RA7H 1AXTL 5GS1A 4WO4D 2VZ1A 1H3GA 4LPVA 3VG9B 3VJ6B 1J12A 4OKVB 2OBGA 3FAWA 3CFJB 1UA6H 3KPRD 2R2EA 1JUFB 4CL7A 4LEXL 3FFCA 3IDNB 3DBXA 12E8H 2XZZA 2BMKA 3U7WH 1KN2H 5KBNC 3W9DA 4OQTL 1HDMA 4EN3D 5F8QC 3DX7B 2DWDA 4JHBA 4PP2B 1D6VH 5DK2B 4KMLB 3AY4C 1AD0A 2MWCA 3PP4H 4PRID 4PJCE 4NC1C 1WISA 2YD9A 4HKXB 5FECA 4CNIB 2ENYA 1H9VA 1G9EA 2PW1A 2EZ0C 1R5VA 5IJKA 4WW2C 5INDA 4PJEB 2QJDA 3LQZB 5D5MB 3VFWA 2D3VA 3K4AA 3BYTA 2G2RB 3DMMD 4EQ3A 5JPNA 5EU4B 3PV6A 1UCTA 3QZWB 1F6FB 4PJBF 3TNNB 1XF1A 4IOFD 5FUOL 3W11D 3RBSA 2I9TB 3F65A 4RFEA 4XCCH 3NABL 1KCLA 2ADIB 4LASH 4TSCH 3IXAB 3MUGB 3LAFA 5D70L 4ODHH 2HFTA 4ODBD 1T2JA 1CICC 1T20B 4X5XB 2ICWA 4RRPA 5EBMB 1KIQB 4Z7QF 3KPMB 4YHKH 1T7WA 2V5TA 3CCHB 2EXYD 2IANE 3NIFF 3MYJA 5GS2D 5IB2B 4UTAH 4WVRA 4JCLA 4Z77A 5DMKA 2GCYA 5JA8B 1FL5A 4P4KB 2HA1A 4KZDH 3ARQA 5BV7H 4D94A 3HRZB 4CRPA 2BNRD 2VXUL 3H9HA 4M6NL 4PP1C 3D3VB 1ULVA 2R69L 5DD1L 1NCDL 1CTOA 1FAIL 4O2FB 1T89A 4NPYB 1TVHB 5CUSH 1N7MH 1CCZA 4QKXB 4LLUB 4YAQB 1TZHA 1ZLWH 1YPZB 4XVJH 1EHLL 4KKCD 4L4VA 3S97C 4EOWH 5HHVL 4MS8C 1YJDC 4K3DH 3S4SG 4ELKA 1H3PH 3UBXI 3FQRA 4Y16B 4P2OB 1V3MA 4FFYH 1Y6MR 5E03A 2AJVH 1OSPH 5I74B 1KPUA 4CVZB 2HFEB 2E27L 3DX8B 1GGCH 5DTFA 3GI8L 1RUQL 3E3QC 3MROB 5FF6B 5HYEA 5C0FB 1TFHA 2WW8A 3PWUA 2NLJB 1BJMA 1IAIM 4KK5C 5D7SH 1S3KH 1KCRH 1LQSR 1YEDB 1DLFL 3RKPA 5DUML 4ORGA 3MJ8B 5IV2A 1CD0A 3E6HB 4RMQA 2XACC 2R4SL 4NHUB 2GAZB 5JMOC 2VZVA 4Z0XA 3EFFA 1JYXA 1F11B 5E1HB 4JFFB 5IMLA 1IGYB 4UTBH 5JXAL 3DETC 3MV9B 3BDYL 3HFML 1P2CA 4JDTH 2X4UB 1XFPA 4HBCH 5E7FA 2I24N 4PFEA 3LHPL 4NYLB 3QPQC 2FECL 5FA3B 5TF0A 5E7BA 1JNLL 5ITBH 5F1OB 3IDGB 3HG1D 5C6PB 1L7TH 4YO0B 4JE4B 3H0TB 1QLFB 3V52H 1G6RL 1J1PH 43C9B 3UTPE 4NWTH 1YMMA 1R3HB 2NTSP 3MJ9H 3HTLX 3OB0K 3ZKXC 1A3QA 3C60C 4BFIB 5JHLH 1A6ZB 4TVPE 2Z8SA 4OZHB 4IHOA 3CH1B 2Y6SD 3O6LL 1QBLH 4HPYL 3EHBC 2E9WA 4G7YH 2QQNL 3THMH 4H8WL 3VFNB 3EDDA 5GS0C 2YZ8A 4YHZH 2A73A 2BK8A 3MLTB 4WI4A 3IJYA 4RAVA 1G7LB 5EO1A 3BMVA 3TCLA 1R5WA 4N90E 2WAHA 2X44D 1KFAH 3L5WB 3BP4B 3W0WA 4BSVB 3QDME 5FYLH 1AGFB 5TQ0H 3VXRB 4HIJA 5D9SB 4PJDA 2DQEH 3WS6C 3FQTB 4NN6C 3T2NH 1XCTB 3WYRA 1N6QL 2D9CA 1S7UA 4ZOAA 3LN5A 5GGUA 3FKUS 1TVDA 2A6DA 2AVGA 3P4MA 1LP9E 4P4RB 2BOBA 1WSST 1UG9A 1P4LB 4G6MH 1GJIA 3I50L 4WU5A 5E4IA 2CK2A 4XVUD 4DUVA 4G6JL 4P4KD 3BQUA 3QG7L 4N9GB 4B41A 4PJCA 2B4CH 2R56H 5MENA 4X4XA 1GZPB 3D3VD 1QR1B 4HCRL 1QSFE 3UJIL 4DCQB 5D2LF 4XNMA 2HFFB 2X10A 3MR9B 4YXKL 4HFUH 4WEUD 3VGFA 1L9NA 4O58L 4DVRL 4ZG1A 1FL6A 1C08A 2B5IB 5D1QA 4LGSB 3OR6A 4WTWA 3SY0A 2I27N 1CDIA 3HLAB 3GB7B 3O41A 1O0VA 4MWFB 2D0GA 2L7UA 4Y16D 3RX7A 4P2OD 4IRJC 3GM0A 1X3DA 5E5MB 1MJ7H 1LO5A 4Q2ZA 4W4NA 3DX6A 1EPFA 3SGJA 1FIGL 1S9KC 3ARFA 4NZRL 3VMPA 2D2OA 5ERWB 1PYWA 4G9DA 3DRQA 1PG7X 4NQSB 2NY4C 3VMNA 1DANU 3ULUL 1PQZA 1OGTA 4FQJH 2CDEB 2HTKD 3DTXA 1A4JA 1EJOH 1AGBB 5H35A 2FEEL 3ZYIA 3FZUD 2DF3A 3P0VL 1PSKH 4L3CA 4JPVH 4O00A 4FZEL 1BM3L 1F4XL 3DVNB 3KNBA 1M05A 1CF8H 4JFFD 2VDQH 2EE6A 4LF3A 3V6OE 3MV9D 3OKNA 1ADQH 1DR9A 3ZDYE 5FFLA 5F3BB 5M95B 3DVGB 1ZHNB 1IQWL 2HKHH 4JRYB 3FB7B 4OF8A 3MCG1 1MHHB 1JGLH 2X4RA 1JF5A 3DYPA 4LAQH 5DD5L 4QRTB 3L95A 1CXHA 1S7TA 1A5FH 4N0YH 1F13A 2RIKA 5FA4B 3TJHC 4GKSB 4U1IA 4LCUB 5IFJB 1CLZL 1MJJA 4HJGB 2EYRA 4CAGA 4U6TA 5C1MB 1XIWB 4MZ3A 3QG6B 4JGMA 2V5RA 3NA4A 2G9HB 2CK0H 4UQ2A 2EDKA 2H32B 3QWQB 1ZA3B 2KKQA 5AWNH 2GTZB 1FORL 2OXHA 3GMMB 3MQIA 4S1QL 2CPCA 1MQKL 2KUTA 3O2DL 1HSAA 1FAKT 1NBZB 1A47A 2X4TA 4XPTL 4JM2C 2X4NB 1VFUA 4R26L 1IC4H 4WUUA 5KVEH 4GUPB 5HI4C 4EUPA 5DJDB 4Y4KC 2QEJA 2XV6B 2PKDA 4RGNC 1LO4H 1OVZA 2GY5A 4X6EA 3F5WB 4YWGH 1IGJB 4OZGF 1H3XA 1IAOB 5F97E 4LSVH 2C4FT 4HJ0D 1UWEL 5B39G 3LPFA 3BI9X 1WWBX 3T65A 1KJ2H 3LS5L 4PR5B 1ZANL 2E7LA 4XP5L 3MRLA 5LVEA 3VXRD 1WBXA 3HS0A 3VU2A 3PDDA 4XBGA 4Q0XH 4MA3A 4FXGB 4JFDD 5EA0H 5GJSH 1RUMH 4KKLD 5C8JA 1B2WL 1DBMH 2BY3A 1ZGLB 2E6PA 4CADB 3CSYA 5HHXH 4P5KB 5SWZA 1FNFA 5DEGA 5BZDA 1MRFH 3RVWC 5L8KB 3FOLA 2LABA 1WBZA 5JW3H 1BJ1J 3C5ZB 2BVOA 3BWAB 3SGEH 5DRWB 2BHZA 1MPAL 1OQXA 3D25A 2CJUL 3WFDL 5GSVB 1INDL 2X4QB 3RNQA 1VDGA 1FGVL 3H3PL 4G42B 2PR4H 3O3EA 4NFBA 3QUYC 1ZLSH 3MRBA 4IJ3B 4JR9L 5FUZL 1JPGB 1J1OL 3CFDB 3RY6A 1P7QB 3CUPB 3QDMA 5E2WL 3TVMC 4NCC1 1MFAH 5FO9A 4CN4A 2GUOB 4FQXC 5HDQH 2HT3D 3RU8L 1UWGL 4LSSL 3I3DA 2VXTL 3C5JA 1YNKH 4FP8H 4ZUVA 2JELH 3DROA 1UB5B 4NUGH 3GNMH 4ODXB 2OLDA 4WO4C 5AG8A 4HV8A 5SWSE 3FQXB 3WIIL 1IGTA 2QQLH 1MHEA 2CKBA 3MLRH 1IC5H 2VZOA 3CFKA 1BLNA 3MRCA 2CH8A 5CFHA 2YMXL 1LP9A 4RMTA 3MGTA 4KPHH 1I8LC 1XF5B 3GJEA 1EMTH 1I9RL 4XC3L 1RIVL 4JFOB 5IROA 3CU7A 3QEUA 4PRAB 4MD5A 1P4BH 4KVNL 3V5HA 4F33A 1YYLL 1RHHB 4YGVB 1W0VB 3GMOA 2GJ6B 4OCRH 3WFCH 1INEH 5FYLD 1MCRA 3SE4A 3QPXL 4XPBH 2X1XR 1QSFA 1KACB 2MSPA 3MRIA 4MMXC 3QIBB 4L3EB 1AKJA 1BFOB 2VYRE 5IMMA 1FC2D 2ZNWA 4G5ZH 1XF3B 2IPKA 4JJHA 5C08E 5T3ZL 3WLBB 5JQHC 3MNVB 2HVJA 4JO1H 4LPYA 3DOSA 3HPJA 3S88L 4PJIF 4NZJA 2CXKA 3M17A 4P5MA 1S7RA 4N0UE 1ZA6B 4OLWL 3DMMC 4HGWB 1A1MA 4JRYD 1YNTB 2KQMA 2BC4B 3QUXC 4IOFC 1KXVC 3W11C 1YMHA 5EH1A 4YDJA 2HVKA 2FIKB 2R8SH 5TE7L 1YEEL 1NAML 2C1OA 43CAB 5C0GB 1AR1C 1LO2H 1J7VR 1CDJA 4I0PA 5I1JL 1H5BA 1U8HA 1AJ7H 4LLWA 3BP7B 4U6VL 2NY6B 1R24B 2A6JA 2YUWA 2DQFA 2EXYC 3E1F1 1MI5B 3FO1A 3LKSA 4U1MA 2BCKB 1HHJA 3H9SE 1LEIA 1BFTA 5I9QB 1BBJB 5JW5A 1HZHL 4QRQA 1Y6NR 1ZVYA 2X7LA 1ZT7A 4OZIE 1IEBA 4EXKA 3FT3B 5HHOE 4I77L 3TLRA 1U8IB 1ZS8A 1Z6JT 1T0MA 4ODVL 5ALCL 1ZHLB 1QFWL 1L9MA 3V6OA 1MI5E 2VXVH 1EGJA 2EC9U 4WNQA 3T0EB 1LEGA 3MV8B 4XNZB 5FM8A 4KKCC 3OF6A 4EIGB 4M6OH 3L3KA 1F58H 2Z93B 3KJ4B 3QNXB 2O26U 5C0DB 3IVKB 4Z9KB 5HGAB 5T5NF 4WUKH 2H2PD 3SDAB 3D18B 4U6HA 5A40E 1F6AB 5C0AA 5FGBA 3T0EE 5IQ7L 3O11B 2CUMA 1A9EA 3CMOL 1XGQA 1ZVHA 2NPLX 2ITDA 3IDXL 4P48A 1CQKA 4Y4HA 3BXNA 5KSBF 5E4EB 2E5EA 4Q6IA 4FZ8L 2WWKT 3HCVB 4Z7WA 2DWEA 3BRDA 1BAFH 1TPXB 5E6IB 1E28A 4LLMA 1JWSA 3NAAL 3CIQA 5E6YA 4QY8A 1DEDA 4AENA 4JFQB 4RRPG 1X5AA 4D9LL 4LVOB 5DJCB 1Q0XL 4KHXL 5AZEL 1K9TA 1CT8A 4AJ0A 1T03H 1TCRA 1WZKA 3LEYL 4PGCB 1P7QD 3IFLL 3LMJL 1S78D 4P46B 4ERSH 3P4LA 4TULL 2VLRB 2RR3A 1FSKC 3VG0L 4XPFH 2AXGA 5CD5D 5I71B 3I6GB 1FVEA 3P0YH 4PJAB 3RZCB 1A4KA 4HWZA 2E6JA 3OPZH 4HDIA 5IFHH 3U0TA 2H8PA 1A7NL 1DQQB 3AREA 2EE2A 3VG9C 5BMFH 3MBXL 1ITCA 5ISZA 3PHOA 3KYOA 4FS0A 2VLRE 1RJCA 4PJBE 4ETYA 6FABL 3RWFA 3MLZH 1KJ3L 2VE6A 2EDNA 5EC2B 1U8KA 5DHVH 2Q76B 2WUCL 2Y6SC 3QXAA 3W5NA 3HA0A 2ED9A 3G04B 4PBWD 1MRDL 1A6TB 4I2XB 4P9MH 2GJ6D 4XWGH 4Z7QE 5D7IF 4GW4A 3F8UB 1D5IH 5IEHA 4JB9L 4YXLH 5CEYB 1JPFB 1T22B 4L3ED 4P59H 5C0CB 5HSFA 2ZCLH 3SBWC 1RV6X 3LRSB 2OL3H 3QUMA 3RWCA 1TZIA 1NCWH 1WEJL 4HK0B 3MLYL 4Y5XC 3CDFA 1QPXA 2R23A 4LPUA 2WMPA 5DEZA 5E8NA 3L3DA 4OLXL 1IL1A 1MCPH 4YR6A 1FNEB 2KL6A 2ZSVB 1TNMA 5C0CE 2WZPD 3GSQB 4IS6B 5FYKL 1G7MB 4FTVB 2P44B 4HIXL 2XWBB 2OQJB 4L9LA 4M5ZL 2EKSA 1QSEE 5BOPA 3OBAA 5D7KE 4I3RL 2PTTA 1NMBH 1U58B 2NY6D 5D1XB 3AUVA 5GHWL 5M7QA 1DQDL 4BQ8A 1T1XA 1VADA 4PLKD 4XVUC 5L7XH 4M61A 4P4KC 2EEDA 4DGYL 5I1DB 2FO1A 3BZFA 3AS2A 4JN1H 3O3BB 4YC2B 4Y1AE 4QRSA 3SDCB 3LN4A 1KTRL 2GQHA 1FYTB 3F12B 3D39B 3EO0B 4CU7A 1UKTA 2GK0B 4XCYA 3RGVB 4NZUH 1NLBL 5C08A 3PWJA 1HHIA 5F88A 4AY0A 4OLYH 3MV8D 4PRPB 5MEOA 4FXKB 4DVBB 1BIIA 1K4CB 3T4AB 4N0UA 4MNHB 4QOKD 1Z9LA 1C5DB 4DTGL 3D39E 3DI3B 4Y16C 5KVFL 3MA7A 1CLOL 1SVCP 4P2OC 1QRNA 2QSTA 3QIWD 1OM3L 2YPKB 1Q9OB 3SDAD 4PRDA 2XXMB 5LGHH 2B0SL 2W65A 5IHLB 4BZ2L 1SM3L 1P7KA 5C3LD 1UZ6F 5F9AC 1SY6A 1QD0A 2AK1H 1C12B 3S35X 3O2WL 1OCWL 3GDBA 1T4KB 2B2XL 2DICA 5DI8A 5F7HA 3BW9A 1FFQA 2O5XH 1EA9C 2EDXA 2OJEB 4AEIH 5E5RB 4G3YL 2HRLA 1GGUA 2NX5B 2HTKC 1ZEAH 1FHGA 2QR0B 3L3JB 3HN3A 2JKXA 3AXLA 3FZUC 1CQYA 2Z8WC 3OR7A 1ZT4B 1JNNL 4OF7A 4OZIA 1RZJL 1K4DB 5IIEB 4L8DB 4IRSA 5GS1B 3S6CA 4I3GA 3TT1H 1G7JB 1N2RB 3QUKB 5IM7B 1CFQA 2NY5H 5CHNB 2R29H 4GW5B 5IVZA 2EIZA 1BGXL 1RJZB 3MO1B 5IBTL 2H41A 2Y36H 5E2JA 4PLJD 2LFGA 2BVTA 5CJXA 3P9LB 5ESQB 1QVOA 1JGVH 3W9DB 2GKIA 3K3QA 3BOVA 3C9NB 2CUHA 4NJAH 1U95B 1FVDB 1ZLUH 3GSXB 2RHEA 3HAEB 5LWYH 3ZT7A 4U1SB 4WHTB 2FD6L 2EXWD 3AM8C 4G7VL 4WFED 1B6DA 4KHTL 5CKAA 5KTEL 2HJKB 2IC2A 2XPGA 3DV6B 3U79A 2JJWA 2VWEC 4GRWB 3LKQB 4NO2B 1CDUA 3FB5A 3U0WH 1FLRH 4HUUA 3OG4B 2APFA 1MFCL 4ZAKB 3PV6B 5EUOB 1RIHH 5IBUG 5ACMA 4MJ5B 4RZCA 1G6RB 2Z91A 1MCLA 1LE5A 3DX9B 1XGYL 2J8UF 3MC0A 5LAXB 1BPVA 5AAWA 1F4YH 4M5YH 2VNCA 3TPUA 1Z2KA 1AP2A 1T7XA 1D6EA 1RZ8A 2H1PH 3HRPA 4HJ0C 1S5IH 4DKEL 2ORBH 1WC7B 4MJ6A 3TWCL 5JOPD 4Z77B 2EDBA 5D2LE 4F3FB 1FFPA 4PGDA 5HHPB 1XR9A 5DRXA 3MLUL 4FTVD 3VH8A 2XRAL 1Q0YL 1HH9B 4HSQA 3VCLB 1N59A 4KKLC 2BFVH 5GPRA 2W07A 1R3LA 5HD8D 5KN5B 3STZA 1A7OH 2WM0A 4PJBA 3O3DB 4LPXA 4ODUA 1RAMA 3NN8B 2FR4B 4PB9H 4U3CA 4NRXA 3REWA 4ODTH 4UDUB 4HXBH 5IB5A 4L4VB 3HUJF 3Q6GH 5D1XD 2YEZB 5EIQA 5F9OH 1NCBL 4E42A 4NNPL 4YX2L 3QRGL 3O2VL 2EICA 2EDQA 3ZYJA 5JDJA 4TTDD 1ZVSA 4LPWA 4NQXA 1FYTD 4ZQKA 5F7EH 4H26B 3RGVD 2MPAH 2CRZA 3CSPA 3MNWA 1CU4H 4X99A 3O81A 1X5JA 1A3LL 2YSSA 3WD5L 1EO8L 2BP3A 1I75A 3EUUA 2B5IC 4PRPD 3WNNA 3FT4A 4KI5D 2X4OA 2JJTA 4HXAL 1CK0L 5FYJU 5GRUL 2HT3C 4NUJB 4PLOB 4F9LC 3BKJL 3SO3B 4BH7B 1BOYA 4ODWA 3MLWH 2ZOLA 4PJ7B 1A22B 1NANH 5FYJD 5FM5O 3TJEH 1NEZA 1DVFD 4M1DL 2D7MA 3S3SA 2ZOKB 3EFFB 4JY4A 5JA9A 3F7RA 1F42A 2Q3ZA 1QFOA 2WP3O 3VXUA 3UZVB 3SCMA 1DQJA 3MRJA 3SGKC 4PJ7E 2AEQL 2DLTA 5I1GL 3WIFB 1AI1L 1P2CB 7CGTA 1NBYB 5EO9B 1G7QA 2NX5D 3QQ9D 5F7MC 2GITA 4G8GD 1U3HB 4JY5L 4NDMA 3GK8L 4OFYD 1JNHB 4MZ2A 2K7QA 4Y5YA 4HZLA 3MV7B 4GXVH 1NSNH 4YLQT 4NNXB 4ZDHB 4BQ6A 4YDKH 3VXTA 5J6HA 1JRHI 1AY1H 1S5HA 1EXUA 3GKWH 1CL7I 4HKJB 5GQBA 1UCBL 3KPQB 4PREB 4U0RB 1KLFA 1FFOB 4R96A 1HEZB 4QHUB 4ZFZB 1MF2L 4Z7UB 4Z7VF 5T1DH 3VWKA 1QG3A 4JKWA 1DE4A 2FGWH 4L4TA 4M1GH 25C8L 3IJYB 5EO1B 3OKDB 1KENL 2B4CC 3B5GA 3P11H 2VDML 2KBGA 2ATPA 4GRMA 4I5BB 5CGTA 3VI4E 1JHLL 4Z7UE 3G6JB 4HJJL 4M7LH 1HSBB 2P5EA 3ROLB 3U2SA 4XX1E 1FNGA 4F57H 1SJHB 5IR1A 3BKYL 2X9YA 3QNZA 4KXZI 4ZAKD 4C56A 4NZTH 4H20H 2P8LA 4MA1B 2V2TA 4RA0C 4TNVK 3OHXA 4FQQB 1DQLH 3QDJB 1MRCL 4X4YA 3CFCL 1KB5L 4P5TA 3SHSA 2VITA 1RUAH 2H9GB 4KJWD 3B9KB 3C2AH 5GIRB 1V05A 3UTQA 3TC9A 4XBEH 2BOBB 2WBKA 5IQ9B 4PYHA 4BFBD 5JOFA 3JUYA 2OTPA 2Y4SA 4ZUUB 5HYIA 4OIAA 1U8NA 1A2YA 1FO0H 2AK4A 4JDZA 4J3TA 1D5ZA 4WJ5B 2EO9A 3BQUB 4ISVB 3D2UA 3TH4T 1Q72L 2EDHA 2H2PC 4HX1A 2Y23A 5MENB 1A0QL 4XAKD 1Z9SA 4V2CB 3STBA 5FB8B 3EGSB 2IPUG 3O45B 2DJSA 4PJFE 2YC1A 3MRMA 4LBEA 3I02A 2VLJB 5D72L 1NFIB 4QGTA 4R3SB 4L4VD 5BO1H 1I3GL 4WENB 2WUBH 1F5WA 3SDYL 4F7CB 3OAZK 3VFTB 4LQFH 5ADPL 1T5WA 4EUPH 35C8L 3JSSA 1OPGL 3X17A 5IK3B 3WIHL 2EYTB 2W0FA 5I8CB 4UDTB 4JM4H 4HULB 1NGXB 2AJUL 1IFHL 4G9DB 1RUPH 4YFLI 4IJ3C 2Q3AA 3BESR 4XMPH 1S78C 1X7QA 1BBDH 3BAEL 1PKQA 1YEGL 2BSED 5D2LA 3HB3D 3JWOH 2IPTH 4KTDL 3MV01 5CD5C 2JB6A 3VFRB 1I7UA 4R7DB 4L3CB 2O5YL 4PJIE 1EEZA 3T0WA 2BERA 4JEGB 4YHMH 4TVPH 5C6WH 5H2BB 2WIIB 2F19H 3GEWB 4C58B 4DEPB 5GISL 4LF3B 5I18H 4XP6L 1U8OB 3BUYB 1Z0MA 4FQIH 2AEIT 1QBML 3HE6A 2DJ4A 3P4OB 5JIIA 1U3HD 4JFPB 3T8XA 1M7DB 4WFGD 4RISL 3MV7D 2CLRB 1IT9L 4XI5D 3H3BC 4RBPK 2FJFB 3N1QC 4Q58C 3BX7C 1DBBH 4M4PA 2I9LB 3HMWL 1UWXH 4WCYL 4ZS7L 4F7EA 1MAKA 4XMLL 4L1HA 4LNRA 4OM0H 4K7FA 1PG7H 2NZ9D 4KY1L 3UPCA 2ZUWA 1BF8A 4UQ2B 1MH5B 5CZXD 1S9XA 2ZJSH 5TPWL 5BZWB 1L0YA 4YHPB 5KSAB 1LNUB 4K7PL 1ERNA 4QXUL 3BZ4B 3TBYA 1W72A 4JZOA 2IQ9L 4TNWF 2CIKA 1ZWIA 5F7LB 1V7NL 2V9QA 5D7LB 4NQCA 5CINL 1F90H 4XPGL 1BZ9A 3C5SA 3ILPB 5F72S 2F5BH 5JLZA 3VRLF 3ULVL 4PRHE 1E27A 2BVQA 4MB3A 4W70A 1J05A 1NQBA 2NY6C 4YHOH 4KI1A 15C8H 1ZTXH 3T65B 4PLKC 3WDJA 3W82A 3B9DA 1TZGL 4D0CA 4OFVA 1T7VA 2PYFB 2IH1A 5T3ZE 1AGCA 5KSBE 3TNMB 5IGXH 4MA3B 4NRYB 4A6YA 2AXFB 3HC4L 1CL7L 5C8JB 3WJLA 4S1SH 1JGUL 4OGYH 3OGOE 3QDJD 1NAMB 5C3TA 3CJJA 3I84A 1T83C 5SWZB 1RZKL 3B9KD 4YGAB 5BZDB 4XNZC 1LK2B 3A67H 2A6IA 3LB6D 5HVGB 2V7HA 4HWBA 4PGJA 3KR3L 1TQBB 4XB8A 5ESAA 3BQUD 3QIWC 1BREA 1KCVL 3SDAC 5ILTL 1JWUB 4OZGA 1BZQK 1FP5A 4RIRA 5MEND 4QGYA 4K3HA 1NDMA 3K4DA 3S37H 5KVDL 1G7PA 4GQPH 5IG7B 1NGQH 2IJ0C 5F44A 2W9LA 2OJZL 1CD9B 5E4EC 2DLIA 3PL6B 1FZJA 5D1QD 2OCFD 2X89A 5FO9B 1BQHA 3CXHK 3GSOB 4P2CG 1I1FB 3EIFA 1KEML 2V9TA 2V5MA 3N9GL 1RURH 5HHME 3UBXA 4GAYB 1QLEL 3PUCA 4XVSL 4CN1A 4YE4H 4K8RH 5DD3L 1OF2A 3HC3L 3A6CH 3DIFB 2HRPH 5ICZA 1IGTB 4KTEL 2DBJA 2J1KA 2W91A 3CFKB 1T0PB 4U1KA 1DSFL 5D7IE 3DUUB 5D4QA 3GJEB 2GSGA 4M62H 3JWDL 1A6WH 3PXHA 4OZ4A 4PLJC 3WNLA 4JG1L 4YHNB 1D7FA 3TYFA 1JVKA 2NMSA 1S7VB 4OD1H 1YEJH 4WEBH 1AIFB 1MHPL 5I71C 1QACA 4QHMA 1KIRA 4XZUA 5J57B 3GMPB 3RZCC 4LCIH 4MX7A 3QQ4B 1CD8A 4NM8L 2EXWC 4XH2A 1AH1A 5DQJA 2ESVE 3O2DA 4UAOB 2HVJB 3HI1B 4HF5L 2GJJA 4OM1L 4NBZB 4GKNA 3TN0B 1MCSA 2P43B 1IM9B 1A7QL 2Y1VA 1E4XH 3RL2B 3B9VA 1URLA 4NN5B 4XPAL 3WDHA 2HVKB 4FQPA 3D0LB 2MCPL 1MLBB 2AW2A 4WI7A 1NCNA 1HK6A 2AS5M 5DSCA 3OKLB 2C3HA 4ZUTA 3HNTH 4NQEA 4GQ9H 2A6KB 2HLFD 5D1ZB 3VGAC 4B7LA 2A6JB 3O9WA 4PJXF 1JGEA 3VFMA 5E1AA 2Q7YB 3CD4A 1A7RH 3FO1B 3LKSB 4Z8FH 1IAKA 4QRQB 4RMWA 3P4NB 2X7LB 4PJIA 1ZT7B 5BVJB 4TSAH 3U6RB 1U8MA 4WUUD 3RRQA 3FRPA 5HD8C 3VFSB 4O4YL 5D7LD 4YNYA 1PLGL 2AJYH 1T0MB 3PWPB 3E2HB 4LP4A 2WWKO 1MLCA 4K3JH 4ZXBA 4JFYA 1QNZL 5F21B 4F7TA 1ZT1B 3HKFA 1IILE 3BSZL 5D1XC 3O6ML 4AIZA 2XWJA 4NGHH 1UJ3B 5CZKA 4TVSa 5CBAA 2YWZA 2G60H 2A1WL 3PWPE 4TTDC 4YC2C 4FHBD 3CC5A 2AV1A 5F1NA 5JHDB 3QUMH 2VDKL 4JANA 5K9JL 1G1CA 3RGVC 2EH7L 4BKLA 1R3IL 1TQCB 4NKMB 5SWZD 4Y4HB 1KLUA 5FYKE 3D48R 4Q6IB 4TVPD 3T77B 1AD9A 4KI5C 5MEQB 4Z7WB 1U93B 4JZNB 4P23B 5JHDE 2QQKL 1JWSB 4KC3B 1MCNA 2GFBA 4UT6H 1U6AL 1YDPB 2OS7A 1OWWA 2I5YH 2R2BA 3GMRA 4QY8B 4AIOA 1DVFC 5CJ8A 4X6CE 3LD8C 4PJ8B 3RI5F 2B1AH 1NLDL 3QXUA 4YFEA 3MOAL 5D6CA 1VB9A 1XZ0A 1VFOA 4PJGF 2J5LB 1AHWC 1Y18A 4YFLF 4N90D 3H6JA 1RK1B 5IKCA 5D8JH 5F96L 5IB1A 1CT8B 4IMKC 3QEQE 3BKML 4G6KH 3KPSB 3GSUA 4M8QA 1KLGB 3QQ9C 2V9RA 5B22A 3HZVA 3RTQB 4P3DB 3KPOB 2JB5L 3MNZB 4JREB 4MAUH 5KSBA 2P1YA 1FDLL 1FVEB 4HWZB 1YJDL 4R8WL 4XP4L 3U0TB 3MRDA 5B8CC 1IQDB 5H94B 5GS1C 3KPSE 1J8HB 4BSWB 1XMWA 3HC0B 3EDEA 5JDSB 1VFAB 5INCA 3DNKA 3W9EA 4RAUA 1DUYB 1T7YA 4NSKB 4BELD 3KLAA 2P8PA 5DVMA 2J8UE 4WW2F 5JPMA 1SY6H 1SYSA 5F93C 1YC8A 4LSPL 3WUZA 4RNRB 1PW3A 4CKVX 5B3JF 3EO1B 5GGRY 1YNLH 5D71H 3IKCB 1RJYA 4Y2OA 2AEPH 1QSFD 3OAYK 5IJKC 3NIGE 1R5IA 3BJ91 2FZ3A 4EDWH 3MXVL 4U6XB 1NEZG 4X9GA 2YKLH 5IB4A 4LSUL 2R23B 1T5XA 5K9QI 3O4LE 3TN0D 1JYNA 1IM9D 2ZP0T 5FGSA 3INUL 2WV3A 4ZAKC 4WTZA 2YD3A 4X8XA 1MVUA 4L9LB 1S9YA 1UC6A 3EFDH 2R15A 4NQDE 4M7JL 4ALAH 4C59B 2YWYA 1L0QA 4HS3B 2XNAA 4K94C 1QA9A 4KJWC 1BQLH 5D7IA 5D1ZD 5EOCH 4Y7MA 3MREB 5EUKB 2EDWA 3U0PA 4NKDB 4X0KB 5IOPA 1DFBH 2OK0L 1HXMA 3IDIA 4CVXA 4IIQB 4QRSB 1T1WA 3LN4B 5C09A 4GAGL 4F37F 4DZ8B 1S7SB 5CBEB 4QCIA 2D7NA 1OSZB 1DJSA 4XCYB 2FATL 2ESVA 5GS0L 4XVTL 1A1NB 4WI8A 2GTWA 4FQ1H 4ZUWA 1WAAF 2BJMH 5HI3D 1HKLL 1BIIB 4PB0H 3WS3B 2NW2A 5D2NE 3FAXA 5IF0A 1RK0A 3PWLA 3Q0HA 1U8QB 2IBZY 1MCCA 5B38B 2JE8A 1DL7L 5C0AD 4DQOL 3VFOA 3SE9L 3AS1A 3KXFB 5C92A 4FXLA 4GG6F 1TITA 1BFVH 2LV4A 2E6QA 4NWUL 5DRZB 4J23A 5BVPH 1CFBA 3L3GB 1J5OH 2VZUA 1ZLWK 3X13B 4Y19E 4Y4HD 5AYUL 3BIAX 3GBLA 4TUOB 4HH9B 1QFUL 5SV3A 4P23D 4PS4H 3HB3C 1YC7A 1JI2A 1WBYB 2YRZA 4M93B 4PUBH 5GXBB 1Y6KR 4J3XA 1GGTA 3NCYP 3OGCB 2VDPH 4XPHL 2ZZUT 3BPCB 4ZTOL 3QO1B 2PXYA 1WF5A 1NUNB 4H1LA 3H42L 3RIAK 3WNMA 1CFQB 4H0GA 4WV1A 3QQNA 4NFCA 2DOCA 1Z0NA 3LQMA 3QJHA 1H8NA 5KJRL 3WE6A 2HFGL 3VWJB 1KELL 4RMUA 1U3HC 1UFUA 5J9PA 4JPIA 3ARTA 2XYCA 1A9BA 5AZ2L 3CPLA 4XI5C 4E41B 5F1KC 4Z78B 4HS8H 5CEZL 1J8HD 3ARED 3O4OB 5DMIL 1EDQA 5ISZD 3MLSH 3HAEG 1P7HL 2E9BA 2NZ9C 3MJGX 4IMLA 3VXMB 1VHPA 4Y2DB 5F9WB 2SEBA 5CZXC 2DQTL 3QH3A 4U0RC 3AMKA 1WZLA 2DTSA 4E41E 3SN6N 1CGXA 4LQ1A 1BVLB 2OTUA 4NQTA 4GKOA 2YPLB 3OKOA 2KH2B 3CXHJ 1OGAB 5F7KC 5ID0A 4NJ9L 2EDFA 3DXAA 1MFNA 2XQYG 1ODAA 2VZTA 3PWVA 1ZGLM 4OFIA 3ZHLA 1OTSD 3QNYA 3FB6A 4BUHA 3WXVL 4LRIC 4FQ2L 1HHKA 4EI5A 1QLRB 3FQWA 1L6XA 3N85L 3LIZL 4AMKH 1I3RA 5MEPB 3U1SL 4NIKB 1RZ8B 4J1UA 1DQML 2FSEB 5D93B 5HPMB 5CP7A 3S36L 2R4RH 1J0KA 1CGSH 1FFPB 4PGDB 3FCTA 1NDGA 3LKRB 3D85A 2R1YB 4GMSL 4BM7A 1XR9B 4MNGA 1F3DH 1WZ1L 1N59B 4GBXA 1FNLA 5T1KA 2DJUA 2XTJB 1BECA 1MREH 1CFSA 3RWHA 2GHWB 2DS4A 5C2BL 2VIRB 3NABH 4MQTB 2F54B 1B4JL 3B9KC 1KNOA 5DC9B 5D70H 2X1OA 3LB6C 1CVSC 5L2JA 4G8EA 4K23H 2BRRL 3DUSA 1H0DB 4M6ML 3V6ZB 5IBLD 1KPRB 2J8UA 3V79C 2XTJE 3AU1B 2DMKA 5I30L 5IUSA 4EQ2A 3BQUC 3MYZA 1KC5L 2QV2A 2F54E 3NFPA 2VISB 2DKMA 3W5MA 3GUTA 5J56B 1R0AH 1M7IA 4FQLL 2VXUH 4L4JA 4D2NA 1RJLB 1SJEA 4ESKA 4POYA 5KSUB 2C7UA 2OYPA 3H9ZA 1B3JA 2AGJL 1DANT 4X9BA 2R69H 4HPOH 5DD1H 1HOCB 1NCDH 2Y7QB 2YSSB 3BFOA 2HYMA 3QEGL 5D1QC 4LPTA 3O4LA 6CGTA 1J0IA 1EHLH 2DQHL 1QRND 5GZOD 2YD4A 2BRQA 5J11B 3HUJA 3B8SA 4NQDA 1CN4A 5C7XL 3KXFD 1I4FB 5LBSH 3SGJC 1BD2B 1XGPB 5JQ6L 1J8KA 3VW3H 1CGWA 2E27H 4LSQH 3MRRA 1DQJB 1BQSA 3GI8H 3WCYA 3BRGC 4B5EA 2FH6A 4JDVA 1D3CA 1ZV5A 5I1HH 3U46A 5I2IA 3Q6FB 1T80A 2F5AL 2XFXA 8FABA 2GITB 5I1AB 1DLFH 4TYUA 1JPTH 4G9FE 3RIFF 4QRUB 1BWWA 4D8PB 2D4FA 4F58L 2OP4L 4XC1H 4IRSD 3U7YH 3VXTB 3L6FA 3QFJB 1S5HB 1EXUB 5HVHB 3P77A 1GGBL 3ZE1E 2CDFB 4DEPC 1SEQL 1V3LA 1F02I 4JAMB 5C0BB 1RUKL 4R4FL 1VACA 5D2NA 1DDHA 5JXAH 4N0FB 3BDYH 4NO3B 3HFMH 4UQ3B 3VWJD 3DYOA 3BKCL 3QFJE 2FDBP 1KTDA 2UWEB 3QJFA 3VRLE 3UXFA 2G5BB 1DE4B 1KCKA 4L4TB 3MRHA 5ACZB 3GM8A 3QAZB 4KKAD 2W9DH 2Z35A 4X6DB 4XX1G 1BQHG 5T1MA 3T0XA 1IZKA 4XRCB 4Y19A 2ATPB 1IVLA 4JM2F 3TO2A 5ICXA 2HLFC 3TO4B 1MFEH 2X4SA 4NC0B 3VXMD 3UBXG 4KJYB 3V0WL 1T3FB 3PHQA 4U7KA 3L3IB 5F9JA 1AC6A 2YPLD 5FCUL 3QNZB 1OGAD 3AS3A 4MA8L 5E6ZA 3O6LH 3DGCR 4HPYH 3KPNB 5DURB 5CSGA 2C3VA 5ID1A 3NPZB 1ND0B 1FFNB 3WUWB 2DIAA 2BNQE 4KUCF 4RWHA 1D9KA 5T33H 4BFGA 4Z7VA 1T7ZA 3VXOA 5K33A 1AO7E 1MCDA 3OL2A 1WIPA 1RI8A 4U7SA 4WHDA 2N7BA 2HAZA 4UILL 4QRRE 4Z7NF 5GGVL 2AK4B 3IU4L 2E7LC 1JE6A 3MRKA 4NP4L 1S7WA 3P30L 4KRPB 3NGBB 4W6YB 3CVHL 4LVHB 1DBAL 5L2KA 3RVUD 4XXDB 3WHE1 5DLML 3MRMB 2NY7L 4LBEB 4KMQA 3KWWA 2WBJB 4MA7L 4AH2A 3MRQA 5F6HI 1N6QH 1U8JA 1A1OB 3IDUA 5IVXF 4I48A 1UACH 3QIUA 4KK9D 2Q86A 2H2SD 2A83A 3I75B 4QF1A 5CD3B 3DSFL 2VH5L 4JHAL 1W72H 2VDRL 3QCUL 3V6FA 1T6WA 1TQBC 3F7VB 2DQDL 4KDVA 1HH6B 4XNXH 2VC2L 2WINB 4HHAB 1UVQA 3ULVE 1CXIA 4AT6B 5J1AA 1B0RA 4G6FD 2HJFA 1YEFL 3R4DA 4JQVA 3EO9L 5JO5B 3PL6C 1B9ZA 2A9NL 3RY6C 2MQCA 1SHMA 5E99L 4YXKH 3U9PH 4RAHA 3T4YB 4DVRH 4KMTH 1PKQB 2BDNL 3FRPG 3D0VB 3VGGA 4A6YH 3QUZB 3LQAC 2BOCB 1QQDA 4J8RB 5C0EB 1OAXL 3MGOA 3L5JA 4Q9RL 1EEZB 1REIA 3SQOH 2R0ZL 2OMNA 3VXUD 2G5RA 2BVPA 3SCMD 3BO8B 4HWBH 1FNAA 2YD2A 4EXPX 3ARVA 3EYFB 4NZRH 3MRFB 1G84A 3OXRA 3BZDA 3PQYA 4Y4FA 1CE6B 1CE1L 3W2DL 3B6SA 5I17A 2PO6A 1YYMH 4PD4K 3GSVB 5ITFA 1MIEL 1MJ8L 2ED8A 2P7TA 4ZO7A 5MP6L 1NBQA 1KEGL 3QCTL 4RQQA 3GKZA 4PJXE 4K7PX 4F2MB 2CQVA 1SJXA 3HZKA 2Q7NA 3QT2A 1EJ6A 1Y0LB 1N0XL 3MV11 1NL0H 1BM3H 1F4XH 2JIXA 3NFNA 3UMTA 4R7NA 1UB6A 3SEPA 3M8OL 4UAOC 3V4VL 3UO1L 4QNPF 5IMOA 5GGSA 2KZ1B 1DEEA 4J3VA 3B3IA 4N9OB 3TN0C 4XXCA 1KB5A 1JGDA 4KDTC 3QWOA 1J88A 4EI6A 4O5LL 1T04B 4BQ9A 4N8VA 3MMEA 4L4TD 4NN5C 4QHLB 4NQVA 4YPGB 4P57B 2EC9T 3VFPA 5DD5H 4A2LA 1FZMA 5CSZA 4P2RE 2R0WL 3BEVA 5D1ZC 3TO4D 1V3KA 1J05B 1CLZH 5CZVL 2DM3A 2P5ED 2CLZA 4WWKA 5KW9L 1O7VA 3LEVL 4Q9QL 4G9FA 3ZKSD 2V2WB 3QQ3A 1Z3GH 2F74A 4QTHA 4OD2A 1FORH 3IJSB 4ZO6A 4S1QH 4C56D 3O2DH 1IKFL 1D5XA 4XPTH 1GRWA 3E2HC 3WKNA 5HI3C 5DZNA 3BP6A 1VGEL 3DECA 4G8FA 1WWWX 2A6IB 3FO0L 3CAFA 2V7HB 3CK0H 1UJ3C 2AK4D 3V5KB 4U0QB 3MCLH 3D2UD 4U6YB 3O8XA 3LS5H 2I25N 4KRPD 4QWWD 1ZANH 5E2UL 4XP5H 3P9MA 1DUZA 1NCCL 4NCDA 1CIUA 3WHE0 1NDMB 3S5LB 1YN7A 1CFVH 2EIBA 2NY3D 4W6WB 1G7PB 5HGBA 3FOMB 4G80B 3JTSB 5KVGL 4OQ1A 5CJBA 3KYKH 4Y4HC 3UTSA 1JWMB 2D31A 2NTFA 4WTZG 5TF1L 4Q6IC 4WI3A 5TDPA 4P23C 1CFNB 3T04D 4HAFA 2ZG3A 1HHHA 1LDPH 2IAMA 2XA8L 4NC1E 3TIDA 1JIBA 4BUGA 3TCXA 1BOGB 4WU7A 2F58L 2B1HL 1JMZA 1MPAH 2BNQA 4ELMF 2CJUH 1AO7A 1INDH 2J5LC 1UKQA 3Q5OA 5F89A 4ZOEA 1FGVH 4H88L 5B3JE 5IJVA 3H3PH 1V7ML 3S8WA 3DWTA 1PJ9A 2VUOA 5KVMC 5F1IA 1Q94B 4S0SD 4QRRA 4YJZL 2C9AA 4HQQL 4X98B 3MOQA 3ZO0A 5FUZH 5DD0L 4WW1A 5HHQA 4IRZL 5E2WH 1E6JL 3QUZD 1D5BA 5BCAA 4JREC 3EOBA 1CFTB 4QHMB 2J6EL 1XR8B 2BSRA 2FJGA 4LSSH 2VXTH 1UA6L 3EJZD 3AREC 4JGJA 5FOBA 3VRJA 2R1XA 1LD9B 4LFHD 1LEKB 4WFHD 4DN3H 3AGVA 1CGVA 4V2BA 4QLRA 1TJIL 2PTVA 4B0MM 2AJXL 4OFPA 2YMXH 1FYHB 3AVEA 3IF1A 1I9RH 2CMRL 2HLAA 3C8KB 2AKRA 4PJEF 4U1JA 4J12A 4QRPA 2P5WA 4KVNH 1EEYB 2MQ0A 1KYOK 2GK2A 4M03A 4U1LB 1OTSC 2UV3A 3QPXH 3D6GA 4WI6A 5DSCB 4D0BA 2YBRA 4NQEB 4ZPVA 4NO5B 5DXWA 4P0DA 5EBWA 5T3ZH 1JGEB 4B50A 1MFBL 3C6LA 5E1AB 4XCCL 3PDOB 5IMKB 3LKPA 4H1LG 3GBML 4OLWH 1T1YB 1WAAE 5JW4M 3G5YA 3OJVC 3QWRA 3VRIB 2HG5B 1JPST 4L9LC 3E3QE 1TVBB 4UT7H 2VLKE 1MCWW 4NQCD 3SE3A 2X42A 3NACH 5DS8A 1JK8B 4UTAL 5TE7H 1YEEH 4L8CB 1W0WA 2XG5A 1OT1A 1NAMH 3VXQB 1GIGH 2C3GA 2IQAA 4NZDA 4OT1L 2RCSL 2XWJB 5EORL 5I1JH 4GG6E 5IBLC 3QFDB 4U6VH 2G75B 2JK5B 2VQTA 1YPZF 1QKZH 4IIQC 3ULSA 4PJXA 3CC5B 2IH3B 1HZHH 1AFVL 1XF4B 1CXLA 3QHTC 4CMMB 4JFHE 4K3DL 1KBGH 4DGIL 4JFEE 5C07B 4TTGA 4ODVH 5ALCH 2IADA 4X80H 2OR8A 2W60B 5DC0A 2AJVL 1OSPL 5E70A 4YDVB 3BPNB 3EOAB 4GMTH 1A7PL 1CIDA 2A0LD 4XNQA 2GFBB 2MHAA 4GT7A 5GZOC 4ODSH 3IDYB 4POUB 1AR2A 2XWTA 1WT5A 4ZD3L 5D7SL 1S3KL 1KCRL 4I4WA 4H25B 3VXPA 4WFFD 4P2RA 5HYQA 4Y5VA 3ESUF 3V8CA 32C2A 3L5HA 5IQ7H 1MUJA 3U7AA 3CMOH 4C83A 3ILQD 3UYRH 3IDXH 1GVIA 1RZ7H 4NNYA 5DHYA 4HUNB 2DQGH 4FZ8H 4Z7OF 3M45A 4M93C 5DJXA 1RQ5A 4UTBL 4MJIE 1FGNL 1GPOL 3NAAH 4IRSC 5E2TL 2CKNA 2R2HA 4S2SA 1F3JA 5LJYH 5DJ0B 1H8OA 1OAQH 5B3NA 4NN6B 1RU9H 5BRZB 1OD7A 2VR9A 3VFVB 1SMOA 2IF7A 1T1ZA 3UYOD 5I66B 4E5XB 4N1CA 4RAUB 4DZBA 1Q0XH 4KHXH 5CJXC 5DUBA 5AZEH 3VWJC 4PJGA 1J1PL 2P8PB 2CRMA 3LEYH 2E7MA 4NWTL 1KXQE 2X5PA 3IFLH 3LMJH 3SDDB 1SYSB 2EEBA 4LARH 4TULH 1CDYA 4RMRA 4OZHF 5DYOA 5JHLL 4OGXH 4KKAC 1WITA 5BJTB 4JY6B 2VN7A 1R5IB 4P9HC 5ENWB 3MBXH 2HH0H 4G7YL 3NZHL 4U31A 3CXDL 3THML 5F9WC 1SEBB 4NKIL 4YHZL 3RWEB 5LXGL 3AY4A 1KJ3H 1TXKA 5MHSD 1EHAA 2OSLB 4JVWA 2WUCH 3ZE2E 1ZLUK 3DV4B 4H1LH 4FFWD 4R4BA 5AUMA 1MRDH 3EJJX 4PG9A 1S9YB 3O6FA 1IM3A 4HKZA 4WW2A 1BZ7B 3OJMB 4KUZL 4PJHB 5FYLL 4TUKH 2XNAB 1OAUL 1AGEA 4NQED 5I16A 3VXNB 3O9WD 5JW4R 5GRXG 3IB4A 2DRUA 2A9ML 1FJ1B 5HTSA 5D93C 1WEJH 3Q1SL 5CEZE 3MLYH 2EC8A 5A16A 1NC4A 2DQJL 5IB3A 3IDIB 4PD4J 4PJHE 2VAAA 2AJ3B 7FABH 2O5ZH 1YEHH 2VLLA 5GJTL 1N4XL 1T1WB 3I6LD 2AQ2A 2LQRA 4LHUA 3MRPA 3RVUC 4JFXA 5FYKH 4HIXH 1KPVB 2ZCKH 1CICA 4JVPA 4M5ZH 1XAUA 3ORJA 4DW2L 3EYSH 5JNYA 5JUEH 2K3TA 4OLUL 4ZXBD 2VABB 4NC2B 1EAPB 3FFDA 4PTTA 4KK9C 1K8DA 2B4CL 3WHXB 2H2SC 3UEZA 1BWMA 3PWLB 1FQ9C 2QKIB 5KS9B 5EOTB 1T2XA 1I8IA 3JTTA 1PX3A 4WGVB 4YHLH 2R1WB 5C71A 2K7PA 5GHWH 4MVBD 4DGYH 3G6AA 2ICES 4HWNA 1JF1A 1MY7A 3AAZA 2IALB 3ABZA 5KS9E 2YK1H 1B6UA 5C0IA 5I1KH 3ARZA 4MB5A 3O3AB 3WSQL 1HQRA 5C07D 1NLBH 3L9RB 4S10A 3TPKA 1WAAA 1NC2A 5J11C 4OCWL 1CLOH 3KS0H 3SKJL 1OM3H 2VLKA 4BZ2H 1WTGT 1SM3H 4I3SH 3IFOA 3TIEA 1EJOL 3SCMC 2J4WL 4X5WA 2DL9A 2B2XH 4GG6A 3K1DA 1OOAA 2Q1EA 3WJJC 5LGJA 2EEAA 5JXEA 4G3YH 4XP1L 2VLME 2VDQL 4F7MA 2H26B 3KPPA 1LO0L 1ADQL 4EVNB 5BXFA 2AV7B 2FWOB 2VAJA 4OCLC 4YFDB 4RGNE 2MCG1 3WEXA 4EIZC 5I76A 1VKXB 2HKHL 5DFWH 5HYJB 1CBVH 3N1MC 3I9GH 1UZ8A 1YQVL 1KF9B 4OV5A 2V6HA 2WWMD 5DUPL 3UTOA 4LAQL 2C1PA 1B4RA 3Q3GB 2EYSB 5IBTH 4UUJA 1JN6B 4BZ1L 4N0YL 5FKPB 4ZNEA 1TTFA 3SDDD 3JZ7A 1IRAY 3S36X 1ZHBA 5DK0A 4P2QB 2CLVB 2DMBA 2YPVL 3EYQD 2CK0L 5AD0B 3C60A 3QAZC 3CU1A 1I1YB 5FXCH 1TJHL 3GZKA 4PY7A 1IKNC 1HHKB 2HWZH 3TO4C 4NQUA 4QYOA 4KDWA 5LGKA 3ARDA 1ORSA 4G7VH 2ADJB 5HGDB 3UZEA 2X9WA 2ADFL 5DEFA 1IC4L 1LE9A 2M26A 3QUYB 3EKCA 4AYFA 1NDGB 3M07A 4HIIA