4X98A

Immunoglobulin fc heterodimer variant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A01
3TZVD 4DFIA 1HZHL 4OFDA 3HMXL 5DVLA 5LGJB 5A2LH 4HUVB 2I24N 3SDCC 3G6JA 3MRIA 1E6OH 1B0GA 3RNKA 5KW9H 5TPWL 3U0TB 4JFFA 4FQCL 5C0CD 3VFMA 4Q9RL 1FNHA 5JXEC 3MV9B 1MRFH 4LLUA 3RPIB 5IMMB 2ERJC 2DQUH 4AM0B 3IFLH 1TJGL 1NGZA 1OSPL 1D5BB 1JFQH 1C7SA 1G7JB 1MH5B 1Y0LB 1NGYA 1FL3A 3K4DA 4NQVB 3V5HA 1BM3L 5SX5K 1CLYH 3EYFB 1HNGA 4P59L 2Z31B 3FQNA 3RBGA 4JY4B 1E6JL 2YUWA 4LLQA 4BK4A 3F7QA 4H0HB 4KTEL 4K7PX 4OF7A 2Y9RT 2A9ML 4X5XA 4GG6A 3I6KA 2E5EA 3LPGA 1HEZB 3P30H 4PRAB 1RUAL 1S7TA 5D1QB 3MRBA 4P2QB 3VGAC 2G75B 3PWNA 5FOBB 4JFYB 3RZCC 2VZ3A 4H5SB 3SKOB 1FFOA 4AJ0A 1JRHI 2EXWD 4MB5A 3KPLA 5FO8B 1UH3A 2YMXH 5CIPA 5MERA 3BRDA 5HGGS 3OQ3B 3IJSA 5E6ZA 1N0LA 4OLVH 3UXFA 2BNRB 2XA8H 3MLUL 5MEQB 4WO4B 4NRXA 4Y5VC 2B20A 5E6YA 5T1LA 3PQYA 2Y06L 1SJHB 5GZOD 1IC5H 2R1XA 1X5YA 1UKTA 2JB6B 1T1XA 4Z5RB 3MFFB 4EVNA 4GS7C 4WW2F 1IGJA 5DJCB 3RVXD 1QRNE 5CZXC 5DI8A 2XKUA 4CVXA 1R0AL 4MHHG 3C5SB 3GMLA 5IMLB 3CFCH 4NO2B 3RPKA 5F9OH 3C6LA 5GGSB 4P5MB 4HUXA 1YY9C 3U1SL 1VFAB 2MQ0A 5C0AA 3W0WB 3U0PB 3FOLA 4NN5B 5LQBH 1BOYA 4WCYH 3V6OE 1SBBA 1NH6A 3GSOA 1QEWB 4DUVA 3PWUA 1CBVL 1DBAH 5DD0L 3WS6A 4LNRB 3T2NH 1G7PB 1MELA 4WIQA 3OKEB 3QO1B 3JTSA 3OXRB 4Y4FC 3SCMD 3I02B 5FGBC 3G9VA 2NQCA 5I1LA 2R23A 3CVIH 3K1KC 4JGJA 1AD9A 3D48R 2C1OB 5HDQL 2YSSB 3U4BH 4U1NA 1BZ9B 1B2WL 4FQPA 1Q9WB 3WN5A 4BJLA 3V5DB 5D72L 3MV7D 3W9EB 2JIXD 4H88L 5A2JH 1KB5L 4H25B 4AQ1B 4Z0XB 2PO6D 3PQYD 3MUGA 4K9EL 1FBIH 3IDGB 2AGJL 1T1ZA 3L3KB 1MY7A 4TUJB 2D03H 4XAKD 2CLZB 2WIIB 2HJKB 1QZ1A 1HH6A 1FG2B 1A9EA 2UZIH 4X4XB 5LXGL 1QLFA 4YDJA 5IHUH 3GJFK 4P49A 1P2CA 3FQTB 1J1OL 2CPCA 3GSWB 5L6YH 1AXTH 1VADB 3ME0A 5KSAC 4PGBA 2LTQB 4LPVA 5CINL 5LGJA 4NC1C 4M43H 3LKQB 5D7LD 4UAOC 1II4E 4EDXA 1WT5A 3SJVD 2W0FB 2P5WD 1CL7H 2NX5A 3TYGL 2CXKA 2UVFA 4HWEL 1N6UA 3MV9A 5BO1L 1F6FB 4YHIB 2LAGB 3FOMA 4M4RA 5IMMA 4PRID 2HH0H 3C5ZC 5ADPH 4MD0B 5DD3L 5IIEB 1Z0MA 1G7JA 5I16B 4RMSA 2X05A 3O41B 2DQJH 2CK0H 2Z31A 4K8RD 4LGSB 4JY4A 1HWHB 4KJWD 4YE4H 5BRZA 2OCFD 2YZ1A 3NA4A 4NKOB 3MJ8B 1W2KT 2F54D 4J4PC 2ZJSL 2QQKH 5FUCC 3ZDZE 1LP9A 5DJ6A 3ULUC 3SEPA 4RDQG 3PHOB 3CFBA 1RJYA 1FVCA 1HEZA 5TF1L 2OS7A 4M61B 2CRZA 4M1DL 1J88A 1CFVL 4XT1C 2EH7H 1E4XH 4P2QA 3SE4A 5FOBA 1FZOA 1KFAH 3NCYP 4R26L 2OR9L 1O7VA 4YAQB 2BVEA 2DIAA 1A0QH 1DANU 4KVCL 4F2MB 3RVUD 2G60H 3O4LE 2A77L 1MRDH 1S9YB 3DPBA 3I3DA 1WIOA 4FTVD 4RZCB 4LSVL 1J5OL 1DQJA 1H3XA 4RMVA 1HI6B 2BMKB 2BNRA 4Z7NF 5MEQA 1W8NA 2PCPA 5HHNA 1K5NB 1WFTA 4OF8A 2C3VB 1T1YB 2NX5D 3OAZH 1F4HA 2Q7YB 4ZAKC 3ILQC 1T21A 1NCWH 4Z5RA 4FP8H 1ZXQA 3EDDA 3MZGB 2JJWA 2K3TA 4XP6L 1EUTA 5IQ9A 1T89C 3MLXH 2AJYL 4U6YA 4R2GD 3KXFB 4P5MA 5DSCB 1V3LA 3MRHB 3O2DH 3T65A 5MHSD 1U91B 1DL7L 1FYTE 3IDNB 3MJ6A 1ERNA 5A2FA 3GDBA 1QEWA 3V52L 4PJEE 3QULA 4G9FB 4G8GE 4TULL 1EHLL 3L3DA 3GB7A 1S3KL 3CK0L 5EN2B 5C71A 3OXRA 3I02A 1C5BH 3C9NB 1VA9A 3LD8B 4NZTL 1F2XK 4XI5C 4HGWA 4U6XB 3SDXA 2M8XA 2ZKHH 2YSSA 3O6FB 1Q9WA 1KPUA 4KKLC 4XPFL 3UTQB 5BJTA 1T03H 3RWCB 4FFVC 3RBSA 1CZ8L 3IB4A 3MGOB 5DUBB 5HPOA 1CDBA 4HMEA 4OFKA 1SM3H 1P7KA 1U3HA 4PRHA 1EJOL 4CAGA 3LV3A 5I73B 3F12B 1F42A 4C56E 3QQ3A 2WLYA 5I2IA 1DFBH 1PD6A 7CGTA 3BKJL 3BISA 4RAHA 3GSRB 1FG2A 4JKKA 4X4XA 4ZTPH 5FCUL 5IHZA 1DEDA 4NC1E 2VZUA 1MRFL 5HGAA 4PREB 3W81A 3G6AB 4HWNA 4OIIH 2DQUL 4IJ3C 4LF3A 5ECJE 5JOFB 1UM4L 4OT1H 4XPAH 2WBKA 2CH8A 1A02N 3EZJB 1NMBL 1H15A 2OTWB 4LCYA 1A3RH 1KCRH 5DJXA 1QQDA 4F57L 5INDB 3FFDB 2K9UA 3O6MH 3BP7A 5GGVH 4XXCC 2A83A 5EUOF 2WUCH 3J7HA 4XBGA 4X7FC 3BQUA 2QHLA 4N8PA 3ORJA 5I0DA 1DLHB 2EYTB 4JJ5A 1HIMH 4MVBC 4HS3A 5EBMB 4LP4A 5DMYA 3O41A 1TZIB 3VFPB 1N3NA 5C9KA 4QRPD 3C6LC 4NQEB 5EZIL 5FUCE 5GGTL 4DQOH 2ED9A 3ULUE 1Q0XH 2QLVB 3T77A 3VI4E 3O2VL 3DXAE 2X9WA 4Y7MA 3AFLA 2YMXL 4JHWL 3MLPA 5BV7H 1UCTA 2EO1A 1JGVH 2ATKB 1PYWB 4GW5B 4HUWB 4P4KD 3WS6C 1QKZL 3O45B 1KB5B 1CE1H 2XA8L 4DEPB 2MTPA 4KRPB 2KUTA 4IRZL 4FN0A 3QUXA 1VFBA 3PUCA 4JM4L 1KTDA 4V1DB 4Z7QF 5CKAA 2P48B 2R29H 1TITA 3N50A 1L7TL 5I1AA 4UOJA 5CSGA 2R9HC 1KBGH 5B38B 2HMIC 1YPZF 4YAQA 4K7FA 4EI5A 3H9SD 1S9YA 3WN5C 1U8KA 5HPMB 1NLDH 3SGJA 1HI6A 1RSFA 3F5WA 3C09C 1AI1L 3CFCL 1KG0B 5IFAH 3MX0A 3LRSA 4K94H 3WNMA 4D3CH 3FO1A 3BQUD 3UDWA 5DD5H 5D7KE 5KVMC 5CD3A 1DBAL 5HXMA 4HQQH 2FECL 4HT1H 4JR9L 4P2OB 4Z7VB 5C86A 1RZFH 5JZ7C 4PRBB 5I74C 3ZDXF 1S5IH 5HYIA 1K9TA 3KXFA 2J5LC 5B4MD 5ITBL 2ADIA 4K2UH 4RGNC 3SY0B 5F70A 3MRKA 3U4BL 3V5KB 3BRGC 4LPYA 3WLWC 5F88B 4JKPL 4OM0L 1YQVL 3K74B 4LCWA 1KJ3H 4FQQB 4JO2H 4TNWF 1WITA 2FWOA 5IB3B 3ZL4L 4G9FA 2GJJA 1F6LL 4Y1AD 2FEDC 1AC0A 5BQ7B 3NIFF 4PB9H 3QUXD 3MYZA 2N4IA 5HHQA 2ZCHL 1FFPB 3S37H 3KPTA 4KK8C 1WEJH 4PG9A 43CAB 5HHOB 2D03L 2Z31C 5EBLB 3TO4B 2UZIL 4ODXB 3T4AB 3TVMD 4GG6E 4WJ5B 3P4MB 1EBAA 4ODSH 2NY6B 3HZYB 3THML 3WKNA 4BKLA 1CFBA 2AXFB 3AU1B 3F6IA 1CICA 3DARA 1UB5B 3NIDE 4M43L 4TSCH 2F15A 4QNPF 1P84K 2FYYB 4PLOB 2JELH 3MRRB 4E42B 5K9OB 4L3EB 5D1QC 1CL7L 1QPXA 2HT4C 4MA3B 3WIFB 1HXYA 2A1WL 1ZANH 5KBNC 1YC8A 5FGCB 1M71B 3GBLA 4OZGF 5ADPL 5GS1A 4Y5XB 1MCDA 4MAYA 3REWB 2WMPA 4OCLC 4OIAA 3T0EB 1ZWIB 3T3PF 1HXMB 3EDEA 3QG7H 4WU7B 1MHPL 5C0IB 5E2VH 2DQJL 4ZS6C 2Y36L 3WJLA 4KK9D 2CDEA 2OTWA 3L3OB 5CS7A 2CIIA 1I8IB 3Q0HA 5E9DA 2R0KH 3ARFD 2D4FA 2IADB 3LMJH 5KSUB 5ID0B 1R5IA 2DMBA 3BIKB 5DT1H 2QQKL 5JW4Q 4JVUA 5B3JE 3H8NA 1SEBA 4HV8A 2IANB 4OFIA 4QCIB 5FKAA 5C0AE 1WCBB 3DNKA 3FB7A 5FYJU 3SDAB 1CXLA 3MLVH 5EOQL 2EH7L 1E4XL 1LO3H 3GRWA 1KFAL 3PDOA 4NN5C 5DQDH 4OQTH 2XICA 2G60L 4YXHH 2Z35A 4AMKH 4XPGH 5HJ3B 3D25A 1KPRB 1PYWA 1CICD 1KCVL 4GW5A 3UTOA 3WSQL 1F8TL 3MJGX 1NC2D 2W9LA 5DD6A 4ZO8A 4G6AC 3QFDB 5AUMB 2DQDL 3P73B 1BLNA 5J3HD 1FNFA 3MBEB 1ZT4B 2OBGA 2LU7A 5B38A 4MAYD 1JGDA 4FP8L 3QIBD 3L1OL 4GSDL 4WGVB 4S2SA 5HHMD 1R24A 5F3HB 3LHPH 5CWSA 5EORL 2P43B 1MNUH 3MLXL 4DCQB 4X7CC 2LU3A 5F1IB 3GZKA 1KN2H 2ZUYA 3VCLB 1I3UA 5E9DD 1Z9SA 1T04B 5ERWA 3P4OA 1NDMA 4AIZB 4F7PA 5GRVL 3T3MF 5J57B 1NC4D 1V8HA 4H1LA 4NRYB 5H35A 5MENA 3EYOA 1RMFH 2HRPL 4RGNE 5GHWL 3STZB 4XB7A 2XT1B 4G8IA 5KJRH 3BP5B 2DI9A 4TUKL 1JK8A 3VFSB 1G7IB 1FZKB 3BOVA 3KPSD 1RUPL 3MV9E 5ACZA 4BK5A 3I50H 3ZLQC 2XOTA 4WENB 3LKOB 4YNYB 3MRQB 1A9BB 3QQ4B 3KJ6L 4FQQA 5FA3A 1LE5B 2F53D 4DGIH 3MRLA 1T20B 4QRQB 3RKDD 3RVWC 4D0DB 4KJYB 4D0BB 4I0PA 4P99A 1KLFA 1UVQA 3FT3B 3TM6A 2IMMA 5BRZE 1KACB 3IDUA 3ZTJH 4XCEA 1FFPA 1T80A 4JO4L 1A64A 4U4BA 1ZGLA 2YUZA 4LLWB 43CAA 5HHOA 4P3DA 1A1OA 2YK1H 4ZTPL 4ODXA 1JNHB 3T4AA 4UI2A 3JVGC 1LP9E 5T3ZL 1ODAA 5ISZD 3D3VD 4HGMA 1BAFL 2Q1EA 2P24B 4X9FA 4XMPH 4BSJA 3NH7H 4OT1L 4P2QE 1LO4H 4XPAL 3GO1L 1KT2B 1G7QB 1ZLWH 1CLOL 2DIBA 4ZFZA 4HIIA 3MLWH 1KCRL 4E42A 4Z7WA 4PJDB 3O6ML 1FNLA 5E8EB 1A7RL 3WIFA 2W65A 2BNRE 3LSOA 2X9YA 2X89D 3V6ZB 4EI5C 4YEFA 1RJCA 1BJMA 3HS0A 3FTGB 1HIML 3VFVB 1RZJH 3IJYA 5B38G 4TVPE 3L3OA 4PV9B 2HLAB 1INEH 4W68A 4JO1H 2VDML 2ZSWB 3QNZB 3PJSB 3LKSB 1DBJH 1MFCH 5KSUA 5DFVC 3WBDA 5ID0A 1DEEB 1YYML 3MREB 5DFWH 5CHNA 3BIKA 5EIVA 1OD7A 2DD8H 4OLWH 4XXDB 3BZ4B 5GZND 4P2RA 2X70B 4QCIA 3ETBF 3W0WE 3EIFA 4QXWA 1XCTB 3QDJA 5DD1H 4WWID 1OGTB 2DMCA 1VFMA 4HEPG 4X4YB 1F11A 1MI5A 1IM3A 2KL6A 2VZOA 3ARRA 3VRJB 2JK5B 4WFHE 1S7VB 4PV8A 2A6KA 2CIKB 1MHHA 5B3NA 4G6KH 4R97B 1BPVA 4ZXBA 1BGXH 1AKJB 1U3ZA 3IRPX 4HS8H 5DJDA 4JGUA 5H8DA 2R1YA 3UX9B 5A2KH 1FLRH 1S7RA 5AUMA 1QFHA 1UH4A 3LD8C 4KXZI 3RFZC 3WIHL 3MBEA 1OAYL 1EEQA 4H26B 4UBDD 3PABB 1FRGL 3O6FC 2B4CH 4ENEC 1FNGB 2CRYA 1K8DA 3MSPA 3WFZA 2UZYB 5ANMB 4D0CA 3V6FA 5DEGB 1S5IL 4MS8D 1BJ8A 3RNQB 1WZ1H 3LCYA 1MWAH 4XC3L 3GSQB 2XZCH 5I73C 4K2UL 4DW2H 3QDGD 4URTB 4UOW0 3N06B 4NZUH 5JIHA 4NKMB 1LO2H 2FLBT 1J87A 4NBXB 4NRYA 2X1QA 2GITA 4LLMA 2UUDK 2Y5TB 3L6FB 3HZMB 4P2RD 3O3EA 3OHXA 5FGRA 5CEZD 4RFNB 2YPKB 3RWDA 4HJ0D 3BH8B 4M5YH 1QFUH 4WHYH 1MJUL 1CLZL 4QRTA 4HUMB 4MD4A 2VXQL 3S37L 3ARBB 4JN2B 2L7JA 5CKGA 3LKOA 4NBYB 4GBXD 1VSCA 3MRQA 1WZKA 1A9BA 5KVDL 3SQOH 2O61B 1QRND 2WQRA 1H3PL 5D1ZB 1G6RL 5GGQL 2AJUH 1EX0A 1T20A 4QRQA 4D0DA 4KJYA 5FGSA 1WTLA 1MFEH 2A73B 3KAAA 4G9DA 3WJJA 2DMKA 1HHGA 5CEXA 2R56H 4R4NC 4JM2B 2Q3AA 2ZUVA 3S97C 4LLWA 2QEJA 2Y7QA 3IGAB 3B2UD 3MGAA 4YHKH 5DGRA 4QF1B 4ORGA 4ZUSA 4NRZB 5I1HH 2X1XR 1IZJA 3VA2C 1RUML 1ZANL 4PRDB 1L6ZA 4RFEA 1NCDH 4M03A 4XRCA 3FKUS 3FB8B 3MOQA 4ZPTA 1FVEA 3D85B 4WI6A 2YRLA 3BP6B 5T1DH 3WIIH 4PJFA 2D9QB 5J6GB 3AS1A 4XNMB 4MXVF 4IS6B 3DV4B 4KRPC 1RHHB 4FQXA 3OTTA 4ONGL 2CRMA 4K9EC 1UACL 4M7KH 1IQDB 1KEML 3FB5B 3LMJL 4PFEA 2J8UB 3M1BB 4HFWA 3BT2L 5DT1L 5EU3A 4JDZA 4G7YH 1J1PH 3RP1A 5GPRA 3GIZL 5DC4B 1OWWA 4G42B 4ZSOB 3MLVL 4KY1H 1LO0L 1LO3L 3SDCD 1XEDA 3HPLA 3I6GB 1G1YA 3LKSA 1PLGL 5C6TL 3HZVB 4OGAC 4Y2DB 2LQRA 3LOWA 3K4ZA 4ISVA 3MREA 1I7ZA 4YXHL 4XPGL 2H3NB 3UJJH 5D7IF 3KXFE 4HFUL 4O51B 4NBZB 1AE6H 4YIQA 4L1HA 4P2OC 3K8LA 4NWUH 1OGTA 4NJAH 3TH4T 2V7HB 2C1PA 4X4YA 3JTTB 4G9FE 5IVOA 3RWJA 1WFNA 3UROR 2JK5A 5E8PA 4WUUD 5C0DA 1AP2B 3O6LH 5HDBF 3U7YL 3BGFB 1S7SA 2CDFA 5T5NF 1MNUL 3AREA 4I0PC 4LMQE 3S34H 2IBZX 4FQXD 4LK4A 1KN2L 3LS4L 4LARH 3NACL 4ESKA 3QIWB 2V17H 2VZVA 5FOJA 4AH2A 1MFDL 4HK0A 1SY6H 2ESVA 4FZ8H 3WFDL 1RQ5A 4K7PH 3VGDA 1IGML 1G9NL 3PABA 3AS0A 4KDWA 4JFOA 3TO4C 2BOBA 3E2HC 1RMFL 3UCRA 1R3HB 3NFNA 2GIYA 4Y4HB 2NY6C 4K3EH 2P7TB 4KFZC 3MLZL 1D9KB 1OCWL 1YN6B 2X4QB 4BQBA 2DI7A 4Z0BH 3RNQA 5JR1H 1EXUB 4F7TA 1NSNH 3GSQA 3IKKA 2C4FU 4GQPH 5GRXG 4I4WA 3TIDA 4D8PA 1SYSB 4N1EA 3O4LD 3U83A 1YEIH 2YXFA 5DYOB 4DGIL 3BEWB 4XNUH 4YFLF 5IOPB 4IIQB 1BQHB 1WK0A 3IU3B 1XF1A 1IFHL 4Y5XC 5A16B 5IW1A 3T0EC 4JN2A 1W0YT 3TBWA 5DEFB 1G9ML 4YO0B 1KIPB 1K6QL 3CSBA 3M45A 5KANG 4NIKB 2VDRH 2IAMB 1MY5A 3L5HA 1C16A 5T33H 2FX7H 5BW7A 1OT1A 3S3SA 4Y16A 5DJYA 5CEYB 3GMPA 2AQ1A 4WFEE 1U58A 2OP4H 4P9HC 4Y19A 1SVZA 3MLWL 5EU5B 1AQDA 3ZDYE 1PDKA 4NRZA 3OKKA 3MCLH 5HBBA 3JBG7 1PEZA 3UPAA 4C4KO 1VESA 2APWA 3LQZA 4B7IA 3ARWA 3KYNB 1P1ZA 3ARGA 3FB8A 4N8CH 1Q94A 3OAYK 4V1DE 4ZXBC 5IVXF 1Q1JL 4IS6A 2EH8L 1RZJL 1U93B 4QRUA 2JLLA 4PUBL 4HBCL 4PJIA 4XCYB 3CSGA 3O2DA 4JO1L 1UJTA 4PY8I 1BX2B 1FO0H 3MBEC 2JE8A 5DF0A 5HVWA 1DBJL 2J8UA 1MFCL 1IARB 3GMMB 4LVNB 2I07A 2JB5H 1A6VL 2WNGA 1KEGH 4ZPVA 4P5TB 1XT5A 5JXAL 2LFGA 4WFFD 5E7FA 2JJSA 4MDIA 3HNTH 5KSAD 4ZSOA 5HI3D 3P4LA 3BKCL 4HZLB 5HGHB 1T0PB 3ARVA 2D7TL 3NFPB 5CJQH 4Z7VE 2HKHH 2E7HA 4Y89A 1YNKH 4KKCC 4Q0XH 2IH3A 5EZLA 2X4OB 1BGXL 4KRMB 3VE0B 3C5ZD 4DUXA 1HYSC 4JRXD 1OP9A 3N85H 1FLRL 3FMGL 2E9JA 3U30B 2SEBA 2VRAA 4JPVH 3FT2A 3QPXH 3DVNA 3VDBA 1UKQA 4KV5E 1AP2A 2B4CL 1G7LB 1Z3GH 4LSDA 5AD0B 2AJXH 4GKNB 1UM6H 2N7AA 4UILH 4XHJC 4M4PA 3TO2B 4A2LA 4O4YH 2VABA 3CVHA 3CFEA 3ARYA 4J4PD 5HHOE 2Z0BA 1N64L 1JPST 1WZ1L 5IBLD 1UC6A 1JF1B 1J18A 3CDGB 4LSSH 4DW2L 2BHZA 3DXAD 4NZUL 3I6LD 3UZQA 5SWZD 2O5XL 3W2DL 2DJ4A 4PTTA 4CBPA 3P11L 2AK4B 5E2WH 1R3HA 4JDVA 1UZ8B 4LCUB 5TGBA 4M5YL 1YN6A 2X4QA 1QFUL 5M95B 4IBLT 4UIMA 4L3EE 1OARH 3T04D 4KHXL 2VR9A 5EZJA 5FGCE 3OKDA 3JV4B 1G0XA 4GKOA 5DHVH 4JPKH 1NBYA 3T0EE 5DYOA 2CMRL 5M7QA 1WWBX 3EO1A 5EUKA 1KIRB 4QRRA 4QXGH 1D5XB 5DRNA 4DAGH 3MA9L 1SJVA 3HPJA 3QEQB 1SQ2N 2PW2B 3LS5L 5DEFA 5EG6C 4YHKL 3VXOA 3JUZA 1T4KB 1ZA6B 1IE5A 5DUML 4N0FB 2QL1A 2IANE 4OLEA 1U8MB 1X7QA 2IAMA 4GRWB 4JG0H 1YNTA 2FD6H 2HKFH 1UWGH 5IJVA 3D0VA 3LQAH 2H26A 4GXVH 1BECA 5TF0A 5T1DL 3PP4H 3DX7B 3HRZB 3ZDZF 5CEYA 4IOFD 2X4PA 3PE9A 4CN4A 1D6VH 2FJFB 1A7QH 1GVIA 1BBDL 1R6VA 2VDQL 3NAAL 2JCCB 3QWOB 1XF3A 4XWGH 1W0VA 4UDTB 2ZWLT 2D7QA 4O02H 4KKLD 1QP1A 5I75B 1P4BL 2X9XA 4HPYH 4R97C 1T0NB 4G7YL 4XMKH 4FFVD 1U42A 1J1PL 5JDJA 5I19H 1KGCE 1H3GA 5EC1B 1MFNA 4M6NL 4NGHH 4FMFA 4MB3A 4MCYA 4XCYA 5E8OA 2X4NB 3QA3A 3OR6B 4MA7H 5JMOC 1ROWA 5F72S 2H1PH 3GMMA 3ZKNC 4Z7UB 3HNSH 4O58L 3UJJL 4M48L 4U6VL 4WFGD 4XBPA 4FNLL 4ZS7H 1RAMA 5BZWA 3RWGA 4OFYA 4LPTA 3U82B 4HZLA 1B88A 1HQ4B 4IMKA 2NZ9D 4NO5A 4BQ9A 4J2XA 3NFPA 3VXQB 4L9DA 4LQ1A 3L7EB 4S1QH 3D9AH 5FKPA 4KQ4H 2YBRA 2AI0H 3CLFH 2VO5A 5DJAB 2AABL 2X40A 4EN3A 4PJEF 1JYXA 1BQLH 5HHVH 3VE0A 4DK6A 5HYJA 1A7OH 1EV2E 4RFNC 4JRYB 4LLYA 3MJ9H 1S9WA 1AO7D 4LPXA 4CADA 3ARBC 1XGYH 2W0LA 3IKCB 4S11A 1F58L 1BQHG 3MLTB 4YDKL 4BQ8A 4XH2A 3LEXA 3U2SA 1TDQA 3CXDH 5AD0A 5D1ZC 1QFWL 4LSPH 1ZHLB 1TQCB 2VSCA 1CDIA 1K4CB 2RCSH 1YMMB 4Z0BL 4Y16C 3EJZD 2D7MA 2BC4A 2F8VA 2EDHA 3BD4A 4R7NB 2DBJA 4DKFH 1JPTH 4ZNEA 5IB4A 1ED3B 1A6AB 4OKVA 1YEIL 4GMTL 3MRGB 1MCRA 4JB9H 3FZUC 2HMID 4XNUL 3X13B 4ZYKA 2ORBL 5DHYA 2X10A 4PY7B 5GS2H 3ARGC 4O5LH 1AR2A 3EYSH 1YJDH 3QDMB 3DI2B 4PJDE 5IBTH 5CBAB 3DVFA 2IPTL 3T0WA 4X8XA 3SGEI 3DSNA 2V2XA 2JTDA 3L3JB 2P5EA 2RR3A 4OQTA 1P69B 2AEIT 3WXVH 5ITFB 4K23H 2R0LH 1D5XA 2H8PB 4DZBB 4WW1A 3B43A 1FPTH 1V7NH 5J1SC 5FO7A 1JRHH 5JZ7D 2OP4L 1S78D 1TVHA 2PW2A 3UJIH 4DZ8A 2E27H 43C9B 1OTUD 2NY4D 1T4KA 3O2WH 3WNNA 3TF7C 4YDLB 2BFVH 5F89A 3ULUF 1U8MA 3SOBH 2DQIH 4U0RB 3VI4F 1OAQL 1U8LA 4Y2DC 4N8CL 2BZDA 3HE7D 3HRZA 1RZGB 2FEDD 4M8VA 1NBZB 2FJFA 5HGDB 4KJQC 1MWAB 5IVZB 5SV4A 3RWIA 5I66B 2B5IB 3KR3H 3V0VA 1FO0L 1N5AB 2ICEB 3PWVB 3NVQA 1L7IH 4EI6B 2JB5L 4HUKB 5IM7B 3IDJB 1HHJB 1MCOH 1K8IB 1AGDA 1EMTH 3TLRA 2H6PA 4NQCB 3BGFC 4CU7A 1ONQB 1F4XH 3KWWB 3OR7B 1FAIL 1NGPH 4APQD 1UT9A 1F13A 4JQIL 1XCQB 2EXYC 1UG9A 1TFHA 4PGCB 2HG5B 3QIWC 2P5ED 5F71A 2HKHL 1MAMH 4BZYA 4TNVF 5D1QD 4Z7UA 4M1GL 3ARQA 2C4FT 1AY1L 1FORL 3T1FA 5D2NB 4EXKA 5CGYD 4Y4HC 1ZVHA 2W07A 1T66C 3EJJX 1VACB 2QSTA 1D9KC 3N85L 2EEAA 3MROA 4O9HL 3VXMB 2EDEA 3CMGA 4F9LC 4RMWA 1HQ4A 2AV1B 3DROB 3H9HA 4ZS6D 4JPVL 3WFEH 2YD8A 4JVPA 4PJXB 4WO4D 3TN0D 2Q86B 2VXTL 4ODHH 5KZCB 5I1GH 2AJXL 1BMGA 1UM6L 2Q76B 2NR6D 4N0UB 4PPTA 1MQ8A 4IIQC 1GIGH 1QD0A 4TVPD 5I1KL 2GHWB 1FFNA 2VLRB 1I7UA 2KH2B 4LSSL 3SKJH 4I8DA 2FR4B 3R4DA 4AG4H 1JNLH 4GG6F 4IM8A 1YEHL 2MHAA 3W0WD 1R3KA 2ZUTA 1DQMH 1TVBB 2IAMC 2XPGB 2XY1A 4H8WH 3VWJB 1A7PH 4D9QE 3P0VH 4HAGA 4DVRH 1YMMA 3A6BH 1P5VA 1KV3A 1GGCL 3RWFA 3NIDF 1V7MH 4J12A 4GRLB 1MFBH 4WU5B 2EDWA 1RULH 4DFHA 1SMAA 2G2RA 4XCNA 4KPHH 2GSGA 4ZD3H 3IFOA 5DO2D 3W11D 1G84A 4K94C 5K9KB 4Z78A 5JPMB 3OJDA 4QXGL 1UA6L 4OM1H 3WNLA 3QIUA 2IQ9L 1CLCA 1QBLL 2EYSB 1LHZA 2J8UE 3HLAB 3UZEA 2GK2A 1IL1B 5DC0A 2ZUSA 3ZTNL 1QNZH 4PGJA 2NPLX 3BIBX 4MQXC 2YOCA 1W72L 2IH1A 3UYRL 1A6TA 4W4OA 1QLRB 5D1XA 3MACH 1KN4H 1LWRA 4LVNC 4ZSOE 3LQAL 1I4FB 5AYQA 4DZBA 5B3JF 1VENA 4EOWH 3IXTB 4DGVL 2GY5A 2C5DC 5ENWA 1INDL 1FLTX 2FX9H 4NP4L 3MRCB 2G9HA 2PYFA 3QUKB 3F7RA 2XWJA 4G80A 3B5TA 3U7WL 3UPCA 4ZNCD 1XR8B 4P46A 4G3YH 3LZFH 3ZTJG 1S9VA 3EW3B 1GJIA 3RVWD 1ZT7B 2YD9A 5KOMC 2APFA 4FXKB 5CP7A 5I19L 1KLUA 2D9CA 5JORA 1RZGA 3VGFA 2VZ1A 5J13B 1MCHA 1MWAA 5IG7A 1KULA 1CGSH 2JJUA 5I1EH 4MA7L 3U30C 5KSVB 5HI5D 3PWPD 1OAKL 2AEQH 2H1PL 4QTIH 5FYJL 4EI6A 3GHBL 1U8OB 1N6QL 3L5WB 5E8DH 4LHQB 1TJHH 1HHJA 1D5ZB 3HN3A 4X0KB 3PHSA 2HTLC 1ONQA 2HN7B 2WK2A 3OR7A 5GGUA 1DVFA 2GAZA 2Z9TA 5GRZA 5JNYB 1P7QB 1KXVC 1OAZH 2AJVH 4PYHA 1JNNL 4MNGB 5C09A 4PGCA 1QYGH 2HG5A 5IB2A 2CUMA 3CZJA 4LCCA 4S1QL 3D9AL 1G0DA 4KQ4L 5EUOB 5HGBA 2MPAH 5D1XD 1DR9A 4E9LA 5ALCH 2ZZUT 2Y07H 1EO8H 3CX5J 1EBPA 1U8NB 3MUJA 4U05A 5JPNB 1B6UA 4OZIA 2IWGA 3VG9B 1QBAA 2Y6SC 2WLZA 5FYLL 3IVKB 4JFQB 2RHEA 3VXMA 4F37K 1DN2A 3LIZL 5I1DB 5ESVB 2UY6A 1EEYB 1IGTA 1Q9OB 1XGYL 2X4SA 1UJ3B 4NFBA 3EOBA 1S7XB 4ACPA 4MDJA 5KVEH 4QRRE 3SO3B 2VDNL 5TDNA 3CXDL 3AB0C 3FN0L 4X5LA 5DFVD 2Q76A 5E70A 1JGUL 5CD5C 1BBJA 1AQKL 12E8H 2QSCL 4MA1B 1NUDA 2VLJA 3CFDB 2EC8A 2ARJB 3GSXA 3MRDA 3RZWA 1JE6A 1FO0B 3N9GH 3VXUB 4JB9L 1LP9F 2XWTB 4WHCA 2J6EH 2OLDA 3VWJA 2V9QA 1YYLH 4O5LL 4YHPA 1YNLH 1GZPA 5DLML 4LKXB 1YJDL 2UVEA 3LN4B 3QI9A 1FL6A 2L7UA 4M8QA 1WV7T 1ADQH 3MGTB 4WU5A 5TQ2H 5EC2B 4HJGA 1MF2L 2GSIA 1J86A 4PJGB 1HSAA 3S3PA 1GHFH 3O8XB 4YZFF 1G9NC 4FFZH 3O6FD 4K23L 3UMTA 1G0YR 3N1GC 3LKPB 4ZDHA 1JPSL 5I75C 3B5HA 3X3GL 2EE3A 4OD3H 1AGEB 3EO9H 4I2XB 3EHBC 4LDEB 4YXKH 2P44B 3HMWH 3EJYC 1IL1A 1S7WB 4UT6H 1PG7W 5F1NA 3AM8C 4RNRB 1A1NB 4RAUA 3SOBL 4E5XB 1CFTB 2DQIL 3W9DB 4OF0A 1NBQA 2F5BH 4X5WA 5IROA 4YDIH 4FS0A 3TGXA 5F7FA 4L9LB 3LAFA 2FB4H 4LEXL 5B8CA 1VEMA 4HF5L 4OLXH 5D71L 2OR7A 1LO5B 4OF3A 2VDPH 1J0YA 5GJSH 1A2YB 1V3JA 4QRSA 3RVVD 4HC1A 5JUEL 1SY6A 4FQ1H 4Q2ZA 3FO2B 3HCVA 5HYJE 5D4QA 2NY7H 3W5MA 3K7UA 3NCCB 3RDTA 4OTXH 1MCOL 4C4KT 3RIAF 1NGPL 1X5XA 4PRNA 4WDIB 4NO3B 1UXWB 1F4WL 4HWBL 1BWWA 1AGBB 5C6WH 5EFIB 3BDBA 4KH2A 5KSVA 1BF2A 1I9JL 3JWDL 3NTCH 4HIEA 1MAML 5DHVB 1R5VA 4OZGB 4NQED 1U8OA 2IPKA 4I5BB 5FYKH 4N8VA 2G5BB 4X0KA 1TQCC 1R3LA 3SKMA 4S1DD 1EVUA 5CJBA 5J6HA 4NHCH 5IV2A 1T2XA 4AK1A 2AK4E 1GC1H 1S7QB 4MNGA 5JA9A 3MNWA 2DWEB 1RZJC 3S96A 2VISA 4XPBH 4V1DD 4KQ3H 1M7DB 2FIKB 4HZAA 2WP3T 4XP5H 4XVUC 1GIGL 4MCZB 3ARUA 1JP5A 5I1DA 5DK0B 5ESVA 1OAUL 2PYEB 3SKJL 1EEYA 1OPGL 3MLYH 4U1MA 1S9KC 1UJ3A 1EAPB 4M6OL 2MCPL 3U4EA 2QV2A 3V4PH 5D6DC 3WDJA 3IF1A 2FGWH 5J89A 1U8IA 4FQJH 4HXBL 4HK3N 3QEQE 4H8WL 3RY4A 1A7PL 2BXZA 4NWTH 4PJHB 2IGFL 2OL3L 2ZG3A 3ARDB 2NNAB 4OLYL 4RIRB 2LVEA 3KYKH 3ULVL 5SWSA 2E3VA 5H94B 5E94B 4MJIB 1IGFH 4K3GA 4JCMA 4YDLC 3CCHB 4HIHA 4U0RC 3IDYB 1IT9H 4RX4A 2X4RA 2B4CC 3O6KL 4OM1L 4LKXA 5E2UL 3WFCL 1EZVY 1AXSA 1OW0A 3FAXA 2E7MA 4JAMA 4Q97A 3S4SA 2JCCE 3D39A 5DQ9B 2CKBL 2VR4A 5ICXA 2IG2H 5EC2A 7FABH 3BWAB 5GRVK 2VLKB 3HAEH 1CT8A 2ZPKL 3EFFB 1QNZL 2NTFA 1ZEAH 2AAVA 2B5IC 4LPCA 4HWZB 4P3CH 1XZ0A 2FJGA 5K9QI 4KMTH 3O8XA 4X80H 3VXSB 4R7DB 5C8JB 3K46A 4PG2C 4MZ2A 1UQSA 3LKPA 1QSFD 1RJLA 5J4MA 1RUQL 4EOWL 4LEOA 2NY6D 4GAJL 1MJ7H 1OSZB 3HG1D 5GRJL 3TP4A 3GSVB 5FUZH 5A3ID 3I85A 6FABL 1IGIH 4Z7UE 4L8SB 1IAOB 4YHMH 4R0LB 4N8VG 4L4VB 1YZZA 3T4YB 4JANA 2VWEC 4L3ED 3VFGH 4LOUC 1AHWA 1U3YA 1HOCB 5D2NC 2MWCA 1EGJH 2YHGA 3LKNA 4J8RB 3T0ED 3R0MA 2IFFH 2E8ZA 4GUPA 1SMOA 1ZLUK 3SE8L 1CGSL 2DYPB 5I1EL 3GKZA 3HZKB 4CU8A 1FFRA 5I1JL 3FO2A 3FRUB 3CIQA 3KPPB 4OIBA 4JRYE 5E8DL 5ELIA 2YEZA 1JIBA 1U95B 1TJHL 4A6YH 1IRAY 2BDNL 4ZOCA 4G6ML 1LE9A 3D39D 2Y1VA 1FNSH 3HI6H 15C8H 1QLEL 4XCFH 1UZ6F 2VE6B 4LQFH 2BY1A 2IAND 2AJVL 1NCBL 1UXWA 3ECBA 2PKDA 3PHQB 1AGBA 4NO3A 5EFIA 2XI9A 1IMHC 3OAUH 5T3XH 3SDAD 3GMQB 5ALCL 1MIML 4EUPA 1YMME 1A6UH 1A47A 2Q20A 4U1LB 2NY2B 4CDHA 3OKOB 4LFHD 3EYQC 3VWJC 2C3WA 3D0LB 2E7LC 5D93C 2Z91A 5GGSY 4EIZC 2ICCA 5D5MB 3CFKA 1M6OB 3OX8A 4RAVA 3D69B 3E3QC 3C60B 3WMSA 2DWEA 5KVEL 2MFNA 3HFML 4OGXH 3UTTA 5KN5B 5E56A 3QDME 3CC5A 4KHTL 1DDHB 2BERA 2NW3B 3KLDA 4UINH 4Z9KB 5FF6B 4CN6A 1S7UA 2UWEB 4YHNA 12E8L 1T0MA 1I3RA 1L9MA 3QQ9D 3QCVH 3G08B 3GIVA 1EAPA 1T7VA 5DK2A 1PVHA 2GFBA 5CILH 2R2EB 3H3KA 4KVNH 4R4BB 2J6EL 3OF6D 4OCXH 1MOEA 4NPYA 5LG1A 2NMSA 3MUY1 4POYA 1J8HB 3ARTA 2EDBA 3ARDA 4HXAL 3VJ6B 4RIRA 1FG9C 4XCCL 1BZQK 1B6DA 3DUUA 4AENA 3ZDYF 4FFYH 2W9DH 1A3LH 2XQYG 3O3BB 3QHTC 5KSBB 4QXUH 5B39A 1EEZA 4PJ9A 4FFZL 1I8MB 4HKZB 2HFGL 5F7WC 1P4IH 4YDVA 5KVGH 4OD3L 1X5JA 4UNUA 5GSRB 4KGJA 4KDTA 4YXKL 3UBXI 2D4DA 5DQ9A 4F7CB 3VFTA 5GGRB 5J13C 4OBSA 3EGSB 4CW1B 3L3IB 4MA8H 2PR4H 4F15B 4GKSA 4NQCE 1QBMH 5EOCJ 4J3WA 3E6HA 3TA3D 4MZ3A 4YX2H 2XTJB 5C8JA 5DJ2B 1OAXH 3MYJB 5C6PB 3MJ9A 4TQEH 2VDPL 5GJSL 1XFPA 2VWEE 2CR6A 5T5FH 1QSEB 1CVRA 1IAOA 4L4VA 3AY4A 3ROOA 5D2NE 5FM8A 2NY7L 4X6EA 4Z7VF 4BYHA 3O3AB 5FUOL 4EZMA 5IJKA 4KXZH 3VXME 3G6DL 1KENH 1F97A 3TCLB 5FAAA 1O7SA 4PJXE 2H32H 4M3KB 2OL3B 3STLB 3L5IA 3C08H 4J8RA 1MREH 1X3DA 1XF4B 5BZDA 3GGWB 4PJ9D 1UJ3C 5E6IA 1KCSH 3PNWA 3SO3C 4KV5F 2VXSH 4KGLA 1I9IH 1U95A 5AZ2L 3NN8A 5C0BB 8FABB 3P77B 2XZQL 2VMFA 3OKMA 5FO9B 3HI1A 1MUJA 1HE7A 3TBTA 4QTHA 1YEFL 3O0RL 1KIQB 2BX5A 3IJHA 2BNQB 3OKLB 5IUSA 3RTQB 4KQ3L 3BPOB 4OV5A 3HR5B 3QUMA 3G5XB 1HQRA 5BOPA 1F3DH 3E3QE 2LVCA 3JWOH 2Q6WB 3VXRA 3GI8L 2V5MA 2R8SH 4LKCA 4HX1B 4I77H 2DJSA 4CVZA 1Q0YL 4DTGH 1AKJD 1TCRA 4MNHB 35C8L 5CIPH 3D69A 3C60A 3MLYL 3OB0H 5B39G 5HVGB 2VN7A 4NUGL 3V4PL 1C08B 4FQJL 1ETZB 2DQTH 2QJDA 3O8XC 4ELMA 4LU5H 4NWTL 3U46B 3QRGH 5GS0L 4FXGA 2IBBA 3FFCA 1EEUA 3G08A 1IM9B 3O11B 5E6ID 1KCKA 1RZIB 3QP3A 1YEJL 1IGFL 4G8EB 1N26A 1ZVSB 2R39A 3V6BR 2NLJB 3G5ZB 4LLVA 1RJZB 3ULSB 1E4KA 4XTRC 2QQQA 5JW5A 4NT6A 3LRGA 2A74A 2PXYA 1A22B 2DWDB 4QHNA 4HJJH 1CGUA 4L9LC 3VJ6A 1CGXA 3SGDI 1EFXA 3BPNB 3EBAA 3DVGB 1LEKA 3QHZL 3TH3T 3GM0A 2EIZB 2Y23A 3L3GB 4OCSL 4D9LH 3WCYA 2RGSA 3O3BA 1D5IH 1K4DA 3KS0J 4GRMB 1XGTA 4MYWB 5ESQB 4X6CB 3MCKB 1MIEL 1I8MA 3QDHA 4HKZA 5D1ZD 1ZHKB 2PTTA 1PX3A 4K8RH 1CD8A 4XP4H 5GSRA 4OGYH 1MJ7L 3Q1SL 1DE4A 2W59A 4NNYA 5C0EB 2R2BA 4GMSL 2YPLA 4NZDA 2EKSA 1IGIL 3L3IA 1CK0H 5AG8A 5IHLB 1IGYB 4YHML 3EFDL 3HNVH 4JM2D 3L7FA 4NC0B 4JO3L 4JQVA 4UZGA 2B0SH 2HVKB 1JZ5A 5DJ2A 2YD4A 3DMMB 3FZUD 4ZUVA 3FFCD 5FV1L 3VFGL 1ZA3A 4MNGE 4XVJH 1BREA 5BVJB 5LBSL 3TJHD 4DOHB 3D85D 1EGJL 3FJTA 3DX9A 4UV4L 2I9LA 2OXHA 1QSEA 4L29A 3SKNB 5L0QB 3MV8A 4HH8A 3O3AA 5H2BB 2NY0B 1F5WA 4A6YL 4PRPA 2DBLH 3RIFK 3FQUA 5F9WC 5DRXB 1A4JB 4F37F 1FNSL 3LQAC 2HVJB 3HI6L 5GSVA 4P4RB 4LQFL 1JWUB 3P9WB 4ZTOH 3SBWA 5JQ6H 3GSNL 1I7RA 1XF5A 3S35X 5T3XL 1J11A 3M8OL 4P23D 1KIUA 4GO6B 1R3JA 1KNOB 3ALPA 2GTZB 3TJEH 3GFUA 3P77A 1ZV5A 3AAZB 3PGDA 1Q9KA 5AYUL 4DVBB 4Y2DD 1QA9B 1CF8L 3F7YB 3BXNB 1IAII 4UV7H 4NO0A 3VFOA 3ARDC 4NDMA 5SX4H 5FK9B 2DLFH 3OKLA 4ZUWB 1PG7L 4NM8L 2GK0A 2XXMB 4RA0C 3UTSB 4JHBA 4F8QA 1VDGA 1BD2A 3FB6A 4JPWH 5LAXA 4NJ9L 1GRWA 3IDYC 5T3ZD 4B5EA 1DZBA 3BYYA 3T09A 1EO7A 4PJGE 5JIIA 4PJDF 3QCVL 4WUKH 4KDTC 4TUOA 2I25N 2Z4QB 1D3CA 4G43B 5J1AB 1MCPH 2EXYD 4JFZH 4KK5D 5HYQA 4KVNL 4U2YA 1CFQB 1LK2B 2IALB 1FJ1B 2D31B 4KK6C 1KOAA 4I2XE 4PJBA 4OCXL 3SE3C 1LEIB 3U0WH 1IJ9A 3U46A 5K59E 3B9KA 4RWHA 1GCFA 4JFEA 5E1AB 1W0WA 1VEOA 4Y4HD 4LAQH 3OPZH 1IM9A 2ADJB 2V5RA 1D9KD 1JGLL 3ULUL 4PBXA 3IFNH 2KQMA 2OTPA 4FFYL 1A3LL 1HDMB 4L8SC 1ZVSA 2NLJA 5E99H 1RJZA 3ULSA 3AY4C 1YDPB 2ITDB 1F90H 9CGTA 1CTOA 3PL6D 4WHTA 2C3GA 3QXDB 3VFRA 4C57C 4P3WA 1RV6X 2R0ZH 2FL5A 5IEKB 3QUZD 5T1MA 3DX8B 4R9HA 1QBML 2RQ8A 5TE7L 3QG6B 3VFUA 4X6CA 3MCKA 5LGKA 4WV1A 3DLQR 5EH1A 2VXVL 1GPOH 4JKWA 4K3HA 3DV6B 4P2YA 1YJDC 4MXWL 1KYOJ 4WWKA 2VZSA 5T5FL 4NQUA 2NW2A 4R8WL 4X7SH 5BS0B 1XGUB 1GZQB 2B1AL 3HC0A 4OCRH 1NGWB 2OK0H 3VMPA 2NY2C 3RAJH 4LBEA 2OSLA 3RX7A 4TSAH 2M2DA 4NZRH 5EO0A 5BVJA 3Q5YA 3UTTE 5BMFH 4X99A 4DKEH 1UADC 1MSPA 3G04B 1MREL 5SX5H 1U9KA 1NFIB 3C60C 4FQ2L 1ND0A 1AC6A 1YMHA 4J6RH 3OG6B 1KCSL 4UUJB 5F21B 4KZEH 1UM5L 4WTXA 2VXSL 3TEUA 2P49B 4U1IB 4OD2B 4JFDA 4Y4KA 5EU4B 1SHMA 2OQJA 2PYEE 2V9RA 3VGAB 1SEQL 3LKRA 2A9NH 4NCC2 4L8BB 4P5TD 1U92A 4P4RA 2OMNA 1ADQA 1XF2B 1EIBA 2NXYC 3LEYH 3RY6A 4NN7B 4PJCB 2KZ1B 5CMAA 5EOCL 2QADD 5DS8B 1VGKA 1RIHH 4PJHE 1WIPA 3NABH 1KCLA 4R96B 3AAZA 4HKJB 4BZ1L 1E4KC 1FAKT 4HMCA 5JW4R 4JM2F 1B3JA 3BXNA 4MJIE 1H5BA 4HG4J 2GT9B 4WWKD 3TNMA 2DM2A 3F6LA 4GKZB 1VGEH 2J3SA 4OLZL 5MEOA 3VWKB 4X6DB 5I8CB 3FT4A 4H0GA 4M62L 1F4YL 2APVA 4JZOA 1YUHB 3WFBL 1SVCP 1UXSB 1NANI 1EA9C 5DHXB 2DQTL 5L88L 3UYOD 3JWDC 4YGAB 1I1FB 4L8CA 2F5AH 3A6CH 4OZFA 2YWYA 3QRGL 2P8LA 4NQXB 5L2KA 2HTLD 4ORZC 2YN5A 1XH3A 3HUJB 3B9AA 2J8UF 5TH2B 3VXSE 1WAAE 4NZJA 5J1AA 3PWLB 3E8UH 4OCWH 1A4KB 5F7EL 3MV01 4PJEB 4F15C 2D31A 4MWFB 4EDWH 1JWSA 3HI5L 4LLDA 2W91A 4LHUB 5AAWA 4JQVC 3V8OA 2AK4D 2K7PA 4A6YB 4HJJL 1QACA 4K3JH 2O93L 3MUHL 5I8EA 5E1AA 4Z95H 4L4VE 1A6WL 5DVNA 1RFDL 4LCIL 1AFVL 1JV5B 3EYVA 1CTNA 5E5RB 3RUGA 4CRPA 4YC2B 4WNQA 5C2BH 1PW3A 1HCVA 2VAAB 2XTLA 1FZMA 2JJTA 4D9LL 4E41A 2WBJA 4U0QB 5E0QA 3GSNB 5I76A 4TTGA 2FATL 1YDPA 1BF8A 1TETL 5F8RC 5BVPH 4YGVB 2E7CA 1X5ZA 2IEPA 3VA6A 3QFJA 1YEEH 4H8WC 4OGYL 3EOAA 1KTLB 1OY3B 2XRAH 3ISWA 4OGZA 5IEKA 3TYFB 1CK0L 3ULVC 4TYUA 1MJJB 5ALBH 3Q5OA 1FIGH 2VKWA 4PP2B 1UWEH 1TXKA 2XQBH 1IC4H 3MOAH 1KXTB 5DR5H 1MVUB 3MNVB 1IEBB 1N6VA 4RQQB 3GJFH 3SDDB 4M7JL 1CI5A 1CFSB 1NLBL 5I17B 4LRIA 5JDSB 5ETUA 3GNMH 4KUCF 3P4NA 1I75A 3OKNB 4MNQB 3LEVH 1RIVL 3PIQB 1OGAB 1V3MA 5CSZA 3G5VA 1N8ZA 3BKYL 2HJLA 1VPOL 5BS0A 2FX8L 3ZSTA 4XNQA 4XGZB 1IGCH 3BPOC 4B7LA 4CU6A 5D5ME 3VW3L 2DBLL 4X83A 5D7SH 2OZ4A 4HIJB 3RU8H 3TZVB 5EWIH 3KPNA 4K3DH 1XGPA 4LGRB 3RGVA 3PGFL 4ETQA 4BUGA 4J23A 4RMTA 4ZTOL 4KTYA 5JQ6L 5C0CB 4X4ME 2XKNA 2XWBB 2ICWI 5FHBH 5FDWA 2VH5H 3MXVH 4UUJA 2UWEE 2P45B 2WANA 4ZO9A 4OZHB 2V5SA 1OB1A 4PTUB 2QSQA 4CNIA 3BSZH 3MRFB 3R1GL 3U9UA 4GT7A 4O2FB 2ADGB 1E28A 4IDJH 4WW2A 1FNEA 3NCJH 1BVLA 4KZDH 4PJCA 3FONA 3HAEA 4GG8A 4UU9B 1I1AD 1J8HE 3MJ7B 5DS8A 2YA1A 3QCUL 2QQNH 3ZYIA 2X1WL 1CXKA 4HS6A 3SGEH 4EQ2A 1DSFL 4ZAKB 4BFIB 4JPIB 5KSBE 3MRMA 1A21A 3BPNC 2MQ3A 4YHYC 2UZXB 4PJ5A 5ADOH 2CLVB 4YK4B 4GW4A 3Q6FA 4YUEL 1UXSA 3DJ9A 4PJ8A 4RFOL 2DQCL 3WUZA 3G6JB 4A2MA 1B0GB 1DCLA 3RNKB 1TPXC 4JN1H 5KOVC 2OJZL 4WV1C 3WL9A 4JFFB 4LAQL 1OM3L 3VFMB 2H32B 4GQ9L 2NY3D 3MTRA 4LLUB 5I30L 4NYLA 2GCYB 2BOCA 3IFNL 4TNWK 4QOKA 5HY9A 4LP5A 1NGZB 3RX8A 2LAAA 4MWFA 5EU6A 1MEXH 4UT9H 1NGYB 1FL3B 3QUYD 3OGCA 3V5HB 4LHUA 3E6FA 3FQNB 5C08A 1BEYL 1T5XA 2VAJA 3DMMC 1DTUA 1QSEE 5EDXA 3WO3B 3M07A 4H1LH 4LLQB 5FA4A 3TV3L 1CYGA 2YD3A 2EZ0C 5D8JH 1FSKB 2R0ZL 4XB8A 3QDMD 4X5XB 3I6KB 1A1MA 5L0QC 1P4LB 1PKQA 1FH5L 4JG1H 1ULVA 2NY0C 4YGVA 5F9DC 3ULVE 4Y4KC 3KLHC 3MRBB 4F33B 3PWNB 2CGRL 3A6OA 4FHBD 1OP3H 4TPRL 5JW4N 1FFOB 5FM4A 1S8DB 4IJ3B 4BZ2H 5EO1A 3TYFA 3VXPB 1BOGA 5CIPB 1MCJA 4D9RD 5C0BE 1MJJA 3OXSB 4M9OA 4PJ8D 1I9EA 4UDUA 5MERB 32C2A 3IJSB 2AJZA 1NAMA 1DBMH 2WWKO 4NRXB 1J0ZA 4RQQA 5T1LB 2OK0L 2PO6B 4D94A 3PQYB 4XVTH 1FE8L 2A2QT 1CFSA 2Z92A 4TSAL 2BNQE 5DMGC 4NZRL 2R1XB 3O9WA 1LDPH 3NCEB 3HAEG 1T1XB 4XX1E 3DYPA 4DKEL 1YEGH 4EVNB 4MNQA 1IGJB 4GAGH 1NBVL 1UYWL 2R4SL 3KYOA 2BRRH 3TT3L 3C2SA 3L3HA 4XGZA 3VG0H 3BZEA 3HE6A 3TZVA 5C0AB 3BUYA 5HI4C 3GSOB 4JGMA 3SJVB 3PWUB 4NQCD 1ZTXH 4PJBE 3BZFA 2XWBA 5DZLA 3OSKA 2HT3C 2FECI 1T2JA 5KANI 1I3GL 3QEGL 1RIHL 1AIFA 4JFEE 4OZHA 1P53A 2BK8A 3NABL 1DQLL 4XBEH 1VHPA 4QY8A 2R23B 1AD9B 4ODVL 4ALAL 4DK3A 4OUUA 4U1NB 4HIXL 3K4AA 4M93B 1E27B 1B4JH 4FG6D 1I9RH 3ROLB 4CDGC 4KMQA 1U41A 3UTZB 5CEZH 3VU2A 1MCQA 2JJTC 4LHUG 3X3FH 1FL5A 2WBJC 3MJ7A 4PGDA 4MQ7A 3MUGB 2RJMA 4WY7H 3V4UH 5E2TL 4N0YL 3A6CL 1T1ZB 3O9WD 5KZCD 3PWJA 4BFIA 3M17A 1HH6B 1FV1A 1QLFB 4JZNA 1NGXA 3BDYL 4AEIH 2JCCF 2AJSL 5MP6H 4X6CE 1P2CB 2YC1B 2VLRD 5I74B 4U7KA 1GC1C 4PGBB 2J5LB 3VGBA 4LSQH 5KAQF 5EULV 3T2OA 4RGNB 1DUYA 3ALWA 1MAKA 4EDXB 3W82A 3BO8A 4Z95L 4I9WD 4OKDA 2NX5B 4KJPC 3V4VH 2H32A 1CL7I 1JHTA 2VLME 1IAKB 4JKLA 4ZFOA 3FOMB 2GCYA 4QYOA 2VJXA 4Z7UF 5IW3A 2O5YL 4GRLD 1NCTA 3BHBA 2Q87A 4M6ML 3ZO0A 3QWRD 4DOHE 4HGKC 5TE4H 4D2NA 4LASL 4IRJA 5BRZB 1J10A 2ADFL 5GS0C 4YHOL 2QR0A 2R69H 2XRAL 1KELL 4ZOBA 2HLFC 3RGVC 5IHBA 5JOPD 1FDLL 1F6AB 5LWYH 4JFDE 1N4XL 2YS4A 5ALBL 1LP9B 5DJ6B 4ZQKA 1P4LA 3B8SA 1UWEL 5DXWA 2XQBL 3NA9L 3CFBB 4PJ7B 3RIFF 1RJYB 1FVCB 2A38A 2A6DB 2AS5M 3SCMA 5C0GA 3ELAT 4F33A 3WKML 1E4XI 1FZOB 1F00I 3H42H 2AXGA 3QB7C 5DDHA 3GBNH 3GNML 1S8DA 5IK3A 3VXPA 3LEVL 4JFPB 2EDJA 4NM4H 3OXSA 5E4EB 2CJUH 1DQJB 2EDRA 1DP0A 3MOBL 3CNKA 4NN7C 4ODTH 1DBBL 3TFKD 3MV7A 1RUKH 2JIXA 4UT7L 1IGCL 4POUB 4V2BA 2PCPB 5D7SL 1C1EL 1NL0H 5HHNB 2PO6A 4X9HA 3BD3A 2X4TB 5L9DH 4K3DL 3IU4H 4Z7OE 1T21B 5ILTL 4R3SB 3UTSE 5B21A 1W8OA 1DBKH 5IFHH 4EQ3A 3VWKC 5IQ9B 3Q3GA 3DGCR 4I18A 5L2KE 4RSVA 2QHRH 4U6YB 4IRJD 5D9SA 2NTSP 5HYFA 1N0XH 3T65B 2B7DT 5D7LA 3BSZL 4FABH 3P9MA 5CJ8A 3TWCH 3ESVF 5SV3A 3SJVA 4QHUB 4G6FD 3NCJL 2P5WA 5E4IA 3QULB 4FQIL 1UCBH 3S7GA 3CDFA 1P7QD 4YWGH 3VXTA 4XPTL 3L3DB 2OX5A 3GB7B 3LB6C 1GGIL 4PRIA 2EDNA 5DRWA 1QFWM 1HH9A 2BSED 4QWWC 4AT6A 4ZUUA 3ZKMD 3GRWL 4HGWB 3SDXB 1CR9L 3RUGE 3FHQA 4E41E 5IKCB 3C2AL 1G6VK 1KPUB 2NY5H 3D18B 1MHCA 1E27A 5BJTB 1OOAA 3ROLA 2FJHA 4YC2C 5FYKE 3UTZA 1P7KB 1U3HB 2F54A 3ABZA 4PRHB 4NHUA 2DLTA 3QFJE 3LV3B 1KJ2H 4P4KB 4LSTH 5E8NA 3P0YL 2OI9B 3QQ3B 4KI5C 1FQ9C 5I2IB 3WE6A 5IFJA 4JY6A 3K81A 2BSSA 3LH2L 5IHZB 2YPVH 3FN9A 2AJ3A 5HGAB 1T5WA 2YC1A 4PYGA 3GMRA 2XZAL 4LF3B 2L4OA 2KZWA 4FTVA 4QHMA 5TDPB 1I85A 3VXUD 1H15B 4LCYB 3EOTL 5DJXB 1QQDB 4NNPL 2EDXA 3SDDC 4EIGB 2HT2D 4OAWA 3RL2B 4YBQD 3BP7B 3LY6A 1TZGH 2A83B 4N0CC 1HK6A 1IAKA 5D8JL 2HAZA 4ERSH 4XBGB 5BS0E 4Y8DC 3BQUB 1NEZA 2VL4A 5DJ0A 1JWMA 5AZEL 3QWQB 4JJ5B 4HS3B 1A6ZA 4JG1L 4ONFH 4P5KA 1U6AH 4MSWA 2XN9A 3WEXA 1N3NB 1FZJB 3HE6C 4AL8L 3TZVC 4XC1H 5CBEB 3T77B 4PJXF 2FH8A 5I1CH 4OUOA 1F6AA 5JHDA 3TBYB 1CGYA 3FQXA 2IPUG 1K3ZA 3KPQA 4NQSA 4PJ7A 1A7BA 1VB9A 4JDTH 4XNYH 2A6DA 5K9JL 3QUXB 1VFBB 3O3DA 3CUPA 1KTDB 4L4TD 4KKBD 1NMAL 4PJCE 5I1AB 1C5CH 2ZNWA 3U6RB 3ARPA 2W38A 4K7FB 4ODWA 2VXUL 5C07D 3TVMB 4EXPX 4EI5B 4JFPA 5IF0A 1U8KB 4U1HA 4GAGL 1ZSDB 3F5WB 1QR1A 4OLUH 2BRRL 3C8DA 3KNBA 4N90E 2O5ZL 2PTVA 2X4TA 5C1MB 2LV4A 1GGBL 4X6DE 4S0SD 3LRSB 3FO1B 1X4ZA 2FSEA 4R3SA 1JHLL 1YY8A 5CD3B 5F3BA 1BIIA 3LDBC 2XN9D 2EXWC 4YK4C 3UO1L 1JL8A 1PEWA 1NDGA 3CPLB 3TPKA 3TNNB 3FCTB 4KKAD 3HUJE 2ADIB 4GLRH 3VRIA 4GFTB 4IHOB 1J1XH 2BVOB 2HFTA 3MRKB 1ITBB 1JMXA 4Z76B 4LCWB 5JHDD 4QHUA 2BVQA 4O2EA 1B4JL 3ARFB 2FWOB 1I9RL 5GZOC 1JZ4A 1CDGA 1NJ9A 1U8PA 4JCLA 4P9HL 3O3UN 4DKAA 5HHQB 3SGKA 3RVXC 3QXTA 2DICA 2QTEA 4PG9B 5F7UA 1B90A 4JFHD 5IKCA 3QJHA 3GM8A 1BP3B 1N7MH 4QRPA 1NEZG 5T3XE 3D18A 1FVDA 3BW9A 1LD9A 5MP6L 5EBWA 4KI5E 2DKSA 3K80A 1FSKC 4FMKA 5F9JA 1F3JB 4BKLB 2PYED 4IOIA 3DO7B 1JCKA 1IAMA 1CICB 2J4WH 4P4KA 4P2CG 2JF1A 1NC2B 1E6OL 5KW9L 3SE9H 5CLTA 3SCMC 3JWOC 3V4VL 3K8MA 3TESA 5DFTA 1HXYB 3S35H 1GOHA 4MAUH 5GS1B 5EZOH 3CVHH 4U3CA 4MAYB 3IFLL 3QIBB 1JFQL 1WWWX 3H9SA 1R5WA 3UYPA 4MJID 1NCNA 2UUDH 3WS3A 1CLYL 1CN4A 2YA2A 5TDPA 2CDEB 5TE4L 3BN9D 1L0XA 5CJOH 2CIIB 2MQCA 5FYJD 4MNQE 5INCA 4QHKJ 2PO6C 1OGAE 4QEGA 5E9DB 1RZ7H 3RL2A 2DQHH 3D2UA 1R5IB 3V8CA 1BFOA 3NFSH 2X41A 2E6QA 4HPOH 3VGHA 1SEBB 4HV8B 5FKAB 1X5IA 3AS3A 2VLKD 3P30L 3FB7B 5KG9B 1XGRA 1FZJA 3KPSB 5C0CE 3SN6N 5CBEA 1PY4A 3PDOB 3GBNL 5DGQA 2Z35B 3CH1A 3CDCA 4S0TD 2EDKA 4OZHE 1T2QH 3D25B 4JRWA 5FYLD 1T3FA 1X6NA 3DI3B 3TBYA 3HR6A 1U8QB 4OLVL 4NQDA 3CX5K 5DD6B 1RUKL 2HTKD 4Y1AA 4LVHB 1NKOA 1BLNB 1WCQA 1IC5L 3LPFA 3IU4L 3U6RA 4K8RC 1JGDB 2X4UA 1WSST 5DTFA 3TVMA 4KJWC 4M93C 4S2SB 1R24B 5CWSB 1ZSDA 2B39A 5IFHL 1DUZA 2GKIA 5ISZB 4CMMA 4QO1A 3MRNA 5I71C 2DYPD 2QHRL 3KPRD 5F9OL 5CJXA 1OD9A 4JQXA 2HJFA 5ERWB 5F7YC 2H2SD 3P4OB 3D2UD 3G9AB 1V3KA 4FABL 1NDMB 5LQBL 4JHAH 3S98A 4F7PB 4WCYL 4H1LB 5IVNA 4PJGF 5H35B 4J3XA 5MENB 2X5PA 3EYOB 4C58B 5GS2D 3N1MC 2WBWB 3T08A 3T2NL 1UCBL 3DHJA 3G6JE 5T1KD 1WBXB 4G8IB 4YFEA 2ZG1A 1JK8B 4JFFE 4OSUH 3CPLA 5CZKA 3TNNA 4U1SA 2YKLH 5IB1A 3FCTA 3CVIL 4HK3J 5ACZB 4IHOA 2BVOA 4M00A 4QGTA 3ZYZA 5GJTH 5K59F 1WT5C 5F97E 5C7XH 4Z76A 2PF6A 2NY5L 5FA3B 1EHAA 4UB0H 4TSBH 1JHKH 3ARFA 3MRLB 4NQDD 3F58H 4I0PB 2CLRA 4C83A 2X42A 1BFVH 4KROD 1M1SA 4YXLH 1S9XA 4HW6A 1UVQB 4XCEB 1FBIL 2ZUXA 2VQUA 1ZGLB 1P6FA 3MUZ1 4QXTA 3GJFA 5F1KC 4P3DB 1A1OB 4Q9QH 2AERT 1MPAH 1KJVA 3E2HB 1QUNA 5FECA 1X6LA 5IHUL 3U36A 5L6YL 5L7XH 1F3JA 2BVPA 1AXTL 3DO7A 3DRTA 5F7MC 1NC2A 1TJIH 4ZFZB 4HIIB 1UFUA 5J06A 2ZOLA 3VFWB 2RAMA 3PV6B 4Z7WB 3SE4C 2Q7NA 4YR6A 2W65B 3JUYA 1J8HD 4ERSL 3MV7E 3BRFA 2HH0L 3LSOB 1XIWA 4XPHH 3ESUF 4WI5A 4UIKH 3QIBA 3PQYE 5E4EC 3HS0B 3OKYA 2N56A 3RL1A 5IBUG 1JPFA 4ONFL 3GBMH 2CK0L 3WYRA 3IJYB 3TBVA 2NY1D 3QR2A 4YE4L 1GAFH 3MZTA 1Y18A 3MLRH 5F7NC 4Y2OA 1P9MA 3PP3K 2QKIA 1NC4A 5CHNB 4RGOH 3V2AR 2GJZA 4P2RB 5D7LE 4XMLH 3QDJB 1CE6A 4MXQC 5KG9A 4JDTL 4XNYL 4FFWC 3B8YA 3SJVE 1A7NH 3QO0B 2P5WE 3KPSA 1F11B 1MI5B 1QTYT 1MQKH 2XTJD 3P3YA 2DN7A 3PG2A 1IM3B 4ODUB 1X4YA 4GBXB 1A0QL 3DUSB 4XZUA 4PV8B 1FN4A 2A6KB 1MHHB 3S88H 1MRDL 2LABA 4ZXBB 5J11B 2F53A 1U8QA 3HB3D 4OLUL 5DJDB 3DSFH 5D7JD 2R1YB 4PJHF 5F6HJ 1S7RB 2FZ3A 1ITCA 4HCRH 3S6CA 1U8JA 1ZMYA 4P9MH 3SGKC 3OAYH 2WWKT 1XIWD 3L95A 3MRJA 1NCWL 3MQIA 4KTDH 4P48A 2F54E 5D7IA 3FO0H 4IRSA 1UEYA 1SYVA 4XNXH 1K8DB 3QEUA 5ISZA 3X11B 5JW4M 3D3VA 4D0CB 1T1WB 1MCNA 3ULVD 3V6FB 2AQ3A 1U3HC 4X6BA 3QPQC 3S36X 3O2DL 3WDIA 1CFNB 4P4KC 1MVFA 5C0RH 3MCG1 1J1XL 2OI9C 3IDIA 3CSPA 2GITB 4LLMB 5IESH 5TE6H 4ZUTA 3O3EB 3OHXB 1WAAF 2D0HA 3RWDB 1WBXA 3SGDH 4P57A 2DKUA 5DJZA 2FO1A 1C5BL 2X89A 2V2TA 4QRTB 2NX5E 4U6TA 3V7MA 4MD4B 2NCMA 3RTQD 4HLZH 4NUJB 3BAEH 2ZKHL 4H20H 5M94B 3DHMA 4FRWA 5HD8D 4BH8A 4QNPE 4CMHB 3BKMH 1TCMA 1T03L 5CGTA 2P8MA 5JOEA 3REVA 3N1QC 1SM3L 3BQUC 3BH9A 4G9DB 2C7UA 4B41A 4N9OB 1HHGB 5CEXB 4LAJH 1UB6A 2X1PA 1DFBL 3H0TB 2Y7QB 1HNFA 2GJ6D 3SE9L 4ORGB 4ZUSB 4IRSD 5BXFB 3WNOA 5B4MC 3S35L 4PJ7E 4OIIL 4RFEB 3H9ZA 4MAUL 4XRCB 5FHAH 1MJ8H 5EZOL 3CVHL 3FAWA 4ZPTB 1FVEB 3W39B 3WD5H 4DUWA 4PJFB 4MJ5B 1ZVYA 2GUOA 5IEHA 4Q6IA 1WVZA 1OQXA 5DRZA 2HFFA 4FQXB 4BFEA 1A3RL 3QUXC 3B2VH 1K3IA 5DC9B 3VFWA 3PV6A 1RZ7L 5GGVL 3KYMB 1Y6KR 1AXIB 5FV2A 4LPUA 2WUCL 3UC0H 3IT8D 4HFWB 2FBOJ 5EU3B 5FB8A 3TVMC 3C5JA 4JDZB 4HPOL 4F8TA 3SGJC 1RU9H 2W60A 1HCFX 1MLCA 3ZE1E 4I3GA 2FO4A 4HDIA 5D5MF 4DQOL 4JQXC 5ICYA 3HPLB 4FZEH 1Q0XL 2X7LA 3QDGA 1DLFH 3SPVA 3H3PH 4ISVB 3UDWC 1I7ZB 3QXAB 2EDTA 5BV7L 4LVOB 1JGVL 5IVXA 1IAIH 5J7CC 4YIQB 1N5YH 1C5DA 1CE1L 2UWEF 4PBVC 5TJWK 4H1LG 3QO0A 2C1PB 1RIUH 2R2HA 2R29L 3RWJB 4K71B 4OB5H 1KBGL 4ODUA 4DWHA 4GBXA 2VQ1A 3DUSA 4KK9C 5E8PB 5C0DB 1PZ5A 1QRNA 2EZ0D 1NLDL 3ARFC 1S7SB 2CDFB 4N1CA 2H41A 2YXMA 3NZHH 3V0WH 4POZD 3SDXE 3AREB 5L2JA 1XGQA 4JY5H 1A5FH 5LCVH 5IFAL 4KMLB 3V6OA 3Q48A 4HK0B 4AH2B 1NFDB 2ESVB 2NY0D 3BVNA 4K94L 3GMNA 4D3CL 5DD5L 3BJ91 4JFOB 2BOBB 3HMXH 4PRHE 5KSBF 1G7MA 4HQQL 3NFNB 3D87B 4TNVK 4HT1L 1QFWI 5TPWH 3X11A 1RZFL 5HDLA 1T1WA 1GH7A 4FQCH 4Q9RH 2QQLH 1CICC 4F7TB 3ALXA 3A0OA 1CFNA 4XAWH 3TIDB 4I4WB 4D8PB 3HA0A 1CU4H 1TJGH 5C7XL 1NAKH 1KJ3L 5E2JA 3MLSH 1INQA 1LVEA 3P40A 4JO2L 4L8DA 4UB0L 1JHKL 5DMGD 5J3HC 1BM3H 1PBYA 3MRPA 2W92A 2GTWA 5GS1C 1JUFA 4PB9L 2VERN 1E6JH 4MAYC 3QIBC 5IW1B 3VD7A 4KTEH 4NUJA 1WEJL 3KPMA 3TBWB 1WFOA 3BPCA 3UTSD 3WJLC 4X6FB 3LRHA 1H0DA 4Y5YA 1MPAL 3ZKSD 1IZKA 3SDCA 1GSMA 5LJYH 4ODSL 4PGEA 1JI1A 1C16B 4Y16B 1F02I 5DJYB 3MV11 4TSCL 3GMPB 1U58B 2JELL 1HSBA 4Y19B 3H0TA 4W6XB 1AQDB 3KLAA 3ILPA 4JRXB 3ULVF 5BXFA 3OKKB 1JPGB 2M26A 1AD0A 2CO7B 3LQZB 5DK3A 4Y1AE 1P1ZB 4XPHL 5D70H 3ARGB 3GJEB 4WUUA 3W39A 2Y06H 1Q94B 4W81A 4MJ5A 2UY7A 2W0PA 2E7BA 1PY9A 5MI0B 2AEWA 3QG7L 5E2VL 5GXBB 4G8FA 1NEUA 1PSKH 1PJ9A 4QRUB 4PJIB 4LVHC 2R0KL 3KYMA 5HHPB 2ZCLH 3MLRL 1R0AH 2CUHA 3DETD 2I07B 3RWEB 5L8KB 4ZPVB 4RMRA 1K85A 3U1SH 5A40E 3TIEA 5TDOA 4MDIB 1J05A 2ED7A 1CBVH 1KXQE 4ZFGH 4LLAA 3F7PC 1DQQA 1Z5LA 3FQWB 5DQDL 4OQTL 3O4LA 3QXAA 3K2UH 3G5YA 4AMKL 1GGYA 5JXED 2IH3B 5EZLB 3KHOA 2A6IB 1EERB 5IR1A 1A3QA 1KJ2A 4LCWE 1ORQA 5D72H 4MJ6A 2SEBB 3BFOA 4U31A 3T0DA 3FT2B 4H88H 3ZT7A 3DECA 4DN3H 3DVNB 4YPGA 3BESR 1H3TA 1T22A 1ZS8B 3BP4A 4KTDL 5HYSA 5JQHC 3EO0B 5GS0D 2AGJH 3LHPL 4XNXL 2VABB 3CVHB 3CFEB 4I3SH 2N7BA 5LXGH 3WHXA 5GZNC 4HC1H 5C0RL 3KDMA 2AKRB 1WC7B 1NFDA 3AVEA 3D6GA 4PTTB 5CINH 3FO9A 5FGBA 3HKFA 2V9TA 5GRWA 3RZCD 5TE6L 2R4RH 4U1KA 4JDVB 2PTUA 4X6CF 4NSKA 5KJRL 5TGBB 1I1YB 3TYGH 3KVQA 4UIMB 4F7MA 4Q6IC 3I50L 3BAEL 5EZJB 3OKDB 2Y25A 3EDKA 5DD3H 2EE9A 4N9GA 1NBYB 4MB4A 5I9QB 5C3TA 3EO1B 5EUKB 4J3TA 4QRRB 5BV7B 4UBDC 5DRNB 3C6SA 4U1JA 3WUWB 5I6XB 5E9DE 3VWKD 5CZXD 2UYLA 3HPJB 2BSRA 4MLIA 2OYPA 5KSAA 2ZJSH 4X6FA 2XG4A 2YK1L 3VXOB 1YY9D 4JE4B 2EC9U 4LSUH 4MXVE 5F8QC 1X7QB 5TF1H 5LVEA 1YNTB 5FHAL 3RVTC 5IJVB 2CDGA 3D0VB 3PGCB 2H26B 4XMPL 5EOTB 3NH7L 3GHEH 1LO4L 3KPSE 1FYTD 4R26H 2OR9H 2X4PB 1VFOA 5IMOA 1ES0A 5E00B 3C5ZA 3CDYA 4Y4FD 3QQNA 2A77H 4HJ0C 2FGZA 5I1IH 4JRXA 4LSVH 1J5OH 1AO7B 3CSYA 4G8GD 4BUHA 1JPGA 5B22A 2AV7A 2F53E 5GGRY 1XF3B 1W0VB 4GBXC 3SQBA 3GJEA 5GIRB 1I7TA 3RWHB 5J11C 2JJVA 3VXNA 4J4PA 2VC2H 2CRIA 4MCYB 1INEL 2Z93A 1OF2A 5E8OB 5HYSG 3QA3B 2ENSA 4KI5D 4BFBD 4FZEL 5HHPA 1DLFL 4RMUA 3DXAA 5ISZE 4U2ZA 3D3VE 3H3PL 5SWZA 5SWQA 2AJYH 4Z7OF 3B2UC 3RWEA 4JKMA 2RFXA 2DD8L 4OLWL 2ZSVB 4XBPB 4C56D 2P47B 1DL7H 2DQFB 5BZWB 3RWGB 1N5YL 1MHEA 2J8OA 2I9TA 1UWXK 5DD1L 4N68A 3V52H 3MR9A 3ZE0E 5MENE 2LE9A 4CUCA 4NO5B 2WP3O 1I1CA 3PDGA 3TBSA 3FQWA 1EHLH 5FKPB 1S3KH 3CK0H 2YBRB 4OB5L 4ZFFA 1O0VA 3DURA 4G6KL 4EN3B 4NZTH 5H37H 3AC0A 4OZ4A 1BJ1H 2A6IA 1EPFA 5HYJB 4HS8L 5CP3H 5KVFH 4JY5L 4LLYB 3BIAX 3OJMB 1OGAD 3RIAK 1S9WB 3OJ2C 4CADB 2DLGA 1CZ8H 1T89A 1MLBA 3BDXA 3QH3B 1CVSC 1TNNA 4XH2B 4Y5YC 3X12A 4ELKA 1ZS8A 2KDGA 2NY4B 3LEXB 1NGQH 3U2SB 3EO0A 1N59A 4CMHC 1X4XA 3BPLC 3BKJH 2VITA 3QYCA 4O2CB 5FCUH 2CSPA 3I3BA 1MWAL 2DI8A 3HE7B 3ULUD 1FCCA 2QQLL 4ZO7A 3WJJC 2BC4B 2XZCL 4XAWL 5IW6B 2AKRA 1WC7A 3MMEA 1LO2L 3K2MC 1N2RA 4ONHB 1CU4L 1HKFA 4NNXB 5IB4B 4W6WB 1UM4H 1NAKL 1WUNT 4OKVB 3MLSL 3DGGA 3F7VB 1JVKA 4ZYKB 1OT2A 2B1HH 3K3QA 4GAFB 2R1WA 5DHYB 1NMBH 3AXLA 5KTEH 4JREC 4F57H 5C0JA 1I1YA 1JZ3A 3V7AG 3DBXA 4Z7WE 3WLBB 1JBJA 4L3CA 1HHHB 4G6JH 2COQA 5C92A 2M1KA 2H45A 4APQB 4FQXC 5F7DA 1VKXA 3SQOL 2V2XB 1KJMB 4FQHA 4EUPH 3AB0B 2AJUL 2WW8A 4ZAKD 3ILQD 2P5EB 4NN6B 4IMLB 1LEGA 4PR5A 2O26U 3IETA 1ACYH 3T2PA 5EZIH 1MFEL 2YWZA 5GGTH 3WUWA 2VNCA 4WW1B 5FO7B 4U6HA 1L6XA 3O2VH 2R56L 3QDGE 1TVHB 2EYRA 1OP5K 5D7KD 4JHWH 4DZ8B 4GXUN 2HFEA 5I1HL 5IVXE 1QKZH 5F89B 1B0RA 4P2RE 5CEZE 4QT5A 3RRQA 1KYOK 1NCDL 1QVOA 4IRZH 3TN0B 1U8LB 3QDJE 1T83A 5D70L 2NY5C 4JFFD 1Z0NA 4JM4H 3PGCA 3DX6B 4LVOC 5EOTA 3WIIL 4XXCA 1L7TH 2DQGH 1MI5E 4WTWA 4CVUA 5E00A 1PSKL 5EPMA 3RWIB 5K9QG 1MRCH 2PW1A 4M7KL 4XI5D 1AO7A 3V0VB 2ZCLL 1K2DA 2NXZB 4PJCF 1AI1H 4K71C 1CWVA 2KPNA 5GIRA 3AMKA 3I84A 1WICA 2QBWA 1AGDB 2H6PB 3RWHA 3B6SA 3AREC 5D6CA 4RMQA 1X5AA 4KY1L 2CQVA 5CZVH 4ZFGL 4GAYB 1QSZA 2DOCA 3T8XA 4JR9H 1U2CA 4X6DF 2L0DA 4L3AA 1U0QA 5E5MA 3K2UL 3EAKA 3RI5F 5ITBH 2BCKA 2WINA 2ZSVA 1KLGB 2DQFA 1ZE3C 3T1FB 1AE6L 2GEEA 3UBXA 4JKPH 4OM0H 1YQVH 1QHOA 4GOSA 4LIQH 3MROB 4EEEA 4NWUL 4NJAL 3ZL4H 4UQ3A 3HUJF 3H9HB 4HG4K 4DN3L 5JLZA 3VRLE 5T1LD 1HILA 1UH2A 5JO5A 2ZCHH 1RHFA 3O6LL 1FIEA 3PDDA 4I3SL 2MSPA 3S34L 1EK3A 1FFNB 2ARJQ 4MJ2A 4LARL 1OWRM 1I7UB 4MVBD 5KS9A 4F3FA 4HC1L 2V17L 3THMH 3QH3A 1JZ2A 1SY6L 4FZ8L 2Q8BH 1JGEA 5HVHB 5F9AC 4K7PL 3C6LD 5HTSA 5HI3C 3WUWG 2MHAB 5C0AD 2R4RL 4HUVA 2DF3A 1R3KB 4FQLH 1H8OA 3NPSB 4K3EL 4KI5F 4O2CA 5BW7C 3U0TA 4GJTB 5JR1L 1TTUA 3HE7A 5JHLH 2Y4SA 3C8HA 3RWFB 2A1WH 1NSNL 4BQCA 5JMRA 3RPIA 5IW6A 1KSRA 4AM0A 4ONHA 4NNXA 1D5BA 2G2RB 4WUUE 4XCNB 1WFUA 1J0HA 5JW3H 2GSGB 1MH5A 1Y0LA 4PJFE 1HKLH 3IFOB 4NQVA 3F7VA 1MHPH 2R9HD 1GGTA 4X7TB 4Z78B 5HYEA 3EYFA 3PWPB 2Y36H 3OJDB 2VLLB 3QIUB 3I9GH 3WLBA 1HHHA 3QNXB 2YD5A 3KG5A 4YBHA 5MI0C 2XYCA 4APQA 5IBLC 4HSQA 1KJMA 3JXAA 4LSUL 2IH1B 2VDRL 3B4NA 4QGYA 1A6TB 3QUMH 4IMLA 3IYLW 4PRAA 2VQTA 5EOQH 5T33L 2FX7L 5D1XB 2WWMC 5D1QA 2F8OA 2G75A 4JFYA 3GHEL 4H5SA 3R0NA 3PV7A 3SKOA 1X9QA 2JJSC 4H0IA 2F19H 1WF5A 5FO8A 5ENWB 5I1IL 4HCRA 2G9HB 1KCVH 2PYFB 3J8F7 2XWJB 3MCLL 4G80B 1F8TH 4RGND 3WSQH 3QDAA 3WLWD 4P46B 4WO4A 3UBXG 3TN0A 2DM7A 1CGWA 1YECH 2DQDH 4V2CB 3F65A 5F6IB 3DX6A 1S9VB 4OZHF 3F62A 4HH9B 1SJHA 3MV9D 5CP7B 1KLUB 5JORB 2JB6A 2BY3A 3EZ8A 3MFFA 2VC2L 1FYHB 2ED8A 5IG7B 3L1OH 4GSDH 4PLKC 4WVRA 5ESAB 5EORH 5DJCA 4KK8D 2Z31D 3C5SA 5IMLA 3DO3A 4NO2A 5CCKH 5BRZD 5IT2H 5GGSA 1KEGL 3IDMB 3UAJC 4PBWD 1VFAA 1CDYA 3W0WA 3U0PA 3HNTL 1NFDE 2ESVE 1DVFB 2GAZB 1O5DT 5GGUB 5E24E 2IMNA 2FEEL 4GAYA 1A14H 4LNRA 1G7PA 2HRPH 1FFQA 3CU7A 4IOFC 5GHWH 5C09B 4QLRA 5IB2B 4LCCB 3OKEA 3QO1A 5CJQL 5HGBB 1YNKL 4TUKH 4P2QD 2HT4D 4Q0XL 1RUPH 1KLGA 2C1OA 4OZIB 2FHBA 4OF6A 5K93A 3G6JF 5KVFL 1BZ9A 5A2IH 4FOMA 3NCMA 3KJ6H 3QHFH 3V5DA 3ZMRA 3KLSA 1IGTB 2BNRD 2X4SB 3W9EA 3WHE1 3EOBB 4MDJB 1OP3K 3QPXL 4H25A 2FBJH 4BELD 4Z0XA 3PF2A 1SJEB 4YFLI 1NGQL 4I1NB 5TDNB 1TIUA 1Z3GL 3IDGA 4JO4H 4J3UA 5I9QC 4UILL 3L3KA 2IQAB 4WFFE 4O4YL 4TUJA 3DYMA 1ZLUH 5C0NC 2CLZA 1BBJB 2HJKA 1RZ8B 2WIIA 4LSRH 5BV7C 5I6XC 3OV6A 5T3ZH 2EC9T 3SDYH 2IBZY 3FQTA 1S5HB 2VLJB 4MXQD 3GSWA 1BAFH 4J3VA 3GSXB 4FFWD 3MRDB 2CK2A 1VADA 2VKXA 2FHFA 3GO1H 3BZDA 3LKQA 5E2WL 1MCWM 2NZ9C 3OB8A 1CLOH 3B9DA 4HKBB 2B1HL 1EHNA 3RQ3A 2R15A 4Y19E 5I15H 5JIPA 5KTEL 5D93B 1T83C 2W0FA 4YHPB 4JRXE 3B9EA 3V7AE 1GZPB 1A7RH 3QI9B 1FL6B 3T1WA 4M8QB 4G6JL 1OARL 4YHIA 4G6AD 4WGWB 4WFHD 4HJGB 2GSIB 4MD0A 5IIEA 4JPKL 1HSAB 2HP4A 5I16A 4X7TA 3PWPA 1ACYL 4ZDHB 1FHGA 3BMVA 3JVGA 2VLLA 4PJIE 4DAGL 2VDMH 4OFVA 3K0WA 3IAPA 3QNXA 4NKOA 4MLSA 3I6LE 2XA3A 1YYMH 5EB9A 3MJ8A 5SWZE 1U3HD 4PRHD 3QPQD 5F1NB 3EJZC 5E95B 4Q74A 3PHOA 4RAUB 3Q6GH 4JG0L 2FD6L 4M61A 4LVEA 2HKFL 1UWGL 4GXVL 4X5WB 3PP4L 4RBPK 5B8CB 5EIIB 2B2XH 2DQGL 4HLZG 4RDQF 3S36H 1D6VL 4OJFH 4F2MA 1A7QL 1MRCL 4QRSB 4RZCA 1MCFA 4IMKC 4C55A 2BMKA 2DM4A 4Q2ZB 4BSWB 3HCVB 4XWGL 2EKJA 3HMXA 4O02L 3RDTB 1K5NA 2C3VA 1T1YA 4HPYL 4EN3C 4XMKL 2DJUA 4HH9A 3WIHH 2Q7YA 1OAYH 1FRGH 4PRNB 4NGHL 1JTPA 5CZVL 4IEFB 5ESAA 3RX5A 3AGVA 3RHWF 4MQTB 1S78C 4HIEB 2J88H 1D5MB 1R5VB 4NQTA 3OGOE 2IPKB 4NKQB 1OTUC 2NY4C 3HNSL 3IDMA 4XC3H 1JF5A 5DSCA 5L8LB 3MRHA 4N8VB 4Q7DA 1U91A 4ZS7L 3IDNA 1R3LB 2XIDA 3SKMB 4Y88A 5J6HB 4LIQL 4