4X98A

Immunoglobulin fc heterodimer variant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A01
2FZ3B 4CU7A 5ESQB 1SY6L 2VL5A 1JIBA 5DJYA 5TDOB 3QEQB 1K3ZA 2FX8H 1ACZA 3B3IA 1Z9MA 4JO3H 1XF3B 4PGDB 2NLJB 1JYVA 1MRDH 3GMLB 3NGBB 2PO6A 5ICXB 1UZ6E 4D0DA 3PABB 4GUPB 4RGMC 5DEFB 3QDMA 4ZS7H 2WP3T 1WLHA 5KSVA 3FHAA 3WDIA 5I0ZA 2D7NA 5BRZE 2X2YA 3ECBB 3SKMA 5E8OB 3ROOA 1ZA3A 4JO1H 4OF3A 1CT8B 1R3JA 1AO7E 5MEPB 5CJ8A 5CMAB 5T1MA 3IFNH 3ILQC 1KTKE 1U8OB 3BW9A 3EIFA 2X05A 1VEMA 3MLYH 4O02L 5F44A 3OKNB 1JGDB 4JPWH 4RMUA 5HGDA 5C09A 3NTCL 4QXGH 3VI4F 2A1WL 4Y19A 3VXRB 5E1AB 3PG2A 3GJFK 4PJBE 1Q1JL 1XIWA 4IRSB 2BDNH 3ARTA 3BKML 2C5DC 5I1HH 5FO7A 4LSPH 1NLDH 4ZUSA 4P59H 1GYAA 15C8L 5BCAA 1JMZA 1EJ6A 4ODHH 2WBWB 1JI1A 1RK0B 4G7YL 5KAQF 3O11A 3QDJD 4XI5D 3SDCB 4HGKC 2Z35B 1A6WL 3HG1A 1RJZA 3IJSA 4ODWA 1S9XB 3AY4A 3OR7B 1LO4H 1C16A 1I3GH 4FZEH 1XFPA 5H37G 5BOZG 1MREH 4XBPB 3NZ8A 4BA8A 4OF6A 5DD1H 3D25B 3U48A 3UTSD 5FOBB 5E8NB 4PLKC 4D2NA 4LAJH 2KQMA 3SDDC 1IL1B 4JDVA 3DRQB 2AAVA 5C0JA 1N6UA 2OP4H 2H26A 3B9KD 5ADOH 2H45A 3CXDH 1CDHA 2NY0B 4PJXE 3OKEA 4JY6B 4D0BB 1YMMB 4Y4FD 4WEUD 5DD0L 4P57A 5DQJB 2EXWC 2XKSA 5DO2C 2AEWA 4DKEH 1ZA6A 3GBLA 4M7ZB 3ILPA 5CJ5A 5DS8A 4ZXBB 1T21A 2OL3H 4FQCH 2ARJA 2YUXA 3CFBA 3LH2L 1LQSR 1MCQA 1CXKA 2YA2A 3NOIA 1RZFH 4DOHE 1P84J 3B9DA 4LRNL 3V8OA 4MA7H 4LP5A 2OR7A 1R3LA 4ERSL 4UV7L 5KS9F 2CH8A 4HIEA 1DQJB 1DDHB 1KF9B 1VGKA 4OD1L 1A4KB 3R0NA 5IW3A 3VFSB 3K2MC 4JVUA 5TGBB 2J4WH 1FIGH 4KJPD 3QXAB 2NY2B 4ZO7A 2I9TB 3CVHL 2CLRB 1EFXD 2YZ8A 4X5XB 4GG6B 5EN2A 3WFZA 5HHXH 3BN9D 3CVHB 5EU7E 2IALA 1BVZA 4LSDA 4NZRH 1LDPH 2FB4L 3E6FA 1V3KA 1FG2B 1OY3B 1AGDA 1QFUL 5D7SL 2FO1A 4KK9C 3MV8D 5C0AA 2H2PC 2AJVL 5DMKB 5DWUL 3DOSA 4OGZA 4PRHB 4FXKB 4I0CC 4G7VH 4YK4B 1MNUL 4DZ8B 3WFEH 4G9FE 5EWIH 2VL5B 4PB9H 2V2WA 4HKBB 2C3HA 5L2KE 4JANB 4RNRB 5JOFA 1QBLH 4PGDA 5DFWH 1I1AC 1T6VN 4ZO9A 1T89C 4X7FC 1D5IH 2X44D 3PWUB 3JV4B 3T3PE 4YO0B 3WHE0 4LEOB 3TA3B 3KYOA 1JF6A 2DL9A 2VLJD 3BEWB 3RPIA 5BV7H 2YXMA 3QDMB 2Q86A 4K94H 5J8OA 2NY4B 1MNUH 4NNYA 2EDJA 4BM7A 3WS6C 1YPZB 5AYUL 5IB2B 3WDHA 5GS0D 1H3UA 1O0VA 2RFXB 2R0WH 3JWNC 3QIWB 3AS1A 4HT1H 3JWOH 1IKFH 4DKFH 4C54A 5HHVL 1MCOL 1SBSL 4N5ED 3S36L 4WO4A 4Z5RB 5LAXA 4GBXB 4JFHE 1B4JH 5F6HI 5J6GB 4KJPC 5CMAA 4M43L 2APBA 4OQTL 1RUQL 1U95A 3DO3A 5DEGB 3RDTD 3TA3D 5CD3A 1A6ZA 4Q9BA 3OKNA 3RWEB 1U2HA 3QEGH 4OTXL 4BQ8A 4P9HH 4GH7B 4F3FB 4NC1C 4OZFH 2X4QA 1PZUB 1EO5A 2DQJH 1R5IB 2XACC 4FXLA 4OKVA 1K8IA 3EDDA 1BFOA 1RQ5A 4PGZA 4CN6A 2J8UF 2V5SA 1E6OH 3UTZA 4Z0BH 2YSSB 3GI8H 2X4PB 3AS0A 4P46C 4ZMAT 5C8JB 1L7TH 5DYOA 3EO9H 3KJ6L 4YUEL 2BY0A 3PWPD 3V4VH 5HYJA 3AUVA 3CC5A 3FT4A 4WI7A 2HVKB 1S9XA 4PREB 2QHLA 5IG7B 1F42A 1FH5L 4MNGA 2D03L 1QRKA 3MUJA 4OJFH 5FKAB 2NR6C 4WTXA 2OR9H 5ERWB 5F7YC 2WWKT 5E8NA 4PY7B 1FGVH 3NPZB 2EXYC 2HJFB 5I1DB 3WIFB 3WLWD 5C0FA 1A3LL 5B3NA 5GHWH 2C1PB 4EKXA 2EDTA 1MRFH 1RZGB 2FNBA 2OTUB 5TFSH 2GFBB 5JPMA 4Z18A 3F7PC 4X0KB 2HT3C 2BVOB 2P24A 3RGHA 5DJ0A 3TO4C 3C2AL 2XI9A 1JWUA 3JTSA 4NKDB 1EMTH 1E28B 4H20H 1I8KA 3LEXB 1JNNH 4OZHB 4LOUC 2ZWLT 4HDIB 4JG0H 3W0WD 3GUTA 2BDNL 1CQYA 5C0GA 3TCLB 4EDWL 2ERJB 3STZB 1QLEH 3QJHA 2GJ6D 1A5FH 3HC0A 5J57B 1FYTA 4NO0A 3BP7B 1ND0A 1O7VA 3D5OF 3UDWA 1AI1L 3HMXH 4XVJH 4XVJL 3QWRD 2PF6A 4F33B 3ARBB 4F15B 3KPSE 4C4KO 4WHTA 1KEMH 4IIQC 3O4LE 4KDVA 1DDHA 3O6LH 4R2GC 3UYRH 2RCSL 3O45B 4J23A 2HA1A 2DLFL 4JY4A 3HPLA 4TSAL 2D7MA 1FVDB 3QAZB 2ZOLA 4Z7UF 5I1HL 1V7ML 4MA8L 5DUBA 1JBJA 1C08A 1HH6A 4LK4A 1IGTA 5DUMH 3IRZA 1YC8A 4JREC 4HKJA 4GG6A 5D93C 3FFCE 5C0BA 3QIUA 2DJSA 4ZG1A 4ELMF 4DFHA 4HF5H 3VRLF 2OQJB 4ZPVB 2DYPD 3S4SA 1OAUL 3M17B 3KPQB 4RDQG 2EDQA 3RL2B 5K9JH 2BZDA 3B2VH 2AKRB 4TUKL 2BNQA 1UWXK 1A1OA 1ZSDA 4YXKL 1G7IA 5EU6D 4MMZC 4KUCD 3QEQE 3ROLB 1IT9L 4HMDA 3BAEL 3LRSA 1LEKA 4NNPH 1S7RB 3G9VA 2IF7A 3TWCL 1Q9OA 1S5IH 2XFXB 1PY9A 4Q58C 1BBDL 4MNQE 1C7TA 4DQOH 4GW5A 3WL9B 1H9VA 4DVBB 5T33L 4R4ND 3ALXA 3H3KA 2Q86B 1EV2E 4MS8C 2DWDA 1NEZB 2GJ6A 1A3RL 5FYLD 1VESA 5K9QG 1MCCA 4I3RL 2HJKA 3VRJA 4W70A 1TQCB 4HJJH 4JHAL 5F1NA 2DQIH 5DGQA 3PQYB 4ZDHA 4HXBL 4ZNEA 1NFDF 3H9YA 4MJIB 1NDGB 1HXMB 3HE6A 1MCWM 3W9EB 1CLYL 3T1WA 4RA0C 1KCUH 1M7DB 4PY8I 3RWFB 3MBEB 3IKCA 4Y5YA 4MGXA 1KEGH 2A73B 1W72A 1DANT 4X9HA 4AIXA 5I9QC 1CD9B 3HMWL 4WJ5A 1T2XA 3IVKB 3FB8B 3K8LA 3ULVD 4QHUB 1T2QH 4LASL 4U1SB 3GIVB 5HTSA 5BW7C 5HHNB 2B20A 3BT2H 3C8DA 3QIUC 3R0MA 4OCYL 1QFPA 4LKXA 1JGEA 3OGCB 3JUYA 2YSSA 2XPGA 5BS0E 1BJ1J 2BNRE 4M43H 5CLWA 3PWPA 3DWTA 4LSSH 3WFDL 1X7QA 3MRNA 4M3KB 2BP3A 1AGEB 4CMMA 4KPHL 1MHCA 4HW6A 2HWZH 3U1SL 3PV7A 1ONQA 3MV11 3OF6D 5AYUH 3QH3B 4WHDA 4BFIB 1NAML 3PWJA 1ZHKA 5LWYL 1JP5A 2EDEA 4QGTA 5KW9H 1NJ9A 4TSCH 4M6NH 4E41D 1IAKA 4JCMA 4Q9RH 4Y4KB 5FB8B 3SDDA 1EBAA 1FRGL 5E99L 3MLTB 4X7TA 1CFVH 2GFBA 4H1LB 4U4BA 1C5BL 5CEXA 3RTQA 1J7VR 1VENA 4NNXA 2ADFH 4JN2A 1AP2A 3G5VA 2NY1C 3FT3B 3ZL4L 1AGFA 4C57C 3WFEL 4I3GA 1JZ4A 1CTOA 5E2VH 3U46B 1DCLA 3BHBA 4LL9A 3WDJA 2WANA 1RVFL 3L5XH 3UAJD 2CRZA 3KNBB 4XPTL 1VFMA 4JFOA 5D7KD 2GTZB 3STZA 2FJHA 1GGTA 5IVOA 5GGRB 4K55A 3BZ4B 4HIXL 5E9DB 1I1YB 1FN4A 2HLFD 2Q20A 3RAJL 3TP4A 5D93B 3SPVA 1EUUA 1T3FA 1WAAE 5DJDA 1FO0H 1RMFL 2NNAB 4RGOH 4EXPX 1JPSH 5FECA 1IEAA 3AROA 1MUJB 2J88L 1RUKL 4KK8D 3SGEI 4RIRB 4RFOH 3L5JA 4AMKL 5I1AA 4W6YB 5I9QB 5T1DL 4HIJA 1J8HA 1E6OL 1IC1A 2ZUQB 1C08B 5T3XE 1J1PL 5DJAA 5E8DH 4M7LL 1GGBH 4GMTL 2FX9L 3UPAA 2YEZA 2XTLA 2H32H 5F96L 1EEUA 2WBJC 4JFDD 3SKUD 3ARFA 1F90H 4WGVB 2VSCA 3C5ZB 4JPKL 1Y0LA 3OQ3B 5K9OB 2ATKA 2OXHA 5FV2A 1CGWA 1KBGL 1ORQA 4UMGA 4LP4A 4G9FB 2EZ0C 5A1AA 1U9KA 4PP1C 4DGVH 2WW8A 3WSQL 1M05B 5T1LD 4DJMA 5CUSH 4NFBA 1TZHA 5EUOA 5B4MC 1I75A 4KXZH 4LLWB 1HI6B 5SV4A 3BE1L 4MJ2A 3P9LB 5IEHA 4H0IA 1AQKL 4HH9A 3H3PH 2FBOJ 2XN9A 2VKWA 3LKQB 1B0GB 4NN5B 3SCMB 2VL4A 4YZFF 4QRPB 2GW5A 2Z0BA 5EFIB 1CD1B 3T0VA 3N1QC 4RFNC 5B38G 1KLFA 4HWBA 4GXVL 1WCBB 4LCWA 2VAAA 1HILB 3DHMA 4ODTL 4MAUL 1MHEB 1NC4A 1CIUA 3HFML 4FMKA 1OVZA 5DLML 4OLUL 4CW1A 1MHHB 2BOCB 5IIEB 3VXTA 5HVHC 1R24B 4R4FH 4YIQA 4FQXA 4QY8A 1F45A 5CEYA 4KI5F 5E1HB 1P4IL 3LSOB 3DRTB 1EO7A 4JCLA 4MNHA 5C0NC 3ZO0A 3FZUD 1QBMH 4YX2H 3I84A 3T2NH 4YXHL 2A77L 2BJMH 2A77H 1NMCB 3ZHKA 2VLJA 4O58H 5D71L 1U3HA 4PRDB 1S5HA 4AG4L 4M9OA 4XRCA 3BP4A 2D0FA 5HHOB 5BXFA 2O5YH 3DIFB 5KSBE 4NRXA 4P46A 3GMRB 1BVKB 4X8JA 1FNGA 2YC1B 4QXUH 4L4TE 2GTWA 3EHBC 4TUKH 4JVPA 4O4YH 5EBLA 4ZYKA 3O4OB 4GRWE 4LLVB 4O58L 2VZTA 3CH8A 4KHTH 1J86A 2EE3A 1OQOA 4YBQD 2BHYA 2Y7QA 4KDWA 4UIKL 4PJGF 3G6JA 1MRFL 1KIPB 4DKAA 4ELKB 3LDBC 1IAKB 1G7PB 5EPMA 1FP5A 3VFMB 2O5YL 4Q2ZB 4U3HA 1CCZA 4P3CH 4ENED 1IC5L 4QRTA 3NIFE 3LN9A 4QHNA 5DJ2B 3SE4A 1BD2B 5IMKA 1FFNA 3QWOA 5BRZD 4UZGA 3CFCH 3VXMD 1DL7L 1KC5L 5ETUB 1N4XL 3TIDA 4OF0A 5ESQA 3CZJA 4P2QD 2VDPH 43C9B 5LGKA 4NJAH 1AO7D 1LHZA 1XF3A 1MIML 5D1ZD 4P2CG 2EYSA 4TSCL 2IBGA 4ODUA 4GRLA 5ITFB 3GEWB 5BMFH 4LSUL 5KSAB 2G2RA 4PR5A 3ZE0E 3MV7B 4FQXC 1MCRA 1T80A 2O5XL 2GEEA 3O9WD 3T1FA 3TNMA 4NZUL 4JB9H 5TDPB 1MFAL 1F4XH 2HRLA 4HXAH 3BXNB 1D9KD 4Q97A 2PTUA 5AAWA 1KXTB 3FO1B 2P48B 5FYJD 3MV9B 5TDNA 1U3HC 4Y2OA 1XMWA 3DTXA 3D1MC 1CK0H 3SGKA 4M6ML 1R3JB 1GIGL 3VFNB 1JJUA 2A83A 3IU3A 4NUGH 4KKLD 4LCWE 1G9MH 1U8OA 1NSNH 4F9PC 5HPMA 3MOAH 2O5XH 5JW5B 1T7VA 1HSBA 2B1HH 2Y5TB 4C58B 3CXDL 3QO0A 3J7HA 4EN3C 2VLRE 1XF5B 4NO2B 3U1SH 1CDBA 4YWGL 5L6YH 1XAUA 1WWCA 1WFUA 2VLKB 5HDQH 3UTSA 2VDKL 3QFJE 5K9OA 1GIGH 4M7ZC 1CK0L 1KCRL 2EDDA 4MAUH 5FXCH 4RGND 5EBGA 3NIGF 3NACL 1N0XL 2XWBB 1K4CB 1XZ0A 3SGEH 1EHXA 1PLGL 3IJSB 1IGJA 3L5IA 3C2SA 4HEPG 1S8DB 1SMOA 4HH9B 3MJGX 3MXVH 4LPVA 4Q0XL 1AHWA 3MLZL 3MGOA 3P9WB 1INQA 1CBVH 4PGEB 2V17L 3BKMH 2LTQC 4RFOL 5FOBA 1AJ7L 3WXVH 5DD6B 3WO3B 2J88H 5ID1B 3OWEA 4LGPB 1M71B 2FX8L 5C0JB 2XN9E 2JJVA 2W91A 1U91A 4OQTH 1AD0A 2DMBA 4QRSB 4JRYA 4CADA 5BZWB 3LB6D 1Q0YH 2VZUA 4BFBD 4JY6A 1JF5A 5SWQA 1QP1A 1EGJL 3BP5A 3QQ4A 4OCNC 5DJXA 3T8XB 2CSPA 2X1QA 3IDNA 1ZA6B 4H8WH 4WI2A 1O7SA 1F8TL 3UX9B 3LS4L 5ELIA 4A6YH 3L3IB 5CJOH 5EU3B 4KVNH 3SKJL 5FUZL 4I5BB 1VFAB 4APQC 4PB9L 1ZK9A 3FB6B 2DICA 1YY9D 1XF2B 5MP6H 4LRNH 3ZKMC 3CMGA 2QQLL 4ZAKA 3ET9F 2W0KA 1AI1H 1YYLH 3K1DA 3LDBB 5CP7B 2HT3D 2YMXH 1LGVA 1WUNT 1GXEA 3KXFB 4RAUB 2CXKA 3KPNA 3U4EA 1CN4A 5EO9B 4G8GB 3QRGL 3R06A 4ZYKB 2APTA 5LWYH 1IZKA 4XNZB 5TGBA 1UKTA 4FG6C 3QXAA 5KSBA 3QI9D 3MCKA 2HTLC 3RRQA 4LQFH 2NXZD 1E27A 3S34H 3VU2A 1MVUB 5INCB 4P23C 5IGXH 5FYKU 5FCUL 3JBG7 5CCKH 4O9HH 3LMJL 5IVZB 5MENB 4Q2ZA 4UT6H 3T77A 3FKUS 5SWSA 4PJIF 4RWHA 3G6JE 3QFDB 2P5EA 2YA0A 2DQHL 3QSKB 2BMKB 1BJMA 4KK5C 3MA9H 4LLUB 4Y5VB 3VGFA 1LE5A 4ZTOH 5CD5D 4NO3B 3H9SB 5KS9B 2KZWA 1Q9LA 2FLRT 1AGBA 4U05A 4NM8L 1G0DA 2QHRH 4YDKH 4ZTPH 2HLAA 3MO1A 5E2JA 1ZHBB 5IGXL 4MVBD 4POZC 3VMPA 4GRLB 3D48R 2ZCLL 1WIPA 3MLUH 3HG1E 1NDMA 4L9DA 5GS1C 5KVMC 2ZKHL 2YN5A 3ULUH 2XRAH 3FT2B 4TUOB 3I75B 4MDIA 4HHAA 1MAML 3T0AA 4DKEL 1BAFL 3QA3A 5GS0L 4HPYL 4X6FA 1I85C 1TZGH 1V7MH 2OXGA 4MA8H 5F7NC 3L3GB 1AD9A 5A2KH 5J6GA 5INDA 4EUPH 3MRJA 2W92A 4LBEB 1H3XA 5CD3B 1QFWH 4WEMB 4KZDL 1A7NL 4NFDA 3BGMB 1HSBB 5D1QD 1R3IL 3RIAK 4NWTL 2J8HA 4PIRF 2Y36H 3DROB 1J0ZA 1P5VA 2J6EH 2BVYA 2E7LA 3BPOC 1MREL 2I07B 5A3IC 3FN9A 4PP2A 5J6HA 3FQUA 4P23A 2MOVA 2P4AB 1JPGA 4CRPA 1XGQA 4GAYB 2EE9A 2Z31A 5DI8A 3FRPG 5DZLA 3MLRL 1HWGB 2NY4C 4FTVA 4I4WA 5F1KC 4ZXBC 2DQJL 5FDYA 3KPRD 2HVKA 1FVCB 3GSOB 4LPCA 2OMBA 4UAOB 2YKLH 1AHWB 4U6VH 5DJ6B 5CSBA 3TFKD 4GAGH 3O41A 2BERA 4HWEL 4HUWB 4HC1H 4HC1L 1CLOL 1FBIL 2DKMA 3PWNB 5DTFB 2EH8L 4ZOEA 1QRNE 3OAZK 1NFDB 3C08H 2V6HA 3MJ7A 4WI5A 3VXMB 1MIMH 3Q1SL 3TBWB 5JLZB 1NUNB 1BD2D 2DIJA 2G9HA 4PJXB 2BVOA 2P24B 5TH2A 4HS3A 3OAUL 2E9JA 3O4LD 2P49B 2C4FT 3WKML 3Q5YA 1QQDA 5E5UB 3S35H 5E5RB 5IFHL 3VFUB 4P2QA 3QULA 2V17H 4JO3L 5C0GB 3RPKA 1R6VA 4UU9B 1RVFH 5CJXC 1E4KA 3KPOA 3SKNA 1S7UA 4R3SB 3OZ9H 4G43B 1HQ4B 5ACLA 3HE7B 4LDOB 5HHOD 1NCBL 2UYLB 2IGFL 1YEFH 4U1KB 1ZLWH 4OTXH 3MJ8B 3UBXI 4DUXA 3DURA 5FUCC 1V7NH 2PW2B 4ZFGL 4K9EC 5EU6E 1CR9H 3PHQB 4BSVB 3WE6B 4X99A 4YHOL 4Z7NE 2J2ZA 3K46A 4M61A 1YEEH 2CKNA 2PW1A 1HHHA 4N9OB 2XICA 4HKJB 1BFVL 4ZUWA 2VWEE 4OZIA 2ZKHH 1QA9A 1HDMA 4G9DB 2EH7L 4EBQH 1OPGL 1L7TL 5GGQH 4G8IA 4AYFA 1XCTA 4Z7UB 5F96H 2R0ZH 3KLAB 4YDIH 5DD1L 5C6TL 3VFWA 4DVRL 2DLTA 1N4XH 1X9QA 1G9MC 1KLUA 1A1OB 1ZSDB 4G6KH 1DEEB 3P9MB 4WNQB 3QRGH 4N8VG 4X6BB 4P59L 3OXRB 4CN4A 5LQBH 4PRAB 4UAOC 4GG8A 3DI3B 3SO3C 5I1CH 2H8PB 4W6XB 1MWAL 2EDWA 5DT1L 1ITBB 4UINH 4GLRI 2LABA 5CCKL 5E4EC 2CO6B 5B21A 4DUWA 4J6RH 3CZFA 3TVMD 1KOAA 3K74B 5FYJU 2HG5A 4LNRB 5M94B 1JFQH 2QTEA 4JM2C 4HUUB 4NWUL 4UIMB 5KG9B 4PTUA 1I1FA 1P7QD 3EOTH 4S10A 3HN3A 1GSMA 3MACL 3MRDA 2MHAA 2OP4L 1F6LL 5DQ9A 3MYJB 5IT2H 1JGUL 3SGKC 1UJ3B 2AEQH 2RGSA 1TQBB 4FNLL 3ZYIA 2ZUQC 1LP9F 3RGVC 4OD1H 1AKJA 1I8IA 1ULVA 3ARDC 2Z92A 1MRCH 4NFCA 5CP3A 2X1PA 5EULV 2IPTH 3W5MA 2OJEA 3ISWA 1YN6A 5F7MC 4QRPD 1O5DT 4PJFE 2IADA 4K07A 5JMOC 1SEQH 4QTHA 3BN3B 2Q8BH 1TJGH 1YNTB 3OJMB 2XPGB 5C0RL 2NY3D 3VWKD 4X9GA 3IDGB 2Z31B 2FD6H 5JR1H 2ICES 1SM3H 2CDGB 3Q3GA 4PJAF 3DX6A 2PXYB 3JVGC 5F1IB 4XT1C 5IB3B 1QLFA 3QUYD 4KKAD 5DJZB 3RVWD 2VDMH 4WEBH 1AJ7H 2FGWL 3TVMC 4M00A 4AK1A 3SDXB 4KHXL 3KJ4C 2VWEC 1UXWA 3C5SB 1MHPH 4HMCA 4PJDE 3DLQR 4XMLL 4RFEB 3KPRB 5ILTL 4JPVL 1PZ5A 2GY7B 4HJGB 2VQUA 1PKOA 5AZEH 4OZIE 4WFGE 2B39A 3BIBX 3EO9L 3MLWH 5TH2B 3MV8B 1R3IH 5CEXB 3QI9B 5GXBB 2XA3A 3EJJX 4OZGA 2R9HD 3BKCH 1ZT1B 3IDMA 2GSGA 4RWYH 3DARA 4IIQA 2V9RA 3GI9H 4GAJH 2PYFA 5CILL 3C5ZC 3VFUA 1DLHB 2QQNH 3CDGB 1G7HA 5F89B 3QEQA 3ZDZE 1FDLL 4G6MH 1OGAD 2J8UA 4EUPA 2FJFA 3OJDB 3RGVA 3DMMA 2H6PB 4GMTH 1TFHA 3TBTA 1OSPL 4FQLL 4TULL 5JW3H 1PQZA 3SPVB 1BBJA 4PJIB 4U7MA 2EDBA 3T4AB 1P1ZA 3STLA 5FO8B 4ISVB 5F93C 3BKCL 3PQYE 4RAVA 5FECB 5I75B 1B0RB 5CSZB 3DXAA 1VSCA 4G8GD 2CGRH 4WFFE 5IW1A 4U1GC 4LLYA 1A1MB 3O8XB 1I9RL 4JO1L 1YA5A 1INDL 3OKDA 4OV5B 2VNCA 4ZUWB 3OZ9L 4JFXA 5J13B 1YNLH 2VABA 3BJLA 4JFQA 4F7MA 4UT6L 3VXSB 4HULB 1YMMD 2B1HL 4U6XB 4Y19B 3FN3A 3OG6B 4MJID 3BGAA 1KJ3L 2FEEL 3L3KA 3EFFA 2N7BA 3WHE1 5I17B 4JJHA 5EOCH 1D9KC 5TE7L 5CWSA 4IRJD 4JHWL 3RKDC 1NMBH 1RJYB 3HAEH 4R96A 4JFYA 2FR4B 5DJCB 3HZKA 5DK2B 3PHOB 1OGTB 1BGXH 2EEAA 1ADQA 4JAMB 3L3OB 5IW6B 1IE5A 1EH9A 3SQOL 4LLWA 5CEZD 4ONFH 4P0DA 2CIIB 3QHFH 1R0AL 4ZS7L 3DVIA 4K8RH 2QQKH 2PO6D 3RY4A 1RD6A 3JWDC 3FB7B 1QHPA 3HCVA 1T5XA 3LKQA 1LO0H 1JHTB 4RMTA 1HHIA 2GT9A 2GITA 2HP4A 5D7IB 5EU6B 1QBML 1ZTXH 3MCG1 3ARUA 3DMMC 1OD9A 5E2VL 1A5FL 2L7JA 3GSNH 5HJ3B 2ORBL 3MRDB 3MXWL 1WITA 3BQUD 4FQHA 3HUJA 5D7JA 2HTKD 4HCRL 1UQSB 2A6JA 4ODHL 4MWFB 1IC7L 4MD4B 2EDXA 2QEJA 4KK5D 3L95B 1A6TA 4G6JL 4P3CL 2IQAB 3TV3L 1KJMA 3O6KL 1CGVA 4WHYG 1RY7B 3D39D 5DVNA 4UUJA 4U33A 3AU1B 5C9KA 1MI5E 1YN6B 4XC3H 1T6WA 2ZJSL 3KR3L 1J5OH 3FRPA 5JPNB 2KL6A 1JTTA 4D8PA 4OLUH 1CLYH 2YD5A 4ZFOB 5BXFB 1CLCA 1D6VL 1NCWL 4GKNA 1LD9B 1DQJA 3GSXA 1FZKA 1XGUB 3VXPB 2CRIA 1AQDA 3GMRA 2PTVA 5I1IH 4PJCB 2A6IA 3VXME 3SDDD 3IXAB 3DETD 3UPCA 2PXYA 3RTQC 3SN6N 5EBLB 2VZOA 1L6ZA 4XWGL 1F2QA 3S96B 4MHHG 3MLSH 2CLRA 2OL3L 4FQCL 4LPWA 5ADOL 4KI1A 2JK5A 5HDLA 1G7JB 4Y4FC 4ELKA 3QUXB 2IALB 4ONHA 5DHXB 3T0EA 4K7FB 4PJ5B 3UTTE 1OPGH 5CS7A 4WWID 4PFEA 3ZKMD 3MV7D 5I1IL 4JKKA 1Z2KA 5IB5B 4RBPK 4NQDD 3DVGA 4PJAA 5IV2A 1DUYA 2VR5A 1QTYT 1A6PA 3T65A 1U93B 5GGSA 5D7JC 5E00A 43C9A 3VFVA 1FNAA 4OI9A 3JWOC 1MHPL 3OAYK 2ZOKB 3ULUE 4QHLA 1KEGL 3CCHB 4JO2H 4PLNC 4QHMB 1IILE 4HG4K 3BEWA 3ARBD 1XGPB 5T5FH 1OB1B 5D7LE 4FFYH 5T3ZL 3LOWA 3PDDA 2FX7H 4GAFB 3FMGH 2HT2C 1SM3L 5GGTH 3QFJD 4Y2DC 1BECA 1FPTH 4F58L 1UXSB 4FOMA 4PRNA 3RA7L 5AZ2H 5BQ7A 3NCJL 3UCRA 1SY6A 4Z5RA 5DVMA 4CMHC 1PX3A 2I27N 1P4LA 4XCFH 5DEGA 5JHDB 1RHHB 2DQDL 4NGHH 3OAUH 1C5BH 2ZPKH 2A1WH 2Y5TA 2QQKL 3EOAA 5BV7L 2VLMD 1HINH 4NO2A 2DIBA 1JUFB 3KYNB 5T5NF 1QLRA 1HSAA 2WP3O 1EHAA 4NC1E 4H8WL 2E6JA 3AXLA 2ZUSA 1BQHA 4LVOC 4M6AA 3BKYH 3LV3B 3V6OA 1VFUA 3HAEA 5C8JA 4P2OC 4ZUUA 2DM3A 3O6FD 2WINB 3CC5B 5HYIA 2AV1A 4HIHB 43CAB 5F88A 4N8VA 3BDYH 1ZWIB 3NABL 5D1QC 5GRJH 1F13A 4AT6A 3HCVB 3BO8B 4UV4H 1FVEA 1UH4A 5BO1L 1SVCP 1FZMB 2OYPA 2HT2D 3SGJA 5ICZB 1IEBB 4WO4D 4HS8H 5FM5O 1N7ML 3D9AH 5IEKB 2CGRL 1D5XA 5D7JB 1KENL 4TVPL 1OAYH 2I9LA 2JB6B 4S11A 4N0UB 1QFWL 3UBXG 1IC4H 2AEPL 4EI5A 1JRHL 4DOHB 1KJVB 5CJQH 3B9KA 1OTUD 1KIQA 1CDUA 3ZE2F 3BRGC 2W9DL 4E42B 3WXVL 3L3IA 2EYTA 1F3JA 1VPOH 1CLZH 1EIBA 3TCLA 1I7UA 1J11A 5HD8D 2R0KL 1FFPB 3JV6A 3WHXA 4MCZA 4UTBH 1ND0B 5D5MF 2VO5A 1J1PH 1U0QA 3BPCA 4OCWH 4F37F 1OSPH 3O2WH 5D6DC 3V9FA 2ZCHL 2AEPH 3QCTL 4Z78B 3KJ6H 4YUEH 2IH3A 3SOBH 3QIWC 4MA3B 1AQDB 1MJ7H 5DZNA 5KOVC 3G5XB 2NY5C 3ZE1E 3CK0L 2P7TA 5JZ7D 4X4XA 3U4EB 3R06B 4LGSB 5B38A 1FVDA 2VDKH 1OAXL 2ZOLB 1PG7H 4XBGB 1N5YL 2FATH 4CL7A 4XVSH 4EQ2A 3LKSB 5EC2A 2EDHA 1KTDA 2F5AL 1M7IA 1RIHH 3FO9B 4ZO8A 4WO4C 3LHPH 1NCCH 2XA8L 3HMXA 2F15A 5KVFL 5EZJA 3R8BB 3TYFA 3X3FH 3KPQA 3V52L 1A6WH 3C8KA 3GMOB 1JYXA 2BNQB 2X6MA 4LU5H 1WZ1H 3QFJA 3P4OB 5L2JB 3T65B 1OAKL 2FZ3A 4QF1A 3BD3A 5MI0B 3OAZH 5DR5H 1SEQL 4WV1A 3V5KB 2YPKA 3BPOB 3NH7L 4C59B 3T4YB 3L3JB 4G6FB 1K5NB 5C0RH 4ZFFB 4IRSC 4JN1H 5EO1B 4KC3B 4Z7WE 3MUGB 1CL7I 3U7AA 3RHWK 4P2RD 3NCYP 3QDJB 1TIUA 4I18A 3W9DA 1YY8A 4JZOB 1BBDH 2EC8A 4OM1H 4OM1L 4FG6D 3QB7C 1MCJA 1I4FB 2DLGA 1A6UH 1RUPL 4M4RA 2IAND 3JWOL 1HIML 2UUDH 1QRNB 4HWZB 1IQWH 4LPXA 3DUSA 4OUUA 2CKBA 3GMQB 4PUBL 3HE6B 2VDLL 4X6DF 4UI2A 1ZS8A 1P4LB 5IT2L 2EE6A 4LBEA 1I8MB 3IDIB 4NP4L 2HKFL 3RY5A 1OAUH 3RVXC 3FCTB 1S7XB 5C09B 2FLBT 4JRXB 1I7TA 4UBDC 1KJ3H 1JUFA 5ECJE 1TQCC 1CGXA 1HSAB 1UB6B 3IB4A 1GCFA 4G3YH 3FQUB 1TENA 4XPAL 3HNSH 5DDHA 5AUMB 5LQBL 5TF0A 3GJFA 1BD2E 5ID0B 4ZUSB 5I71C 4XMKL 1Y6MR 5JIKA 4BZ1H 1J18A 4S1QH 5ITBH 3HAEB 3MODH 3DV6B 2XZZA 1IGMH 1X7QB 4NZRL 5KVDL 1E4WH 1MCHA 4NJ9L 3LEVL 1CGSH 4PGCA 3TO4D 2IPUG 4IMLB 5DK0A 3QCUH 4N8VB 4NN6B 1PBYA 4BFIA 1RK1B 4XAWH 4XP5H 4ELMB 12E8L 3PWNA 5DTFA 4GS7B 5J4MA 3HZVB 4J4PD 3DRQA 4I18C 4Z77A 2XZCH 3VWJB 2HFFA 4TOYH 2BVUA 1CVSC 2KKQA 2WIMA 1CU4L 5ENWA 1D5ZA 4YHNA 2Y23A 1DBKH 5A3ID 1OD7A 4ORGA 1BOGA 4DW2L 1MJUH 3VA2C 2R2EB 3QIUD 3MRFB 1Q1JH 3BHBB 3LD8C 4HUNB 1MIEH 3I85A 3UO1H 5D1XB 4OI7A 4PJCF 4C56A 3QDAA 5FYJL 4FFWC 2R1YA 3JV6B 2NPLX 3RX7A 3BZ4A 3NFSH 4Y4HC 5IOPB 3DSFL 4U7KA 1R3LB 2IG2H 5CEZL 2IH3B 2MKLC 5I8CB 1XR9B 1LK2A 4LVHC 3GBML 4RMWA 4M7JL 2VITA 1A4KA 3NIDE 3CIQA 4MMXC 4JFEE 5ALBH 4X99B 1I9IH 3I2CL 4GW1B 4HIJB 1KFAH 1G9NH 5JW4N 2AW2A 3RIAF 5SX4H 1G6VK 1LEGA 4YHKH 1DP0A 2AXJA 4H26B 3WLBA 4QO1A 2O5ZL 2OSLA 3VDCA 1P84K 2XYCA 5F6HJ 1DBMH 2JELH 3MA7A 3MBXH 4K3DH 3EJZD 3VXSD 1U3JA 4NQED 4G8IB 3MRQA 5AYQA 1BIIB 1Y0LB 1XCTB 2R29H 3MNVB 3QXDA 3QIBA 2C3GA 3VFWB 3F7QA 5HYSG 1GOGA 3HI6H 5L2JA 5JIHA 4YPJA 1QO3A 2HRPL 3MR9B 4RAHA 3TZVD 2GUOA 4PJEA 3L3JA 3M8OH 3SDCA 4HLJA 2Y72A 3MLYL 3MNZA 4O02H 5IEHB 3M1BB 1J05B 4XPFH 5KVGL 4RQQB 2DQEL 3BGFC 3CZFB 3RZCD 1UWEH 4L4TD 2WWKO 3HHRB 2XN9B 3TPUA 3BP6A 3NZ8B 1CFQA 1P2CA 3BOVA 3GJEB 1G7QB 2ID5A 3L3DB 4LDEB 5DRZA 2J4WL 4KRPC 2DB8A 1QRNA 1H8OA 4HWZA 4X7SH 1QG3A 4OLEA 3ZDXF 3GMQA 5H35B 4GXVH 2ZG3A 3MZGB 1NPUA 4OB5H 4PJHE 1L0XA 5EA0L 2WNGA 1YEHH 4ZPTB 4R6UA 5F9WB 1MHHA 3B43A 4P57B 5CKAA 35C8L 3BH8B 1A6VH 3ARGA 1U8KB 3FCTA 5C9JA 2Z92B 1OT2A 4XHJD 1T66C 3F62A 5JXEC 5DS8B 3K4DA 3RP1A 2OJEB 5EZOL 1N64L 4P2QE 2XQYG 4M48L 3F65A 2ARJB 5B4MD 1TCRB 1BP3B 1YMHA 4ZOAA 3RNKA 2FWOB 2B5IB 4ETQA 2QV2A 1VDGA 1S7SB 4LCCB 2AERT 4LFHG 3E2HC 2DQTL 4P46B 2HFEA 4X8XA 1MCPH 4MX7B 3FT4B 4UILL 1C5DA 5KTEH 1R3KA 1DQTA 3DPBA 3IJHB 3BUYB 1RUPH 4JFEA 4U6YB 3ARSA 5E2UH 5A2JH 2F54E 4QNPE 4DEPB 3GBNL 2RB8A 5DURD 4B7LA 4HEME 2DLIA 2DQCH 2DQGH 1W8NA 2VLRD 1V05A 1MFDH 4QXUL 1ZT1A 3IDMB 3QPXL 3QPXH 4DZ8A 5GZOC 4WU7B 3ARFC 1T0NB 5J11B 3MRFA 3QUMA 1VEPA 3X13B 3ZE0F 1MJJA 4Y5XA 1FNEB 2ICCA 4RNRA 5EOCL 3HZYA 3I3BA 3QDHA 5D1XA 3RVTD 3F5WB 2IBZY 4RGNE 1FJ1B 4UIKH 4PJ7B 3WD5L 1S78D 4NO0B 4IMKA 3LQAL 1NGWB 3MV7A 4K3DL 2YPVH 3FRUA 4NP4H 1TTGA 1KB9K 2XTJE 3U30B 3T1FB 1MY5A 3DNKA 3TNMB 4OM0L 5F9OL 2F5BL 2QKIA 1D6EA 1DTUA 2BSSB 4RFNB 4Z7OE 3QIWA 1S9YB 3JTTA 4Y16C 1QKZH 3QNZB 1B0RA 1V8HA 4L29A 1NC2B 2R2HA 5C6PB 3ARED 4PRPB 3IU3B 2XN9D 4JM4H 4ENEC 5LGHH 1H15A 4RX4D 1QSFA 4M6NL 2BXYA 2YUZA 4JRYD 1S7QA 3WLBB 3LZFH 4M7KH 4OV5A 2VQTA 4W4NA 1W0WB 4LSVH 2YBRA 1NBZA 4YLQT 1U3YA 2X89D 1CU4H 2B8OT 1XT5A 4MVBC 4POZD 1FLTX 2F53A 3NZHL 1T04A 3OKLB 1ETZA 1K2DB 1T7WA 5EU5B 3MRQB 3BYYA 4ZQKB 2VLKA 3UTSB 4WVRA 1A9EB 4RMQA 4LHUA 3QDGD 3LQZB 2EEDA 1MIEL 4PJFA 1BVLA 2YPLA 3QXUA 4BUHA 1URLA 5DJCA 5JDSA 3OKKB 1YEKL 5GSRB 1FC2D 2FO4A 5DJ8B 5T1KB 1MOEA 3EZ8A 3SOBL 4YQXL 1LNUA 2QL1A 3UEZA 2CIIA 1HHJA 4XGZA 6CGTA 4PJEE 4Y4KC 2GAZB 2B7DT 5D1XD 3VFTA 5I15H 3KHQA 3D39E 5E5MA 1MCEA 4F8QA 4DVBA 1K9TA 5HDQL 1T20B 1MI5D 3ORJA 4PP1D 4X6CB 1HEZA 4XP6H 5HYJE 3WIFA 2AK4B 4HJ0D 5E6ZA 2Q76A 2X4TA 1WEJL 1AGCA 5I8KL 1U91B 2DDQH 2XQYK 4LHUD 1UJTA 1G9ML 3OF6A 3W9EA 2OK0L 3VW3H 3VW3L 3MRLB 3ZTNH 3FAWA 1I8KB 3T3ME 3SBWC 3W11C 2R29L 1JRHI 3TBSB 1U36A 4IRSD 3GB7B 4G3YL 4QHUA 1FH5H 4LMQE 4PJ8C 4U1SA 3QJHB 3FHQA 4KAQH 1YMHB 5EZIL 5HHME 2GJJA 1K6QH 1KCSL 3GSRA 1N2RA 5ITBL 5KANI 1B6UA 1F4AA 1MSPA 1S7SA 4OLZH 5GPRA 3ALWA 1F6FB 2B1AH 3MV7E 2R23B 3T0WA 5ACZA 3VDBA 5ESAA 4NQDE 1T7XA 4LVNC 2QR0A 5D8JH 5C0ND 1DVFB 3FZUC 5MERA 1XGRA 1IGYA 5DRNB 3MCKB 1PFCA 4KMQA 1VKXB 2C7UB 1MVUA 4CVWA 2YPVL 5J12C 3F6LA 4YDVA 4Y4KA 3SDCD 3S4SB 5D7LD 4XNYL 1T1YB 1WQVT 2AKRA 5KJRL 3T2QA 2VRAA 2Z91A 4GG6E 3FT3A 4CVXB 3REVA 1JHKL 1G7IB 3LKRB 4MLIA 3WIIH 2X09A 4CU6A 4RMVA 5C92A 3QUMH 2OS7A 4MA1B 4NZJA 1LEKB 3KPMA 3HZYB 3LRSB 3VGHA 4YXHH 5L7XH 3VFRB 1TNNA 2ORBH 3FONA 4KKNA 5ICXA 2HLAB 4PJ8D 2EDFA 4MSWA 2ADIA 3CCHA 4GW5B 4TVPE 5EBWB 4HK3J 4KI5C 1KJ2L 1UA6L 2YUWA 4R8WH 3FT2A 2B4CH 4K3HA 2R8SH 1MFEH 1BMGA 3VWJD 5KSVB 2CLZB 5FO9A 5C0BD 1E4XL 5EZOH 1ZVSB 1BZ9A 3QNZA 4KQ3H 1Z0MA 5ISZE 3LKOB 4S1SL 4S1DD 5F71A 3GBNH 1D9KA 1J8HB 3IDJB 5J7CC 4HZLB 4QYOB 3MBEA 5FIEA 3FN0H 1S7QB 3O9WC 3MLUL 4HPOH 3PJSB 2NTFB 2QADD 2V7HB 4NKIL 4F7PA 2AJXL 4LEXH 3UROR 3W2DL 4KROC 3V5DB 5HI3C 3X14A 5I2IB 5B39G 4DAGH 5K59E 3LQZA 3PV6B 5HXMA 5IM7B 5DO2D 4UDTB 5CBAA 3QEUB 5FO7B 4YDKL 4NRZB 4MCYB 4TSBH 3QG6A 4HXBH 3OX8B 3KXFD 5B22A 3O2WL 2V7NB 1XF4A 4WTZG 2X4RB 1Q8MA 2W65B 3V6ZA 3ME0A 4IHOB 4QCIB 1QR1A 3CFIC 3EYUL 1HHJB 4PRPD 2OR8A 4J3UA 4ZFOL 2OTWB 5C0CE 1MLCA 5BS0A 1MH5B 4DGYH 2AI0L 5F6IB 3S7GA 1EX0A 1B90A 2ZUVA 2EH8H 3RNQA 1UZ8B 5T1DH 1G6RA 1BHGA 4OQ1A 1CFBA 2LVCA 3PNWB 1J87A 4AEHL 4P5MA 5JTWA 1D7FA 4MA1C 4BK4A 5J1SC 3KHOA 4LAQL 1DBAH 3CSPA 3BN9C 5IMOA 2BOCA 4PRBA 5D2LE 4G6FD 3TJHC 4JFFA 3V6OE 4NZUH 1RUKH 4GKSB 1L0YA 2A38A 5CEYB 5A43C 4E42A 3VGAC 2Y06L 1CFSA 6FABL 4JFOB 2J8OA 4HS8L 2OZ4A 5C07A 5D96C 5JXEA 2DN7A 3P0GB 3TIEB 3BZFB 3CFBB 4NCC1 1PW3A 3LKNA 2Q6WB 1FZOA 2NW2A 3BPCB 3B5TA 4D9RE 4FQJH 3LZFL 4M7KL 2YUVA 4YDJA 2BOBB 5DURB 4O2CA 2Z31D 2A74B 4Z78A 5B8CB 2D7TL 3QDJE 2NY3B 4HIEB 3T0EC 4K7PH 2Z93A 1X5FA 4Z7VB 5D1ZA 2Y06H 3J8F7 1DVFA 2FDBP 4JHWH 4M7JH 4DZBA 2K7PA 5EZLB 2VQ1A 4XBGA 4NC0B 4NQDA 4JGJA 4LLVA 4WUKH 3IAGC 2A6KA 5DJAB 2DDQL 1KTDB 2R15A 5E6IC 3G6JB 2FSEB 4MXVE 3P0YH 1QFWM 3NACH 2UY6A 1FG2A 4QLRA 2R0LL 2AQ3A 3VCLB 5CIPA 2V5MA 4KDTA 4QHNB 3KLAA 5DJ2A 3TA3C 1JZ2A 3I9GL 3P4OA 5ADPL 4HZAA 4N1CA 5I1EH 1JZ8A 2YPKB 4QOKE 3NCJH 3U0TA 4JKPL 5JOFB 4Y5XC 2ADGA 5I8KH 3H42H 3H8NA 2KH2B 4JPIB 5EO1A 1FV1A 4I13B 2DQTH 4S1QL 5TE4H 4L4VD 4S0TD 4HLZG 3KYOB 3GSWA 5GISH 3SCMC 4NIKB 4J6RL 4LVOB 4BSWB 4CJ1A 5E2WH 2NZ9C 3EO0A 3HLAB 4ELME 4HGWB 1CD1A 2VR4A 1OTSD 1F00I 3LN4A 5EOTA 4HJJL 1AO7B 4OUUB 5DZOA 4NC2B 4NN7B 5LAXB 5EBMA 1S7TA 5I73B 2IPKA 3MRHB 4HBCL 3TZVC 4LSRH 4OCRL 4YC2B 4R4NC 3V6OC 1ZLVK 1Q72L 3QUZA 4HSQA 2LQRA 1YYLL 4DQOL 1I7TB 2ARWA 2F58H 3ARYA 3NPSC 1MCLA 1MFNA 3FQRB 1UFUA 1BFSA 3V5DA 3BEVA 4X7EC 4WWKC 1LDSA 5FUZH 2WV3A 4LIQH 3I6LE 3PV6A 3MLSL 4L3EE 5AUMA 4UDTA 1RZKL 2IBZX 1TVBA 2AJSL 4P9MH 4MCYA 3CSGA 2ICEB 3G5YB 3QO1A 3SGJC 1KENH 4TVPH 2W38A 4X83A 3TF7C 2V7NA 2VXSH 2WWMC 5E4IA 5F9JB 2XWBA 5JNYA 2UZIL 5HYJB 2VLJE 2YC1A 1K3IA 3CFCL 3MRPA 1OP5H 2AXHA 4JPKH 3KDMA 4GAGL 5IB3A 2OJZH 4XP1L 1MH5A 3DXAD 2FGWH 4R26H 5FKAA 4X6CE 5C6WH 3CDFA 3MOBH 3ULSB 3MFFB 3KLDA 1M4KA 2ZUUA 4LCIH 3VH8B 2NZ9D 1CI5A 5DVKA 1BFTA 4RFEA 4GKOA 2ED9A 4L4TA 4LSVL 1K8DB 5L0QC 5HVHB 4OB5L 4XXDA 4IJ3B 1WBXB 3C09C 3TN0B 4P5MB 4QRTB 3VFGL 5LKNA 1JZ7A 4YHNB 3CX5K 3CSYB 2FIRT 3EYOA 3LPWA 4FQQA 4MJIE 3ZL4H 4XTRC 2DLEA 2R4SH 4IIQB 3T8XA 3VD4A 4M7LT 3WV0A 3HRPA 5FKPA 3KPLB 4HFUH 1G9EA 4YGAB 3MRCA 4AH2A 3QNXA 5C07B 3EGSB 5IFJA 1SQ2N 1VFAA 2WUBL 3DMMB 4JO2L 1FZOB 4Z7WA 2NY7L 3KPSB 3ARBA 3TT3H 5C07E 2AXFB 1CXFA 4HGMA 4ISVA 5BVPL 5FYKE 3PGDB 4BQ6A 2YHGA 3EYSH 2ESVE 2AJZB 1MAMH 5TDNB 3BGFB 4HUKB 3H9SD 5L8LB 1SJEB 4MLSA 3U7WH 3LAFA 1U8PB 2ICWA 4DGYL 4N9GB 3ARFD 4I0PA 1YEIL 2UWEA 3A0OA 3CFDA 4HUVA 5BV7C 1NCUA 5FYKH 1AXTH 3OKDB 5DRXB 4NQSB 4K9EL 4NSKB 1DBBH 1REIA 2RBLA 3QUYA 1FSKC 4M03A 2G75B 5INCA 5GS3A 2N1KA 3AMKA 3ARWA 1QPXA 4WDIB 2ITCB 2BY2A 2DYPA 3PL6B 5JOPD 1ADQL 3O8XD 4ZS6D 2QSQA 1IM9D 3GO1L 3QFDA 4XPGL 3TO2B 2OZ4H 1DUZB 4JFPB 1FDLH 2DJUA 1AR1D 1P6AB 1RJYA 4R96B 4XNUL 1YEIH 3FAXA 2GUOB 4PJEB 4GQ9L 5JW4M 1U92B 4LF3A 4Y19D 1OAYL 4TOYL 4MD0B 3FO0H 3MO1B 3FFDB 1Q9OB 1L6XA 4OT1H 2OMNA 5ESVA 4K7PX 1A6VL 1UA6H 2A0LC 1ADQH 1C12B 5I1JH 2OTPA 3P77B 1VB9A 3H6JA 4R4BA 1KIRB 3I75A 3BSZL 2IANB 2GITB 3QT2A 4ODVH 4YFEA 3EO0B 3HLAA 2BNUA 1NGQH 1P7KA 2X4NA 4XCNA 3VRLE 1P4BH 4JQIH 3VRJB 3BZEA 5I1EL 3SJVE 5EOTB 4U1LA 1X5ZA 1UQSA 2R4RH 1FGNH 3MRBB 1SJVA 1KJ2A 1WBZB 1JK8A 5C0AE 3QUZB 1NAMA 3BIKA 4YR6B 4DWHA 1A7QH 5E94A 4Y4KD 5I74B 3AU1A 3BEVB 3I6KB 3AS3A 4C56E 4BUGA 5L2KA 3ZHLA 5GGUA 3MJ9A 2F54D 3GSVA 4PJBB 1DE4A 3NCFB 4LKXB 1JPTH 3QXTA 1NCDH 3X3GH 1AR1C 2FGZA 2XG5A 4KJWC 3QO1B 1CICC 3FOLB 3O3UN 2E27H 3GSXB 5DLMH 1MJ7L 4OIAA 4XAKD 2HFEB 5IBLD 5JNYB 1FYTD 1MHCB 3DMMD 4LOUD 3P73A 3KPPA 3UBXB 3M07A 4DN3H 3VD5A 1BAFH 4WGWB 5C0EB 3LS5L 3LS5H 1OAKH 3QG7H 4JFEB 2UZYB 2D9CA 4YBLC 1WGOA 3IJYB 4OF8A 1E27B 2VH5H 2RR3A 4PRHE 5DUML 3TT1H 3KLSA 4K7FA 5F9WC 4R97B 4KQ4L 5FB8A 4OCLC 3GHBL 3Q6GL 2IAMA 3VWKB 3U4BH 5HBBA 4HH8A 4R4FL 4LAQH 3SJVB 2MMXA 4QNPF 1DUYB 1AP2B 1UM6H 4KKAC 3DX8A 1IRAY 4HX1B 4WU7A 5E6YA 4KKCC 4NBZB 3U46A 1Q9LB 1QYGL 3IAQA 4B7IA 5I16B 5FKPB 3U83A 4B41A 2BJML 3KPLA 1FL3A 3LH2H 1MCNA 4KGJA 5IROC 5SWSE 5I1LA 4LIQL 1CG9B 4YEEA 4KKBC 4AH2B 3EGSA 5IFJB 1U6AH 2ADJA 4FA8A 1JN6B 1S7UB 4QHLB 2DBJA 1ZT7A 2MSPA 4PBXA 3IS0X 3CFKA 1AKJD 5DEZA 5H94A 2DMKA 4NCC2 4DFIA 5EIIA 5CZXD 1F6AB 3VXUB 3RFZC 4I9WE 4K3EH 2QKIB 2QLVB 2YS4A 4XP9H 5L8JB 4PGBA 3BPLC 2YD6A 1S9YA 3JTTB 4HBQA 3TJEL 3D85D 1EXUB 5D1ZC 1PAMA 1U8PA 3KVQA 1EZVY 4PPTA 1L7IH 1A2YB 1DQLL 5T1MB 4D94A 2XWTB 1RHHA 5F3BB 4HKXB 5BVJB 3S3JA 3CX2A 4R7DA 1U8HA 2BVPB 2DYPB 3DROA 2F58L 1T04B 1FC1A 3RIFK 4YHZL 1JPFA 1KPRB 1ZV5A 2HYMA 4ODXB 3WXWH 1S3KH 4JZJB 4LHUB 3VXQA 3TESA 1WFNA 1YEEL 2YPLB 5KAQG 1JPGB 4NT6B 1M05A 2VERN 2Z9TA 1MCKA 1SYSB 4BZ2H 1TETH 4UQ3A 3BQUC 3K7UA 4JGMA 4KUCF 3IFPA 3UPRB 1YEFL 3CLEH 1ZT4A 1FVCA 4YFDB 5GISL 1ZWIA 5E5MB 4OZGF 3ESUF 2DAVA 4XBPA 5FV1L 3W82A 2H2SC 2WSKA 2HG5B 3NABH 1T20A 4LNRA 3U7WL 1C5CL 3IDYC 3KLHC 4K2UH 3SY0A 3SCMA 2BVEA 1FORL 1TJIH 1G9NL 1LP9A 3E2HB 3BWUC 4M1DL 3VFOB 3TVMB 3QDGB 4XXCA 2BSRA 4OLXH 2NY7H 3OKEB 1JK8B 1QSEA 1PDKA 2E5EA 4QRRA 4CW1B 1W0VB 1RUAL 4K3JH 4AIZA 5IVXB 3A6OA 5ACMA 1VACB 4P5TB 4YDIL 2IQ9L 5DA0B 4J3WA 4Y1AA 5GRJL 4KVNL 3OKMB 5LBSL 4PV8B 5HDBF 4J8RB 1GVIA 4XPTH 3N1GC 5E2UL 3V4PH 1RZIB 2R56H 2AJYH 4O2EB 1JHLL 3GJFH 1KCSH 4OCWL 1T7YA 4PJBA 2X70A 4UTAL 1JGUH 4UTBL 1MWAH 1KELH 2Y5EA 3I6GB 1FE8L 3GMMB 4OT1L 4KZDH 2ADFL 4MNQA 3FO0L 4MA3A 3D69B 3B8SA 3G08A 2PW2A 2ZUYA 5DMJB 1EJOH 4M5YH 2VXQH 1ORSA 4P3DB 5IB4A 5T1LB 3T2PA 5DD5H 3CDCA 4O2FB 4EUPG 2VXVL 4R26L 2BY3A 2IWGA 1QLFB 2OR9L 4ODVL 1BZ7A 1YJDH 1Q9WB 4RCAA 1ERNA 1PG7L 1A3LH 3EJYC 2Y7QB 5FYLH 4KUZL 3WD5H 1UCBL 4YDVB 4ZSOB 1PZ5B 1Q72H 4HJGA 1J8KA 2G5RA 4YQXH 5EZJB 5HI4C 3TYFB 1JNLL 4IMKC 4KV5F 4PRHA 4FXKA 4G6JH 2P8LB 1IAIH 2XY1A 3VGBA 5I15L 1HOCA 4N0FA 3LKRA 4PBVC 4ZTOL 2Y07L 1U58A 4PRAA 4JQIL 4HKBA 5DK3A 2VYRE 4Y16A 3KPMB 2VXUH 1K5NA 3QIWD 4HUMB 2ADJB 3VA6A 4KZEL 2AJ3B 4I18B 5FK9A 4PR5B 3TT3L 3LMJH 4XCEA 3CFKB 1JNJA 4XNXL 1KJ2H 4OBSA 1NANI 5EUKA 2CLZA 4O5LL 5FO9B 5MI0C 5FFLA 3FO1A 2LU7A 5HGGS 1ZVSA 2NY5L 4OUOA 4G9FD 3ZSTA 3DUSB 3U0PA 5D1QA 1FSKB 1T03L 5L7XL 4UOW0 1NLBH 5DQ9B 4NO5B 1F2XK 1CGUA 1A4JA 1MELA 3VXRE 3G6JF 4M3JA 3VFNA 4IEFB 5FCUH 4IDJL 2M1KA 3G5ZA 2AP2A 4KK6C 4DN4H 3RWEA 4NUJA 4HUXB 2B4CL 3QEHB 1U8NA 2VUYA 3BPNB 3PJSA 3WFCL 1UH2A 4JFQB 1PSKH 1DN2A 4POUB 2DD8H 4LEXL 5ICYA 3QQ3B 4X6EB 5FHBH 1C5CH 3RZCC 3LB6C 5IHUH 1N5AB 4TNVF 1YPZF 5D72H 2PUQT 3SE8H 3BKYL 3FQWA 2XV6B 3V7AG 4NRZA 1X6LA 2VDLH 4J3SA 4O00A 1VERA 2FIKB 4QRQA 4YHPA 5I1KH 5IW6A 1S7VA 3MV01 3QYCA 4ESKA 1EBPA 2X9XA 2VZ1A 5D6DA 4JM2B 3SQBA 3ZT5A 3CFEB 4JJ5A 1DBAL 1QR1B 4JR9H 2DWEA 1ES0A 2FX7L 1OM3H 2OL3B 4R0LC 1T1ZA 1S3KL 1I8LC 2UVEA 4FABH 4LLQA 5D7IA 4U0QB 3C5SA 5IQ9B 2HJFA 3UJTL 5C0FB 4BJLA 3OHXB 4F7EA 2HFFB 1EEZB 2H1PL 2XZQH 1L0QA 2DI8A 3QDGA 1WV7T 2ZG1A 4HS6A 1I9JL 2F5BH 5BZWA 3O2DL 1OGAB 4KJYB 1J0JA 3B2UD 1BOGB 3L95A 3LEVH 4M1CC 5SWQB 1A6TB 3ZDYF 3BP5B 1ODAA 3IAPA 4P5TA 4OSUL 1G0XA 4M6OH 4FFVC 1NBYB 1C8PA 1A02N 1U8IA 3LIZL 3QRFM 3MRRA 3ULVL 1E6JL 2CMRL 4DUVA 2Q6WA 2FJGB 5JPNA 2H3NB 4WV1C 5GJSH 1BFVH 2H9GA 4D8PB 4P2YA 1BBJB 1TETL 1EHNA 1JNHB 4G42B 3PWLB 1INEH 1WC7B 3F7VA 2J8UE 1FZKB 4NJ9H 3ZTNL 5H2BB 4M6OL 4Z76A 4RAVB 3O45A 3TJEH 2CDEA 3GKZA 5A2LH 3VI3E 3CMOH 3KPNB 5EO0A 3NCEB 2VQ1B 4FQIH 5KSBB 4YHML 1A6AB 1JF1A 2A6KB 4GMSH 2MQ0A 4YFLF 5C0BB 1UM5H 4HIXH 4L4VE 1U8MB 3QWRA 3C6LB 4LVHB 2DTSA 3V5HB 4D0CA 1KG0B 3EOYG 4LHUG 3VCLA 3IFOB 3MNVA 5FDWB 3L3KB 2P47B 4P2OB 2P8LA 4L1HA 4Z0XA 1AXSA 2K9UA 2ERJC 5C71A 3U79A 3PGCA 1F11B 4MJ5B 2VXVH 1MI5B 1SYVA 2EXWD 1F3RB 3HRZA 2ZG2A 3O9WB 4L8BB 5F72S 4ZUVB 4UNVA 1AGBB 3RVVC 2GSIA 4Y16B 1WEJH 4I8DA 2QSCL 2ADGB 5AG9A 1N7MH 2R56L 2D31B 1NCBH 5E99H 5CBEB 3P11L 3M1BA 2FX9H 5JXAL 4F9LC 3S3SA 1YUHA 7FABH 3DX9A 1OB1A 3EYQD 1W72H 1FAIH 2Z8SA 3MXVL 2D7PA 3O8XC 1GPOL 4ZS6C 1IAOB 1IQWL 3RJQB 4UBDD 3I2CH 3K4ZA 1A9BA 5J89A 1KGCE 2K7QA 1ZGLA 5D9SA 4X7SL 1UXSA 5D7IE 5HHPA 4PYGA 5E6IB 3HUJB 4NNPL 4X6FB 2YD9A 1MLBA 3THMH 2BC4A 4JDZA 4YHKL 5EBMB 2R1WB 3X12A 5INDB 3RIFF 3RWFA 3PDGA 3HMXL 3IKCB 4Y5YB 4LMQI 4YZFE 5MENE 2IQAA 1KJMB 1RZ8A 2AJVH 3ZT6A 3QHFL 4NZTL 1UGNA 1T83C 3QQ3A 4X6EA 4FMFA 3FQRA 4KKBD 5B3JE 1QLRB 1DQQA 1E0OB 3N1PC 5HHNA 4QOKB 3CVHH 2BHZA 4P23B 4QRUB 4PS4H 1JTOA 3FQWB 2Z8RA 1INDH 5CZXC 3LV3A 4WFED 2W60B 4K23L 5JOEA 4ZFOA 4H8WC 1TJHH 3RVVD 4ZUUB 3TN0D 1AGEA 4PJCA 1WZKA 1MCDA 3CFEA 4JJ5B 3ALPA 4NKMB 4YNYA 4AIOA 3GSOA 2IPTL 3ULUF 4LIQE 1F5WA 4I3SL 2YA1A 5KZCD 3BUYA 3ULVE 5FGBA 4H88H 1H8SA 3MRGA 1U42A 4LLQB 3S5LB 3MJ7B 4GO6B 3QUXA 4ONHB 3VXMA 2ZZUT 2NY3C 3C6SA 3RWJB 3T0EB 3DX7A 4O9HL 1D5XB 2YRZA 5BV7B 5BS0D 2VDOL 4HPOL 3BE1H 4MD5A 5F8RC 4N0UA 4M93B 2L4OA 2IFGA 3I50L 1OGAA 4KJYA 4ZD3H 4AENA 4MDJA 3ZT7A 2ESVD 3HR6A 1IBGH 2L0DA 3QDGE 3INUH 3RUGA 5I6XC 1I3VA 1J1OL 1FNEA 4HD9A 1YEDA 3KNBA 1U8IB 2QSTA 3MRCB 3QNXB 3F5WA 1FJ1A 4PRIA 4PJAE 4XMLH 3SDAB 1RUQH 3A6BH 2ZCLH 4AM0A 2AXFA 3HE6C 4UILH 5KVDH 2JCCE 1K4DB 3F7VB 4TQEH 2XTJC 3PGDA 4L9LC 1HK6A 2GJZB 1MUJA 4RWYL 4OSUH 3QWQB 3ROOB 4OFDA 3HPJA 2P7TB 1NC2A 5C3TA 3RBSA 4JKWA 4LLAA 2KQNA 4OLVL 3BRDA 1A6AA 5JHDA 2NR6D 5BW7A 1ZANH 4QWWC 3LQAH 3AMLA 1FQ9C 1HKLH 3UZVB 1G7MA 3CFJA 4WDIA 4GKZB 4XCCL 3OKLA 4OM0H 3WN5B 5TQ0L 1GH7A 4QXGL 2IQ9H 4PJ9A 5T5FL 1UADC 3S3PA 5GGVH 4WW1B 1AIFB 2YOCA 2ATKB 3RGVD 3NAAH 1DUZA 4PJFB 2VDQL 2VDQH 4UT9L 4Z7QE 1S9VA 3HNSL 1DBJH 3SJVD 3BFOA 3U6RA 4AEHH 3QJFA 3MXWH 1I7ZA 2ESVA 1EFQA 2YZ1A 3ES6B 3MLRH 2WINA 1BOYA 1G7LA 4NKOA 5HHOE 1KN2H 4K7PL 2EDYA 1U3ZA 1CICB 4P5KA 1YUHB 1H3WM 3TV3H 3S37H 3DUUA 4RA3A 4OJFL 5F70A 2PN5A 1CFNA 4X6CA 2BNUB 1OAXH 2EC9T 4ZFZA 5KG9A 1RULL 5EFIA 1I1FB 5IEKA 4NHUB 4MJ6B 1TZIA 2JCCB 1NGZA 3L5XL 3HE7C 3BPNC 3ARXA 2I9LB 2JB6A 3D3VB 5F9AC 2VAAB 1WAAF 2BSTA 5HHQB 1ZS8B 1NSNL 2NY4D 4Q9RL 5IMLB 3EO1B 4LKCA 5BJTB 1H0DB 3EFDH 1MJ8L 3JWDH 4N0UE 2OK0H 5JUEH 4XVTL 4QWWD 1UM4L 4LLDB 3B9KB 3CK0H 4YIQB 1KIQB 4NQCA 3VMOA 4YR6A 4QHKI 2EYTB 4GW4B 3P4NA 3DETC 4IRJA 5ALCH 2HFTA 4NKQB 4OGAC 4Q6YA 1CBVL 4HQQH 2C3VA 3OKOA 5DHVH 3QUZD 2RQ8A 3O3AA 4E5XA 3GSRB 4QTHB 3V7MA 4PJ9D 1NL0H 1EUTA 1S5HB 3NA9L 5D1XC 2IH1B 4OI8A 4WUUB 2R23A 3DIFA 4WI9A 4NDMB 5ESAB 2VN7A 4Z7NF 1AE6L 4PTTB 5KVEL 1FG9C 4X8JB 3D0VA 3PP3K 1NANH 3QUKB 4NKMA 3Q2CA 4K3EL 5SWZE 5EUOE 4EIZC 3VGEA 2BY1A 4PGCB 4L1DA 4RSVA 3I9GH 3UDWC 3SE9L 2J7LA 2DIAA 1J5OL 1OP3H 4X5XA 3FO9A 3DX7B 3P0YL 3TLRA 4KUZH 2VXTL 1OARH 1S5IL 5EA0H 5FUOL 5C0AB 5ENWB 1IAII 2O61B 3MUY1 2GSGB 3SE3A 3AAZB 4Q6IC 1N64H 1V3LA 4J3TA 5I16A 1UVQB 5DUPL 3CDGA 3F8UB 4PUBH 1EA9C 1JWMB 5I1LB 3FONB 3QZWA 3TWCH 3SDAA 2I5YL 3S34L 3JV4A 1IAMA 1IFHH 4XCCH 1QFOA 4AM0B 4PRPE 4FQ2L 3VXUA 4OAWB 3OKYA 2CJUH 3T4AA 1J8HD 2BFVL 1VGEH 1YPZA 1LK2B 1WBYB 1BZ9B 4JFZL 3H3BC 4K71B 1EXUA 2ZCKL 4RMRA 3LRHA 5IW1B 3QUML 3RWIA 3DBXB 2E9IA 2X1XR 2YK1H 2XZQL 2OX5A 4JFDA 4DTGL 1FCGA 4L4JA 1F58L 1H5BA 3WJJC 2AEQL 2GKIA 1I8MA 2EYRA 1FRGH 2QQLH 1A6ZB 5F3BA 5SX5H 4FFVD 3ARVA 2VABB 4P9HC 1KT2A 3GGWA 4XZUA 1AC0A 1RHFA 2X4QB 4PJ8B 4I0PD 4U6XA 2E3VA 3UC0L 3BH9B 5FGCB 2DD8L 4EOWH 4ODXA 4NOFA 5GRVK 5IB1A 2CQVA 3BD4A 3MOBL 2NX5A 5IWLA 5ALBL 4U31A 3V7AE 3GMPB 1A3QA 3VG9C 3RWHA 5DC4B 3U6RB 2QSCH 3KS0J 2X4PA 5SX4I 2QHRL 4Y7MA 4N1HB 1OGTA 1UKSA 4JAMA 4YDLB 5FCSH 5HGAA 1I7ZB 4UQ3B 1QSED 3CXHJ 3NN8A 1XZ0B 1ZLVH 1IGJB 1NFDE 1G7LB 3Q5TA 4NKOB 4F7TB 1QD0A 2OTWA 1GZPA 1R3HA 5IVXF 3MV9D 3PQYD 5C08A 3TPUB 3U9UB 1CFQB 3UO1L 1A64A 3L9RB 1CD0A 1CFNB 5I1DA 4G8GE 2EECA 4Z9KB 5GS0H 4Z77B 3F7YB 1BX2A 3O0RH 3VWJA 1TZIB 3RTQD 1RZGA 4X98B 4NM8H 4Q6IB 2H2PD 2ARJQ 3L6FA 1F4YL 3FN0L 3FQTA 4JRYB 5HHQA 2C3WA 4DKDC 4ORGB 1H0DA 2JIXB 3EHBD 4FRWA 2AABH 1CF8H 3BH8A 4JFFB 4HDIA 2DRUA 1HHGB 3RZWA 4UUJB 4MZ2A 4C56B 1I1AD 1CVRA 5HI5D 4Y0GA 3CLFH 1C7SA 2VLRA 4KU1A 1DBBL 3LN5A 5CUSL 2VXUL 4H25B 4L3CA 4ETQB 5LJYH 2X70B 1DR9A 5IOPA 2R69L 2IH1A 1MQ8A 4BELD 3DV4A 4GKNB 1OLZA 5HDBE 1OAQH 3P4MA 4PG9A 1LD9A 4TYUA 3L1OL 4JRXD 3VXUE 4NDMA 4DGIL 1F8TH 2VUOA 4E0RB 1KULA 1IEHA 3TH4T 5HGBA 4W4OA 2CK2A 3KXFA 2BRRL 3U30C 4O2FA 4K3GA 1ZGLM 1NBQA 4FABL 1WSST 3UTPD 3D9AL 5DUBB 1BZ7B 3LVEA 2A9NH 2UWEF 4U6YA 3RI5F 1Z3GL 4H26A 3LKPA 5AWNL 3AGVA 2R1XA 4G8FB 4U1MA 4FQXD 4X6DB 3RDTB 3RU8L 3MA7B 2PYED 1IGML 4V1DB 3B4NA 1WISA 1S7WA 3BVNA 3D3VD 2NYYC 5FOJA 1UM4H 3DVGB 4HV8B 1QZ1A 2HAZA 1F4WH 1SY6H 2YKLL 5GJTH 3VWJC 2DQFB 2NX5E 1BPVA 2X4UA 2Y6SC 1HIMH 1QO3B 3AAZA 4NO3A 4L3ED 5DJYB 2Q7YB 5IFAH 4PJ7F 3WNPA 3MRMB 1H3GA 3GMLA 3PP4H 4FZ8L 5DA4A 3RUGF 2ZOKA 1RIHL 3H7BB 4UNUA 1YDPB 4JPWL 3PABA 4KTYA 1OTTC 4K8RL 3FRUB 5TPWL 1X4ZA 1XGPA 3O2VL 2LTQB 4GUPA 1SEBB 3X3FL 5DEFA 4PBWD 3S37L 5JXAH 4MQSB 5FF6B 1J1XH 2NZIA 5GJTL 3BRFA 1F4WL 2QADC 5C3LD 1RZ7L 3QHZL 3QA3B 5IFAL 2P8MA 5HI3D 4L29B 4NO5A 1Q9KA 5AEAA 3RWGA 1AD9B 1M7DA 5EORH 1H15B 1QSFB 4ZPTA 1GOHA 3BESR 4XNXH 4IOSD 2YBRB 2A73A 4NUJB 4UINL 4W4OC 1R0AH 3EOAB 4NO0D 5C2BL 2HH0H 3BQUA 2F53B 5ICYB 4ONGH 1ETZB 4XVUC 1VFOA 2BHUA 4PJHA 3UJJL 3EYVA 5FGRA 1XIWB 4XWOC 1I9IL 2A9ML 3VDAA 2PR4L 1GAFH 2P5EE 4LCCA 5EORL 4BZYA 3H9ZA 2FIKA 4XH2B 4KTDH 4MA7L 3RVXD 2AS5M 4HK0A 5GSRA 3N0PB 1D5MA 1UENA 1T1WB 4V1DD 4JM2A 2AK1L 4MX7A 2R39A 1B3JA 3IXTA 1ONQB 4FFYL 2GAZA 3IJHA 5DJ6A 5C08B 2HVJA 3MUZ1 4LCUB 3MFFA 1NFDA 3NIFF 3S98A 5GGTA 4KK6D 1EERB 5GS0C 2AK4A 2ZNXA 1DQLH 4L4TB 4OZHE 3QHTC 4X98A 2H26B 3MLTA 3ARDA 5E9DD 1QBBA 1OP9A 1ZLWK 4KRLB 1WBXA 3TN0A 2WLZA 1FE8H 1J88A 1GZQB 4HS3B 1A7RL 3RTQB 5JOPE 4KRPB 3EYOB 1BEYL 4KMLB 2EIZA 2VLME 1TVHA 1EJOL 4M5YL 1RURL 4G7VL 3T0ED 2R8SL 5GS1A 3VGGA 4L8SC 1TPXB 3LPFA 3GDBA 1RIVL 3ILPB 5ALCL 3NCBB 2ZCKH 1T89A 1WCQA 1P7QA 4OIIL 4UU9A 3WIHL 4Z7VE 1PKQE 4JHZA 4CBPA 4FQJL 2WWMD 4QEGA 2Q8BL 4FFZH 4G43A 5JQ6L 3MGTB 3G04B 1ZAGA 3KPSA 3KYMA 3SGDH 5DFTA 2NY0D 5GS2D 1T3FB 3O4LA 5GRXG 2FD6L 3JZ7A 4KPHH 3MPCA 2Q8AH 4D9LL 3P30L 3V6BR 3FJTA 5F7LB 3B5GA 2AJZA 4F58H 4X7DC 2KUTA 5EO0B 1NBVH 4WHYH 3OMZA 1XGRB 3AM8C 4KKCD 4I0PB 2W0FA 3K81A 4M61B 2YPLD 4YHLL 4M8QA 4G80B 5DRXA 1VKXA 4NSKA 1IM3B 3GMNA 3LKSA 3V0VB 3B2UC 5EN2B 1PJ9A 3WLWC 3V5HA 5T3ZH 2HKHL 2XNAB 2XRAL 3TZVA 2F8VA 3IF1A 5E95B 3BVNB 3E1F1 3CD4A 2BNQE 4O51B 2KDGA 3NIGE 5DFVC 2ZUTA 3DGGA 1F11A 1QKZL 1VFBB 1KCRH 3OXRA 4WV1B 1KFAL 3V5KA 4HPYH 2V2WB 5D7LB 1KB9J 4TSBL 1CZ8H 4EN3A 5E56A 3NCMA 1HI6A 2W0LA 2GK0A 5CBEA 2P5WD 1EK3A 3DO7B 1EHLH 4DK6A 3PWUA 1DFBL 1YDPA 2C1OA 3D0LA 3UYPA 1CXIA 4L8SA 3SDAC 3WUWA 2CUHA 3P77A 4Q0XH 4R4BB 3TCXA 4AEIH 2VMFA 1B0GA 3VG0L 2EO9A 1F3DH 1HEZB 2HN7B 5IB2A 1CLZL 1T1XB 4PYHA 1PEZA 3HS0B 3ARGD 1FFOA 3LKOA 3QPQD 1MLBB 4P2OD 4WFEE 3MRBA 9CGTA 1UJ3A 3O6FC 2AEIT 5HSFA 3H2WA 1KCKA 2NY1D 3ZZ1A 3U36B 5I71B 2LFGA 2C9AA 3TC9A 1RZ8B 2ZUXA 2YMXL 3BIKB 4JRXA 3BQUB 3LSOA 5E94B 4Z7WF 2WQ8A 3FQXA 2H2SD 1MVFA 4LQFL 4CVUA 3VI4E 3SKOA 1I8LA 1OAZL 3IFNL 4YHMH 3VE0B 5ID0A 1OF2A 1YNTA 4XH2A 3ZE1F 3JXAA 4FFWD 3RI5K 1S9WB 1T1WA 1BVKA 4EBQL 2W65A 4KK8C 3D2UA 4IHOA 3P73B 2W07A 3DX6B 1NUDA 3FQNA 5F1IA 3IXTB 4RZCB 5C0EA 4PJHF 1I3GL 1RK1A 2IANE 4MNGB 3F12A 3UJJH 2R0KH 4QRPE 1DZBA 3IJYA 3HZVA 4KFZC 3TEUA 3HNTH 3MMEA 1WFTA 4BFEA 3TT1L 1WZLA 3T0XA 3WJLA 4N0CC 4MZ3A 4ZTPL 3DYOA 5HGHB 1U8JB 3GM8A 3VFMA 3ARDB 4L4VA 2FEDC 2IAMB 2E8ZA 2VJXA 8FABB 1Q94B 4NN5C 3DYPA 3MV8A 1GZQA 4X4ZA 5JUEL 1FNSH 1FFNB 1N6QH 2R4SL 1CDCA 4WCYH 3DX8B 3RBGA 4CVXA 2Z4QB 4M9PA 1TVHB 5ETUA 2G60H 4WY7H 2X9YA 5IHUL 4GKSA 4X9BA 5F3HA 4FXGA 4OD2A 1FLRL 2DLFH 1G7HB 2JJSC 3MGAA 5F89A 5KSUB 4KJWD 5IF0A 1CICD 2GYSA 3TH2T 4H0GA 2J8UB 4EUPB 3EDKA 2X1OA 1KB5B 5JDJA 1ZT7B 5AG8A 1YEGL 4OCSH 4AG4H 4ZAKD 3MGTA 4JO4H 4PJFF 3V79C 3LY6A 1A7NH 4WFGD 4NN7C 4MYWB 5EIIB 1N6QL 1KYOK 4WHTB 1MFCL 4PJIA 1K4DA 3WUZA 3OXSB 4XP4H 2Z93B 4NBYB 2NW3B 4GSDL 3MLPA 3MYZA 3JV0A 3GKWL 1VGEL 1OP3K 1T0PB 1HQRA 2MPAH 5JORA 1B2WH 3C08L 5JIPA 1DBJL 5BZDB 4DZBB 3RVUC 5EZLA 3EOTL 4J4PA 1OGAE 4HZLA 2DKUA 1ED3A 3L7EB 5FGSA 4JFXB 4FFZL 3V0VA 1WT5A 1G7MB 4QRRD 3P11H 1LDPL 2FB4H 4P2RB 4XNQB 5EU7C 1ZVHA 2BVPA 4DEPC 3VXSA 4JB9L 4JM2D 4PJDA 1FO0A 1JMXA 1GGIL 2I26N 2APFA 4PJ9B 4PRIE 2QBWA 5I2IA 1TMCB 2AI0H 3QXDB 3H0TB 1YECL 1X5GA 2DTML 2YD7A 4M8VA 3GSQA 5CWSB 4HWNA 3CMOL 3DVNA 4M6MH 4NT6A 3QG6B 2AJSH 1IM9A 1ZXQA 5J1AA 5M95B 1FV1B 1GGIH 5DHYB 5IMMA 1OL0A 1L9MA 1CICA 3MLWL 1A3RH 4LPYA 1T4KA 4UOJA 4PD4K 5JHDE 4IJ3C 1QPPA 1QBAA 4BH8B 2DWDB 3OPZL 4PGEA 1UG9A 2XWJB 3SY0B 4OLWH 5CILH 1L7IL 2VIRB 2HJKB 3V0AC 3IU4L 1H8NA 1LP9B 2YWYA 5A40E 5B39B 2GHWB 3H42L 3PQYA 4ZDHB 1FFOB 5DHVA 8CGTA 3O0RL 1KCUL 1BJ1H 1S7TB 3IKKA 4I48A 2VDRH 2A0LD 4PV9B 1W0VA 4PRBB 5JR1L 1W72B 4NQEE 4NQCB 4CNIB 4JLRB 4Y1AB 4FQ1L 5BVPH 5IBLC 3VH8G 3RX5A 4GW4A 4J4PC 3P4NB 4PD4J 3MC0A 3TIEA 4GAJL 3BZFA 1DLFL 4EVNB 1YNKH 2F19L 1OT1A 5FA4A 2ED7A 3ZKQD 3E6HB 5GZOD 1GC1H 2AV7A 1A7BA 1SJHB 4HCRA 4JFFE 4NPYA 4WWKB 5JQ6H 1ZHNA 5H8DA 2DMCA 5IROA 3OJ2C 1HZHH 1NKRA 5TPWH 2JB5L 2R9HC 5CP7A 3U9PL 4JQVC 3D69A 2HJLB 4EXKA 5JA9A 1V7NL 4ZUTB 1ZHLB 2VXQL 3ZLQC 4CMMB 2DBLH 4PTTA 5T1LA 3MRPB 3D18A 3KWWA 2C3XA 5HVFB 2FHFA 3GNML 2VH5L 4NQDB 1ZHKB 1GC1L 3RZCB 3WFBL 1BQLH 2G5BA 3WMSA 3UYOD 1KNOA 4Y4HD 2MQCA 5AD0B 2FHBA 4YFLI 5EOCJ 3V95A 4PJ5D 5C0IB 5DT1H 3BUTA 5E08H 1U8JA 4FNLH 4X7TB 3U7YH 5AAMA 4JGUA 1FL6B 1FZJB 5FAAA 1FFQA 4FS0A 4PG2A 3GBMH 4JN2B 1RURH 3F58H 4XNZC 4FQQB 3ETBF 1CQKA 4N0FB 2X10A 2RHEA 1VEOA 3HC3H 3DGCR 3NCCB 1MJJB 4JEGB 3RKPA 4Y5XB 4NQVA 4U0RC 4F15C 3WIHH 3ZYOA 3WSQH 3VRIB 2MJWA 3SDYH 4P9ML 3B8YA 5GHWL 5T3ZD 4NRYB 2FJHB 5SWZA 1ZHBA 4OCMC 1ZANL 1F97A 2AJ3A 5JMRA 5FK9B 3QZWG 3HB3C 4YAQB 4TTGA 1YNLL 1H3PL 2XKNA 2EE2A 3IDYB 3QUXD 5IJVB 4HHAB 4CAGA 3VXNA 4BFGA 3HZMA 4EJ1C 1Y18A 2BRRH 1IEAB 2Y07H 3U0PB 4LVNB 4PJIE 5DQDL 5F8QC 5JORB 5I1AB 3LCYA 5MEPA 5CINH 4L3AA 1TLKA 1G6RH 3HUJF 3MRJB 4XBEL 2EYRB 3BW9B 1J0YA 1NL0L 1W0WA 3LHPL 1NBZB 4U1HB 4X6CF 5IQ7L 5EOQL 2ITCA 1PGRB 3KYNA 4NWTH 1FO0B 1CFTB 5F21B 2HH0L 4HFWA 3T09A 4ZQKA 3O6KH 1IGFL 4NQXA 2R2BA 3UTSE 3H0TA 2QQNL 2BK8A 3TO2A 4D3CH 4HAGA 4IRSA 2Y1VA 1TVBB 1OAZH 2AQ1A 2FECL 4DCQB 5J9PA 1U8LB 4HCRH 3OKKA 1NGXA 4CVZB 4GAYA 4N0YH 4PG2C 2FL5A 1JCKA 1HNGA 2VB5A 4HKZA 3WO4C 3UP1A 3KDMB 2CLVB 3OR7A 3E0GA 2F54B 4K2UL 4XX1E 1T1ZB 4DN3L 3BO8A 1OCWH 4KHXH 3L9RA 2ED8A 2EICA 1N8ZA 3I02B 3SE8L 5C0DB 5IQ9A 4G6ML 3T04D 5I30L 3MREB 1HXYB 1RUML 4ORZC 3S36X 5JLZA 1EEZA 1RIUH 3BZEB 5MEOA 4MAYD 3QBTB 5DHVB 1WCBA 4LCWB 3VD3A 4JRYE 3KJ4B 1A14L 3WFCH 5FUCE 5I0DA 5DFVD 2DI7A 3VXUD 4D0BA 4GRWF 4W81A 5T33H 1KJVA 2H41A 2AXGB 3D85A 3RJDA 5E70A 1F3JB 1CLOH 1FBIH 1JV5B 3PE9A 3T2NL 1CGTA 1RZJH 4NJAL 3MRRB 4N68A 4Y89A 3LQMA 3WHXB 3VXOA 4OIIH 2MNUA 2W0PA 1N2RB 3ARQA 5C08E 3S5LG 5I66B 2OBGA 4XCFL 5GS2H 5J3HC 4MB5A 2CDFB 1NCTA 4U1KA 5H2BA 5EG6C 4MAYA 5D7SH 3HR5A 1R5VB 3G5XA 1ZHLA 4Z95H 2Q8AL 4D9LH 3VFSA 4OZIF 5FM4A 3KPPB 2CDEB 4C83B 1JWSA 1Z5LB 1XH3B 5MERB 2ICWB 1KGCD 3NA4A 3QR2A 3R1GL 1VCAA 4ONOA 4F9PA 1NMBL 3L3HA 3ZTJH 5MEQA 1DLFH 4JHAH 1S78C 2CIKA 2R1XB 4U1MB 5JO5A 2HFGH 4AY0A 1ZGLP 4NHCH 1G7PA 3OBAA 5MEND 2AJUH 3C6LA 4Q7DA 4S1DC 4YH6A 3N9GL 3WJLC 4OF7A 4OGXL 1FCCA 2UZIH 4QXWA 2UWEE 4Z7UA 3U9PH 4QTIH 1S7WB 1T1YA 1G1YA 4P2OA 3VJ6A 3GMOA 4FZEL 5IMKB 1CGSL 1LK3L 2G60L 4WY7L 4HV8A 3REVB 3MTRA 1XR8A 3CNKA 1OSZB 1QFWI 4QF1B 1LO5B 4WFHD 4X6BA 4EIGB 5CINL 2Q7YA 4EZMA 3PP3H 5C70A 4H0HB 2R4RL 2JLLA 4JFHD 4UT7L 3VRIA 4KAQL 1CG9A 5HHMD 3VGAB 4PJEF 2ZP0T 1ZVYA 5LG1A 5SWZB 3FFDA 3MUGA 4NHCL 3MLVH 4RMSA 1D5BB 3EBAA 5D6CA 2EDLA 1MFAH 4OFIA 1KLGB 4OKDA 1LO4L 3N1FC 1QNZL 3T2OA 3VXNB 1EEYA 3VD7A 3BXNA 1GRWA 4PGBB 2X4SA 4EI5C 4HQQL 1A9BB 2BSED 4GRMB 2J3SA 1FHGA 2P8MB 4LPUA 2P5ED 4W68A 5JHLH 2SEBA 1EZVX 2WUCL 3X12B 1A2YA 4QYOA 4XNMB 3SDXF 4V1DE 3CGTA 5DD3L 4P2RE 1S7XA 2EKSA 3QO0B 5I74C 1A6UL 1AR2A 1FO0L 1RMFH 2NY2C 4BQCA 1RZ7H 3P3YA 1CFTA 4APQA 1JPFB 1KPRA 4PJHB 3TBVA 1DQQB 1VADB 1UB5B 3NFNA 2KZ1B 5GGUB 4JKPH 4P5TC 4ZAKC 3MRKA 4YHYC 4QRUA 2B4CC 3QEUA 1TQBC 1EPFA 5FGCE 1PX4A 3FB5A 3OX8A 1A0QH 3EYQC 1DVFD 3RWDB 3DV6A 3U4BL 3NFPB 1M1SA 1D5MB 1MQKH 5E24E 2X4RA 4KTEH 1OTUC 3V6ZB 4TVPD 4ONGL 2BCKB 4D9QE 1ZT4B 5KJRH 2BFVH 1CWVA 3VG0H 5DJZA 4XP1H 3H9HB 1RZJL 3GSUA 5IK3B 5C0BE 3K80A 2LAGB 4XCYB 3UTOA 3FO2B 1CXEA 1UXWB 1N8ZB 3I02A 4AMKH 2D2OA 4R97C 3V0WL 4OGAD 3EZJB 2FHCA 3SDYL 4EDWH 4EI5D 5BRZB 1HXYA 3MREA 2C1PA 1M71A 5GRVL 5IESH 2OTUA 3VWKA 3IS1X 1AD0B 2E7BA 2Q3AA 3UZEA 5DJ0B 3WS3B 4WU5B 3I50H 4OZGB 2EIZB 4K94L 5DSCB 4NKDA 3FMGL 5IVXA 4LLMB 2WZPD 2R2EA 4MHHI 1NMCC