4X98A

Immunoglobulin fc heterodimer variant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 39
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98A01
1I7UA 3WFDL 5I2IA 1NC4D 1DFBH 5GPRA 5A2IH 2VLME 4XMPL 2F58H 4C56D 1SJEB 2F5BH 3SDDC 2BVOA 1LWRA 2D7OA 2AEPL 5I1AA 3IGAA 1YDPA 3DNKA 4YNYA 1I3GH 4EUPA 5HHMD 4EOWH 2V7NB 1IGCL 2BNQB 1F90L 1A22B 3PQYB 3RZWA 3QEHB 3R0MA 3L5XH 1OP3K 1A2YA 3VFTB 4NQVB 1INEL 4R0LA 2XWTA 5FUOH 2OXGA 4TUOA 4OCYH 1EA9C 3ILQC 4U7MA 3GJFB 3KHQA 3HI5H 1VACB 1OP9A 3HE6D 4O02L 2D0GA 4OFIA 3OR6A 4ZNCD 1A02N 5FYKH 2OMBA 5TE6H 3PJSA 5H2BA 5BVJB 4PG2C 1M05A 5BRZE 4FTVB 1INQB 2J12B 4OM0L 1YMMA 5A3ID 1IEHA 5IMKB 4L8CB 2AXGB 4X4XA 2ED8A 1V3JA 3F6IA 3H0TA 1JGEB 1T89A 2Z31B 4MSWB 3NGBC 2J4WL 1KPUB 5HD8C 2A1WL 3ARRA 3GSQB 5D96B 2IPTH 4NM4L 1ZV5A 2NY7L 4DK3A 2PXYD 3GRWA 1WIUA 3SKMA 5D7SH 3DUSA 3HA0A 2BSRB 5FDWA 1TCMA 3OJ2C 3X3FL 1IGTB 3L3JB 4LLMB 5D9SB 4MX7A 3V6FA 4AH2A 1XR8B 1AR1D 3EHBD 3P0VL 4J6RL 4NQEA 1JPFB 4BQ6A 5IMLB 4WUUA 5JO5B 4IMKA 4PJIA 4S1RL 1QFUL 4QXUH 5SX5H 3VRLE 4AEEA 3QZWG 4P4RB 4D3CL 4OLWH 3QULA 1B88A 4QOKE 2ICCA 5IHUH 4DKFH 4HT1H 4U1HB 1GOHA 5HI5C 3HI1A 2DS4A 4OZGE 3CFKA 4AIOA 4F3FB 1KPRB 5HHOB 4MXVF 3D39D 4P2OA 5CS7A 3AS3A 1EEYB 1GL4B 2I5YH 4ODVL 1CFTB 4NBXB 4Z0BH 1RUML 3UTQB 1A1OA 1W0VA 3HG1E 1MQKL 5DZNA 2AV1A 3NPSC 4HLZH 3MC0A 4FMKA 4YHOL 1BZ7B 5AEAA 1R3LB 3JWOC 4FMFA 4NRYA 12E8L 2YK1H 3SQBA 2NY2C 3DXAD 5L6YL 4TULL 4HUNB 3BP4A 5FUZL 2FD6L 4LLWA 1M71B 1NLBH 4QRUB 1FYTD 1Z6JT 1MOEA 1N0LA 3IF1B 1N6UA 3MCKA 4YZFF 1DQQA 1AQDA 3BPCB 3ARDC 4JY4A 1YEIL 1X5HA 4QOKA 3P9WB 2VXVH 1FL3B 1ZHBB 5C08D 5IWLC 1OQXA 2AEPH 3HNVH 3PV7A 3JUZA 2C3WA 1CD1A 3HMXA 3OKLB 3UJJH 1OTTC 4L9LA 4Y89A 2HFFB 3L3GA 3P0GB 4RGNE 4XPAH 3SOBH 2OR8A 3E1F1 3MJ7A 4U1KA 4KGLA 15C8H 3KXFE 3MRNB 1U2CA 3FO9A 2BRQA 3W0WD 4AEHL 2XZCH 4M3KB 5F9JA 1UZ8A 3O45A 2OZ4A 1AIFB 4LQFH 1I1AA 1ZEAH 2L4OA 2VL4A 2D7PA 5FUOL 2VLKB 4B7LA 3WN5B 3JV0A 2CKBH 4JRWA 1CYGA 4YDIL 3BKJL 1RUKL 5LGJA 3SKOB 5ALCL 3DYMA 3RA7L 3ESVF 3H2WA 3QIBC 1AC0A 4NFDA 1A7QH 1I8KA 1UH3A 2JJSA 2XRAH 2PCPA 3V0VA 5F7EL 1HH6B 1DBKL 3BXNA 3MV8B 4UMGA 2AJZA 4PTUB 5HVGB 4QHLB 3GSRB 3MXWL 1CCZA 3MODL 3UP1A 1FFOA 3VXOB 4JFOA 4YC2C 4OFDA 3C09C 4MS8D 4RAVB 3WO3B 4X98B 3FZUC 2CXGA 1S78D 3KYMB 4JQIL 2VDMH 4CVZB 4PJ7B 1PLGH 1JN6A 3HAEB 3SDDA 3WDIA 4X6EB 4NSKB 1H3WM 5CBAA 2VAJA 5DSCB 3GMNA 4WI9A 2VDRH 3D3VA 4XCCL 3IRPX 4QTIH 4XP6H 4JGJA 1QFPA 3S37L 4JRXA 1B6DA 1ULVA 3HCVB 3SY0A 4QEGA 5D7JA 2F5AL 2BZDA 1AXTH 4FP8L 1A6ZB 2RIKA 3O2DH 3DX7A 3GSRA 1Z3GH 3V5HA 1X6NA 1A5FH 2HKFL 3ABZA 2EIDA 5F7NC 5GSRB 2FHCA 5ICXB 1QRND 2XY2A 5BOPA 5CEXB 5KVDH 3T0EC 5SWSA 3QULB 1CFNA 5JOPE 5E9DD 1FN4A 4MA8L 5JW3L 3QCTL 4Z5RB 3HAEH 4DKFL 3O9WD 4PJDF 4HKJB 2R1WB 5CZXC 3VXNA 5D1QB 3ROOB 4LVOC 5DURD 2YD6A 5INCA 2H9GB 5D9SA 2OTWB 1G6RL 2H6PB 2UWEA 4Y2OA 1HQ4B 1BQHA 2YXMA 4JQVC 2HFGL 3WIHH 2AS5M 4R4ND 2BNUB 2EIZB 4ZUTB 4OF7A 5ISZE 4X4ZA 1RZIB 3LVEA 3VCLB 4GQ9H 2X42A 2AGJH 4YXLL 1P84J 5MEOB 4K8RD 1EJOL 1BP3B 1PD6A 4PJBE 5CMAB 5DDHA 1T6VN 3MFGB 1ZWIA 4HC1H 4PJAA 2BSTB 2V9RA 5L2KB 2FX7H 2C3XA 3SCMD 4ZS6C 2B2XL 3RTQB 2D03H 2QLVB 4M6OL 4J7RA 2PW2A 4HC1L 1HQ4A 1EEQA 1BPVA 3RNQA 4JFDD 3MCKB 4AEFA 1BVLB 3V5KA 1OSPH 2GTWA 2K9UA 1OGAA 1A6VL 4Z77A 3ROLA 1CDUA 4KUCF 5CJXC 4L4TD 4PJEF 3HMWH 4DUVA 5DJ6A 5HVWA 3TVMB 5MI0C 1C08A 5D2LA 4JFZL 3GNML 3MMEB 3NABH 5BQ7B 4LIQH 1U8HA 3D85A 4LHUB 1CT8A 5T1MB 5E8OA 4JM4H 4BKLA 5I1IL 3ARXA 3MFFB 3VGBA 4WWKA 4LF3B 1ES0B 4XNMA 3BP4B 3GK8L 2A77L 3BMWA 3TT1H 4FZEL 1J5OH 3QDHA 4PJEA 1CWVA 2FHBA 5ADOH 1KACB 4GW1A 4FQ2H 3BISA 3KLHC 1J1XH 1DSFH 2KQMA 2FL5B 2Y23A 5E8EB 3KYMA 3O6KL 5L8KB 1JYNA 3OXSB 2OJEB 3U1SL 1XH3A 5IB4B 3TNMB 2EXYC 4MXQC 4GMSL 1UM6L 1YQVH 1MY5A 4QHLA 1QBML 4V2BA 4HPOH 4L8SB 1S7XA 4EI6A 1SEBA 1VPOL 1R5VA 1GHFH 2FO4B 4ELKB 1TQBC 1XGPA 3N06B 1R3IL 4KI5F 1RULL 5HTSA 3UDWA 2DM4A 2XPGB 4P2RB 4QHUA 5FGBA 5F1KC 3MUZ1 5J57B 5D7IA 4LLMA 3CXHK 5CIPB 3BYTA 4JN2A 4U0RC 4U1LA 1F6AA 2IPUG 4X6BA 1INQA 5SWZB 4NKDB 4O58L 3HLAA 4HIEA 1A3RL 1HHHA 1CBVH 4Y4HD 3FOMB 4FQIL 3PJSB 2CMRH 3QDMD 1BD2B 1B4JH 4UNVA 4C4KO 1RZKL 2XZAH 5GZOC 4IRJC 2XFXA 2DQCH 1I9EA 1PFCA 4LSVH 1OB1A 4L8SC 4Z76B 3OKEA 5E6IB 3MLSL 5IVZA 3U4BL 2WV3A 3DUUA 3O9WC 4MNGE 4UTBH 1DVFB 5F7UA 5HYSG 2ZUUA 1SY6H 3RWEA 2EE6A 4K94H 4F15B 1QSFE 2GJ6B 4FFYL 5GS2H 4U6XB 1L6XA 5DEFA 5T1LD 2XYCA 1FVEA 3CD4A 3HMXL 2K1MA 3WIIL 3VRLF 2BOBB 4LSPL 1EO5A 5BXFA 4WFFE 3TT3L 4R0LB 1MJ8L 4LDOB 5J11C 3QNYA 4JY6A 5TGBA 1TNMA 2FX7L 3F5WA 3QUKB 4N0YH 1NANH 5DEGB 2FX9H 4IRSD 2I9LB 2D03L 3MLTB 1RY7B 4FQPA 5GS0L 4EVNB 5EOCH 2JF1A 1V3MA 4YHLL 2LV4A 4JFFE 3MLXL 1LO3L 4JAMB 4J3SA 2GAZA 2NW3B 4G42A 4BZ1H 2FRGP 3RL1A 1KJVA 2VERN 5I8OL 3NTCL 2DKSA 2HJKB 4OZGA 4BFIB 3V9FA 1A7RL 1BQSA 3QO0A 1JMXA 4AEHH 2FR4B 1J0ZA 4UDTB 1HDMB 1J10A 1S8DA 3SBWA 2NW3A 3WS3A 4HWBH 3NFNA 5JNYB 3FMGL 3ZO0A 3OJVC 4PB9L 4R2GC 3B2UD 2NMSA 3K74B 4WNQA 3UTTA 1F97A 1XF1A 3DGGA 2UV3A 4NO0B 5ADOL 3MTRA 5EBWB 1JZ7A 3FTGA 4NM8L 1P4LA 4OZGF 2LTQB 4G6KL 2NXZC 3E8UH 5DO2C 3CLEL 3OMZA 4P4KA 1NMAH 3MV9A 5I1DA 3EW3B 3MQIA 1QSFB 1I9RL 2GJ6E 3DGGB 4JCLA 5FYJL 4CADB 1AY1H 4HDIA 3UTTD 1C5CL 1J0JA 1ZANL 5IFJA 2IAND 1HKLH 3STZB 1F3JA 4X6CB 4O2FB 1RURL 4FTVA 1T83C 1OTSC 1S5IH 4WUKH 1X5AA 5D1QC 3TM6A 3PP3H 4M62L 3DXAE 3EYOB 5E2JA 4Z7UB 4K7PL 4TTGA 1OCWH 1H3GA 1KG0B 2EEDA 5SWZE 2GK2A 3LKPA 4PJDA 1CD8A 5E95B 5C07B 4M1DH 4PUBL 3O41B 2YUWA 4P9ML 1ZLUH 5FYJE 3IDNB 1AGEB 2A0LC 3WLWD 1J86A 4WHDA 2NY0C 1DQJA 5DHXB 3MLTA 3CUPB 1RUMH 2BK8A 2JK5A 2XOTA 2H32H 3QQ9D 4GLRI 5GGVL 1MAKA 5KW9L 3QWRA 4OCWH 4JKWA 1CICD 1K9TA 2HTLC 3KPMA 1U6AL 1DDHB 1N3NB 4YC2B 1H5BB 1NFDB 2PYEB 3KLAB 4XP9H 2DQIL 3QHZL 1NAMB 1NAKH 5L88H 5LJYH 4F7PA 3UCRA 4KDVA 5DEFB 4N0UA 5DHVA 4MA3B 4OFKA 2FEEL 1F4WH 5C0CA 3RWEB 4M1CC 3SO3C 4MNHB 2RCSL 5DI8A 5GISH 1CDGA 4G7YL 2R9HD 3WHXA 4TUJA 3UTSA 4PY8I 1WBXB 3MLPA 4FFWC 5DUMH 2YPLD 5FUZH 4OAWB 3VXSA 2XFXB 4JRYE 3TYGL 4DGIL 1ZA3B 4PLKD 4ONOA 3HZKB 5E6YA 5C3TA 5CHNA 1KIQA 4HT1L 3TA3B 3IU3A 2UYLA 3LQZB 3NZHH 5FYKU 3IXTB 3H9ZA 5IJVA 5CSBA 4P3WA 3UTPE 4JFFD 5D7LA 3VWKD 2OK0H 1G0YR 2I60H 4UDUA 1E27A 4Y8DC 3F62A 2QQNH 2RFXB 1L9MA 3CJJA 5D7IB 3VMOA 2Q76B 1KTRL 2YUXA 2X4QB 4G8GE 5KSVB 2X41A 4HJGB 4XPFH 5FK9B 2X6MA 3GMPB 4NP4L 1WZ1L 2X7LB 2X89D 4JFFA 1RJZA 3AB0C 1WTGT 4R8WL 1JGVH 3RWIA 5D1XC 1CIUA 2DMCA 2H2SC 5DQDL 3LAFA 4HKBA 3JTTB 4FQXC 3OXSA 1AIFA 3B2VL 3S35L 3WDHA 3BZFA 5ALCH 2NNAB 4TNWK 3UBXI 3RX8A 3X11A 1WT5C 3QFJB 3ARGA 4AQOA 2R1XA 1OAXH 2IFFH 2Z93A 1FFPA 5J9PA 4U1SA 1KBGL 1ODAA 2APVA 3PHOB 1UH2A 4Y4FA 1ZANH 1ZOXA 5EU6B 1M7DB 3WL9B 4HGWA 2FO1A 1JTOA 4GS7C 2HLFD 3BJLA 4E42A 3VFNA 3UPRB 3EDFA 3MRKA 3OKNA 4Y4KC 4XNZC 2W0LA 1P7QD 2HH0H 5DYOA 1R5IB 3BH9B 3QIWD 4ZFFB 1NDMB 2LABA 3U79A 2E7MA 4P2YA 1DLHA 1T1YA 4YK4B 2R39A 2NY6D 3TJHD 3ZZ1A 3VXUE 1EHLL 1FL5B 2RJMA 3MRGA 2GTWB 5IHZA 3ULVD 1LEIB 2VDKL 1U36A 1KT2B 3S88H 1NGXA 3O6FC 2R29H 1TZHA 2NCMA 3P4MB 4GBXB 3VDCA 2MNUA 1S9XA 5F9WC 1FJ1A 1R24B 1FNLA 4P2OC 5CFHA 1MRFL 4M93C 4D2NA 3W39A 1WWAX 3K4DA 4HKZA 3B9EA 3BOVA 5E9DA 3T77A 1BZ7A 2W0FA 5GGVH 4I3SL 2ZOLB 3CCHB 3DX7B 2W60A 4PRNB 4MA7H 4OI9A 5HHNB 1LVEA 1RZFH 2EXYD 4IDJH 4KROD 1XCTB 2VXTH 3WS6C 3OB0K 4F9LC 1CL7I 5IGXL 3ULUH 4JHZA 1ZE3C 2AJUH 3DETC 3U46A 2J4WH 3GJEB 4G9FA 4PJAE 5ENWB 4DW2L 3T8XB 1RVFL 4K9EL 1KXQE 4WW1A 4NKMA 2HT4C 3FB5B 3O6FB 1CDHA 5ILTL 3NCYS 3ZE2E 3A67H 5D7SL 5KS9B 1GGCL 3LEXA 3AM8C 4JFEE 5F7LB 1ZLUK 3RVVD 3T0EE 2O61B 5GQBA 4I0PD 1P7KB 5EIIB 1XR8A 3EO0B 3R06A 1IGYB 1GC1C 1FNSH 3S96A 2M26A 3RU8H 1U2HA 3NH7L 1BZQK 3TCLB 5E1AB 3NPZB 3T8XA 1KCLA 5KG9B 1IGFH 1GAFL 4K8RH 2BERA 5L7XH 3IKCA 3WN5A 4U4BA 4UV7H 5BZDB 5I8OH 1NCBH 1NKRA 1E6JL 2R2EA 4RFEA 2IQAA 1FP5A 4F7TB 1PZUB 1U8JA 4ZS6D 1S7SB 1XGQA 2DQHH 2E8ZA 3D48R 3GSVB 3SDDB 1CE1H 3IJHB 4FQXB 2QL1A 4MNGA 4XNQB 1KN4L 4XC3L 1BQLL 5GJTH 1OLLA 3TZVB 1JFQH 1WICA 3L5IA 2DKMA 3WSQL 4OM1L 4WO4A 5EBLA 4CN1A 4LSSH 2VISB 1NGWA 2CUMA 3CSGA 2C4FT 2O5XH 1YYMH 2YXFA 3VFGL 4JY4B 1GOFA 3WMSA 3BN9C 3VA2C 4APQB 1S9WB 1TTFA 1MCOL 1GGBH 1CR9L 1OTSD 4XGZA 1QLEH 1FZKA 1JL8A 2ZJSL 3MV9E 2N7AA 4GXUN 4GAGH 5KANG 1JPGA 5T3XE 2XXMB 3QEGL 4AYFA 4G3YL 1SBSL 5BV7H 3EOTH 3N1GC 3RZCD 1HCFX 3TO2A 4Y4FB 4KKNA 3RL2B 1QLEL 5E2WH 2R1XB 1QEWB 3BZ4B 2H26A 4U7SA 1IM9A 3VXRA 2ZG1A 1RZGA 2XN9D 4R97C 4YHNB 1MHEB 4ELMB 3T0XA 4GOSA 5E2WL 4HHAB 4NZUL 1YNKL 2MCPL 2EC9T 4M1DL 3PL6D 2G9HB 4YHIB 1UVQA 2CLRB 1XGRA 5CP3H 3W9EB 4AY0A 4G8IA 1SEQH 4MNQE 1SM3H 1EDQA 3O6KH 4KHXL 1EJ6A 1I9JH 1BD2D 1LMKA 2P43B 2CH8A 4Z0XA 4FNLL 3THML 1JPTL 1SY6L 2MWCA 2IQ9H 2A6JB 1A3RH 4L4JA 5DTFB 3V6FB 4MX7B 1T3FA 5J6GB 2PKDA 3LZFH 4Y16D 1TJGL 3BQUB 4LHUG 3TN0C 2WM0A 4ONGL 3EDJA 2AQ2A 4MD0B 3DRQA 3TA3A 4NBYB 1X44A 4P57B 2ZSVA 3MRRA 4WRLA 1TJGH 2JTDA 3ARSA 3RAJH 2UZYB 3BPLC 3BIAX 2XZZA 3CPLA 3RVVC 5EOCL 5HYJA 1N64L 4MS8C 3HI1B 2V17L 4HV8A 4X9FA 5LXGH 4HS8L 1YN6B 4P5TB 3ARBB 5DD5L 1T5WB 5C70A 1FH5H 2CD0A 5DHVB 3OKMB 4HPYL 4DZ8B 3B83A 3B9DA 4OLXH 1MRDL 1T4KB 4W4OC 1AD9B 3QUZB 4AH2B 3V6OC 4HPYH 4QHMA 5DHYB 5TF0A 4Z7NF 2VQ1B 4TTDC 3ULVF 1T2XA 4IRSC 1QFWH 2NXZB 3WE6A 4LVHB 5EZOL 3SKMB 1B0GB 1MJUL 2GTZA 1XIWB 3KDMB 4R2GB 1QFWL 1NJ9B 4YBQD 5B39B 1AGEA 1FGVL 3HI6H 3I02A 1KXVC 3BPOB 3SEPA 2AP2A 4L4TB 2IANB 2ADJB 3BEVB 1OARL 43C9B 3U2SA 3VD4A 1TVBA 3Q6FA 5CEYB 3SGDH 1FVCB 2ATPA 4JFDB 4QRPD 5I2IB 5IR1B 4N1CA 4N8PA 1RSFA 3F12A 2PXYA 3IDMB 1S5HB 2KH2B 1T0NA 3EYFA 4LASH 4NT6A 3TV3L 1CGXA 2B5IC 1LO3H 1X7QB 4GAGL 1OVZA 3AMLA 3ESUF 3IT8D 3TH2T 1UCTA 5B4MD 3EJJX 1DCLA 5T33L 3VWKB 2Y7QB 5JLZA 5IEHA 1K4DB 4KI1A 1I1FB 4DZBA 1KEML 4P9HC 2X1OA 4LPTA 4QWWD 3D5OF 4GW4A 1X5LA 4ODXB 1W0YT 3RI5K 4JDZA 4R96A 4PJFE 5CJQH 5T1DL 3FT2A 5A16A 1D6EB 4L3AA 5F1NA 4HFWA 4NZUH 4XVTH 3VE0B 5DFVC 1G6RA 3QXTA 4KV5E 5I74B 4NBZB 2R29L 3TIEA 4XP1H 1J05B 3RPKA 4ZDHB 3OHXA 3RA7H 4H8WL 5HBBA 3RX7A 1OAYH 1U42A 3K8LA 3O9WB 5L88L 2GUOA 1DBKH 2AJVL 2GK0B 2VSCA 1IGML 1ZTXH 3CSYB 5LWYH 2Y07H 3NIGE 3WIHL 3FONB 4JY5H 3G5VA 4TVSa 4NJAL 1G7QA 1A4JB 1NGZB 3OKDA 5IF0A 3VFMB 4OGXH 4WTZG 3PWUB 2ADGA 3PABA 3AFLA 5CD3B 5HHXH 3N85L 4H0HB 2ZUYA 5E8NA 3KGRA 2R4SL 3FRPA 2MOVA 5C0GA 3FT3B 3D9AH 4JRXD 3B9KC 4UQ2B 2F74B 1JYWA 2J5LB 5JMRA 4OI7A 3SKNA 4FP8H 5K33A 1NFKA 2D31A 3RU8L 5ITBH 1Z3GL 4FOMA 1FO0L 3QDMB 1OAKL 4HLZG 4OGZA 3BAEL 2YPVH 5CJOH 3MA7B 3DBXA 4PYHA 2QHRH 2DI7A 1QSVA 3NZHL 1MQKH 1KSRA 1A3LL 5IVZB 2RB8A 3ZSSA 1MJ7L 6FABH 4RZCA 5DS8A 4X0KB 5ID1B 5IT2L 1CD9B 4JFDE 2VLKD 4BQ8A 2EDWA 2ESVB 3QDAA 4XHQA 2VXSL 2PETA 3FB8A 3HC4H 4JFQA 5FGCE 1YZZA 5HGAA 2L7JA 2VMFA 4I77L 4Z0BL 1SJHB 1T1XB 1JF1A 5CEZH 3J7HA 3O8XC 5CIPA 1YA5A 2DQDH 3T0EA 4DFIA 3B2UC 1IARB 3QXVA 5EZLB 2R0WH 2GY5A 1OD9A 1FCCA 5EOTA 4Y0GA 1M7XA 2NX5A 3VFGH 3QA3A 2UZIH 5DQDH 5I73B 3RWGB 2ICWI 1G9MH 3NFPA 3IFOA 2Y5TA 1T5WA 5F1SA 3WFEL 2WWMD 3A6CL 5IM7A 3L3KA 2GK0A 2P24A 2GSIB 2IH3B 3AS1A 5IB1A 1D7FA 3Q3GA 4OD2A 1DBBH 1S9KC 3N9GH 1QP1A 4XWGL 3RTQC 2V5SA 2VN4A 4CUCA 5BOZG 1O7VA 3GSNA 5SWSD 1FLRL 3UJJL 4I2XB 2FJFB 1A7PL 4KROC 5GSVB 2GSGA 4NN7C 1JRHH 1U8IA 3S97C 1JBJA 4X6CF 3UYPA 3MFFA 5HHOD 3ZDXE 5E5RB 5ESVA 4QYOB 4N8CH 2YKLL 5DUBB 1EEUA 1C1EL 5D2LB 2D2OA 3H9HA 3GKZA 4R4FH 4UNUA 1OSZA 1QR1A 4MLSA 2GIYA 4MAYD 1W8NA 2XG4A 2FECI 2ID5A 4NIKB 2VXUL 5ICZA 1A7BA 1BVLA 3V5KB 1IBGH 5E4IA 1HKLL 3FQXB 4ELMA 4ORZC 1XF2B 2ADFL 1DEEA 1VFUA 1BFVH 3BFOA 4QRSA 3VJ6A 4YDLB 1IQDB 1RZGB 2ZUWA 3QG6B 3TPKA 4GRMB 1QRKA 4PJEE 1AE6L 3EOAB 3DO3A 3F6LA 4UB0H 3PG2A 4L8BA 1S7UA 2BSSA 2YMXH 1H3PH 3MNZB 1JPGB 4F7EA 3BWAA 3GBNH 3FFDB 2X10A 3LB6C 4RMSA 2ICWJ 3CZFA 1QSED 2JELL 1YY8B 3T2NH 3C6LA 5GS0H 3TEUA 1QFWI 1FH5L 3QFDA 4TVPL 4WCYL 3NCFB 4YBLB 5IBLC 4NHUA 4EKXA 1XGTB 1BZ9A 1UYWL 3EJZD 4ZXBA 5IHLB 4Q0XH 4IOFD 1A3LH 3WUWB 1LP9A 1X5GA 2DTML 2MQCA 1HN1A 5JR1L 1MJ7H 2VUOA 4OF6A 5JHDA 4QRPE 4M6MH 3TESA 5C9JA 3D0LA 3HNTL 4GKZA 5DD6B 1A9EA 3BT2L 4AIZB 3R0NA 1D5ZA 3IDGA 3LS5L 2P5WA 3OF6D 4M5ZL 4JM2C 2F53E 2ZWLT 2EDOA 3WIHA 3PP3K 4D0BA 2GFBA 1CFNB 4YBLC 4ENEC 2IQAB 4RFEB 3U0PB 1NCAH 5FHBH 5BZDA 1AC6A 2VZSA 2L7UA 3CMOH 2QBWA 4G6KH 4JKLA 3MV8D 4KQ4L 1ZLWK 3BUTA 1NUNB 4JHBA 4BH8A 4WY7H 4LCYB 3DYOA 2CLVB 4YPGB 3MJ9H 4RFOH 4EN3C 2WZPD 5I76B 1IGYA 1G7MB 5MEQB 4KRPC 4FFVC 3WXVH 1PBYA 3UBXA 3MV8A 1W0WA 3D25B 3GMMA 5FCSH 3REWB 3DMMB 1IGCH 1OGTA 4QOKD 2WW8A 4IMKC 1RK1A 5CCKL 3FB5A 2DD8L 3H9SB 4OF8A 4G9DB 4KAQH 5I75B 1CI5A 5HGBB 1T20B 4X4YA 4Z7VB 4F37F 3NA9H 4U6YA 4JFEB 4K07A 4PP2A 4CJ1A 4BFEA 4M7LH 4POZC 3E2HC 2VO5A 4UUJA 5T3ZH 3WNKA 1YEHH 4WFEE 3KYOA 3EDEA 4XCYA 5DJZA 4WI5A 1YEGH 1N5AB 4S11A 5I8CB 4S10A 4M7LL 5IKCA 5C0IB 2CIKB 1DTUA 3IAQA 3KR3L 5DRWB 4X0KA 4UIKH 1NBZA 1U92A 5T5NF 1PKQB 3DX6B 2YUVA 2PN5A 1J1XL 4G5ZL 5DURB 2ZP0T 1I8MB 3QBTB 35C8H 2OZ4H 5GRJH 2XTJB 2FLBT 3SE4A 3OX8B 4HK0A 3BH9A 2BXYA 3X13B 4JFXA 4QXGH 5DGQA 4LARH 1F58H 1SJXA 4WHTA 1QPPA 3LN4A 3D39B 4OLXL 3C5JA 1CBVL 4QXGL 3RVUC 1F42A 3TNNA 4APQD 3HFMH 1YPZE 1I9JL 3SDCD 1BM3H 4MXWH 2Q8AH 2QQKH 1AJ7H 1QACA 4PGEB 4PB0L 3MREB 1Q0YH 1ACYL 3VI3F 3X11B 5LXGL 1YN7B 4HS8H 4Q97A 5I6XC 4N0CC 5JOFA 3E6HB 1MI5A 4CVUA 5H37H 1RMFL 5C9KA 2DIJA 2Z31C 1KTDB 2MPAH 4XBPA 3EYSH 3IU4L 5GRUL 4O58H 3FFCB 5I15H 1VFMA 2CMRL 5CZXD 2A83B 4RIRB 4PS4L 2GUOB 3RY6C 2X4TB 2GT9A 5KSAC 3I75A 4ZXBC 1Z9SA 4C56E 4G9DA 4K23H 2Y6SD 4XAWL 1WZKA 1EEZA 3QUYC 5KTEL 1D9KC 1H9VA 2WUCH 2FZ3B 3HUJB 4JHWL 5ETUB 3HRPA 4ETQA 2HFTA 4NCC1 1G9NC 4HIIA 5EWIH 3WV0A 5I19H 2RFXA 4BK5A 5CZKA 3VFVA 4PRPB 5KS9A 1YPZA 1MRCH 5F1NB 1PEWA 3L1OL 3H3PL 5L8JB 5FYKE 1AHWA 1OAXL 2IFFL 3DWTA 1MCBA 5DLML 4X83A 3F58H 3P9MA 3FRPG 4GAYB 1FVDA 4X6DF 1JI2A 1OTUC 3TN0D 2WWKT 5CJQL 5M94B 3RUGA 1WAAE 2F5BL 1T1WA 3FQTA 1U3ZA 5E7BA 3HMWL 2AV7B 2CRMA 3QEUA 2W91A 5DJ2B 3MOQA 1I1CA 4HKZB 1BOGB 3TGXA 5B3NA 3PXJA 3HC3L 2ARJQ 2C3VB 1JZ8A 2A6IB 1N6QL 2MKWA 1U3HD 5ADPL 2YPKA 2X89A 4U31A 5E99L 3GJFA 4QXWA 1IMHC 5GIRB 3FT3A 3LKSA 3JWNC 3PL6C 5FF6A 1HOCB 1CGVA 5E8NB 5DD1H 1UWEH 5KAQG 4PJ8B 3MUGA 4GRLD 2CDEB 1G6VK 1MHPH 3S35X 1A7QL 4PJFB 4WGVB 3ZHLA 5B3JF 2Z92B 4NDMA 1UFUA 3ARGD 4WWKD 1JGLL 4NRZB 4CU8A 5LGHL 2EECA 1W72A 2PW1A 1KEMH 4U1SB 2VN7A 3QIWB 2FJFA 1U8PA 2YPKB 1CDJA 4ZG1A 4R7DB 1I7UB 4YIQB 3G5ZB 3JTTA 3U4AA 2E7LA 4U2YA 1NSNL 3I85A 1QZ1A 1PAMA 1M6OB 3HPJB 3SE3A 1KXTB 2WBJD 1WVZA 3STZA 4MYWB 3IDYB 2FHFA 3O6MH 3C8KB 5IW6A 4XBPB 1RU9H 1OPGL 1UZ6F 3QIBD 4WEUD 5E2UL 3LRSA 1JV5A 3V5DA 4OCWL 5JW3H 4JDZB 3SQOH 1EGJH 1URLA 2LAAA 3DSFH 3K2MC 2Q76A 3EZ8A 3FTGB 5DZOA 3D3VD 1MCPL 5E4EC 1JP5A 1MIEL 2AK1H 4MA7L 3CH1A 4KTEH 3HNTH 3SDAA 4ENED 3MV11 1TCRA 2WBJC 2G2RA 1Q1JL 2XT1B 3F8UB 3QEQB 3FT4A 4XBGA 5GSVA 1I1YA 2P5EB 3T2QA 1KB5B 1B90A 4Z0XB 5HHME 5CBEA 3AY4A 5ETUA 3ZE1E 1LDPL 5IVXB 1X6LA 3QO0B 4TNVF 3V5DB 1GGYA 2CK2A 4QTHB 5E7FA 4GQ9L 2ATPB 1SQ2N 1BFOA 1NAKL 1TZIA 1UKQA 4L3EE 2D9CA 1RK0B 4FABH 4R26L 4RNRB 2ADJA 5DI8B 3GSWA 1KPVA 1P84K 3TJEL 5IBUB 4I3RL 1PY4A 3VFWB 4CW1A 2BRRH 2R69L 4M7LT 3MLRL 4DJMA 4G7YH 2NX5D 1JVKA 2P5EE 1RZJC 1DBBL 2BNQD 4JG1L 4YDVA 1EHAA 5AYUL 2NY4D 3VXME 4ZNEA 3TO2B 5C0GB 2YBRB 2COQA 1S9YA 1ONQB 2IMNA 3MRCA 2JIXB 5FDYA 1GJIA 1SBBA 3K8KA 3FQWB 2LU4A 3AREA 4O51A 3OAYK 4OUUB 3X3GH 5KZCB 3OKMA 3V4UH 3N9GL 4OIIH 3QO1A 3MUGB 2OLDA 1N26A 5KJRL 3NA4A 5DS8B 4WW2A 2W0PA 4MNQB 3ARQA 1V3KA 3ALPA 1A7OH 3DURB 4PRHD 2OX5A 3TBTB 4XMKL 4K7PY 4P0DA 2HAZA 3ZT6A 2ZCKH 3MRIA 3T4AA 2VDQL 5KSBB 4JQVA 4R4FL 1KIRB 4IOSD 2FNBA 3T65B 1IAMA 4PJXF 4NQCE 5DRWA 4ELME 5LCVH 1G7PB 1LO2L 3SPVA 2CLVA 2GCYA 3QIWC 5SWZA 1U8JB 1XF3B 2LVCA 3GSOA 3C9NB 4Q9BA 4P59L 4U1LB 3G5XB 3G5YA 4OSUH 1LO4L 3T3PE 1LNUB 2HH0L 1F4YH 4LSTH 4OCRH 5F6HJ 4PJGF 1I7ZB 3MGOB 3KS0J 2VDRL 1AHWC 3MV9B 1BLNA 1D5BA 1V3LA 1S7RB 3PWUA 4M9PA 4OD1H 5I66B 5SWZD 5HSFA 3TO4C 2OR9H 5BO1H 3UO1H 4L3CB 4L1HA 1CGUA 3IDGB 3UTTB 4N68A 3BZDA 4M7JH 1SMAA 3C8KA 3O11A 4HAGA 5C0BD 3W9EA 4ONFL 4LMQE 4BSJA 3P4LA 4WTXA 3UBXG 1MVUA 4M48H 43CAB 2J6EH 3HNSH 4OZIE 2J2ZA 2WWMC 5KVEL 4KK6D 4U1MA 4XNXL 1U3HC 2VLLA 4JLRA 5E5MA 3TIDA 5SX5K 2Q8BH 3I2CL 3Q6FB 3FQNB 3BZ4A 4YFLI 4ZDHA 5CEYA 5F8QC 2JCCA 4P48A 4XNXH 4KJYB 4UNTA 2VZUA 4XXCC 2AJVH 4PV8A 3X12B 4FXKB 2P48B 3KXFB 4UT7H 2QQLL 4U49A 5HI3D 5KN5B 3K0WA 5JMOC 1VGKB 3BGAA 1MJUH 1MWAH 4IBLT 1F5WA 2QJDA 3ULSA 1RUAH 5FHBL 4FFVD 2D7QA 5KS9F 1QR4A 1LDPH 1MHHB 2NY7H 2CDEA 4C56A 1HSBB 3WIIH 4PGBB 1HOCA 4OLYH 4PRPE 1HHIA 1T2QH 2I07B 1JUFB 3KPQB 3P9LB 3LN4B 2BOBA 4PG9B 4GSDH 4WHTB 4O00A 3MYJB 1U3JA 3QUYB 3CNKA 4M5YH 3RBSA 5I18L 1JHTA 1T0NB 3EYFB 2JLLA 5KS9E 5KSAB 3P2TA 1PKOA 3P11L 1FO0H 1YEJL 3IDIA 3V6ZA 5ICYB 2DWDB 3B8SA 4V1DA 5IHUL 2IANA 4MD4B 3RX5A 1A47A 4OQTA 1OTTD 3MGAA 3I02B 1FFPB 3OSKA 1GGIL 2ICWA 3D2UD 4NGHL 1OP3H 5I1LA 2EDNA 3MLWL 4UILH 4JKPL 5HHOE 4YGVB 3TCLA 2IADB 4M61A 3WEXB 1I8LA 1NMBH 4S1DC 4ZNEE 4HS3A 4ODBD 4LP5A 1MHCA 3RWDB 4JZNB 2PO6A 4KTDH 5IBTL 4XP1L 1EVTC 2W9EL 4PD4K 4YX2H 2EYRB 1KJ2A 2VDOL 3GGWA 1DL7L 4YQXL 4YK4C 4LCWB 5BS0A 3OAZK 3H9SA 1P69B 4XP4H 3LQAH 1CLZL 1DUZB 1IAII 5DR5H 3GB7B 1DSFL 1NBQA 1BECA 3VH8A 1UACL 3MOAL 2B20A 3G04A 5AZEL 5C0CE 5A2KH 5EU6E 4WHYG 3RHWK 3T1WA 2VZOA 2V9QA 5HHNA 5DSCA 1HKFA 1U8LA 5E9DE 1JNNH 4HJJH 3RWHB 2W65B 4YPGA 5HGAB 1FAKT 3E2HB 4M62H 3JV6B 1NSNH 4FG6C 1BM3L 4FRWA 4MXWL 3GBLA 4PRDB 5EPMB 4S2SA 5GGTA 2P49B 3ETBF 4MJIA 1MNUH 5TQ0L 2YUZA 1NGXB 1YMHA 3Q3GB 3O6ML 2JIXD 1FFOB 2CDFA 2X9XA 4R9HA 1ROWA 4KI5C 2AABH 3SDCA 3H9SE 4KI5E 3MA7A 4HH8A 5ESAA 1EGJL 5KANI 5F21B 2DWEA 3IFOB 4N0UB 1QLFB 2EDQA 1FSKB 1MJJA 1KB9K 1N4XL 2DIBA 2VE6B 4JM2A 5IVXE 3UTOA 2ORBH 3V8CA 3AREB 3PQYE 4NKQB 1AFVL 1MCFA 3SKOA 3QEQE 5F70A 3P9LA 1Q9LA 4G6FB 2DRUA 5GGRY 1NL0H 4WFED 5CKGA 3LCYA 5EWIL 2F54B 3H7LA 4W68A 4Z7OF 2HT2D 5AUMA 1R6VA 4O2EB 4MA1C 1CQYA 3K7UA 2EC9U 4PLKC 1A4JA 2CDGB 3MROB 3QNXB 2CJUL 5HDQL 2EKSA 4OJFL 4JQXC 1GIGH 3H6JA 3QEQD 4J3VA 5CILL 1UB6A 1E0OB 3OB8A 1RZIA 4MGXA 2SEBB 3REVB 1ZHLB 3SCMB 1FZJB 1X4XA 5BV7C 3DOSA 2F53B 3F7YB 2O5ZL 4N0YL 1CXHA 4KUZH 2F19H 3ORJA 2IAMD 3N1FC 4O2FA 4ZUUB 4K71C 2G2RB 3QEQA 5L0QC 1I4FB 4RBPH 5KOMC 3SJVE 3ZKSD 4YHYB 5LAXA 2AQ3A 2CGRH 1F11B 2Z9TA 3VXSD 4L3CA 3O6FA 5EFIA 1B0WA 4XNQA 3BKYL 3IETB 4PTTB 1EO8H 4LQFL 4Z18A 4PJXA 2H41A 3EYVB 3RVUD 1W0VB 2YA1A 1I7ZA 3MRHA 4RBPK 5MEND 3MBXH 4X9IA 1WEJL 3DRTB 1A6TB 3U6RB 4PRHB 5F7FA 1ORQB 4J3XA 3PDOA 1XF3A 3JWOL 5E9DB 1FGVH 3HI6L 4X6FA 5FIEA 1O7SA 5F7EH 3P40A 5D7KE 1G7PA 2FR4A 2CLZB 1L9NA 5KZCD 4JFDA 5EZIH 4G6AC 2ARWA 3ALXA 4MQXC 2E9BA 2IH3A 43C9A 5SV4A 5JHDB 1K2DB 3O3DA 2ZUSA 1OSPL 5IM7B 1YJDL 1AGBB 5GGSA 2APFA 4MB3A 1IEAB 3ULUF 4XNYL 1MCWW 1NBYA 1XF4A 3PGCB 4NHUB 4NNXA 4UQ3B 3SBWC 1MLBA 1G7LA 1DLFH 3FQWA 4O51B 4XBEL 2OQJB 2NX5E 5ACZB 1JNLH 3MBEB 3HZYB 1K4DA 4H20H 2BSSB 4C59B 4W6XB 4ZD3H 3MA9H 5IMKA 4L8CA 2YPLA 3BSZL 5D2LF 3ULUC 4PY7A 4RX4A 4EJ1C 1IQDA 3BIKA 2HJLB 1OPGH 5DF0A 3OG6B 4MAYC 3OR6B 2E7HA 5IR1A 1FRGH 1WCQA 1YEDB 3U2SB 5I1CH 5EB9A 1RI8A 4PRPD 1BFOB 3A0OA 4G5ZH 4Y4KD 1FRGL 4PJAF 1IM3B 5I73C 4QTHA 1HYSD 3GMOA 3FB6B 4Q9CA 4OV6F 2XV6B 4JO2H 3RNKB 3SGEH 1WGOA 1CE6A 3IF1A 3MRKB 4QCIA 5EO1B 1AD0A 4OCNC 4YNYB 2IPTL 4NM4H 5D1ZC 5DD0L 3F7QA 4PRPA 1FFNB 3QQ3A 3HUJF 1AD9A 3QUZA 1N8ZA 2MFNA 4W6YB 1X4ZA 3QFJA 1VCAA 1PDKA 2FO4A 1JMZA 5JTWA 3UTQA 2MHAA 5GS0D 4TVPH 4WCYH 5HYQB 2R0LL 4J3TA 4OAWA 1SYVA 3MRDA 4JO3L 4KH2A 5EDXA 1KENL 2DQEH 1LK2A 3ARTA 2DTMH 1LEKB 4U1HA 4KJQD 3AGVA 2R9HC 4DVRL 2JCCE 3WFHB 1CQKA 4N1EA 2XWJB 2X7LA 1IM9D 3ZDZF 3S37X 2FL5A 4R7DA 2DM3A 1A8JH 2X4OB 3NA9L 2KUTA 3KPOB 3O81A 4XHJC 4H25A 1C5BH 4TQEH 4KRMB 3QQ3B 1S7QB 3QDJD 5JZ7D 2A77H 5LBSH 3QT2A 3RGVC 4DEPB 2F8VA 1I7RA 4E41B 1YEIH 1QHPA 5E8OB 2CO7B 1YYML 4PLJC 3SO5A 4CMHC 3DUSB 2VXVL 3L3IA 4PJXE 5GJSH 3M07A 4GJTB 5AYUH 3C5SA 1P5VA 5IQ7L 2X4UB 2YSSB 3T04D 5K9JH 1R3HA 4HUXB 3H7BA 4RMQA 5IEHB 2Z8WC 4M00A 3WJLA 3DPBA 1OM3L 5E6IA 4TUJB 3DSNA 2G9HA 1G7JB 3GFUA 1GC1L 1KCKA 4Y5XA 4V1DE 3X17A 1A7PH 2VLJA 4QRQA 2IBBA 4JFED 4LSTL 5L9DL 3KYNA 1B2WH 1NLDH 2YHGA 4ZODA 2C3VA 5C0IA 3LKOB 5K59E 2Z8SA 3BKJH 3QEUB 1MRFH 2X44D 2Z31D 1W2KT 4N8CL 4GRWB 4LNVA 1ZXQA 3TBYA 1U93B 1IC1A 3TWCH 3QDJE 4HXBL 3MBEA 4WVRA 1PX3A 3R8BB 4KK5D 2YOCA 4WI2A 4Z7UF 3CDGB 2XZCL 4HUWB 2XPGA 3DECA 1CVRA 1ITCA 4OCMC 2A73A 3QWOA 4GMTL 2BNUA 5DMJB 4AEIL 4ALAL 3QXDA 3GI9L 1QO3A 4G80B 2V7NA 2CKBL 1NCTA 2WLYA 4S1SH 2QKIA 4ZPTB 5E08L 5KVEH 3CVHH 5F9OH 4GRLC 5BS0E 2F54D 4WO4C 4O5LH 5MI0B 2FECL 3VFVB 2Q8BL 4LKXB 4GRWH 3MUJA 4G6FD 1U58B 2R56H 3O2VH 2BVQA 4Z7UA 3GBML 5EOCJ 5I1KH 3RIFF 4LPYA 4D9RD 2ITCB 3BEWB 4IS6A 5C0AD 4FA8A 4W4NA 2XWBB 3TP4A 5LQBL 4BFIA 3CFEB 2HN7A 3LEVH 3PDOB 3RIAF 3TIEB 1A5FL 2OK0L 4NKIL 4DN4H 3FAWA 3WYRA 3ZYZA 5J1AA 4HDIB 2PYFA 1IJ9A 3LRHA 1MCIA 5F6IB 2WQRA 4PRIA 1KCRH 4TOYH 4GG6B 4YDJA 4LVHC 1NCBL 3S4SA 1SMOA 4YBHA 2ATKB 4OLVH 2YPVL 4NUGH 3MREA 5EBWA 4KY1L 4X98A 4IRJD 5E8DL 1QYGH 1L6ZA 4I13B 1C7TA 3LIZL 4NQEE 1NGPH 5I1HL 1C5DA 2EDJA 1BVKB 3RZCA 1WJ3A 2BNRE 1UWGH 3D0VA 3DVFA 4KU1A 4LVOB 4U1GC 2D0FA 1N59B 4P5TC 1GGIH 2VDOH 2Q6WB 1XGUA 2PNDA 2H32B 4P2CG 4G8IB 4UT6H 2EDHA 4L8DA 4Z76A 3JBG7 4JAMA 2A9NL 3U7WL 4XI5D 1IAOA 2DAVA 2BY2A 3VXQA 4N9GB 5IW1A 5B39G 2BRRL 1RUPL 3CFCL 2WUBL 2F53D 1IFHH 1OOAA 2V2XB 3QRGH 4Z7VE 1T2JA 3CMOL 3MYZA 1KJMA 2E5EA 4QF1A 1S9XB 3I9GL 2XQBL 3C87A 4JO1L 1A1NA 1LK3L 1WWBX 1R3KB 4QO1A 1T4KA 2DICA 3BP7A 2FIKB 2XA3A 4HMEA 5C8JB 5L0QB 2P46B 5L9DH 1T7ZA 1KCSL 2ED7A 4OTXL 1MCCA 5IWLA 1OAQL 1P9MC 1WISA 2JB5H 3JV4A 5DJ0A 5I71C 4YE4L 2HP4A 5SWSB 5GGSY 1FDLH 1UENA 2OJZH 4HV8B 4MJID 3OKEB 1JWUB 5TE7L 4B0MM 2HJFB 2BHUA 5HYJD 1ZT7B 4HMDA 2R2CA 5J9PB 3QDGE 4P57A 3FOMA 1WAAA 2UYLB 5KW9H 2AKRA 5FYKD 1FQ9C 5DJ8B 1S7VB 3B43A 3VXSE 4AG4H 3K2UL 4MA1B 4M9OA 1U6AH 1IAIM 1WBXA 2YD8A 1TNNA 2R56L 3TC9A 4ZFZB 3LMJH 4S1DD 2GSIA 5C71A 5F93C 3L3KB 2MKLC 3MRPB 5ESQA 2Q7NA 25C8L 2D7MA 3AREC 3EO1B 1UM6H 5GISL 3WHE1 2FYYB 3IAGC 4IM8A 2FX8L 3ROLB 3VXUA 5GRJL 1UEYA 2VOTA 3KYKH 4LFHD 1QD0A 1JJUA 3MLRH 1E27B 3Q1SL 3VI3E 3K4AA 3WNLA 5C0FB 4FQIH 3I50H 3WIFB 5FDWB 5BW7C 4DFHA 1NDGA 1V8HA 2IADA 3EGSA 3MOBH 3LQZA 3C6LB 4PJEB 3D3VE 2G5BA 4M6NH 1F3DJ 4KK6C 2IAMA 1NL0L 2MTPA 2DQGL 5EORH 2ZNXA 5E00B 2YEZA 3AAZA 1LD9A 4LOUC 4BKLB 1WK0A 3WCYA 4GUPA 4OZHF 3IJSB 1MFNA 3V4UL 1HI6A 4IDLA 4WU5B 4IMLA 2B4CL 4FN0A 3T77B 2E8YA 5K9KB 2P8PA 4GRLA 5ERWA 5HDQH 2NY5L 5HI3C 3ZKMC 1I9IL 3LPWA 3MYJA 1KT2A 1T7XA 4XC1H 5JHDD 4HSQA 2H9GA 2VDQH 4EDWL 1OT2A 3B9KD 4NC1C 5IFJB 3TV3H 1DDHA 1JUFA 3ZDYE 5A2FA 3HN3A 3Q5YA 5ECJE 5IOPB 4N8VB 2FIRT 3F58L 4LSPH 3QEHA 1Q72H 1R5IA 4MB4A 5DFVD 5CEXA 5DQ9B 4Y16C 4WU5A 4YDJB 2BCKB 1K5NA 5IF0B 1AO7A 5IFAL 4R90L 1U8QB 4I2XE 5F88B 2J6EA 3G5VB 1F3RB 4LASL 3R4DA 4K8RL 1CZ8H 4H1LH 3GMNB 5J4MA 1U91A 1AGDB 4QRTB 4NNPL 2H3NA 3RI5F 2VLLB 4FTVE 4JLRB 1F00I 2EIEA 4OLEA 5C2UB 4QRRD 1NCUA 1WBZB 4OZ4A 3DI3B 3KXFD 2E9IA 3CSPA 4K2UH 4LLAA 4BH7A 1E4KA 5FXCH 1P7KA 5EIIA 3GK8H 1N6QH 3VWJD 4MJ6A 3HB3D 1K8DB 4XAKD 3EYQD 4PJFF 3VGHA 4F7CA 3DHMA 3ME0A 2R4RL 1NGYB 2BNRB 5I66A 3QXDB 1TJHH 3T0DA 4EI5D 3K2UH 3M1BB 2BNQE 2P5ED 3U7YL 2EE3A 1LNUA 1GZPB 4NM8H 1JTTA 2P8MA 4YO0B 5FO8A 3HKFA 4P23C 5HHXL 4UT9L 5JNYA 3D3VB 1YEEL 4C57C 1SBSH 5FYLE 3WHE0 3O45B 4D0CA 3BRFA 4P99A 1JYXA 3H3BC 3VDBA 2ADFH 4KK8D 3V7AE 3IU3B 1P53A 1IL1B 3W81A 4DGYH 3T65A 1KEGH 1TJIL 5ID1A 2Z8VC 5E2UH 1VACA 4CMMA 2NXZD 2VZ3A 4E0RA 2B8OT 2ZCHL 1YNKH 3J8F7 2V5YA 4MNQA 4WI3A 1IGIL 1DLHB 5FFLA 4QT5B 4XNUH 1BD2A 5J06A 4OZFG 1U8OA 2NW2B 2WBKA 3MOBL 3OKKB 2C3HA 4KHXH 3CGTA 5HPMB 4O2CA 4LSUH 2VABA 5D7IE 3C08H 3WE6B 2MPAL 2VYRE 4EUPB 2DQGH 1A4KA 2GITA 1EFXB 2DOCA 4LLWB 3CVIL 3S3JA 1YDPB 12E8H 3MGTB 1NEZG 1PW3A 3LQAC 5JXEA 1UM4H 5C7XH 1HHJA 1QTYT 4ELKA 5HPMA 5D2NA 3U30B 3QDGB 1NGZA 2YD2A 1U8MA 5FCUL 3QP3A 1ZSDA 4AL8H 4JRYB 3FONA 3PP4L 4QRQB 3O4OC 4LNRB 3ARBA 1J8HB 3BI9X 1EV2E 2ZPKL 3CSYA 4OT1L 1WFUA 3CFDA 3FCTA 2FGZA 3O3UN 4M43H 1KG0A 1NCDL 5EG6C 3ULVC 4Z8FL 5DC4B 2X4UA 5E8EA 4XVUC 3MRRB 4P9HL 5FK9A 4ZUVA 1IEBB 1A6PA 4GW1B 4Z7QF 3ZKND 5EU3B 3H9YA 1XF5B 2X4QA 5D6CB 1BVKA 4JO1H 1ORSA 3BQUA 2D7TL 4FZ8L 2YZ8A 1I7RB 1T3FB 2P8MB 4QRUA 1PG7L 4C4KT 1Q94A 6CGTA 2BSRA 2EXWC 1EAPB 3VG9B 1U8HB 2DQTL 3RNKA 5F89A 2N1KA 1FFRA 4HQQH 2EH7H 4J23A 3BKYH 1NUGA 4NQCD 1NGYA 2BNRA 1RV6X 1ZT4B 2MCPH 4XVSL 3IB4A 1CFTA 2YKLH 5JIKA 3SDXF 4LAQL 2Z31A 4MJ6B 2AXFA 4HJ0D 2DLHA 3BD4A 1LEKA 4YHIA 1MAML 4BH7B 2P7TB 3HE7B 5FYKL 2GQHA 1YEHL 5BVJA 5MHSE 4L4TE 2C7UA 3GM8A 4WW2C 2HJLA 1ZGLP 1JHKH 4LIQE 3ZSTA 2OMNA 5TPWH 4BQCA 2GEEA 4WUUB 5DR5L 2DF3A 4S1SL 1NEUA 4ODWB 2XWTB 1KYOK 4LMQI 2WBJB 4D8PB 2LFGA 3LEVL 4LNRA 2CRYA 3WLBB 3EBAA 4L4VE 2YD7A 2X1QA 3EIFA 3JVGA 5E4EB 1FAIL 4Z95H 3MRBA 1D5IL 5HD8D 3D85B 1S9WA 4NNXB 2NZ9D 4LKCA 4PJ5D 5I1KL 5CGYD 4M4RA 3O3BB 3VFSB 5JDJA 5AG9A 4MHHI 2NY3C 1VKXA 4JQIH 4BFBD 4M7ZB 3QQ4A 4R4NC 2GITB 2KDGA 3QCTH 5E03A 1K8IA 4E9LA 4UAOC 5CKAA 2UZXB 4HK3J 5JW4Q 3UO1L 5IG7A 5FM5O 4ALAH 4GAJH 2ESVE 1JPSL 4ZO8A 1FL6B 2O5YL 1UQSA 2F19L 4H8WH 4QT5A 2X9YA 2A6DA 4IDJL 5ITFB 2DTSA 4JFPB 4UT7L 1OAYL 2OTUA 4FQHB 4K8RC 2OSLA 4PRBB 1F3JB 1T66D 3EDDA 1ZWIB 5FA3B 1G9NH 4CADA 5D1XA 1GZPA 2CSPA 4NQVA 4IOIB 4DTGH 1T0MA 3MR9A 4LRNL 2R15A 2DM2A 5CBAB 1JNHB 4M6ML 5F7KC 4Q7DA 4KQ4H 4JG0H 1G7IA 4R0LC 4RAVA 3LSOB 5D5ME 1I1AD 2ED9A 2WIMA 4OD3H 5C0FA 3UJIL 5ID0B 1CIDA 5F7MC 2ERJB 1JNJA 2F9BT 2LVEA 4Y88A 2FEDD 4F33A 2DMBA 3PL6B 3NH7H 1WZMA 3IAPA 4TN9A 2A6JA 2MQ3A 2ZUVA 3VXUB 1IC4L 4G6JL 1L7TL 4F15C 4OD3L 2R0ZL 3QJHA 5DXWA 3LKNB 1SEBB 3Q6GH 1OTUD 2CLZA 4KV5F 1FN4B 4PIRF 3TH4T 3OAYH 2V7HB 3WFHA 1BIIB 3TH3T 4B50A 3MRPA 5ESQB 5ICXA 2JJVA 1T7VA 3PWJA 3U6RA 1A6TA 2ZUXA 4ISVA 1OWWA 4KKAC 1YEJH 1NCCH 4DVRH 1P4BL 2BOCA 3CC5A 3KPLB 4JKMA 1UZ8B 1VENA 4U7KA 4H1LG 4ODSL 3O0RL 1QQDB 1MQ8A 4QKXB 3JWDC 1HHJB 4NQXA 2X4SB 2XA8H 4NQDA 4MHHG 4OTXH 3QG7H 3F5WB 3TNNB 1FJ1B 1R24A 4ZFGL 3QNYB 4JY6B 4KWUA 1JF5A 3TJHC 3T0ED 4JFOB 1MFEL 4OIBA 4PPTA 3ZTNL 1NQBA 1TQBB 5EC1A 3GKWL 1OP5K 1D9KA 4FXLA 1BJMA 1MJJB 2NR6D 2XQYG 3JV4B 3E6FA 3TVMA 2F15A 1QOKA 5A43C 3SDCB 4FQLL 4Y2DA 1DN0B 3BP7B 5C8JA 2AXJA 1UH4A 1UB5A 1HI6B 1YC8A 1CLOH 1UT9A 5BVPL 4HWZA 4OSUL 2W9LA 4F2MA 5E00A 2PTVA 5CJ5A 4D9RE 4OCSL 1QFHA 4GT7A 1WT5A 3BIKB 2CDGA 2CK0L 3QNXA 1HNFA 1TLKA 3MZTA 2VKXA 3V0WH 4NKDA 3SKJH 5D6DC 5I6XB 4JPIA 2R4SH 1C7SA 4GUPB 2Q87A 2IALB 5AUMB 1QSEB 3QI9D 5L2KA 4LOUD 3VXUD 4OCXH 5FYJU 4M48L 1KF9B 3RVXC 3OKLA 1RULH 3TWCL 2HFEA 5KG9A 4FNLH 3THMH 3MA9L 1C16A 3QR2A 2R0LH 2AEQH 3BSZH 5BZWA 3O6FD 4P4RA 3TLRA 4OF5A 5IBLD 1KENH 4EI6B 1GOGA 4WFGD 4F7CB 3W9DA 4BSVB 3BPCA 3VFRB 2OTWA 5EIVA 4P2QD 7CGTA 4RAHA 1IVLA 1T66C 4MAYB 4OCLC 2DLEA 1IC5H 2NY2D 5T3XH 5K9OB 1DQDH 1KLGA 4K3HA 3BVNA 4D9LH 4YGVA 1AGFB 5L2JA 1C16B 1KFAL 4MD5A 4YHPA 5LQBH 1ED3B 1NLBL 1U91B 5L2KE 3LZFL 1AO7E 1ZT7A 3MBEC 3BP6B 2OL3B 3DRTA 5DMIH 4NC2B 3ARDD 3P30H 4WWKB 5IFAH 1WLHA 5H8DA 4JDTH 5ICYA 2OSLB 1S7VA 1RJYB 5J1SC 2BCKA 5IQ7H 2W0FB 2DB8A 2DBLH 1KIPA 2VLRB 4ZXBD 4DGVH 1JHTB 3QYCA 4P3CL 4F7MB 1KCUL 3TO4A 3WFDH 5IOPA 3L3HB 5TFSH 2LU3A 1NAMA 3QPXH 4AMKL 5BRZD 1L7IH 3OAUH 1YY9C 1PG7H 1FBIH 3GMQB 2B4CH 5CP7A 4KMLB 4KRPB 3FHQA 1EHNA 5GRYA 5E24E 4PJHE 1Q8MA 4LCWE 3BKML 4ZPTA 3LD8C 4PB9H 2IG2H 3SCMA 1AKJD 2NTSP 3UMTA 3SDXE 3QFJE 1QVOA 3RGVD 4LLDB 5SWQB 4HCRA 8CGTA 2D9QB 4GH7B 1S7UB 3QISA 4KJPD 4RGOH 3GIZL 5J56B 5MEOA 3IGAB 3DETD 2Q86A 2WBJA 3D2UA 4LDEB 4YDKH 4GMTH 1OGAD 5F7HA 2DWDA 3A6BL 4BZ2H 2QEJA 3WJJA 3IDIB 3EGSB 5TH2B 1XF2A 4U1MB 2CQVA 1HHGB 3ILPB 1YJDH 1NC2D 2HFFA 3QH3A 4HFUH 43CAA 2CUHA 2APTA 4LCIH 1XZ0A 1T7YA 4K71B 2EEBA 3VW3L 3OJDB 1KYOJ 4NO0D 1WC7A 1NMAL 5INCB 1C5DB 1BAFL 3MX0A 5EZIL 4K7PH 2P4AB 2Y6SC 1ZHBA 4JFFB 4BYHA 4X8XA 2DYPA 4RWHA 1UXWA 3AVEA 4NFCA 1BBJA 3QJHB 5F89B 1RU9L 2APWA 5T33H 4WENB 1B0RA 2EDTA 3FO2A 3WN5C 1ERNA 2W07A 3ZT5A 5CUSH 3SY0B 1LP9F 1IT9H 2VLKE 4ODHL 2PYFB 3G5YB 3G5XA 3G6AA 4PV8B 3PGDB 5E5UB 1Q0XL 4Y19B 5CEZD 3GSOB 4DVBB 1QBLH 4HGKC 5I17A 5A2LH 4XX1G 2AKRB 4ZAKA 4Y5VB 4M1CD 5JXEC 4LPWA 4QHNA 3OR7A 1H15B 3QDGD 1U8LB 5LWYL 2ITCA 3BEWA 4FQ2L 2XWJA 2N4IA 4IS6B 2ZZUT 4QWWC 2P47B 3T4AB 2X4NA 1JWUA 2EDKA 4Z78A 3C6SB 3S3PA 1ZGLA 1AR1C 2GAZB 1G84A 1DQLH 3NCYP 4TRPH 1YQVL 3AROA 5HYQA 2OZ4L 1FL6A 2NQCA 3NCJH 3T09A 3QPQC 1JF6A 5JO5A 5JPNB 3QWOB 4I18B 4YR6A 1I85C 2Y1VA 1EJOH 1GIGL 5FCUH 2NYYD 5CILH 1MFDL 2A74A 3T2OA 4IEFB 1ZS8B 3O8XA 5KVGL 3O6LL 2VSDA 5C07E 1KC5H 3VH8G 3W0WA 4HIXL 1XR9A 5EO0A 5GGRB 2Q8AL 3FB8B 4JFQB 3VFUB 5DD3L 5C09E 3MRBB 4WW2F 4U6XA 1Q0YL 4P4KD 3GSQA 5TFSL 2P45B 1RZKH 3IJYA 4K7FA 4Y1AD 2PTUA 4FFWD 1YMMB 4D3CH 4PLJD 1CDBA 1HSAB 4JKPH 1Y0LB 4X8JA 5KSBE 15C8L 1HHHB 2VLJB 2GJJA 4CU7A 1ZLWH 1KN4H 2BNRD 4XBGB 5C0RL 4A6YB 1BQLH 2IBZX 1YMMD 5D93B 2Z35B 1D5XB 4JN1H 3TYFA 1JWMB 4TUOB 4X99A 4E41A 3CH1B 3VWJB 1RFDH 4EDWH 3BW9A 3KVQA 2XN9E 4JN2B 5EUOA 1ZT1A 4F57H 4JR9L 5CLWA 4XCNA 1VADA 4XMLL 3W0WE 5CD3A 4P4KB 3PQYA 4ODUA 4MJ5A 4KQ3H 5EO9A 3KPOA 5JIHA 1XIWD 4XP4L 1AXIB 2E7CA 5GZNC 1G7QB 3RY5A 1A1OB 4HFUL 5KN5A 2AJXL 1C12B 4MAUH 5KVFH 3JXAA 3I9GH 4M7KL 1KIUA 2V2WB 3FQNA 3PGFH 4XNYH 1F4HA 4XHJD 5BRZB 1WBZA 4OZ4B 3TNMA 3O9WA 3E3QE 2VZVA 1FORL 5A1AA 1BJ1H 2MHAB 3T4YA 3E3QC 1F6LL 3L9RB 5DJAB 3OHXB 4WI6A 4ONHA 5B4MC 4ZTOH 3FT4B 3QAZB 5HVHC 3OB0H 2PW1B 3F7VB 3GIVB 3MRDB 3OQ3B 3S37H 1IGTA 3MRHB 2I24N 3VRJA 2YD3A 3B9KB 4G8GB 4NNYA 1DE4A 4HWNA 4I48A 1ZEAL 1S7RA 5IGXH 5BQ7A 5CGYC 3NCBB 4PJCA 3BKCH 5DEGA 1G9MC 3GMOB 3PWLB 3VRIA 4OM0H 3ET9F 2DQJL 1A9BA 2ICEA 3CFBA 4HZAA 4J3OC 4OZFA 1I3RB 4LLVB 5FYLH 1FGNL 1CL7L 5EO1A 4QCIB 4Z77B 2VDML 1FV1B 1QHOA 5EU4B 3WJJC 1YEDA 4XAKE 1MY7A 3NZ8A 1YPZF 4KK9D 4QNPF 5H2BB 4NWUH 4YIQA 5ERWB 2PW2B 2F53A 4OZIB 4PGDB 2VXUH 2VNCA 1H3PL 5I18H 5I9QB 3PWPD 5JPMB 3Q5OA 1E4XI 3RUGB 1LHZA 3B9VA 3AAZB 1CFSB 4DGIH 4PRHE 5I74C 4P2RD 1H3UA 1KGCD 1JIBA 3HC0B 2X05A 5D1QD 4HXAL 4HIEB 1AHWB 1P2CA 2Y36L 4HEME 2HVJA 4ZUTA 5GRVK 3WXWH 5K93A 4FHBD 2R0ZH 1NDGB 4D9QD 1P4BH 2WK2A 3MLWH 4UILL 3C2AH 1QRNB 2OP4L 1UWGL 4NQSA 4LEOB 4YO0A 2BFVL 1T6WA 5HHPB 4F58L 3ALWA 3PWNB 4PJHF 1T83A 1ND0B 1LGVA 3QCUH 3M1BA 5E70A 4LCCA 5IVXF 3I6GA 5D1QA 5E8DH 5K9QI 3MV8E 4UT6L 3UXFA 4YXHH 3P4NA 4DCQB 4NP4H 4RGMC 2NY6C 1A7NL 2A6IA 1E6JH 2W9DH 5ESAB 4X5XA 5LG1A 4ZYKA 2Y9RT 4L8SA 2GT9B 3VFWA 1N2RA 5DJ2A 2FBOJ 2IF7A 3EZJB 3O0RH 4NQDD 4CW1B 4RNRA 4MDIA 1IC4H 4G6JH 1FYTA 4WV1A 1OARH 2X4PA 2QSVA 1SYVB 5TJWK 5TDPB 3ARFB 1VSCA 2DLTA 4MJIB 1X5XA 2R0WL 1J0IA 4CN6A 1U8KA 4MD0A 5FA4B 4QRTA 5FECA 4OCSH 1UADC 3MRLA 3TVMD 2IAMC 2A6KA 5D72L 3Q48A 3QDJA 1PZ5A 1TCRB 1KOAA 4NRXB 7FABL 3GO1H 4OF0A 1RURH 3G04B 1EXUB 1XEDA 4NO5B 5D70H 5JW5B 5FV1L 5IK3B 3MO1B 4HIIB 4M8QB 1F3DH 5C0AE 3KNBA 2XQBH 1NKOA 1LQSR 5AZEH 3VXTB 2XNAB 2VDNL 3VD7A 3X3GL 2ESVD 1EH9A 2EIBA 4ZFGH 5DJ6B 3ZDXF 4GKNB 5IB5B 1QA9A 2EYSB 3U9UA 5TDOB 3PWPB 1OAUH 3ARBC 4YH6A 3MACH 4NCDA 2RR3A 4LBEA 1A7OL 3QZWB 1V7MH 2OL3L 4LCUB 5J6HB 1HEZB 3VFOB 2HRLA 1F2QA 1TXKA 1MCNA 3GI9H 5DJZB 2J8UF 3IJSA 4M8VA 2VXTL 2YEZB 5DDHB 2HG5A 3UTPD 1HZHH 3VG9C 3ULVH 3LOWA 2AJUL 1ZTXL 1T0PB 3QHZH 1KBGH 1AQKL 5INDA 2DQUH 4HS6A 3QI9B 4R4BA 4X5WB 5D1ZA 5HYJE 4XH2A 1OLZA 2ZCLL 2EIZA 3ARFC 5DJDA 1S7WB 2KL6A 5KSAA 1Y6NR 1OGTB 3MLYL 4NN6B 2M1KA 1VESA 1AGBA 1I8IA 5GGSB 4WDIB 3V0AC 1DBMH 1FNGB 4OQTH 3FRUA 2W92A 4YBQC 4EBQH 2NY6B 1MWAB 1U92B 1FE8H 1B4JL 5A2JH 2R23B 3V6OA 4XCFL 4UU9A 3IJHA 4FQXA 5JUEL 3X14B 1OAKH 3B6SA 4HIHB 3QNZB 5E6ZA 5FGBC 2ADIB 4D0DA 2D7TH 4H88H 4OV5B 4XCYB 4CDHA 4HUVA 3NN8B 4PRHA 2WP3O 4PJ7E 5DK2B 3HCVA 1EEYA 3KXFA 4ZQKA 2FJGB 4ZTPH 3ARVA 1FIGL 1KPRA 3STBA 2AK4A 4XPFL 3CDFA 3EYVA 4UBDC 4YXHL 3QFJD 4FQXD 4PLOB 1A7NH 2W9DL 4PJ9B 5JHLL 1Q9OA 2XWBA 4PR5A 1MH5B 1JGUL 4EI5A 4R8WH 2QR0B 1WCBA 4JB9L 1JHLH 4H1LA 1JPFA 3HE7D 4GKSB 1UC6A 1LP9B 4QXTA 1D3CA 4L5FL 1FNEB 1XGTA 2HWZL 3JV5A 4WW1B 1FZJA 1G9ML 4XZUB 3TT3H 2FIKA 1Y18B 3D1MC 3MLXH 5ANMB 3AXLA 2X4TA 4TSCH 4G9FB 1JTPA 3FN3A 4PG2A 5D71H 1NC2A 3DYPA 5DMKB 1DFBL 1TMCB 3GHEH 5LGKA 3TBYB 4L4VB 1GC1H 4PV9B 1ZA6B 2W60B 1I1AB 3MUHL 3WUWG 2VL5A 1ZLSH 5C08B 2M8XA 2ADIA 2EDLA 4Y19E 3WFZA 2GCYB 3VMNA 3CFJB 4JZJA 4X7TB 1TZHB 1CFQA 3QAZC 4XVSH 3WO4B 1HXMB 1FL5A 2UVEA 2VRAA 2GI7A 4L8DB 2B39A 4P2QE 3E8UL 1BQHG 1TPXC 4LSSL 1XGUB 2H45A 4HUXA 4ODHH 1FZMA 3MLVH 4JCMA 2VLRD 4ZXBB 3U7YH 1HXYA 1QFOA 3LV3B 4C56B 4HWBL 5DJDB 2GJZA 1UGNA 5I30H 4XVJH 4OUUA 2EYTA 4KFZC 3UPRA 4JREB 4O5LL 3CZFB 2R4RH 3MNVB 4JO2L 1HWGB 5EU6A 4KXZH 1HH9B 2VWEC 1MVFA 4FXKA 3X12A 4Y1AE 4PJIF 1CICB 1MREH 4S2SB 2NR6C 1OWRM 2HT2C 3L3DB 2A0LD 4P4KC 1MFDH 1P1ZB 3JV6A 4TNWF 4LK4A 2KQNA 1D5IH 4Y16B 2AV1B 3OKOA 3P4OB 3HB3C 2VIRB 4M02A 5DD3H 4J3UA 5EU6D 3HZVB 3OGCB 3SDXB 3VH8B 4PP2B 5HGGS 3P3YA 4N0FA 4Z7OE 1I3VA 5IB2A 3QXUA 4XZUA 5CJXA 3H9HB 1NGQL 3GSXA 4KZDL 3OL2A 5IVXA 2C1OA 4BUGA 4LSRH 5KSVA 1EO7A 1OGAE 4X9GA 2PXYC 1RMFH 2PO6D 1TITA 1MCSA 5BJTB 4Y4KB 4DQOL 5MEQA 5DVKA 1UWXK 3WKNA 4PJCE 2QR0A 4Y1AA 1U8IB 2RHEA 4DWHA 4GS7B 5DJCA 5DVLA 5D2LE 4UTBL 2IPKA 2G60H 1G0DA 1NBVH 2AJSL 4XAWH 2DKUA 4M61B 1KIQB 3WEXA 3NBNA 4KTEL 2YD5A 4LCCC 4YUEH 5GJTL 4M43L 4Y4FD 3CDGA 5I0DA 5B8CC 2G60L 1IM3A 5MENE 2HA1A 5TDPA 2GYSA 1KPUA 1S7TA 2DIAA 3S5LB 4MD4A 3WFCL 3VXPB 3RWJB 3U0PA 4OI8A 1JGVL 1M6OA 3HPJA 4PJ9D 3HNVL 1M05B 3KPRA 5AZ2H 3GHBL 4EI5C 2Q7YB 4MZ2A 4JHAH 5GGTL 4KRPD 1BJ1J 4OFVA 2Y5EA 2E7LC 5HHMB 3QEGH 3KJ6L 1ND0A 3VGDA 3RWFA 3KPMB 3TBTA 2C9AA 3UDWC 4LU5H 5EC2B 3VGGA 5DUPH 4EN3B 4KTYA 4CL7A 4K3EH 3FN0L 3L5WB 5FHAH 5B21A 2BJML 1QKZH 3SDDD 3U9PL 5H94B 1KCSH 2N56A 5DC0A 1KJ2L 1NC4B 1YYLH 4NZDA 3MLZL 1UZ6E 5C0AA 1QLRA 5MENA 3TA3C 3IDNA 1V5JA 4YJZL 4KMQA 1JRHI 2AAVA 4GG8B 1MIML 4F57L 5I1AB 2CR3A 1PYWA 5TE7H 1RZ7H 1NCWH 4E5XB 3IVKB 5DGRA 2AEQL 2ITDA 4U6HB 1WEJH 3FQUA 4RGNB 4QHKI 1U9KA 1EUTA 4OB5L 3F7RA 3GSWB 1ADQH 3MJ8A 3RWJA 4RQQA 5I1GH 1BFVL 4GMSH 1OHQA 4UTAL 5F9OL 2BC4A 5C2BL 1WIPA 3GJFH 3PWLA 5TQ2L 5DK0B 4AM0A 3DV4A 2AEWA 4UV4L 4TNVK 5JQ6H 1AI1L 1EHLH 1KCRL 1VEMA 4NJ9H 2O26U 3KPPB 3KLSA 1I1RA 2HLAA 3Q0HA 1N0XH 1MAJA 4PUBH 2OR9L 4OZFH 1S8DB 5D8JH 4YDLC 4JJ5A 1CE6B 3HG1B 4ONHB 5F9DC 1I75A 4MCZB 3DHJA 1BGXH 4LSRL 3GSXB 4OLUL 3SE3C 2JJTA 1FVCA 4YFEA 4P3DA 1L7IL 5C6WH 2EEAA 3MRIB 4G42B 1MWAL 1ZVSB 3IRZA 4H5SA 4JJHA 5H37G 5HGHA 3IVKA 2YWZA 4NO2A 5T5FL 1UB6B 3HZVA 4KJWC 4K9EH 1TIUA 1II4E 3UZQA 5CSZA 4EVNA 4NC1E 2MCG1 5F71A 4R7NB 5T3XL 3RWGA 2GTZB 5HJ3B 4MQTB 1U8PB 1GPOH 4R96B 3ARFD 3MV7E 3L3DA 1FNFA 4MMZC 2LTQC 4YAQA 4CJ0A 3IFNH 2FB4L 2V5TA 4NN7B 2Z91B 3VWJA 2JCCF 3MRFB 5BXFB 3MNVA 4NWTL 4RAUA 4XPBH 2PUQT 4EXKA 2J8UE 3RWFB 4JZOB 2UZIL 1FVEB 1LK3H 2WIIB 4JFXB 4OLYL 4KJWD 4UQ3A 5H94A 1S5HA 1NBYB 3R1GH 1ZGLM 4PJ8A 5EUKB 4U6TA 1BOGA 3EHBC 2B1AL 5CJOL 1I8MA 4M5YL 4G7VL 5D72H 4YE4H 3RVWC 4K7FB 2IH1A 3INUL 4XPAL 3SOBL 5JW4R 1WAAF 5AAWA 1T22A 1U95A 1VA9A 5HGDB 3E0GA 6FABL 1B3JA 4ETYA 2ZUQB 3VGAB 3KPRB 3BPNB 1G0XA 3BN9D 5HHQA 3RPIB 3RGVA 1T1WB 3FQTB 3O8XB 3QIUB 3EOBB 4GAFB 2VDPH 1JGDB 5DMGC 1LE9A 4YQXH 4OZFB 1YPZB 4ODSH 3H8NA 2A74B 3FMGH 1NAMH 5DMKA 1R5WA 4QHUB 3GIZH 1NMCC 4N1HB 3CX5J 5ANMA 4Y4HB 4X9HA 2IBGA 3C6LD 1CR9H 1HINH 2KPNA 1MELA 2NY5C 2W9EH 2HKHH 1UACH 4LCWA 4P23D 2X1WL 1SYSA 1W0WB 3D25A 4MDJA 4N0FB 4WUUE 1IGJA 3MJ8B 1Q9WA 1JPST 1WCBB 1F4YL 4OCRL 3ARDA 1IE5A 3V0WL 4N9OB 4Q6IC 4A2LA 3OKOB 4UOJA 4Z7VF 4IRJB 1P6FA 3OR7B 1IAIL 1HIMH 3MJ6A 4XWGH 5D4QA 1QEWA 5KSAD 3SE9H 2ZUTA 1CD0A 1GH7A 3RKPA 4Y5YC 2VZTA 3RDTC 3G6AB 4CMHB 4ONFH 3TBVB 1UA6L 5DK3A 3OPZL 1GZQA 1JRHL 4L29B 3VGFA 5D7LE 1A6AB 2NZIA 1UYWH 1EZVY 5F3BA 3MJ9A 4OFPA 2F54A 3L3OA 1ZT1B 3LKSB 1E6OH 4AIZA 4PG9A 2EZ0C 3SKUD 2CRIA 2AJYH 4Q6IA 3PDDA 1UM5L 3JWDH 2WNGA 3S6CA 4BZYA 4CNIA 3C5ZC 4YHML 1HXMA 4UOW1 5E0QA 4XP9L 1RUAL 2BSED 2ZSWA 5IHBA 1A6UH 2DQCL 5FUCE 1Y0LA 3MLYH 3NAAL 2AJYL 3RTQA 2CR6A 4ZOCA 3I84A 3DV6B 2H26B 2VL5B 5INDB 1F6FB 4Y4HC 3UJIH 5EN2B 3IJYB 4TYUA 4L9DA 4XMPH 5DEZA 4ONGH 2DQDL 4PRIE 3KWWB 4I0PA 1E4XL 3BGFB 3CFJA 2VLJD 5TDNB 3GHBH 5EPMA 4XGZB 4HEPG 2OYPA 4GXVL 4Z7WA 5GS1C 3KLHD 5IB3B 3RTQD 4JEGB 5K9JL 1EZVX 4HD9A 4PJ5E 4IRJA 1BQHB 3BHBA 2Z8RA 1Y6MR 3EO9H 5GGVY 1KB5L 3FQXA 5D7JC 4N0RA 3EJYD 3RZCC 1J8KA 1CFBA 1EERB 4G6MH 1IGJB 4LDLB 3TPUA 1Y18A 2GKIA 4QRRB 3U9UB 5C86A 3KPNA 4HCRH 4HKJA 3VXNB 4K2UL 3EFFA 3GSUB 3B3IB 5F7DA 2H2PC 2YC1B 5DUBA 1KNOA 5F72S 4W81A 4NPYA 4ZSOA 4JDVB 2A9MH 2OM5A 2FJGA 4MJ2A 5IUSA 4NN5B 5E8PA 1XIWC 3BP6A 3QDJB 3M8OH 3E6HA 3H42H 1TQCC 1K3IA 1AGFA 3HI5L 5L2JB 2YS4A 4IRSB 3QNZA 1MEXH 4CVZA 3BYYA 3U1SH 5HGDA 1FC1A 5HVFB 1XAUA 3S96B 1FGNH 5KSBA 8FABA 1DBJH 2DI8A 2K7PA 2AJXH 1MPAL 5KVFL 4F80A 1YECH 5I0ZA 4V1DB 1H8NA 3EFDH 3I6LE 1D9KD 5EUKA 3X13A 1BBJB 4ZFFA 4UV4H 3P0YL 5JXED 1S7WA 3OX8A 2J88L 4WHYH 1MWAA 4AIXA 1D5ZB 4P9MH 3B5HA 5TF1L 1QFUH 2VXQH 5C0EB 3IDJA 5DA4A 4E42B 2HFEB 3S36L 3WL9A 2BVTA 3X3FH 5KSBF 3WUWA 3O2DL 3RDTD 5JDSA 2VB5A 1T03H 1AGCB 2G75A 5ISZA 3ARUA 2HVJB 4YHNA 2ZOLA 2VWEE 3PHQB 5IB3A 5JZ7C 2OP4H 3ULSB 5DJXB 1BX2B 3FFDA 1RIUH 3VXRE 3LH2L 3L3GB 3GZKA 3FO1B 2BY1A 5C0JB 2HG5B 1CFSA 1BVZA 2UY6A 3MRGB 1QG3A 4UI2A 3V8OA 4YHYC 3AM8A 2JCCB 5IMOB 3C08L 3T0WA 3GEWB 4PGCB 3FL7A 4JFYA 1T20A 4X4YB 3QG6A 4RFNB 3TIDB 5JIIA 1MIEH 2AK1L 3CVIH 4FTVD 3Q2CA 1NCDH 3ILQD 1UM4L 1T21A 3MCLH 3ISWA 4PBWD 4JANB 5BV7B 3HE6B 5IJKC 1NGWB 1LEGA 5HDBF 5C1MB 3QIBB 4K7PX 5GGQH 4NO5A 1E4JA 5I1JL 5FO7A 3L3HA 4FQCH 4R97B 1CDIA 3JTSB 2ZG2A 4NQXB 4LCYA 1U8KB 5FA4A 1AJ7L 5AAMA 4NNYB 1KCUH 4F7TA 2JE8A 3LPFA 3QCVH 1VHPA 4H88L 3LRSB 4AK1A 3AS0A 2HTKC 3SE8H 2V2TA 2AJ3A 5D7JD 1JGDA 1FYTB 1BREA 1G7HA 1NBVL 1RUQH 4K3GA 4LHUD 3L5HA 4CVXB 5CGTA 1MIMH 3LQMA 5K9OA 2OJZL 3GMLA 3SHSA 3VFPA 2KKQA 3HTLX 4HWEL 1FSKC 4HX1A 1QKZL 5T5NG 5KTEH 4MAYA 3ARDB 1H3TA 4JHWH 4XCEA 1JFQL 1IKFL 3MLUL 3TZVC 5GS3A 1ZLVH 4WI7A 2J8UB 2NTFA 1XFPA 1J5OL 3A6BH 3LSOA 5MENB 3MODH 3MLUH 1CDYA 1F02I 1RIHH 3KR3H 3LKRB 1A3QA 2NY2B 4YFLF 2HWZH 1A0QL 1CGYA 1CLZH 4LCCB 4RRPG 2WSKA 2UUDK 1PJ9A 3VW3H 5FF6B 1NFIA 3VXSB 1AI1H 4RZCB 3VI4E 3EFDL 25C8H 1JWMA 4XX1E 3WS6A 3WHXB 4WFGE 4X7EC 4RWYH 2EE9A 5D1XD 2P44B 1H0DB 5ITFA 2VAAB 4JE4B 4PGDA 4TSBL 2PXYB 3S7GA 4ZOEA 4MA3A 1Q9KA 1HSAA 4UINL 2D4FA 1U8NA 4F2MB 5TQ0H 1KPVB 3WD5L 4NKOB 4S0TD 3S36X 2IBZY 4EIZC 2E6PA 2BHZA 1OF2B 1UB5B 4OLZH 2NXYB 1KJ3L 3MRJB 1QSFA 2WWKO 4LVNC 1FVDB 4NFBA 3CX5K 3ARWA 3QDMA 3SGKA 3VXTA 2NY1D 3OZ9L 2VDKH 3TO4D 4M8QA 1DQJB 4QYOA 4I48B 4JZOA 5DFTA 3RY4A 4UQ2A 1OAZL 2VQ1A 4QY8B 1TVHB 3UPAA 2FWOB 1CICC 3CXDH 3NFNB 4ODWA 3NGBB 5BJTA 3LKPB 2GSGB 4K23L 4XPGL 2OCFD 3QQ9C 1KGCE 2DQUL 3O3AB 1DQDL 1JGUH 3VFMA 2YD1A 2EH8L 3UC0L 2DJ4A 4GBXC 3NCJL 2BVPB 2NXYC 2CJUH 3O2VL 3NIFE 1RAMA 1P6AB 2Z4QA 5DJYA 4ZUWA 2FEEI 5CJ8A 3DROA 4WI4A 4YXLH 3A67L 2JJWA 5F6HI 4MA8H 1H15A 3I3BA 2QSQA 5GZND 5J12C 1K4CA 3FT2B 5A16B 4DGVL 3NCCB 1JWSB 5DRNB 3NCMA 5EZLA 3O3AA 2AVGA 4NGHH 4WJ5A 1KB9J 2XTJD 4XB7A 4NO0A 5HHPA 1I1FA 4DZBB 3C5JB 3OAUL 2C1PA 3OKYA 4CGTA 4HFWB 1WUNT 1D5XA 3TYFB 1VFBA 3K80A 2X4RB 1FIGH 1AXSA 1DR9A 4OBRA 5ANME 2GJZB 5CHNB 3HC0A 1VADB 4XCNB 1NFDF 4JQXA 2H1PL 5I1EL 1NPUA 5D1XB 2C3GA 2EE2A 2YK1L 5JLZB 1T80A 1IKFH 3FOLB 3MRJA 5IQ9A 1KV3A 2X40A 4PJGB 3CFDB 3FCTB 2XA8L 3OJDA 4YDKL 4FQLH 3SGDI 1CN4A 3GMRA 3KPSB 3F12B 2ZJSH 3B8YA 1N5YH 4IOFC 4ZUSA 5J0BA 2K3TA 3QDGA 4KHTH 5D5MF 3V7MA 2IFGA 3QJFA 2LE9A 2GY7B 1NFDA 2PYEA 3KLAA 5F96H 5F1IB 4E41D 3DMMD 3QXWA 2JKXA 4F9PA 1T5XA 3QQ4B 2WUBH 4HKXB 3CFBB 3VRIB 4KXZI 2JB5L 3O3BA 3VFSA 4KMTL 5F96L 4U6YB 2JK5B 1FIEA 4JPWL 5GRVL 1RJLB 4G8GA 1FLRH 1MCLA 4J3WA 1OCWL 3FQRA 1FNEA 4M7JL 4GRWE 1JZ3A 4J6RH 3DMMA 5CP7B 3LY6A 4GKSA 3SGEI 4S1RH 4E0RB 3HNSL 1S9VB 5C09A 5CCKH 4XCEB 4MQ7A 5I71B 3UYOD 4XMKH 4F7MA 2C1OB 2HKHL 1EEZB 2DYPD 2Q7YA 3MACL 4MJ4A 1EGJA 4I3SH 1KCVH 3L7FA 3GSVA 2YD9A 2XICA 2AK4B 1LO2H 4K3JL 4X7SL 4X6CA 4YHKL 4Y19A 3VXPA 4RISH 1HK6A 4MQXD 2W1NA 5C09D 4WEBL 3IKKA 4OBSA 4P59H 3L6FB 4U05A 1LO4H 3HAEG 5C0CD 1LE5A 2NY1B 3O3EA 4Z7WE 1JZ2A 5I17B 1KLGB 2WQ8A 1P4LB 4E41E 2PF6A 1PLGL 2WANA 2XN9A 2P42B 3UTSD 2Y7QA 2QV2A 3AU1A 4HZLA 3MRQB 2EYTB 3MXVL 4R3SB 2EC8A 5C0BB 5GS2D 3SJVA 2YN5A 4HIJB 5J3HC 4AJ0A 1HXYB 4EDXA 4JG1H 2J6EL 5BS0D 5JIPA 5CWSB 2Y36H 5BZWB 4NKMB 3WXWL 4C54A 5IROC 3BAEH 1INDH 3QRFM 1CXEA 3RL1B 2CKBB 3CU1A 1YUHA 4Q0XL 1UVQB 3JUYA 5FB8B 3I2CH 2BFVH 5C08E 4HBQA 3IFPA 4ZSOE 3BWUC 3UTZB 4XNMB 4BQ9A 1CGWA 3RGHA 2AW2A 3VCLA 1FPTH 4URTB 2ICES 3MLZH 5TH2A 3O8XD 2VITA 5H35B 5MERB 2B1HL 2NLJB 3L7EB 4LRNH 4G9FE 4KK8C 4ZTPL 4EQ2A 1FO0B 1GPOL 4U33A 1J1OL 3D2UB 2Q86B 3ECBA 5KOVC 4QHMB 5DHYA 1EFXA 1MAMH 4G8EB 2BDNH 1J18A 2FD6H 1CFVH 2H8PB 4V1DD 3WNOA 3UAJD 2FX9L 5EBLB 1LP9E 4LSQH 4UOW0 2ZKHL 4DUXA 5IESH 5TDOA 4XMLH 1PQZB 4JO4H 2XQYK 3TZVA 4OZHA 4Z5RA 1A6WL 3ZHDA 1RZ8A 4LSQL 4S1QL 4RGMB 5DFWH 3QUYD 1DVFA 2R0KL 2HMIC 1EFXD 5D7JB 1SVZA 1G7MA 4PJAB 2CPCA 3KJ6H 4KPHH 4HGWB 3BUYB 3WUZA 4XXCA 3IKCB 3N0PB 3INUH 2A6KB 1PG7X 4XVTL 5GS1B 5HDBE