4DP5X

The 1.88 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 8.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp5X00
4HIPA 4AKOA 1A3ZA 1NWPA 1E5ZA 2QPDB 4BXVA 2A3TA 2FT7A 4N4YB 4DPAX 1ASQA 3CDZA 3WNIA 2CCWA 1JVOA 2UXVA 4E9SA 4DP4X 7PCYA 2EIMB 3ABMB 4WTQA 3WNJA 2IDUA 4G7SB 2YXVA 2UX7A 2UXFA 4KO6A 1TEFA 2OV0A 3AG4B 4KNSA 2XV0A 1PF3A 4KO9A 3SBRA 1NINA 2YAFA 2FT6A 4G72B 2YAMA 2EINB 1ILSA 2FNWA 2VSMB 3DTUB 2JXMA 3EF4A 5EHFA 2PP9A 2IH8A 3T9WA 3X1NA 2I7OA 4X4KA 1NICA 5AFAA 1GW0A 3BVDB 3QJQB 3N2JA 1BQKA 1HFUA 1NWOA 1XB3A 2B08A 3TASA 2OJ1A 2R7EA 3NJMA 1ET8A 3SBQA 1A65A 2AVFA 1TKWA 2QDWA 5D4HA 3AG3B 3FYEB 1WAEA 1JERA 3S8GB 2UXTA 4DP9X 4GY4A 2VSKB 2BP8A 3ERXA 2DV6A 1SHXA 4YSEA 1A4BA 1PCSA 5D4JA 1GY2A 2CBPA 2XXGA 5AZUA 4BK5C 2J55A 4G71B 5I5IA 1FFTB 2YAHA 4A68A 1FA4A 1SFDA 2YARA 3UAEA 1E67A 2YAOA 1M9WA 3NJIA 5TK2A 2BO0A 1KGYE 1OE3A 2HX8A 3HB3B 3OMNB 2IDQA 2PCYA 5PCYA 3ABLB 2GI0A 1JZIA 4HCIA 2WSDA 2GHZA 3C75A 3FSVA 5I6KA 3FSZA 2H47C 3NP4A 1AS8A 3FPYA 3T71A 3ABKB 1IC0A 2DY2A 3QQXA 3H4FA 1XMEB 1JZHA 1ZIAA 1ZDQA 3OQRA 3ASNB 8PAZA 1OF0A 1OCCB 7PAZA 2TSAA 1BQRA 3NYKA 4UANA 1OV8A 4A2GA 1SHWA 1AZRA 1DYZA 2BP0B 2HRGA 3NP3A 4YSCA 1AS7A 1BYOA 1R1CA 2VM3A 1JVLA 3X1GA 3H56A 2UXGA 1NTDA 3PAZA 4YSOA 4JHVA 3CVCA 2CUAA 2VW6A 4HZ1A 1ASOA 1WA1X 3AG2B 1V10A 4DP6X 2VM4A 3NJGA 4YVUA 2QT6A 5I5MA 2X88A 1BAWA 1WS8A 3QPKA 1MDAA 3H4HA 1NIEA 5PAZA 2XWZA 4YSQA 2XU9A 2BWDA 5B7MA 4UAHA 1AANA 1PNDA 2UX6A 3JT2A 4DP2X 1TU2A 3ASOB 1DZ0A 1AACA 1SFHA 4P5RA 5B1JC 3QJVB 1HAWA 2DWTA 4KOCA 4W9ZA 2VMJA 1MZZA 3IN2A 3ABGA 1ZDSA 3EH3B 3ZX1A 4E9YA 5I6PA 1V55B 2XUWA 3N55A 4EF3A 2BWIA 1N68A 1AIZA 2PLTA 2VN3A 3L45A 1NIFA 1SJMA 2BZCA 1CYWA 1AS6A 1AZCA 3FU9A 2EIKB 4AKQA 1ID2A 4AKPA 4YSAA 2MTAA 3SBPA 3PPSA 1AOZA 3T6VA 1QLEB 3OD3A 2XV3A 3AG1B 1EZLA 1L9TA 2B3IA 2DYRB 4AX3A 1SF3A 1AZBA 1PLBA 1GS8A 5B7FA 2BZ7A 4F2EA 1RZQA 1KBWA 2FQDA 2DWSA 2XV2A 3T6ZA 4E9XA 4G7QB 4GXFA 4BXSV 2PPFA 2HX7A 3EHBB 4F2FA 1JXFA 3T6XA 3NJLA 3CVBA 2QDVA 2IWEA 3NJJA 2XLLA 1W8EA 4NERA 1IBZA 2Q5BA 4Q8BA 1SDDB 3FU7A 2IAAC 5B1KA 1ZIBA 3X1BA 1I53A 1J9SA 1E5YA 1ETJA 3UACA 1PZAA 3AW5A 2PPAA 2WO3B 4UF7C 3ZDWA 2QPEB 3WKPA 1FWXA 1GS6X 2AZUA 2J56A 4Q89A 1M56B 1QNIA 5B1JA 2X87A 3UAAA 1AQ8A 3WKQA 5TK4A 4YSUA 3ZBMA 1XB6A 3PAUA 3KW8A 2JFCA 1CUOA 4YSPA 1PMYA 2ZXWB 3WG7B 3V9CA 2R7EB 1AG0A 1BYPA 2W88A 1WS7A 2ZWNA 5I5JA 2CAKA 1JZFA 2FQGA 3HEIB 3MBWB 5B1BB 4L0PB 5I6MA 1BEXA 4DP0X 5I6OA 3X2QB 1NPJA 3X1FA 2YAPA 3OMIB 3NSDA 2GBAA 1KCWA 2FTAA 3KW7A 4KNTA 2BP8B 5B3SB 1MG3C 3WIAA 1E65A 1V54B 3SQRA 3X1EA 4HCFA 3S8FB 5ANHA 4KO5A 1BXUA 1JZJA 1ZPUA 2YAQA 1OE2A 1NIAA 2VW7A 3D12B 2OCCB 1IUZA 2GB2A 2PP7A 4QLWA 2CALA 5D4IA 4ENZA 3TBBA 4M4RB 3MX0B 3G5WA 2PCFA 1KBVA 4JHUA 3NSCA 4QKTA 1PLCA 2XX0A 4HHWA 4WKXA 2FWLB 3QJTB 1WA0X 2JKWA 3WI9A 5AKRA 3UGEA 1J9QA 1GYCA 2MRYA 4FA7B 4YSTA 2P80D 4RH4A 1PNCA 4ZK8A 4N8UA 5LDUA 4PAZA 4YSRA 1XB8A 4YSDA 2ZOOA 3NJHA 1VLXA 1ZV2A 2BP0A 3FQ2A 4FAAB 2PP8A 1KDIA 4PCYA 4BDVB 5B1AB 1E30A 1NZRA 2I85A 2TSBA 1BQ5A 5F7BA 4DPBX 1AZNA 5E9NA 3ZIYA 3CZUB 2DYSB 5A7EA 3GYRA 2GIMA 4E9TA 1J5CA 1T5KA 1CC3A 1NPNA 5IY5B 2GC7C 2PPEA 3CDZB 6PAZA 3TBCA 3FYIB 3DIVA 4NAJA 3EH4B 1L9PA 3FPXA 2IWFA 4E9QA 1NIDA 1EHKB 4P5SA 2AFNA 2J5WA 4F7KA 2EILB 1AZUA 3PXLA 1TEGA 2GSMB 1KYAA 2AZAA 2FT8A 5B7EA 1AR1B 4MFHA 3NSFA 4CSPA 4DP5X 1PZBA 3AZUA 3PCYA 2IDSA 1RKRA 2FQFA 2XYBA 1F56A 2IDFA 3IEAA 4GYBA 4A66A 4DP8X 1X9UA 4YL4A 4KNUA 4CSZA 1OCRB 4BWWA 1ADWA 2YXWA 2HX9A 3FSWA 4AI7A 1L9SA 2FJSA 2HLEB 1GS7A 2GC4C 5F7AA 3IN0A 4HHGA 1A8ZA 2EIJB 1OCOB 2Q9OA 3T6WA 1SNRA 3AY2A 3CG8A 2FQEA 1A4AA 1JZGA 1CYXA 4BWTA 2BHFA 1A4CA 1PY0A 2J57A 3S3DB 5I26A 9PCYA 1J9RA 3EH5B 3NSYA 1CURA 2BW5A 2RACA 4E9VA 3V9EA 1SDDA 3FU7B 1IKOP 3FT0A 1IBYA 2HXAA 2P80A 1SF5A 3BQVA 1RZPA 3TU6A 3QJRB 3FQ1A 3OM3B 1AG6A 1PLAA 4A2FA 1MZYA 1JXDA 4GP4B 2PPCA 1KV7A 1UATA 3DKHA 1L9OA 2WO2B 4G70B 4KO7A 1J5DA 3GDCA 4G7RB 3UABA 1B3IA 2AANA 2H5UA 3RYMA 1J9TA 2XVBA 4DP1X 2ZONA 4KOBA 3PAVA 4K9JA 1KDJA 2Y1AA 1PAZA 4M3HA 6PCYA 4TXVB 2Y69B 3IE9A 2W8CA 3QJSB 2IDTA 4W1TA 5I6LA 1OOWA 1ET7A 1W6WA 2CJ3A 1URIA 2PPDA 4HAKA 1GR7A 3OMAB 1JXGA 1N70A 1PZCA 3S3CB 1ILUA 4YSSA 2YQBA 1OCZB 1GY1A 3FQYA 4DPCX 1M57B 1NIBA 1HAUA 1OE1A 2E86A 1RCYA 4E9WA 1WA2X 4GP5B 4A2HA 4BWUA 4E9RA 1BXAA 1JOIA 3NJNA 2H3XC 5FC9A 4NB7A 1GSKA 1NDTA 3TA4D 3NT0A 3JTBA 4GP8B 1ET5A 4AZUA 2IWKA 1KCBA 3NJKA 1JZEA 1BXVA 2IH9A 1YLBB 3PLYA 2BW4A 3S3BB 1W6LA 1AAJA 1L9QA 2I7SA 2VW4A 2XXFA 2HRHA 4DP7X 2HZHA 1L9RA 4A2EA 4HCGA 3FU8A 3U25A 2YAEA 4A67A 3UADA 1ASPA 1MG2C 3FSAA 3GXUB 3NJFA 5I6NA 4BDVA 1QHQA 1X9RA 3CVDA 2N0MA 2LLNA 3FS9A 3IBOA 4HALA 4A2DA 4JKNA 5I28A 2XX1A 2NRDA 3QJUB 4YVNA
chains in the Genus database with same CATH superfamily
5FEBA 4IHOB 1QSEA 1VEOA 1GAFL 4OLZH 5KSBF 1NFDE 2K3TA 2KDYA 4IIQC 4QWWC 4Z0BL 4YJZL 3WHXB 1F6AA 4L8CA 2KZKA 3DHJA 3QK0A 1CZ8L 1X5LA 4PCTA 1UYWL 1EBAA 2MH4A 1OP5H 5DJCA 1N6UA 4N8CL 4MD4B 1UXLA 5KVDE 1TEFA 5FYJH 3NGBC 3OLDA 3U1SH 3MV8B 3QUZC 2PYEA 1FNLA 1QFWL 5DJ0A 3QO0A 3QVAA 2KBGA 2O5NA 2A4CA 4H8UA 3ZE2E 2ERJC 4FYRA 1QSZA 2XZAL 3X1NA 3MRBA 2OKMA 4ADIA 2C3VA 3PQYA 2ORBH 3OHXC 1CD1B 1RP8A 2LE9A 2X53A 5B4MD 1SXZA 2YPVL 3VFWB 4XPBH 2P5WD 5D8JL 3TM6A 4CN6A 4LCWA 4U6TA 2VDMB 2G0LA 3FTGA 1QLRA 1P4LA 2YS4A 3MLYL 5C0DA 1IQWL 1OQXA 3A22A 1JERA 4WWOA 5E8PB 1NEZG 2M26A 5MP6L 2WBXA 1IGML 4NNPL 2ED6A 4LOFA 3M7OA 4NC2B 1NC4A 1Z1WA 3RI5F 4AYFA 1PCSA 1MW0A 4BEIA 2B77A 3STBA 1KXQA 1J1PL 3QWOA 2YD7A 5T33H 5ADOH 3NIGF 3P4OA 2AJVH 3ECUA 4FQQA 5HPMB 1XHHA 1F86A 3O11B 1XGQA 2BO0A 2WAQA 5LG6A 4PI0A 4P9ML 1E4KC 5F97E 1KGIA 2X4QA 1SXBA 5F6HJ 1JF1A 1T6BX 1HDMB 4Y4KA 2NNFA 4R4BB 2CIKA 2H47C 5IHZA 4P9HH 2VDOL 3O0RL 4XWGH 1A6VL 2CUMA 1Z5YD 2EE3A 3CFMA 3GEWB 3UP6A 3O45A 4KRPB 2XQYK 1JZHA 3DXAA 1QI4A 2OMNA 1OIOA 4MJ5A 5B39G 4XR8C 1OCCB 4TVPH 2WD0A 5E2JA 4AOFA 4PJ5B 3WMSA 1OV8A 1CICD 2WSKA 4JN1H 3ZDYF 1BFVH 1NM9A 2NDGA 5IB5A 4HETA 5LXGH 1QX1A 3PNRB 1RZ7L 3FXIC 4PJFF 1BQLL 3C09C 1INEH 2XKNA 3QNXA 1ZHBA 4YWGL 4WW1A 3L3HA 3UO1L 1PLGH 4YSOA 3SCMA 2C4XA 2Y25A 2PXYC 3RVTC 4HDIA 5EBMA 5T3XH 2JI3A 4N0CC 1EDHA 1KLUA 4FCHA 4FQJH 2NY0B 4YVUA 4HLZG 4C56B 1JV2A 5F3HA 2VLRD 4WCYH 5I5MA 3B8SA 5FO2A 3LOWA 1WS8A 2BVQB 2E9BA 4Y4FB 4ZFZB 2E9WA 5PAZA 2NNCA 4FFWD 4ZUUA 3QI9D 3W0WD 2ICEB 1KEML 4PD4J 5KVFH 4FQ1L 1EJFA 3G6JF 1GYUA 3SSGA 1JI2A 3D2UB 3ASWA 5DD3L 3OXSB 2EXTA 4W9ZA 3IMSA 1J12A 5MEQA 4XMWA 4DJMA 4LSUL 3VNYA 2VLJD 2XFXB 3CFQA 1ZS8A 3O9WD 1K4DB 4GT7A 4PJGA 1CGSH 2Y6SD 3LH9A 4LQ1A 4EF3A 2PLTA 1J05A 1JHKH 1KPUB 2G60L 4Q9BA 2GBTA 4U1JA 5E24E 2XWTA 2EVGA 4D0BB 1WYJA 3OR6B 3UJJL 1NAMH 4MJ6B 1M3JA 5T3XD 4AKPA 2VAAA 3RG1C 3U4BL 1CXEA 4EOWL 3QFJD 1AOZA 1QLEB 3UTQB 2L3BA 3MO1B 1Q0XL 4LPVA 4OD1H 1MVUB 2QZ5A 4O00A 3L3KB 4HPOH 1BZ7B 4ODVH 2XA8L 2A9CA 3CUPB 1RZQA 2QPUA 2NY6B 4N90D 4Y2DD 4M5ZH 2QKIA 2WNXA 3VU1A 3UG3A 3MR9B 5D1QE 2VDLL 3D85A 3VYOA 1VFAA 4Q56A 2KZWA 3CVBA 4TUKH 3OXRA 4JUSA 2QDVA 3MRIB 3AACA 3DX8B 4W81A 3BVNA 1JXKA 4PJ7E 2BSEA 5F8RC 2Q5BA 4APQA 1SDDB 1MFBH 2EE9A 3BEVB 4ZZKA 5KAQF 1I3GH 4S2SA 2GG1A 5BPPA 1ZXKA 2CCVA 4HKBA 4FQ2L 3SO3B 4RFNB 4JHWH 2GHWB 2OQJB 3FZUC 3ZKMD 1PZAA 1KTKE 1FNSL 3OPUA 3CFCH 1AGCB 2MJWA 4QYOB 4EE2A 4RMWA 3DI2B 1A25A 3MVSA 2VLJA 3QNZA 4Q74A 3FTZA 4QY8B 3QEQD 1NC2A 3WKQA 3JUYA 3ZZSA 5CEXB 2CJUH 5DFVC 4EUPA 1BQHG 2BIIA 5FCUH 1OGSA 1TZOA 1G1KA 2FEDC 3IDUA 2P1YA 1IAIM 3JTSB 3FO9B 4DNLA 4QXTB 1JPGB 3N1QC 2WO4A 4OCYL 4PN6A 5EO1A 5HGBA 1IBGL 1GJUA 1R34A 3JZ7A 3QJHB 3VYNA 5DMKB 1EEZA 1U8HA 1EJ8A 1H0DA 2NX5E 4JANB 3OMIB 1EUUA 1BP3B 4ORZC 4U3SA 3QNFA 3CMOH 4NLHA 3QIBB 1UH3A 3DHMA 3WIHL 5I8KH 5AYUL 5IIEA 4POZD 3FO0H 3S2CA 1FFOB 1YEFH 1OE2A 2A74A 4JM4L 4QTHB 3EJZC 3V4PH 5EU7E 4CC4C 1Z3GL 1PIGA 3QYNA 1K4CB 2DIEA 4LBAA 3NABH 1QBAA 3RGVA 3CWGA 1I8MB 1DLFH 1EVTC 4NO3A 3WFDL 2OP4L 1D5ZA 4LLDB 4CVUA 1A6PA 3CVHL 3OKMA 5I30L 5LQBH 3I6GA 2UZXB 4JJ5B 1EGJH 3H9SE 1S7WB 1ZTMA 4JPKL 4FTVE 2CLVA 4IKNA 3MGTA 4IBZA 2LHAA 4LO9A 5IFJA 1CD8A 4WW2B 4AG4L 4D9LH 4IBVA 4EBQH 2J88L 5C07D 4N2NA 4YPJA 1H6TA 5DUBA 3HE7A 4JFEA 1J87A 5CJXA 3MROA 3OAWA 4PJXE 2DBLL 3PL6C 4UWQB 2NXZD 4Z7OB 2NPLX 4J3OF 5HYEA 3SN6N 2XJLA 3P3SA 1T2XA 2OJZH 3C5SA 1CGWA 3K5RA 1YYMH 1QSEB 4K23H 3V6BR 3RZCD 2GIMA 4F7CA 1CC3A 5EA0L 4LESA 5CSBA 4NZTL 5KSBE 2XVGA 1A7QL 3KPSB 3HC0A 2GTWB 3SZ6A 5KN5A 3MTRA 4OI7A 4IGBC 5DJCB 1G7MB 1NIDA 2PWHA 5BXFB 1S7UA 4GRLD 3MV8A 1AZUA 5F0JB 2LU7A 4HUUB 3GC3A 5AW7B 5IMOA 3FUNA 2EJ1A 4JE0A 1KY7A 1KYFA 3QO0B 3DECA 1XBRA 1N0XL 4XN2A 3UTTD 1MCBA 4YUEL 3EJCA 1A4JA 3GSNB 4XCCH 1IGYB 2H0EA 2C3VB 2DAVA 2C4FT 5KOMC 4HFUH 4D9RE 4N1HB 1K6QL 1XGTB 3GINA 3SKNA 3PGCA 3QARA 2YPKB 4APQD 1WGOA 4HUXA 1VFMA 3BPCA 3EJPA 5CNHA 3FTGB 2HVJB 3MJ9L 1OTTD 1RU9L 2IH3A 4JREB 3MMEA 4WI3A 1NBVL 2VMFA 5JXAL 4HS6A 5E8PA 1RZJC 5BNXD 3ULUL 1SNRA 4NKOA 1OOAA 2L0DA 1NC4B 3ET9F 1EO8L 5B4MC 2WCGA 3BDXA 3VTTA 1I9JL 1ORQA 1TSRA 1MJJA 3DBSA 3QWOB 4QRTA 3GMOB 2Z92A 3P4OB 4FQQB 3RGHA 2DQUL 1MKFA 3GGWA 4G6MH 4JPVL 4KMQA 4TLTA 4PJ7A 4CMMA 5FGRA 1XGQB 3IDMB 1OB1B 4JQIA 1PU0A 4GAAA 1KJMB 1VGKB 2ISDA 3MV8D 1ZE3C 3ZYIA 4P2OA 5A3IC 4LDLB 4NDMA 1MF2H 3KLSA 5CEZL 4R4BA 2X2HA 3WIFB 3BISA 2PW2A 4OGYH 4LHQB 2V2TB 1OP4A 1I7TA 1F8TL 1ZTXE 3GBEA 2DD8L 2A6IB 4HBCL 5GSVA 5TPWL 5H4ZA 5B3NA 3IVKA 4AIZB 4XP4H 3HUJB 5CJ5A 2Y2TA 1DCLA 2HG5B 4B3VA 4AK1A 4JM2F 3TJEH 1JZ7A 1HEZA 1YEDB 4WI5A 5T3ZE 4YHPB 1KBGL 4LIQL 4Y89A 4Z0XA 3C6SA 2XKNB 3QNXB 5KYWB 3V7MA 1ZK5A 4FNUA 1IV8A 1TQCC 3ULUH 1OHZA 2ITFA 5D7IA 1JFQH 1OAKH 1HKFA 2QGDA 1TETL 2XACC 3L4XA 4LRIC 1RY7B 4HAKA 4OFDA 4BFKA 1ILUA 2GVYA 3MLSL 1AO7E 4LSRH 3PHQB 1C7SA 4Y4FA 4ZFZA 2H32A 4F20A 5JIHA 3ROOA 1T5WA 4ZUUB 1M57B 2WXIA 1HAUA 3ZKXB 3K5SA 3CDYA 5IFHL 2HB0A 2YXFA 2DQFB 3PWPD 1JOIA 4XNQB 3ZHKA 2QV2A 3B7YA 1I31A 3LKOA 4MD5B 5FC9A 4JFZL 3VXNA 5I8OH 4N2EA 2HSIA 5ADPL 2XBTA 5MEQB 1FAKT 3ZPDA 1LD9B 3FTSA 3H54A 1XSKA 4P3DB 3FFCD 4YXKL 4FNQA 2NXYD 1XF3B 1L9QA 3LXBA 1W0WA 1TVBA 4CSTA 3ZTNH 4MJ6A 4CVZA 3FU8A 3RDTB 1NDMB 3TP4A 5HVHB 3ARXA 1XXFC 4FJZA 4HGKC 2GAZB 3CVDA 2ZWSA 1M2OA 4XN9A 4JFVA 4ODHH 2RALA 3H0TB 4PJ8C 1BZ7A 2X89A 4K3EL 1KELL 2J43A 2FSEA 3QZBA 4M6NH 3MZGB 3MR9A 3WD5H 5JHLA 1HHGA 1WFIA 1E3FA 1ED3A 2IIJA 3DPBA 3GLEA 2TAAA 1QSVA 4EN2A 3I84A 2WXPA 1AYOA 3M7FB 2VGLM 3U6RB 4TVPE 1WBYB 4MMXB 3RWHA 2V8LA 2P24B 3MV9D 1EGJA 4A39A 3EOBA 3PPEA 1N0LB 5GRUH 5B39B 5BVJA 1II4E 4KNSA 1FPTL 1HESA 3ARGA 4RZCA 1KXQE 2YPVA 1AMXA 3CVHH 1U58B 4FTVB 3U0PA 4L8DA 3S6CA 3NDZE 2EINB 2FNWA 2VLJB 3ZDZB 1JPTL 2LOEA 2BIQA 3VI4B 1BLNA 2EQDA 1TJGL 4JX0A 2PTVA 5F21B 2VDRH 1SEBB 5DTFA 5KS9A 1Z3GH 4ZFFA 3V4PL 5AAMC 3NBNA 1NWOA 3ILPA 1XB3A 4G9FA 2P8MA 2QPFA 4CJ0A 5F7HA 1ET8A 5EC2A 2AQQA 3QFJB 4GSQA 4QXTA 1JPGA 5EBGA 5DUMH 4WFGE 1EXHA 2YGVA 1H0DB 4JANA 4Z3HA 3A4AA 4HWNA 2VSKB 2WB7A 4GEIA 4PGBA 4NNXB 3RDTD 3OF6D 2E6PA 1UD4A 3EJSA 5DFVD 2E75C 4HU8A 2Z1PA 5IB4A 2FEDD 3AS3A 4EIUA 2R2EB 3UP1A 3HA0A 4HS3B 1ETB1 4NHCL 4LCVA 5I9QC 4QTHA 4WUUD 5DHVH 4V1DD 1MLBB 2H8PB 2VL4A 4BKSC 4G80A 5EUKA 2OTUA 1G84A 2F58L 1MEXH 3MRMA 1WF5A 4ISVA 5E00A 2ZIDA 4I9XA 5C07E 3VXRB 2OR8A 5F7YC 5J6GB 3ESNA 5E5UB 4ANVA 3T08A 3LIZL 2WANA 1NCBH 2A6DA 2BHZA 2NTFB 2CRYA 1QSEE 3KNBB 3PY9A 4FI7A 3FSZA 4PY8J 3NP4A 2MEJB 5A2JH 1L0QA 2UZXA 4JJ5A 1J48A 1DCEA 1QYGH 4ORGA 3NDYE 2E4TA 1ZWIB 3MGTB 4ZW6A 1XVSA 4HKZA 1PG7X 2ROYA 2B4CH 1DYZA 5F89B 1SXAA 2BP0B 3VH8A 4GQ9H 2VDLH 2FD6H 2O6PA 3LPOA 4R2GB 3V5HB 3O6KL 1EUTA 3VMNA 4BHUI 4YFDB 3BAXA 1KN4H 3GTNA 3LN4B 4ODHL 4MVBC 4AQ1B 2CUAA 1RLBA 25C8L 2VW6A 4PWFA 3QEHB 1DQQB 4DP6X 4PWJA 5I1GL 2YD4A 1JZ8A 4F7CB 5D2LA 1UEMA 3P4LA 4Z3FA 3LV3A 4I5BA 4L8SC 1BXXA 3WN6A 4MMYA 4R7NB 4U6XA 2XWZA 3KPSA 3SD5A 3HC0B 3ZE1F 2NXZC 5ELIA 4ZUVB 5KN5B 5JHDD 1AANA 1MCEA 3RX8A 1BZOA 1IGFH 3JT2A 1G7MA 4N8VB 4JQXC 4WWKD 4PGDB 3O4LB 4Q9QH 3B3IA 4HUUA 3QJVB 1EAOA 3OB0K 3RZCC 5BZWB 1MZZA 4FFYA 4OUUB 3ZX1A 2C3WA 3QZMA 4QRUB 5I6PA 3VGHA 1OAQH 3N55A 3VI4F 1A4JB 1KEMH 1N68A 3GSNA 3NEOA 2EH8L 1ZSDA 3VXRD 3UZVB 4NXKA 1S9WB 2YBRB 2BZCA 2UWEE 3HB3C 4IGBD 1RPQA 1AZCA 1ZGLM 4FKKA 1XGTA 3SKNB 4DEPC 3DX7B 1AQKH 1OGPA 1MQ8A 4HUXB 1P7KA 3SGJC 3BPCB 3ZUNC 4FP8L 4TSCH 5KYYA 5CXPA 3OGCA 3SGKC 3T6QC 4U6VL 1CL7H 5LCVH 4HS6B 1MH5B 1MWAB 4MMZC 1SF3A 3P2BA 4KDWA 4QRAA 4OF7A 1PLGL 1UXWB 1AE6H 4NKOB 3CX5K 2DWSA 3RWDA 4RAHA 4NC1E 1OP3K 1X44A 3PDOB 1RZ7H 2ODIA 3UCQA 1MFAH 3NJLA 3ZZ1A 3T0AA 4NM4H 1MJJB 4CRPA 1J11A 2CJSA 3GMOA 4TVPL 2Z92B 2VDQL 1LDSA 2R8SH 4PJ7B 4CMMB 4F9LA 3IDMA 2EIDA 1F3JB 2ZSWA 4A6YA 2FBJH 1AKJA 1OGAB 4XMLH 1VGKA 5D7HA 4XNXL 5JW4R 2CD0A 3ULUC 4I18B 1OW0C 2C9UA 1W72L 1YNKH 4L8BB 2A6KB 3TTSA 1G9ML 5DMIH 3T3PB 1DQLL 4Z3GA 3E3QE 2BINA 2J7LA 2VDPB 3FT9A 5DK0A 1I7TB 1LILA 2VRAA 3GTVA 1E4JA 4P9MH 1QATA 5GSVB 4PGJA 4OZIE 3UAAA 1MI5D 1L7IH 1D5XA 4WUUA 4OJAA 1CU4H 3K0WA 3OAZH 4PJFE 5I1HH 2AK4B 2HG5A 4WTZA 4UAOB 5BRZA 1IE5A 3Q13A 2JLLA 3GMNA 1BVNT 5K59E 3NA4A 5AW0B 1WFTA 1HEZB 1YEDA 2EC8A 2WZ0A 3ESOA 2ZWNA 4Z0XB 2NY7H 2NCMA 4CKVX 1VACA 1U8KB 3N43F 2XTLA 5KYWA 3OX8B 2BCKB 4UYPA 1NKOA 4CGUB 5D7IB 1BD2B 3VI3B 2COQA 3HAEA 3OJDB 4YFLI 5HDQL 1B9KA 3KWWB 2QSTA 3PHQA 3SE3C 1P7HL 3QDMA 4LDOB 1DBAH 4UDUA 1S3KL 2DTMH 4DVRH 1E90A 4DO5A 3RNKA 2XZAH 3CHSA 4QLWA 4X99B 1QFPA 2WXNA 2FJHB 2DQFA 1PTZA 1TZIB 1EJOL 1UD6A 2EYRA 3GJFK 4Z3JA 4OSUH 5F72S 1AGBB 4UOZA 4WKXA 1WAAF 3IFOA 3T77A 1U8JB 4JO4H 4DTGH 3KLDA 2Y1VA 1NEZA 4YDKL 1XF3A 3CLFL 4L5FL 1JPSH 3B2XA 1W0WB 4QRRD 1DBBH 3AABA 2IJ0C 4CVZB 3RDTA 1ZV2A 3FQ2A 4WK4B 1B0GB 2C8NA 4HT1L 1XBDA 1J8HB 4W68A 4C54A 2XWDA 4K23L 2GAZA 2EVFA 2ZTBA 1Y1DA 4YPGB 3C8KB 3ZE0E 5CBEB 1E40A 1OWRM 3TJHC 4K3DL 3SQBA 5C9KA 5CZRA 3PWVA 2FX7H 4R96A 3ATFA 2DOCA 2NXYC 3O6ML 4WY7L 4XVJL 2DBLH 5IKCB 3GYRA 2ZE0A 1J5CA 3GI9L 1GC1H 2HPTA 4CJ1A 1CFNB 4LEXH 3TEXA 1WBYA 4MMXA 3RWHB 3EH4B 4BUGA 5C0RL 1J0IA 4WO4D 5I0VA 1G5AA 2QGEA 4TVUA 1N0LA 4U0QB 1I1FB 5B39A 3BVXA 5BVJB 4HIEA 3ARPA 3MOBL 4JM0A 1EHAA 4H4NA 1U58A 4M6MH 4PRPD 1W72H 1YNKL 4TNWF 4HEPG 4LSTH 5B7EA 3V0IA 4XNXH 1DQDH 2WJ7A 3KPRE 3FFCB 4HK0A 3VTAA 2XQ0A 2VDOB 3LX9A 4ODUA 2APXA 1SEBA 5DTFB 4BCXA 5KS9B 3EZJB 2VDQH 4ZFFB 3W5MA 3HNVL 3ILPB 1TVDA 4G9FB 5ECGA 1KN2L 3V0VA 2P8MB 4HXBL 3NG5A 5CHNA 4UTBA 3QFJA 4MZ2A 4TS6A 4XNBA 4AI7A 1N5YH 4JY5L 1VZIA 3GT6A 4LVOC 5T1LA 3UBXB 4JN2B 5ECJE 3IT8D 1BEYH 4W9EC 5I0ZA 2Q7YB 1TPXC 2XOTA 2F53D 1KNOA 2K8QA 3C9NA 1VPOH 4NNXA 3GF8A 3ZQXA 3MLRL 1A4AA 1SBSH 2J4WH 3S37H 3JWDL 4WI0B 4AYGA 1A4CA 4WGWB 2DQMA 3MU3A 5I5RA 4XBPB 4AENB 4Z8FH 4F8PA 1G1OA 1MLBA 1OPGL 2ESVE 2H8PA 2X9XA 4PTTB 4J27A 4MLIA 4NCC2 1TNMA 5EUKB 3U0WL 5E00B 3ZU8A 2FSDA 1UFUA 3M07A 4H8VA 4HJ1A 3I6SA 4B9IA 1CFSB 4ZI8A 2BLFA 4KKPA 4RX4A 1E0OB 4NUGH 1MZYA 4MASA 4KMLB 4OM0H 1JXDA 5FYKU 2VXQA 4N3UA 5FWQA 5JIDA 1T7WA 3FK3A 3QULA 4FEIA 1I3GL 4N2MA 2ICWA 1HE7A 1NFDF 2CHXA 4OZFA 3FTYA 4HKZB 5DJ6A 5FF6A 4KV5E 1U2CA 2Z8RA 3ZHLA 3QXVA 2BIPA 4DP1X 1LEKA 3KZ8A 4KDTC 3SKOB 3TC9A 3PAVA 4F2ME 3H3KA 5AVSB 5ISZA 4DGIL 3MBWA 4RZKA 2QJDA 4TXVB 3BPNB 4LRIA 5C3TA 2ADFL 3KG5A 4YO0A 1S9YB 2ENQA 1FFNA 3LZRA 3PF2A 1J86A 4BH8B 5IHLB 4OZGA 1RMFH 1TJMA 2CJ3A 2K7QA 1PZDA 3BE1L 3I9IA 4FI6A 4HOMA 1F90L 2FB4H 4B9GA 2KQMA 5D2LB 5I6XC 2F15A 3FUKA 1BA9A 3LV3B 4AY0A 2ZUSA 3OZ9H 4PI2A 3VNZA 4MMYB 4R7NA 4U6XB 2VLJE 1NKGA 5GHWH 4M7KL 5AW9B 5EORL 4PGDA 1ZV5A 1ZHNA 2EIZB 4X6BA 4A2HA 2G3ZA 2I27N 4MVBD 2H3XC 1RJLB 5DWPA 5D70H 3PFQA 2EUZA 1CF1A 1RZGA 4IGBA 3ARGC 4J3WA 1G6RH 2MHAB 4OUUA 1IAOA 4HCRA 4KJQD 4M1DH 4PTUB 1TQUA 2ICWJ 1EMTL 4GXVH 3L1OL 2GEQA 2SODB 1AAJA 3D33A 1BFTA 2IG2L 2VOTA 1SQMA 1WQVT 1R19A 3JV4B 5L8JB 4DCQA 3KPRA 3WO4B 1P7KB 4QIRA 3FSAA 3RWCB 1RK1B 5H2BB 5AW1B 4FQJL 1FFRA 3FONA 3ZOAA 4J8RA 3OGCB 1VPOL 4N2OA 5G4NA 4CC1A 2C26A 1IC7H 4CA4A 3WJMB 1I3VA 3GS0A 1JMZA 1KENH 3QUXC 2NRDA 5AAWA 4HA1A 4YVNA 5DR5H 3KPTA 4C8XA 1VIWA 3ARBB 3R8BB 4HD5A 1E5ZA 2V0AA 3KMDA 4NENA 4ZFGH 3NN8A 4PJ9D 4HZAA 1K5NB 2OMWA 4PV8A 1M42A 3WNIA 5DSCA 3QEQE 1MRCH 1YEGH 2EIMB 3NPSC 3H85A 1DVSA 4WTQA 5K59F 5FDYA 2F5BL 4K9EC 4GMSL 2X4NB 3FL7A 4IOSA 2UXFA 3QS3A 1D5BA 1G7HA 4PRHD 2OV0A 3P54A 3TPUA 4KXZI 1TITA 4P9HL 3T2PA 1KJ2L 2F53A 1A4KA 2ERJB 4KMTL 1OK0A 1SVZA 2WXLA 1KGJA 3RX7A 1Q0EA 1VCBC 2V5MA 1NDGA 4RWYH 1UWXH 2JKJA 5BZDA 2HUEA 5EU3A 4JFFA 2QHLA 3RVTD 5C0RH 1XV8A 1CR9H 1P6AB 3JWOH 1K5WA 4L3CB 1NFAA 3F8UB 5BRZB 4YK4B 4KKLD 2WIIB 3ULUD 1H3WM 2W0KA 5KANG 1IMHC 4AYDC 1WCBA 1JZ5A 2QDWA 4FFWC 4U1LB 1VGEH 2BFGA 3QI9C 4Q0XL 3G6JB 4QXWA 3V5KB 5LNGA 4ATTA 1QABA 1VACB 1U8KA 4AT6A 3OX8A 4K3EH 1NLBL 3OKOA 3RJQB 4Z7VA 4D9RD 3HAEB 2JCCE 3OJDA 5EOQH 4P5TC 2R0KH 5K39B 4LGSB 1HVXA 3IF1A 3C6LA 3KBHE 1J88A 2QMKA 2YAHA 3H9SD 3O3DA 3QDMB 3VD7A 3O9WC 4OFPA 1LMKA 5EOTB 5ANME 2ZUTA 1F11B 2EICA 3N42B 4WWID 2I5YH 3RNKB 4HV8A 4NYLB 4X99A 4AL8C 5HXMA 2CIIB 3HB3B 2FJHA 1JHLL 2XA3A 5CD5C 5L7XH 2PWGA 1UD3A 4FXLA 4HX1A 3U1SL 3LXAA 4AV5A 1A02N 3ABKB 3E9TA 1U8JA 4I13B 4RESB 4MDIA 3PUUA 3WKMH 5IFHH 5JIMA 1Y18B 4TLKA 5TQ0H 3CN0A 1AQHA 3H6AA 4U3XA 1ETZA 5BO0D 1JN6A 1KEGH 1DJZA 3BP7B 4JFYB 1ZAGA 3I75B 4IKIA 2MMXA 4WTXA 5GS2D 3PJSA 3IXAA 4AYID 1CB4A 1IE4A 4FRWA 4NQDA 4QDGA 5DZVA 5C0GA 2D3VA 5IVXE 2Z6FA 5K33A 2RFXB 3HE6A 2VO5A 5IMLA 1HZKA 2NY1B 3ZT7A 3S35L 2IVFC 1CICB 2A1WL 2JI1A 3ZHFA 1USQA 1MWAL 3GSOB 2DWEA 3SYQA 5EU6E 2WTPA 4PR5A 3UJTH 4BD4A 4RMBA 2BY2A 3PP3H 4CNIA 4G6JH 1UH2A 3KPRD 4NRXA 2E8ZA 3FTWA 5FO7A 2Y9RT 4J4PA 3RNQB 2CR3A 2Y06L 1NAKL 1PNDA 3L9EA 3SYCA 4EMZA 4OCSL 4P9HC 5J1TC 2UX6A 1CE6B 3QFDA 3ASOB 4MKMA 3VRJB 1I1FA 2NX5B 4G8GB 1O0VA 2DRUA 2WUCH 2XQYA 3GK8L 5EZLA 5BW7C 2B5IC 1T5XA 4ZNEA 4F27A 4Y2OA 4H13C 1R3HA 1MAKA 3MLTA 3FFCA 4HK0B 1MPAL 5H4YA 3UPCA 4DSYA 1ROCA 5AW3B 4OFIA 2IV9A 4I7ZC 3DX9A 1BZDA 4OD2B 4JUTA 5EBLA 3D0VA 4POZC 3V0VB 2OR7A 5AVYB 1ZSHA 4AUJA 3EJZD 1EO8H 3D69A 1CE1L 2I60H 5TDNA 4JN2A 5HY9B 1T04A 3UYOD 4OFYA 3JYBA 2Q7YA 2JQAA 2O61B 4XC1L 5CUSL 1LDPL 4XXCA 4FP8H 4TSCL 1RU9H 3GBLA 4A7GA 3CLEL 2Z4QB 1ID5I 4UTAH 4JFFE 4OLUL 3UAJA 3GFUA 1PG7L 4KDVA 3W39B 1ZV9A 4LLQB 2Q8BH 3NJJA 3WAKA 4XNZB 2XQBL 4PTTA 1CDGA 1CF8H 3LCYA 4LASH 1SEQL 5H37H 4NJ9L 3GSNH 3UACA 3H3PH 1PYWB 3A4DA 3PFUA 1D6VL 3IJHA 4PS3A 1CFSA 3WKPA 1FWXA 4I0CC 2VISB 3HIZA 2X9WA 3S88L 2VB5A 5DD6A 5FOBB 4KTEL 3RL1A 4M3KB 2IDCA 4N0RA 3QISA 4P2YA 4L1HA 4OZFB 1JTOA 2NX5D 3IDYC 2IADB 3AM8A 4K94C 3CPLB 1MIEL 1FI8C 3O6FC 4F3FA 4LLYB 5KSAB 4HUMB 2Y7QB 3GKZA 1AG0A 2X41A 3EDFA 4GRWH 5I1GH 1UB6A 3HEIB 3T0EB 4WAFA 1BEXA 2WKOF 2HFEB 1J8RA 1S9YA 1D5IL 3ULVE 1OHQA 4K7FB 5KVGL 5LVEA 5K9JL 3AS0A 3WIAA 2GUYA 1BIHA 1XCTA 5LG1A 4GUOA 4GI8A 4HHAA 3UBXI 3B6SB 3D87B 1M05A 1AGFB 1BG9A 3V0JA 2B4CL 1ZPUA 4C56E 4MNHB 4LCUA 3EHBC 4FMKA 1ZT4B 1HU8A 2YMXH 1D7CA 5ID0A 4KKRA 5CEYB 4BGLA 2EIZA 1B0WA 4UMSA 3LHPL 3MV01 4FG6C 4W9LC 2J8UA 4BYHA 5ESVB 1KZYA 3QDGA 1PLCA 1RZGB 3F62A 3NRFA 1T22A 2MHAA 4QRBA 2P8LB 3P9LB 1IAOB 4LVOB 4P2OC 1QUNB 3NABL 5LDSA 1LO5A 4HIJB 3WI9A 1E6OL 4NM8L 5T1DH 4FA7B 4XP6H 5KS9E 3G04B 5D2LF 2JTDA 1H6UA 1RJCA 2EDRA 4XI5D 3H55A 4DCQB 2GSGA 4Y5XC 3ZDXF 5JPMA 3UMTA 4Y2NA 3SKJL 3RWCA 1RK1A 3VFPA 4Q9CA 3T09A 4WHCA 5I1DA 3ARGD 3BD3A 2J1WA 4F7MA 1A6UH 1KGXA 3LQAC 3Q8EA 5J1SC 2JJUA 1O5PA 3RVVD 1BBJA 3HTLX 4QT5B 1MRFH 4XN5A 5DJ2B 3ULVC 3ARBA 1XGUB 3SDDB 3IDJA 4NENB 3B9VA 2H0PA 1LTXA 4WVRA 2OMWB 3CU1A 4YQXH 2N1KA 5LAXB 1HQRB 1EHNA 4H8HA 3MV7D 3RIFF 2VR9A 5DSCB 2V17H 3WJJA 2NY5L 3BO8B 3GSVA 3A6BL 4PVBA 4EXKA 1JWUB 2BXZA 4MB5A 4AQ1C 1XTMA 1ZJBA 1DBJL 3HG3A 3QWNA 3RGVC 4JRYB 5C1MB 1ES0B 5D7IF 1A4KB 5BZXA 1OSPH 2FR4B 4NIYE 4WV1A 3UAFA 1AR1B 2X12A 5GGRA 4O02L 1U6AH 5GRUL 5BZDB 2XWXA 1BM7A 2V4LA 3MUJA 5EU3B 3PCYA 3VM7A 4GRLB 2YUVA 4AGMA 1NBYB 2HH0L 5I73B 2ZWLT 4L1DA 4E68A 4L3CA 1MQKH 4DP8X 1UA6H 3OWEA 2G2NA 1ZE3H 3ZE2B 4Z7NB 4KNUA 3O3AB 1HC1A 4TUKL 3TNMA 4Z7NE 1T4WA 3G7TA 1UJ3B 4KI5C 4GEJA 1Q9OB 2A9DA 2Q3AA 3IRCA 5C09D 4AT6B 3ESVF 1KELH 1OTSD 3MUGA 1A8ZA 1ZA6B 3LYRA 4FABL 4C47A 1WLHA 4ODSL 3MJ6A 2YMOA 4JPWL 4UCFA 4YBLB 2YN5A 1I1YB 4HC1A 2IGFL 3LEVL 1WAAA 3BHBB 1CYXA 1NGXB 3TFKD 2V37A 4H7VA 1CGXA 2OL3B 4LOEA 5CP3A 3HBQA 2Q2EB 1RVFH 2P47B 2PR4L 2X7LA 4Y4HC 1TTUA 4BZ2A 5IVOA 1XL4A 1YC7A 3UBHA 3LMJH 4WFEE 3KCWA 5H37G 4TQEH 1QRNA 2YA1A 4Y1AA 3RL2A 4HV8B 2FATL 1T89C 3MJGX 3TIDA 3FU7B 2WK2A 4XNDA 3VDAA 1ZVNA 5DS1A 4Y7OC 3BQVA 4JO3H 3TNNA 5T8IA 2PCPB 3GSXB 2UZIL 3INUL 5ADPH 4B60A 5MERA 1UCBH 4HX1B 3E6HA 3GJFA 4UQ9A 5F7KC 4PLJC 5AYTA 1UATA 4PJ8D 4MDIB 3ZVVA 4WEMB 4NJ9H 4YDJA 4NQDD 2DIBA 4FQ1H 5FAAA 4KDTA 1JN6B 4UM8B 2GI7A 1BVOA 5EU6B 2AEIT 4OZIB 2V3DA 1EQWA 3LPPA 1J9TA 1WIOA 2FJGB 3JWOC 3IXAB 3PJSB 4KXBA 1D2OA 5FX3A 3D85D 1RD6A 4CN4A 1QHPA 4HUVA 3U30B 1MHEB 2CDGA 1AO7D 4KGJA 6CGTA 5IMLB 2RFXA 4U1IB 4WENB 4IEFB 3QJSB 1CICA 5D71H 3UYRL 4J4PD 2B0SH 2H9GB 4JKMA 4M6OL 1OZTG 4O51A 4PR5B 1MFMA 3BWUF 1YY9C 1FLTX 2FEJA 2QADB 1JXGA 4JRXB 4AIOA 1BPLB 4IDJH 4APQC 5IT2L 2WXOA 4CNIB 4XC3L 1LO3L 3X13A 3VXUA 4LMQI 3RKPA 1RERA 4NRXB 2R0LL 3EOAB 3RNQA 5E2UL 4GIAA 2VE6A 4MNGE 5TPWH 1W16A 3EO1A 4ANUA 5E2VH 5EZLB 4ADJA 1U4FA 4QOKB 4BRVA 4JCWA 4F37K 2QSCH 5ICYA 1R3HB 4ZUWA 1W72B 2B1OA 3OBAA 3QQ3B 1UB5A 4R6UA 3T8XA 3HI6H 2X3BA 4G7VL 4RMQA 3KJ6H 3I6KB 1FP5A 4WJ5B 3CPUA 5DEZA 4WHYG 5E9DA 1XFPA 2VTFA 3ESPA 4K94L 3WTXA 1LNUB 4F2MA 4NKQB 2BNUA 1HYSC 1K3ZA 1KLGB 4HCGA 4DW2H 1RSYA 2ZG3A 3A3YB 2LABA 4LARL 1WFOA 4PJ8B 3D69B 4Y4HA 4Z7AA 1P7QA 5TDNB 1NJ9A 3NJVA 2IOOA 3EDEA 5JPNA 4JKNA 2P8PA 2VLME 3TA3B 4JCLA 5IFAH 2FJFA 4Y19A 1NBVH 2VH5L 3D06A 3MLYH 4NQUA 4WTWA 2UY6B 2HWZL 2Z4QA 3GBDA 5KSBA 3STZB 2AC0A 4MMXC 4PJHB 5CN3A 3W39A 4OZ4B 3AXLB 3TYFB 3HKZA 5I17A 1AQDB 2R69A 4O02A 3QUMA 2FLMA 4LP4A 2V9RA 3QQDA 4NSKB 4FFZL 1G7JB 1HL4A 4TKWA 1DL7H 3WS3B 3OKKA 4NQXB 2HKFL 3NA9L 1XR9B 3BIKB 4I88A 4UB0L 1SOXA 3IJHB 4N8PA 4Q6KA 1A9BA 3EGSB 4HEME 4ZMOA 1L5GA 5DD6B 5FOBA 5JR1H 4MA7H 4L1BA 4U6YB 3B9KC 3T9WA 3AAZB 1QBLH 1Z5HA 1IBBA 2I5YL 4PRPA 1RZKH 4QOKD 1MIMH 4LGRB 4PJAA 5IR1B 4F3FB 5KSAA 4LLYA 2B08A 1OP3H 3EFDL 1VRSA 5ENWB 2AVFA 4YXHL 1UB6B 4LPYA 2CKBA 3T0EA 4J3OG 1PKQB 3PWNB 5CU5A 3MBEB 4DUXA 4OCRL 3IFNH 4V33A 1DDTA 5DHVB 1E9QB 1HXYA 4CGTA 1VGEL 3LZFH 4X9GA 3PWLB 5AZUA 2CBPA 1T20B 2WXQA 1M05B 3JXAA 3RIAK 3FN9A 5C2BL 2BSCA 2QQLL 5DQDH 4HW6A 4LCUB 3SPHA 5KYXA 3RP1A 4NAMA 2NUPB 2I24N 4PJEE 4ZMQA 3WGVB 4HAGA 2C5DC 1Q0YL 5DRZA 5ID0B 5CEYA 3LKNA 1EGJL 5PCYA 1X5GA 3FB6A 5AZ2H 5I2IA 4P57B 2J8UB 2W9DH 5I30H 3BUYA 4KMTH 4V1DB 1UC6A 5ESVA 3V0WH 4DT2A 1BQUA 4JL2A 3C75A 4XNYH 4D3CH 1T22B 3L3IA 5HDRA 1U8LA 1XEDA 3STLA 1EEUA 4JHBA 2P8LA 1OAZL 4G8EA 5A2LH 4AIEA 4RWHA 1IAIL 4N9OB 2P7TB 1HZHL 1KIPB 1NPUA 2C9VA 1LO5B 2HTLD 1MY5A 2ENYA 3DSNA 3CZFA 4HIJA 3ZMRA 4N0YL 5DZLA 9CGTA 1QMUA 1TTRA 1OF0A 1IVTA 3Q2NA 4JDVB 3BMWA 3DBXA 4KPHL 2BVYA 1NSNH 3DUHA 4L4VB 1P5VB 4NI6A 8FABA 3EOTL 3ZKQD 3KYKL 5BOZG 3NP3A 3MRFA 4JO2H 3LN9A 3DYMA 2NDFA 3GHEH 5FFLA 1PCXA 3RWIA 2IH1B 3VFTB 1DEEB 1G4RA 4M3JA 4P2OD 2BVOA 2HT2D 2A4EA 32C2B 4GRMB 1P4IL 2LTQC 1BBJB 4DK6A 4QT5A 4KFMA 5J13C 5EEVA 3P30L 3IU3A 3K71A 4XHQA 2NW3B 3FUFA 5LGJA 3WCYA 1A3RH 4XT1C 1F4XL 4NO5B 2Z8WC 4ODXB 5G55A 4XZUA 3FQTA 5FW7A 1AR2A 2Z0UA 3L3OC 1D7BA 2WLLA 1RZIA 2V6HA 4IKLA 5B7MA 2VR4A 3BO8A 3HFFA 5HP5A 3QCTL 1JWUA 2FZ3B 3GMMB 1R17A 2D03H 5BCAA 4WK2B 5IHUH 4JZJC 1UT1A 3BSZH 3VSUA 2ZUVA 4JEGB 3MRNB 5JA8B 3MGOB 1G6RL 5HHQA 4JRYA 4HIQA 5IOKA 2FR4A 1ODUA 4WV1B 4BA8A 1MFCH 2AQRA 4ZMXA 3CC1A 4NO2A 1RULH 2H26B 4WWKB 5D5ME 5GGRB 3VD9A 5LN4A 4ZDHB 1LE5A 3VG0L 5J9PB 4GRLA 4Z7UE 5BMFL 3TT1L 5LWYH 3AC0A 2VMCA 5L8KB 4F7EA 2MOGA 5L2JA 1TTGA 1LQSR 1AS6A 2IFGA 4R8WH 2QV4A 2HJFA 2ZJSL 1D5RA 2NCEA 2ZZUT 4K5LA 3B7SA 1QQDB 2DN7A 3PPSA 4PBXA 1Q9OA 3FUDA 3ECBB 3MUGB 4WHTB 4I4WB 2ATPA 2YJQA 4I0PB 5FB8A 4ZFQA 3VA6A 2OSYA 1DLHB 2CG9X 2O5XL 4EIGB 4FFZA 2ZUUA 3CFBB 1NGXA 3BI9X 4F2FA 1E28B 3WEMA 3E9UA 4HJIA 1KIQA 2X7LB 5C08E 1NSNL 3KM2A 4WSJA 3UJJH 1JWMB 2A9NL 2YRBA 2QVIA 1BAFH 5K9OB 4Y1AB 3RL2B 2RD0A 1OTSC 3QXWA 1OKEA 2IPUG 3FU7A 3TIDB 1MFNA 2X9YA 3K6SA 4LSUH 2R0ZL 1UKQA 1OAZH 2J6EL 3HZYA 4YHZH 5ICXB 5F1NB 3LD8B 5F3FA 4NUGL 4P5MB 4X83A 4NQSB 3ZDWA 5DQJB 5DXWA 4LDEB 3TFKC 2W9DL 3BXNB 1NANI 1AR1D 2HFGH 4MHHG 2X87A 5IHUL 1BJ8A 5DLML 2VERN 4NQCA 4POYA 1K8DB 2J8HA 1JD7A 3CH1A 3AQDA 3DX0A 4MX7B 3U9UB 5DLLA 4YSPA 2YA0A 1OK8A 3QQNA 4U3HA 4A37A 3GSRA 3S37L 1MHEA 5GSRA 4M48H 5B1BB 4L0PB 4MS6A 1XXDC 4PLJD 4J8QA 1OM3L 2ZNWA 1CDYA 4KNTA 2J8OA 4PSRA 1IRAY 2KZ1B 2V9TA 2YO3A 3B43A 3CXDL 2BP5M 3DTDA 4HCFA 4TLSA 1BFVL 2ZSVB 3EOTH 3F83A 4KFZC 2ZX6A 3VXUB 3PL6B 1TF4A 4H2AA 2GY7B 4I0PD 4V11A 4URKA 3EOAA 2OCCB 2N7SA 3W5NA 2YC1B 3ARZA 3L17A 5FYLE 4ENZA 4J6IA 3EO1B 4L0ZA 3CE1A 1Q9LB 3G5WA 2NSMA 2E9IA 4JHUA 4PB0L 1AQMA 1UZ8A 4JDTL 4XO8A 3ZQWA 3ZSSA 5DMYA 4NQED 1R0AL 4KQ4L 1FYTE 4ZW7A 2ZWYA 3OTTA 4OQTH 4WJ5A 3ZYOA 3Q9PA 3DGDA 2I9TB 2BFVH 4DQOH 3PQYE 4X6CB 2WQUA 4AMXA 1LNUA 2DL9A 3CX5J 2BS71 4PBWD 5C2BH 3VXQB 3GI9H 4DGYL 5D6DA 4JZNA 1KTJA 3H53A 5ALBH 5C0BE 2PP8A 2GKIA 2YK1H 3MYJB 4Y4HB 5EWIL 2VH5H 3SB3A 5HDBF 5BUAA 1NZRA 1AC0A 2DJUA 4OQ1A 5AB0A 1KPRB 3EG9B 3TA3A 4F33A 5C0AE 1JCVA 2B9AA 4PRDA 3X12A 3BKJH 5KBKA 5F7BA 5CKGA 4X5XB 2PW1A 1I9RH 4HWEL 4ZSOE 4HSAC 2X4RB 3VWKA 3DV6B 5J12C 4TTDD 3IDNB 1DHKA 2BNQB 4PJHA 3E3QC 5DGQA 2FNBA 3CDZB 3NSJA 3MCLH 3TBCA 1RZKL 3A4EA 4X80H 1AQDA 3DIVA 5SV4A 3MPCA 3QUMB 4O02B 1T83C 4UILL 3QQDB 4P2QE 4IRJA 3TV3H 4QOKE 4IRZL 3GZQA 3WS3A 3OKKB 3WDIA 2CBQA 4U7KA 4HH9B 3QUKA 4DOHB 5F7FA 4MA3B 3U82B 1PJ9A 2QSCL 4BQBA 5E1AB 4HJJL 4LL4A 3ZY7A 4AEIL 4K2UH 1EJOH 4WJKB 5KSUA 1GW6A 4QO1B 1XDTT 2EEXA 1DL7L 5FKPB 5IM7A 4GFTB 4OLWL 1I3RA 3LNIA 4OY9A 1UVQA 3QHTC 1D9KC 1F56A 4PRPB 5FIEA 5JDSB 4GO6B 5IR1A 4YLQT 2CSPA 3WN5B 4KUZH 1X9UA 4PJIF 5CGYC 1CLVA 5J7CC 4G9FE 1XIWB 3IDXL 5E94B 2CK0H 4LVNB 2CKBB 4BQCA 1MCPH 3TLRA 4FLQA 2B0SL 5F7AA 4BZ2L 4FQHA 5I0YA 2WTOA 3N06B 2ZUYA 2K45A 3S36X 4ZSOA 5DHVA 2EH7H 1FNGA 3VX0A 1CVSC 1DVZA 1BQHB 1HXYB 5IBUG 1EFXB 2GJPA 4YX2L 5A16A 2OYPA 3EYVB 1JP5A 3V6OC 4KJQC 4QR7A 3QDJA 3DMMD 3IAPA 4M9OA 1YY8A 4PJIB 4PJAF 4HLJA 3PHSA 5KYXB 1U8OA 2G3NA 2AQPA 3AWEA 3U2SA 1R3LB 1NL0H 2WN3A 2XG4B 4L2LA 3HG0A 1TJHH 2OW6A 5DVNA 4P57A 5I2IB 4PGZA 1RZFL 2BNQD 3BUYB 4V1DA 3UC0L 5IESL 3ECWA 3INUH 4HJUA 1U8LB 2JKSA 4WFED 4G8EB 3CZFB 1HINH 1TZGH 4OLYL 4LP8A 3UABA 1JTPA 3X14A 5EO0A 4XC3H 4NN6C 3CVHA 1P5VA 4PJ9C 8FABB 1VB9A 2VDNL 2AMGA 2RB8A 1YEIH 2XRAL 4UQ3A 4FQXA 4AQEB 4ZMVA 2CBTA 4X4MA 2K1MA 4ODSH 4IOFC 2BVOB 5DT1L 3J8F7 3HNSH 3WEBA 3WTTA 1ICTA 3CVIL 2WP3T 1CK0H 5D7LD 2W07B 5LCVL 3NACL 1YHPA 1A6TA 4QHNA 4U6VH 4R3SA 3TZVB 3K71B 1MFDL 3X3GH 4UZSA 5DA4A 1N9PA 5IQNA 3UG5A 3WNOA 3FW6A 1J10A 1OT1A 4X7CC 4MRBA 3MNVB 4NO5A 2J44A 1E4HA 1ZLWH 1GY1A 3FQTB 1NUGA 4IS6A 1IJNA 5BJTA 2DS4A 2WLLB 2FYYA 4ZPVB 3CX2A 2Q10A 1NIBA 1A9VA 2FZ3A 3GMMA 1QLFB 1QLEH 2N56A 2OMTA 4PGEA 3MGOA 5HHQB 3CBKB 1DVUA 3MA7A 1JPST 3CTTA 4KXCA 3QRGL 4KXDA 1E8ZA 5HGHA 1CFTB 3PWJA 1Q72L 1AYRA 1E7VA 1WWWX 2GJRA 2X3AA 4ODWB 1LE5B 5J9PA 2ZWKA 3S5LA 5SWSD 3QIUA 3IJ9A 2EDLA 1HHKA 4ZX3A 4BH7B 3M88A 2DH2A 2IBZY 1SM3L 2PTTA 1R5VA 2Q7NA 3KEDA 1WP6A 1NUDA 1ASPA 2NNAB 5DZJA 2AK4E 2HJFB 3FUMA 4J3BA 1JRHL 3CFJB 4NT6A 1X9RA 2E9GA 2Y5TA 5AL8A 4BFFA 4K7PY 1BOYA 5EF0A 4I4WA 2ATPB 3DIDA 3L3DB 3QUML 4ELMA 2R2CA 4LSQH 1DLHA 4WNQA 5D2NB 4JFDE 2YKKA 3UZEA 3HHSA 4YIQA 2FWSA 4KROB 5LGHH 1E28A 2JE8A 1ASQA 2GIYA 5DJAA 1AXIB 1CTNA 3D4CA 5HHPA 3NPSB 3BSGA 1PZ3A 3ARDC 1JWMA 1JVOA 1JNNL 4J5VA 1FZMA 2UVFA 4UT6L 3WNJA 3TZVD 3LZPA 1GGBL 3UTTA 3F7VB 3QG7H 4M8UA 3AG4B 3HZYB 1OO2A 5F1NA 2DWYA 2DLGA 4NQSA 3SBRA 2VL5A 3ORJA 3BXNA 1RFDH 3Q2VA 5BW7A 4MMZB 4BJLA 1MJ8L 2C1PA 3EF4A 3HPJB 5I82A 4EI5C 1UTDA 4NQCB 2YGQA 4HMEA 3M1CA 1RQ5A 4GMTH 5CN1A 1K8DA 5FGCE 3MREA 1A7PL 1RJZB 4X4KA 5ALCH 1QO3A 4L48A 1PFCA 3SE9L 1N4XH 3N2JA 3W3BA 2VABA 4AGQA 1B2WL 2F74B 3WUWG 1CTOA 2YIHA 3NFNB 1TKWA 2ADGA 2M2DA 1EFQA 2WLNA 4H26B 3KWUA 3FYEB 1NH6A 3D0AA 1FGVL 5SWSB 3RTQA 4Y5VA 3WJLC 5I15H 2AEPH 3ZKNC 1J0ZA 1A6UL 1E3ZA 4GPVA 4C57C 5A3ID 4JMNA 1OGTA 2P3YA 1RUAH 2DLFH 1KCLA 4WFGD 3D4YA 2ZUQB 5D7KD 5EF2A 1H15A 5I1KL 4K71C 1KGCE 1NAMA 1L6XA 1UWYA 4GKNB 3BDYL 3NJIA 4PJBA 5FW8A 1LWRA 3CXFA 4MNQD 2G0KA 2NY4C 3VFNB 3DJRA 3DETD 1UZ8B 1D6VH 4JY6A 1KJ2A 1YO4A 4KK5D 1FPTH 3VJ6A 3WFHB 5CP7B 3RFZA 4WI2A 2DY2A 1G9MC 4AM0B 4NUPA 4MB4A 3MRLB 4XBGA 4ZXBA 4EN3B 4AE0A 4QRSA 4F8TA 5DJYB 3K6IA 2XQBH 5E0QA 4ZX5A 3IXTA 1ZEAL 4X5PA 1VADA 1HQ4A 6FABH 3KXFD 3ML8A 1EEQA 1Q4NX 3FRUB 3CLEH 5B38A 4FTDA 5J8OA 1FE8L 3MV7E 1AGDB 1MW2A 4HWZA 3EYUH 4M6NL 1AXTL 3NCJH 3NACH 5C71A 1A1OA 3V95A 4RSYA 5C0EB 5KVGH 3DSFL 5DRWA 1KPRA 4UDTB 4F33B 3X12B 4PRDB 4KITB 5CJ8A 4RRPM 4ZBJA 1C8PA 4FHKA 2PW1B 2P9RA 2F9BT 4JFDB 1N64L 5IMMA 2WVVA 1YEIL 1C5DB 2VDNH 3WFZA 1NMAH 3B83A 4G8AC 3W2DL 4WNJA 2ZF8A 5DJ8B 5FYJD 1LO4H 4YSQA 4E2OA 1TZGL 5HGGS 2YKLL 4N68A 1TU2A 1P84J 3MRPA 3HLAA 2YRZA 5JHLL 5AW2B 2G4EA 2ZPKL 5B1JC 1Z9SB 3UC0H 5E1AA 3V8CA 1TZHB 1DJGA 2DLIA 3E7JA 3KYAA 5J11B 5KSUB 4QO1A 1RUMH 3EKCA 5IM7B 1T66C 2G5RA 1S7RA 4PJDF 1COBA 1BVKB 2VO8A 3CCHA 4OCSH 2XNAA 3L45A 1UVQB 2H41A 4YE4L 4KQ3L 2HLFD 4KY1L 2EYSA 3QDHA 2AJUH 2VDLB 4L3FA 4M8RA 4AKQA 1B0IA 4YGVA 3S4SA 3CFEB 2E56A 5E94A 4YX2H 3EHBD 3DVGA 1LDPH 3VWJD 2VDKB 3EO0A 1L9TA 2DYRB 2YSTA 1UQSB 5F6HI 3HE6C 4OI9A 1FNGB 3SPJA 4G7QB 1BQHA 1MCPL 4WEBH 1XZ0B 5ID1A 5HHMD 3N9GH 4KZEL 5LUMA 4Z76A 2YD5A 1QFWM 4NPYA 4XHJC 3T4AC 3IMTA 1W8EA 5MENA 5GGTH 3BSZA 4N90E 4Q8BA 5EIIB 1UG9A 3VB8A 1OAUH 3MUUA 2A9MH 1H5BC 4XCFL 4Z18A 4WKZB 4AVIA 5BVPL 1V7NH 4OGYL 1IAMA 5FUOH 1UWXK 4HMDA 5D1QA 4OCXH 1O6TA 2X44D 1MF2L 3AREC 3I3BA 2WUCL 3WS6A 1BAGA 1G0DA 1J0HA 3HC4L 4FOMA 5JNYB 1MUJB 1E5CA 4XP9L 7FABH 1WHPA 5BZZA 3DDFA 4G6ML 4JPVH 3RDTC 3ULVD 4O58H 2K7PA 4PJ9A 1CI5A 4EI6A 2JCCB 3PAUA 1BGXH 5EO0B 3X14B 3PYCA 3IETB 4TPRH 1AHWB 5DU7A 3JV0A 4W9CC 3WIHA 2YQGA 4FQXB 4FJYA 1SYVA 4P3CH 4AQEA 1W0YT 3PHOB 4HGWA 4FGMA 3UTSA 4DP0X 5HYJB 5I6OA 2DDQH 4QHLB 5EZOL 4DHLA 5C97A 4KX8A 4F1ZA 1AY1L 4QAWA 4LBEA 4PPTA 2H6PA 1A6TB 4QHNB 3TZVA 3IYLW 5CGTA 2J5LC 1FV1B 4G8IB 3V4UH 2F8OA 3N41B 1HL8A 3LKRB 3ILQC 4HFUL 2FYYB 4ZPVA 5H37A 3D51A 3FRPA 1QLFA 1D3CA 5DZOA 2YR3A 4ZUTB 3NIDB 4PM1A 4M4RB 2OMTB 1G7IA 2H2PC 2ODHA 3NCWA 3IJEB 1RJYB 4KI5D 4QKTA 1TQVA 1FVCA 2YN3A 5C9JA 3BPNC 5HGHB 3KEHA 5E7FA 1CFTA 3PWJB 4XZ4A 4OM1L 5DJZB 5SV3A 1A5FL 2FL5A 4I2XB 3S5LB 3B34A 3A47A 2MNJB 2D4FA 3W82A 3VGAB 3AGWA 5LDUA 3E8VA 4BH7A 3KPMA 2PTTB 1XB8A 2VDML 2QQNH 2ZOOA 5HPOA 2R29L 2XN9B 5FHAL 2NNAA 3EYSL 2ZOTA 5A2AA 1BMWA 1WK0A 3SPGA 4QAMB 1VEMA 3CN2A 2O72A 3HUJE 1A6AA 1N10A 5DYOB 3MOAH 1N3NB 1NCAH 1OM3H 4UM9A 1S7VA 4N0UB 3MRQB 5D2NA 1IC7L 3VRIA 2HJLB 4DPBX 3QUYD 1KYOK 3SPCA 3ZHNA 2UWEA 2VR7A 3GNML 4RAUB 1JS4A 3HG1E 3L3OA 3O6FD 2VXTH 5HHPB 5DJAB 1A7OL 2J88H 1DJXA 4GKLA 1G7QB 4WW2C 2PABA 4XMKH 1CR9L 4IIQA 4ACPA 3C8DA 4YLCA 4WUKL 1WTGT 3KDMA 4L4TE 3TT3L 4E41D 1BLIA 4OZHB 1S7XA 5BUPA 1NMBH 4M1DL 4JGJA 4KV5F 1PD0A 4UINL 1BZQK 3QWRD 2FX9H 3BRDA 2EIEA 1MVFA 2V3EA 2NZ9D 4XMPL 2VLRE 4YHZL 1SLXA 1ZLDA 3HLKA 3V9FA 2IBBA 5A2BA 2F5BH 3M1BB 3T0WA 2D7NA 4J4PC 4J3TA 4CKQA 1QO3B 3IGAB 2WPGA 5C0FA 3GTTA 1BWWA 1YY9D 2JCCF 5GHWL 1LP9E 4MD0A 4JM4H 1T0NA 1OCRB 4BWWA 3KPQA 4FG6D 4UNVA 1CLZH 1TKWB 1L9SA 1SJEB 1E9PB 4PG2C 4WSGA 4V1DE 5DURB 1JWSB 2GC4C 2MQGA 4UQIM 4S1RL 2OYMA 1I9EA 3KH4A 2AQ3A 1VCAA 2Y72A 3R1GH 2Q3XA 3JTTA 1SBBA 5AOIA 4ZTPH 3RX9A 1XH0A 2E46A 4GFXA 4KROD 1RAMA 1JZGA 1DVFD 3ZKXC 1EA9C 3VXME 2XTJE 2J57A 2NXZB 3C60A 2EDQA 4YZWA 1J5OL 4A2MA 1CURA 1P2CB 5JORA 2RACA 2Y3NA 2WW8A 2QMJA 3GPEA 4L3EE 4P2AA 4PJBB 4RFOL 3VG0H 2GT9A 2R2BA 4HD9A 4LLVB 2IOMA 2DQIL 3RHWF 3RVVC 2IPTH 2A77L 3AUWB 3MACL 1IC4L 4LEEA 4H1LA 3SDCB 3ECQA 3ZTJH 3ZYJA 1AG6A 5D9SB 3BN3B 2VDNB 5G2NA 3KPSD 4GP4B 2NR6A 2J71A 1Y0LA 2QBWA 3WHE1 1B6UA 4PIRF 4XVSH 3DKHA 4AM0A 4XO3A 2CA3A 2XICA 5EORH 2QR0B 2BMKA 4UQCA 4QRSB 4ZO7A 1T1YA 4JL1A 1U93A 4DGVH 4GAGH 4HYTB 3MQIA 2WMPA 3QJZA 4M02A 4RFEB 1VADB 4KOBA 1S7SB 2Z8VC 3RGVD 3IAGC 2BSBA 4HWZB 3NJXA 4M5TA 2ZUWA 1T3FB 3ISWA 5IJDC 4HGMA 4CW1A 1N2RA 1UWFA 1BEYL 2YLKA 3E0GA 4OLEA 1MFVA 2VQTA 3HNTH 4JRWA 3K3QA 4P4KB 4PG9B 3LAFA 4JFDA 1NCNA 3FT2B 3OMAB 4X5WA 5AVQB 3D0LB 1PZCA 3TH3T 3A67L 3QPXH 3ZE0F 3WNNA 3A6CL 4PJHE 5DURD 4RSVA 2OTWB 3BSHA 4NOBA 3H9YA 2FAUA 5ABDE 3S8WA 2F8IA 5AALA 5JMOC 3Q3GB 2ICWI 3KWTA 1I9IL 5D1ZB 3R0NA 3BPOC 5IB1A 3W0WA 1IAII 1U0QA 1HZHH 1NC4D 3ES6A 3MRPB 4ILDA 4PJCB 4BWUA 3BCDA 3QG6A 2ZF9A 2K9UA 3VTMA 1H6FA 3GXFA 4GP8B 3U6XA 5DD3H 2BJMH 2G5BA 3O3BA 1FNHA 1SMAA 2EO9A 3QXAB 1DQJB 5EOCL 5TDOB 1CBJA 4AEEA 1HNGA 4P4RA 4IU3B 1BXVA 2X4OB 2IH9A 1YLBB 1N7ML 2XWJB 5T1KA 1W91A 3REVA 1LK2B 2XNAB 1OB0A 4JGMA 3CSTA 4PJ5D 3SDAB 2PUQT 3CV5A 1L4IA 4M5YH 3WMQA 2Z1KA 1YEHL 2EYSB 3TVMB 4D2NA 1C08B 3GXUB 3CDFA 4E36A 4FNLH 3OPZH 1XF4A 1FDLL 1YZZA 2JNZA 3IJSB 3FB5B 5KVGE 4Q2ZA 4XXDA 4QXGL 4QF1A 1IZJA 1CLYL 1UQSA 2BX5A 3NCXA 4K3DH 5EEYA 1ZVSB 4AC4A 2JELL 4IDLA 2G2PA 4YWGH 2IANA 5D1XE 4N1EA 2PCXA 1ZMYA 4K7PH 1XZ0A 4X7SH 1N5YL 4X9FA 2OMZA 1UA3A 3BQUB 3BT2L 2FT7A 4XCYA 4PQXA 3VFGH 5C92A 5I1CL 4W9JC 3HNVH 2PO6B 2AXHA 2HTLC 3QI9B 3O6LL 4KUCF 5JIPA 3V4VH 3B7TA 5GXBB 5C86A 5EIIA 4X8JB 2WXFA 3DRTA 3W56A 2YXVA 2R0WL 2Y7OA 4WU7B 5C0CE 2R1YA 1S4IA 5EOCJ 2J2ZB 1NMCB 4ELKB 1U3HD 5D1QB 5DQ9A 2VXSH 4M5SA 4D9QE 3MV9E 4D8PA 1U2YA 3FSOA 1TLMA 5HJDA 4MSWB 1NICA 4JFQB 4EI6B 1OT4A 1U8NB 4P8QA 1L3WA 4PW9A 4P2RB 4PBVC 1RIHL 4OGXH 1AHWA 3MRRA 2X4SB 1M7IA 2RJMA 5CLTA 3ARED 1VFBA 4WY7H 5E5RB 1X4XA 1XGYL 4YHYC 3PV7A 3QSKB 5IJBC 2AXJA 3FQWB 2NR6D 3G5YB 4LP5A 4OZFH 4PW4A 5H94B 4A7TA 5MI0C 3REWA 1OPOA 1SZNA 3MNWA 2DV6A 5C3IA 5HI5D 2YD6A 2BY1A 3K6OA 3WN5C 4JQVA 3QUXA 5FCSH 3H7BA 1QFUL 2A0LD 2RBLA 2W65B 4M00A 4G8IA 1KBKA 1VSCA 3K1KC 2YQ3A 1YVLA 4DZ8B 4GUQA 1FFTB 1GJWA 2YPVH 2Z93B 3MCKB 4AQ8C 5JPMC 5I1HL 4IRZA 1E67A 4PJBF 4DUWA 4JM2A 4PRBA 3BGFB 3FRPB 1I1AA 1J0KA 4KKBC 4Y88A 5CN2A 5F7LB 3L5XH 2HCZX 4ZUTA 3ABLB 3PDGA 3MX0A 4M4RA 4YN3A 2BS8A 6TAAA 4JFHD 5CLXA 3IJEA 3T0EC 1F4AA 4J3OC 5C9JB 3CSGA 1TTCA 5CINL 1JZ6A 2FBJL 1FVEB 5ESAA 1XH1A 1U8CB 2WLJA 4G2AA 5FWRA 2O93L 1TNNA 2R0LH 4ZZFA 3KPMB 3NTCH 3VACA 2AV7B 3DO4A 4A2GA 4L0YA 5IT2H 2XN9A 3VFSB 5AAWC 5KWYC 4AVKA 1FL3B 1HYRC 5M95B 5FLVA 1X7TA 5DYOA 5KVDH 1AE6L 4BZ1H 1A0QL 4L4TD 4E41E 1YMHA 3GBML 1N26A 4UM9B 3QC6X 4JHVA 4QXGH 5DMGC 3TF7C 2HJLA 2W95A 2BPBA 4TRPL 2NY7L 1OSZA 2NLJB 2OTPA 3L3OB 4RBPK 2EYTA 3EFFA 1BAWA 4GW1B 3E80A 1YEWA 5GJTH 3S96B 1M71B 5MENE 1YMMA 4OZHA 1S7XB 5HJBA 3HZMA 1DZ0A 3GJFH 3QIWA 1YPZF 3GZPA 4DP2X 2G30A 1SFHA 2X28A 2ZCKL 2WQSA 4OZFG 4KRMB 4XBEL 2V5YA 4UT7H 3MLPA 1TCRA 4FKHA 1IGCH 5HYSG 1ONQB 1FIGH 4BFGA 2WLHA 1ZDSA 3QAZC 4GKSA 4YH6A 1L0YA 4L8SA 3UBGA 2ZCLL 2F53E 3M1BA 3DOHA 3TJPA 2A5UA 3CZLA 4XPGH 5C0FB 1UOKA 3CN4A 4Y4FD 4R83A 4U6HA 3V8OA 1LE9B 5ACZB 4Y16A 2E47A 3A6CH 3KPQB 4HISA 1N64H 4HWUA 1DUZB 1SJEA 4LNRA 4Q6IA 3CXHJ 4U1GB 4UTCA 2SEBB 1EZLA 4HZLB 4KAQL 2Z91B 4ONFH 3GMLB 1GIGL 4JDZB 1GS8A 3DSFH 4IJ3B 4N2BA 3JTTB 2HN7B 1JGVL 1KXTB 3BWSA 3BD4A 4DQAA 5C8JB 1A47A 5EC1B 1UFGA 4M8QA 1YQVH 3FN0L 1E42A 3V0FA 1LWHA 1AQKL 3VMOA 1PDKB 4JFOA 5E56A 1A66A 4HFWB 4PSPA 3P11H 1SQ2N 3RRQA 4DGVL 1Y6KR 1NUNB 2NY3B 3THMH 4FLHA 1MCSA 5AEAA 4DO4A 2B1AH 2WUBH 5FA4A 5EZIH 1THCA 1G6RA 1U6AL 3BUDA 4O02H 4KKLC 4XVSL 4CC0A 3CHPA 4JFFD 2RGSA 1AI1L 3PJLA 4KROC 4N85A 1CXLA 3UPRB 4DK3A 4L1SA 4R2GC 5D9SA 3FUJA 5D7LA 4AYBA 1FRGH 4IBSA 1RUKL 4KJWD 2DQIH 2JXMB 4GLRH 4PD4K 4F24A 1AQ8A 2QR0A 1MHPH 2GJJA 5EPMA 4LPWA 1K72A 4FXTA 1LEIA 1GL4B 5KW9H 4MCYB 1U93B 1GGIL 3WNPA 3O4LE 4MBOA 2X0UA 4F8LA 4OT1L 2EEBA 1J5OH 5ITBH 4RFEA 4PLOB 2DLFL 2Z65C 3TCLA 1F42A 2Y2WA 3VCLA 1LMIA 3M45A 1MRFL 1HSBA 1IM3A 3APMA 1YN7B 3R7QA 3ZYZA 3DK0A 1N2RB 3S36H 1FGVH 3MJ8A 2XWRA 2YD1A 2KI6A 3GZKA 1C16B 2AEOA 2AEWA 2VSDA 3MRJA 3Q44A 4XOEA 1CS6A 5DUML 1XGPA 2QHRH 1QEXA 3FT2A 3P69A 4ZTOH 4AYMC 2A7BA 1WHOA 2OTWA 3VI4E 2APSA 3BPLB 3Q5OA 2VLKE 5EN2B 5L2KD 2Z3FA 2X6MA 4NQEE 4MXWH 4XP6L 1IUZA 1CL7I 1VZHA 1E6OH 2FECL 1D9KD 4RIRB 5D1ZA 3RDJA 5I71C 2RQ8A 2I26N 1C7TA 4X6FA 4PJCA 5D4IA 3RY5A 4GINA 5CGYD 4QYAA 3QG6B 1YAIA 2X4UA 1LWJA 3RPKA 3US9A 1YN6B 2AKRA 3CFUA 4GKZB 1HCFX 2YRPA 4MAYB 1TO5A 2K3HA 4FG0A 3UGXA 5EFIA 1ZLUH 4K5MA 4UINH 3FF8A 5JXED 4P4RB 1PZSA 1WA0X 3VSVA 1KGCD 2X4OA 5KBMA 4XO9A 3UYPB 3QIBD 1RUPH 4JRYE 4K4KA 4GRWF 4P46B 3REVB 4PRHA 4UQEA 4WHYH 5FK9B 3S35X 2F0CA 3SDAA 1NKRA 3KPNB 3UIYA 2N01B 5EUOE 4JO8A 5DF0A 1ODAA 5LNEA 3DMMC 4HXAL 2PXYB 4ZTOL 2FUQA 3BKML 1QBMH 5LGHL 2NY5C 3IJSA 3FB5A 4FZ8H 4CBZA 1AR1C 3GS4A 1O75A 3T1FB 1DN0A 4KVNL 3D3VE 1MCIA 5HJGA 4I18C 4NO0A 4Q6IC 4GAJH 1N6QL 1AZNA 1XX9C 3C2AH 1VA9A 1BDYA 4E9LA 2WXHA 2AK1H 1WT5A 3L4CA 2YWZA 4HIIA 1ZHLA 2EP6A 4OT1H 5HHXL 3QA3A 4G59C 1BOGA 5KSVA 4XNAA 2CE6A 3IMUA 4Z7WE 1A5FH 1T1ZA 1EAPB 5E6RB 3DRTB 3PG2A 1HK6A 4YBLC 3EIFA 2GK0B 4CDHA 1I8IB 3IJ8A 2MCG1 2IV8A 4PP1D 4ELKA 5G4MA 2XN0A 4F15C 43C9B 1MW1A 4D8PB 4U1HB 2GEEA 5FA3A 4CVXA 3CC5A 2V2WB 2IDSA 3DVFA 3VQ2C 1N18A 3MV11 1R47A 1RIVH 1UXSA 2IDFA 4NKMA 3TVMD 2XIBA 2ZYRA 3JVFC 5E08H 3F6IA 3MRRB 5HJ3A 3RKDD 3FSWA 4Z7OF 1MFDH 4XAWL 3SE4C 1CK0L 3T8MA 3B2VH 4HHGA 3SD2A 1CDIA 2EIJB 3GSQB 2YOCA 1XIWD 2C1OA 4AGNA 4B0MM 2VC2H 1CJYA 1AD0A 2JQZA 5CJBA 1ACZA 2W65A 1YAZA 4DZ8A 5L88L 2BNQE 4JKWA 5CJXC 4DKFL 3B9KB 2ID5A 1J9RA 4XP1L 2OSWA 1CFBA 2WWOA 3SJVA 3VGEA 4E9VA 3IFPA 2A9AA 4JM2B 1LK3H 1IKOP 1I1AB 2KERA 1XR8A 2DD8H 1NEPA 4LCCA 3UTPE 2EIBA 2NR6C 4I3SH 3WSQL 4C4KO 1F58H 1SF5A 3QZLA 1OF2A 4ELMF 3F7YB 2RMNA 4TV3A 5INCA 3JBG7 2HYMA 1PD6A 3D05A 3COOA 4JS7A 1KJ3L 1I7ZA 1QR1B 5BS0A 1X5MA 2WO2B 2EUVA 1UWEH 1U8CA 4ZMLA 1TQTA 4WHDA 3FHEA 2Z35B 3DV4A 4ZAKC 1PZ2A 3HJEA 1IEAA 2WGXA 2ZONA 3VFSA 3ARDD 4UBDC 1FL3A 3AREB 2CDFB 3WFBH 4KKQA 4FC3E 3KM1A 3TZVC 2WVUA 1YMHB 2VDKH 1EAJA 4UV7H 5AVVB 1MELA 4B50A 5E5MB 3D08A 3WTVA 2PPDA 1FFQA 3IDXH 4GLRI 1N70A 1AHWC 2V5RA 2IMMA 4XNZC 3VD3A 2YLHA 4H5SB 3HVDA 3OAUL 3EFFB 4N2AA 5EZPA 4RA0C 2ZXEB 4KUZL 1H9DA 3UBFA 4FQXC 4XNUH 3AITA 4D0DA 1M71A 3ZDXB 4FF9A 1TZAA 2GBVA 1DQVA 2V2XB 2Q7AA 4XI5C 3D4ZA 2PYEE 3P4MA 4QRPB 2VLLB 1NCIA 3VE0A 3WKML 2VWEC 3V2AR 4J23A 5CINH 3NIDF 4NB7A 3VFOB 3OC5A 4JQIL 4XRCB 4HJJH 4AEIH 3Q6FA 2GJZA 3I9GH 2FGWL 5GGVY 1ONQA 1CT8B 4OGZA 3H42L 1J5IA 1JHLH 2IWKA 2DWDA 1GH7A 3TV3L 4YHYB 3ZKND 3MCG1 2XXFA 2HRHA 3TGXA 4U0RC 2QVTA 1WTLA 3W2DH 4G8FA 1A7RL 1E27B 1JIBA 5JQ6L 5LKNA 2ZX8A 5IB2A 1RZKC 3VQLA 4KI5E 4JR9L 1IX2A 1S8DB 3S5ZA 2WXJA 5CO1A 1I85C 1TMCB 2JK5A 2QFRA 5D2NC 2SEBA 4HZLA 2LLNA 3M1OA 4PJXB 4XMUA 2XWBA 3C5XA 1XGYH 2HN7A 2QVMA 4MJJA 3TPKA 1KXTA 3K2MC 3L13A 4PIBA 4Q0XH 2X4TB 4BXVA 5HVGB 1KWGA 2P43B 5GZOC 5FO9A 1CVRA 1IFRA 2WP3O 1SLWA 3BEWB 2BNRD 4E9SA 1CWVA 2Y22A 4AG4H 4D9LL 3H6JA 2BP3A 3O4LD 2E74C 4KO6A 2B14A 1MI5A 4JRFA 2XV0A 2DQGH 5DDHA 5E9AA 2OP4H 5A6IA 3EGDB 3HI1B 4YHIA 5IF0A 3TO4A 1ILSA 3RZWA 1GZHA 3RPBA 5EN3A 1Y1UA 3TBSA 4OVUA 4QTIH 3NIFB 2KDGA 5KS9F 4Y5XB 3TL5A 1MRCL 4H8QA 3B8YA 1JYWA 1GW0A 3GUTA 5F7EH 4JG0L 3BVDB 5GRZA 2FX8L 1KOAA 5F2FA 1IEHA 3NJMA 2LLGA 3TXAA 3VWKD 4MDJA 2BOBB 4PMFA 1U92B 4KXAA 2V9UA 4HPYH 4IBUA 3BH8A 4EAEA 4FJ6A 4B27A 4KVNH 12E8H 3NPZB 3MJ8B 1G87A 1EXUA 2EKSB 3H1ZA 5AKSA 3SKUD 4NRYB 3GBNL 1GGTA 1XGPB 1F4WH 2P5ED 1WEJH 3LS5L 1B2WH 1YEHH 2DQHH 4M5YL 2CGRH 4KRLB 2F2HA 1SY6H 2C3GA 3U0TB 4LDCA 3VMPA 2AMUA 2NNRA 1H3PH 2G9KA 4O9HH 4RIRA 3LSOA 1ZD6A 2WSPA 4P06A 1OE3A 1NBQA 2AAVA 1M9SA 1T2QL 1MJ8H 5DLMH 5I1EH 1ZANH 2X4UB 5K9KB 2BJML 5FHBH 1J18A 4L2YA 3L7EA 5AVRB 2Q8AL 2HT3C 5HYQA 1N6VA 3KXFE 4G1EB 3INOA 2NT0A 3V79C 3K91A 3BAYA 1X6NA 4KGLA 1SYSA 3I3EA 5EF1A 3FH8A 1MFBL 2AGJL 3HG1A 1TJIH 4HUCA 4PRHB 4X9YA 4M7KH 4UOW1 4XPTL 5DVPA 5HHOA 5FK9A 3NCYP 4AMWA 4DVBB 4X5RA 4LRNL 4IHBA 3K8KA 1U8PB 3KPNA 4P23B 3C5JA 2Y24A 4PYGA 2EDHA 3A67H 3QPXL 4CMHB 2ADJA 1FBIL 1SMOA 3EXJA 4X7TA 4UT9H 3BE1H 3T1FA 5DHDA 3D39A 3HZKA 4EI5D 4NCC1 4HPOL 4ODVL 3U79A 4AITA 3FQRB 1OW0A 4Y5VC 3WJLA 3TWCH 5GIRA 1V3JA 4C4UA 4H8WC 2VJXA 2ZJSH 2FH8A 1MAJA 3IDIB 3MSPA 1QASA 4HIIB 3HN5A 2P5PA 3FCSB 3IMVA 3CGTA 4W9HC 3PV6A 4OD3L 3L3GB 4YGAB 1D9KB 2HP4A 3TT1H 3PUCA 4BFRA 1MHPL 2BSED 4WEUD 2HFTA 3IK2A 3PGFH 2PWEA 4XB8A 1KMGA 3G9VA 5DUJA 2VERA 3CFCL 3S0PA 1ACXA 2ITCA 3CIAA 5DEJA 3ABGA 4HWBA 1JV5B 1V05A 2AEQL 5JW3H 2VITB 4UIKH 1IGTB 3OV6A 1E2ZA 2E4FA 2W81C 1KZQA 4DERA 3MHZA 1IGJA 1OPGH 3BX7C 4I77L 1JNHB 2NUTA 3HR5B 5IEHB 4NKMB 3CN1A 5BS0E 1OM9A 4BV1A 5EU4B 5HJ3B 5DCCA 4UOJA 3DETC 4U1MA 3J27A 3O9WB 4PP1C 2WZPD 1BJ1J 5DK2A 1RK0A 2RA1A 2VLKB 4JFPB 4K5OA 3UTSD 5E4IA 3NFPA 3TBTB 4ADGA 1GOFA 4OFKA 2A73A 4F2EA 4DVRL 2FWOB 1F4YH 2C1OB 4YBQD 3FNKA 3EHBB 5IQ9A 3HMXA 4POUB 3TVMC 1OLZA 3F00A 1OD7A 5AG8A 2DQEH 1HT6A 5T5FH 3SOBL 1KB5A 1A7NH 4F93B 2YJLA 4LFHD 2D3JA 2X70B 2XLLA 3SJVB 5E8EB 4JAMB 3VI3E 3IFPB 1H3U