4DP5X

The 1.88 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 8.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp5X00
1J5DA 3H4FA 3KW8A 1GY1A 2GHZA 1XB3A 4WKXA 3T6XA 4Q89A 2GB2A 2FQDA 1V55B 1VLXA 3QJVB 2VSMB 3IE9A 2QDVA 1NICA 4A2HA 5I5IA 4JKNA 4YSQA 5I28A 2BHFA 3IN2A 2J57A 2QDWA 3H4HA 1OF0A 3X2QB 1BQ5A 1W8EA 4YVUA 2A3TA 3FSWA 1UATA 3QJUB 3ZDWA 4TXVB 1TU2A 3NSFA 4UF7C 2HXAA 1M57B 3WNJA 4YSOA 3AY2A 5B7EA 4EF3A 3PXLA 1A3ZA 1CC3A 1IBZA 1W6LA 3ABKB 2IDQA 3FS9A 1X9RA 1PCSA 2H47C 1ASPA 1ET5A 3U25A 2DYRB 3EHBB 4PAZA 3UACA 4QLWA 1ZPUA 1IC0A 1PY0A 1E5ZA 3AW5A 4DPBX 1A4BA 2FQEA 3ASOB 3T9WA 2EIKB 1ASQA 2DWSA 2H3XC 3KW7A 3EH5B 3V9CA 4BDVA 1JZGA 4YVNA 4HALA 4KO5A 1JXDA 3ZX1A 2HZHA 1OCZB 3OMNB 5TK4A 3WNIA 1SHXA 1XMEB 3S3DB 2FQFA 1AIZA 4W9ZA 3FPYA 2CAKA 1FFTB 4UANA 1J9TA 1AS8A 3TASA 3NSDA 4M3HA 5AKRA 1URIA 2OCCB 4YSSA 1MG2C 2YAOA 3N55A 2UXGA 4MFHA 3X1FA 2TSBA 3H56A 4HCFA 4BXSV 1FWXA 2B08A 3GXUB 4DP4X 1KGYE 1NDTA 1XB6A 3N2JA 3GYRA 3FQYA 1E65A 4DP6X 4F2FA 2DV6A 1PZBA 2JKWA 3HB3B 2CBPA 5I6KA 1QHQA 2IDUA 1YLBB 1GYCA 3S8FB 1M9WA 1SDDA 2VMJA 3AG2B 4BWUA 1NTDA 3WKPA 3CDZA 1RCYA 2DY2A 3NYKA 2UXVA 2YXVA 4UAHA 1J5CA 1ZV2A 4G7RB 1SJMA 4KNSA 2W88A 2N0MA 1OV8A 5B1BB 3FU8A 1DZ0A 3AZUA 1JZIA 1PLCA 1QLEB 4AX3A 1AG6A 4FA7B 5B3SB 2VM3A 5I26A 3G5WA 4ZK8A 3WIAA 3QQXA 2XXFA 4YL4A 2PP9A 2PPEA 2HRGA 2UX7A 5I5JA 4W1TA 2Q5BA 1AZNA 1OCRB 2HX7A 2IDFA 2EIJB 2MRYA 4DPCX 2QPDB 5I6MA 1ZIBA 2FT6A 5B7MA 2EINB 1TKWA 4DP9X 1NIEA 4P5RA 1PF3A 4YSAA 3C75A 3PPSA 4K9JA 2IWFA 2XX0A 1OCOB 4AKOA 2BP8A 1MDAA 2QPEB 1JZFA 2IAAC 3NJGA 4G7SB 3FU7B 2UXFA 1KV7A 3NJFA 3GDCA 9PCYA 1JERA 2AFNA 1ET7A 1AAJA 5PAZA 1KYAA 1SHWA 1F56A 3PAVA 2VM4A 4F7KA 3ZBMA 2R7EB 3SBRA 3S3BB 1OOWA 2I85A 5EHFA 3TBBA 2LLNA 4GY4A 3FYIB 1L9SA 2CUAA 3JTBA 5AZUA 4CSPA 1KDIA 2VN3A 3FPXA 2BO0A 3WKQA 5D4HA 4E9TA 4KO7A 1BYOA 3L45A 1JZJA 1NWPA 1N68A 3ABGA 4X4KA 3X1EA 3FT0A 1ADWA 1AZCA 3NP3A 2YAMA 1KBWA 3PAUA 5FC9A 2VW4A 1BQKA 1QNIA 3T6WA 3EH3B 1EZLA 1A4AA 1NPJA 1AACA 2J55A 5PCYA 5B7FA 5IY5B 3BVDB 1ID2A 5I6OA 1CYWA 3WG7B 1HFUA 4KO9A 1XB8A 1OCCB 2I7OA 2XWZA 1OE2A 2BWDA 2YARA 2FJSA 3NSYA 2BP0A 3ASNB 4HAKA 1R1CA 1ZIAA 2DYSB 3X1NA 2BP8B 8PAZA 2GIMA 2ZOOA 2JFCA 4HHWA 2YAFA 2B3IA 1E5YA 2FQGA 3OD3A 3TU6A 1HAUA 4YSPA 4E9RA 2ZXWB 4KNUA 2X87A 1BXVA 2VW6A 1J9QA 1AG0A 4YSEA 3QJTB 4DP8X 1MZYA 1L9PA 4HHGA 4CSZA 1V10A 1OE1A 2XVBA 1ZDQA 3ABLB 4RH4A 1NIFA 3S3CB 2I7SA 2XV2A 1ILUA 1JVLA 1GS6X 4WTQA 2FT8A 3WI9A 2RACA 4A2FA 1NIBA 3PCYA 1OE3A 3QJRB 3OM3B 2BZCA 2IH9A 4G70B 3FQ1A 1KDJA 4YSRA 7PAZA 3UGEA 3CVDA 4KNTA 1AS6A 2GSMB 2AZUA 3UABA 2XV0A 4Q8BA 3NT0A 1TEGA 3BQVA 3S8GB 2PPCA 1NIDA 1WAEA 1E67A 2EILB 2FTAA 1N70A 1JXGA 5I6LA 3IEAA 4G71B 4P5SA 4A66A 4HCGA 3ZIYA 3FQ2A 4BDVB 3T6ZA 1JVOA 4AKQA 1AOZA 3QJQB 4E9XA 2OV0A 2PLTA 4BXVA 1RZQA 1JXFA 2XV3A 3UAAA 3FSAA 2Q9OA 4A2EA 4AZUA 4DP0X 1WA0X 1L9QA 3NJLA 4N4YB 4E9YA 3SQRA 3NSCA 2PCFA 3NJIA 4AI7A 2GC7C 1J9RA 3D12B 5E9NA 1BXAA 2YQBA 5F7AA 1GS8A 4DP5X 5I5MA 1FA4A 1GS7A 4E9VA 5LDUA 1IBYA 1GW0A 1A8ZA 1AANA 1RZPA 5B1JA 2MTAA 4NAJA 1SNRA 3QJSB 2X88A 2YAEA 3NJHA 2IH8A 1SFHA 2Y69B 1CURA 3AG3B 5D4JA 1AS7A 3NJJA 1SDDB 3X1GA 4BWTA 1RKRA 2HX9A 4GP8B 3CDZB 1PLBA 2FWLB 6PCYA 1AR1B 2XXGA 1BAWA 1M56B 2BZ7A 4QKTA 3CVCA 3TA4D 4NB7A 1E30A 1ZDSA 2EIMB 2HX8A 3DTUB 2J5WA 4NERA 1JOIA 3IN0A 2VSKB 1KCWA 2H5UA 2PPAA 3EF4A 2J56A 4HCIA 3RYMA 4JHVA 2HLEB 1ETJA 3UAEA 2AZAA 6PAZA 3MBWB 2TSAA 5AFAA 1BQRA 3SBPA 3IBOA 1KBVA 1BXUA 1NWOA 2JXMA 3NP4A 2UXTA 2GBAA 1PMYA 2FNWA 1PZCA 4KOCA 1X9UA 4A2GA 2NRDA 1V54B 2P80A 3OMAB 1AZRA 2Y1AA 3JT2A 7PCYA 2PP8A 4A2DA 4HZ1A 4GP4B 1GSKA 2PPFA 1NINA 3NJMA 1ASOA 2XYBA 3FYEB 1SF3A 2GI0A 2ZONA 1AZBA 2FT7A 3PLYA 1PNCA 2OJ1A 2YXWA 3V9EA 4YSUA 1PNDA 4DP7X 4GXFA 2YAPA 1DYZA 2XLLA 4E9SA 3TBCA 1GY2A 1PZAA 2XUWA 2WO3B 2WO2B 4ENZA 1CYXA 2VW7A 1JZEA 2IDTA 1MG3C 5B1JC 1GR7A 1HAWA 4DP1X 5I6PA 2AVFA 2DWTA 4G7QB 1A65A 3QPKA 4GP5B 4A68A 2HRHA 3FU7A 2QT6A 4M4RB 2XU9A 4YSDA 3UADA 1AQ8A 3FU9A 4JHUA 4F2EA 1IUZA 1T5KA 2GC4C 2UX6A 2AANA 5B1KA 1ILSA 1J9SA 1WA2X 1KCBA 3T71A 1L9TA 4G72B 5F7BA 3OQRA 3ABMB 5TK2A 2R7EA 1L9OA 1NZRA 5A7EA 4BK5C 2P80D 2IDSA 2CALA 2IWKA 2YAHA 1AZUA 3T6VA 2BW5A 3AG4B 1JZHA 1MZZA 2IWEA 4HIPA 3X1BA 4KO6A 4PCYA 2BWIA 3PAZA 4KOBA 4E9QA 4L0PB 4FAAB 1WS7A 3DIVA 1PAZA 1B3IA 3EH4B 3NJKA 3HEIB 2W8CA 2PPDA 1WA1X 1BYPA 1CUOA 3CVBA 5B1AB 4A67A 3ERXA 2PCYA 2XX1A 2CJ3A 5I6NA 1L9RA 2BP0B 1SFDA 5D4IA 3CZUB 3MX0B 1IKOP 1NIAA 1NPNA 2PP7A 2WSDA 4BWWA 2CCWA 3CG8A 2ZWNA 4GYBA 3OMIB 4DPAX 4DP2X 1EHKB 2BW4A 3DKHA 3SBQA 1PLAA 1ET8A 1A4CA 4YSCA 1BEXA 3NJNA 1SF5A 3FSZA 1TEFA 3FSVA 1WS8A 2E86A 4AKPA 4N8UA 5ANHA 4E9WA 3AG1B 2YAQA 4YSTA 1W6WA 1I53A
chains in the Genus database with same CATH superfamily
3V4VB 5DHXB 1F02I 2BXYA 2HKHL 3JTTA 5DLMH 1H3XA 3FKUS 2EXTA 2JCCB 1RVFH 3GRWH 4IRJB 3SGEI 3VACA 5FR3A 4YGVB 5IROA 3U9PL 4FI8A 1DLHB 4PJ8B 5KWYC 2WN2A 1KTBA 2G0LA 3SYPA 1BQLH 3A6CH 2R2HB 2P8PB 2EIZA 4WSJA 3SPIA 3TNNA 3ZDYE 3BPCA 5IJBC 3LKOA 4X6FA 1CF8H 1SXZA 3SDXA 1A7RH 2JJSA 1UATA 1DQQB 3ZDWA 5F0JB 3MLSL 3TBSA 5HGDB 3MRIA 3ZRSA 4OCXH 1N0LB 1M57B 4IGBA 4PJIA 3VFWA 3T0EB 5B7EA 5DRNB 3V0EA 1K5NA 2HKFL 1CC3A 1IBZA 2OR9L 1NCNA 3ABKB 4ZUWA 4Z7QE 2BSEA 2F8OA 2X09A 1KG0A 1SOKA 3G5VA 2BFGA 3IJ9A 5C0CE 3QWNA 3SZKC 4GRWE 2CDEB 3UACA 3UYPA 2FIKB 3BQUA 4FF9A 1T89A 2VIRA 3U6RB 1YEIL 3TVMC 5LAXB 4OFVA 3SDAB 5I30L 3D18A 3BGAA 3QUXD 3V9CA 5CD3B 5IFJA 4QO1A 2NX5E 5I71C 3OR7A 2VN6A 4QXGH 5JORA 1B2YA 1E43A 3HZ3A 3PNRB 4QCIB 1XCTA 3GMLA 4YHZH 3ULUF 2DQFA 2YEZB 1H8LA 2XFGB 2EIBA 2AGJL 1FE8L 1KPRB 2FD6H 3ETSA 5AAMC 1FZJB 4BZ1A 1F8TH 1W72A 3IK2A 3NSJA 3EO1B 3DURB 1CDCA 1U8OB 2BWQA 3MUHL 1T1XA 2R2BA 3PQYE 1NAML 2VRKA 3N43B 4JJHA 4TSBH 4P9HH 1B9KA 4IQHA 2EE0A 4LMQI 5BV7H 4M3HA 4XE0A 4W6YB 1MHEA 3ECWA 2H1PH 3VI4F 3ZE2E 1O5PA 1JYXA 4Q9RL 1FG9C 1FFPB 1GZHA 5CUSH 1FWXA 1ZCRA 2VITB 1OSPH 4QYAA 5E2JA 5LB1A 3TXAA 4DZ8B 4I88A 4PBWD 4ANVA 2IH1B 1J1OL 5IK3A 2XZQH 4IU3A 2ZOLB 1NM9A 2HJKA 5FGCE 3TT1H 4ES8A 3UZVA 4F7TB 5EULV 4AYGA 4NEHB 5E4EB 3VX0A 1FL6A 3RURA 1S5IH 4ISVB 2P5EA 5I6KA 1VEPA 3OGCA 4U6HB 4WNQA 5KBKA 1YMMA 4NQCE 5BOPA 1VZIA 4TSAH 4XCFL 3VSUA 4BQ9A 5DCCA 4HT1H 3EH1A 2UXVA 4RWYH 3TV3H 1PW3A 4G6ML 1GOFA 1ZV2A 2AI0L 5E51A 3EYSL 4DGYH 4HUUA 7FABH 1WGOA 4M93C 2CA4A 3ZTJG 1KFAL 3O8XB 4GB9A 2RTTA 3NZHL 3L95B 3AREA 5E2WL 2VKXA 3BH9A 2J8HA 5D1QC 3QQXA 4U6YA 4N6QA 2IANA 3G04B 1FYTE 4ELMA 2PKDA 5I1CL 4R3SA 3H0TA 3B2PA 3ILPB 2V9RA 4V11A 3RJQB 3QZOA 4BH7B 2Y7LA 5A1AA 3LSOA 5TE4L 5HD8D 1J5HA 4O2CA 1BBJA 4YR6A 4LOUC 1CQKA 2W65A 3S2AA 1JIBA 4ZJ9A 4QRRE 1O7DC 1VFBA 1SY6H 1GYUA 1YN7A 4P3DB 4ZOEA 4U7MA 1PGRB 3FO2A 1MCOL 2EE6A 5FS5A 4FQIL 3TTSA 3RY6C 5C6TL 2XTSA 4PG2C 3V5KA 4N90D 3ROLA 2RHEA 1KY6A 1HXYB 2XIIA 3QDME 1ES0B 5DQJA 4H13C 3NZ8A 3K8KA 1T22A 3S5LB 1Q94A 5HHMD 2AVGA 5F7EL 1MRFL 1JGDA 4G6AC 3RPIA 1KV3A 3NCJH 3PAVA 3S4SB 3WO3B 2JWYA 2JJWA 5GZNC 3A3YB 3V0GA 5I74B 3R1GL 2R0ZL 3MRQA 4PJEB 4MNQB 4PRID 3OKLB 4MMXA 4XPTH 3IFNL 1UH3A 2C3XA 3AS2A 4DWHA 4H8WL 3QCUH 4N2MA 4IOSD 3HG1B 4P2OC 5GGUA 3VVWA 1QBAA 2AJYH 2I32A 4GUPB 4L3EA 4GQZA 2H9GB 5FC9A 2F54B 4F9LC 3DHJA 1QQDB 1E5BA 3BT2L 4X7DC 4AGQA 1A4AA 2CK0L 3QUYC 4BSWB 4GRLA 2EDFA 3IDNB 4R7DA 3V6ZA 1UZGA 5DJCA 4H20L 1R4XA 3VXMA 3HVDA 3QQDA 5HI4D 3PP3H 5JUEL 3LH8A 4AC4A 4P2QA 1AVAA 1KIQA 1ADQH 2XTJD 4Y2DD 1CYWA 3I74A 4YDZA 4ZZKA 1I3RB 4MAZA 4H88L 4PW9A 2YD8A 4X7TB 3O0RL 1AOHA 1X7SA 3OPZH 4ZT1A 1BFVL 2DYSB 4Z8FH 4Y5YB 3QEHB 3DUHA 5EIIA 1O0VA 1BECA 3PL6A 1KC5L 1TZIA 3POCA 2XNAB 1GKOA 1NFIB 3N1MC 3UJIH 4POYA 4XZUB 1GHFH 2JB6A 5EU6E 3ZK0A 1K6QL 2DB8A 2HT4C 3KVPA 2OP4L 4OBRA 2EZ0C 1EBAA 3OHXB 3KL5A 3VMPA 4F93B 2J8UB 5IFHH 4UYQA 4QDGA 3N0PB 5ERWB 3D3VD 1DBAH 4PJDF 4F33B 3SGDI 4DPRA 1J12A 1B4RA 1C5DB 4A55A 5DUMH 1JF5A 1DFXA 1HDMA 1XIWC 5FYLL 3WL9A 4ZS7H 2XZZA 2CJUL 2GIYA 2XKNA 1NL0L 1TPXB 3GUFA 5JOPD 1VB9A 2ZX5A 3FOLB 1C16A 2VDOB 3HTLX 3IXAB 4YHLH 5T5FH 3LHPL 4WHDA 1J5IA 3D0VA 1DQLL 3N3EA 2HWZH 4NC1C 1OGAD 2UZXB 2DH3A 5HJ3B 1E67A 1YUKB 3HAEA 4MCNA 1RL1A 4XX1G 4NWTH 1JXGA 5KAQF 4XN7A 4U6XA 4BDVB 4UOW1 1KB5B 1IC7H 5GS1B 4G6FD 2CRZA 3FCTB 2FB4L 4GSXA 4MJ5B 3ZHDA 4UILH 3NGBC 4W4NA 4YDIH 1CFVH 1JDCA 1UXLA 3WOVA 1NDMA 4P5KB 2WQRA 2B15A 1KCSH 4G43B 3WE1A 1NCCH 1O7DE 5KVEL 3VU1A 4AQ1B 1C9SA 3QHTC 3QWOB 3T08A 4DP0X 4FFVC 3VD3A 2LAAA 1XSIA 4X4XB 4FXKA 4QHKJ 1A9BB 2J5LB 1SEQL 2GY5A 1FIEA 1XH3B 1XGUA 1W91A 2WWMD 3FFDB 3DYMA 4XVTL 1IL1B 3ZO9A 1F3DJ 4AM0B 3BO8A 2XQYA 3ECUA 1YJDL 5AYQA 1EO8L 3FFCA 5E2VH 4OKDA 4L9LA 5IB4A 2OW7A 3QCTH 2VDLL 4OW6A 3MJ8A 3QJSB 1OHZA 4NSKA 3C6LB 4P4KC 5D93C 3NJHA 5T1MA 3MLUH 5B8CB 2HKAA 1HH9A 3NCCB 3LN9A 4OLUH 4XNUL 2P8LB 4HXBL 1MEXH 1PZ5B 2ZCZA 5MEQA 4L1HA 3E1ZA 3C09C 4BWTA 1G5GA 1F0LA 3SYOA 4K7PY 4YDVB 1KGUA 2GHWB 3B3IA 4J8QA 4KK6D 3GF8A 1PKQE 5AYTA 2JKNA 3MLZH 4CN4A 5DJZA 3AWFA 4KRPD 1J5OH 4E41D 5JOEA 3UPRA 1EO7A 4IRJC 4XGZB 2F53D 2O6DA 4X9FA 2NY5L 3Q3GA 4PJ8C 3FTVA 3RYMA 2COVD 3SKMB 3IJHA 2WJ7A 4YDKL 4DKFL 3JQOB 2VC2H 1G9NC 4HGMA 5KS9E 5MEOA 4GXVL 3EUUA 5EZIL 2CR0A 2VLLA 2XN0A 5F9JB 1PG7X 3IS1X 4Z95L 3KR3H 3PABA 3L5WB 4EUPA 2QGDA 4X5WA 1YPZA 3C5SB 5AW1B 2GTZA 4JFOA 4F7PA 1C5BH 2EE9A 3EOAB 2VLRD 3PHOB 2N1TE 1G9NL 2QPUA 3RDTB 3T0EC 1X9UA 3DYOA 1BEYH 1XAKA 1V54B 3DMMD 1K85A 1P1ZB 4YN3A 3N50A 2EJ1A 4Z7WA 1DFBL 1EZVX 4ALAL 4OZ4A 4KZEL 1NGXA 1OGPA 4N1EA 1ERNA 3IVKB 1WFJA 3QG7H 3FYEB 2ZSWA 2EADA 1JNHB 2GBVA 3BAIA 2X4OA 1Q72L 4WTZA 4NKOA 4KJYA 5L2KA 4NUPA 1BX2B 4QYOA 4MX7B 3MRMB 4JN1L 4XCNA 3WYRA 3SDAC 3AY4A 1IBDA 2VUOA 2YXWA 1IEAB 4FHBD 4ZXBD 2WLLB 4LMQE 1BIHA 2B1AL 1VPOH 4YEFA 2VDQB 4GUQA 3W5MA 12E8H 1JDDA 1JF1B 1OARH 2BXZA 2Q7YA 1D2PA 4NHUA 1PQZA 2DYPD 1CT8A 1FCGA 4G7QB 1I7ZA 5DRXB 1PPIA 2OTPA 1EIBA 1TMQA 2Y2YA 3FU7A 1Y6NR 1CL7H 1WBYA 4OCWL 5EC2B 5JIPA 2V9TA 5FYKU 4GJTB 3V4PA 5T3XE 3S36X 4NKQB 2V2XB 3HHSA 1ZHLA 5CIPB 3I6LE 5I9QB 3RWHA 3MXWH 5IR1B 3FUMA 4L9DA 4KHTL 3MRRB 3ULUL 3PREA 1LE9A 4EPSA 2WLHA 4AQAA 2XRAL 2VQ1B 3NOIA 3KWVA 4X4ME 1KBBA 3EBAA 5IZ7A 2GK0A 2PO6D 2HMIC 4LDEB 5E4EC 2XZAL 4PCYA 4E9QA 4AITA 5CCGE 2CM6A 2P5WA 1PAZA 3NMEA 2Q8BH 5JLZA 3MGAA 3GSQA 2EIDA 1I4FB 1KGCE 5DS2A 4FQCL 4PRIA 4FFYH 3VCLB 5EFIA 3HMXA 43C9B 5I8OL 4N2DA 3OKEA 3CFCH 3QZPA 4IOSA 2XHNA 4QRQB 5DJ0B 3WS6C 4RISL 1S7SA 5ADPL 1U8IB 2WSDA 1INEH 2ZWNA 3HUJE 1HCYA 3B8YA 3O8XC 3OXRA 5BQ7B 4P06A 1HYSD 2FJHA 3IXTA 3MR9A 4IKLA 4N6RA 4PJFB 4YSCA 1XWVA 2E59A 2IALB 4JB9L 5TF1L 3F58H 4PS4H 2YAQA 5IESH 1UKSA 3L3HA 5DFVD 3ZZSA 4Y9FA 4JPSA 2ADGB 1J5DA 4MMYA 2CCVA 4CMMA 1NBYA 1W9XA 2ZF8A 3ZUCA 2P5EE 2C4FT 4Y2DA 2OK0L 1R5WA 4NLHA 4OV5A 2VGLM 3B1UA 3O3UN 2ZCHL 1DEDA 3CZKA 4PRPD 4HCRH 5D6DA 4PGCA 1QFPA 2BRRH 2JCCE 3A4FA 4YLQT 5EIVA 4A2HA 4G83A 3BEWA 4YSQA 3W9EA 4LSQH 4MMZB 3Q01A 4K3JH 3GLAA 4Y5XA 4F7CA 4TL4A 3UAFA 3UBFA 1P7KB 1QHPA 1WZ1H 3QS3A 3M8OH 5DMKA 5BVPL 4DVBA 4KUCF 3ZHLA 1XHHA 2J73A 5INDB 3ZTNH 1KLUB 1EJOH 1CG9A 1E6OH 1ZT7B 4QF1B 4WI0A 2NZ9D 3MRHB 1SPDA 5I74C 4MD4A 1TXKA 3SKJH 2IANE 3IFPA 2Z8VC 1U95B 1Z9SA 3FQTB 4HUCA 5AB2A 1WBZB 4K5NA 3T2NL 4Z77B 5T1DH 2NT0A 3H3PH 1DJXA 1WF5A 4QLWA 1TTUA 2NTSP 4HPOH 3IB4A 3AW5A 4MAYD 1A8JH 1LLAA 4UTBA 3WEAA 2ADIB 2QLYA 4WHTB 5B3NA 2WVVB 4F8QA 2D4FA 3GSWA 4XOCA 4NGHL 1ZA3A 4MSWB 2Y5TA 5DDHA 3LJ3A 3O3EA 5EC1B 5C3TA 4K8RL 3VFVB 5LXVA 5ACZA 2XPYA 1FGNL 5DS8A 1SHXA 5C7XL 1OGAA 2YK1H 5HHNA 2YIHA 4UZSA 2MOGA 3D9AL 1LJMA 3L7EB 4S1SL 4ZX4A 5J6SA 4X5PA 3WY3A 3MLPA 3GC3A 5I0WA 2BOCA 5I24A 4G8FA 1N5YL 2FAUA 5C9KA 2ZCKL 3I84A 1XFPA 3CZEA 2QMJA 3QUKB 2JB5H 2WNKA 4I48B 3DBXB 4LQFH 4X83A 2WXRA 5FM4A 2B08A 2GJ6D 2R69A 4Y5YC 1G9MC 3MCYA 4IBWA 4FNQA 2PR4H 3CFBB 4PBVC 1NDTA 4F58L 1MJ8L 2DKUA 3FO9B 2LLGA 3V95A 1IBHA 5DTFA 3KWTA 1E65A 1LK3H 3C60B 1A4JB 3JV6A 3LPGA 2VL5B 1GKEA 3QVAA 4OAWB 4WW2B 4F2FA 5E8NB 3DJTA 4XP6L 3ILQC 2HG0A 3B9EA 3FTXA 1ZJAA 4M56A 2HJLB 3D48R 2QSTA 3OHXC 1J88A 3HG3A 4XMKL 5KYWA 2DY2A 1DO6A 4PU2A 4YX2L 4PLOB 4A1RA 1F45A 3D08A 3VXME 1UENA 5DXWA 2OW6A 1KJ2A 3PXJA 3B2XA 4P2QE 4IOFD 3HC2A 4F24A 4BHUA 1JD9A 5EO0B 2MHAA 3EGDB 1C08B 3EXLA 1IFGA 1QSEB 2FJFA 3LEVH 1WBXB 1TPXC 1KJ3H 2D2OA 5D7HA 4LEOA 4WI8A 5D7IF 3JZ7A 2XXFA 1C1EL 3P4OB 4JAMB 4WY7H 4E41A 2BHZA 2HRGA 3HE6B 3O2DA 3ZE0E 2Q5BA 3DRTB 5EU5B 2RBLA 2F53A 2LR4A 2AQTA 4HIEA 2PWDA 4URKA 3VFSA 2JQAA 1A0QL 4YC2B 2BVPA 3SE8L 3ZKMC 4I3RL 5D1XB 1WWWX 2EINB 5FV2A 5GS1C 4N0UA 5C7ZA 5C08D 4P5RA 3SGKA 2BNQB 2FYVA 4AUJA 4ANWA 3TEZA 2IWFA 3K91A 4AQOA 4CBZA 3DI3B 3KLQA 3H9YA 4GOSA 5ALBL 4AQ1C 3WTSA 1KB5L 1HQRB 5DD6B 4R7NB 2VLRA 2CU9A 4WI9A 4UQEA 3IPFA 3DPBB 2J5LC 3RZCB 3DMMA 5GRVL 2YQ3A 3WNMA 2FO4B 2GJPA 3B9VA 3FRUA 3GBMH 1G6RA 2OS7A 2DMHA 3CGTA 4TTDC 5TE6H 3RY5A 3VQ2C 5SWZB 2B14A 3LVEA 1ZY9A 5DT1H 3OJDA 1F3JB 4WQOA 1NCGA 1XD1A 35C8H 5E94A 4TLUA 4WIQA 3SBRA 3ZU8A 3S3BB 4N0FB 2WBJB 3B2DC 2QELA 3CHPA 3UMNA 4BQBA 5HYJB 1AY1L 3Q13A 2DIAA 2X0WA 2DL9A 3C6LC 3FYIB 4APXA 5B8CC 1HZHL 4ZXBA 4MNQE 3ZRFC 4BHUI 2ORBH 2YUXA 4LSSH 2OMZA 5BRZB 5JW5A 5HDBF 4ZW3A 2OULB 3DXAD 5JW4M 1HQ4B 3FUFA 3HG1E 4QHMB 4DETA 3WNPA 2DYPA 3UBXB 2WQ8A 4BFBD 1KBWA 2ID5A 1XGPA 2V3EA 1ZGLM 4OT1H 3GXPA 3MLRH 4JL2A 3QO0A 3WD5H 1QEWA 3OX8B 3AGWA 4KY1H 3HZKB 1XZ0B 4R96A 4TNFA 5BJTB 2AKRB 1U33A 4IS6B 1N19A 1GPOL 1NLBH 3B6SA 3LXUX 3P0YH 2H8PB 4MZ2A 3P3UA 5AZEH 4YDLB 5JA9A 1G7QA 4FNLH 3L08A 5EO9B 5ACLA 2V2TA 5LGJA 2W94A 3TFKD 4KH9A 5F9WB 1E50A 1N64L 4Y19D 5BO1H 2PO6A 3C6EA 4NRYA 1P5VB 3KPLB 4HEMA 4QAMB 3O6KH 1UD2A 3RDTC 2IPTL 3BEVA 4JFDA 3L6FB 4PVLA 3BDYL 4XPAL 3B9KA 2G2RA 1ZXQA 2F74B 3GTTA 1INDH 1EV2E 1F2XK 2O93L 3HPJB 1E27B 2BCMA 1YVLA 3SEPA 3IDXL 2FEJA 1HL5A 4P3CH 2XTJC 4KTDL 1NCWH 1LWHA 4J1UA 1AZVA 2E5EA 2VABA 3FFOA 1MCDA 2RIKA 4W9IC 3WEMA 2XV2A 1YQVL 2DQHL 1UB5B 1UJTA 2J8UE 1W8NA 1EGJH 3ELAT 4M8QB 1OE3A 3ARBB 5TH2A 3ULVH 2W38A 2F8XC 3GMQA 4BRJA 1AMXA 2EYSA 4D9QD 3L54A 2B1HH 3Q06A 3H3KA 2L7EA 3RUGE 1MI5D 2VERA 4L0ZA 2P4AB 3BUTA 1YPZE 2I26N 4PTUA 3CVDA 3LN4A 2GSMB 1NC4B 2VDQL 4QRPD 2QQQA 4G8GD 1TJXA 5E9DD 5G2NA 4OF3A 5AB1A 4S1RL 1NIDA 3ZYOA 2H2PD 3BSZL 4F15C 3PFQA 1MNUH 3DIDA 4L29B 4PRPA 4Z7WE 4XMZA 5E5UB 1ZLSL 5I9QC 1RD6A 1KCUH 1JVOA 2JV6A 1VFAB 3BUPA 2ZCLH 1NBVH 1MHPH 4ZAKD 2OMWA 3QJQB 4X42A 2YPVA 3PE9A 1P4LA 4OSUL 3A5VA 3CHSA 3EO9L 4U2ZA 2NUPB 2ZNWA 3QR1A 2J20A 1JXFA 5BXFB 3G6JB 5D70L 5J6HB 1ZE3H 5DUBB 3SZ6A 2G5UA 5E4AA 3VI3F 2WP3O 2Q9OA 2Z31B 2VDKB 3QJOA 5F3HA 4ZFZB 3INUL 1TSRA 4DEWA 4GNKB 3NJLA 5KYXA 3SQRA 2Y3AA 4B5EA 4BUQA 4HWEH 2I25N 3HBQA 5ICZB 1BXAA 3HC0B 3HI1B 1E4XL 1GS7A 1RJZA 1MUJA 3D4CA 4FYQA 4JK0D 4OZHA 4MAYA 2YD1A 4JHWL 5C0EA 3SOBH 1GGYA 3BFQG 4M3JA 1I8AA 4B9JA 3QWQB 3KLHD 3S37X 1MFDH 1S9WA 4J3OD 3QO1B 4D0CA 1SDDB 1LEKA 3JVGA 5D7LB 2HX9A 4N90E 3K7UA 3Q6GL 4L1DA 4XP9H 1V3LA 5CP3H 4BQCA 1OLZA 4M4PA 3BSGA 3ARDD 4NO5B 5HHME 1UOLA 4LPUA 4NUQA 2R1XB 3KGUA 4NZJA 1RUPL 3PGCB 5KOVC 3EO0A 3FT2A 5K9JH 2NNFA 4OB5H 5C0AD 4JFED 1MCPL 4ANXA 3CDGA 4NUJB 4XC3H 4EIBA 4XXWC 1G7MA 4MMZC 2E9WA 1H3PL 3UEZA 3UAEA 5I1KH 5I8EB 5F7NC 1ZHNA 1D5ZB 2VXQH 4HKXB 1TTAA 3IETA 1MWAL 4L8DB 3RWIA 5HSFA 2FWUA 2JXMA 4DCQA 2QSQA 2GBAA 1CTMA 3O6LH 5AVVB 1EXGA 2VUKA 2ZG2A 4L5FH 2A99A 3D07A 5IWLA 1HN1A 2K45A 1AI1L 1W0VA 1ZEAH 1KPUA 3GMPB 4RZCA 2ZPKL 4RRPA 3O2VH 3WCYA 3H2QA 2RB8A 2ZX7A 5LBVA 1OTTD 2XYBA 4IJTA 5KVDL 5C71A 1QFWH 4PLJD 1RPQA 2GI0A 5GZOC 4PB0L 4FZ8L 2XTJE 4L18A 2CHDA 3C2SA 5EO1A 4WU7A 2KZ1B 4M7LL 3WEBA 1UEYA 3V9EA 4BE5A 1DE4A 5JMOC 2JLLA 1GY2A 3KYAA 3S96B 2R39A 1OD7A 3UC0L 4CILA 4RQQA 4DP1X 2WKOA 3ZKNC 2HG5A 4BFRA 4PJBB 5F88B 3OLIA 1HH6B 2FX8H 3CZGA 1BVLA 1PD1A 3WFBH 1ZLVK 2GIXA 1IUZA 1M71B 1T5KA 3QIWD 4ONFL 5KTEL 1DBMH 4HFUH 1CCZA 3W57A 4FOMA 1DJWA 1GVIA 4FCHA 2VAJA 3PDDA 5C09D 5F7BA 4N9OB 1A6UL 1QLRA 2AERT 3QH3A 4RESB 3D3VE 2WKLA 2HT2D 3BHBA 4Y0GA 1DN2A 2CALA 5E6RB 1ACYH 1SXAA 2YA2A 2XQBL 3AG4B 2G3XA 2WQVA 2D7PA 4WW2C 3EOTH 4BFGA 1F4AA 3HS8A 2DN7A 4KO6A 4CA4A 5JOPE 2HT3D 4F7MA 3P73B 4M7KL 5ETUB 3EH4B 3FQWA 3V0VA 3OKKB 4MJIB 5I2IA 3ULAB 3QG6A 5E5MB 5JPNA 3C08L 3ARGB 3X3GL 4B0MM 2CO1A 2K6WA 5ANMA 2JKSA 5LKNA 5E4OA 5FO2A 4EI0A 2Y3NA 3CFMA 2MQCA 5IMLA 2J88H 3DV6A 2P52A 1SUHA 1YECL 1YEKH 4BZ2H 2V37A 2ATKB 2BJMH 3U7YH 3W5NA 1U30A 3WS3A 5I1EH 4Y9CA 3HE6C 1TEFA 2PXYB 2D7TH 1NC2B 2Q10A 4JO1H 4DIXA 1KEMH 3PP4H 1W6WA 1RUKH 2ZUVA 3MV7B 4IBZA 3MOAL 4XOEA 2OCJA 4MHHG 4YO0B 5D1XC 4FLRA 3KW8A 4LLUB 1A3RL 4PGJA 2EYRA 2X7LA 3D34A 4OCNC 1IAIL 2OFQA 3HI5L 3TGXA 1UXSB 1XSKA 2EO7A 4H25A 3S88L 3VFUB 3X14A 5ID0B 4Y19A 4AWJC 4NRXB 3K8LA 3VMOA 2FYYA 2J57A 3V52L 4R0LA 2OSYA 2QBWA 3RZCC 5A16B 4M5SA 3LQAL 1PD6A 5I73B 3KPRA 5LG6A 3L3OA 2OX5A 3KH3A 1CR9H 3T8VA 3QNYA 4KKPA 3RBGA 2L7QA 1R3LA 1Y1DA 2F5AL 2WBJC 1I3UA 3VM5A 1MFVA 4FFZH 4BFKA 2H47C 4NPYB 1FYHB 1Q8MA 2P42B 5FYLD 3TBYB 4PAZA 2WWKO 2DM3A 3V4UH 2IBBA 5L7XH 5I66A 1RK0B 2DIJA 4LVOB 5CGBA 1T1WA 2DWSA 3GMMB 1KYDA 2AV1B 3GJEB 1MI5A 1JZGA 4UIMB 2ZOWA 3MRBA 1E8YA 5FECB 3OC8A 5CR1A 1X5IA 1SN0A 4J6RH 4S0HA 2HZHA 3E7JA 4G8GA 5CJBA 2ITDB 2DQDH 5E9DA 1M2VB 3BT0A 1EEYB 1UM5L 3I2CH 3CFNA 1AQKL 1I7UA 1GCYA 2X2JA 4D0DA 2ATPA 5GRJL 3L1EA 3K3QA 4YDLC 1A1MA 4LVNB 4AMKL 4UCFA 2JJTC 1DBBL 2PYEE 4ZAKA 1GRWA 4GG6B 3GK8H 1JMXA 4R2GD 3NEOA 5DWUH 3UPAA 1ZTMA 2WTOA 3HS0B 5F9WC 4BZYA 2UXGA 4M5YL 1H3WM 1XF5A 2WUCH 3IDIB 4I18B 3MLTB 1GW6A 3H56A 4CADB 3BRGC 4OJDH 2DQUL 4F8OA 1HKFA 1IAKB 32C2A 2CCLA 3S97C 3U7AA 3BXNB 5IG7A 1IJNA 5KVFL 3IPBA 3DHMA 3GYRA 3FUKA 3L7FA 3P11L 3I3DA 5GRZA 4OZFG 1U8KA 1Q38A 4YXKH 4IBYA 2W9EL 1JNLH 2E9IA 1CLZH 4BUHA 2DI8A 3LIZL 2J6EH 1OAZL 3AITA 1L9NA 1SHSA 1YEGL 4HXAL 3MRPB 5FK9B 4Z7IA 4DJMA 2BSTA 4UT7L 3TVMA 1GGIH 3ARBC 1PBYA 3LNFA 1EO5A 2C7FA 1DQTA 2ITCA 3BIKA 5B1BB 2F1AA 1LO5A 1NCHA 2PWFA 1PKOA 1QLEB 1T20A 4O02L 1QSEE 4A2MA 3KMDA 1O6VA 1W80A 1NAMA 3D25B 2WINA 4YL4A 2TAAA 5AOKA 3MFFA 4P23D 3RB7A 5EEUA 2V17H 3SIKA 5IJVB 2CMRH 3LEYH 5D72L 4GQ9L 3BRFA 1TQCC 2ZSVA 2NY2D 4E5XB 1TCRA 3MBXH 1VGEL 3RFRA 3S0PA 5D1XE 4KK5D 2PWEA 3CHQA 2C7UB 4JJ5A 2MQ3A 3RNKB 2BNQE 3DGDA 4UU9B 4OLZH 1YN6A 3DJRA 1JN6B 2AAVA 2DI7A 1JS4A 3UYRH 2Z31C 3HRPA 4LCYA 2VZ1A 2BFVH 1L3WA 4YLCA 3HKFA 4ONGH 5FGSA 3MODH 1JK9B 1T03H 2A4CA 3Q9QA 1ND0A 2QQLL 2KBGA 5LBSL 2EEBA 1CDIA 3MLVH 2NR6D 3RIFF 1RLWA 2G3ZA 5SWZE 4G2AA 3M7FB 1I31A 2YUZA 1OOWA 3FQXB 4R9HA 4OZIB 4FZEH 3CSYB 2I85A 5EHFA 1LK2B 3EYUL 4CSPA 4FQQB 5DJDA 5BVJA 4DAGL 4LPXA 5HYJE 5IM7A 4PRPE 1KIUB 4HH9B 1HCFX 5CP7B 4JPQA 2NNAA 4BFFA 1HEZB 4P2YA 3S5LG 4EIGB 1HEJC 4YPGA 1PEWA 3NP3A 5HVWA 4KXZH 3GI9L 3SKNB 5ESQB 2VW4A 2AEPL 3RGVD 3O81A 1HZLA 1U3ZA 4M02A 1GJUA 1HWWA 3QIWA 2R2EB 3VW3H 5DZOA 5E8OB 2CJSA 2O5ZH 2X6MA 3BCFA 1WWCA 3KM1A 1BMZA 3LS5H 3ULUD 1L7TH 5C09A 1J8SA 3IU3B 2NLJB 1NLDL 2FZ3B 5AUMB 1BAFH 3ZOAA 4AGOA 5IUCA 1QFOA 3SY0B 1IC4H 4GFXA 4Z23A 5C6PB 4IBLT 3MGTA 3UCQA 5KANG 3QPXL 1XEDA 4BQ8A 2XWZA 4B7LA 1TZ8A 1KLGB 3RY6A 2UZYA 1UXMA 2CHNA 1VF5C 5H37G 3HJEA 2BP8B 3IJSB 5ID1A 4I87A 4XWGL 4KAQH 1UA6H 4LSTH 1FG2A 1BBDH 4PREA 3ESUF 4JJOA 1HAUA 1JGLH 3EZ8A 4EQ2A 3AJ7A 3SDYL 3CFKB 2ZXWB 1Q9LA 4B9YA 1ZS2A 4I7ZC 3MROB 3UDWC 4PY7A 1BWMA 3VU2A 5CINH 1BXVA 3VXQA 1RJLB 3N91A 3VGFA 4B27A 4NJ9H 1UA7A 1D7BA 4PLKC 4CDGC 4DP8X 4CSZA 4HHGA 1DDHB 4GQPH 1JGUL 4W9GC 4OLWH 2XG4A 3U83A 4PJ5B 5IBTL 1HX0A 1ED3A 5D6CA 4L0YA 2YRPA 3L3JB 2UVEA 2DEYX 1LP9E 4X5XB 5C07D 2GJ6E 2CBQA 4UDUB 3FQ1A 2DRUA 3FB6A 3V0WL 1L3NA 2GTWB 2J44A 3VRIA 4YH6A 3BN3B 3R4DA 1DQML 4A63A 2WCGA 3LNHA 2NW2A 1G9EA 2IF7A 4QRSB 1G7JA 2G0KA 5E2TH 3K81A 2B7DT 1XV8A 4OZGA 5LCVL 1RZGB 2PPCA 3TPUA 1MF2L 4ZTOH 1WG3A 1T6WA 2FE0A 1KSRA 5LAPA 3T3MF 5MP6L 5E24E 4N2CA 1HHJA 2J43A 1YNKH 1CFSA 1F11B 4N8CH 4HJGA 2DQCL 3T3MB 4PJXB 4OJFH 1SEBB 3BW9A 3DX9A 1T5XB 1AJ7H 1MAML 2I07A 4IU2A 4LF3B 4X0KA 4N2HA 3UAAA 1BD2D 1SHMA 2W5PA 4N1CA 3G6JE 4IM8A 1FZMB 5IMOB 4OBSA 5KUKA 3G5ZB 2B4CC 2A4ZA 2RCSH 3L4WA 1IVLA 1NSNL 2A74B 3RVWD 2FJUB 1NCBH 3ARGC 4G8EB 4FQJH 2D7MA 4CU6A 3QULA 5DO8A 4EI6A 1CK0H 4UQBA 1UXWB 5CJXA 1B0GA 4AMWA 3V4LA 5CN3A 4Z3TA 1SVCP 3MZTA 4WWNA 1A8ZA 2PF6A 3CFJB 5EB9A 3SPGA 4MXVF 5C08E 4B53A 2IPUK 4K8RD 5EF1A 2BMKA 1IGMH 3LKNA 3EG9A 3JWDC 2CBMA 2W95A 3FF8A 3V5DA 2NXZD 1MAKA 4N2KA 2PXYC 1DEEB 4OQ1A 2OQJA 1FI8C 3IDYB 2A9DA 1ITCA 1SYVB 5DR5H 2EUXA 4HKZA 2Z4QA 2MH4A 1P2CA 3MJ9H 1DVTA 4LASL 2Y7QB 1I7TA 3JV4B 4O2FB 5ALCH 1N6UA 5GIRA 3U46B 3DO7A 2BSRB 3BDBA 4GRWH 2IGFL 2E7BA 4FTDA 2BCKA 4C4KO 1ZS8B 4XCEB 1BZOA 5SX4I 4WJ5B 4I89A 4LSVL 4JW3A 3UIZA 4RAVB 4XOAA 4MQSB 3ZE1F 3WIFA 1KLFB 3CC5A 4O2EA 4QGTA 3DXAE 4A6YL 5I73C 1JSYA 3VGEA 2UXTA 2WQWA 1P7QA 2EKSA 4Q0XH 5F71A 1FDLL 1B4TA 1NBZB 4A2GA 4IRSD 4RAHA 3B7RL 2WAQA 3ZW3A 1Q9OA 5KSBF 1CXIA 7PCYA 4A2DA 3BCDA 2VXVH 4M61A 4UB0L 4KVNL 3VFGL 4CN1A 4ZYKA 2JK5B 2DTSA 5AW5B 7TAAA 3K0WA 5DJ8A 5HHOD 2AJ3B 5T5NG 4KXAA 4XN9A 3V5HB 1YNTA 4LVOC 3RGHA 5CFAA 3I3BA 2F15A 4A7UA 5EBWA 2YAPA 4OM1L 4OGQC 4E9SA 3MV9D 4Y19E 3IDJB 3MAWA 2G3NA 1OK8A 4PGBB 3IJEA 5FA3B 3CN0A 4S1DC 2A83A 4UTAL 3MOBL 4P23A 3QUZC 4YHML 2V7NA 2VAAB 3LMJL 3BP6A 3WFDL 1SMOA 4JFZL 4W6WB 5HHXL 4B6ZA 1QOKA 4F2MB 5GS0H 2BZDA 1UZ6F 4M7JH 2QT6A 4LVNC 4YQXL 2VOTA 5MERA 1RMFL 4PJBE 5EUOF 2NCMA 2NW3B 3KPTA 1DLHA 2AANA 2Q6WB 2ZUWA 4ZUUA 1QASA 4EDWH 3HS0C 4F37K 3OQRA 4I18C 1DUZA 4YIQB 5TPWH 2C9VA 1L9OA 1TJGH 3DSNB 4HWBH 4BK4A 2P1YA 3CVHL 3CCHB 3SKOB 1FC1A 3T77B 1JZHA 1SMAA 4D9QE 2L3BA 1X5MA 4YFDB 6TAAA 5DRNA 1MI5E 3X1BA 5E8DL 3WDJA 4NUGH 2NR6A 2DEWX 1QKZL 3B3BA 4QRPE 2XN2A 3DX1A 4LLWB 4QOKD 2GBUA 5MEQB 2W8CA 2CDEA 1AC0A 3CVBA 4M6MH 1OCWH 3CU7A 2JKJA 1D7DA 1EHLL 5F9OH 3JYCA 4GMSH 5FUCC 2DDQL 2YPKB 2PP7A 1HESA 3CG8A 2C1PB 4P99A 4DPAX 1F6LL 2DWXA 4G6KH 4K7FA 4DP2X 2BW4A 5DK2B 1MJJB 1IQWH 1A5FL 2ZD0A 3MNVB 2HFFB 5GGRY 1JZ4A 3RGVA 3QQ4A 5GGTH 2Z92B 4LDCA 1FZJA 1IGFH 1Q1PA 5C8JA 3MREA 2OSLA 2JE8A 3G08A 5IHLB 3QIBD 3MNWA 1U91A 1IZKA 4HK0A 4N25A 3THMH 4DO5A 4F3FA 1U8OA 3IKCB 1KJMB 1LTXA 5K1NA 2R4SL 4ICWA 5L8JB 1NFDF 3EBHA 3MV7E 1PSKH 2B9AA 2HTKD 5C2BL 3G6DH 4KRMB 2FQDA 1NGQL 4S2SB 2BS9A 1S7VB 2NY7L 2GG1A 3PGFH 4KKCC 4TN9A 5J9PA 4ZDHB 3QXUA 2W0LA 3QEQB 3SJVB 1ZVSB 4NN7B 3QDGD 5F9AC 2OTUB 3VI4A 5FHAL 3FULA 2CLZB 2QLVB 4NQUA 1YEFL 1U2CA 3N1GC 2FR4B 1NKGA 4YVUA 1AGEB 1PD0A 2A6KA 3ZDZE 5C92A 1ZT1B 2X44D 4JGJA 4XPHH 2OAAA 1N2RB 2VMDA 5JO5B 3TC9A 3VFOB 2Z35A 1ZKAA 4QY8A 5DHVH 4NO3B 4ODBD 1IBGH 3VB9A 3VGAC 3CFDA 4NQVA 5DURD 3B5HA 1RZIA 1AHKA 2OMYA 4RGNB 3O3AB 1FF5A 1JGEB 2BNUA 2RJMA 1FNFA 1NDGB 5C0AE 4JFEE 4BKLB 3AM8A 5HP5A 4QHKI 2XN9B 2LW3A 1PY0A 4U6TA 3T1FA 5C07A 2YGOA 1K4DB 1A4BA 3BAYA 1QWUA 1NJ9B 2Z8RA 3JV0A 4JO4L 2HN7A 4WCYL 2DQIL 3U0WH 1LEGB 1VFUA 3KBHE 4FXGB 3P3YA 1FJ1A 4L8SB 4HWUA 4WWKB 3WNIA 1DP0A 1FPTL 3K2UH 4U1LB 4BH7A 4HLJA 3NFSH 4WEMB 1RURL 1SUJA 1A1OB 2V9QA 4IKKA 4MASA 1BYNA 1JGVL 4UANA 1G7LB 4HUNB 2X4UA 4YNYB 4GG6E 1E8XA 1WSST 2R15A 1X4YA 3GSOB 2V33A 1OAUL 3WLBB 3DYPA 5C0FB 3S3JA 4HMEA 1DQJB 4X80H 3S4SA 4FI6A 4NZUH 3HBZA 1EJ6A 2XIBA 4X99A 3L5XL 2BIQA 1SLVA 2IDUA 4C59B 1VAHA 1AXTL 1MFAL 1TU2B 3R0NA 4I0KA 1ZHKB 4XP5H 3ZHKA 4LSDA 1NTDA 2X53A 5TQ2L 3DRQA 3RIAK 3CDZA 4WGWB 1UTDA 4YXHH 5IB5B 3D69B 2YXVA 3GHEH 5ABDE 4TUKH 4UAHA 3DO7B 3BH8B 5GGSB 1SLXA 2FJGB 4QPEA 1P84K 1F58L 1SRDA 3KBPA 4LGSB 2VDNB 4ADIA 1GA2A 3AZUA 1PLCA 1I1AB 2IV9A 2YXMA 1UGNA 2F54A 5FUCE 2HRPL 1QQDA 4LCWD 4BSWA 3IDNA 3WIAA 4F9PA 1HCVA 3B43A 5F1IA 3PJSB 1HEHC 4QHLB 3OPUA 5CILH 5TDPA 2IDFA 3EDJA 4NO2B 5CZXC 5LGHH 5SX5K 5KSAD 3FTGB 5DHMC 5FEBA 4X7TA 1LWRA 1SJHB 4JREB 4JFWA 4KUZH 4WW1B 3L3KB 4N26A 2C3GA 3OKNB 4R97B 4YHKH 3QEGL 1UHVA 3TZVB 3KPPB 5AL0A 5I1HL 1JZFA 4QTIL 3PJLA 2BPBA 4LEXH 2XBDA 3U36B 2XWBA 4JZJB 2GSGB 2R0LL 4JCWA 1NFIA 4IRSA 3OGOE 1JERA 3HMWL 4XZUA 3MKGA 1JHLL 3BDXA 2A74C 2P8MA 4N5EC 3VG9C 1UACL 4BJLA 4KUCD 5T1KB 3TBWB 5EDSA 4F7KA 2Q20A 5BZDA 1J9CT 4TVPL 2KDGA 3NCEB 2WSPA 3NH7L 2CKBB 1WVZA 4NN5C 3WJJA 4JQVA 4K5OA 2N4IA 1C5DA 3GTVA 4N2FA 2MCAA 4UNIA 1JV5B 2ALWA 4FQLH 3VXSB 1FO0H 1RSFA 4PJDA 4X8JB 4ONHB 1NWPA 2IJ0C 1H3GA 1L4IA 4N2BA 3IDYC 5IT2L 3UTTD 3NABH 2JTYA 2R8SH 5FKAA 3FBKA 3OAWA 1M9SA 2UZXA 2DQEH 3FN3A 4LRNL 5HJ3A 2AEQL 2XQ0A 2J55A 5JW4R 5JPMB 2CIKA 2OXHB 1QVOA 1KB5A 1OSZB 3QRBA 5GS3A 3TYGL 1DBKH 4MXWL 3GI8H 2YGQA 5AWNL 3U4EB 3JSSA 4WNSA 1OT1A 5IMKB 2FWSA 4MJ5A 3R18A 5FYLE 5IJKA 4QT5A 3FNKA 3HS9A 3QUML 4JUSA 4AENB 3BE1H 4GO8A 4Y2LA 3W2DL 3N44F 1QBBA 3NIFE 1JMZA 3EAKA 3ZQXA 3T0VA 1A9BA 2WVUA 2E74C 3KL3A 4H0LC 3FFDA 3BP7B 2HFEB 4FG0A 5CKGA 2OA9A 4AM0A 5HHPA 3O6MH 5DMJB 4QOKA 5D4QA 4MCZA 2WB1A 1EXUB 2VDML 4FEMA 3STLB 3IDMB 1ZLWH 1FNLA 4I0PD 1KTLB 4MNHB 4CW1A 1AHMA 1OQXA 2XTLA 2WBWB 5ITFB 3C6LA 1E4HA 2DKSA 2OR7A 4KROD 1TJHH 1ZDQA 3V79C 1F97A 1J0HA 2QEJA 3NQIA 1R24B 2E7MA 2BC4B 3KL0A 4PJ5E 2IQ9H 3V7MA 2ZUXA 3NIDB 3C5ZD 2A2QT 4NJAL 1ZWIB 3QIBA 2QGEA 7PAZA 1SOQA 1CJYA 1AKJD 3UBHA 1TQSA 5JW4Q 3QAQA 3QW9A 3VG0L 1ML0A 1MHCB 3RAJH 3WY4A 2APBA 5F7UA 1ETZB 5JXEC 3RX5A 3BQVA 5IHHA 3ARPA 4K55A 1GJWA 2BSBA 1E4JA 1AHWB 3IDGA 3IU4L 1IAMA 1FVEA 5DD3L 2X0VA 5FW7A 3QDGA 3STZA 1UZ8A 3L5WA 3FXIC 1K2DA 2VUYA 1TUPA 4MAUH 4FD0A 3AS0A 1YEWA 2IPUG 2XV3A 3VWJB 4YZFF 3VH8A 4Q52A 3DGGB 3GRBA 5DUPH 4TQHA 2R1YB 1UYWH 4HC1H 1PL3A 4JFUA 4MXQC 4OM0L 5I1IH 2YSTA 2KS0A 4NN6B 4QIRA 4F5CE 3NSCA 4P57B 3V4VH 1ZTXL 4KMQA 1BA9A 3H9SB 1J9RA 4U4BA 1JNHA 4Y16D 2YQBA 1XL4A 4D9LL 2R2CA 4B3VA 1WC7A 1EMTL 1UOKA 2D03L 1SBSH 2C5DC 1Q1JH 1AR1D 2WIIB 4NKDA 1SNRA 2VLMD 3DSFL 4IBSA 3B9DA 2Z7YA 1G84A 4DUXA 3F5WA 1OK0A 3CHXA 4OIFA 3QGVA 1JF1A 3F7QA 1T2QL 3TX4A 3BSZA 4QXUL 3DHUA 4QJ5B 5F1OB 1BAWA 1M56B 1URZA 2MCG1 4F91B 4K3GA 3ROOA 3QHFL 5CZRA 1RZJH 2KQMA 1I1YA 3O4LD 2GBTA 4JM0A 5GRUL 2OI9B 2J5WA 2E27L 3WFEL 3QNFA 4OIIH 4D0BA 1DL7L 1U8QA 3QZMA 1G4RA 2HLEB 4NN7C 5I75B 3C8DA 3US9A 2X4SB 3CXHJ 1H3VA 1JPFA 7CGTA 3T8XA 4G7VH 3SPJA 1VZGA 5K1JA 5GGQL 3SE4A 3WEXB 2FX9L 1IE4A 5E1IA 5IEHB 2P3YA 1RZKC 1FFNA 1N4XL 1A02N 5H35B 2E9BA 1YHPA 2DWEB 4Q6KA 2RFXB 1BZ7A 1IGJB 4M6NL 3WHXB 5D5MF 4NM8L 4QXWA 2HA1A 4OLXH 3SB3A 4ODWA 3S34H 4RGNC 5I8CB 2VC2B 5D2LF 4HZ1A 5JQ6H 4OZFH 3UZEA 1WP6A 5DLML 1BZ9A 2Y7SA 3ULUE 3GRWL 1RVFL 4QRQA 4XPFH 2HB0A 4I1RA 1U8IA 1OHQA 1F90H 1JXJA 4WWID 4AK2A 3TESA 5BQ7A 5JXAH 1BIIB 5J0BA 1Y0LA 1LD9A 3QQ9D 3ABZA 1BQLL 4DVRH 2QADD 1K9TA 4DP7X 2FHBA 1CF8L 4LCWA 4MCYB 1S8DA 1AFVH 1W2KT 4FXGC 3CN4A 5HDQH 4L8SC 3O4OB 4HX1A 4IBQA 5ENWA 1QRND 3D4ZA 4WWKC 4OCXL 5BNXD 2JQZA 3ZMRA 2MOQA 3O3BA 3QPKA 4N8VA 1T1YA 3DVGB 1GZQB 1XF3A 5HI3D 1F4XH 2FBJH 5I16B 4RBPK 5KSAA 1MWAA 3EYFA 3LKSB 2NTFB 3QA3B 4LNRB 2YHGA 3G6AA 5DI8A 5D1ZD 4Z78B 1M7DB 1RP9A 3K71A 2ZWLT 2V3DA 1KNOB 2YLHA 3IMWA 5B3JE 4L1BA 4PJIF 4LSRH 4AW7A 2PUQT 3BRDA 1R0AH 1IRAY 4OQTL 3LH2H 1TVBB 4BK5C 4GSUA 5C07E 4JVPA 1E4XI 2NOYA 4YFLF 5I0DA 5INDA 2JKRM 4QXGL 1ZT7A 1Z0MA 3MRHA 1U8HB 4HIPA 4KITB 4AIOA 1VACB 4KTYA 4LOFA 2FD6L 4MJJA 3GIVA 1F8TL 4FHKA 4Z77A 5I1JH 5DZVA 1J87A 1K8DA 2HTLC 3TBVB 2Z65C 5I6NA 4JRFA 4TSBL 4P9HL 5BV7L 2V9UA 4GAYB 5DMGC 2H1PL 4R6UA 2H4EA 1CPUA 5IVXB 3IGLA 4MB1A 5CUSL 1I1AC 2CO6B 2QSCH 4MSWA 1GIGH 4XAKD 2YBRB 1G6VK 4ZW8A 2CLVB 3BC9A 5KUMA 3X11A 1RZ8B 1UUNA 2L8AA 4LCUB 1BD2E 3TT1L 1N10A 3F6JA 2MPAH 1S5IL 3GHPA 1A4KB 4PG9B 5I18H 3BLPX 2GCYA 1IB5A 3ZL2A 4TSAL 2MNWA 3MRKB 1A3QA 3GS0A 1N5AB 3QCVH 4Y2OA 1QD0A 4HT1L 3TV3L 4JREC 4RWYL 1RERA 3DBXA 1BMWA 1NH6A 4N2LA 4R97C 2VSMB 4HJ0D 1WLHA 4K3DH 3TZVC 4NOFA 7FABL 1FZOA 2N56A 2IV8A 3Q6FA 2JJUA 1NUFA 2VH5H 4PGEB 1X7QB 3IN2A 2C3VB 1E3XA 3QEQE 3H4HA 4JZJC 4BE6A 3C60A 2EH8H 4OCSH 4JFTA 2YMXH 3PHQA 3QJUB 5E8NA 4BA8A 5DHYA 5IHZA 5H37H 2H3KA 3EKCA 1X5HA 1QTYT 2EEXA 4HV8B 2HJLA 3D0LB 4LCIH 1LO2H 5EH1A 1PDKB 1FNAA 2VSDA 4LPVA 3PWJA 3VRLF 2HTKC 4MD0B 4XBPA 4I0PA 1YEDA 1FGVH 4N8PA 3LNDA 2J2ZB 5F7MC 3BP5A 1T4KB 4H1LB 4YE4H 1M42A 1ET5A 2BERA 3FB5A 1FZKA 1HSAB 2NNXA 2YA1A 1H5BB 1N8OE 5EO0A 1C08A 1VHPA 2KZKA 4HAFA 3VJ6B 1SY6L 5TDOB 4U1NB 2XN9E 1IM9D 2KPWA 4M1DL 5E6ID 2EIKB 1AGDB 3S5YA 2VB5A 4GMTH 2EDOA 3EH5B 1G9MH 2XN1A 5JDJA 4YBQC 1AKJA 3DVNB 1Y1UA 1XBDA 2CPUA 3P2DA 3W11D 2H0JA 4ETQB 4N86A 5D7IA 1XMEB 5JPMC 4FC3E 1N59B 3GBDA 1A6ZB 1CGXA 1VGKB 2H32B 3NCJL 4WU5B 1PYWA 2UY6A 3CSBA 2SEBA 3VNYA 2HP4A 5A2JH 1BQUA 1BV8A 2VKWA 1RPUA 4D94A 1RU9H 2YOCA 4O5LL 2MFNA 5BS0B 1GOGA 3UERA 4XPTL 1P4IH 1U8CB 2APVA 5HHOE 3L3IA 2VYRE 1URIA 4WUUD 4J4PD 1V7NH 4R7NA 3GSXA 4MFHA 4R4ND 3BD4A 2AJYL 4MB5A 1XTLA 3UTSD 5ITBH 2VZVA 3MV9E 2NY4D 4PJDE 1BP3B 3N2JA 1J8HB 5ACMA 3FQYA 2VDOH 3ZSTA 5BOZG 2ZUYA 3BGMA 4Y16A 2ZJSL 3T3PE 4DO6A 3LNIA 3KWWB 1A6VH 2N59A 5FO7B 3AXHA 2ESVD 3GXDA 1PJWA 2VMJA 4LKCB 3WKPA 1P4UA 4Y4HD 1ADQL 3KGSA 3QE5A 1J11A 3ZQ9A 1J5CA 1AXSB 2GJRA 2Y7MA 3BKYH 2FDBP 4QHMA 1E0OB 1J0YA 2GUYA 2VJXA 3CSGA 3OPZL 3UBXA 3DX8B 5FIEA 5C0RH 3P3TA 2WLYA 1WCBA 3UROR 4Z8FL 2R9HC 2PWHA 3ARRA 1AG6A 4WV1A 3HZYA 4CVZA 1BZEA 1IAII 3GS4A 1Z2KA 3UH8A 3OX8A 4JS7A 2DLTA 1WIUA 4XNMB 1SZNA 3MBWA 3HZKA 1XZ0A 3LHAA 4UQDA 5BJTA 4H2CA 1MLCB 3TFBA 4RDBA 2F7IA 3UJIL 8FABB 1GHFL 2QPSA 1AZNA 4PJHB 2H8PA 4Y1AD 1AHWC 2JF1A 4QOKE 5DRWB 4HZLA 4AYEC 2JJTA 1ZIBA 2APTA 5EO9A 2X6UA 4DP9X 3HNTH 3WFCH 4LLDA 3AVEA 5F8RC 3EFDH 1DBAL 5CEYA 1TTRA 4PVMA 4P9MH 1MDAA 2QPEB 4OIBA 4J27A 2AJVH 5DUML 3VWJC 3APDA 4ZS7L 3WO4C 3IJ7A 3UXFA 3FB7B 3LIZA 4K94L 3ZGIA 1E27A 4NN6C 3REVA 4JFFB 4P5TB 4CVWA 4YHLL 1DQKA 3DTXB 1S7RB 1TQBC 5T5FL 2J1WA 2EDNA 4LLYA 1J1PH 2HWZL 4DERA 3D39B 3TJEH 3FQNA 3H9HA 4FJ6A 2A9BA 5DD0H 3ZT6A 3I9IA 3CBJB 3VX1A 3FH5A 5AENA 4O02A 2GT9B 5E1HB 4FQHA 1IC7L 1PZDA 1AO7D 4WUKH 4RNRA 3EDKA 2Z93A 5K9KA 1KDIA 5A2BA 4UILL 1CFVL 4PJCB 4Q9CA 1NKOA 1JWUA 3QDGE 1MCNA 3Q5YA 4LFHG 3DETD 3MA7B 1KCSL 1NCCL 1RK1B 1QRNA 5DQ9B 3VXSE 3AT9A 2IWGA 4N9GB 5JHMA 4HUXB 2W9DH 3LV3A 2YAMA 5L9DL 1EK3A 5FAAA 3H7BA 3KBEA 1T21B 5KN5B 3RWEA 3T6WA 3EH3B 2VXSH 2AK1H 1U2YA 3L3DB 5ILTH 1YDPB 4TUOB 4U33A 3LNGA 5D1ZA 5E2VL 5I75C 1QO3B 1RUAH 1Z1WA 2A6JB 3QCTL 3VRJA 2QPFA 1XBRA 4NKMB 5EOQH 1MELA 3MLUL 4H8PA 4OLUL 5BXFA 3NIGF 2BWDA 4JCMA 5LBSA 5J6HA 5DUBA 1MEXL 1XF4B 2KH2B 2YEVB 1O7SA 2FJSA 4ODXA 5D71H 1EAOA 5FGBC 4BD4A 4ZFZA 4HAKA 3APFA 3HZMA 1QSFD 4TPRL 4YK4B 4NZRH 4XI5D 3NIGB 3BYTA 1Q4NX 3AROA 3VI3A 2B3IA 3N41B 1R3JB 3RWFB 3WUWA 4LHUD 1J5OL 2IG2L 2NSXA 3D7PA 1HI6A 1ORSB 3MLYL 3UAJD 1QLFB 3LQZA 5CIPH 1TZHB 3ZPDA 4QXTA 5E4IA 4JO5A 3SE3C 1G7PA 1QNZH 1FL5A 1U58A 2VC2L 3QUHA 4BV1A 5DVPA 4Z3EA 2Z1PA 3X3FH 4XOBA 4GLRH 4KKQA 5IFAH 2BH0A 5HPOA 2FT8A 5D7LA 3EDEA 4U7KA 3O4OC 3QJRB 1PG7W 3KE0A 2WMPA 1C5BL 2O72A 5IB2A 1U8PA 1X5ZA 4TLSA 5C0BD 1BOYA 1OXYA 1S7WB 1TCMA 3O3DA 3WY2A 1BEYL 3ZTDC 2UV3A 3UGEA 4TRPH 3T4AB 4HFWB 4NRZB 3VFTB 1D9KB 4YHIA 3OKOA 3ULVF 3AT0A 5HVFB 3DIFA 3LPPA 3GSUA 1FN4B 3OC5A 5D1ZI 2XXCB 3QHZL 5AZ2L 3PWPD 4G71B 4HIXH 2NY1D 3ZIYA 5INCA 4UBDC 1Z9PA 5I8EA 3Q44A 1D5ZA 4V2CB 1VENA 4HKXA 2IOIA 1UWGH 4KI5C 4L8DA 3UTPE 3KPNB 5L2JB 1VPOL 2OV0A 12E8L 2VR5A 4YBHA 2WP3T 5KBLA 5F96H 1OARL 3GMPA 4LCWE 3SOTA 1R5IB 1MVFA 2P45B 4UZUA 3RVXD 2ED8A 4NQXB 2NNRA 4WHCA 1E42A 1ZT4B 1CL7L 4XR8C 4JDVA 4LL4A 5E5LA 3TIDB 2KPNA 3GMRB 5JYMA 2QGBA 4A38A 5MENB 1W0YT 2AJXL 3H9SE 1KXQA 2WCPA 2HPOA 3V9FA 1BSIA 3CX2A 4RMRA 3NPZB 5AW2B 2R0WH 1KJ2H 4YHNA 2OR8A 1IM9A 4HQQH 4K73A 4GRMA 2YAEA 3RP1A 4R4FL 2YQGA 3TJHC 5CLWA 5KJ7E 1SOSA 1QA9B 1I1RA 3IWVA 5LCVA 4GIPD 2B59A 5HY9A 1ACXA 4AT6B 2ZUSA 5F88A 4JLRB 4YEEA 4GKSB 3HLKA 4FA6A 5KVDE 4XNXH 1U8LB 2GUOA 3CVCA 2Q8BL 2A9NH 3B37A 1HT6A 2J72A 3DTUB 2Z0UA 5CFHA 2K7PA 2G60H 4DW2H 4FFYL 4JPIB 1KTDB 2VDPL 1E8WA 2FH6A 3SDCD 4WUUA 3CFCL 3DK2A 1HOCB 4J4PA 5EG6C 5F7FA 1IKFH 2YKKA 5DJ2A 1FL3B 1OAKH 1S9VB 1INEL 2AZAA 3NCMA 4GI6A 3UTSA 5I1AB 1MLBA 1P5UA 3PWVA 2V2WA 1MOEA 3HLAB 2NY6B 4HD9A 4NKIH 4RRPM 3J2PA 3QK0A 3R8BB 1A6PA 3DO4A 3P73A 3F58L 2XZCH 3UTTE 1H6EA 4MJIA 5IESL 1X4ZA 2P80A 3SCMD 3TCLB 2V3FA 4ZUTA 1SGKA 1XCQB 1N67A 3TEUA 5IV2B 4Y4HA 1R75A 4U3CA 4KHXH 4MLSA 5D7JD 1H5BC 3H2WA 3MBEB 4KMLB 2I5YH 5JNYA 3VGHA 4HIHA 1MW2A 5DS1A 4HCRL 4XO4A 2BRRL 5HYQA 1PVHA 1S3KH 2FLMA 2ATKA 1C5CH 4QRAA 4LSQL 1HNFA 1T1ZA 1TENA 1WEJH 3AU1A 1YEJH 4K3JL 3RVUD 1EAPB 1UM4H 5C86A 3TBCA 5L8LB 5CMAB 3TO4D 3ZTNL 1EJOL 1GR7A 3HR5A 3MCKB 1E6OL 1TSHA 1A65A 3BGFC 4GP5B 3MGOA 4A68A 25C8H 4LLUA 4OJAA 4Y1AA 5IB3A 5LVEA 3CBKB 5FO9A 4QNPF 3CU1A 4PWEA 5AD0A 1JHKH 5T1DL 4XPBH 1DO5A 3H3PL 1XGRB 1B9ZA 2GC4C 4LSPH 4A6YA 1Q9WB 3F8UB 4UYPA 1FFOA 1KCBA 2QADC 4HPOL 2Q2LA 3TN0D 2HVKA 5EOTB 3Q2LA 3NZSA 1HIMH 3FB8A 1RIHH 3FJTA 1CD1B 3BOVA 2CIIA 3KPSE 5BPPA 4MJHA 4LP8A 2KKQA 4LSUH 5E00A 3WKYA 2AQPA 1FV1B 3L13A 2BWIA 2YK1L 5FOJA 1ZGLB 4FAAB 3IMTA 1MXDA 4AUUA 1VEMA 4NPYA 4GKNA 3MRDA 5D7IE 5BOJA 1Z32X 2PPDA 3TBYA 1AO7A 2DI9A 5KVGE 4UTAA 3TS8A 4WAFA 5FKPA 3I9PA 4ZMOA 4L4VD 1A7NH 2EDEA 4EJ1C 2DMKA 2AV1A 1UD8A 3FN9A 1LGVA 3OMIB 3PWLB 2PR4L 5CSZB 4JFQB 3LRGA 4XB7A 5IQ9B 1T66D 1M2VA 3QFDB 3EJJX 1R3HB 1R9FA 5IOKA 1LK3L 1T3FB 4QRUA 4EO5A 4E0RA 1QW9A 3PF2A 2ROYA 5ANHA 5CBEB 3PHAA 4Y9EA 5B38A 2LLLA 3CVHA 4XP4L 4ZMZA 1V5JA 2RQ8A 1UWEH 3KYNB 3PXHA 3T6XA 4HSQA 2FL5B 4GG8A 5LGYA 5JA8B 1RUQH 3SPVB 2XG5B 1JZDC 2YD7A 4NQDB 3AUVA 2EYTA 1D6VH 3QJFA 4I18A 1MCIA 3BPOC 2ZYIA 4PRBB 2VLME 3O9WD 4ODTH 2G9HA 5AQ0A 4ODVH 4D9RD 2FATH 3LEVL 1QSFA 2EUVA 2XKUA 5CGTA 4P5TC 4JG1H 4ACPA 5A6MA 1SBBA 3HVNA 4MDIB 4U7SA 4QD2E 2H45A 4LHUA 4WY7L 3MLXL 2HXAA 5HDBE 5A3ID 3UAJA 4XXCC 3REWB 1GZPA 2WLZA 2Z0BA 3BZFB 1O6TA 3O4LE 1JUFB 1GH7A 2R59A 3HE7D 5FK9A 2YGNA 1JWSA 2ICWI 1JD7A 2UWEF 3EFFB 3A0OA 1B3JA 2WWKT 4ZMAT 3KJ4B 4MQ7B 3KPOA 4Z76A 1MFBH 1RY7B 2R56L 5KVFE 1YYCA 1CE6B 3II2A 3EBIA 4G9FB 2PCFB 2WTRA 1FCCA 1CLOL 3GUTB 1MIEL 3EJQA 5TE6L 4PGDB 4H26B 4P46B 5IJVA 1B0RB 5CGMA 5DT1L 35C8L 5FUOH 3PWPA 4E5XA 4BKSC 3Q2CA 3VXOA 2CAKA 3I9GH 1FFTB 2K0RA 4DGIH 4JFXB 3RTQB 5BS0E 1LMKA 4UU9A 3BPNB 2ORBL 4LSSL 4JPVH 1IFHH 4G80A 1U4EA 4AIZA 4LLVB 4Q4EA 3QNZA 1IEHA 4J2XA 5EF2A 1JHTB 4YK4C 4XVUC 4WSKA 3V6OC 4PP2B 2VR8A 2DS4A 1QRNE 1WITA 5HHVH 4OT1L 4O4YH 3WD5L 3KDPB 1PZBA 1E9OA 4KY1L 3FQXA 2VQUA 3CSYA 1LK2A 4J5VA 2F7OA 2J21A 3FCUB 4FQQA 4LT7A 5J1SC 3P0YL 4FG6D 2P24A 5AZEL 1KIUA 3BISA 4HH9A 1OIOA 2NQDA 1CI5A 4FNLL 3G7TA 1HEZA 2PABA 1BM7A 4EN3D 4X6BB 1OV8A 5BO1L 4NQED 3O6KL 1JZIA 3FK3A 1AIFA 4TQIA 3QZNA 2VDKH 5B3SB 1KIRB 4J3VA 4IOIA 5I26A 1T7ZA 1INDL 1D9KC 4YE0A 3U6XA 5E8OA 4OGXH 1QR1B 2R23B 1HXKA 5I1GH 5DVNA 1RK7A 5CZVH 3VI3E 4L37B 3EOYG 3ZHFA 3KDMB 5I6MA 3SDCA 3TEWA 2CHWA 4PJHE 3NZUA 3F7PC 3SY0A 3BAJA 5DEJA 2E8ZA 3RY4A 4QRTB 3DNKA 1I8KB 3LCYA 2VJ8A 3QXDA 5KYNA 1KLGA 1T80A 3L16A 4YAQB 4YSAA 1UWXK 4IMKA 4FDWA 2BP8A 4Z6AT 2R29L 4G3YH 3ULVL 2XWJB 5ISZD 3CUPB 2B1HL 1FNEB 1P69B 3GJFB 5TFSH 3D2UB 5TGBA 3SCMA 2YOAA 1DVFB 3CFKA 3OKDA 3O6FB 5CS7A 2IBZY 4JFFE 4U3SA 1G9HA 2IQAA 1LO0H 1OT4A 1KYAA 1OTUC 3VQLA 5D7JA 4N2OA 1IGIH 1MNUL 3L4VA 4JM4H 4HUVB 4MKMA 4XBGB 1UKQA 3MNZA 3ZT7A 4DKTA 2ZCLL 2LLNA 5EUKA 1NBVL 3MFGB 1MHPL 5T3ZD 2F7RA 2V5RA 3DX4A 4GBXB 3ZTCC 2VLJB 1D5XA 1YY9C 1P6WA 2ZAHA 3KXFD 1A6AA 4TMPA 4OD2B 1Y6KR 4BFNA 3G5XB 5AKSA 3TO4A 1OF2A 4A2LA 4QRSA 1TTFA 3Q2VA 3RNQA 4ABVA 4KJQC 1S4IA 3K1DA 4HWEL 4KZCA 4Q4IA 2AQQA 3F7VA 2A38A 2Z91B 2Z4TA 4P2RD 3BZEB 4OUUA 3CK0H 4ZSOA 1DJIA 5CBAA 4EI5D 5E23A 2E7LC 3QZWB 4H0HB 4B0MB 1HWGB 5HI5C 1G4MA 5IF0B 3TN0A 1ID2A 1YYMH 3SOBL 4RFOH 1CI3M 1KXQE 4EOWH 3WN5A 1OCCB 2G30A 4LF3A 2NY6C 2LOEA 1MFDL 2APXA 2MCMA 4LGPB 4APQD 2ZYRA 4Z7VB 5KBDA 4AQ8A 3H54A 3G5ZA 4OGAD 4XP9L 2FEDC 4FJZA 4OZHF 1MVUB 1OWWA 2A74A 2NSQA 4J12A 3OD3A 4G8EA 3U4AA 1ZMYA 3ARTA 3GSNL 4ZFOB 4PJ7B 2IMMA 2IH3B 2FGWH 2H26B 5EU3B 1QBLH 4DGVH 2XC8A 5K9JL 2X87A 1CIUA 1S5HB 3MBEC 4MDJB 4KJPD 4OB5L 4P3WA 4LPYA 4XN5A 3SPCA 4U1JB 3CFJA 1UADC 4W81A 5AOLA 4XC3L 3N1FC 4HF5H 1KBGH 2X9ZA 4L4VA 4MS8D 3WE6B 1UJ3B 4OCRH 2YSSB 3FT3B 2CDGA 5DJYA 2QHLA 2D2CC 2NY0B 3SQBA 1RUML 4B60A 5I1KL 4KZDH 3P4MB 4WUUE 1GS6X 4ZMWA 3FTWA 5IJCC 3WNLA 1OL0A 3T65B 2VXQL 3HFFA 1DEEA 3ZN6A 3PCYA 1U3HD 1S7XB 3UTSE 1SYVA 4L5FL 1CFQB 4WVRA 3U46A 2X4NA 2ZXGA 3KVQA 3U9PH 3QIUB 3K2MC 5TDNB 4TLTA 4J28A 4AYDC 2GEQA 3Q48A 3QUMA 4K07A 2B4CH 2Q8AL 3O2VL 4HA1A 1KN2H 3FRPB 2FO8A 4EIZC 2ESVE 4XCEA 4WJ5A 1WAEA 5IW1B 4XCYB 2EILB 3X12B 2FTAA 1QFWL 3CNKA 2W60B 4Z7UE 3MLSH 3O9WA 1ULVA 5IKCB 2X70A 2BNRB 1GTFA 2DF3A 4XVSH 3SDDD 2HUEA 3WAJA 1B6DA 4BSJA 4C83B 4PFEA 3N42F 2HKFH 4B50A 3GXFA 2K1MA 4NQQA 3L4CA 5FUZL 3LZRA 4JFPA 4NO0D 5ICXA 5FYJL 4KH2A 3EJZC 5T1LB 5AAWA 3MPCA 1SXCA 4R90H 4XB3A 2DQGL 1IE5A 3PDGA 3O41A 3PDOB 1JDAA 1YEIH 3HE7A 4TUJB 2NY1C 2AXFA 3E2HB 2MPVA 3WFBL 4JDEB 5KSBA 2W0FB 3U79A 3AUWB 5JIHA 2F58H 1DBML 4X6DB 4MYPA 4HFUL 3A4AA 3AAZB 1HCZA 5AW0B 4C4BA 1HHHA 3IWUA 4NAJA 4OFIA 2V5YA 1BOGB 5D7SH 4FMVA 2WXIA 5LXGL 2EE2A 4OLVL 1A22B 4YWGH 1QWHA 5C0DB 1TQWA 1ACYL 3NEEA 1L7IH 4V1DD 3VXTA 4EIUA 1AQMA 1PLBA 5B39B 1YRKA 1XAUA 3DLQR 5E56A 5TTRA 5H94A 3M46A 1PX8A 2QVIA 1WFMA 1IKNA 2UYLA 2IFGA 1J0JA 3VWKD 3ZDYB 4W9EC 4PBXA 3WIIH 2Z7WA 4C4KT 1YAZA 4E9LA 3B2UD 1LE5A 1GYAA 3LKQA 1UGKA 3RIKA 1AE6H 4YIQA 3OJMB 4FQXB 4Z7QF 2O6FA 2F1EA 3PWUB 1LEIA 3MUGA 1CDGA 1OB1A 2J88L 5KSUA 4BZ2L 4GRWF 1YEKL 4UM8B 3JWNC 5AOIA 4OCMC 1K8IA 3T77A 5L4MA 3TA3D 3U30B 3U7YL 1H19A 3OJVC 4XCFH 5EN2B 5I1EL 5C0CB 3K4AA 5G4OA 2D7TL 3IRPX 3PP4L 1RUKL 3U0TA 4X6CF 3CPLB 3WEOA 4PJ9D 4LXFA 4KKZA 2RA1A 1DVSA 1DN0B 3NFNB 4X9YA 4J3BA 3WTYA 1NINA 2AS5M 3BKMH 3KJ4C 5CEXB 3FH8A 5FCSH 3KWXA 2YPKA 3RKDD 4LCCB 2NYYC 2QQNL 1H6UA 4BSVA 1HINH 5BW7A 3HC3H 4EN3A 4WDIA 4NQEA 4I9WD 2F8IA 1G7HB 5SX5H 4XNQB 5TE4H 4HP5A 1PZAA 5DGRA 4P46C 3IKCA 1A6TB 1KJMA 2G5RA 4DT2A 4JHZA 1CR9L 1YAIA 2DWTA 2VQTA 2EKJA 3JZYA 3MJ7A 3ZE2B 4KK9D 5D7EA 3VFMB 1M05A 2AABH 4YSDA 2I9LA 4FJYA 5JIQA 1S7VA 3QJHB 2J8OA 3QFJD 4FFZL 3FU9A 2AF2A 2Q3ZA 2UX6A 2YO3A 4NHCH 3K6DA 3RTQC 4KDTA 1NFDA 5I0XA 1J9SA 1Q0YL 2CGZA 2OMVA 2X1PA 4FMFA 3SJVA 4DN3H 3V4UL 5IHWA 1NMAH 5L7XL 2CLZA 5F7EH 1A2YB 4PY8J 1MIMH 4YDJB 3SGJA 3CMGA 4DK3A 4OI9A 3NPSB 5ISZA 3H6AA 4NQCB 4BQ6A 2BOBA 3FCSB 1ZT1A 2P49B 3K8MA 4QR7A 1L0QA 3ESPA 5EZLB 4UNTA 5CAYB 5JO5A 3GRWA 2XFXA 4NO3A 5C0BE 4AYID 5GXBB 3Q8CA 2DQDL 2PCPA 5IQMA 3MMEA 3UG3A 1LM8V 3I2CL 1GSMA 4H8WH 3QDJD 3O3AA 4AL8L 1JGEA 1U2HA 1RIVH 5GGVY 2ZE0A 2CRMA 3HNSH 3MVSA 5GPRA 4Z5RA 4DEPB 3OAUH 1UOWA 3FTUA 3MV8D 3IJ8A 1XXDC 3GK8L 1K4DA 3PWPE 2PYFB 4WEUD 5D4IA 2BIPA 1WRFA 2Z8WC 3LRSB 2DICA 3KXFA 1I7RB 1IM3B 1FYTB 1S7TB 3BT2H 2YKLH 2WUCL 2CK0H 2E7HA 4HPHA 2CCWA 4Z7NB 2EXSA 4UMGA 3DA0A 1BM3H 4ZQKA 2Y4SA 4WWKA 1JPSL 4GFTB 5LQBH 4U1LA 2WXOA 2LQRA 4QRRB 1WV7T 4L8BA 4LGRB 1OB0A 4P2RA 4RWHA 2BVOA 3TTYA 4YXKL 4EI5A 2ITFA 3GMOB 1JNLL 3LKPB 3PFUA 4UM9D 1CLZL 4KTEH 5DVKA 4OQTA 3F7YA 1BFVH 5IVNA 2J6EL 1GY1A 1MQKL 3QDMB 1WT5A 2TRYA 2GB2A 4UQ2B 1GC1C 5SX4H 4L3CB 5GHWH 2OCFD 2QDVA 1KC5H 3ETBJ 4NQDE 5DGQA 4APQA 3WLBA 3IFOB 4JKMA 1ONQA 3RILA 3GNML 5EBLB 1SVBA 1DVFC 1PTZA 3CC1A 3O6FC 4S1QL 2YPLB 4AYFA 1CGVA 1TU2A 3NSFA 4UUJB 1USQA 1U93A 2F7QA 3TNMA 2PW2B 1VADA 2V17L 4WKZB 4BH8B 3SYCA 1P4BH 3LEYL 2KUTA 4XN2A 5K9OA 2ZWKA 3W9DB 5BMFL 5FYLH 5C0NC 5I76A 1NGYB 1X9RA 4FQ2H 3DV4A 3KYMB 3MBXL 4BFIB 4GBXC 2GJZA 5KG9A 3RL1A 2ZX8A 4JZNB 4MVBC 3BUYA 1U3HA 2AHIA 5EDXA 3RFZA 1KEGH 2BFVL 4U1SB 2N7SA 4NQSB 4ONGL 2O5NA 3T6QC 1Q0XH 3MODL 1JXDA 4KKAC 4KVPA 1T03L 1QPKA 1NMBH 4XT1C 3T09A 4ES9A 2C3WA 1KENL 1MCLA 3GLDA 5JIIA 4H1LG 3MLVL 2IXQA 3S3DB 2FQFA 4RZKA 3RBSA 3SQOL 1MCQA 5I17B 1JYNA 4GEJA 4LPWA 2GW5A 5FLUA 1J9TA 4LZKA 4B7IA 3TZVA 1SJXA 2IPKB 1SEQH 3PPEA 4OJEH 4OFPA 1JXKA 1O6SB 4JANA 4JN2A 5EU6B 4JM2B 3C5XA 4BXSV 3GXUB 2CBOA 2YR3A 3ZDXF 3CZSA 5C9JB 2H0EA 1MCCA 2NXYD 1RQ5A 2DV6A 3GHBL 5DJ6B 1SY6A 4XBMA 3VXUD 1I8IB 1N7MH 2D4DA 3VW3L 2O5ZL 3LS5L 3VXNB 1TQTA 2C1OA 4OF0A 4K3EL 5KOMC 3BQUD 1L7TL 2WNGA 1UJ3C 1F1DA 4POZD 1BAFL 3QRGH 5B4MD 2NY0C 5F3FA 3B9AA 3QI9B 1IC4L 2FRGP 4U1KB 3EJPA 4GXUM 3OF6D 2EH7H 4N2IA 4JE0A 2W88A 3QXWA 5CEZE 1SYSB 3LXCA 4V1DA 3S98A 1OKEA 4FFWC 5LJYH 2DLIA 3ARSA 5F3BB 3E6FB 4AX3A 5J5EA 3S5ZA 3QIUC 1UA6L 2VM3A 4LSTL 3WIHL 1BBDL 3VD2A 2AJZA 1JGLL 1M6OB 4XHJD 4HLZG 1IJ9A 2OXHA 3VWKA 3ARFD 3F64A 5EZIH 3U82B 4PYGA 4N3TA 5DZNA 5C0IB 5CINL 4AH2A 1FLTX 4NJ9L 1JGIA 4X7SL 5B7MA 5K59F 5HYSB 4AENA 2C26A 4OLWL 4G1EA 4FHJA 4RVBA 2JELH 3VSQA 1XD0A 3CFUA 4TQEL 2O61B 3NJGA 4FCAA 3EGXA 4JQXA 4ALAH 4KZEH 4PIBA 4EMZA 3ES6B 2Z7UA 4KDWA 4UT9H 1X3DA 3GB7B 4G5ZL 3VXRD 5IGXH 4W4OC 1OPGL 2YD4A 1ADQA 3PHSA 3GDCA 1YMMD 5JOFA 2ITEA 4PJ9A 3IMBA 1JRHH 5E2TL 1E7VA 1SHWA 2HYMA 4ZTOL 4P5MA 8CGTA 3EBGA 4ZPVA 4X6EB 1R24A 4ILDA 2BC4A 1WFOA 1OTSD 1CN4A 1YNKL 1OO2A 4N68A 5DO2C 4HISA 4N8CL 5JDSA 1NCDH 4EVNA 2VN3A 2A6DA 4RBPH 1AJ7L 2VLJE 4EDXA 4X4YA 3GXIA 3OQ3B 4HK3N 5GSRA 3ABGA 1AZCA 2C9PA 2EXWC 3MRFB 1MAJA 4P59H 4PJAF 2KLRA 2M26A 2RCSL 2CDFA 2WPGA 2VLKD 5KS9B 1OD9A 1NPJA 4KHTH 3ULUH 3QFJA 5I19L 1NCBL 1CDJA 4FQJL 3QNXA 1CK0L 4WFHD 1HHIA 4YHPA 4FQXC 4B9GA 3RWCA 1XR9A 2APSA 3D05A 5KSBE 2R1WB