4DP5X

The 1.88 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 8.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp5X00
1DYZA 3WKQA 1IKOP 1NPJA 2I85A 1XB8A 2CAKA 4A68A 4G72B 2WO3B 3T71A 1ZIAA 4G7RB 3X1NA 2JKWA 1E5YA 3NJFA 5IY5B 2ZOOA 2XVBA 3FS9A 4QKTA 1KV7A 5I5IA 2IWEA 2BHFA 3CG8A 3NT0A 1DZ0A 3QPKA 1N70A 1AOZA 2PP8A 2EIKB 2BP8A 5EHFA 4UAHA 1J5DA 3FPXA 2GBAA 2TSBA 3H4HA 2HZHA 3TBCA 1AS7A 1WAEA 1KYAA 2CUAA 3S3CB 2AZAA 2BP0A 4DP6X 3FSAA 4DPCX 5B1KA 4A67A 2YAPA 1HAUA 3EF4A 1HFUA 3AW5A 4BXSV 2EIMB 3DKHA 2FQGA 2XX1A 1L9OA 2BZCA 2CCWA 3PAZA 4AKPA 2PP7A 3EH5B 4E9WA 1AR1B 1OCZB 4UF7C 2FQFA 2IDTA 3AG1B 3HB3B 3OQRA 4A2DA 4KOBA 5ANHA 4HAKA 2P80D 2YARA 4YSUA 1SDDA 1EZLA 2VSMB 4HHWA 4DP4X 1MG3C 3TBBA 5I6LA 2BWIA 2HX9A 1AS8A 1E67A 1OOWA 2X87A 2Y1AA 1CURA 1AZBA 3NJKA 4A66A 3CDZA 1PNCA 2Q9OA 1T5KA 4L0PB 5D4IA 2J55A 3T6XA 2BP8B 3WNJA 3GYRA 5B1AB 2YXVA 1GR7A 2XXFA 1WA2X 3NSCA 4KO7A 4YL4A 3S8GB 1ET8A 4YSSA 3FQ1A 5A7EA 2PP9A 3FSVA 4FA7B 5TK2A 2GC4C 3L45A 4W1TA 1NINA 1KCBA 3ASNB 1E65A 1SHXA 2YQBA 1A3ZA 1AIZA 1ZV2A 2WO2B 6PAZA 2QT6A 5FC9A 2EILB 1IUZA 3ABKB 1SF3A 2XX0A 4PAZA 2IDSA 1CYWA 2PPAA 4KNTA 5B1BB 5LDUA 1E5ZA 2BW4A 2DYSB 4MFHA 3V9EA 2ZXWB 3IEAA 4DP5X 3ZIYA 1JZEA 4QLWA 3MX0B 5I5MA 1ADWA 4GP4B 3JT2A 1ASOA 2PPCA 1V54B 1ILSA 4GP8B 3KW7A 3ABGA 3FU8A 3OM3B 2DWTA 2H5UA 4A2EA 1VLXA 2R7EB 1CYXA 2OCCB 5I6OA 4ENZA 2XV2A 2FNWA 3T6ZA 3QJSB 4NB7A 3UAEA 8PAZA 3SBPA 1GS6X 1RZPA 1OF0A 1RZQA 1R1CA 4HCGA 3N55A 2YXWA 5B1JC 1ASQA 3ZDWA 1NICA 3TA4D 1RKRA 2GI0A 4KO6A 4G71B 5I6MA 1JZHA 5E9NA 3QJVB 2GSMB 4YSAA 2IWFA 3EH4B 2YAFA 1ET5A 1SDDB 3NSDA 2XXGA 4AKQA 1KDJA 1TU2A 1PZCA 3X1EA 2N0MA 1NTDA 2GHZA 3PXLA 4GP5B 5B7EA 2XLLA 5F7BA 2Q5BA 4Q89A 1M9WA 1GY2A 4HALA 4DP8X 1ZIBA 1OV8A 4F2FA 1PAZA 3QQXA 4GXFA 2QDVA 2DY2A 2FWLB 2PPDA 4DPBX 2BW5A 4YSOA 1ETJA 2NRDA 2UX7A 4A2GA 3FSWA 1NIBA 4DP9X 1ET7A 2IDUA 5I6PA 4UANA 1E30A 3ZBMA 1KGYE 1URIA 2JFCA 2XU9A 3PPSA 1WS7A 4YSEA 3PAUA 1SHWA 2WSDA 4WKXA 2AFNA 3EH3B 2PLTA 7PCYA 1J9SA 1SFDA 2QPEB 3NJHA 3QJRB 3G5WA 4KOCA 1NIDA 2IWKA 1SJMA 5I5JA 1V55B 3NJNA 1BXVA 1BQ5A 4AZUA 4F7KA 4NAJA 4E9XA 1JXGA 1JOIA 1GS7A 4E9YA 2PPEA 1GY1A 3OMAB 1BYOA 2B08A 3CVCA 1FWXA 4DP1X 2TSAA 1EHKB 3FU9A 3S3BB 4G70B 2FT8A 2BP0B 4BDVA 1PZAA 2QPDB 4E9QA 3GXUB 3FQ2A 1IBZA 1PZBA 4YSQA 5I26A 2IAAC 3SBQA 5PCYA 2J57A 1QLEB 4DPAX 3FSZA 3GDCA 3T6WA 1MDAA 4JHVA 1AG0A 1KBWA 1PMYA 2CALA 3ABLB 4N8UA 2X88A 1NWPA 2RACA 4PCYA 2R7EA 1AAJA 3CVBA 3BQVA 1BEXA 2I7SA 3NYKA 1FA4A 4M4RB 1X9RA 1A8ZA 5B7FA 1JXDA 4YSCA 5AKRA 1ILUA 2H3XC 1AANA 1AS6A 1NDTA 2W8CA 1N68A 4JKNA 1NZRA 3AY2A 1BAWA 1WA0X 1OE3A 1MG2C 3FYIB 3NP3A 1KCWA 2YAQA 1M57B 3CZUB 1OE2A 1L9PA 4M3HA 3FPYA 5B3SB 3DIVA 2GC7C 3NSYA 1XMEB 1OE1A 4A2HA 1JZIA 3CDZB 4BDVB 3T9WA 3X2QB 4A2FA 2W88A 4GY4A 3CVDA 4F2EA 1OCRB 3IBOA 2JXMA 1JZGA 1AG6A 4N4YB 2OV0A 1A4AA 3UACA 2AANA 4E9SA 5F7AA 1RCYA 2XYBA 2VW6A 1X9UA 3IE9A 3OMNB 3PCYA 4Q8BA 4HZ1A 1PY0A 3UGEA 1GYCA 2HRGA 3NP4A 1JVOA 1CC3A 1AACA 4AKOA 2IH8A 4TXVB 3NJMA 4FAAB 1SF5A 5I28A 2VMJA 1HAWA 2VSKB 3S3DB 7PAZA 3NJJA 2UXVA 1F56A 1J9QA 3WNIA 1W8EA 5TK4A 2PCYA 4BXVA 2DV6A 5B7MA 4X4KA 4BWWA 3TU6A 2PCFA 3UADA 1NIAA 3IN0A 4W9ZA 4CSZA 4KO9A 1JVLA 3ABMB 1PNDA 1PCSA 1GS8A 3NJGA 2BWDA 3X1GA 1IC0A 1TKWA 5I6NA 1SNRA 1AZUA 3H56A 1L9RA 4HCIA 4DP2X 3PLYA 1J5CA 4AX3A 2DYRB 1YLBB 2FQDA 1WS8A 3EHBB 3MBWB 4G7QB 4HCFA 1GW0A 1JZJA 1ID2A 3SBRA 4HHGA 2I7OA 4EF3A 2HXAA 4DP7X 4NERA 3HEIB 1BYPA 2BO0A 2HLEB 2VW4A 1I53A 2E86A 3FYEB 1SFHA 1FFTB 2XV0A 2UXFA 2XV3A 3PAVA 3AG2B 4P5SA 3UABA 4ZK8A 2EIJB 5I6KA 1PLCA 3N2JA 2CBPA 4YVUA 1ZDQA 1B3IA 1QNIA 1L9SA 1JZFA 2FT6A 3FU7B 2HRHA 3FT0A 2PPFA 3TASA 4GYBA 1JERA 3C75A 2DWSA 2IDQA 1A4CA 1J9TA 3OMIB 1PLBA 3AG4B 5AZUA 2J56A 3OD3A 2J5WA 2QDWA 1GSKA 1NWOA 4CSPA 3SQRA 3IN2A 1AZCA 3UAAA 2YAEA 2HX8A 1AQ8A 1BQRA 2P80A 4AI7A 3V9CA 1J9RA 2UXTA 2FTAA 4KO5A 4YVNA 3NSFA 4BK5C 1QHQA 3QJQB 4YSDA 3BVDB 3S8FB 2GB2A 2FT7A 3ASOB 4E9VA 2ZONA 1M56B 1PLAA 3WIAA 4HIPA 3ZX1A 4E9TA 3FQYA 1ZDSA 3DTUB 3QJTB 1CUOA 1L9TA 1XB3A 2YAOA 3ERXA 3FU7A 2YAMA 2UXGA 1NPNA 1TEFA 5B1JA 3AG3B 2GIMA 2B3IA 2VW7A 4K9JA 1UATA 4G7SB 1BXAA 4JHUA 1KDIA 4WTQA 1TEGA 1OCOB 1NIEA 1AZNA 3WKPA 2VM4A 2Y69B 3U25A 2BZ7A 4YSRA 1A4BA 2AZUA 1XB6A 4YSPA 5AFAA 2AVFA 9PCYA 2UX6A 3X1FA 1WA1X 3KW8A 1KBVA 3QJUB 4P5RA 3T6VA 3WG7B 1JXFA 4BWUA 2H47C 1NIFA 2XWZA 1A65A 1BQKA 2ZWNA 1OCCB 1W6LA 3D12B 3WI9A 4BWTA 4YSTA 2VN3A 3JTBA 1MZZA 2CJ3A 4KNUA 2XUWA 2EINB 2YAHA 1IBYA 4KNSA 1PF3A 2MRYA 5D4JA 3RYMA 2IDFA 3AZUA 4RH4A 4E9RA 2FJSA 1AZRA 4DP0X 2MTAA 1W6WA 3NJIA 2HX7A 2FQEA 1MZYA 3H4FA 1BXUA 5PAZA 2OJ1A 1ASPA 6PCYA 5D4HA 1L9QA 2IH9A 2LLNA 2VM3A 3NJLA 3X1BA 1ZPUA 1V10A 2A3TA
chains in the Genus database with same CATH superfamily
3GM8A 1ORQA 3LHPL 3RIFK 1KV3A 1V3KA 3LXAA 2HH0H 1MF2H 1FL6A 4YAQA 4G7RB 2FLRT 1E9PB 4JKWA 4WI7A 4H0GA 2TAAA 1QUNB 3VFNB 2R0WH 4JREC 3UJJL 4XZUA 5KSVA 4LPYA 3VRIA 1R3IL 3QNZB 1QASA 2CRZA 1KPVB 3IGLA 1N70A 1PTZA 3N50A 1KEGL 1YEIH 2KPNA 3KNBA 1QVOA 4LPTA 5HHMD 2WTOA 4L4VB 4JVWA 1MCNA 2FWOA 4LASH 1S7VB 4AQ8C 3ZDZF 2HFEB 1BGXH 3T2NL 1RUML 3BJ91 3U1SL 3V5KB 2R69H 4MMXB 4N90E 4APXA 5CEXA 4K94L 1HL5A 3UX9B 4A67A 5CEXB 4GUPB 3MFGB 3COOA 1CE1H 2DL2A 1HFUA 3KYMB 4KUCF 4QCIB 2EDOA 4BXSV 4MMZA 3HB3C 3LZQA 2OMYB 1R0AL 4U1NB 4JFQB 3MJWA 3MREB 1QFWH 1YMHB 2MPAL 4JCMA 5JHAA 4MXWL 3F8UB 3RWIB 1LXMA 2R4SH 4ZSOA 3MRNB 1GZHA 3U7YL 2GEEA 2CNYA 1RIHH 4YSUA 2GG1A 4DVBA 1JWSA 1OZUA 4XE5B 3SDYL 4B0MB 4PJDA 1CI3M 4OAWB 2NY0C 5DJCB 3FTZA 3ZRFC 1ZS2A 4MA8L 4YZWA 4Y9BA 2IIJA 2QQKL 3KL3A 3L3OB 4IBQA 3TA3C 1JGVH 4OFKA 4JRYD 2XA8H 2VH5H 2VQTA 3H9HA 4YSSA 3DIFA 3AU0A 4FTVB 3IFOB 3KPOA 3NIDE 4PGJA 5EZLB 1JHTB 1X9LA 1SXAA 1JDDA 3D87B 5CGTA 1DN0A 4RFEB 4MAZA 4MAYA 3ULVD 1F42A 2ADIB 5D7KE 5D7JC 2F19L 4O51B 5I75B 4IU2B 4NQXA 5CP3H 3M88A 1N0LB 3A6CL 1YUHA 2XX0A 1S7UB 1P5UA 2XKNB 4EOWH 1U8KB 4KKBC 1PKQE 4NWTH 4XWOC 2BIHA 2OAAA 2AEPH 1MIEH 2PTTA 4UUJB 4PI2A 2ZXWB 5F21B 2JB5H 3V6ZB 4BUHA 3GSXB 3BYYA 2OZNA 3G6JF 3HHMA 3MPCA 4BHUA 1CQKA 3IGAA 1E4XH 1FL5B 1R3KA 3DMMD 5C08B 3VH8A 4I3SH 4LLDB 1YZZA 3ZT6A 4G8AC 4ZD3L 4AIEA 3HUJB 1I1YB 3BVNA 5J13C 4CNIA 4RGMC 3A6BH 1CGTA 1DVYA 3JBG7 4I1NB 4UYPA 2FIRT 3E2HC 8PAZA 1ZE3H 1UUNA 4N3TA 2XFXA 3P2BA 1CE6A 4P23C 1RZQA 1HI6A 3JWOH 5KSAB 2NLJA 4F24A 1MHCA 4WWID 2XJLA 4KVCH 1WZMA 1JG9A 5AVZB 4OLYL 4IGBA 3AQZA 1NICA 3UBHA 1U2YA 4DZ8A 4I85A 1Z0NA 3RUGF 5TQ0L 1ZLWH 3ISWA 2R56L 3KE0A 4ZMQA 4LCIH 4YBQC 4KITB 3EH4B 2XXGA 3CSFA 1AOHA 4JN2B 2GABA 4XN9A 4JK0D 2BSRB 1XR8A 4C4KT 5DJ0A 2FZ3A 1HHGA 3TJEL 3QUZA 2RJMA 3Q9QA 1MW1A 3MGTA 2MKWA 1GL4B 2Q5BA 1BQHG 15C8L 1BVNP 2MSPA 3EKCA 4OZHF 4PB9H 3R18A 3WO3B 3CN3A 4QT5B 4TSCH 3QQXA 3GS0A 2DY2A 3OPZL 1D7CA 1WEJH 4J3OG 3C2AH 3GHBL 1U30A 2OLDA 4LLUA 5E4EB 3WFBH 4BFEA 1BWWA 3BVUA 5EU6B 1QABA 3L5XH 1UQSB 2GITB 1W72H 1EJ6A 3V6BR 4ZX5A 4HUXB 3HIZA 2BSSB 3F7VB 5AL8A 3NCFB 1XF4A 4F92B 3CV5A 4H4NA 3FAWA 1BQHA 4DJMA 1A4KB 1J9SA 5K9QG 1NKOA 5BRZB 3QXAA 1AH1A 1JUFB 2O6DA 5TGBA 2I9LA 1TEYA 1NC4D 3MJ7A 3NVQA 5DS8A 2OMNA 5DMKB 2LU3A 3DTXA 4N3UA 4LDCA 1WZAA 2CUIA 3CX5K 1F13A 3S36H 4OZIA 1CTOA 5C0BD 3OHXC 3ZKQD 1P5VA 2BS8A 2QHLA 4PRBA 3L5HA 4B5EA 4U2YA 4R7NA 4MD0B 5IM7B 5IQ9B 5K59F 3US1A 4FABH 4YNYA 1EHKB 5BVJA 3DX9B 4BSJA 1HHHB 1F45A 1HU8A 2BOBA 4JREB 5BS0B 3LQZB 1PJ9A 4M3KB 3FUJA 4YNYB 1YAZA 4DQOL 1G94A 3N9GH 3KPLA 4PLKD 1QNZH 3RZCC 2Y2TA 4TVPL 1KC5H 1MWAL 2CD0A 2L7EA 4HIQA 5DRWA 1FFOB 3GRWH 4MMZC 2DQIL 2XY2A 4OGZA 4FULA 2O93L 2J57A 3HI6H 5C8JB 4WKZB 3WUZA 3WY1A 2XZZA 1PG7X 3SOBH 4YHIB 3Q1SH 2DWYA 4M8QA 5GZOC 2A74A 3KPRD 1AG0A 4AQ8A 1KB5A 3RFRA 1CG9A 5GS2D 4NZDA 1MFEH 5CBAB 3TC9A 3CVBA 1JXKA 2FYVA 1NAKL 1U42A 3DSFL 1ACCA 3QDJA 3NYKA 4RDQF 2K1MA 4KKQA 3FULA 5FDWB 2M8XA 1JXDA 1IJNA 3CFQA 2GI7A 2X2JA 3QIUB 3SY0B 5DSCA 5C7ZA 4BH7A 2X1WL 4Z76B 5FV2A 3RHWK 1UZGA 3EDDA 3GSWB 3QUHA 1F3DH 1YHPA 4NFBA 5KN5B 3PL6B 4LCYB 3SOTA 2ENJA 2H4EA 2HJFA 1J1PH 3G6JE 2YAQA 2XG4A 1UHVA 3GS7A 3H9SD 2AQ1A 3L1GA 2BCMA 4YFLI 3LNDA 4KX8A 1RUPH 2GBUA 4Z7QB 2DQDH 1D9KB 2WANA 1S9XB 3NFPB 1PG7L 4Z7NE 3B4NA 2FSEA 5C3TA 2VDRH 3KXFD 4HOMA 4PG9B 1XMEB 2R1WB 4JPVH 2IMNA 1KJ2H 3DTXB 4Y4FD 4QHNA 5J9PB 4PB0L 4KZDL 1EEUA 3OAUH 2F0CA 3ZHLA 1P1ZA 2B2XH 2MKLC 4K3HA 2X2IA 2IBGA 5JOEA 4JCWA 4K5OA 2LFEA 2P8LB 1JZGA 4QHLA 4NJAH 5FPIA 4UIMA 3T65A 3BN3B 4JJHA 1BOYA 5ABDE 3IM1A 4L0YA 3F6JA 5FFGA 1UXMA 2KERA 1GYCA 4HKJB 1NBCA 1NC2A 2GBTA 2A74B 3GMRB 3OVUB 1X7TA 1SJEB 4FAAB 5DUPH 3HI5L 4ZTEA 4WTXA 2W07A 5FO9A 3PJSB 4IHOA 2UXVA 3VQ2C 1JL8A 2CGRL 2VLLA 1PCXA 2OZ4H 2VR9A 4P59L 4MGXA 3FQ4A 2WZPD 1RSFA 1JYNA 4WFGD 4TL4A 1AVAA 1DSYA 4BWWA 2Z8WC 3M1CA 3UADA 3NAAL 1NIAA 3NFPA 5D7IB 2F5BH 4DO6A 4P3CH 1C16B 1RI8A 1BMGA 2FAUA 2VMDA 3D69A 3T6QC 5KBLA 3B2UC 2ZUQB 3THML 2R1XB 1XCQA 2PO6C 4GAJH 1E8XA 2H45A 4XH2A 5JIMA 4K5LA 2GSIA 3EHBB 1NCAH 3O0LA 4Z76A 3GMLA 5I1CL 4PRBB 2J12B 2VXUL 4HK3N 5T3ZE 1P2CB 4P2CG 2J5LB 2B4CH 2NXYB 1TPXB 4HU2A 1UD3A 4UAOC 2CLZB 3H9SA 2LHAA 3TZVB 5LO7A 4MBOA 3F3HA 5B8CC 1KC5L 2X89D 3P3TA 2XV3A 3SKMA 1E43A 1TCMA 1JNHB 1I4FB 1P4IL 4NKDB 2OMXB 4K4KA 3QDGD 4NSKA 4ZK8A 1MPAH 1PLCA 2K9FB 2CBPA 4LARH 3U9UA 4HWBL 3SKNA 3EAKA 4NCC2 2IG2L 2F54A 3NZHL 2VR8A 2VWEE 4HF5H 4WENB 1PZUB 1JXJA 1N12A 1JERA 4MYPA 1W0VB 1E5AA 1NFDE 4I0PB 4UQ3B 3V9FA 1KTLA 3N43F 3LCYA 1E4WH 4EBQL 1OVZA 4JRYE 3PF2A 4LQFH 1YUHB 1NLBL 1AQ8A 1F41A 3OAUL 3AS1A 5F0MB 4CMHC 1TZHB 3RL2A 5ETUB 4Y2DB 2L3BA 4P5TD 4JPVL 3T0WA 3IDIA 4ZUUA 3HZYB 4JN2A 3BVDB 3N44F 3QWNA 5T1KA 3FQUB 4JRXD 4L1DA 4Q0XL 4P5MA 4A6YB 3LRSB 3EGDB 1BOGA 2X0WA 5F1SA 4R2GB 5SX5K 5I24A 1DN0B 4RFEA 3GO1L 3UG4A 1IB5A 1UGNA 1KGIA 4XWOD 1NCCL 2YJQA 1WEJL 4RGNC 2OFQA 1FYTA 5E99L 4JY4A 3UMTA 3WLWD 1MHHA 4U1KA 4PJGF 1KDIA 2NY3C 1J8HB 2P45B 5E08H 1WT5A 4JO8A 5FM5M 3TYFB 4AQZA 2CXGA 3I6KA 5IEKB 1BQSA 1MAKA 4PIBA 5FYKE 1UYWH 4HCRA 4TNEA 3RWCB 4WI2A 3EJJX 4PJGA 3X1FA 2BY1A 2EYTA 3S98A 3L3KB 4OD1H 2P47B 1JPFA 4PRHD 1BQKA 4LIQH 1A6TA 1KFGA 4GLRH 3S5LA 3O9WA 1CLZL 1BJMA 3GBML 3CLFH 1PD0A 3AWEA 4KNSA 1XZ0A 4U0RC 1MFDL 4RH4A 1GC1C 3FOLA 2H2PD 2J8OA 5CHNB 3AS2A 1JPSL 1YEEL 4YHLH 5DYOA 3L7EA 1EMTH 5AG9A 1IE5A 2WWNA 1CD0A 1AO7E 3WLBA 1LDSA 1B0GB 2VDKB 4GSUA 2HMIC 2A74C 3PNWA 3WMQA 1V10A 2EDEA 4JS7A 4S0SD 1A6VH 4F8OA 1PFCA 2EEXA 4X4XA 3VWJD 3CFUA 5G4MA 1Z9SA 5C0AE 2IAMD 4PLNC 3KLAA 5FO8B 2CIIB 1G9MC 3VI3A 3FO9B 4N2CA 4JJOA 2BHFA 5GS3A 2Y5QA 3V4UH 2DJMA 2L7QA 3JTSB 2EIKB 1SXCA 3CZEA 1HSAB 4OJYA 1B6UA 2E74C 1HWGB 3WV0A 1FO0A 2VGLM 1A1MB 3KVDD 4PYHA 4QRPB 4R4FL 5EC1B 1RZKH 4HWEL 3R1GL 3FRUB 5FB8A 3TIDB 1RHFA 4KXZH 4UQIM 5ADPL 1HAUA 4UQBA 3E6FA 3R19A 3N1QC 2FIKA 3GXPA 4M29A 4AKPA 3PAZA 1K9TA 2DZEA 1KYOK 2DYPD 3D7PA 4XVTH 3D0AA 4PMEA 2KZBA 3MLZL 5I75C 4OLZL 3VMOA 3UBXB 1AR1B 2XWCA 4NI6A 2LE9A 2Y25A 2ZCLH 4GI9A 1JGUH 4H5SA 5ANHA 4A2DA 5INCB 1CT8B 3TJEH 1TFHA 4PRID 4KI5D 2VSMB 1U8LA 4MMXC 3TBBA 2HX9A 4PJEA 1AZBA 1U3ZA 2HKFL 2VR4A 2DM7A 3HN3A 4KPHL 2OL3A 2P5EA 4X7SL 5B1AB 3U2SA 3FC8A 5JDSB 1AY1H 3KPNA 4WWKD 4XWGL 5F7UA 3IGKA 3S5YA 3MUGA 1QFWL 3CX2A 3K71B 4PN6A 4D8PB 1UCBL 1WWAX 4KKCC 2A6IB 4R8WL 1CFTB 4OIIH 1SN2A 2NNAB 3KLDA 2OYKA 5J11B 4MA3A 1SF3A 4XO9A 5EZIH 4DGVH 3II2A 3PGDB 5D1QC 3L6FB 1DQJA 1AO7B 3IDNB 4TQ8A 4W6WB 1WVZA 1OGAE 1T22A 4HZLB 1C7SA 3VFTB 1T66C 5D7LD 5D2LE 2VCOA 1UWEH 3DNKA 1R3IH 1H6UA 1HL9A 5GGSA 5I5MA 3ALXA 5CZXC 1KYDA 3VYNA 4MHHG 2WD0A 1KXTA 2YEVB 3QUYC 1YEDB 4R8WH 2Q6WA 3FUIA 3KW7A 1GYWA 4F9LA 5BMFH 4NZRL 3OX8A 3QFJB 3ZSTA 4EOWL 5JNYB 5FAAA 4JAMA 2WM0A 3T6ZA 5AOJA 2R23B 3RTQB 4NQCE 4FCAA 3U46B 2OX5B 3UTTB 4X8JB 2F19H 4ADJA 2H2PC 1B3JA 2QKIB 1L9NA 4UV7L 5JW3H 1JNJA 1EAPB 3I2CL 1A2YA 1JWUB 3HRZA 1H5BA 2NY7L 1WUNT 3HE7A 3DV6A 5CKGA 4TS6A 2ZAIA 4GQRA 2DLTA 4QAMB 5GGUA 3BUQA 3K0WA 3KBFA 3VD3A 3RZCD 2GFBA 3P0YH 3HC4L 3VM5A 4HWZB 4HPOL 2EKSB 3Q2NA 1I3UA 5J3HC 4MZIA 3DOSA 2LU7A 3SDYH 2WXNA 2YC1B 1GZQA 4NQEA 3RY6C 4WDIA 5HGGS 4AMKL 3TEUA 3IKCB 4N8VG 2IANB 2ZXQA 4UZSA 1RPQA 1LP9A 4L8DB 5H37H 4KY1L 1WZKA 1R3HA 2MPAH 3KL5A 1G7MA 5A2AA 4EUPH 2D2OA 2GBVA 1L6PA 2X12A 4ODXB 5DD0H 1CCZA 4PP1C 2YD2A 3HPLA 4WGWB 3STZA 1E28B 3AM8A 3P0VL 4KKLC 4NUJB 3ESUF 1K8IB 1T22B 3CN2A 3SJVA 3MRHB 4LOFA 3JWNG 4YXHL 3PWPA 3FBKA 1F2XK 3BHBB 1T1ZA 4ZUWB 4XPHH 3LS5H 2NXZB 1XH2A 4GG6B 3VI4A 4IMLA 4P9ML 2B14A 3APFA 4K9EH 4F7CB 3SGKA 1F8TH 3ULVF 4F37K 3RVTC 1UZ8A 4XCFL 1QR1B 5E6ZA 3AREC 3RB7A 1JPGB 3KVPA 1T5XB 3WY4A 3ARXA 3KPSE 3NACL 1AXTH 2H8PB 5DZJA 4E9XA 2DM3A 4BZ2H 3MSPA 4LEOB 1GS7A 2EXYC 4FFYH 1T0OA 4OLXL 3EJTA 4FQ2L 2AMUA 2PPEA 2QTEA 3HMXH 3MROA 3CBKB 3AMKA 1AGEA 2KQMA 2Y06H 4WTZG 4QHLB 4XP9H 3SE3C 3EHBC 4L4VD 4NKMB 4CW1A 4X5WB 4PLOB 2VDMB 4ZTOH 5F89B 1XXDC 1TMCB 3RTQD 5C08E 1EX0A 3I2CH 4N9GA 5ALCH 4IMKA 5EPMA 4NBXB 3PWJB 4UT7L 2C26A 4Y2DA 2DWEA 2ZYSA 4OCNC 4P8QA 1FNGA 2HT2C 3FU3A 5DLLA 2GJ6D 1PZBA 4N2HA 3S97C 2DI7A 3JWNE 3SBQA 3TBVA 1FORH 3UPAA 5HDBF 4RLDA 1YMMA 3FSZA 2NY1C 2X3CA 1OLZA 3GDCA 4I0PA 4UM8A 3U9PH 4ANUA 5I74B 1JN6A 2A9ML 3JTTA 4LKCA 4UNTA 4KMLB 2E6PA 3EJUA 4Z7OE 3ABLB 2CDEA 4QOKA 5KS9B 4GKNB 3ESMA 3CXHK 1G7LA 4PCYA 5AQ0A 5K9OA 3O9WB 2VLMD 1CDYA 1E3ZA 4WFFD 4GKSA 2WVVA 4Q0XH 4PJ9A 2YMOA 3QUYD 5LBSL 4KXDA 1DBAH 1D5ZA 3ARBD 1Z3RA 4L29A 1NDTA 3SDCB 1N68A 4PJFF 2R4RL 2PTUA 3BN9D 1JPEA 1FG9C 4NRZB 2EE9A 3STLA 4QTIL 1JGDA 5SWSA 3QG7H 1PIGA 4FXGB 4P3WA 1CDBA 5FHBH 3BE1L 1PKQA 4BCYA 3VSVA 4H8HA 5B3SB 2YGPA 4H8PA 4EUPG 1Z5HA 1AP2A 1JZIA 1E6OL 1PU0A 1WC7A 1YEKL 3F12B 1WGOA 5T1LA 3FJTA 1T2JA 1RY7B 3V0JA 1JWMA 4LARL 5LXGH 1DFBL 4KTYA 4O2FA 3UO8B 3JZYA 3UERA 3VRLE 1NGWB 2OV0A 5GS1C 5ESAA 4BQCA 3CIAA 4DPRA 2XYBA 2ZCHH 3VD7A 1TZHA 3AM8C 4BUGA 1Z7JA 3OWEA 3OG6B 5I0YA 3FCUB 3HG1B 5AKVA 1FH5H 1DVFD 5TDNA 3RY4A 4QXGL 1SUJA 1Z5YD 5D96C 2OMTB 1HDMA 2WXJA 5F3BA 2HRGA 1AHWB 1MDTA 1YNLL 2J6WA 5KVMC 4E42A 1XGTB 4AQ1C 1UWGH 3L16A 5EOTB 1JF1A 4HT1L 3K6DA 5LNDA 1J9QA 5ADPH 4KJYB 3QDAA 1LILA 4J3OD 1RZJC 2LFGA 4KY2A 3VWJC 1KGCD 3L1OH 5J06A 4LPWA 1O0VA 1EANA 3TU6A 4AUJA 3IJHB 1VEOA 1IGCH 4CSZA 1F3JA 3N85L 3I6LE 1G7HB 2MQGA 2P24B 4LLUB 3FAXA 4TULL 1LO5B 2WQRA 3D39E 4L37B 1SNRA 3KPPA 4ZO6A 3TH3T 4U3SB 2FH8A 5C0RH 5I15L 4BK8A 2B1HH 2QELA 3MRIA 3FNKA 3JV5A 2ITDB 1X5GA 2Z3FA 3OHXA 5F9WC 4OB5H 4IMKC 1JZJA 1NEZB 5HGHB 3MGTB 4IRSA 4N20A 3QFDB 1HZHH 4HHGA 2W1NA 3RWHA 3SDXE 1WBZA 4P2YA 1ZANL 1MI5D 2XZAH 3QPXH 1BYPA 4S11A 4H8WC 3BZDA 1ZLUH 2E86A 1F4XH 4J6RL 3NCBB 4FFZL 4KTDH 3KCPA 4GW4B 2W92A 3QIUA 4HIJB 1FZJB 4PQXA 2MCPH 4P5SA 3D08A 3B56A 1A4KA 5I6KA 4YHLL 4GT7A 5GJTH 2DDQL 3N2JA 3IFNL 3L7FA 4KRPB 5MI0C 1ZJAA 3SGDI 5F7WC 3P3RA 1YSOA 5JUEH 4OCRL 4UZUA 5IR1A 1F1GA 1LQSR 1IM9D 4G42A 2XZQH 3ME0A 5FYJE 3LB6C 3A24A 3MODL 2J5WA 4FXKA 4ZTPL 2WKOA 3QZLA 4MB1A 4I0CC 2L04A 2CO3A 2BSBA 5CS7A 2HX8A 4PRHE 5FYLH 5BV7C 4AG4L 3RP1A 5IB1B 2R2CA 4HXAH 1N64H 5DMIL 3Q6FA 1I9JH 5AW8B 1YDPA 3QZPA 2CJTA 4IOSA 1HH9A 4W4OC 2GB2A 4TQIA 4ZMNA 4KK5C 3P3SA 2EIBA 1S78C 2ZONA 3F01A 4G6AC 1PLAA 2A77L 1ROWA 5IVOA 3HKFA 1KTBA 3VFRA 5IKCA 3FQYA 4JPWL 4YPGB 5I18L 5CN2A 4HIEB 4GRLC 1SBSL 1SEBA 1LEGB 2E9GA 1OAKL 1JUFA 4C4KO 3GK8L 4D0DB 2GTWA 1OAYH 3IDXL 1MFMA 1T6BX 3MNWB 3TV8A 5AFAA 4D7PA 5I1HH 2VLKE 3FW6A 1TZOA 1W0WB 1FVCB 3TNNB 1XVSA 1AMYA 4LQFL 1JXFA 4DKFL 4HIXH 3HMWH 1JTTA 2O5ZH 3O6KH 3PHQA 4QRUA 1SGKA 2WXLA 3LKNA 4QLRA 5JW4R 4GG6E 3QDJB 5IR1B 3LIZL 3NABH 4JKLA 5ALCL 1PZ3A 2RCSH 2VLRB 5K39B 3FN3A 4FTDA 1MHPH 2CJ3A 3L5WA 1G9NC 3MJ9A 4JHWL 5C0CA 2Y22A 1P6FA 2V17H 4MLSA 3L7FB 4FEIA 4FKHA 1MNNA 1KTCA 1W6WA 1HNYA 4WW2C 2AABL 4OZFB 4M6MH 5ECGA 4IOFC 4KRLB 2Z4QA 35C8H 1I9IL 2DMGA 3A4EA 1HVXA 1C12A 2XTSA 2F1BA 4FL4B 5AVRB 2IOIA 3MREA 4NQDA 2B0SH 1KIQB 3QULB 4N2NA 4ZJ9A 3V6OE 5TTRA 2Z8VC 5CBEA 4R5TA 4AWJC 4O02A 3FUHA 3GZOA 4NUJA 5AD0A 3MRIB 2YRZA 4MMYB 4I89A 3M46A 4U1MA 5IY5B 3Q9PA 1M3JA 2FBJL 3OSKA 3BVTA 4QKTA 4Z0BL 5T1LB 3QCTH 4Z78A 2UY6B 4HEPG 4JPIB 1E6JL 1R47A 3C6LD 3WDHA 3ENEA 4HKXB 3BIAX 4JDVA 1NCBH 5HDOA 4PB9L 5DUBA 5HYQB 2A0LC 4OM1H 3UTQA 3L3OA 1TZGL 1T4KA 4JO1L 3QXAB 4YDKL 4ZZKA 3ULVC 5F9AC 2CO7B 5H2BB 5D7IF 3NRFA 4NRXB 4JVPA 5G4OA 2SODB 3DLQR 1GW6A 4FLQA 3IJSA 1S7RB 1KBPA 3ARDA 3B43A 3GSNA 4P9HH 5FYKH 1JCKA 5T1MB 4DN4L 3H2QA 1D5ZB 4YXLL 2WPGA 3IRPX 2WXPA 5E8OB 3IETA 4LGPB 4Z3IA 2B1OA 5KVEH 3D85D 2CCWA 4S1QH 1VEMA 5F1IB 4I3GA 1O9ZA 2WUBH 4MJ2A 2PP7A 1QFUH 3HG2A 2ZYRA 4FN0A 4RGND 4IYKA 5K5YA 1DBML 5FKPA 2DQEL 1OTUD 1XGQB 4JZJC 4XX1E 1KIUB 3SDAB 2Y7QB 1WDAA 2ZCKH 4YLCA 1YUKB 3TCLB 4L4VE 4P2QE 2J55A 3T1WA 2BCKA 5LKNA 1U8MA 1UD5A 4WF7A 1V05A 2VXSL 1KXQE 2AJXH 4K3EL 4GSQA 3X12B 5HPMA 2ESVA 5EBGA 4ZO7A 3IDJB 1G6RL 1PG7H 3FQ1A 1WTGT 3ULUC 2GTZA 1IAKB 4ZMXA 4X6EA 3HI1A 3RI5F 3WDIA 4M61A 2HRLA 4JFYA 3TEWA 2BJML 3SPIA 2UZIL 1A6ZA 1AO7A 5BPPA 2F5AL 4PBVC 3M6DA 2JELH 3MJ8A 1MWOA 1HEJC 1GTNA 2CLRB 4OFYD 5I71B 2J3SA 3DXAB 4G9DA 1GJIA 1E5ZA 1J88A 2EKJA 4FFZA 3IFLH 1YVLA 4NHUB 2HG0A 1XTLA 3ZDZE 1WHOA 5J3HD 1QWUA 1IAOA 1NGZB 2EVGA 2XQBH 3LV3A 3QXWA 1MNUH 4MQTB 4NAQA 2A6KB 4QLWA 2C1PA 3O3BB 1ACZA 3JVGC 1H3XA 1BFSA 2EDQA 5K9KB 2R29H 2IPKB 2K45A 1KCUH 3MMEA 1ILSA 1IFHL 3BWAB 3EYSL 5I8OL 3FB7A 1AGDB 4LL9A 4HC1A 3ZO0A 5C97A 4F7MA 1J8SA 5KVGL 4PJAB 3D9AH 3GLDA 2VJXA 4MB3A 1EFQA 1KCRH 4HK3J 1NQBA 2VIRA 4PWGA 4DEPC 2OA9A 4KMQA 3D2UB 2JCCB 3LZRA 1FYTE 2VIRB 2X6UA 4OUOA 5J57B 1BVKB 2QFRA 1SM3H 1ZLDA 4BFOA 5D6DC 2ODIA 5I8CA 1GKOA 1SN5A 3CH8A 3PU7A 3UEQA 4DZ8B 1NBQA 2OS7A 4Y2OB 5FLUA 1CYGA 2WQUA 3QSKB 2FIKB 2QVFB 4MS8C 1TZAA 2GI0A 2OR9L 3NN8A 4G71B 4KDWA 1IM9B 5ANME 3MV8E 3I3DA 4IRJB 5E9NA 1AFVH 5KVGH 1UM6H 3SGKC 1Q38A 4Y19E 2XPZA 2IWFA 5GGVY 2C3GA 2YAFA 3V6OA 1MUJA 1SDDB 3BRFA 2NY5L 1KCUL 1NBZB 3S4SG 5KBDA 2NX5E 1JV5A 5DJ6B 1PBYA 3ILQC 1PZCA 3LNFA 4V33A 4RZCA 3T2NH 3FBQA 4U1GC 3U1SH 4JR9H 4C57C 3QH3A 4X6DA 1PQZB 4P4RA 4WO4B 4XBPB 3ECWA 1J8KA 3KYOB 3T0DA 1GCYA 1B88A 1F11B 2DQMA 2WXGA 3OKMA 3GSUB 2Y4SA 2Y36H 4XMXA 4JZJB 4YE4H 2JELL 3HZVB 1X5LA 3MV9D 1FC1A 4ENEC 1ZV5A 3BGMB 3RNQA 4DP9X 2IDUA 3GJEA 1LMKA 4UANA 2DWEB 5AWNH 4JKMA 3S4SA 5HP5A 1XGZA 2E56A 4PJIA 4X5XA 2WXOA 2XU9A 3D4ZA 5CJ8A 2BRQA 2XN2A 2AJSL 3NJXA 1DSFH 3PPSA 4OZHB 4PP2B 4WK0B 4BUQA 4A1RA 3PY9A 1UVQB 3CFJA 4ZFZB 3NK4A 4F1ZA 3QR2A 5DWPA 2NTFA 3ZKND 4JKKA 1TKWB 1HC1A 3FB5B 3QJRB 2LQRA 5CU5A 1N5AA 3HHSA 3WFHB 4QJ5B 1HSAA 2D0HA 3QQ9D 2D7TL 3FQXA 1L0PA 1MFAH 4ODTH 1D7DA 3SDAC 3TBTA 4UTCA 1YPZF 2R0KL 4ZFFA 4M6NL 1VFMA 3FU9A 3WNKA 5HHNB 1XF2A 1PX4A 2FEEI 4MNQA 1YECL 3AXIA 4FP8H 4G1EB 3TCXA 4LIQL 2ZOWA 4N0CD 1T6VN 4GW5B 3SCMB 2ZE0A 2IC2A 1MW2A 3GXUB 4DOHE 5CU9A 4XBGA 4AQEA 2YK1H 2OR9H 2CDFB 4JY4B 3HNSL 4P23D 2F18A 3N1GC 3MUY1 5PCYA 3RDJA 1UUSA 2H32H 1B2WL 3CFEA 3EH2A 1URZA 5FEBA 2NTFB 1IGJB 4ZFOL 1OAQH 4Y4KC 4PV9A 3TT3H 4ZO8A 3WFCL 4OM0L 5IQMA 5TH2A 3P9MA 3O45A 5E6SB 3T3PE 4P5KB 5JHLA 4YSCA 5AKRA 3PL6C 4QEGA 4X5QA 2X4RB 3DUSB 1AANA 3MXVH 5JW5A 3EH1A 3FFCD 5HHPB 1KBGL 3LD8C 1A1MA 4G1EA 4ALAL 1W16A 4LVHC 5TFSL 5J6GB 2JMRA 2O5XH 3KYKL 1YYCA 3CZUB 1OE2A 1ZTXL 4RGOL 4LNRB 2H6UA 5KYNA 1OARH 1LD9A 4UM9D 2AABH 2AGJH 4IJ3B 1H8OA 3DIVA 3G9AB 3G5VA 4MJIA 4X8JA 5AW4B 5CD5C 1TQCC 2L8AA 4TVPE 5DD6B 3RILA 3LKNB 3WIFA 5EIQA 3WFHA 1QLRB 5LBSA 1MUJB 2V17L 2IGFH 4MKMA 1AO7D 3ZHNA 3C5ZA 3OX8B 3QFJA 2E9BA 4LP8A 2BSTB 4PLJC 1MCSA 2OW6A 1P0SE 4FNRA 5C9JB 4NQSB 1YEDA 5F7AA 3ZDYB 1CJYA 2R4SL 5IJVB 3FCTA 1IT9L 5IB2A 2HT3C 3GMPB 1GRWA 4U6TA 2VXSH 4K3EH 4QOKD 1UT1A 4E41A 4JG0H 4F2MB 3VTAA 3BFOA 3NA9H 4AKOA 2IH8A 4TXVB 4K71B 4M02A 4AYID 2C9AA 4J4PC 2DTSA 3GZQA 2BHZA 1BREA 2GYSA 1T2QH 1WGVA 1UWEL 4MS8D 4JDEA 5LAXB 4TUKH 1LO3H 2TRYA 4I88A 2FWSA 1MAMH 4H25A 4CRPA 1QOKA 3WIHA 4TPRL 1PCSA 1G0YR 3BVXA 4M1CC 1KTKE 1T83C 2DWDB 3BD4A 3C5ZD 3ULSB 1HZKA 3H3PL 1U33A 2FJGB 4HXAL 1EJOL 2V9QA 2DMCA 3D34A 5BXFB 1I9RL 3AQYA 1UM4H 2G3MA 4TUJB 2VL5A 1IC7H 1GJUA 2IALB 3MRQA 5E4OA 3ARGB 1U8OA 3ZE1F 1M42A 4E2OA 1LO0H 2VW4A 3LRSA 4N6QA 5A16B 4XPFH 5JDJA 2YWZA 4JO3H 3INOA 4U05A 5ADOH 4QHNB 2EDKA 5J9PA 3WTYA 3S8WA 5GJTL 5AVUB 1BAFH 2NOYA 4YVUA 2DD8L 2A6DA 1NEUA 3BDYL 3DJRA 3D6GA 1YC8A 4MNHA 2DQEH 4PJHA 1UA7A 4QF1A 3VD1A 4RAVB 2EZ0C 3CFCL 2BIMA 2ED6A 4QHMA 3W5NA 3FQNB 4XNAA 2A4CA 2WUBL 3B2UD 1AMXA 2EYTB 3R4RA 4Y2DC 5BZDB 4PJGB 2VLKD 1F1DA 1DDTA 5AALA 4FNTA 4C56B 3HG4A 1FDLH 4HJEA 2W9EH 3L9RA 3MRLA 1XF3A 4W9LC 3TO2B 4QTHA 1TJIL 3IWVA 4DK3A 3H55A 1OM9A 3MRKA 3N42B 2YD3A 4NLAA 5IJKA 1UTDA 4FFYA 3S2CA 4RGNB 4TQEL 2GAZB 1IAKA 4ZX3A 3DRTB 4Y16D 3W0WB 1FPTH 2G5BB 3IU3A 4PJDF 5BS0E 3MRDA 2P3YA 3BCFA 5LJYH 2WBJC 1CUOA 3BH8B 5E4AA 3ZDXB 1HHJA 2PXYA 2VZTA 4RRPA 3VXSA 3WLBB 1GIGL 3QWRD 5ERWB 4PGBB 3VXMB 4FNLL 2QPUA 2ZOTA 1D9KC 2AQPA 3QWRA 4U4BA 1NIEA 3GBEA 4IEFB 4MX7A 3U25A 4QXTB 3WIIL 1HJCA 4K55A 3WKYA 4NPYA 4FYSA 2AVFA 1I82A 2F7QA 2ZF8A 3PNRB 2HFTA 2R1XA 5H4YA 4EEEA 1LWJA 4W9DC 3ZZ1A 2WQXA 1G9NL 2PKDA 4ZPTA 2XWZA 1CFNB 3F6IA 3B5TA 3RWEB 4QI3A 5DVLA 5ICZB 1U4EA 3WHXB 1F3RB 1N7MH 2VN3A 1BX2A 3A6OA 3VXRE 4LDLB 3ZE0F 3X11B 4DW2H 2Z0BA 2MRYA 3CU7A 4IBSA 3U9UB 4EZLA 3TWCH 2EC8A 1QRNE 1KENH 3RI5K 1PFOA 5DFVC 1TENA 2HX7A 1FG2A 3QO0B 4K0OA 4PY7B 3DETC 1BBDL 3H7BB 4UOW1 3GRGA 2DYPB 5D4HA 3HMWL 4G8GD 4WUUB 3NJLA 4XB8A 1D5XB 4HUXA 1ZPUA 1AR1D 2OMWB 3PDOA 4KQ4L 3G6JB 5D7IE 4ETQA 1EZVX 4JFVA 5HBBA 5DI8A 1CU4L 3WKQA 5I66A 3OXRA 5JHDA 1K4DA 2HJKA 1G7LB 1CVSC 1FVCA 3K46A 4PRHA 4AC2A 2WLLB 1ZMYA 5LBSH 3APCA 1IV8A 3CJJA 4ZUUB 4X5PA 4Y5YA 4IOIB 2D7NA 1T66D 5I5IA 3QDGB 1S9WA 5L2KB 1MXGA 1ZGLB 5L4MA 4Q6IA 3O9WC 4FQXB 5DJDA 5MEPA 1KIRB 1KGWA 1HIML 3CUPA 5DJ0B 5KYXB 1HL4A 4U3SA 4F33A 2PXYD 3VXSD 5CZRA 1JVKA 4LHUD 4MNGB 1AGFB 1LK2A 3AACA 4PRNA 4Y4HA 3NIGF 5D4QA 5ICXB 2C3HA 4FE9A 4PRIB 2ATPA 3MXWL 5D70H 4XXWA 3O3AA 2HLFC 3WJLC 3C09B 2XX1A 1CIUA 3KH4A 1UQSA 2GITA 4B9PA 2NSQA 4YHOL 5AW9B 2CBTA 2R59A 4J3VA 5F9OH 1KXHA 4RFOH 5TQ0H 4MJ4A 4BFRA 3D06A 1JZ3A 4KI5F 4ABWA 3LEXA 2W9DH 2VR6A 5IIEA 4HAKA 3UMNA 4M8QB 3WEXB 4MXQC 3NCCB 1EGJH 1OF2A 1WD8A 2WQAA 4UDTB 1IEHA 2E76C 3GHEH 3ILPA 4UIKL 1NGYB 2F6AA 4PWHA 5D4IA 5AVYB 3QUZB 3ZUCA 3FT4A 3D4GA 3GMLB 4YLBA 3FU6A 4XNZC 3PQYE 2V2WA 2XPGA 2FHCA 5IREA 4NT6B 5IW3A 3K6SB 1DANT 3MO1B 3BQUC 2FJUB 3WEBA 3PV6B 2YA0A 3WIIH 3G08A 1HZHL 3FSVA 5A16A 4XZ4A 5TK2A 3WN6A 4LNVA 2ZX7A 1NINA 2YD4A 3ASNB 5MEOA 5D7IA 3L4CA 4IDJL 3UTPE 4LGSB 2WO2B 2DIBA 2EVHA 4PRHB 2R51A 2BVPA 1U8KA 4S0TD 5AAMA 1ZWIB 2DS4A 2X05A 3G7TA 4CA4A 4G6KL 2DLEA 2BOLA 2CPCA 1LTXA 5DU7A 3V9EA 5IUCA 2AQNA 3KPPB 5FHBL 2BIOA 1VERA 4WO0A 2P52A 1DQLL 5L88L 1T1YB 5TQ2H 3TM6A 2P43B 2WP3O 3ZKMD 3H8NA 5B3NA 1VJSA 4JDTH 4YHIA 3RU8H 2BSSA 3PL6D 4DT2A 4GP8B 3UC0H 3WXVL 1JTPA 1KELH 2ISDA 3CX5J 4XRCA 4JO4H 4R84A 5FCUL 1FAIH 4GBXB 3I6GA 2XV2A 5F71A 1FJ1B 4KHTL 2WWMC 3U82B 4KKLD 5E5UB 4X8GA 4O2EA 3U6RA 4QHUA 3KGRA 2QLYA 3SBPA 1S7TA 1T2QL 5JPNC 3MRGB 5ESQA 4HCGA 3VXTA 4KKNA 4BFGA 4NQXB 1ERNA 4XMZA 2AV7B 4ZUVB 1XCTB 4QWWC 1JCVA 1ZLSL 1EEZB 4OD3L 5EU6E 2IBZX 1NGWA 5ERWA 5C9JA 4MS6A 3VVVA 1N5YL 5J11C 2OMZB 1LE9A 4WI4A 3RJQB 1IGJA 2DWXA 4YGAB 3QDMA 4LOUD 5D7EA 1BQLL 3CFTA 1M3IA 3IJHA 1I9RH 4NO0B 4L4VA 3ZE0B 3X1EA 3GTTA 1NFIA 3PREA 1NTDA 25C8L 1P69B 1MVFA 2R69L 2BY2A 3OZ9L 2PWEA 3FO2B 1JE6A 1VF5C 3DHMA 1ZXKA 4CVXA 2B9BA 4M9PA 5HHPA 2QDVA 4LFHG 4Y1AE 1FIGL 2R39A 2AJZA 2YK1L 1URLA 1CBJA 2YPLD 1RUAH 1GGBL 5C9KA 1KBGH 1I1YA 3BVNB 3PABB 4PIRF 5HVFB 2O26U 4OIIL 5FCSH 1E8WA 2DQUH 4RAVA 2V2TA 4ZI8A 2H6PA 3AB0C 4XNMB 4PGEB 4XPHL 3FF7A 2X9XA 3OGCB 3CFMA 1MCDA 4X9FA 5T3XH 1IQWL 4XOBA 3EH3B 4IU3B 1JN6B 2XCMC 3JTTB 4JGNA 1IT9H 4RESB 1BLIA 4M7ZC 1V55B 1RD6A 1I1AA 2CA3A 2WNKA 2JI2A 1U8QB 5CAYB 4J3WA 1QZ1A 1ANUA 5IB2B 3H9YA 3D0VA 5F88A 4NEHB 5IESL 2Y06L 3KM2A 1UOKA 3I85A 3OSVA 3W0WA 1WFNA 4JZJA 3O2WL 4OBRA 3MRCA 1CDCA 2V6HA 1LVEA 3PUCA 4QRPA 5KVFH 2OM5A 2NYZA 1AGEB 2X4NB 2G5UA 4PTUB 1XF3B 1AGBA 5EWIH 1BZ9A 4K7PY 1DTUA 4TLKA 3U0TB 3ZTNL 5EU6A 1IBZA 2JKJA 4XPBL 1JWUA 1VEPA 1MJJA 1XIWC 3HRZB 3OKOA 3QDGE 3UDWA 4LDOB 3V52H 4W9HC 2WV3A 5F72S 1JHLL 3G04B 4Y2DD 5IROA 4N24A 4L8SC 2HVJB 4X9HA 3BO8A 3S36X 1I1FA 5BQ7B 2YZ1A 5EFIB 1VIWA 1XAKA 2XN9E 2IAMC 1UH4A 3SCMD 1INEL 2VAAA 1A3LH 4N8CL 5D93B 3EW3B 1LEIB 4G6ML 3X3GL 3T5WA 1YEGH 5T3ZD 5H35A 4AUUA 3P0VH 2LT9A 5CCKH 3DGGB 2FYYA 4XNXL 5KVFL 1YY9D 1NGQH 2AK4B 5FXCH 1LDPH 3N43B 2Y7OA 3I3EA 4F91B 2LR4A 4FXLA 1H3UA 5CWSA 2Z31A 1OW0C 1EUTA 4XOCA 3BWSA 5HI3D 2BHYA 3G5YA 4QAWA 3X13A 3I84A 4MAYB 3CSYB 1BAWA 4BBWA 2DQGH 2HA1A 3QJZA 3N91A 4HH9A 5DEGA 4NQVB 5D6CA 4DHLA 1BCIA 3MROB 2ZSVB 4ORZC 4AIZB 4NN6B 5FHAL 1UADC 2NMSA 2R1YB 2X89A 2G9KA 1SOQA 2XKUA 5EZIL 2KC0A 2G5RA 4F7CA 3RVWD 2A6KA 4NJ9H 3OBAA 3VFSB 5FM5O 3V8OA 2BIIA 3KPNB 3I9PA 3OKOB 4N4YB 4ANKA 2EECA 4NKOB 1BVLB 1MRCL 3B3IB 5DZPA 5GSRA 2FHBA 1XIWB 3NA9L 4JM4H 3FFOA 3RJOA 4CVXB 4DTGL 5F1NB 4LHJB 3TA3D 2QSCL 3BP6A 3CQPA 5I0ZA 3D48R 3PWNB 1QQDA 2ITCA 4ODUA 4JUTA 3C60B 2ATAA 1G7PB 1CXFA 5K69A 3G5YB 1E28A 3RHWF 3VD4A 3G6AA 1PD1A 2AJYL 4WZ9A 1N0LA 3PHOB 4Y19A 1FGNL 4G7VL 3DO4A 2OMBA 1P84J 2D7QA 3AXHA 3SPJA 4BZ1L 4X98A 2RH0A 1UFUA 1LEIA 4X0NA 2IV8A 1JRHH 4XBGB 4YDLC 3ARFA 3ORJA 4HPYL 4UQ2B 5B4MD 4HLEA 2NUTB 4Y4KD 1MWAB 4ZFQA 1KXVC 1YEGL 4RMRA 3X3GH 3G3LA 5ACZB 3CDFA 4GAGL 3SPVB 3I9GH 1OGTA 1KFAH 1ADQL 1FLTX 1GW0A 4G1MB 1ETZA 4O9HL 2F58L 2QQNL 4OFYA 2NYKA 1YPZE 5E4EC 3TS8A 1NBYA 1FN4B 2VH5L 5FM8A 3TJHD 5E8OA 3W3BA 1NEPA 1N5AB 1K2DA 1SFHA 3ZTNH 2D03H 5E0FA 3EOBB 5ECJE 4P2RE 1OAQL 4UM9A 3VB9A 2NY4B 5AYTA 4LB8A 1QNIA 4MMZB 5F8QC 1L9SA 2HMID 4PR5B 2BX5A 1KSRA 2WWKT 5M7QA 1JGUL 3TASA 2YLHA 4FA8A 4NO2B 2WVTA 5JA9A 4HIIA 3GRWA 1S7XA 5BV7B 2GUOA 3DPBA 1XZ0B 1GSKA 3V4LA 3OKDA 4XNXH 1W8OA 4H5SB 1MKFA 4M1CD 1RUKH 2WZ0A 3HCVA 3T0VA 4PRDA 3TJPA 3EUDA 1RZFH 2H3NA 4YN3A 1CICC 1KG0B 2WZPA 4H0HB 4GW5A 3SCMA 3QXDB 1MAJA 4O5LH 1T1WA 1F18A 3QJQB 4YSDA 2IMMA 1TNMA 5EUOE 3O3EB 1BBJB 1XF2B 2PW1A 4UV4L 4Z3TA 1MCBA 1D2OA 4J8RA 3BRGC 1O7SA 1RZGB 3ZX1A 4E9TA 5SX4H 2IQAB 4LSPL 3UJJH 4NHUA 4TNVF 1X6NA 3QC6X 4RMVA 2X6VA 2VDOH 2FL5B 1VACB 5I30L 4X4ZA 1T7ZA 3CD4A 1KCSL 1ZA3A 4JO1H 5IEHA 3JTSA 4BFNA 1I1AC 1HOCB 2QSTA 3K72A 2PNDA 1NCUA 3FT1A 4R3SB 2YQ3A 1J1XH 1RSYA 3QVAA 5T1LD 1AZVA 4OF5A 4DK6A 5EZPA 2IQ9L 4R90L 5C0NC 3LVTA 4QMEA 1U8LB 5AD0B 4KK9C 1KBVA 2P8MB 3RB5A 3UJTL 4N8CH 1USQA 3EBHA 2BK8A 3O6KL 3EADA 2ZWNA 3ZL1A 1ZPLA 4NZTL 3D30A 3SDDD 5DJ2A 1KN2H 4PB0H 3FB7B 3RYMA 1AIFA 1HE8A 1OTSC 2VABB 4YOKA 4YDLB 5E2UH 3MRBA 5EEVA 1A6AB 3S7GA 4PGDB 3V6FA 2AHIA 3CZGA 2OJ1A 2V2WB 1B0WA 1ASPA 4GRLA 2F74A 3O0RL 4H0LC 1INQB 3DI3B 3AQDA 1YDPB 4OD1L 5EUOA 2F61A 2HT2D 1PYWB 2A3TA 1FV1B 2IAND 5E9AA 1XB8A 4YIQA 1Z3GL 3B1TA 1CLYH 4HJSA 3WXVH 2OSYA 5BZWA 3LEXB 4L0ZA 5EBWB 2JCCF 2BSED 2IBZY 2ZKYA 4D9LL 1UENA 4RGMB 3UTSB 1H8LA 4EUPA 2X5PA 3O3DB 4QXVA 3GO1H 4N2IA 5EHFA 3SDDA 4M48L 2IPUK 4ONGL 4Y8AA 2ESVB 5ICXA 1JPTH 1U8MB 1DJWA 1H3TA 4ORGB 4DVRL 4YHKL 1QSED 3EJPA 5EC2A 3GMNA 4I3RL 4R83A 3K6FA 5BCAA 3CU1A 2K6ZA 8CGTA 5EEZA 3B9EA 4U1SB 1HHIB 4GKZB 2IOMA 4CADA 1G6RB 2J88L 5HYJE 3EG9A 4MJIE 1P7KA 4KAQL 4Y2LA 3BP7A 3EH5B 1CFQB 1MH5A 2VUKA 3KYNA 2QADC 3MV7D 4KI5E 1Z9PA 3AG1B 3RPIB 4XNDA 4ZMYA 3MRGA 3ZN6A 5HDWA 5JO5B 2YARA 5FYLL 1DANU 1INDL 4HHAB 3BAYA 4DP4X 4MQ7B 1KELL 1ZVHA 3H85A 5F9JA 3VFVA 3PQYD 3GHEL 4JKPH 5IW6A 4AEHH 1E67A 3REWB 1I7ZA 2HG5B 2CNZA 2HB0A 3CAFA 3EYVB 1TCRB 1NFIB 2F8IA 4PG2C 5E4IA 4F2ME 3BX7C 1CDGA 1SYSA 5JIHA 3AY4A 1DVFA 4EZKA 2XXFA 5DVMA 1BOGB 1GHFH 3D07A 5DMYA 5I1AB 2FUTA 3L5IA 3B9AA 3U1QA 4WFED 5F7NC 1JSYA 3HN8A 2ZYHA 5D70L 1FRGH 2AXWA 2VXUH 3CZFA 2ITFA 3GXMA 1OT1A 4AJVA 3RVXD 3RL1B 1ULVA 1I9EA 4LBAA 1A9BB 4XBMA 4BKLB 1BEYH 3MBXH 4IK6A 1F6FB 1NFKA 5F0LB 4NPKA 5DK2B 2AQ3A 4UU9A 4FFWD 3EG9B 5IMLA 1R24A 1L7TH 1QO3B 5B1BB 1G7JA 5SWQB 1KEML 2GHWB 15C8H 2GSIB 4ZAKD 3MGOA 4IKNA 3VFWA 1KPRB 3GGWA 2FH6A 5DMIH 2V7HB 3BAIA 3QUMB 5IOPA 2HJKB 1EFXB 2IFFH 2PPCA 4F58L 1CWVA 4PJIE 5AOMA 3FCBA 2J21A 1QRND 1FNEB 3VQLA 3PAYA 2OL3H 4H26B 1BIIA 2JCCE 3L5WB 2OCCB 1WWWX 4PY8J 2MMXA 4ENZA 1M1XB 2DMKA 2M26A 2OKMA 5EU3A 5T1DH 2WXRA 3PP3K 3VFVB 4HP5A 4PJ9C 3UPRA 1N59A 1I4FA 3KBEA 1E7VA 3JV6B 2VOTA 2ROXA 4AEHL 3SDCA 3B7TA 4L9DA 3LEVH 5IVZA 2XYCA 3M8OH 3V0WL 3IXTB 1I8MB 4QRFA 3SN6N 4KTDL 2GJZA 2ZUVA 1CS6A 3IS1X 4HUMB 3GEFA 1S6NA 4POZC 1AXSA 4L1SA 3MOAH 5LLIC 4MZRA 4H13C 1R3JA 2J88H 3BLKA 3HNTL 4U0RB 4RMSA 1GOGA 1MQ8A 4ELKB 1PY4A 1T89C 3QFDA 2ZT9C 3ETTA 4PD4K 4YHKH 3QHTC 2BY3A 4MZ2A 4M62L 2JB5L 4N8VB 2X10A 4EVNB 3KLHD 4XNZB 2I9TB 1HXYA 1A3QA 1JPTL 4GRLD 6FABH 1ES0A 3ATBA 1GIGH 3GEWB 1BSIA 5IFHL 2QLVB 2WWKO 3TXAA 1MCPH 5FO9B 3C5JB 1JHTA 3U7AA 4MZ3A 3AREA 4A2GA 2DEYX 1N26A 3BMWA 4ZG1A 4N8PA 4ICXA 5EUOB 2FO4A 5DI8B 3MOBH 1DBAL 2IQAA 3LD8B 1EQWA 2Y23A 4WFHD 4YJZL 5DD3L 4QRTB 3E9TA 3E8VA 4N2FA 3BPLC 4Z7QE 2MHAA 1EFXD 3X11A 4LAQL 4F7KA 4OV5B 3RGHA 1BX2B 3OB0K 3ILQD 3NQIA 3O45B 1FORL 3QQDA 5DK0A 3DXAD 3OWRA 4OZIF 1NEZA 2B9AA 3AU1A 4KQ4H 5IFAL 1R5IB 4A7GA 4BH7B 5IMKB 3LEVL 5EN2A 1D6VH 5LHDA 1OEZW 1WC7B 1K4DB 2GY7B 4J2QA 1CGVA 4R26L 4E9QA 4XNUH 2GJJA 4OD2A 2ZXGA 3VXMD 5IUSA 1CK0H 3WNOA 4YSQA 1UD4A 1HCFX 3W11D 3BZ4A 1X5ZA 3DJTA 3RRQA 1FPTL 4E41E 4OCRH 1JYWA 5DZLA 1FZOA 3CFNA 4GEJA 2CKBA 5B39B 3OMZA 3C6LC 4NS0A 2FJGA 1SHSA 4XCCL 3VRIB 4G9FB 3UTSA 1MDAA 2FGWH 4JQVA 3BT0A 3WL9B 5A3IC 4Q2ZB 1JGEB 3FB8A 1PJWA 1W72L 1WPCA 2D0GA 1ACYH 2RACA 2DF3A 1GGCL 3P11L 4WFEE 2BMKB 3H42L 2DQFB 3MGAA 3ZY7A 3MDJA 4B41A 2J8UE 2D7OA 5KG9A 4UV4H 1FA4A 1KG0A 3ZYJA 4ZQKB 5DJYB 3FRPG 1QBLH 4HUUA 5EIIB 2IDCA 5HJDA 4ZD3H 2BXZA 3DECA 1J1OL 4HPOH 4LCWB 4LVHB 4PJ7E 4PH8A 1T3FB 1ZTMA 3ZVVA 1H9DA 1ZSHA 4DCQB 2J72A 1AD9B 1WA0X 4OTXL 5C0RL 2ZOLB 3AT8A 4ZODA 5I15H 3P3YA 5HDLA 2FSDA 1TQWA 5J89A 1A14L 5T5FH 4Y1AB 1AQMA 2VXVH 4QYOB 3TBSB 4QF1B 1KYFA 3GI9H 1AP2B 2CQVA 5I1JH 1P4UA 3BUPA 3IFPA 2QGBA 2ZPKH 4Z3FA 2I07B 2R56H 4TVPD 2NCMA 3QIUD 1NMBL 2NXZD 3RFZB 4U6XA 1E2ZA 5E6IC 3U7WL 4HZAA 5IBLD 4PWEA 4M7LH 3T9WA 2NZ9C 1T89A 1VPOL 5LGHL 1IC7L 4Y1TA 4JFXB 4NN7C 2VZOA 3M45A 1CR9H 1SYSB 3ESVF 1KB9K 3UACA 3ARGD 3OQ3B 1KLFA 3MRQB 2IFGA 4XCFH 1DQVA 5HYSA 1O7DC 1U2HA 3CFCH 3PS6A 5KSAA 1I31A 2AEOA 5IW6B 5FFOA 3QZMA 2YZ8A 1OARL 1VFBB 2V4LA 4HV8B 4LFHD 3BGFB 1CFSA 3EYQD 5HYFA 2E6QA 3O6FC 3QPQC 1S78D 4FLHA 4G6AD 4XPAL 1DQQA 1NCHA 5C0DA 5LN8A 2PCYA 2MWCA 3ZTJH 1XL4A 2WJ5A 2GUYA 4GG6A 4PJBF 3FOMB 3HBZA 4OZHE 4HVBA 4AW7A 2XTJE 5IVXF 1IO4C 1U8NA 2YFNA 4QRAA 2Y72A 2AEPL 1O6SA 1DBKL 4F7TB 2BWDA 5AOZA 3F12A 3LNIA 4PGCA 2R2HA 2Q76A 3W9DA 3DK0A 3SE4A 4G7VH 5KJ7E 1BG1A 2UWEF 1MFVA 1DVZA 1UJTA 2CHWA 1IIIA 4AMKH 1UB5B 5D1ZA 1FHGA 1ZHBB 5IK3B 4JM2D 4PJCB 4OZ4B 3O81A 2X2UA 2JF1A 3QFJD 1T0PB 2CO4A 2H1LM 3APMA 2RAMA 1YEIL 2J6EL 1KEGH 4R5VA 1HI6B 2G2NA 4N25A 4NKIH 1Q1PA 1KYOJ 4YC2B 4ZPVB 4JM4L 1UZ6E 2QQKH 4NHCH 4G83A 3C9NA 1DQQB 3SODB 2BSEA 1QLRA 3FCSB 1FZMB 5DRXA 5C0BB 4PJHF 1CO1A 1KTDB 1HCZA 3IBEA 5E8PB 1TQBB 4PTTB 4JGMA 4LGRB 5AB2A 5DS2A 1E42A 2R15A 1FFNB 3FT0A 3U7YH 4M7LL 4PJEB 2Y7MA 3TFBA 4HPYH 4WU5A 5L0QC 1XMWA 4Z1PA 5FHAH 4X7FC 2V3DA 5G2NA 2O5YH 3KPQB 4KGLA 3CQFA 4GQZA 2EYRB 3AG4B 4HSAC 1CT8A 1AQHA 2Z93A 2QDWA 2WLJA 1CGUA 3RWIA 3ZQWA 4HS6B 3TVMB 4PJFA 4AUYA 5T5NG 3WNPA 4LKXA 5IK3A 1OGAD 1J9RA 3MR9B 4G6JH 1G7MB 3CLEL 1UFGA 3QA3B 4KO5A 2JJVA 5FA4B 2V5TA 4JHBA 3HZVA 2BNQD 1IZJA 2G60L 3GMQA 2Q8AL 3CMGA 5F89A 1EXHA 1ZTXH 4E68A 2I27N 3ZL2A 5E1AB 2Z6FA 3RVUC 5CHNA 5BS0D 2CO1A 2MOQA 1YG9A 2EDBA 3GUTB 4LNRA 3FO0H 2YAMA 2GIMA 4UTBL 2FX8L 4RSVA 5I1GL 3WDJA 1H8NA 3DSNA 4O5LL 3SEPA 3WEAA 5C0GB 3V52L 5L4IA 5I6XB 3LPWA 4G8IA 1MVUB 4PJXB 4PW3A 1MFAL 1F6LL 3DXAA 4G9DB 5IBLC 3WG7B 2H26A 2NY6D 4YDVB 1VADB 3FK3A 5LCVH 3WL9A 4X9IA 3TPUB 3F65A 2SEBA 5HHQB 1VGKB 5IG7B 2Z35A 1D6VL 5J6HA 1IZKA 4QCIA 3ZO9A 3ARQA 1U8QA 5TDPB 2OZ4A 3WU1A 1UG9A 4KY1H 5D6CB 3ZR5A 4HGMA 2P44B 1YN7A 1P7QA 2DIJA 1L4IA 2UZPA 3HI1B 5DLMH 1QLFA 4V2CB 3KXFE 4F20A 2KDGA 3X12A 3VI3E 2IPTL 1N8OE 2VM3A 2DM2A 3QRGL 1JV2A 5LNEA 1DO6A 1QRNB 2HRPH 2MNUA 4M6NH 2R0KH 3QK0A 1INEH 4XP5H 5KS9E 5ESQB 4I5BA 4RMQA 5KSBB 5HI5D 1ZA6B 3KDMA 3PRZA 1G0DA 2CAKA 1RURH 1M2OA 2OPCA 4L2YA 3FF8A 1X5MA 4JFPB 3X1NA 3LV3B 4Y4FB 2JKWA 4HWZA 2EXTA 1OPGL 4G8IB 3FS9A 1CLVA 2OXHB 3VWKA 4NNYB 4N2MA 1EO7A 2JIXA 2X53A 4OZGE 4UQ3A 4XRCB 2CLRA 4OT1H 3CG8A 2CE6A 1FL6B 4YAQB 4AGLA 4GBXA 2UYLA 1G7QA 1I7RB 4E9LA 4K5MA 4NO0A 1CFMA 3U30B 2OL3B 1WHPA 3SPVA 2OX5A 4NRXA 2N4IA 5DZOA 1QACA 3IMWA 3GSQA 2BP3A 1N8ZA 1D3CA 25C8H 3LDBC 1IEBB 2EDXA 4M61B 4Y5XB 5E1HB 3S3CB 3F85A 4P5MB 4A6YA 2WWMD 2FECL 3BP4A 2JB6B 4BGDA 2NZ1A 1LMIA 2M2DA 3TZVA 3BD3A 1I1AD 3M17A 4RGNE 4QHPA 4AVJA 1NM4A 3BDXA 2ZCZA 1OCZB 2EXWD 1KCRL 2KHAA 3ZRCC 4PV1C 2HAZA 1X4ZA 5JQ6L 4EN3D 5DFAA 2PO6A 4LCUA 5IB3B 1I8AA 1EZLA 1Z9LA 5CJQL 3ASWA 2E27L 5FWRA 2NW3B 5D8JL 1PGRB 4YMPA 4ZQKA 1KT2B 1CPUA 1HH9B 1KJ3L 2K8QA 3RAJH 3VFOA 2BP8B 4BQ6A 1FO0B 3B3IA 3GYRA 3VXUD 3VFPA 4NM4H 4ODWB 2CPUA 1CFTA 2IJ0C 2YMXH 3KBHE 5DMGD 3DARA 2HJLA 2R83A 3CPLB 2FVNA 3T0EA 3O4LE 5C0DB 1XGYL 4I0PC 3RZCB 5H2BA 4F8PA 2F5BL 2CKNA 5BOPA 1Y6MR 1NEZG 1RULL 1RZ8B 1BVOA 3CBRA 6PAZA 4AG4H 2UV3A 4ZRGA 2N7AA 4XMKL 2EILB 1ZEAL 5EEWA 4IGBC 1MHHB 1U8HA 5C6TH 3QZWA 2WCGA 2VXTH 2PPAA 1IM3B 1J0KA 4J28A 4UILH 2DYSB 3CSYA 3HE6C 4NC2B 1NUGA 2BS71 3L3JB 3ZUNC 4Z7UB 3Q2CA 2NNFA 3BPNB 5KYXA 5J1AA 1MRFH 1ASOA 1GVIA 4KK8C 5EORL 1A1NB 2AKRB 1LNUA 4DSYA 5LGJA 3HG5A 5AKSA 5L2KA 2YS4A 2VC2H 4CSTA 1FL3A 2VDNB 1E8ZA 3L2LA 3WTWA 3KPRE 1EXGA 3ZHDA 3D52A 3GMOA 1U3HC 2J1XA 3KPSA 5ESVB 4A38A 2ZP9A 2OR7A 3V5DB 4GMTH 4A7UA 1L3NA 3RKPA 4KVNL 5KVEL 2BH0A 3CDCA 5EBLA 4J27A 2H32B 2RBLA 2GSGA 5DUPL 3D1MC 1F3DJ 1ADQA 4WI6A 3OXRB 1F00I 2E75C 3ZDXE 2JKTM 5IESH 5CCJA 3IETB 4I9XA 2X4QA 4X0KB 4V11A 4JFYB 4Y9EA 5F7YC 2VDKH 2P5PA 2ZPKL 1HEZB 3ZQ9A 2ITEA 1NCBL 1NGPH 4DKFH 1N6UA 5FKAB 2QMKA 2QFPA 4MA7H 5AAPA 3I6SA 2C4XA 4KX7A 2X7LA 4GQPH 1M7DA 2A4EA 4NZ8A 1DBMH 4DH2A 5DJDB 5MEPB 4IDJH 4MDIB 3QCTL 4IRSC 2JIXD 1QTPA 3GK8H 2JKLA 4HKBA 3PXLA 4JY6B 4OZGA 1P6WA 3VMNA 4ZMTA 3BFQG 3RL2B 5F96L 4BFIB 4K2UH 12E8L 5CMAA 4WFGE 3MLSL 4TYUA 4WGVB 1AYRA 5GGTA 2KBGA 5CMAB 2B0SL 4K71C 1SQMA 4DAGL 4JPWH 3BZFA 3EOYG 3F7PC 2FX9H 4RQQA 4HUUB 3P4LA 2VN5A 1X7QB 4MA1B 4ZXBB 1FFPB 4NUPA 5H94A 3TYGL 2V2TB 4KMTL 1E30A 3RDTD 5EBMB 4F9LC 4UQCA 2Z31C 1JRHI 4P99A 2KL6A 3L95B 3OZ9H 3WMSA 3QDHA 2F8XC 1UB6B 4P2QD 3WE6A 3ZSSA 5A3ID 4NQQA 4I0KA 2QPEB 4UDTA 3NJHA 4XNUL 3RUGA 1LJMA 4JBSA 4W68A 2A83B 2A4ZA 1DBBH 3A4AA 3Q5YA 4J3TA 5D7HA 3RWGA 4EN3C 5DTFA 3ZKXC 4WIQA 1BXVA 2VRAA 4AZUA 3IXAA 1DVFC 2H9GB 4BZYA 1JXGA 3VGHA 4QRQB 4DW2L 2AAAA 3OMAB 4MQ7A 5C7XH 1JF1B 3ZZLA 3PHQB 2JKSA 4QRUB 3AT9A 3QDMB 3RGVA 1FWXA 3ZE2E 1KGJA 4OF3A 4E42B 4KH9A 3BUBA 3FQUA 3LKRB 4Q9CA 2EIZA 1RK0A 5IHLB 3LX9A 4AVHA 4B0MM 1RUQH 3EYOA 2DQDL 4I77H 1AGFA 1LK2B 4PREB 4KK6D 4PGDA 3L5XL 4XCYA 3HOGA 3V6FB 3HW7A 5HHOB 4I1PA 1FZKB 2VTFA 4FFZH 3SGEH 1GTFA 4AEIL 4G80B 5K9QI 1MCRA 1U91A 4N2GA 3B7SA 4X6BB 3LN9A 2EO9A 2Z4QB 4BFKA 5FGBC 3C08H 1SHMA 2YQ2A 5D93C 3UCQA 1T4WA 4L37A 5TE6H 4HU8A 1ZD6A 5FOJA 2P8MA 1MIMH 2ZUUA 4J23A 2CCVA 4HX1A 4JM0A 3STBA 3VG9C 1NJ9B 4TUJA 2F53B 5L0QB 2DH3A 1D5IL 4FQLH 1KIPB 2XWTA 4PV8B 4LVOB 3K72B 5DCCA 3O3DA 1BEXA 4UT7H 2HTLC 3ARGA 5SWZE 1A8ZA 5B7FA 1OAKH 4X4MA 3WGVB 1ILUA 1E2VA 1I8KA 1W0WA 2WLNA 4XPGL 1IC1A 5MI0B 2R69A 5BXFA 1F1AA 4J12A 1BPVA 4YR6B 1U8CA 2HJLB 1WCBA 1N7ML 3NP3A 1MG2C 2QBWA 4EE2A 5D1QD 1MWAH 4MYWB 3LJ3A 4LL1A 5IFJB 4BQ8A 1T6WA 5IWLC 4A63A 2MCPL 3SBWC 3WTSA 4PG9A 1V7MH 3NSYA 1F8TL 2YHGA 4UM8B 4EXPX 4GW1B 1HHKB 5KYWB 1GMIA 3LPFA 3EBAA 4JPQA 4BYHA 4QDGA 4JFDB 5IOPB 1HHKA 3NPSB 3FHQA 4MVBC 5KYWA 3L3JA 5BW7A 1NL0L 1BFOA 4NT6A 4AQOA 1PX3A 5ADOL 3Q6FB 3TN0A 2AANA 3IF1A 3L48A 3W57A 1E5BA 3RKDC 3ML8A 1YMME 4P4KC 1X9UA 5E1QA 2YKKA 3T2OA 4ZW5A 2EXSA 5JUEL 1OW0A 5DHYA 4WI0B 3OLEA 4N5UA 1Y6KR 2HPTA 2VITB 4DGUA 4Z3HA 1DLHA 2CXKA 4NXSA 4NWTL 3EGSA 3MRDB 4XX1G 2FX8H 5DJAA 2OTWA 3QWOA 4D2NA 2OSXA 1F56A 5E8DH 1R5WA 4YIQB 1JGIA 5I71C 1I7RA 5GRUL 1QRKA 3DX6B 1HWWA 3K3QA 3OAYH 3DGDA 3QNYA 2GJ6A 1ZS8A 2X4TB 2LOEA 4JFSA 2VDRB 3T3PB 1QPXA 1NCTA 2ESVE 3WEOA 3TTYA 5M94B 4OI8A 2EDFA 3NDZE 1JVLA 3D85A 2V7HA 2Y1ZA 3KWWB 4AYMC 1OGTB 3H56A 4DP2X 1WITA 4G6JL 1PZ2A 1S9XA 3EYFA 3VSTA 3ARFB 2KKQA 2AQRA 5ITFA 2NUPA 2NR6C 3GDBA 5F3FA 1EZUA 1H15A 3UTZA 4MD0A 4R4ND 5T33H 1F0LA 3WELA 4DO4A 4EI5D 1G4RA 3MJ9H 4W81A 4TOYH 4WJKB 3QRBA 4QHKI 2ZWYA 4FADA 5KAQF 1JFQL 3P2DA 3HA0A 3VXPA 3EYOB 4M5YH 2BO0A 1A7BA 1QLFB 5C2BL 2F7IA 1X5JA 1T20A 2UXFA 3T4YB 4ZNCD 1UD2A 3AG2B 3T0EE 2JKXA 4XBEL 5KANI 2BM3A 3CFKA 2V8LA 3EGXB 3UZVB 3PDOB 1FSKB 1OPOA 4F8LA 2WO4A 4OIFA 3Q1EA 2ZXAA 1SY6L 4JDZA 3NEXA 2Y1VA 1QKZL 1BFVL 2NY0D 3D5OF 5HHVH 3B7UX 4QXGH 3ZR6A 4NAMA 4GYBA 1E4KA 3TV3L 2Q86B 3I74A 3RVUD 4JL1A 1FNHA 3VWKB 1SXZA 1MAML 3V95A 1LO4L 2ZNXA 3G5XB 3QG6A 1E9OA 3UZQA 3OKEB 5DHMC 3CPLA 2EIEA 4APQC 3U4BL 3OJDB 3HUJA 4FYQA 2CBQA 4KBPA 3HFFA 4WNQA 5A2IH 3L3HB 2HVKB 3SQBA 1KBKA 4BK5C 2NSXA 1VGEL 1X7SA 3Q01A 2YBRB 3HCVB 1NCDH 4Z7WF 4YFLF 1TJHH 3VGEA 2N01B 5IWLA 1M56B 1U58B 3AJ7A 4HIPA 2J20A 3NPSC 4BFIA 4QTIH 3MLYL 1F2QA 4L5FH 4PJIB 5AW0B 1IQDB 4NRYA 5I0XA 3T2PA 1WWBX 4BKSC 4HWBA 1CLYL 5D2LF 3QEUA 4O58H 5J1AB 1UATA 3QNZA 3FHEA 3LKSB 4TNWK 3CIQA 5SWSB 1W72B 4WK2B 4G8FA 4PSRA 3UBXI 5FO8A 1AKPA 4Z3EA 1XB6A 4R7LA 3QS2A 4TNWF 2NY4D 5FX3A 1RZ7L 3L6FA 5GIRA 3RBSA 2YPKB 3DVNA 4JFEA 4G5ZH 3K2MC 4AV0A 2KH2B 4RGOH 2GKIA 3II1A 1OCCB 4UOW0 2G0KA 5IB4B 1ZY9A 4KXAA 2E4TA 1TITA 4PJ5E 1SXNA 4V1DE 4NQDE 3ZOAA 4JM2F 3DX1A 2EINB 1N6VA 1JWSB 3BI9X 4QO1B 3ULUL 3CFIC 3U0TA 3ZU8A 2NCEA 3HAEH 4HKZA 5E7FA 1A7QL 1RV6X 4HUWB 5D7LA 1DQTA 3N41F 4JAMB 5GZND 3VG0H 3MRNA 4WJ5B 1HN1A 2K6YA 4D3CH 3UJTH 3O4OC 1CE1L 1N67A 3L4TA 4NP9A 3UOAB 3T3MF 4HH9B 2D2CC 1FNGB 1CQYA 3PWPB 4OGAD 2Q20A 5E5RB 3F00A 2XKSA 3RDTC 3F7LA 1OP3K 2I85A 2XWJB 3GINA 3PNWB 4W4OA 3ZE0E 5HY9A 3T77B 3UZEC 2XZCL 4G72B 3APNA 3QWQB 5INCA 2OJEB 2DOCA 5I0DA 2H0JA 2JQAA 3F05A 4DETA 2ALWA 3KYOA 3K8MA 1IM3A 3N1FC 4YE4L 1T0NA 4W9EC 3P4OA 2VM9A 4CN1A 3QAZC 5GS2H 4KKBD 2M1KA 4B3VA 1J5DA 5K1JA 3FPXA 2E8YA 5GHWH 3KG5A 3IKCA 3AWGA 3TBCA 3OGOE 3J8F7 1HESA 1KTJA 3MV7B 3TV3H 1ZT7B 1JBJA 1KPUA 2RB8A 1CFSB 2CUAA 2H3KA 4HS8H 4NP4L 3O6FA 4DPCX 3VNZA 3MNZA 1A5FL 1S9YA 3WBDA 2HFGH 1EZSA 1MJJB 2VDQL 5DFWH 1RHHB 5GGUB 1DE4A 2FQGA 5D96B 1AFVL 1LQBC 3WO4C 2ENPA 4K15A 3MNDA 5JZ7D 5CSBA 4JFXA 4FXTA 4BK4A 4RISL 3CH1A 1TVHA 3DJ9A 1F90L 4ZXBC 1HJBC 3GPEA 2OSWA 1RIUH 4G6FD 2BDNL 5E1GA 1EH9A 3UFIA 4ZYKA 5HPMB 2BNQA 1OOWA 1OD7A 1ZE3C 1LP9B 4ZOBA 1T5KA 2XVLA 3MFFA 3QYCA 4HDIB 3SJVD 1YNKL 4FNUA 3T6XA 4KRNA 3FSOA 4YEFA 3BWAA 4FG6C 2XA8L 4I18B 4FNSA 3CFDA 2NY6C 5HYEA 2YPVH 5C2UB 1U58A 3PHOA 4Y19B 1ZOXA 2PYFA 3QYMA 2Z1PA 5FUZL 4DN3L 1SZNA 3BIBX 4UOZA 4FTVA 3ULUD 2PN5A 4JE0A 2J6EA 4P57B 4TNVK 1ZK9A 3AAZB 4Z7VA 3ULUE 1F5WA 1KBBA 5JIPA 3IAGC 1AIZA 2QQQA 3BVWA 3HNVH 1WV7T 3MLYH 3OKLA 3PFQA 3Q2WA 4LCVA 4OF8A 1DE4B 4X5RA 5FC9A 3QEQB 4MBRA 5EDSA 4NOBA 2JCWA 5IFHH 5L2JA 1A6ZB 5LDUA 2E9IA 5E5LA 4UI2A 2EIDA 3DUUB 4JFEB 2VLME 4LPCA 3Q06A 2ZX9A 4ZSOB 3MNZB 1WIOA 3IEAA 5C07B 4J2XA 1R9FA 1FBIH 4JRLA 2ICEA 1BZEA 4DP5X 5B4MC 5JHDE 2MCG1 4Z3GA 4F1SA 1L7IL 3CGTA 4GAAA 3ABGA 5TH2B 1FH2A 3SBWA 1KGUA 4FF9A 5C0JA 4JX0A 4BSVB 5DUBB 4NO5B 5HYQA 1A6VL 3B5GA 4Y1AA 4JDVB 2CDGA 3G5ZA 3MOAL 4LIQE 1T20B 3V0FA 4ZYKB 4UNUA 3DHUA 4A04A 4NB7A 3UAEA 2Y7SA 4G59C 2RMNA 3IMTA 1EMTL 3CVHH 1T1XB 4XE0A 4TSBH 1XCTA 3QIWB 1WWCA 1QSFD 4I4WB 1MF2L 1DJYA 1C16A 1UCBH 3OZLA 4TRPL 1XIWD 2FWUA 4KI1A 4P23A 2SEBB 4UCFA 4WV1B 4XWGH 4YE0A 3SDXF 4KHXH 2ED9A 2EYRA 3ARSA 3MLTB 4MAUH 4P06A 3O41B 5K1NA 5C0ND 4G2AA 4S1QL 5B38A 5I1IH 3RWFB 3WAKA 1MCWW 3MUGB 5GGSY 1I3RA 1X6LA 3TFKC 2ZXCA 2EE0A 3WN5A 5CM1A 5LBVA 2QADB 1OB1B 2YJLA 3V4UL 1IBGL 3ARPA 4HJGB 4HJ1A 3HKZA 4OCLC 4L4TD 1D5MB 1WAAE 3GBNH 4KROB 3BUYB 4KZCA 1TYJA 4OLZH 5EUOF 2X38A 5L6YH 4JW3A 4JPIA 4HXBH 1GYAA 5JORA 3MHZA 1OV8A 4FZEL 5AWNL 1DLHB 5EN2B 1PG7W 5BVPH 2PPDA 2D31B 2AJXL 1R5IA 2X44D 4P46D 1HXYB 3H42H 4OZHA 4PP2A 4X6EB 3QR1A 2ZUSA 3BUTA 4MASA 3BP5A 1WTLA 1ET7A 1O6VA 2OXGB 3W56A 2QR0A 2E9WA 4ZUVA 5A6LA 4QTFA 1QEXA 4JB9H 5J8OA 1LEGA 3SQOL 2J8UA 5KSBF 1JHLH 2XVGA 5JHMA 4WEEA 3D69B 3KPQA 1KIUA 1UACH 2H1PL 4L1BA 4X6CA 5ENWB 3UJIH 5EWIL 3HVDA 1N4XH 1JNLL 1RUPL 4QRRE 1TTGA 1FFNA 4QXWA 3FQRB 3BKYH 5DVNA 3OJ2C 1AZZC 3LPOA 5ICUA 4YHNB 3BMVA 3QFGA 1MHPL 3QJFA 4JHWH 5CKAA 1K8DA 5JHLH 3OC5A 1JAEA 3LNHA 5DJAB 3H7BA 3FL7A 2BP0B 2CRIA 5C0FB 3TYGH 4ZUSA 5KVGE 1FNFA 2QPDB 2EUWA 1BXXA 3FZUD 3E8UL 3WIHL 5ABZA 1BLNA 1QA9B 1XHHA 3T04D 1T5WA 1OCWH 3CSPA 5MENB 4JJ5A 12E8H 3JQOB 4JRXA 4DPAX 5JA8B 1WLHA 1BM3L 5F96H 2DQUL 3Q5TA 3VFWB 1S5IL 2FB4H 2MIZA 3MOBL 1SBSH 2YR3A 2Z7WA 4IU3A 4U6XB 3T6WA 1REIA 5I1CH 1MN4A 1CXIA 1CD1B 1CD8A 4ZZFA 4MMYA 2CALA 1M05B 5MEQB 1NWPA 1DVTA 1AQKH 4FYTA 2R7E