4DP5X

The 1.88 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 8.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp5X00
3G5WA 1BYPA 2YARA 2XVBA 3NJHA 5AZUA 2FT7A 4BDVA 2YAHA 1HAWA 2DWTA 2BWDA 1ZDQA 3UADA 3NJJA 1ILSA 3SBPA 4BWTA 1KV7A 2XXGA 2FTAA 3TU6A 4DP5X 2Y69B 1IUZA 3FQ1A 2XXFA 4AKPA 2HRGA 3UABA 1NIFA 4QKTA 4UAHA 3S3DB 2IDTA 1WA2X 1AQ8A 5F7AA 1UATA 1IBZA 4YSAA 3ABKB 1E65A 2XYBA 4E9QA 3OMIB 4UANA 1AZUA 1JZHA 5B1KA 1KCWA 2FJSA 1AZBA 3MX0B 5I6PA 5B1JA 3ABLB 4KO5A 3SBQA 2AZUA 1SFHA 5I5JA 2PPFA 2X87A 4YSSA 1R1CA 2FWLB 3X1NA 4G7QB 1ET5A 5B1JC 1JXDA 3TASA 5I6MA 3H4HA 2UXGA 3FQYA 2IAAC 3S3CB 2CAKA 4GXFA 2IDUA 2YQBA 3PAVA 2OJ1A 1KGYE 1KDIA 3WI9A 1SNRA 1NWOA 2BO0A 2BWIA 5AFAA 1N68A 1DZ0A 3QQXA 1OOWA 3NP4A 1KBVA 1OE1A 4PCYA 2BHFA 4HIPA 1PLBA 3JTBA 2GSMB 2PPAA 3L45A 3H56A 1MDAA 1ASPA 1J9SA 4DPBX 1AZCA 1SFDA 2ZOOA 4HHWA 1NWPA 1AG6A 2GC7C 3T9WA 2IWEA 3CDZB 4HCGA 2IWFA 2MTAA 4YSOA 1GS6X 4P5RA 4E9SA 4A67A 1IC0A 2DWSA 4M3HA 3SBRA 1A65A 2WO3B 2EIKB 3NSDA 1JVLA 1TEGA 3ZBMA 3GDCA 1AACA 2H47C 2JKWA 1OE2A 4DP7X 3JT2A 1SDDA 3ERXA 2CJ3A 3KW7A 1B3IA 1NPNA 2VSKB 1KBWA 1ILUA 4KOCA 1AG0A 1T5KA 5AKRA 4BDVB 5IY5B 1J5CA 1SHWA 4GP4B 3AG2B 5B1AB 4NB7A 3CG8A 1JZEA 4CSZA 2IDSA 4DP0X 2XV3A 3QJQB 2BZ7A 2HX9A 3QJTB 1BXUA 3IE9A 3DIVA 1WA1X 1XB3A 3NSYA 2Y1AA 3KW8A 3NJGA 2R7EA 1ETJA 2YAFA 1A4BA 1ZPUA 1RKRA 4KNSA 2JFCA 1BAWA 2GIMA 1AZNA 3NJNA 2HRHA 1GR7A 2PPDA 4BXSV 4BK5C 1AAJA 4YSPA 3IBOA 2HXAA 5A7EA 1DYZA 2IH9A 4E9VA 1V10A 3QJVB 3DKHA 1ZIAA 4AZUA 3FU8A 1X9UA 1F56A 1RCYA 1L9TA 1EHKB 5D4HA 3ZX1A 1A4AA 4DPCX 3V9CA 4BWWA 1OV8A 3QJRB 1ET7A 1JZFA 3X1EA 3OQRA 1HFUA 1OE3A 2XX0A 3AG4B 1L9OA 1BXVA 2DYRB 3T6ZA 3PPSA 1XB6A 2XV2A 3UACA 1ID2A 2QPDB 3WNJA 4WTQA 1CUOA 4DP9X 1CURA 1SF3A 4YVUA 4GP5B 1N70A 4DP1X 2VMJA 7PCYA 1L9PA 2BP0B 4E9TA 3ABMB 2B08A 2BP8A 2J57A 2AANA 3PXLA 3TBCA 3HB3B 1BQKA 1W6LA 2J55A 4E9RA 3ASNB 2UXVA 4YSTA 4HCFA 1V55B 1E5ZA 3ZDWA 4KO7A 5D4IA 1J5DA 3S8GB 1AS8A 3BQVA 1RZQA 3FSAA 1GY2A 3OMNB 2W8CA 3IEAA 3PLYA 3SQRA 1ZIBA 3UAEA 4A2HA 2YAQA 1TKWA 2XWZA 1OF0A 5B7EA 4DP6X 1SDDB 2YAEA 1J9QA 3FSVA 1BXAA 4W1TA 5B7MA 1JXFA 4GYBA 2JXMA 1RZPA 1E67A 4FAAB 2MRYA 1JZIA 4A2DA 2XX1A 4YSDA 2BW4A 1MG3C 3X1FA 1AOZA 4AX3A 3UGEA 3IN0A 3WKPA 1EZLA 4JHUA 4K9JA 2HX7A 3NT0A 4G7RB 9PCYA 3CVDA 3NSFA 1ET8A 1PZCA 1E30A 1NDTA 3CVCA 4F7KA 2WSDA 1NICA 3NP3A 2PCFA 1PCSA 4M4RB 3FQ2A 1JZJA 1TEFA 2DYSB 5D4JA 1NTDA 2UXFA 2QT6A 1JOIA 3PAZA 1X9RA 3FU9A 1FA4A 1KYAA 4CSPA 4ENZA 3FPYA 3GXUB 2QPEB 2YXWA 3CVBA 4PAZA 1AZRA 4P5SA 4AKQA 3AY2A 2Q9OA 3X1GA 2NRDA 7PAZA 2CCWA 5B1BB 1OCOB 1I53A 3NJMA 4Q8BA 4NERA 4WKXA 4E9WA 3NYKA 1NZRA 3C75A 4GY4A 4N8UA 1L9QA 1QLEB 4F2EA 3S8FB 3IN2A 5LDUA 1BQRA 4EF3A 3QJSB 2AVFA 1L9RA 3TBBA 3EH3B 3FYIB 2X88A 4AKOA 4A66A 2Q5BA 2HX8A 1VLXA 1PAZA 3MBWB 2LLNA 2GHZA 3NJKA 1GSKA 3NSCA 1JZGA 3T71A 1AIZA 2VW7A 4YL4A 4E9XA 3BVDB 5ANHA 3V9EA 1PNCA 1V54B 3WKQA 4L0PB 4KOBA 1ASOA 1QHQA 2PP8A 2UX6A 3NJFA 2OCCB 8PAZA 3NJIA 4GP8B 1GW0A 2XUWA 4Q89A 4NAJA 2VSMB 4MFHA 4G72B 1URIA 2EINB 2GC4C 1FWXA 5TK4A 1WA0X 1CC3A 1JERA 4W9ZA 5I6KA 1OCZB 2XU9A 5B7FA 3CDZA 1WAEA 2P80D 3WG7B 4YSQA 3EHBB 3FU7A 3QPKA 1GS7A 1PF3A 1IBYA 4E9YA 4KO6A 3N2JA 3T6XA 2HZHA 5FC9A 3QJUB 1NIAA 5PAZA 5I28A 1TU2A 1J9TA 4KNUA 3OD3A 2YAOA 4G70B 2CUAA 4YVNA 2QDWA 2CALA 4A2EA 1L9SA 4UF7C 5TK2A 1ADWA 2FT6A 3D12B 2BW5A 5I26A 1WS7A 2UX7A 1OCRB 1JXGA 1M9WA 2ZWNA 2XV0A 2FQFA 3T6VA 3X2QB 1NIBA 4AI7A 2J5WA 3HEIB 2EIMB 1M56B 4JHVA 4YSCA 2EIJB 3H4FA 2DY2A 1KDJA 2FT8A 2GI0A 3NJLA 1GYCA 2W88A 1AR1B 3AZUA 1MZZA 2EILB 2XLLA 3OMAB 2WO2B 3ASOB 1JVOA 4N4YB 4HZ1A 3ABGA 2A3TA 1GY1A 1NPJA 2IDFA 3ZIYA 1PMYA 2RACA 5I6OA 1BQ5A 2TSAA 1AS7A 2H5UA 6PCYA 3AG1B 2PLTA 2UXTA 4JKNA 1ZDSA 3AG3B 2FQEA 3S3BB 3PCYA 1PLCA 6PAZA 5I5IA 2OV0A 1A3ZA 2PP9A 1CYXA 2I7SA 2ZXWB 2PPEA 2HLEB 3X1BA 2H3XC 2R7EB 1NIEA 2GBAA 4KNTA 4HCIA 1BEXA 2YAMA 1WS8A 4KO9A 3FSWA 4G7SB 1ASQA 1XMEB 4A2GA 5B3SB 1SHXA 5EHFA 1IKOP 1PZAA 2FQGA 3PAUA 2QDVA 3FT0A 2GB2A 2BP0A 2E86A 1CYWA 1PY0A 3RYMA 3TA4D 1M57B 1PZBA 5E9NA 1AS6A 5F7BA 4TXVB 3EH5B 1FFTB 1QNIA 2AFNA 3EF4A 2CBPA 2IWKA 2VM4A 3FU7B 4DP8X 1MZYA 4DP2X 1J9RA 1NINA 2VW6A 1HAUA 3GYRA 4FA7B 4BXVA 2YAPA 4YSEA 3AW5A 1W6WA 3DTUB 3FPXA 1AANA 4HALA 2J56A 2VM3A 3U25A 3FYEB 2N0MA 2BZCA 2PP7A 2VW4A 1SF5A 2AZAA 1NIDA 4X4KA 4A68A 3EH4B 3N55A 2BP8B 1KCBA 1A4CA 2FQDA 4G71B 4A2FA 1XB8A 4HAKA 2DV6A 3OM3B 3T6WA 3UAAA 4QLWA 4RH4A 3FSZA 3WNIA 1A8ZA 4F2FA 4BWUA 2VN3A 3CZUB 5I5MA 1PNDA 5I6LA 2P80A 1GS8A 3WIAA 2I85A 1YLBB 5I6NA 1ZV2A 4DPAX 2ZONA 3FS9A 2FNWA 4ZK8A 1OCCB 2IH8A 1MG2C 2YXVA 5PCYA 2B3IA 1SJMA 4DP4X 1PLAA 2PPCA 1W8EA 2PCYA 2I7OA 4HHGA 4YSUA 1E5YA 2TSBA 1BYOA 4YSRA 2IDQA
chains in the Genus database with same CATH superfamily
5FWQA 1TQBC 2NY6C 2X6CA 3EZ8A 2X0UA 4KK9D 5EF0A 3UTQA 4ANVA 2YO3A 4DUXA 3W2DL 2XVBA 1I31A 3CFEB 4Z7VE 3MV8B 1XF2B 3PFQA 4HT1L 2HFFA 5DC0A 1NUDA 1QP1A 1XDTT 2DQHL 5F89A 1BOGA 4JEGB 2IVFC 4LNRB 4QRUA 5CIPH 3FU5A 1DJXA 5DJ8A 5GHWL 1JUFB 3U36B 5IUSA 1KJMB 1YUHB 2VXQA 2HRGA 3P69A 3N06B 4EBQH 4NC1C 1X7QA 3Q2WA 4QRRD 3FB6B 1XSOA 5D2LE 3CSGA 3AXLA 4LCCA 4K5MA 5E51A 5F7AA 2XTJE 1ZS2A 3ZL2A 5GRJL 4PI0A 2Q7NA 4Z7UA 3RTQB 5SWQA 2FJSA 3TFKD 5CHNB 2DTSA 3MX0B 2ZOKA 4L4VA 5KSAB 1NMCB 2NUPB 3MO1A 2EP6A 3VU1A 1BZEA 1CDIA 3WKYA 1KB9J 4KX9A 2ZD0A 4Z7NF 4JKWA 1Q72L 4BHUA 3I75A 5CR8A 5K1NA 2YPLD 1UXWB 1YNLL 2V4LA 4GW1A 2WVUA 5J6GA 3WYRA 4EIUA 1FH5H 4H25B 2P45B 2HJLB 3CFJB 5B1JC 4EUPH 3RIAK 5EBLA 1RK1A 4URTB 2VRAA 1XZ0A 4AQAA 1PX4A 4GXFA 3RG1C 4RBPH 2E0PA 3W0WB 3HUJA 5KTEH 3IDGA 3EYOA 5IVXE 1BQHG 1OP3H 5IHUL 4N2FA 4OGXH 3RJQB 1CL7L 2OXHB 1MRCH 4G9FA 1IVLA 5FHAH 1PLBA 3L7FB 4PWJA 2JK5B 4MNGE 3TBYB 3L3KA 2AMUA 5AW8B 4F8OA 4OH2A 4PS7A 4P2QE 4JPQA 4DPBX 1AZCA 2R1YB 4UOJA 4CN6A 2RBLA 1SYSA 1AHWC 4R90H 4QUOA 3IVKA 2RCSL 4M03A 4RMWA 5FUOH 1N59B 1U6AL 2E6PA 1KC5L 4UQ3B 2ENPA 4YXHH 3SQOL 1ZOXA 1IC0A 2DWSA 1NCBL 4Y1AB 2XPYA 4JZNB 1R5VB 2PO6B 4NWTH 3NSDA 1TEGA 1SBSH 1QYGL 3PNWA 1XXDC 4XMVA 4ZUTA 1IGCL 2JKWA 4KDVA 3Q2CA 2Z91B 4P9ML 3FFCD 1NPNA 4XCEB 3UGUA 3QR2A 3UJTH 4JB9L 1DQDL 1OXYA 4OM0L 4R26L 1SEBA 2F53B 2WQRA 4PJAB 4X4MA 2VXUH 2YZ1A 1GGCH 4U1LA 1OAZL 4KV5F 1A14H 1MHEB 3KYMA 3CDGA 3WNNA 5D2NE 3HN8A 1L9MA 1TYEB 3S4SB 1KENL 2EZ0C 3H6AA 3QJTB 2WOYA 4YDJB 4M00A 4YBLB 1XSKA 3BKYH 4MQTB 2WIIA 5IWLA 1HIML 4UT6A 4BK5A 4XMWA 2EDRA 3HG5A 2GI7A 1TNMA 4PTUA 4BCXA 3S88L 4PJ7A 3JVGC 1XAKA 2YAFA 1ZMYA 4Z8FL 3MRQA 1UACL 1RKRA 3OPUA 4UB0H 1L3NA 1BIIB 3WXWL 2PYFB 3NJNA 1G84A 2DTML 1ZEAL 4BXSV 4OKVB 2AJYH 3WS6C 3WFEL 2R1XB 3UJIL 4HG4K 2QHLA 4OBRA 4UM9D 3N44B 4ZQKB 4EJ1C 2LU3A 1ZIAA 3RX8A 1D3CA 2KERA 3FU8A 5EA0H 3KS0H 4N8VA 3EOAA 2XWBB 3A6BH 4JFOA 4S0SD 5DHMC 2OR8A 1A1OB 4NYLA 3C2AH 3MNVA 1HQ4A 1HSBB 4EQ2A 4S1SH 5HGAA 4MBOA 3CZKA 3QRGH 3KHQA 5EUOB 3OKOB 4GFTB 4WO4B 3BXNA 3ARED 4GPVA 3KPQA 5BV7B 4GO8A 3C9NA 2WLNA 1KCRH 4TTDD 1NGXA 1TVBA 1R5WB 1DBKL 3KPSE 1DN2A 4XMPH 1NGZA 3BVXA 5TE4H 3NIDF 4POUB 4JO4L 1M42A 4J6RH 5AW5B 2WQAA 2JELL 1E42A 2CCLA 4KZ0A 4PJ5A 2Z35A 1I1FA 1QEXA 5IB3A 4FQIL 2BRQA 3IPEA 2C1PB 5IVOA 2YBRA 3H9SE 4OV5A 3P02A 4UILL 3QA3A 1RJYA 3EOYG 3B43A 1MY5A 2VN4A 1NSNH 4QHPA 1E5ZA 1A3QA 3GRWA 1M6UA 4LCUA 5SWZA 4J7RA 4YR6A 1AS8A 2NNRA 3FZUC 4HK0B 2GCYB 4IDJH 5D1ZC 2AQ1A 4K3EL 4GRWB 4TVPH 1SXAA 4PV9B 5CJQH 1OF0A 2APSA 3LN4A 1KTBA 1P4LA 1SDDB 3MCLL 2XY1A 4GKOA 3W82A 3Q2VA 4YBLC 4YEFA 5JPNB 3HC0B 4N2IA 2P8PB 4H88L 4JO1L 1MLBB 2XWRA 4WCYL 1T0PB 3O41B 1KCVH 4M8QA 4AEIH 5B7MA 2YRZA 5I0YA 2VDRH 1G0DA 5CN2A 1AHWA 2O5XL 3BJ91 4P9HC 2BW4A 3GEFA 3SB3A 2NQCA 2VE6B 3CFEA 3FMGL 5C3TA 3MV8A 1EHXA 2X41A 3N3EA 3WFCL 4NHCL 3N1FC 15C8L 4UIMB 4BK8A 2K78A 2JQAA 2A9NH 2ZOWA 2WLKA 1JUFA 3U36A 5CD5D 1KJMA 1YUHA 1WV7T 2UZXB 1ZKAA 2BIIA 3UEZA 3DO4A 4HLZH 2WNGA 3FB6A 1I9RH 1XTMA 2G2RB 4TVPE 2VWEC 2L7UA 5E2TH 4K8RC 3BSHA 3JTSB 1UD5A 5D5MF 4WO4C 4IMKC 3WL9B 4K71C 4U7SA 1S9KC 3VFSB 3RTQA 2H32A 2VLJB 4IW4C 5CHNA 3MX0A 1F2QA 5KSAA 3IGFA 3WNMA 5GS0C 2C3GA 2EDQA 2NUPA 2FBOJ 1E6JL 3SOBH 4P3WA 5KS9B 4S1QH 4YHIB 5SWSB 3J7HA 1T4KB 1HHIB 3EJZD 1UXWA 3IU4L 5I82A 4B3VA 5GGTH 5MENB 1BFVH 4DUWA 3OXSB 4H25A 4L23A 1EBAA 1E27B 2HJLA 3CFJA 3L4CA 4HVBA 3F83A 5L2KD 2LLNA 3QUXB 4RFEB 5DZNA 1GSKA 3V6ZB 4G3YH 4I9WD 4NKOB 5E24E 5C0JB 3W0WA 4Z7QB 3V9EA 3N1QC 4KJYB 2OXHA 3WEXB 1SLUA 4L0PB 1J8HB 3SGDI 4FA8A 3GZKA 3MV7B 3L7FA 4N2CA 2JK5A 1NCHA 3Q1SL 3TBYA 2EDTA 5T1DH 3B5GA 4W9LC 2FH8A 2G5BB 3WAKA 1OT2A 4U7KA 3U9PH 1JPTH 2G5RA 5EO0B 2WJ5A 2R1YA 5GPRA 1VKXB 2BFGA 4JVUA 4AYFB 4CILA 3EO1B 3ETBJ 3GXFA 2MPAH 1IEBB 1N59A 1TJGH 4LHUG 4UQ3A 4Y1AA 2OBGA 3N2JA 3TS8A 4Q9CA 5HYJD 3RVVD 4FQXD 1R5VA 2PO6A 4JZNA 3C6SB 4K5OA 4Y9BA 5D7JC 5HD8C 3O0RH 1U33A 1HH6B 2I60L 5PAZA 3AROA 3V0JA 1RMFH 4FLOA 4LBAA 1JSYA 4YBQC 4YHNB 3ZKMC 5FGBA 2Z91A 5CSBA 1L9SA 4XCEA 3QEQB 2F53A 4PJAA 3G6AB 5CGMA 1MCBA 4WFHE 2WBJD 2PR4H 1KGJA 2DIEA 4IRZA 2YFOA 5D7SL 1MHEA 4OLUH 2JH2A 3HG2A 2WP3T 1ZHBB 1SM3H 3S4SA 5B38G 3EBGA 4OZFG 4ZS6C 1F3JB 5SV3A 2UZIL 4YDJA 2AAVA 3GDBA 3RGVD 2LE9A 1JBJA 2NX5D 2DQFB 4GH7B 5LN4A 2JI3A 2HFGL 1BIIA 3UP6A 2PYFA 1A21A 4X5PA 4M8VA 5IK3B 2PW1B 4OKVA 1CD8A 2RACA 3GMPB 4ANXA 2R1XA 5AENA 2VLKB 2D7MA 3U0WL 2QV4A 4ZQKA 3H1ZA 4F8LA 1MCWM 3OAYH 3BSGA 2XOTA 3D4GA 1Q4NX 3A67L 2XWBA 2PP9A 4MXQC 2OK0L 1NEUA 1A1OA 3ZZ1A 4YDZA 1MFUA 1HSBA 2ZXWB 4YWGH 1NIEA 4PMEA 1A7QL 3W39B 4ZXBC 4JR9H 2VZSA 3CXDL 5EUOA 1SVBA 3OKOA 1J18A 3VI3F 4WO4A 3HG3A 4H5SB 5D7LE 2Y2TA 4M7LH 3G04B 2VDLB 3GKZA 1PY4A 1ASQA 1R5WA 1ITBB 1SXZA 3RHWK 5DZAA 2EYTB 1C8QA 4DGYL 5CJ8A 2X44D 3FT0A 3MUY1 5DWUH 4EE2A 3UG4A 3H55A 1XGRB 5ANME 4XMLL 1N64H 1D9KB 3ATAA 1M57B 2C1PA 4U1MB 5GS1B 5IESL 5HDLA 4RRPG 1NANH 1E4XH 4QRFA 1A7RL 2K4WA 3TO4C 4JPSA 4FP8H 3BH9B 3GSNL 5IMLB 3IDYC 4QHNB 4FA7B 2ODHA 4BXVA 4U6YB 5DMJB 5E6UB 4ONFL 4DGVL 4HK0A 4PJDF 1A3RL 2GCYA 4Z7VB 3UG3A 2B59B 1AANA 2GEEA 1P5UC 4PV9A 3HG4A 5DHDA 3VW3L 5KVEE 1SF5A 5IHZB 4QAWA 3GXNA 5JPNA 1IEAB 5BUAA 5FA3A 1TLKA 3HC0A 2P8PA 1YVLA 4K9EL 1MLBA 3O41A 4PG9B 3KLKA 5T5NG 3NIGF 2OM5A 2WMPB 3C5JB 2FEEI 2HT3D 5E6IB 4MGXA 1B3JA 2NZ9D 2VE6A 1RAMA 4XVJL 5D2LB 2QVMA 2YJLA 2BVOB 3EDDA 3KAAA 2XTJB 2BS71 4BFKA 1KLUB 1PNDA 4FXGC 3FRPG 3IK2A 1MG2C 4I0PB 3CH1A 1G7IB 4KI5C 4Y8AA 5I1IH 4P49A 1OTSC 1S5IH 4DP4X 3JWNC 3S35X 2UZXA 1MEXH 1FNSH 4XOBA 5J13B 3S3PA 4FNTA 2DYPD 4BD4A 4AH2B 3IKCB 3JTSA 4HK3J 4IGBB 1E5CA 3KYKH 3WL9A 4KDWA 4YHKL 3HI1A 2R2HB 5I74C 3ZKNC 3DVNB 3VFSA 2VLJA 4N26A 2EEBA 3RGHA 3V8CA 1QFWM 3IETB 4NENB 4BDVA 4F57H 3D2UB 4LOUD 5IVXB 5KS9A 2FECI 5SWSA 5CINL 5J5EA 2F7OA 4BFRA 3MKKA 1T4KA 5CJXA 5C0EB 3AB0B 1HHIA 4MNGB 3RVTC 4R7VA 2ENJA 5MENA 4AV0A 5D1QE 3OXSA 1GGBH 4LMQI 1E27A 4JM2F 4P2QB 4XP1H 2BC4B 3IAGC 1E4WL 3QUXA 4RFEA 3QPXL 1Q9KB 1YEFL 3V6ZA 2XQBH 1UATA 1IBZA 4NKOA 4PRID 5C0JA 4E9QA 1SY6A 2IC2A 4JPKH 5B1KA 1F4WL 1F3DH 4KJYA 3WEXA 1EJFA 3MA9L 3TIDB 1F8TL 4E2OA 1MCPL 3D5OF 5TDNB 3FAXA 3MV7A 4TSBH 4Y4HC 5M95B 3Q7JA 4R97C 2WO4A 4QTHA 4U1GB 2Q3AA 1IBFA 1XCQB 2BOLA 3O2VL 2G5BA 2IH3B 4G1EB 4TQ8A 2IPUK 3BUTA 5EO0A 1VKXA 1LE5B 1UZ6E 4BFOA 3AAZB 4F9LC 3P77B 3BC9A 1DSFH 4K3GA 3P4MB 3CFBB 4R9HA 3EO1A 1A7PL 1IEBA 1TFPA 1OLLA 2QKSA 2GUYA 3GUFA 3QAQA 3UMNA 1MKFA 2CAKA 2XTJC 2HT2C 2YQBA 4MS8C 4HXAL 3WI9A 3C6SA 3H7LA 4N0CC 1JZ5A 1OOWA 3T3ME 4TSAL 1OE1A 4FRWA 4YHNA 3CMOH 3FCBA 3MJ9H 5LNEA 1H6TA 1HXMB 4K2UL 4KX7A 4KZEH 4WWPA 3QEQA 3OLEA 3GTVA 3G6AA 3BD3A 4ZO9A 5JR1H 3SY0B 2NLJB 4HHWA 4J39A 4WW2C 1XX9C 1ZHBA 2YXFA 2D7TL 3DETC 2EYSB 2G30A 3MV11 4OLZH 4V33A 5HGDB 1F3JA 4A67A 4CUCA 4XVSL 4U3HA 2XFGB 2R4SL 4AJVA 5C6TL 3RPBA 4M61B 1EQWA 3I74A 2DQFA 3WY1A 1PD0A 4I2XA 2HP4A 4S1DD 2JI1A 3FFOA 3D87B 4A2MA 4X4YB 4JG0L 2VSKB 5IK3A 5DZ9A 2AEIT 2PW1A 1OSEA 1NCWL 3GMPA 2J21A 4XWOC 3TT3L 2VLKA 2UYLB 2D3JA 3CFKB 4J3OF 1CLZL 1H8LA 3KPSB 4F7CB 5IW3A 1GL4B 1MAMH 1WITA 2NOYA 4I18C 3WY4A 2N1KA 5C2UB 1AKPA 2W5PA 5DR5H 1OWRM 2VT0A 2F61A 4O51B 3H9SB 2HWZL 4RWHA 4XVUC 4Q9RL 1CE1H 4HETA 5B39B 3W39A 1ML0A 4ZO7A 2BFVL 5DUPL 3OR6B 4H5SA 5DHXB 2VUOA 3TBTB 5L8KB 3T2PA 1GXEA 3KLQA 2L04A 1IC5L 3G04A 4ISVB 4JG1L 3UPAA 5E5LA 1J8KA 3DJZA 1W9XA 4WEEA 3SKOB 2EYTA 1SN2A 4XN5A 5DD3H 4HFUL 5D2NC 4WUUD 5DJ2B 1XGRA 3BKJL 2MMXA 1D9KA 4Y19E 5GS1A 3NFNB 4U1MA 3HR5B 1TXKA 4IJ3C 3WTXA 3CWGA 4FI6A 4U7MA 3GK8L 4M7LT 2GTQA 5KBKA 2WWNA 2VXSL 2B4CC 3E8UH 3BH9A 3OKMB 4J3UA 3X1EA 3RA7H 1KPVB 5IMLA 1QBAA 4QHNA 3OXRB 1P7HL 4PG2C 4U6YA 3BGFB 4GUQA 3V5DB 1NCNA 3BQUC 4L9LB 5KBPA 2PR9A 4Z7VA 2B59A 1S9YB 4X80H 3OX8B 1MW1A 3FTWA 3VWJD 3FTGB 1GOFA 4Z7OE 4LLDB 1YEGH 1S7RB 3LX9A 1CURA 1U8QB 3FO0H 2CMRH 5IHZA 4BQBA 1RZ8B 1JRHH 2ADJB 1IEAA 3BDYL 4Q14A 5E2VL 3D3VD 2IQ9H 4ZTEA 4DZ8B 4PG9A 1OM3L 4ZMLA 3FUIA 3TN0B 4FTVD 4YN3A 4F8QA 4AJYV 1NPUA 4NC2B 4AJ0A 3EBAA 4PRNB 1Z9MA 2WMPA 3C5JA 4CSTA 1V55B 6FABL 1DVFC 5E6IA 3FB8B 5I1GH 3VO0A 2ICWJ 1DTUA 5D2LA 3ZKXC 3L2NA 2BVOA 1B2YA 1LP9F 2IGTA 1KLUA 1TVHB 3ARBC 1O6TA 3WJLA 4YZFE 3X3GH 2CRIA 1X5MA 4UINH 1KPRB 2VDRB 4DERA 4LEXH 2X38A 1LK3L 4I0PA 5JTWA 3G9AB 1A9BB 2AI0L 2N7SA 3JWOH 1CFVL 2DLEA 3MV01 3DPDA 2VDNH 1E67A 1PZUB 4AWJC 4AH2A 3IKCA 4NNYB 4IGBA 2Y3AA 2VL5B 2PN5A 4JRXE 1EX0A 2R2HA 1LO0H 3DVNA 3F8UB 2BJMH 4U1JB 1PS3A 3U30B 4F9PC 4UOQA 3IETA 4YJZL 2Z93B 4NENA 4MAUL 4AW7A 4K3DL 4ZI8A 5E4AA 3D2UA 5LGYA 3T0EE 4DESA 3PHSA 5IVXA 1CBVH 2OSYA 3LXBA 2AXGB 4X6DF 1CTNA 1E30A 4AVKA 1E4KC 4XBEH 5C0EA 3THML 4PW3A 4MNGA 1W91A 1AO7D 1DJWA 2Z31D 3TPUB 1EEYA 3ULUC 4P4KB 4P2QA 5E5RB 2UXFA 2BC4A 2DW5A 4WJKB 3ZTEA 2CGRL 3QISA 4Z77B 4FERA 1F6FB 1B0GB 4NUPA 5IUCA 3L3HB 2YUWA 3QW9A 5K5YA 1JYWA 2F7RA 4BFJA 1BPLB 3EFOB 4GOSA 1KPUB 3TIDA 3ZTNH 3WLBB 5TDNA 1JPEA 3C08L 1X4YA 3C6LC 4WJG3 2H1PH 5CLWA 3QG6B 4JKLA 1IL1B 1J88A 1XCQA 4C4KT 1LGVA 4PJFE 1QR1B 4G1EA 3MRJB 12E8H 4OD1L 4YLCA 2NY4B 3CIAA 4HBCH 1LE5A 3B4NA 3AAZA 1VDGA 4LOFA 2N7AA 3P77A 4MCMA 3ETBF 4OCNC 3DK0A 3P4MA 3CFBA 1THCA 1KIQB 4LSUL 3MBWB 4M93C 4MJ2A 3LPWA 4WW1B 5GRWA 4Y2DC 1BF2A 4AV4A 1T7ZA 4G7VL 5D2NA 1AIZA 5IG7A 1KFGA 3EYFB 4NRXB 5L88H 4HS8L 3VDAA 4ANWA 2OMZB 3GBDA 3L16A 3KGSA 5F7YC 1NC2B 4JRLA 3II2A 1KT2B 1HXMA 1NCUA 4ZUSA 4U6VH 3VD3A 4ZMNA 1HL8A 2VSMB 5LG1A 1CF8H 1DL7L 2Y0SA 4NIKB 2DWXA 1WAAF 2HJFB 2NLJA 1CC3A 3BQUA 4LPYA 5E6YA 5TK4A 4KZDL 1PD6A 4P2RE 4FYSA 2EYSA 1DJZA 1Z5YD 4FHBD 1H3GA 5HGDA 2CGYA 1IBYA 1YG9A 2DLFL 5IQ9B 4RIRB 2WLJA 3SGKC 1PLGH 5FC9A 3B7YA 4M61A 1U3HB 3I9GH 1G1OA 4G70B 3RUGE 4X4YA 4PW4A 1BFSA 4UF7C 4YHYC 2ZKHL 3NQKA 3VXUE 3RKPA 4UZSA 1RULL 3RFRA 3K72B 1OPGL 5EZPA 5A2AA 1PTZA 3KYAA 4AUUA 2UYLA 2UZYB 3CFKA 4ZMAT 2V7NB 1YMHB 3ZJAA 1MELA 3KPSA 3IJYB 3ZSTA 4HQQL 3SKJL 4R3SB 2YD3A 3N1GC 3QQDB 4QDGA 1C5CL 1SXBA 2BIMA 3W2DH 5ANMB 3S3SA 4TLUA 1GYCA 2TAAA 4KK8C 3H9SA 4HT1H 3GPEA 2EILB 3VTTA 4X2UA 2DQHH 2KC0A 5B39A 5HJGA 4HYTB 3VM7A 2B7DT 3VYPA 4AM0B 2WLZA 3OR6A 2Z0BA 3IPBA 3TBTA 5GHWH 2ARJB 2ZSWB 4ISVA 2Q8AL 4ODVL 4K5PA 3SKOA 4XAKD 2QGDA 1TT6A 3MMEB 5DJ2A 2ZG1A 3L48A 4X99B 1MJJB 1K4DB 1GHFL 4JKNA 1OVZA 3WENA 3MLPA 1Z32X 3ZOAA 3HR5A 3SDYL 5IJKC 5GRJH 4TV3A 3QQNA 2ZKYA 1CYXA 5K59F 3S2AA 1CK0L 3OKMA 2CO2A 1KPVA 3OXRA 43C9B 2BCMA 4APQB 1M9SA 3V5DA 2J88L 3ARGD 1Q72H 3I9AA 4L9LA 1ECZA 4X9IA 1DSWA 1EGJL 1FQ9C 1S9YA 1YNLH 1YJDL 3OX8A 4OFIA 1DJIA 3FTGA 2Q86B 2CUIA 4LLDA 1S7RA 1U8QA 3B37A 4IKKA 1RZ8A 3K4DA 2ADJA 2A1WL 2E86A 4DZ8A 1LK2B 3POHA 5DO8A 1PZBA 3GSOB 3TN0A 1QD0A 4HW6A 4JUSA 2CA4A 4PRNA 4DTGL 2E47A 2IWKA 3L4WA 4LASL 1CL7H 5DMGC 5IHUH 3UTZB 3GO1L 3DIFB 3FB8A 1N6QL 1J9RA 3O4LD 1EZSA 2VERA 2XTLA 4HKBB 1AKJB 3DUSB 1TNNA 1KPRA 3U25A 3FYEB 1Z1WA 3EZJB 4YHZL 2H2SC 3EH4B 4KV5E 1I3VA 1U6AH 1NEZB 2XXMB 1KC5H 4C83B 2YN3A 3FRUB 3SQOH 3MLXL 4IOSD 5D1QB 5E8DL 2PCPB 1L6ZA 1QYGH 2FATL 4RNRB 5AOMA 4HZLB 4NNYA 2LGNA 1MUJB 3D2TA 2VL5A 5JQIB 1IGCH 1LL1A 2MPVA 4PU2A 4F2FA 4U1JA 2HYMA 4P9MH 3BPCB 1G1KA 2Z93A 3EGSB 1M53A 4XH2B 3KVDD 4JB9H 1DQDH 3LNIA 3QIBB 1MI5B 4OM0H 4R26H 2ZF8A 3ZUCA 4PM1A 3SYPA 2D0GA 2AXGA 3BP6B 1OAZH 1ZWIB 4MDJB 1D2PA 3TPUA 4K7PX 3VXRD 5F9OL 4P4KA 5IMOB 1GC1C 3KBHE 1HIMH 4Z77A 4YSRA 1B0GA 4OI7A 4APQC 1O7SA 5FIEA 5JIMA 3S88H 4BQ6A 3L3HA 2JKNA 1OW0A 4OCXL 4Z8FH 1ND0B 3EFOA 5IHWA 1UACH 1JNJA 1KPUA 2XQ0A 3WLBA 2XZQL 3WXWH 1LTXA 2DTMH 1ZEAH 2DWDB 2DWTA 3QG6A 5AW3B 1IL1A 3WFEH 3T3MB 3B8SA 3UJIH 2F18A 3LB6C 2M8XA 3MRJA 3N40P 4Q4IA 2X4SB 4JHAL 2XXFA 4W4OA 1WZAA 4OIBA 5LHDA 1KIQA 3S37X 2JF1A 3MBWA 3ZHDA 5AAWA 4WW1A 3LZNA 3G7TA 4TUKL 3CN2A 2WC7A 3H9ZA 1TO4A 3VGEA 4XP6L 3MGOB 5AVQB 3M8OL 4EVNB 5AYUL 3EYFA 4NRXA 4L0YA 3ZZQA 1KCWA 5FLVA 2OMZA 5CP7B 1WZ1L 1HNFA 3U2IA 1NC2A 3TZVC 4YZWA 1EO7A 1KT2A 1WTGT 1DBKH 3SE9L 1Q38A 2CHNA 3TGXA 4PJ9D 4AT6B 4JO4H 4MMZB 2JELH 2J6EH 3MUUA 1NOAA 5BQ7A 2HJFA 3QPQD 1EO5A 2NR6D 3F65A 4FQIH 4ZS7L 4YSSA 5DF0A 1ET5A 4UILH 3LEVL 1D5IL 1E2VA 4OLWL 2YPVL 4NQCE 4HOXA 2C5DC 2NTSP 3FQYA 3S3CB 2NXYD 5IQ9A 4RIRA 2E9JA 3FUKA 3CLWA 4YHML 4GS7C 3RWJB 1BREA 1U3HA 3K8MA 4JFYB 5JORB 1R33A 2JB5L 3GBEA 4K3EH 4NDMB 32C2B 4CADB 2OX5A 4WJ5B 4EXPX 4NNPL 3MCLH 3K72A 3NRPA 1U92B 2IMNA 4H88H 4JO1H 4NCC1 3QR1A 4WCYH 1NWPA 5BOZG 4X5XB 2GC7C 2UZYA 4H26B 5EEWA 2V7NA 5IZ7A 3VI4F 5DURB 1YMHA 2BVYA 2O5XH 3K2MC 3IJYA 4U4IA 1JGVL 1SYVB 4R3SA 3QQDA 4XVTL 4L1HA 4PLKC 4M3HA 4LCWE 5ANMA 3FMGH 1WGOA 4AUYA 1FO0L 5D5ME 2X6VA 4Y19B 1RHFA 2ZP8A 3LKRB 4NHCH 2BNQE 3WFCH 4JFWA 4AOFA 15C8H 2ADFL 5CMAB 3W9EB 1P7BA 1OE2A 4AM0A 1JK8B 4P2OC 3ZYJA 1B3IA 2ARJA 2ZSWA 5C0FB 3B9DA 2D3NA 4FFZA 1T5KA 1TPXC 3NPSC 1IC4L 3T4YB 5B1AB 4DEUA 3MMEA 1U3JA 2FO4B 1MJJA 1NCDL 1UJTA 1K4DA 1S9XB 4R7XA 4Z7OB 4WFGD 1UFUA 3N9GL 3SY0A 3LDBB 5HHMD 4GKSB 4KMTL 4LOEA 4N68A 3ASWA 5IVZB 4GMTL 2FO1A 2W0PA 1MCQA 4ORZC 4RGOL 1E6JH 43C9A 3IGUA 4APQA 2MNWA 1RV6X 2VKWA 2N56A 3IU4H 4N90E 2Q86A 4QOKE 4WTZG 3UTSD 2X28A 2GJPA 3RB7A 3TESA 2ZUTA 1QW8A 4EI5C 1Q8MA 3QJVB 1LK2A 3QYCA 3ZE0F 3GSOA 5DJXB 1B0IA 1A8JH 2BWQA 2Z64C 3F6IA 5T5FL 4EN3B 4N25A 2VSCA 2AQTA 2EDDA 3UTZA 3DIFA 3GJFK 2DEYX 3T77B 2ORBL 3Q1SH 2PXYB 4AC2A 3C09B 5J12B 4ZAKD 2E7LC 3APMA 4NIYE 4HKBA 1AKJA 3DUSA 3BDXA 4YDKL 1BEYL 1TQVA 3T6ZA 3PPSA 2C3WA 1KBKA 4W81A 4HLJA 2FLRT 4F3FB 7PCYA 2F8VA 4OY9A 3DHUA 3Q6FB 1NEZA 1AQMA 2YLKA 1I7TB 4C83A 3FRUA 3IJHB 5FFOA 5KBDA 1QSFD 3VFWB 5FUZL 4N2HA 5D1QA 1GYUA 2PCPA 4RNRA 4CJ1A 2WIMA 4HZLA 2I60H 5C0DB 1MUJA 3WKNA 3HNTL 3TJHD 2KT6A 1ZCRA 3BPCA 3T3PF 3EGSA 4XH2A 2C9VA 1Q9OB 3OMNB 3QIBA 4FXLA 4BM7A 3SQRA 1ZIBA 3QIUD 2V2WB 4XNZB 2Q7YB 2YAQA 2ZTBA 3BP6A 5D7SH 1ZWIA 3JV4B 2VDNB 4MDJA 5SX5H 4RFNB 5D6DC 3I9IA 1RIHL 2E6QA 4EO5A 2EIZB 5FAAA 5IMOA 4PJFB 4W6YB 5GISH 3HI5L 3LRKA 2UZIH 4I3RL 3ARRA 3L08A 3NCEB 3TBVB 3MRHB 5EU3B 1RUQL 1T2JA 2YMOA 1T7WA 3F01A 4WNQB 2YGVA 1XCTB 3FW6A 3HC3H 1ND0A 5GS2H 3WCYA 2HFGH 3EDJA 4Z9KB 2XIIA 1EAOA 3NG5A 2DWDA 1PDKB 4I3GA 3VI3E 9PCYA 3B3IB 3BUIA 4AE0A 3G08B 1DJHA 3U0WH 1P0SE 3US0A 2X4SA 2ENYA 1U8PB 3APDA 4WU5B 1GGIH 1L0YA 4ZDHB 1QSVA 3A67H 4WV1C 4IIQC 2QT6A 1N0XL 2OK0H 1UUNA 2ICES 3N40F 3NPZB 1ZLEA 3C09C 4JY5L 3MGOA 1AZRA 2F74B 4ZD3L 1YHPA 1KGWA 4EVNA 1A7QH 3NCWA 1JDDA 4HJ0C 3CXDH 2OW6A 4HAFA 3D7PA 3MBEC 5CP7A 2MCAA 2PTTA 4C59B 3WD5H 2AXWA 5C09D 1AXTL 3HNVL 3T0EC 5JOEA 1BWMA 4Z95L 4N8UA 3ELAT 5G4MA 1RQ5A 1KULA 2P47B 4AT6A 1PSKL 1W72L 4MMZA 4BFFA 3RUGB 2IV9A 2IGLA 2YRLA 4NBYB 4XMLH 4A66A 3VXUB 3AT8A 5IESH 2HX8A 2QVFB 3HFML 4WI7A 1A7RH 3WFBL 4D9LL 1J0ZA 4FQ2L 4HOZA 3NIGE 3SKUD 3GSNH 2VW7A 4JG9A 3HE7D 4LEEA 5E6ZA 4ONFH 1EEQA 3W57A 3EO0B 3ZQ9A 4DGVH 3CMGA 3RWJA 1A3RH 1SXSA 2EO7A 4JFYA 1UB6B 5JORA 3RDTD 3RLSA 4NDMA 2X5PA 4I77L 32C2A 4CADA 3S6CA 3VW3H 3V0EA 1FPTL 7TAAA 4K15A 4QYOB 4WHYH 1U92A 4K9EH 1TR7A 3L1OL 4LPWA 4X5XA 4H26A 4JQIL 2D3LA 5GS3A 4NO3B 3EUUA 3Q06A 3FL7A 1SYVA 4P04A 4U2YA 4XVJH 1AZVA 1RJZB 3CBRA 4OFVA 4Y19A 3LKRA 3W9EA 5CMAA 3IRZA 2NY1D 1XV8A 3OD3A 1NFIB 1NBVL 1WBXB 5FX3A 1BD2E 1JK8A 3KJ4B 4PPTA 2ED9A 1X5IA 5F1SA 5C0FA 1PBYA 3A6CL 1DVYA 3TONA 4WWID 4PI2A 1KIRB 3VQMA 3T4YA 5FCSH 3SODB 2CR0A 2YOCA 2R69L 3I3EA 2FO4A 1NBQA 5K1VA 1S9XA 4ZPTB 5D6DA 4DVBB 4XT1C 4GKSA 4YHKH 5IVZA 1U8HB 3OF6A 3NDYE 1IEHA 4IBWA 5KW9L 5F6IB 3IYLW 2WLYA 1KCUH 4N2LA 2GK2A 5CINH 3JYCA 2Y24A 1PG7L 5EG6C 3VA2C 4PTTB 1N10A 4AQ8A 1V3MA 4XNUL 4J3VA 4BZ1L 1TDQA 4K07A 3TT1L 1E4WH 2JMRA 3QPXH 1OQOA 3ARDD 4PJIF 4QHKJ 1M6OB 5DJXA 2FQEA 3QAZC 3S3BB 4TM9A 2VXVL 4EN3A 2KS0A 5I5IA 4K5NA 1F4WH 1LMKA 1IO4C 2HLFC 1ADQL 3MA9H 1F8TH 2HB0A 4PFEA 1MCPH 3TPKA 5AW1B 4MNQE 5D96B 2WNXA 3T77A 3NEOA 3D39D 2PXYA 3BFQG 4E68A 1FAKT 5D1XB 4M8RA 5FF6B 3O2VH 3U1QA 4J3OH 4JRXA 3RDJA 2DM7A 1V27A 2IBGA 1G7MB 3GS4A 1XMEB 2NT0A 4HEPA 4F3FA 2JKRM 4CBZA 3PAUA 4EUPG 1A7PH 5GZNC 3Q6FA 5HHOE 3EAKA 1I7TA 3GNML 3IJHA 1CYWA 1AXIB 1FZMB 3VFWA 4HXAH 2ALAA 3FN0L 3EH5B 3HNSL 4JGNA 4QRPD 4JY6B 5C0DA 4OJCA 4OD2B 1RJLA 3A22A 3FU7B 4R2GC 4TSAH 4ZPVB 1OALA 3QHFL 4MBRA 4H8WC 3KZ8A 3ULVD 1UD8A 2W9LA 3DURB 4WF7A 1KTJA 1Q9OA 1FLRL 4BEIA 2V2WA 2Q7YA 3LNGA 3IJEA 5J4MA 5B8CB 3JV4A 4PJXF 2AZAA 1PIGA 3B7RL 3KL5A 1XL4A 2D7TH 2EIZA 2ZQKA 5BJTB 3NA4A 4LIQL 5F7DB 4PJFA 1CL7I 3WGUB 4XVSH 1NDGB 2R4SH 2FQDA 2YKLL 3TBVA 5C6TH 3MRHA 5EU3A 2G4GA 1XB8A 4GUCA 4PJ8D 4YBHA 3GHBH 4WNQA 1WISA 5B4MC 1XCTA 3QNXB 4ATTA 2W0FB 2WN3A 3RL2A 3K3QA 2QZQA 3ZTCC 1SOQA 4JG0H 2IF7A 1O9ZA 1GAFH 5FO2A 1PDKA 2XG4B 3B3IA 5EFIB 1NCWH 3G08A 2E74C 3TT3H 4R8WL 3VXTB 3T2LA 4BFBD 2A9DA 5HDQL 5IJVB 4LHQB 2G4EA 1UQSB 1U8PA 2VZ3A 1CLZH 4WU5A 3MRFA 4ZDHA 4G43B 4YHLH 1OGAE 3P73B 1FLTX 4DEPB 3GMRB 3QFJD 4NN7C 4AM0Q 4HHGA 4LLVB 5FYJU 1JYNA 2A4EA 4K3JL 1C5BL 2HWZH 2V2TB 4Q9RH 4P2RA 2ZYIA 2F74A 2YARA 4NQCB 1S7UB 2BFVH 4LDEB 5DUPH 4F7PB 1UKSA 3QYMA 1MW3A 3UX9B 4UNIA 3B2PA 1IC5H 1E8ZA 1W8NA 2KDYA 4JG1H 1W80A 4ZOEA 1NFKA 4WHCA 3IT8D 2FWOB 1KV7A 4HFUH 1PCXA 3RUGA 4J3BA 3MV9E 3FQ1A 4KGLA 4L18A 1AP2B 3VXUA 3DIDA 5C0ND 1LD9A 1U91B 2YPKB 5AW9B 3L3OB 1FYTE 3L5WB 3QZWB 4UAHA 3GK8H 3S3DB 2DJUA 5I6NA 2OP4L 2VXSH 3KWWB 3OMIB 4UANA 4LHUD 5IFJB 2J8UF 4HWZB 1KCLA 5A6IA 1Z3GL 5B8CC 1A6UL 1E8YA 1UB6A 5D5MB 1VESA 2XRAL 1R5IB 3PJSB 3ZMNA 4ZMOA 1F11B 5C07D 3ZE2B 1ZS8B 1D7FA 4Q9QL 3BDYH 4KY2A 5E2VH 4GRLB 1P7QB 2B1OA 1COBA 3PP3K 5ESQA 1OM3H 4OD3L 2DN7A 3CU1A 3ZKSD 5EDSA 1Y6NR 4RAHA 2F7QA 4NO3A 3FBQA 4WEMB 2ITFA 3KEDA 4F1ZA 3GXMA 5AZ2L 2J1ZA 5GZNA 4Y88A 4QRAA 1RJZA 1ONQB 2AAAA 5JOPD 3G3LA 5C08D 1JL8A 3IXTA 5GSVB 5H37H 4GIAA 4GI9A 4P5TC 1NFIA 1WBXA 4LCIL 2ADIB 3LD8C 1LK3H 1E5AA 2EABA 2AI0H 3R0NA 3DWTA 1JHTB 2G60L 1KIRA 1CFVH 3K2KA 3QEGL 3PY9A 5CGYD 4KITB 4X83A 2ODIA 4M7KL 4NZFA 4QOKB 4JFHE 4CGTA 4ZPTA 1EWHA 2X2JA 4KROC 4LEOB 3WDHA 3I6LE 1DJYA 4XN1A 5KVDE 1K6QL 2FLBT 4DVBA 1OGPA 1U8HA 3ILPB 5TDPB 5JZ7D 3KH3A 5CBAB 3WEAA 3K0WA 3UZVB 4MAUH 2FDBP 1WUNT 4K3DH 3TV8A 3GJFB 3K5RA 3HE6C 2CBOA 5ELIA 3V0VA 3D51A 4A7QA 1P84J 4MS6A 4W9CC 4F15B 3P9LB 1HOCB 4GEIA 5DLML 3THMH 3O45B 3VFUB 1A6ZB 2J72A 1OCWL 4UTCA 2DL2A 1CICB 1D6EB 1JHKL 1BQUA 1SHWA 5MI0B 1VEPA 3CVIL 2CGRH 4HLZG 4GAFB 4PSRA 1ORQB 5C97A 5HYFA 5I1KL 2IDSA 4Y4FD 3QGVA 5LO7A 1QLRB 1M6OA 5IQOA 1Z0MA 4KRNA 4YH6A 3GXTA 5DGQA 5F71A 1BVNP 3KLSA 1WA1X 4LHJB 3C08H 3F2LA 3J2PA 4KXDA 4UUJB 1IU1A 5IIEB 1KSRA 4JNXA 1WT5A 5FM4A 4NO0D 5D1XA 4P59L 5FF6A 4YAQB 4RX4A 4OD1H 1N67A 5I1DB 5TQ0L 1G9ML 1ZTMA 1OL0A 1G7MA 3LRHA 1NFDF 3RVUC 4LSUH 3KWTA 3I85A 4H2AA 2HTKC 1OT4A 1QFWL 2YR3A 4CN4A 3RZCB 4HA1A 1FZMA 1JPSL 4G7VH 1EUUA 2JIXB 5T33L 1KWKA 3HKFA 4UMSA 4BFEA 4AYID 3EJSA 1A25A 1A4AA 4HS8H 4JY6A 2GBTA 4OD2A 4ZPVA 5F8QC 4TN9A 2ZX8A 2QPUA 4DO6A 1GKEA 2VUKA 3AG4B 3DURA 1UWXK 1HTYA 2PUQT 5E95B 1DL7H 4DETA 1CI3M 5B8CA 4KZDH 1IRAY 5IROC 4DP9X 1RUML 1N70A 3MLUL 3VI3B 1HYSD 2V9TA 5BJTA 3FNKA 5F7DA 2J57A 5BRZD 1ZV9A 2DLFH 4PCSA 1CXFA 5MEQB 1INDL 1XGYL 1TMCB 4U2ZA 4OFKA 5EBGA 4LE8A 3AMLA 4Z7IA 4H2CA 3QNXA 2W0FA 4RA3A 5D4IA 1LQBC 2WUBL 4DQAA 2ZKHH 4NX0A 3FSAA 1RULH 2XG4A 3CTTA 1OPGH 5EFIA 3VWKD 3H6JA 3V4LA 4RRPM 1FVEB 3VXTA 5IJVA 5C6WH 2K9FB 4W68A 4XMTA 3SDDD 1UQSA 4FNUA 5E9DD 4DP6X 4PR5B 1KEGL 2L8AA 4UT7L 5EZLB 1CVSC 4G43A 4HQQH 4WFED 2EE6A 3SKJH 1E9PB 2IQAA 3GMRA 1C5CH 2CD0A 4MVBD 1Z9OA 1RZPA 2CK2A 1AY1L 2K6ZA 4LLVA 3ZR5A 4H44C 2V2TA 3TM6A 2YJQA 4ERSL 1EVUA 4BK4A 5K59E 3OG6B 4LFHD 4NQCA 3AS1A 1S7UA 4F7PA 3Q8BA 5I17B 3NIGB 4B60A 2WZPD 2DH3A 3B9KD 2OZNA 2Q8AH 3RWHB 1JG9A 1BM7A 4ODVH 3VGAB 4NXKA 2KQNA 1IX2A 1R3HB 5GRZA 2FWOA 4H20L 1DVZA 2F7PA 1X9QA 2V2XA 4X8XA 1QQDB 4G83A 5F8RC 1GHFH 3WUWB 1AP2A 4LRNL 3WGVB 3M86A 2B0SL 1U91A 2YPKA 3SDYH 3CDFA 3L3OA 3DBXB 3L5WA 3QZWA 1QSEE 4Z3TA 3K6SB 1BV8A 1CK0H 3GXUB 1T7YA 1HKLL 3FUNA 4OFDA 3KWWA 5LAPA 2QGBA 4Y16C 3QUKA 5IFJA 4HWZA 2NRDA 1QLEL 2J6EA 2J88H 4LCWA 1EGJH 1JMXA 1YJDH 1UM5L 3HB3D 4K7PY 4M02A 5D5MA 3UTTE 1SLVA 2BNQA 1PPIA 1R5IA 2VXQL 3TA3D 2X3CA 1F11A 3U4KA 1M7XA 3FCUB 1ZS8A 3VU2A 1WICA 5L6YL 2OTUB 3HR6A 2A1WH 4GRLA 1P7QA 5KAQF 5LVEA 1BD2B 4HUWB 2ZNWA 2BVEA 1VLXA 4DFHA 4QAMB 2WWKO 4DTGH 4LASH 4KKLD 3PWPD 3GO1H 4JQVC 1N6QH 4WVRA 2GG1A 4Q52A 4JM2B 5D7HA 1ONQA 1CXIA 4WENB 5GSVA 1RHHA 4W70A 5E99L 4W6WB 3O6FD 1YEHL 2Q3ZA 3F7QA 1GPOH 4KOBA 1J7VR 1KZQA 1G6VK 1UOVA 2DLHA 4GXUN 2DKUA 4NUQA 2VXTL 5FYLL 1GW0A 2ADIA 2C4XA 3SDAD 4YHZH 5DUJA 3UTOA 2XZCL 4QXTB 1JHTA 2AEPL 5CU5A 3BGMB 3MLXH 2P8MB 1UXLA 1A66A 4QOKA 1YEIL 5E8DH 1P6AB 1NUFA 3RPKA 1RFDL 2FATH 4LEOA 3WN5C 4B7IA 2BXZA 5JPMB 5DJ6B 1WFOA 2J12B 3R7RA 5AOKA 3ILPA 5TDPA 5K33A 3OC5A 5CBAA 3UZVA 1NIAA 3CHPA 2C9QA 3SO3C 3GJFA 1EZVY 3QDJE 2D0FA 2I32A 4YO0B 2HN7B 4MNQB 3P9LA 1HOCA 1WBZB 2F54E 3O45A 3VFUA 1A6ZA 2IAMC 1NM4A 1UOLA 1WS7A 1CICA 1D6EA 3FB7B 5E7FA 5F9OH 5F6HJ 2ZWNA 2XV0A 3P0YL 1QI3A 3OQ3B 2XCMC 3L4XA 3N04A 1BGXL 1ORQA 3QE5A 4Y5VB 3G9VA 1M56B 4JHVA 1QLRA 2OSXA 4EAEA 5HHOB 4OCXH 1TTBA 2OZ4A 5HYEA 4ANUA 4EIZC 2XZQH 4YPJA 1XD0A 4PJEF 2X89A 4UUJA 2XPZA 5IIEA 2F0CA 4JRYE 1IAKB 4YAQA 2AEQL 3MLSL 3P4NB 5I1DA 4UM8B 1I1CA 5CS7A 1AI1L 4JHAH 1FBIL 5I1HL 1JFHA 2UVFA 1E8XA 4DWHA 4L4VD 4AG4L 3MQIA 4Y9GA 4TUKH 1GZPA 1LMIA 1IQWL 4UT6L 3RZCA 3SCMB 4XP6H 3JYBA 3UTPE 2JIXA 2BHUA 5LLIC 3FAWA 3M8OH 1JZ2A 5AYUH 1MCJA 3CU7A 4GQZA 4RZKA 4LOVA 5FYLD 4MAZA 4L1DA 1TQCB 4AQ1C 1WCBB 4ZTOL 3SE9H 4XO8A 5EMYA 1C1EL 3L81A 4K73A 3PGCB 2FUTA 4J3WA 4XTRC 2A6IB 4ZS7H 2R2EB 2MOQA 3LEVH 3VI3A 4G9FD 4M7ZC 1D5IH 4L1TA 1F6AB 4OLWH 2QDVA 2YPVH 4U0RC 4HPHA 4Z7AA 3QUYD 3S96B 2CZNA 3VI4E 1YMME 1OP9A 1RURL 5F7BA 5MEQA 1QTSA 1S7XB 3HC2A 3WO4B 1IQDB 1OGAB 1V3JA 1YQVL 2X3AA 2BIOA 2CO7B 4LB8A 4YHMH 2X1QA 2BP5M 3ELQA 2BSEA 1HAUA 2JB5H 4JQVA 5ICYB 4OUUB 2QQKL 4NNPH 5J3HC 2ZWKA 5HGGS 4BA8A 5HGHB 2B9AA 1W6WA 3GLDA 1FVEA 4Y5VC 3SQBB 4PR5A 4R4BB 4UYQA 1CLYL 2L7JA 1DFBL 5EZLA 1JGVH 2VM9A 2BP8B 1E9PA 4XVTH 2N0KA 4JFVA 3MV9B 1BZ7B 1MFDL 2EE9A 2ZXCA 3NEXA 4F20A 1FO0H 3RVXC 1UVQB 2OPCA 3GC3A 3SKMB 2ESVE 1FYTB 2JNZA 1C5DB 1CDUA 3BI9X 4AEEA 5I17A 4X7SL 3TP4A 2XN1A 3SY6A 3FQXB 3RWHA 1KTCA 5KOVC 2WB7A 1KYFA 1VENA 1BMWA 1L7IL 1IC4H 1R3HA 2DBLL 4G1MB 3FS9A 3GS7A 1OCCB 4CVXB 1RSYA 1NCDH 2B3IA 3ENEA 3WUWA 1MAKA 3N9GH 4OF8A 3S48A 1W8EA 4IIZA 3X12B 1T80A 3ZE0E 4KMTH 3DBXA 2D7NA 5DVPA 3S98A 3K6SA 3O8XB 2VR6A 1RJCA 4HWUA 2UUDK 1CZ8L 4GMTH 4X9YA 1XSIA 3KWUA 4RGOH 1NLBL 1L6PA 1YNTB 1F00I 3Q2NA 1XF5B 1HEHC 5HTSA 4YX2L 3U4EB 5JA9A 4JVWA 1IILE 4P23B 3UADA 4J4PC 4OU3A 2VGLM 1QWHA 2BX5A 2OTUA 2FTAA 3RBSA 3NCYP 4DP5X 1BD2A 1IUZA 3BN3B 1VCBC 4HUWA 4AYSA 3E3QC 3RWFB 5T5FH 3HMXL 3K0YA 4MAYB 3WJJC 4HU8A 1MCNA 1KZYA 4HJIA 4K94H 1AQ8A 4OR1A 4JM2A 1B4RA 2ORBH 3QEUB 3WU1A 1XH2A 4PD4J 3P3TA 1C9SA 4PJ5D 2OCFD 1FV1B 4D0CB 2X6UA 2EDHA 4YDKH 5KSBF 1BEYH 3T3PE 4QKXB 5I6XB 4UAOB 4X8JB 2AJSL 2OKMA 4CMMB 3ZO0A 4YFLI 1VAHA 4F27A 5SWZD 4ZZFA 4HIEB 3A3YB 4QXTA 1PW3A 5EF3A 2PPFA 2HT4D 3MFFB 4MB1A 3IPFA 3BGMA 3L3GB 4XNQB 2P8MA 3LIZA 5FUZH 4PGDB 4RDQG 4G8GE 3W11D 3EYSL 3H4HA 5F7FA 3FKUS 3P11L 2JLLA 5JPMA 3HNTH 1HS6A 5DJ6A 4WDIB 5HVWA 3ZRCC 1XSJA 1KDIA 1REIA 3SE4C 4E0RB 3I84A 4A1RA 2IDCA 5K39B 4MJ6B 4GG6E 4NZTL 1MXGA 3WIIL 3UPCA 3AGVA 1KBVA 1RZFL 5CZXC 5JQ6L 2YRBA 4YO0A 4NP4L 1KXVA 2HN7A 4MNQA 2B15A 3M07A 1PG7W 1WBZA 3QXDB 3MJ6A 1RIHH 4RMBA 5C9JB 1MDAA 1BDYA 2JJSC 5FUCC 3FB7A 1SFDA 3ZZLA 3HI5H 3MV8D 3FQTB 4I3RH 1RPQA 4AIEA 4IRSB 3K80A 5GGVL 4Y5VA 1RUQH 3ZDYF 1IBGL 1MOEA 3T1WA 4IBUA 3F5WB 2BZDA 5HHOA 5DSCB 4U05A 5T1JA 2VLRE 4N87A 3MLZL 3ZRSA 1CXHA 1AACA 4PRBB 1IAKA 1YECL 5C6PB 3K4AA 2K7QA 4N20A 3DX7B 3ARYA 1F1AA 3P4NA 1ETZB 4PLJD 4UM8A 2XKNB 1KCSL 1KF9B 1T3FB 2EZ0D 2VDQB 3RTQD 1N0XH 4MQ7B 4NB7A 4IMLB 5KSAD 3OHXC 5DC4B 4AUJA 3WNKA 4JO5A 3SCMA 4JY5H 4JUTA 2H6PB 4ZD3H 3HRZB 3Q5TA 4P9HL 5I6XC 2VR9A 3UBGA 2VMCA 1J12A 3TEZA 2JJWA 1AXTH 3HNVH 1WCBA 4XZ4A 1QG3A 3I50L 4KNQA 4Z95H 5IBUB 3CLFL 3MCKB 4ETQB 5EIVA 1PSKH 1W72H 2DQIH 3OC8A 1BAWA 1T2QH 4O2EB 3VX1A 2YGOA 1W16A 3PGCA 2A6IA 3W0WD 3AXHA 4W9KC 4G6JL 3V55A 2R2EA 3C6EA 4B9FA 2AJVL 4M8UA 5F0JB 5LXVA 2IH9A 1JGUL 1F6AA 3HFMH 2H8PB 4X6BB 2QGCA 1S8DB 4JDTL 4FQ2H 3SE3C 3WFBH 3UO8B 3S96A 4MZ2A 4MRBA 4YGAB 4B9ZA 1B9KA 1S7XA 1IQDA 1OGAA 4K8RL 2CO7A 3CHOA 2VC2L 2KPWA 5B22A 5BV7L 3UH8A 4I77H 4UV7L 1IJNA 1HXKA 4OUUA 1ANUA 5FYKU 4FLRA 5GS0L 5HGHA 1FPTH 2G9HB 2FX7L 1BXVA 2R4RL 2VITB 5FLUA 1JZ8A 4Y1AD 1S78C 4FNQA 3L1OH 2PO6D 4DH2A 3L2MA 5JW3L 4P2YA 4JQIH 4YVUA 3SQBA 4R4BA 1HHKB 1KLGB 3WIFB 2BP8A 3S36L 1UWEL 3QUZB 3MV9A 1BZ7A 4KJQC 2AJUL 1UVQA 2ADGB 2F53D 2VRQA 2MKWA 3LCYA 4GSUA 3SKMA 3M46A 5LGJB 1FYTA 1C5DA 1QSEB 5AVZB 1NBVH 2DIAA 5D8JL 2XKSA 1Q0EA 4EQ3A 3S8GB 4GT7A 4FE9A 4YDLC 2FO8A 4KTDH 1X4ZA 2OMXB 3FQXA 1A6TB 3SE4A 3A6CH 2GY5A 1FIEA 5IBLD 3SE6A 2A9AA 1IT9L 3II1A 3QZMA 1XH3B 2P49B 4G1MA 3QC5X 2EUXA 1XGUB 1GZHC 1J0YA 2R69H 4HISA 3UTTB 4CVXA 2NY5C 4CL7A 1I7UA 3KPPA 4TLKA 2X40A 3HZKB 4WIQA 4K55A 1QO3B 1VFBB 4PJIE 4CDGC 5DHEA 2IEPA 3O8XA 1IAIH 2E75C 4HGWB 1TZHA 4AGLA 2UY7B 4LSQL 5HVGB 5AW4B 5KW9H 3TBWA 1A1NB 5L0QB 1C12B 1YNTA 4OBSA 1II4E 1J0JA 1X5HA 2K3HA 1PG7H 3KMDA 1XF5A 1MCWW 2DF3A 3HN3A 4XOCA 1JZ7A 4ATWA 3U4EA 4MXVF 4XNUH 4BZ1H 3WBDA 2YEZA 4P23A 3ZIMA 2RAMA 3TT1H 3TXAA 1IE5A 3QK0A 1K72A 4HMCA 1KGUA 2WSDA 3NP3A 4O9HL 1SQ2N 5F1KC 1NL0L 2D2CC 3RWFA 3QIWB 2AQ3A 2HVJB 2VXVH 4MAYA 4G42B 1ZLWH 4X0KA 1ADQH 3TIEB 1OANA 2QVTA 4FGMA 4FJYA 4ZFZB 4G8EB 3QEUA 2A6JB 2GJZB 3PHQB 1FV1A 1AGDB 4D0CA 2AF2A 5I1EL 5IMMB 2EDLA 5DEZA 3UAJC 3GM8A 2DS4A 3AS3A 3DX3A 4GKNB 4LGRB 1J9CT 2H6OA 4X8JA 1F6LL 3QORB 4GUPB 4CMMA 2B8OT 4GSQA 3QUZC 4PJXE 5DFWH 4HIEA 5IVNA 1T7XA 3GNMH 3MFFA 4AIOA 1UWGL 2VCOA 2F54B 3L3GA 2Q5BA 4XNQA 2OJZL 3FN0H 1QSZA 4PGDA 5T3ZL 3GTTA 3HNSH 4PJHF 1SY6L 5H37A 1OP5H 2QADB 5IOPB 4WSJA 1F86A 3PL6C 4WDIA 2WBKA 3QHFH 2EDBA 2MNJB 4XCYB 3RURA 4E9XA 3EJTA 3P9WB 4E0RA 4LSRL 5K39A 4PVNA 4H1LH 3CHRA 1FLRH 4UQAA 4IRJB 2L7EA 1J10A 1AE6L 1D5ZB 3BESR 4G6ML 2OCCB 2IWGA 1QVOB 2VR5A 3QXDA 4Q89A 5C9JA 4P07A 4JRYB 5AUMB 1URIA 3K91A 4HD9A 4LGSB 1UD4A 2WWMC 4LIQH 3PGFL 3V2AR 1Z5HA 3FQTA 4R96B 3DMMB 1OCZB 2XU9A 4JGJA 4A7TA 1EDHA 2YKLH 1NQBA 3WMSA 5L0QC 1EMTL 1HE8A 5AVTB 4XB8A 4FI7A 3F5WA 1DE4B 3VD4A 2YD0A 5FKPB 4BKTC 4J6IA 4YBQD 1QMUA 5DSCA 5D70L 1UA3A 1UOKA 4PRBA 1KIUB 4KDTC 5IP4A 3GM0A 4R8WH 1XCWA 5HDQH 5I71C 2WXLA 3DX7A 1ETZA 3O3EB 2XKNA 1Z7JA 3G5XB 4KUZL 4LLAA 3NESA 1T3FA 1Y0LB 2VLJD 5LGKA 2ZXGA 4M4PA 5AB1A 1TIUA 1NIBA 4J23A 4MQ7A 4IMLA 1YYLL 4CU7A 5DJAB 4WK2B 4K3JH 1C5BH 3B9AA 4RETB 4JDEB 5SWSD 3DUUB 2H6PA 2D3VA 3HRZA 2UV3A 5E94B 4FA6A 3VI4B 4LRIC 1YMMB 2W88A 4ZX5A 3AZUA 5AAMA 5MEND 1PQZB 3OMAB 2XLLA 3L4ZA 5DVOA 3U7WL 2J8UE 3QORC 3WV0A 4WY7L 2H9GB 1F4HA 1N26A 4WAFA 3MCKA 4ETQA 3QUXD 3F7PC 2OXGB 3HI6L 4U4BA 3WAJA 4O2EA 4NUGH 2A3TA 5E4EC 1OHZA 5T3ZD 1TTCA 4MNHB 3ZIYA 1HU8A 3BAIA 5KUKA 2QADC 3VRLF 4AEFA 3T8XA 3HS0C 4X6BA 2H8PA 1J8HD 2H5UA 1S8DA 3MV7D 2GEQA 1OSYA 1H3WM 4B0MB 2OP4H 2CDGA 1H9DA 2E76C 4KAQL 5FV2A 4W9IC 6PAZA 3UG5A 3AWEA 3QNZB 1OGTB 1Z3GH 1A6UH 2I7SA 4PWHA 4DVRL 3MKGA 3X1BA 3JT0A 1QBML 3P9MB 4TS6A 2EUWA 2XRAH 5JIDA 4PV1C 2ESVB 2G9HA 4XC1L 4Q9QH 2VITA 3MR9B 4LESA 4M1GL 1MPAL 1M1SA 4OD3H 3QUMH 5B3SB 3Q8CA 4Y1SA 4DPRA 1HHKA 3NZ8B 1KLGA 3WIFA 1ETB1 2V5RA 5AZ2H 4DK6A 3KG5A 3QUZA 5JHLH 3D50A 3Q01A 1WCQA 2CLZB 4LT7A 3QEQD 4FQPA 2ADGA 1AHKA 4LZKA 1IC7L 1LLAA 4D2NA 5LGJA 3ZE0B 1QSEA 1JGLL 2JJVA 3K2IA 3MOAL 4LCIH 2OMXA 4XOEA 5LGHL 5G4OA 2E7BA 2ICWB 1A6TA 4NQXB 3SD5A 4D9RD 1JF1B 2BSTB 2G60H 1MWAH 4Z7WE 1XH3A 3QEGH 1XGUA 4KVNL 1FO0B 1WC7B 3UTTA 4M7KH 3EH2A 3EYVB 3JWDC 3HZKA 1K6QH 1QO3A 1VFBA 2X4UB 4HEME 1CXKA 2NNAB 4KI5F 4HGWA 3RTLA 2UY7A 4PWGA 4QLWA 1TTGA 2HLAB 4JREC 1A1NA 1UM4L 1C12A 4OCRL 1UM6L 4PYHA 2VLKD 1AMXA 2O5ZL 3B1TA 1JWSB 3C60B 5EU5B 5DLMH 1OCWH 3RWEB 1JHKH 1PIFA 4NQSB 4GMSL 1VZGA 2ZONA 4X9FA 3QHTC 1NFDE 4ZK8A 3T3PB 2O61B 2IH8A 1U8KB 4AYGA 5I1KH 4KXCA 4PUBL 3QIWA 4KTEL 2HVJA 3CHQA 2W95A 4AK1A 3CXFA 1W0YT 2NNXA 4G42A 2YSTA 3UPRB 3SBWA 5IFHH 3TIEA 1EGJA 2CNYA 3WJMB 5JIKA 1BYPA 1MY7A 3GSVB 2X4OB 4G8GB 4ZFZA 1OAYL 4G8EA 2JJTA 1MH5B 2A6JA 2GJZA 3O2DH 3PHQA 4MMYB 1AGDA 4M29A 5IMMA 1D9KD 5TQ0H 1G9MH 1K2DB 1HAWA 2FWUA 2H45A 2EEDA 4GKNA 3FU6A 4F7TA 2HCZX 4GG6B 3OGCB 3TURA 3QORA 4GUPA 4KKBD 4M1CD 3VGBA 3H54A 3WDJA 3K8LA 2F54A 5T33H 5DO2C 5DFVC 3IDXL 1MREL 2WLHA 3H42L 4U6TA 4QKTA 5ALCL 5IOPA 3WEMA 4FD0A 3MGTB 1X7TA 1HH9B 1IBDA 3KPMB 1JZHA 5JXEA 4ZMVA 3FUFA 4IRJA 3FHAA 1ZE3C 1D5ZA 2VLRB 3VRJB 2YUZA 4BZ2A 4KO5A 2WKGA 4N1EA 1RUMH 3MLUH 2ZXDA 1D5BB 4JRYA 5AUMA 3U9UB 5E6ID 4OGXL 5EC1B 2GYSA 4DK5A 5A2IH 5DFTA 5BO0D 2Q8BL 4R96A 3DMMA 5JHMA 3KPOB 3VXQB 4HXBL 4KK5D 1INDH 1XGYH 3PWLB 4LP5A 5GJSL 2FGZA 2UXGA 1LEIB 4XNYL 1DE4A 1XF3B 1NAML 5FKPA 2YHGA 3K6IA 4CNIA 4I0PD 2OMTB 2WUBH 3IMUA 2BO0A 3BVNB 4NN6B 4WWKD 1RK7A 2EXWD 2B4CL 3BLBA 1KIUA 3NFPB 2GSMB 4BZYA 4LLUB 4ETYA 4UIKL 3O3EA 5HJ3A 3VH8G 3DRQB 1KEGH 2LABA 2MJWA 3M1BB 3HMWL 3G5XA 3BUPA 4IGBD 3TNNB 4ZX6A 4UT7H 1Y0LA 4HDIA 5LCVL 2ATAA 2QR0B 4PJCF 5DJAA 1AY1H 2FUQA 1FZOB 1RH8A 3D2UD 4ERSH 4JDEA 3DUUA 4LSTL 2F8XC 1CLCA 2VXUL 2XBDA 2JJUA 3AU1B 2LR4A 3NUKA 4JHWL 5E94A 5EIQA 3VI4A 1YMMA 4NI3A 5JW5B 2BH0A 4XO3A 4JKPL 4EIGB 1PQZA 3QDHA 4OLEA 4P2QD 4A63A 3BW9A 2H9GA 1USZA 1U8IB 3S3JA 4GQ9L 1XIWC 2OXGA 4XWOD 4H20H 1FC2D 2MOGA 5T1KD 4OZIF 3MODH 1G5AA 1HWWA 2K3TA 3ZN6A 4MNHA 4A7GF 1AG0A 4HPYL 3HVDA 1FGVL 4LRNH 4R7LA 3UCRA 1J1XL 3ZT7A 2K9UA 1V5JA 2B0SH 4ADGA 3WTUA 3AG2B 2YUXA 2WYZA 1SOXA 2EVFA 4JJOA 2WGXA 5HHVL 1NCGA 1HKLH 2WQUA 4XVUD 3TV3L 3IE9A 2AJYL 2XFXB 5H4YA 1W72B 1Z6JT 1QLEH 2GABA 3QNZA 5FM5O 2EACA 1I1AB 1UM5H 3P9MA 4LGPB 4IHOB 2VXQH 5HYSB 2ESVA 4X8CA 4KNSA 1KCKA 3MR9A 5L6YH 4I3SL 2HRHA 5A6MA 2JV6A 2WQWA 5A6LA 5B3JF 5DEFB 4JX0A 5FPIA 1EHNA 1T6WA 5KSUB 2GHWB 3A4DA 5H2BB 3NZ8A 3GSRB 3ZL4L 1TTAA 3ULUL 5IGXL 4CBPA 3KWXA 4OM1L 4QHLB 4NN6C 5I76B 1KCRL 1FAIL 3WE1A 5ALBL 2CLZA 1FFNB 2AXFB 4NKDB 5E99H 4MRCA 1YEHH 4KK9C 4PJIB 4TLSA 5DJDB 3VSQA 4B95C 3L13A 2VXTH 2ICWA 1L9OA 1U8JB 2X4RB 4NQXA 4BRJA 1JF1A 2XZCH 4OCWL 1NGQL 2BSTA 4OQ1A 1XB6A 4KJPD 4PY8I 5FYJL 2AEPH 2DQDL 5CZVL 1I8IB 1HCVA 2DJ4A 3COOA 1FO0A 1WC7A 3K6DA 3MYJB 1YEIH 3EYVA 5JHDE 1RFDH 4N2GA 4NRZB 1ZK9A 1QFUL 2X4UA 3GJEB 3PXLA 2NNAA 2O5NA 2AK1L 4TPRL 3DX0A 4LVOC 1IM9A 4WUKL 3KGTA 4DKAA 2HLAA 1F1DA 3WFZA 3L9EA 1ZA6B 4PJEE 3TFKC 1JWSA 2CIIB 5EU5A 4PBWD 2V9UA 4FFWD 3IEAA 3FOLB 4ZOBA 4NQSA 4CVZB 4NN5B 3P0YH 1EEUA 2P42B 2R0WL 2O61A 3H9SD 1U8KA 5ACMA 1BGXH 3TVMB 4CKVX 4M6ML 4PBXA 3CGTA 2G9KA 1QTPA 1BXAA 1CDGA 3RPIA 5IFAL 4LU5L 1YZZA 4PJXB 1YY9D 3UPRA 1MCHA 2MRYA 3UIYA 1JZIA 3B2XA 3WJMA 3ULUF 3BIKA 3E0GA 3IFLL 3GSVA 2BHZA 2X4OA 4G8GA 4S11A 3VYOA 3JZ7A 1MH5A 4RGMB 5EIIG 4MMYA 4HLEA 2AEQH 2OMVB 3MLSH 4JHUA 1NKOA 1DQML 2TRYA 2WN2A 1K2DA 5E2TL 1HESA 1FBIH 4JL2A 4NQEE 4G7RB 1LNUB 1SUHA 4EPSA 2FHCA 3FQUB 3QT2A 3OGCA 4GG6A 1PZCA 4HULB 3CVCA 4AG4H 5F72S 2NXZB 1GH7A 1IQWH 1FSKC 3CV5A 4X98B 1DFXA 4U33A 3DX4A 3FPYA 4OW6A 3FFDB 4XXCC 3D85B 3MGTA 1MCRA 1HH9A 1GJUA 4ZTOH 3KPMA 3STZB 1C16B 3A5VA 1WF5A 1C1EH 1Y1DA 3ABZA 5C71A 3EJUA 1NC4B 5D4QA 3TN0D 1TENA 2VLRA 3VRJA 1BWWA 4A04A 3N6YA 3NYKA 1F97A 4ES9A 1JGDA 3CFNA 1D5BA 1WEJL 3U9UA 1X5GA 5EC1A 3QJSB 4TVPD 4GSXA 3CZFB 5F7LB 1A7NL 1RURH 3KPOA 3VXQA 3PWLA 2A4CA 1YQVH 4H1LB 1R0AL 1LEIA 2XWTB 5IJCC 1XF3A 1GGTA 4WGVB 1N6UA 3CPUA 2NT1A 1PX3A 1X5LA 3S5ZA 2OMTA 4L5FL 3SJVE 3BVNA 2L7QA 5ANHA 1QABA 1G6RB 1HOEA 3NFPA 5IM7B 3DUHA 4LLUA 2J8UB 3DRQA 3DXAE 3CC1A 3M1BA 4HGKC 3TNNA 1CLYH 1DFBH 1P1ZB 2EINB 3CQQA 3ECWA 2DI7A 2QR0A 2P9RA 2CG9X 4WI4A 3U1SL 4PVBA 1MFDH 1Q94B 3QO1B 2Y6TE 4FFYA 1FZOA 3BKML 5CCGE 3MLYL 2XZZA 3UBXI 2P28B 4HV8B 2VUYA 1RIUL 3S8WA 2OQJB 3LOWA 3AU1A 1FFPB 1X5ZA 2NNCA 4KHTL 3U0PB 4PGJA 4V1DE 4PB9L 3QUHA 5JW5A 4LPTA 1MRDL 3QJUB 2VB5A 4P4KD 1SM3L 2PYEE 1TU2A 1J9TA 5HVHB 1U8IA 1SJVA 2ZXBA 1ZVYA 3VYNA 1L7IH 2NY3B 4PBVC 2DBLH 4JPWL 3AREC 4A2EA 4JFXB 5TK2A 5DS2A 1D5MB 2ZPKL 3VXNB 2HA1A 2C9UA 4QNPF 3X2QB 2WHVA 3B2DC 4M62L 4XGZB 2XKUA 4BE5A 4D7BA 1CZ8H 2EIMB 3MI6A 1E2WA 3MRMB 3MUHL 4WTXA 1NLBH 1XXFC 3JV5A 2XFXA 1LO4L 1W72A 3KH4A 2NY4D 4KUCF 4U0QB 1RZJC 1C7TA 1I1AA 4YX2H 1TG8A 1EJOL 4IHOA 4FFZL 5KSBE 5HYSA 3KLDA 5CP3A 3L5XH 1DANU 5DEFA 4FQ1L 2H2PD 5KVEL 3CZGA 1I8KB 5KSUA 1H3TA 3HMXH 5H2BA 1UJ3B 3GSRA 3KPRE 4Z7WB 1NC2D 3AG1B 2H32H 2PLTA 4QHLA 1KTKE 1XF1A 1GC1L 5I76A 3V4VB 4G5AA 2DMGA 3LS5L 4YK4B 2AXFA 4NKDA 2NQDA 3O9WB 1SOKA 1QATA 2X09A 4PJIA 4BKSC 5DJDA 2PWFA 3MJGX 5CBEB 5CUSL 3QUMB 3UXFA 4PQXA 4F7EB 1EPFA 2AJSH 1BEXA 1A4JB 1U8JA 4FQXB 2KYIA 2X4RA 1S7VB 3C8DA 1WS8A 3PYCA 4QY8B 1P84K 2BVQB 1FNAA 3T8MA 4A2GA 1I8IA 1M2VB 3MYJA 5CD5C 1U3HD 1BVNT 3EYSH 4ZOCA 2B1HL 4NRZA 3P11H 3BZEB 4NPJA 1NFDB 3DGCR 1GOHA 1VFOA 3GJEA 4MDIB 1SOSA 1U8NB 3ZDYE 2LFGA 3NK4A 4YNYB 3WFHB 1QNIA 5IKCB 3IWUA 4LL4A 2QTEA 3GBML 4NZTH 3WIIH 5L7XL 1MWAB 1MZYA 1RZFH 2J73A 1ZA6A 1ITCA 2DBJA 1GVIA 4Q2ZB 5JQ6H 4NP4H 2CIIA 2R69A 2RIKA 1WHPA 3ATEA 4PHXA 5AALA 4AMWA 4I1NB 4XNBA 1N4XL 2ARWA 2P5PA 3FOLA 3DTUB 3V6OA 4CVZA 2F15A 2B77A 2ZAHA 4BFIB 2WK2A 4MB3A 4ZG1A 3EJZC 5ESVB 3FU3A 5TD4A 5GGVH 3TVMA 5F9AC 1E40A 1IBGH 4HP5A 4LL9A 3T2NL 3HAEB 4J2XA 4PJXA 3I2CL 5C1MB 2G3ZA 1DUYB 5EN2B 3WSQL 5K9KB 1J8SA 3MLZH 1A6AB 2DV6A 3T6WA 1ZGLM 4V2CB 4BZ1A 3IXAB 1B88A 1YECH 5T5NF 1A5FL 1FVDB 3WUZA 1FNSL 2AQPA 2E9GA 1U0QA 2OMVA 3AWFA 4UOW1 2G5UA 3IGAB 1LNUA 1KCSH 1ZV2A 2MHAA 4O5LH 4AY0A 3NACH 2QEJA 3PGDB 4F2ME 1IZKA 2FNWA 1AHMA 2EC9T 4XO5A 4APQD 2PWHA 3O9WC 4F57L 2R2CA 3N42F 5HYQB 4X98A 3CE1A 3AUWB 1PZDA 2B20A 4IQHA 4P9HH 1E5YA 3STLB 3FFDA 3D18B 3D85A 1MVYA 3RVVC 1WUZA 3HBGA 4FQXC 4Q6KA 3I50H 4ZO8A 3LRSB 3STZA 1C16A 3CLFH 2E9IA 3BPNC 5EC2B 4HIJB 3VJ6B 3X11B 5JNYB 4NBZB 4PP1D 3ARVA 1NC4A 3MRNB 2CHZA 4JDZB 4G6JH 4E5XB 5KG9B 1CQYA 2AJVH 1JGUH 1TITA 4HJ1A 4JDTH 5L4FA 2WBJC 3BUQA 2Y69B 4ZW3A 3CZFA 4KKCD 1J0KA 3LN9A 2CPCA 5DD6B 1EUTA 4TNEA 8CGTA 1BVZA 3GMMB 1AKJD 3VMPA 4BFGA 4H1LA 4K8RH 2XWTA 4OCSL 2VC2H 4JM0A 5BV7H 2ZOTA 2ID5A 4UV7H 4ZUUB 2D73A 4PVMA 4KFZC 3RGVC 1U3ZA 4B27A 1G6RA 5GS0H 2FX7H 2R4RH 2HPTA 3IJSB 4ZFQA 1QFWI 3ABLB 5IM7A 2O6EA 3MA7B 5D1QD 5JW3H 5FO9A 1ZY9A 2BNRB 1A2YB 2J8UA 2HPOA 1NCOA 1OK8A 2QQQA 1P1ZA 2RTTA 2P46B 1XGPB 3IDUA 5DMIL 1UWEH 3S36H 1R1CA 1S3RA 1Q94A 3QO1A 4GLRI 2AJUH 3QIBD 4KRPB 1MI5D 5EZIL 3REVA 2CIKB 4HV8A 2V7HB 3S2CA 4H40A 2OQJA 5D8JH 3U83A 1FFPA 3U0PA 2OJ1A 1KGYE 2XBTA 4GRWH 2EO9A 2RQ8A 2VABB 3FHQA 2VWEE 1T20B 1WIPA 5ADPL 4PCYA 3AABA 4AMXA 3ARQA 1CDBA 5E6RB 4MXVE 1CYGA 4JFXA 3FT4B 1D5MA 3VXNA 4G5ZL 1KYUA 2CDEB 2DQUL 1TETL 3BUDA 4XGZA 2CR6A 4IYKA 3FT1A 4HCGA 2I27N 3MRMA 4LSQH 3ZQXA 2YQGA 2I07B 1I8AA 3UO1L 3U2SA 2VDML 3FTYA 3SYOA 3ESNA 4Y5XC 4OV6F 3GDCA 3VDCA 1PEWA 4DZBB 1MAML 3FN9A 3FXIC 3HLKA 4O9HH 4LO9A 1ZXKA 2DWEB 2N59A 3T0DA 1NL0H 4NZUL 2FEDD 1ZLDA 1I8KA 3ZHNA 1UJ3A 2QSVA 4YE4L 4F24A 1JZEA 4XO9A 4Z7WA 4RSVA 5JW4N 4IBZA 4PJHE 3O2WL 2R27A 3V4VA 5JHDB 3T04D 1TJMA 1DO6A 3O9WA 2HT3C 4K3HA 4Z3FA 2NZ9C 5I1EH 1FZJB 3KR3L 4HEMA 2HTLD 3AVEA 1VRSA 2LTQC 3QUMA 5CBEA 5ABZA 4WTWA 1JK9B 3QDME 2APTA 4F7EA 1A4BA 3EH1A 2A6KB 4FZ8L 1A4JA 2N4IA 4Z3JA 4FQXA 1N0LB 2LW3A 4ENEC 1S7VA 5C9KA 3UOAB 4PJEB 1AZNA 3PPEA 4QY8A 3X3FL 1E3FA 2BVQA 4ODXB 3WO3B 5JHLA 1AAJA 1UWGH 1U36A 1M2VA 5F9DC 2OJZH 2H41A 1UA6L 5T3ZH 4ZOAA 5KJRL 1EV2E 1SY6H 1YEJL 3BZEA 2NSMA 1NFDA 3PP4L 2EDYA 2ICCA 2Y07L 4MDIA 1TYJA 1U8NA 2Q76B 4M5TA 3ZX1A 2ENQA 4YNYA 3WFHA 4F8NA 3QSKB 3DJRA 3HZYB 4LSRH 1SDYA 3N85L 1CGWA 4CC4A 1MWAA 3K6FA 4Q2ZA 1AE6H 5DQJB 4G6MH 4A7UA 1OE3A 2E46A 4CAGA 2Y1VA 3UDWC 4RSYA 4LOUC 2JQZA 2X4QB 1GJWA 2XN0A 1UCBL 3PGFH 4BFIA 4PRHE 4TNVF 4Y19D 1NJ9B 2XSKA 3M7FB 4NQEB 1EMTH 4LSDA 2FEJA 3ABMB 5EULV 3HAEA 4FMKA 5D7EA 3MHZA 1HEJC 3TEWA 4JHBA 2GPZA 1DUYA 5CGTA 5D70H 5EN2A 3W56A 3ASNB 5BW7A 2UXVA 4QTIL 5K9KA 4P5KB 1A6AA 4E42B 4O02L 2VMEA 1I8MB 3IXAA 2KMWA 1FVDA 2Q3XA 1J5DA 1RZQA 3L7EB 2VDNL 4HUUB 4MA1B 3ARZA 3WIHH 3O81A 2AXHA 4KUZH 3IGAA 3UAEA 4OZ4B 3OB0K 5CF3A 4NJAL 4K9EC 3OF6D 3PGDA 3VRIB 1IV8A 5C0RL 1LO0L 1YYLH 3E2HC 1K9TA 3BIBX 3VRLE