4DP5X

The 1.88 angstrom crystal structure of oxidized (cuii) poplar plastocyanin b at ph 8.0
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp5X00
3QPKA 3WNIA 1CC3A 4M4RB 3NSDA 1KGYE 4BXVA 1NWPA 1NIEA 4BDVA 1GSKA 2XU9A 4KNTA 1KCWA 1SHXA 2X87A 1MZZA 3QQXA 1J9SA 2FT7A 3H4FA 1BQ5A 3AG3B 5E9NA 1AZRA 5I28A 3UACA 2XV2A 3SBPA 3AY2A 2MTAA 2FT6A 1WA0X 2ZONA 1TEGA 1WAEA 5I6LA 3KW7A 3QJVB 2PPCA 2CBPA 2I7SA 2YAHA 4GP4B 1SF3A 3WNJA 1J5DA 1VLXA 4E9RA 1ADWA 1XB3A 1SDDA 4AX3A 1GY1A 4YSSA 1HAUA 3X2QB 2GC4C 2FTAA 4KO7A 4HIPA 2PP9A 3FYIB 1V54B 2B3IA 2YAFA 4P5RA 2GHZA 3SBQA 2AANA 4BDVB 4YVUA 4KNUA 1OCOB 2BWDA 4W1TA 1SNRA 3T71A 5D4JA 2GIMA 3NP4A 3NSFA 3AG1B 5I26A 1OE1A 1V55B 4YVNA 3ERXA 2VW7A 1JZJA 4G7SB 4Q89A 4YSUA 4Q8BA 3X1EA 4WTQA 5ANHA 2H3XC 2VSKB 3TU6A 4HCGA 3NT0A 3ABKB 4KO5A 4MFHA 5AFAA 2IDTA 1GS7A 3OMNB 2XX1A 2TSAA 2HX8A 1OCCB 1AZNA 3IN2A 5B7FA 4HZ1A 4G72B 1SFDA 4YSPA 1SDDB 1EHKB 2XX0A 3EH4B 2CJ3A 3EH5B 2W88A 5EHFA 3TA4D 5I6KA 1SF5A 3NP3A 3EHBB 3OD3A 1OCRB 1JXGA 3UAEA 2TSBA 2OJ1A 2PCFA 2PCYA 2XUWA 2DY2A 4GP5B 4E9YA 4YSAA 3S3CB 2WO2B 4AZUA 2HRHA 3IBOA 2NRDA 4TXVB 1I53A 3FSWA 4DP7X 2QPEB 4PCYA 2HXAA 3NJJA 3PPSA 2HX9A 4DP8X 3OM3B 3X1GA 1RCYA 3BQVA 1KBVA 1NINA 1QLEB 2CUAA 4YSQA 2DYSB 3FU7B 1TEFA 1B3IA 5D4HA 3S3DB 4PAZA 1F56A 3QJQB 1AS7A 4DP1X 3DKHA 1CURA 2VW4A 3TBBA 1NTDA 1GW0A 2UXGA 1SJMA 2B08A 1PCSA 4A66A 2PP8A 4DPCX 2FQFA 2XLLA 1JOIA 4AKQA 1JVLA 2EIMB 4NAJA 3RYMA 1JZIA 2JFCA 4BWTA 1NDTA 3NJLA 3UGEA 1AZUA 4EF3A 5AZUA 1ASPA 2XV3A 3JT2A 2AFNA 2J57A 2PPAA 3IN0A 2YXVA 3S3BB 3V9EA 1AS8A 4F2FA 2UX6A 1QNIA 2ZWNA 1OF0A 1PAZA 3TBCA 5B7MA 3ABLB 1PZCA 2Q5BA 3FPYA 4DP5X 4HAKA 1AIZA 3NJNA 1ZDSA 1YLBB 1IC0A 1M57B 1PLAA 1ZIBA 2A3TA 4GXFA 5B1BB 1RZPA 2EILB 3ABMB 1A8ZA 1R1CA 4HALA 4AI7A 3IEAA 3AZUA 1ET8A 2J56A 7PCYA 3UAAA 3T6VA 3TASA 1AS6A 1M9WA 3NYKA 2QDWA 4KOCA 1A4AA 1XB6A 2R7EB 1JZHA 1A65A 1BYPA 5I6OA 3QJRB 1NIDA 2P80D 3HEIB 3FPXA 2W8CA 1JZEA 3NJKA 3OMIB 6PAZA 2BZ7A 5B1JC 4E9WA 1BXVA 2AVFA 1JXFA 2IH9A 1IBZA 2VMJA 1BQRA 5FC9A 1AR1B 1CYWA 3QJTB 1JERA 4YSDA 2IWFA 4AKPA 2UXVA 3QJSB 2OCCB 2BO0A 2FQDA 2HLEB 4K9JA 2DWTA 4A2HA 2PP7A 1PZBA 2J55A 8PAZA 3AW5A 4ENZA 6PCYA 2BZCA 1GY2A 3WI9A 3DIVA 1A4CA 2EIJB 4A2DA 2FQGA 5B3SB 4G7RB 1OCZB 4YL4A 1JZGA 1OV8A 3FU7A 3UABA 4NB7A 3CVBA 3IE9A 1J5CA 3PCYA 2IH8A 5B1KA 3S8GB 1EZLA 3NJFA 2DV6A 2HX7A 1ZIAA 3WKQA 1E5ZA 2BP8A 2XXGA 2PPFA 5D4IA 1BQKA 1J9RA 3V9CA 1J9TA 4G71B 3X1NA 3KW8A 1ETJA 2GBAA 3MX0B 2X88A 2QPDB 4GP8B 4KOBA 2XXFA 3CZUB 1PNDA 3H4HA 3HB3B 3PLYA 4JHVA 3DTUB 3ZX1A 3ABGA 1GS6X 1NPNA 3NJMA 2CALA 3GDCA 4QLWA 4GYBA 3JTBA 2UXFA 2CCWA 4DP4X 2Q9OA 3ASNB 3PAZA 3EF4A 5PAZA 3CVCA 1NWOA 1E5YA 2YAOA 3CDZA 1OE2A 1ZPUA 5B1JA 4E9TA 1GS8A 1PLCA 3QJUB 1E30A 4DPAX 1XMEB 4CSZA 3GXUB 4BWWA 1CYXA 3FQYA 4G70B 2BP8B 4X4KA 1BEXA 2IDFA 4UANA 5B7EA 1SHWA 2R7EA 5I5JA 3S8FB 2PPDA 1GYCA 1IKOP 2YAPA 1AZCA 1IUZA 5I6PA 1PLBA 2FWLB 3N2JA 7PAZA 1KCBA 2WSDA 4DP2X 3PAVA 1FWXA 1NICA 1NZRA 4E9QA 2XWZA 2VM3A 2GB2A 4AKOA 5I6MA 3MBWB 4HCFA 1XB8A 1NIAA 3WIAA 3FU8A 3NJGA 2BHFA 1JXDA 3SQRA 3CDZB 4FA7B 1ZDQA 3CG8A 1J9QA 1GR7A 1PF3A 1WS8A 1W8EA 1HFUA 2OV0A 3WG7B 1A4BA 5B1AB 1BXAA 2DWSA 2PLTA 3EH3B 1QHQA 2IAAC 3H56A 4E9VA 1DYZA 1MG2C 4GY4A 5TK2A 1FA4A 4UF7C 1AG0A 1BXUA 2MRYA 3BVDB 1ID2A 2XYBA 3D12B 1TKWA 1L9QA 4L0PB 1KBWA 1E65A 4M3HA 3T6WA 4HHWA 4G7QB 1X9UA 1KV7A 3FS9A 5LDUA 5A7EA 2IWKA 4N8UA 4N4YB 3L45A 3T6ZA 1RKRA 3FU9A 2IWEA 4HCIA 2HZHA 1BAWA 4KO6A 4DPBX 1NPJA 4A2FA 3AG4B 2N0MA 5I6NA 2WO3B 5I5IA 1W6LA 4KO9A 2GI0A 3WKPA 4DP0X 2CAKA 4DP6X 1JVOA 1MZYA 3T9WA 1ZV2A 2H47C 3FYEB 5F7BA 3ZIYA 3N55A 3FQ1A 4JHUA 1RZQA 4UAHA 3T6XA 1AQ8A 2FQEA 1PMYA 3G5WA 2Y1AA 2BP0A 2VSMB 2PPEA 3X1BA 1N70A 3C75A 3CVDA 1MDAA 4YSOA 4FAAB 1T5KA 1ILUA 2YAQA 5F7AA 1L9PA 4BK5C 3ZDWA 2FT8A 2J5WA 4KNSA 1JZFA 1NIFA 1OOWA 9PCYA 5PCYA 2IDQA 4BWUA 2UXTA 3ZBMA 1X9RA 2GSMB 5AKRA 1KDJA 1IBYA 1L9OA 2H5UA 4E9XA 4ZK8A 1WA1X 1WA2X 1AG6A 2JKWA 3NJHA 5TK4A 3FSAA 3U25A 2I85A 4DP9X 2E86A 2EIKB 3UADA 1AOZA 4F7KA 1OE3A 3ASOB 1FFTB 2QDVA 2YXWA 3FSVA 4A2GA 4W9ZA 4YSTA 2AZAA 2ZOOA 2VW6A 2BW4A 4E9SA 4YSCA 4CSPA 2YAEA 4NERA 2GC7C 3X1FA 2JXMA 4A67A 4RH4A 1CUOA 2VM4A 1W6WA 4YSEA 3NSCA 3OQRA 2BP0B 1ET5A 2DYRB 2AZUA 1NIBA 1UATA 1ET7A 1M56B 1WS7A 3FQ2A 4WKXA 5I5MA 3SBRA 4A68A 1E67A 3FSZA 2YARA 1BYOA 1V10A 3PXLA 1AANA 2P80A 1KDIA 3OMAB 1A3ZA 2RACA 3GYRA 2BWIA 2EINB 1ASOA 2BW5A 2Y69B 4A2EA 3PAUA 4YSRA 2IDUA 2LLNA 2I7OA 1DZ0A 3NJIA 3AG2B 4JKNA 4QKTA 4HHGA 1ASQA 2QT6A 2HRGA 1AAJA 1SFHA 1L9TA 4BXSV 1PY0A 2XV0A 2VN3A 1L9SA 1PNCA 1AZBA 1TU2A 2XVBA 2UX7A 1KYAA 5IY5B 1N68A 2IDSA 3NSYA 2YQBA 1L9RA 1AACA 1MG3C 2FNWA 3FT0A 4P5SA 2YAMA 2ZXWB 1HAWA 4F2EA 1URIA 1PZAA 2FJSA 1ILSA
chains in the Genus database with same CATH superfamily
3GM0A 1R5VB 2KL6A 4IBVA 4XP5L 2MCG1 2H2PC 1XIWD 4IJ3B 3CFQA 4OZFA 1EDQA 2WKGA 3P9LB 4R97B 5E9DA 5G4OA 2R39A 3K7UA 5J57B 5F9WB 1GPOH 1NIEA 3IU3A 5AENA 2FJHB 2OSYA 3QXWA 2NLJA 1IM9B 1GSKA 3ALWA 3SBWA 3ETBF 4DN4H 2IAND 4PGZA 1K5WA 2OMWA 1G6RB 5EF2A 3Q6FB 1BW8A 1T21A 4KVPA 2ZXCA 5F89A 3Q5OA 2H45A 1UACL 4XT1C 1S7SA 2ADFH 2UY6B 3MRGA 2X5PA 1G7JA 3QFJB 2DLFH 5E4OA 3WS6C 4YHLH 3ZKSD 2Q20A 1AZZC 2J6EA 1HWGB 1NCGA 2V3FA 4PJAA 4LF3A 1HHHB 4UAOC 1V7MH 4X2UA 1TYJA 4JO5A 2I7SA 5DQJA 1RJYB 4YBLB 3RJOA 4NQXB 4CC1A 4EKJA 1XB3A 1TO4A 3GXFA 4ZS7L 2BOCB 4ZUVA 2X6VA 2HLAA 4LBEB 2FWSA 3P4OA 4XR8C 4ANXA 3P4NB 4UDUA 4YSSA 2EVGA 1L6XA 1GYUA 4DZBA 4DIXA 4KVCH 3F5WB 1HZLA 1A6VL 4BUGA 4K94L 4Y2DA 4Y9EA 3ILPA 1ZLWH 4M7LL 1NDGB 4U6XA 3U79A 4NYLB 1K8IB 2W94A 4DOHE 3PWNB 4OIFA 5CBEB 3NP4A 4PJ9C 1HCFX 2BIPA 2IAMA 4XMWA 3TTSA 2VH5L 4HUNB 4IOIB 3OZKA 1CFNA 2BWQA 2HWZL 1TTFA 5GHWL 3RDTB 1YNTA 1VENA 3VI3F 2WBJD 5FYKH 1V5JA 1FL5A 1XR8B 4WTQA 3TU6A 3DYPA 3EGDB 1TQWA 3WLBB 1CGYA 2EH8L 3OXRB 1GS7A 5DJ8B 3T4AB 3P0VH 4Z7VF 3APDA 1UVQB 3A23A 4XBGB 3VFRA 3CSFA 4JKWA 1R3IH 4EXKA 3E6FA 4NN5B 1SFDA 3JWOH 3IE4A 4D9LH 4K7FA 1VA9A 4HBQA 5EHFA 3GS0A 3U4BL 1S7XA 1T66C 3ETTA 5DJXB 1OCRB 1WWBX 2OSLB 1FNSL 3FO9A 4FFWD 4NFBA 5FDWB 3V5HA 4Q9RH 2OJ1A 4I3GA 4HJJH 1NC4D 5C0JB 3WS6A 4LLDA 3CX5J 5IWLA 4MJHA 2C3GA 4QD2E 5AW8B 3QXAA 1I4FA 3DLQR 1HIML 1OZUA 2D2CC 2EXWC 2Y22A 2F74B 1BZ8A 1XGQA 4M8QA 3FZUC 4KH9A 4C56B 5IBLC 4QF1B 2YD9A 3HHRB 2HXAA 5TH2A 4N22A 2EUVA 2FJFB 2IADB 1JNJA 1BX2A 5H4ZA 1MCCA 5MEQB 1MJ7L 2D3VA 2X4PB 4I5BB 3D9AH 4ONOA 2DYSB 1R3JA 4JFDA 4PREA 2BH0A 1B3IA 4RFOL 4NNYB 3ZTNL 4D0CA 4DW2H 5FYJH 4YR6A 2Y06L 1DJGA 3GSRB 3U4KA 4PJ9A 1E43A 2KZWA 1NCIA 5D7KE 3SD5A 3UDWC 1SJMA 4NKOB 4PJ7A 3X3FL 2XWJA 5EMYA 1EWHA 1KXHA 5CP3A 2XN9D 3V0HA 4PV1C 3UTTE 3E8UL 5CGTA 4F7TB 2H6PB 3NG5A 4W68A 4X0NA 3UGEA 3VG9B 2XRAL 4L1DA 4Y19A 1AMYA 3G6JE 2NY7H 4ELMF 3HI5H 4QGYA 4JFQB 3IFOA 4BGDA 2CHZA 4HMDA 3BDBA 4PJGF 1QR1B 2KHAA 2UX6A 3TN0B 2OSWA 1GAFL 2J12B 5GJTH 2G3MA 2M8XA 5E6YA 4LGSB 3EOTH 2J8UF 5I1HL 2Q3ZA 2V5MA 2BFGA 4KK9D 5TE7H 4MZRA 3S35H 3HC0B 1IKFH 2WV3A 3RKDC 3HNTL 3SJVB 2QL1A 2WZPD 1VPOH 4XPGH 1HWHB 1RZPA 2EILB 3LQZA 3ABMB 1MEXL 3QQ9D 3LS5L 3QCUL 1CN4A 1FFQA 1Y6MR 3OLEA 2WB1A 2Y1VA 2BMKB 4PRBA 1WH0A 3UAAA 2F2HA 1MF2L 2Q3AA 3GEWB 1KFAH 1H8OA 5D1ZD 5ADOL 4TSBL 2OMTB 2UUDH 3T0AA 4HT1H 1HH9B 2BVEA 2DEXX 2QADB 3BRGC 4PJXE 5CBAA 3OX8B 4AENB 4JVUA 4L8SB 4ODUA 4KUZL 1YEJL 4GXVH 3S34H 2H3KA 5EBLB 4JAMA 4WK4B 1A1NA 1KEGL 1HINH 4AQ1C 4X5WB 1T83C 3ZL1A 1H5BA 5F7EL 3UDWA 2J44A 4CC4C 4GKLA 3VH8A 3TONA 3VXUA 4R7NB 4Y9CA 2HVJB 5IEKA 2DI8A 4NKIH 3EYSH 3VE0B 1OAKL 2D7QA 2KKQA 5EDSA 1BMGA 3TWYA 3RWIB 2FQDA 2QBWA 4TQPA 4X6EA 4ZS6D 5L4IA 5JHAA 2XPGB 2X42A 4K9JA 1CGXA 2H6UA 4PHZA 2PP7A 3MXVL 4JFOB 5B22A 4DGVL 2DF3A 1NJ9B 5DA4A 2W5PA 4ENZA 5C0FB 5GS0C 4M48L 1A4CA 4A2DA 2GY5A 1PDKA 3PQYE 1UZ6E 1RU9H 4JQXC 4DOHB 2W9DH 3SGEI 1VHPA 2OJZH 3L4YA 1XHHA 4XN7A 4RCAA 2AGJL 2VN6A 5G4NA 4ZO7A 3TO4C 3ZO0A 3D48R 1E5ZA 1JGLH 1BGXH 3R06A 2WGXA 2GSIA 3PHQB 4MWFA 4FN0A 1SXCA 4NM8L 3OJMB 3MCKA 4UMGA 1R5WA 2EIEA 3WEMA 5L2JB 2JI3A 1G9MC 4OFVA 5L0QB 2MCPL 5MP6L 4KUCD 3SDAA 3ETBJ 2NUTA 1KCUL 3DECA 2BS71 1D6VH 1INQB 4B5ZA 1KB5B 4PWJA 1P5UC 3K6FA 4HKZB 4RNRB 4WEUD 4HFUH 1LVEA 5ITBL 4PJAF 4N2NA 3QO0A 4AQ1A 2OJEB 4YDNA 1YECH 4QRUA 3HE6B 3K8MA 4XP6H 4XWGH 4CC4A 1ONQB 5ICZB 5EO1B 1F8TL 2LTQB 1FVCB 5EBWA 3CZJA 2BP8B 3GZPA 4RLDA 5HDBF 3VDAA 4PLKC 1MHHA 1SVZA 3BSZL 4FP8H 4PRID 5E6UB 1DQLL 1X9QA 2R7EA 5BV7C 3K8KA 1J05B 3QR2A 1MIEL 2DBLL 5FEBA 2EVIA 3W5MA 1NOFA 2ZCLL 4PRDB 4BFEA 5DO2D 3HMXH 1EDYA 1XF5A 3SY0B 3HZKB 4F27A 3QE5A 1E50A 4DP2X 5I6XC 1VKXA 3DTXA 3N1GC 4EZLA 5FGCB 2WW8A 2XWZA 1UB6A 3BVNA 1B4JH 2G5UA 3QUYA 3TO4A 1PEWA 3QIBB 4YDLC 3JYCA 5E08L 3BAIA 3NJGA 3UTTB 3VFMB 4FYSA 1J9QA 5IMOA 3EOBB 3N6YA 3G6JB 5F1NA 5IKCA 4WEMB 2H8PA 3AQDA 1HFUA 5E2TL 5C9KA 5B1AB 5TFSL 4IU2A 3NGBB 2FLMA 1QHQA 1QHPA 4NQCA 3H56A 2NY4B 4WW2C 1MG2C 1KG0A 1P5UA 2ROXA 4PJ5B 4GEIA 4EI5C 3WUWG 3K5RA 1E5BA 1ZLSL 5CEXA 2MWCA 4KZDH 1OSPH 3U9WA 2PWGA 4Q6IC 3W9EB 3SE4C 1A5FH 3VD2A 4L3FA 2X0VA 5CILL 4XBEH 5D1ZI 3ZE1F 3OR7B 1X9UA 4OLUH 1KV7A 3EDKA 3QUMH 5M95B 5E4AA 4ZUTA 3VJ6A 5E8NA 4BFNA 1LE5A 1K4DB 1OTTC 4NSKA 5IB4A 4WI0B 5H37H 3LEXA 5EULV 1F1GA 4QEGA 4O4YH 1NEUA 3X14A 2N0MA 4LGPB 5I6NA 1K2DB 2FSEB 4ODTH 3RPIB 5ANME 4BA8A 1S7QA 4GMTL 2ERJB 4RX4D 2AMGA 4PJXB 4JO2L 3QUMB 1AD0B 2WVSA 2YD4A 2JELH 1QSFE 4ZAKA 1DVSA 4ZJ9A 5MEND 4TNVF 1ADQH 3DHMA 3RNQB 5EO0B 1MLBA 1SN0A 3MRPA 5LHDA 3RKPA 4HOMA 3QJHA 4GQ9L 4Z3FA 4QJ4B 5DURD 1C1EH 1LM8V 3APMA 3WFBH 2QGBA 3QXUA 3GPEA 5LGHL 3DTDA 4L8BB 3II1A 1ZLUK 2I26N 1ZT4A 2XOTA 1E8YA 1ULVA 1BOGB 4U6HA 4WHTB 3V9FA 5KVEL 5D1XE 4HJSA 3OQ3B 4NRZB 1VACA 2XICA 3VD0A 1YNKH 4JFYB 2RH0A 1AG6A 1AHWA 3ETSA 4O51A 4UYQA 2N01B 3HTLX 5B1CA 4BFIB 4DJMA 3U0PA 5DZAA 4JFVA 4M7ZB 2C1PB 4WW2A 1TTGA 3RGVB 5K39A 1NLDL 3PQYB 4IBUA 3SPVA 3MV7D 1AOHA 3BQUA 5CJQL 2YD5A 4BZ1L 5I1AA 2VW6A 1AXTL 4AUJA 5C09A 4CJ0A 1DQQA 1I7ZA 4N3UA 3W82A 1LD9B 4NM4L 3OQRA 1KYUA 1P4IH 2BP0B 3UZVA 4ZI8A 3WTWA 5DZJA 1ZT1A 3SBRA 2APSA 5I1IH 5LNEA 1OGTA 3GBMH 4YHKH 1AANA 1HL4A 4PG9B 3AU1A 3DNKA 2ZJSL 3PWPD 3DOIA 1H3GA 3CLEL 5JW3H 5K1VA 4PWFA 1MVUA 1KLGB 4AJ0A 3V5DA 2B9AA 3PAUA 2HFEB 3ZDZE 2LLNA 2W9LA 3V4PL 3QDAA 1DZ0A 1LMIA 4JPVL 5CGYD 3FFCA 2Q8BH 1OGAE 1OAQH 4QKTA 3HJ0A 5IB5A 4LLYA 1KYDA 1XBDA 2HRGA 1AAJA 2W59A 1WZAA 4BGLA 2XV0A 3CSPA 2BVPB 3D39E 5DZ9A 3RAJH 1JYVA 1JHKL 3EO1A 2KUTA 3VACA 1UWXK 4HA1A 5FCSH 2B8OT 2OXGB 1EHAA 2H4EA 2Z1PA 4ILDA 4JKPH 4P5SA 3SE8H 4HGKC 4P9ML 1HAWA 2AXWA 3HFMH 1CT8A 3KEHA 2AABH 3HI1B 1F5WA 4AUUA 1PZ5A 4JDEA 4GG6A 4M4RB 4XNUL 3FC8A 4BXVA 2XYCA 1TVBB 2CA3A 2YPLB 3DX7B 4JFSA 1ZRUA 4M93C 4OFIA 4JY6A 1UWGL 1ORQB 1CBVL 3VXMD 3Q44A 4WVRA 4PS3A 3D50A 2Z3FA 4HUWB 2ZCKL 2WMPB 2WXPA 3BLKA 4XI5D 3QZWA 3NCFB 5I28A 3SBPA 5JMRA 3KPRB 4LQ1A 1LO0H 1TZHA 5EA0H 4L8DB 5DHYB 4XVOA 1JV2A 1K85A 1U8KB 1RJLA 2OL3H 5IQ7H 1T04B 5EBGA 3MLXH 2BHZA 2HKHH 1RZIB 4IJ3C 5F7YC 2QKSA 4R97C 1RP9A 5F9WC 3Q05A 5HYSA 1A9EA 2ENSA 2MQ3A 2XPYA 3X2QB 1UWYA 4DUVA 5LQBH 4DKFH 1PEZA 1UD3A 5K9KB 4DUXA 1WAPA 4NRYB 5ID0B 4ZFOB 4KNUA 2G2RB 1IFHL 2VXVH 2WO4A 3GSNA 4P59L 4Z3HA 3FUMA 1RURL 2GIMA 4EOWL 2AI0H 4O9HH 3AG1B 2Z31A 3FBQA 2VR5A 4Q74A 4HWZB 4R9HA 2EZ0C 3QYCA 5DD3L 1OM3L 5ANMB 1JZJA 1E7UA 4N24A 4PW3A 3TPUB 5SWQB 2PCPA 4YSUA 1CFSB 5IQ9A 3D18B 3JTTB 4YBLC 4V11A 4LSSH 4H40A 2QVIA 1E6JH 1P4BH 3DARA 5HVFB 1QSFB 4JZNB 1GGCH 1F3RB 1X5ZA 4XWOD 3VA2C 3TF4A 2C3VA 4AEHL 3ZMEA 4GW4B 1B6DA 3KWWB 3LKOB 3Q8AA 1DEEB 2B77A 2BHUA 1ZLDA 2YQGA 4FFVC 3ZQWA 1ZVNA 5KVDE 3LV3A 2CG9X 2J20A 3DRQA 4G1MB 1T0NA 1IZKA 3CVHA 3E3QE 4RMVA 2DL9A 1Q1JH 1RIHH 2X4SB 4JFFA 3VMOA 5DEFB 4QRTA 4YAQA 4XCFL 1U8LB 3VXQA 4BZYA 1O5DT 1A0QL 3DO4A 1TZGH 5D1XB 5T1JA 3HBPA 2DQJL 2WLJA 2F53A 1RZ7L 4UILL 2GJPA 2X2HA 3CC1A 3IPEA 4X6BB 1R5VA 3RDTC 2R1WA 4OD3H 5ADPL 4N5UA 3IBOA 2O6DA 2X1OA 3AJ7A 4QRRD 5GRUH 3P9LA 1CXLA 3RGHA 1DSWA 5D55A 3T4AC 3MV8D 5B3JE 2XACC 2QQNH 2J6WA 3VDCA 3BQVA 3HBZA 4GXUM 2PW1A 5DMKB 4L4VE 2XBDA 3HCVA 1WBXA 3P4LA 1NINA 4NN5C 2BERA 4O58L 5C0RL 3BFOA 3Q6FA 2F08A 5ENWA 5T1DL 4CAGA 4HCRL 1MFDH 2K3TA 4XP9H 2CE6A 5E7FA 3W0WD 3S3SA 2YMTA 3QFJA 1DJHA 4L3AA 5ACMA 4HIHB 1OT4A 2BZDA 2X2IA 1VFBA 4KRPD 4HXBL 4UOW1 1TXKA 3IWVA 1NGZB 3ZDZB 1PG7L 3MA9H 5BOZG 2XWEA 3JWOC 1OGAB 3QDGE 3EJYD 3FB8A 3BD3A 2MCAA 4JHWH 1DBML 4N2LA 3ZUNC 5B39B 3D39B 3MRMB 3NSXA 4XNMB 4WZ9A 3CZGA 5F7DB 1O7VA 5ID1A 5CEYB 5MEOB 4L3CB 3VXRE 3WKNA 4JG0H 2QJDA 4OUUA 1ZLVK 1OF0A 3IVKA 1B9ZA 5B38B 3MRJB 2I9LB 3WFZA 2WYHA 4G9FD 3MI6A 3EH1A 1NA8A 4PB9L 3C5JB 1JFHA 1GGIL 3GUTA 4WW2F 3OWRA 3HG5A 4I9WE 4WTZA 5JW5B 1ZGLM 5F0JB 4G6ML 1DN0A 1WVZA 5DJCA 3ORJA 3RDTA 3F05A 4ZFFA 5HYFA 1F4XL 1EXGA 1XR8A 1FN4B 3L9EA 3IEAA 5JW4R 2K6YA 3WLBA 2P9RA 2VR9A 3OXRA 4DKAA 4GI9A 2FB4L 2B2XL 3GMMB 4FXGA 4N6RB 1AS6A 1SQMA 5A16B 3AACA 4U4BA 4XBGA 3TZVC 1WD9A 5DHVB 2TRHA 3S9DB 1ZAGA 3SKNB 3RI5F 3TN0C 2R56L 3R4DA 3RVWC 3FSOA 1B4TA 3L5HA 4MDJA 5DJXA 2OSLA 3O6KH 3WJLC 1NIDA 5DMJB 2W9EL 3QR0A 4BFKA 1RJZB 3LRLA 4JN1L 5DS2A 5C0JA 1PQZB 5C0BD 3E9TA 1MELA 2F8OA 2HT2D 3VRIB 4KTDL 3K5SA 3QA3B 1BXVA 1XSIA 1N6UA 1FVDB 1FZMB 1VFMA 3ARED 1UOWA 4TUKH 1NCUA 3QJTB 2DYPA 4GAGH 1P7QA 2YPVH 4KXZI 5IOPB 4YSDA 5IMLB 2IWFA 1IKNC 4Y2OB 4AKPA 3Q9QA 2UXVA 2CCLA 3D0AA 2WP3O 3I6GB 5AAPA 1NCCH 2FJFA 2IADA 2QADC 4PGEB 3HOGA 2VJ0A 4K3DL 5I8OL 2ZG2A 4PRAA 4LIQE 1FSKB 3B5GA 3L95B 1I9JH 4GKNB 4L8SC 4RDBA 3Q1SL 2WKOA 1LHZA 4G8EA 2Y7MA 1T1ZA 4LOVA 2IH8A 3S2CA 5KVDH 3S5ZA 3JV6B 2BNQB 2RALA 1ZHKB 5C0CE 1HX0A 3FAWA 4UOJA 3OB0H 1ZIAA 1PYWA 1CXKA 3NIDE 4L1LA 5DVPA 3VB8A 3ZUCA 4G5ZL 4LL1A 5EZOH 2YK1H 2MJWA 2VZVA 3O0LA 1KF9B 4GP8B 1TFHA 2B3RA 3IXTA 5J1AA 1OAUL 4GJTB 3HB3B 1V3KA 4JFQA 3TZVA 3R1GH 3V8OA 5DJ6A 2R69H 2MPAH 4KC3B 1QR1A 5CWSB 5HGBA 2FGZA 3CQFA 2Z64C 3QIWB 5AB0A 5F3BB 4P23D 3MBWA 5HXMA 1WFJA 1UM4L 2RCSH 4QOKD 5F6HI 4LLQB 2AK1L 1SLVA 4U1KB 4OFYD 5F9DC 3NCYP 1DLFH 3SJVA 3JWDH 1FBIL 1Q90A 4HV8A 4O5LL 1RLWA 4L9LC 3GBNL 5IFJA 2ICWJ 4LT7A 1A7NH 1ZOXA 3G5ZB 4OM1L 3BIAX 2CA4A 1X6LA 4M6MH 2P7TA 1CL7I 3G5XB 1IKNA 2ZXQA 2C5DC 3B2DC 3RX9A 5L0QC 1H3PH 1K6QH 1BF2A 1WUZA 1BEXA 3FUEA 3VFSB 3DGGB 5EU5B 2GJ6E 1F11B 4ADIA 4N0UE 3VAEA 2OTWB 1HOEA 4XH2B 5H94B 3SDDB 4QWWD 4OZIE 4TUOA 3SPIA 1N59A 1Q0XH 1Y18B 2CHNA 3OX8A 4YLQT 3RU8L 5EBLA 4DVBA 4Z7WE 5DQDH 1I1RA 4LSVH 3PU7A 3PAVA 1TZIB 4X5WA 4Z7QB 5C6WH 4XOAA 1VEMA 3HE6C 1ZA6B 4G8FA 1WFTA 4LLVB 3WD5L 2AJ3A 3EFDH 4UT9L 4X6FB 1OTSD 1QFWL 1MI5E 4Z95L 2JB5H 2HVJA 2GUYA 4UQ2A 1I1AC 4H8UA 1S3KH 2LTQC 4PP1C 5BRZD 3VE0A 4PQXA 1Q9KB 3QDGB 3RWIA 2A0LD 5ERWB 3ZU8A 1Y0LA 1KCSH 3HE7B 2EXYD 3SB3A 2DAVA 2NT0A 4XNXL 1NJ9A 5C0FA 1DQMH 4MAUL 4Y4FB 3GTNA 2NNAB 5C3TA 4AWJC 4OB5H 1Q72L 3VXRB 2VJ8A 1E7VA 2MRYA 3IRCA 1ID2A 2QHLA 3QK0A 3ZDYE 4F7CB 2Y7LA 3T2PA 5JQHC 1ZLWK 1IAKB 2AKRA 4JFUA 3RL1B 4G7QB 4IRJD 1D9KD 3IBEA 3BOVA 5EEUA 1J1OL 3QIBC 4GKZB 3T5WA 4L9LA 4Z0XB 5D71H 3T6ZA 3UIZA 4X5XA 5DMGD 3SDCA 1JPFB 4X4XB 1BAWA 1E9QB 4RFNB 4XXCC 1CG9A 2IH3B 4PJHE 5L2JA 4LQFL 4GUOA 2NW3B 3PP3H 1E4XI 2E6JA 1W6LA 3AXLB 5KVFL 4DP6X 4XO3A 4U05A 3NGBC 4HWNA 5FOBB 2FBOJ 4OLYL 5AOKA 2NY4C 3ZIYA 1NAKL 4HKZA 5FYLE 4LOUD 2R2CA 5FGSA 3QWOB 1MFEH 4WI4A 1U8IA 4TM9A 3LPGA 4XTRD 3TLRA 1J8HE 1NBYA 5HPMA 2OJEA 1T5KA 4JFED 3OTTA 5LNDA 1EHNA 3ELAT 3IRZA 1IGFH 1A7QL 2JQZA 1ONQA 3WUZA 1W0WA 4HJ0C 3PV7A 4PM1A 4ZXBD 9PCYA 1I1AA 3MLPA 1EQWA 3EYQD 1FVCA 4NHUB 3IFNL 2KC0A 2OKMA 3S0PA 4CNIA 2F7IA 4N0CD 1WQVT 3LPFA 3T0EE 1SHSA 4H26B 4IU3B 1JNNL 2CO2A 4KX9A 5H4YA 1JDAA 2LFEA 3SCMD 3A21A 3L3JB 2NUPA 1C16B 3WE6B 2YEZB 2ERJC 3FFOA 3VQ2C 4JANB 5I18H 4F9PC 3TOPA 3BGMA 5JXAH 3FQXB 1RFDH 1QEXA 4Y0GA 4I85A 5JORA 3HZ3A 3LMJH 5B4MD 3NEOA 2D7MA 1KPVA 5C0CB 1Q9WA 4N2BA 1NUFA 4F91B 4FNQA 1JYWA 5IJDC 2L7UA 1UUNA 5KBNC 3QIBA 3FQUA 3LIZL 3NIDB 3FQ2A 1ED3B 2N7BA 2VDMH 4DGUA 4EDWH 3L5JA 2WHVA 1FGVL 3EOBA 3PXLA 5DJAA 1Z9PA 5GRZA 5J13C 3FW6A 3E7JA 2NXZD 3HMXA 5BS0A 5CSZA 4M7ZC 3L2MA 4LPVA 2EINB 3MSPA 2B4CL 4L37B 4PLJD 1RUAL 3RGVC 3U1QA 2F8XC 4PJ5A 4AYID 2I7OA 1DVZA 3B2UD 3LZPA 5CLZA 3U2SB 4EN3D 1YN6B 4HHGA 3BAYA 3QEQD 1GZQA 2E74C 2VDMB 4U1NA 1AC0A 2VN3A 3OR7A 2G9KA 3S4SG 3P9MA 1GJIA 2CO6A 1U2CA 4PCSA 4UNVA 3UYRH 5T1KB 5HJGA 4JZOB 4ANKA 4DGWC 4KKPA 2YQBA 4DGYH 1L9RA 2OPCA 2V0AA 2VLKD 2R29L 1FLRH 3Q6GL 2YAMA 4C55A 1R3HB 2EDLA 2NY2D 2WWMD 3RPIA 3MYZA 2GJ6B 1RIVL 3B9EA 4N0UB 1DBKL 3P02A 1B0IA 1U8CB 2YA1A 1F45A 1NANI 4OZIB 1EJ6A 1NCDH 1U3JA 2UUDK 3PDOB 4C58B 1AD0A 1Z0NA 2E75C 3NSDA 4P57B 4F9PA 3RX8A 3CDCA 2ARJA 4J4PD 4Z7WB 3RNQA 5H37A 1ESOA 4TSCL 4IRSB 3EO9H 2DH2A 4CU6A 3T08A 1JL8A 3VSVA 4GSDH 3VSTA 1U3ZA 1MI5B 1S7UA 4L8BA 2DJMA 3S96A 2DBJA 4OLZH 4WHTA 1E3ZA 4WJG3 1DFXA 4L18A 2F54E 4JZJB 1R17A 4TLTA 1CGUA 1LO2L 4NRZA 2DKUA 2H9GB 2MTAA 3AY2A 4JFYA 4BFIA 2BLFA 1N4XH 3EH2A 1T0MB 4JM2B 5F9AC 3KW7A 3NZ8A 4NUJB 3RGVA 1RZGB 3W11C 4C83B 2WZAA 3DBSA 5CJOL 2GCYA 1I75A 2VMDA 2BSBA 3ZDYB 4HIXL 4XP5H 3TBWA 2LABA 3FTXA 4I48B 1T7YA 1S7TB 3EJJX 4QUOA 3VU2A 2JLPA 4KO7A 1I85C 4RMUA 4NX0A 3BFQG 2QQQA 3PDGA 3HN3A 3VGEA 4BUQA 2R1YA 4NPJA 3NPSB 3ARFB 3PG2A 4W1TA 3B7SA 3HR5A 4PJHB 4Z77B 4LEEA 1G7HA 3LVEA 1RPKA 2EJ1A 3OGOE 5D5ME 3SDXA 4YEFA 4IYKA 3L4UA 3ZHFA 2BDNH 1MW0A 4PVLA 3ZTJH 2V2TA 1EPFA 1F90L 2HFEA 2WBXA 4HD5A 4LEXH 1IBFA 4HCGA 2P5PA 3ABKB 3NT0A 4L3EE 4DO5A 3PV6B 4B9CA 4YIQB 3INUH 1FFOB 1J8HB 1AZNA 3TNNB 4AEIH 5DD0L 4ZS7H 1VF5C 2H7WA 3QJFB 2FVNA 3GLDA 4YGAB 1B4RA 2OXGA 5E0FA 2ITCB 3CFIC 4LMQI 3C09B 2YKLH 3H1ZA 5L4FA 1A6VH 4K94H 2DMBA 4M7LH 3S7GA 3GMQB 4BFRA 1T22A 5F0MB 2EEBA 3U4AA 2NX5A 5DUJA 1CLYL 5J3HD 3T0EB 3AWEA 5GSVA 1HNYA 1ZTXL 3LKQB 4V1DB 3S3CB 1MWAL 5EO9B 1C8QA 4I4WB 1OQXA 2VH5H 3WHE0 3C6LD 2VDLL 3TWCL 1KBGH 2YHGA 4TXVB 5GHWH 1H6TA 3FSWA 4MSWA 3SDYH 3UJTL 4DP7X 2YPLA 4LVNC 1XT5A 1RLBA 1Z32X 3D4YA 5TQ0L 2EH8H 5E94B 4PJCE 3MV11 5KSBA 4HUWA 5CP7B 4BFOA 3RWFB 5EUOA 2L4OA 3QDMB 1QLRB 4BH8A 4JRXA 4PAZA 4HWEL 5D1XC 3KPRA 3RVVC 1E2ZA 3L1FA 4MX7A 1KWKA 3U4BH 1FFRA 2GSGA 4OD1L 1DDHB 5CS7A 5AOJA 3UG5A 1FJ1A 4Z78A 4N5EC 3ROLB 1FNSH 3HZVB 4OZHA 4XNYL 2B08A 5IB3B 3IPBA 2YGQA 2FQFA 4UM8B 3FT2B 5DZVA 1GCYA 1I1FB 4AKQA 2WLZA 2VIRB 1V7NL 1M1XB 3U36B 1EUUA 2HJFA 2PXYD 2IBBA 2XZZA 2ZUQB 4A6YB 3GDBA 1ASPA 4P05A 4UUJA 1LK3H 1HIMH 5CKGA 1HSBA 2ZG3A 2DIAA 2AJZA 5T1MA 3ZRSA 3T3PE 1PW3A 2WJ5A 2PPAA 3CNKA 3D7PA 3UP6A 4W9FC 1HQ4B 1WFIA 3QXDB 3FN0L 2VTFA 4NZUL 1YEFH 2OL3A 4NRYA 5ID0A 5CMAB 1NC2B 2G2RA 3RWCB 1MJ7H 2Y2WA 4DP5X 5A43C 2GEEA 3DIFB 4HWZA 3NJNA 4RFOH 5L2KE 3C5ZB 5ANMA 1XV8A 2IPUG 3STLB 3VD1A 3WV0A 1UD4A 1ETB1 1ZIBA 3LNHA 1CFSA 4AG4H 3A4AA 3EDJA 3MLSL 1TF4A 4HALA 4UI2A 1SXBA 1MRCL 3X3FH 1QSFA 4Y4KB 3CE1A 2IIJA 2ZKWA 1KTDB 3MLTB 4J3OH 3L5XH 3LKOA 3KWWA 4KOCA 5D6DC 2EDKA 4Q6KA 4BCXA 3P73B 2NSXA 4KKZA 4HOWA 2OTUA 3RY6C 1B2WH 4G1MA 4WV1A 4AW4A 1AQHA 4P46A 2QTEA 2XJKA 3G6JF 3LXAA 2IALA 1U8LA 2F54B 4CGTA 3HEIB 1G7PA 1GAFH 3MRBA 3CBKB 4JFTA 4NT6B 2ATPB 1U30A 1F00I 2VSDA 3HAEA 3SO3B 4N2OA 4Y1AD 3PABA 4E9WA 5T1LB 1A3RH 5I1HH 2DI9A 5D96C 1W8NA 2B20A 2EDQA 2MQ0A 1BQRA 2BIIA 3NN8B 2WOYA 1UXSA 4RIRA 5JDJA 3IFLL 3HNTH 2QKIB 4N1EA 5GGUB 3W1ZA 1P6AB 3VM7A 4GW1A 5GGSA 5I17B 1MEXH 3LS5H 3F7KA 3KVPA 1CFVL 1FFNA 4XMTA 1HKLL 2BZCA 2KQMA 2OR8A 1MF2H 4FHJA 1UADC 2FIKB 1LO4L 5ADOH 4TSBH 1LEKB 4WI6A 2LAAA 1HQRB 4JCMA 3HW7A 1J5CA 4R3SA 15C8L 1T2JA 1EGJL 4RA0C 4LCYA 1LEGA 5AG9A 4LK4A 5FXCH 3NJFA 4A7GA 5GS0D 5D5MB 4PJXF 1YEJH 4IOFC 4R8WL 1KEGH 4HHAB 4LLUB 3RWEB 5IP4A 5C0EB 5LG6A 2WZ5A 1N2RA 5E4EB 2K45A 5F7EH 5JR1L 1EJ8A 1WJ3A 4L3EB 5JHDE 1BMWA 2W65A 4LLMA 1OAKH 5LAXB 4P5KA 3O45B 5D6DA 5F7DA 2NZ9D 1U8OB 1RH8A 3FO1B 3IAPA 2HG0A 1A3LL 5MEOA 1TUPA 1LQSR 4QLWA 3X3GL 1FSKC 4NQTA 4DGVH 1XGPA 3MXVH 5KN5B 1EHLL 2CLVB 4P3CH 2M2DA 4MYPA 1MJJA 2I9LA 1OCWL 3F83A 3PAZA 3HN5A 4GUCA 3FHQA 5PAZA 5KSUA 1Z5HA 3CVCA 4LNRA 4TLSA 1NWOA 4U1IA 3UH8A 3ZIMA 4TUJB 4LSRL 3M45A 2VKWA 1MY5A 2YAOA 1WZMA 5FUZH 1UZ6F 1XR9A 2DQEL 2X70A 4AQAB 4P2OB 2A9NL 2AGJH 1JZ2A 2CK0L 3KYKL 3O6ML 3IMSA 2LLLA 1O7DC 1TVHA 5DMIH 5CINL 3QXVA 3GMMA 3HB3C 2YA0A 1B90A 5A16A 5MEPA 3CZLA 3KXFE 3D30A 1ACCA 4NKDA 5CR8A 2X4TA 4KDVA 2WXIA 2WCGA 4MZ3A 5D7JA 4E5XA 1I8LC 2MCPH 4PJCB 5MP6H 3CFNA 3E3QC 3QIWC 1WD8A 4H0IA 1ZK9A 4HIJB 5DHMC 3I9IA 5HI5C 1RHHB 4PLKD 1KCBA 4WI5A 4I8DA 3H7BA 3UC2A 3PNRB 4ZPTA 3GS4A 4QTHA 5ITBH 4OW6A 1NICA 4E9QA 4APXA 1JAEA 4JPSA 1PD6A 4C4BA 5JMOC 5C07A 3QULA 1HJBC 5IMLA 3KLQA 1A6AB 3CG8A 5DC4B 1F8TH 3ECUA 5KG9B 3I6GA 3SKMB 1T0PB 1CZ8L 2GT9B 1N0XL 2A6DA 2PLTA 4Y16D 3NCJH 3SDDC 1RULL 3BD5A 1QWUA 3BSZH 4NQED 4X83A 2Q6WA 3L95A 1DQLH 1AG0A 3BGFC 3VNZA 1CL7L 1N18A 5ISZA 5FV2A 4P9HH 5GRXG 2M1KA 1MIEH 4FNUA 4N2KA 5IEHB 2DBLH 4NXKA 3JV6A 2AXFB 4MJIE 2BNQA 5GS1B 1ZHKA 4S1QL 3OMZA 3BH9A 5KVMC 2Z8VC 5L2KB 5HJBA 5C08D 1QUPA 4EI5D 3VX0A 3N5AA 1DJYA 2Q86A 3CXHK 1EEUA 1KB3A 1YY9D 3C60B 4FXTA 5LCVL 3WN5A 3DV4A 4O2FA 1NBQA 3FNKA 5B39G 3CFEB 5E7BA 3VU1A 2D73A 2OW7A 4A2FA 1AQMA 1TDQA 3HE7C 5SWSB 5E08H 2OW6A 4I2XA 1U92B 4R2GB 1FYHB 4L4JA 2I24N 4Y4FC 1P7KB 4HLZH 5F7BA 5B38G 4AM0B 1NCJA 4NC1E 1KLFB 3N85H 5CWSA 5E2TH 1CICB 2R2BB 3GMRA 5TFSH 1G9NC 4X5QA 2V3DA 3QIWA 2Y1AA 2ZSWA 3APNA 1U33A 3D69B 3TO2A 5F3BA 1YUHB 2DLHA 3HRPA 2FL5B 3QDJE 4LL9A 2ZF8A 4LLQA 4UM9D 4BQCA 1JDDA 4BK5C 3H9SD 3QAQA 2NYKA 4Z3GA 3F04A 4YFLF 3WIHL 3BEVB 3QIUB 1OP3H 2ZOKB 3UO8B 4E36A 1CLVA 1O6SB 1L6PA 1URZA 2WGNB 3L3KA 1MFUA 3PRZA 1EIBA 4GRMA 5GIRA 1ZHLB 1KELH 5C0GA 1L7TL 3PWVB 2X4OA 3P30H 1J5IA 4MXQD 3CDGA 5FX3A 1F11A 2C34A 1H3VA 3WDHA 2RAMA 4GSXA 3ZL2A 4AYSA 2OTWA 4UQEA 1GRWA 4XBMA 1KTBA 5H94A 4OZFG 1IM3A 3TCXA 1Y18A 1F42A 2CO4A 3SPGA 3PWJA 1MCNA 4A2GA 4XAKE 1PZ2A 5K9QG 3HG3A 1FYTE 4GMTH 1F6LL 1E4XL 2IG2L 4NOFA 3IDNA 1W6WA 1QR4A 2BY0A 2JQMA 4KJQD 4Z76A 1ZY9A 5C71A 2XQ0A 2DYRB 4F15B 5EU3A 5K59F 3THML 4GQ9H 2CDEB 2OMYA 2AC0A 3JWNH 1R5IB 5IVZA 2YOAA 1INEL 5LGHH 5JHDB 4K7PY 1MCPL 1YMHB 2V7HB 4J7RA 2OMXB 4MD0B 1DP0A 3SE3C 3ARDC 3EBGA 2NNAA 5DHDA 4MJ2A 5IIEA 5KS9E 4PJDA 1WG3A 5EN2B 3SD2A 4L23A 4YDVA 2ED7A 4ISVA 4JKNA 2BCKB 3PJSB 3CDYA 1HZHL 1ASQA 1SFHA 3F7VB 3MR9A 2D8KA 1NLDH 3D6GA 4XNDA 2FH6A 5EIIA 1AJ7L 5F7KC 4E41B 5BMFL 1GYAA 5CJQH 3FH8A 1E5CA 1AKJA 4BZ1H 2ZE0A 4K2UL 4L4TE 4JGJA 3VWJB 5DZNA 1T5WB 3UG3A 1JPFA 4X4XA 1BF5A 3GBDA 3FT0A 4EO5A 2CGRL 3WNLA 2NW3A 3TFBA 4UV7H 2V4LA 4XPAL 1GOHA 4WUUE 1BLNB 4ZZKA 3MRLA 1DHKA 3KXFB 4L29A 4WI8A 3GRWH 5CEZL 2ZJSH 3I3BA 4HJEA 3CLEH 1RHFA 1N5AB 1TLKA 2VLRD 5C0AD 2EKSB 3V0DA 2WKLA 1YEHH 3G08A 4YPGA 3V4PH 2DQCH 5DJYB 5EU7E 4QT5A 4JPVH 3V4VA 4E41A 4BDVA 4ZX4A 3ZDZF 1Z1WA 3NFPA 4ODXB 4NUGL 4M62L 5DUML 2XA8L 4U3SA 1DVYA 2EE9A 2ZAIA 1T7VA 2JNZA 2OCFD 5GS2D 4CVWA 2FJGB 4NHUA 4YEEA 1JHKH 3BDYL 1AZRA 3KLKA 3MGTB 3KMDA 2QZQA 3CH1A 1D7FA 1A6WH 2XVGA 1WA0X 4M3KB 3ARDA 1FRGH 2J2ZB 1VGEL 1HNFA 1JE6A 1XBRA 3AT9A 3V4PB 3MO1B 4B53A 4P9MH 2P24B 4HIQA 2OXHB 2DMGA 5E6IA 3DX0A 1OLLA 2Q3XA 3KWXA 1O75A 1ACYL 3TTYA 4E9RA 2AQSA 4CA4A 2I9TB 3MV9D 3MJ8B 1LDPL 2P44B 4PCTA 3CFTA 4ONHB 4MJIB 1GY1A 2FX7H 1HHJB 4IRSC 4XNUH 1COBA 2WLNA 1HYRC 1VB9A 3UO1L 3X13B 3L4CA 4IKJA 3VFOB 4ZOAA 2IGTA 1UWGH 4I77L 4YVUA 2AEIT 3NA9L 4JZJC 1C8PA 1E9PB 5GZNA 3UC0L 2NY1C 3MAWA 4G80A 1IM9D 2ZCKH 5EWIL 5FM5O 1ZXKA 2IDCA 3CGTA 2XC8A 4JM2C 3LKSA 4L37A 5L88L 1WFUA 2WBKA 4BKTC 1AO7D 3L2LA 2YEQA 2APWA 3GI9L 4YO0B 3RVUD 4R83A 3C8KA 4HUMB 3SO5A 4QRPE 1EA9C 2WXGA 4M9PA 5T1KA 4L9DA 2QSVA 3REVB 3FOLA 4YSPA 2VDPH 3EH4B 3D08A 4HUXB 1L7IL 1SF5A 2DM7A 3NPSC 4G2AA 5IW1B 1XH0A 4NP9A 5E8EB 4EUPH 3HZMA 1R3HA 5E8OB 1OWRM 1DBBL 4HGWB 2YBGA 4FFVD 2QZ5A 1IFHH 4K3GA 3V95A 4P59H 2CBTA 3RB5A 3MYJA 1RURH 3X11B 5D7HA 1RZ8B 4MNGE 1U4FA 1U8CA 3AQZA 2LE9A 4K3EL 1BFSA 4AZUA 1LDSA 3P11L 2HLFC 5DD3H 4N9GB 5DJZA 2Q87A 2VDRL 1KY6A 3HRZC 3HA0A 4Z7OE 2VDPB 1FYTB 2E0PA 5ALCH 3IJ8A 3AXIA 3TEXA 4IRSA 4OLVH 2F58L 4JKKA 1FI8C 4MMZB 1GZPB 4EUPB 5HDWA 3LOWA 4XMZA 3K2IA 2CUAA 5CCJA 2AQ2A 2Q10A 2GTZB 4JHAL 3C09C 3MXWH 2FCBA 3MRQA 2ADIA 2J5LC 3MNWA 2A99A 2CDGA 4I18C 4NQDD 4RMSA 4W4OA 4EE2A 1V3JA 2OYLA 4MD5B 3QJQB 1DDTA 5C0DB 3T0EC 1DCEA 3EJQA 4XCFH 4JM2A 1A0QH 1I7RB 1W72L 4KRNA 2DQJH 4UILH 5KS9B 5CCHE 4S0TD 3PF2A 5AOLA 4BHUA 2BXYA 1C5CL 1WDAA 4AOFA 2JMRA 1EEYB 4EF3A 1P5VA 2ZOLA 3L4ZA 2XV3A 1F6AB 3QUZB 1JGVL 4K94C 3EIFA 4PPTA 2ISDA 3Q2CA 4L4TB 3AGWA 4C56D 1G0DA 2VXQL 4MJ5B 5B3JF 2ZWNA 3B2MA 1YPZE 3FMGL 5DXWA 4WNSA 4CVUA 3K0WA 5E51A 5GPRA 2JTYA 4O58H 5C0RH 1DUZA 1P9MC 3QRLA 4WUUB 5T1DH 4JG5A 1IC0A 4KAQL 4FTVE 5AVZB 3UJJH 5F0PB 3DI2B 3PP3K 5AD0B 2AVGA 5JXEA 1Y7VA 4Z7QF 3ARXA 1INDL 2ZUVA 2H26B 2ZUQC 4G3YL 3HRZA 3WFHA 2VR7A 2FH8A 4PRPA 2DTSA 2DMCA 2IOOA 1PG7H 1WIPA 1N12A 2FK9A 3QI9B 1FDLL 1NH6A 3IJ7A 5CIPH 5IR1A 1QNZL 2QDWA 4CU8A 1A4AA 2LOEA 2YUZA 3CXDL 3OKOA 4MQ7B 4LCWA 4UNIA 3KCWA 3MBXL 1DBMH 3WJJA 5E2WL 2WPGA 5IESL 4NZTL 2NYZA 4DHLA 5I6OA 5A2FA 4I18A 1TQBC 1A7PH 1U8QB 3MLYL 5F96H 3OHMB 3C5ZC 4WU5B 3VXNB 3TN0D 2ESVE 3LKQA 3PS6A 4PB9H 4V1DA 5CIPB 3WTYA 4A7VA 1GGIH 2Z4TA 1ZVYA 3SHSA 3O11B 4I4WA 4ZUSB 1AR1B 1ZWIB 4K5LA 5DRWA 4G6MH 1R4XA 3QQDB 4Y4KC 1MH5B 1ANUA 1F4XH 5IG7A 1CGVA 1E2WA 3FQRB 3CQQA 1JF1B 2A9ML 4GLRI 2JIXA 2HTLC 4LKXB 5FM5M 4DO6A 3KWTA 3LZOA 2YMXL 2FB4H 2B2XH 5E94A 4KWUA 2HRPL 2ZUUA 3QDMA 3MHZA 3QORB 1QLRA 1K4CA 4LSQL 5FWQA 5DGQA 3PCYA 5CZRA 3SPHA 2JSFA 3SO3C 1P9MA 1UJ3A 3OF6D 5BZWB 1KY7A 3BSHA 2ZYHA 2W9EH 4J3OC 4YHPB 1NUNB 4JN1H 3BP7B 3FT2A 4UM8A 4P2CG 3BEWB 1I1FA 4WRLA 2DQGL 4Q2ZA 2VIRA 4KTDH 1JWMB 2Y5TB 2QKIC 2R2EA 3U36A 5M7QA 5HHPA 3LNFA 4B6ZA 5I8EA 1OAJA 2H32H 3K2KA 2NNCA 2YBRB 2WQSA 3BH8A 5F2FA 5J6SA 3TBVB 4M5SA 4BJLA 2IJ0C 1RVFL 3VNYA 4QRPB 3TV3H 3DTUB 4C59B 2OFQA 2VRQA 4OLWL 3LCYA 3NJMA 4Z7UE 2IC2A 1HQ4A 4XN2A 5E5LA 1SYSB 5IFHL 1WWCA 4N20A 4H20L 3UXFA 3FUIA 3RWCA 3WNOA 5HYEA 4K3DH 5I8OH 3AMKA 5JHBA 4O2CA 1JTOA 3UYOD 2VXSL 3DIFA 3L1GA 4JGMA 3Q1SH 3LQMA 1J18A 3C5ZA 5HHNB 4B9IA 1XIWB 4GRLD 1ITBB 4X6DE 4MNGB 1CDGA 4NS0A 4EQ3A 5E4EC 2P4AB 3U48A 4ALAC 3BN9C 2DM4A 4LHUB 1D2OA 4GBXD 5KANG 3BVXA 4Z7OB 3F6LA 1L9NA 5DRXA 3MLTA 3SQBB 2X9YA 2FNBA 4G5ZH 1CTOA 2IDFA 1CCZA 4B7IA 2LVEA 1OSEA 4FJYA 5I5JA 3O6FD 4JGUA 3K8LA 1BIIA 1GYCA 1OAUH 2NY5C 3S37X 3FFDB 1RSYA 5AOZA 1CFQA 1HE7A 2F54A 1SJHB 1EVTC 3D05A 5F88B 2KS0A 2GEQA 4BRJA 2ATPA 5DSCA 3WXVL 2VRAA 4YOKA 1BZEA 4HH9A 2VM3A 4P2OC 1UM4H 2ZWZA 4HK0B 1YZZA 4U1GB 3NN8A 2E9JA 1FBIH 3MNMA 2VL5A 4IMKA 4O5LH 4OU3A 4BA0A 3GBNH 3LH9A 4U33A 3QSKB 2HT3C 4OM1H 3F01A 4P8QA 3QFDB 5I1CL 2ZPKL 1A4BA 1LNUB 1YC7A 3GFUA 3NDYE 5JUEL 1DYZA 1TQUA 1RK1A 2FIKA 4PP1D 5TK2A 1QLFB 4ACPA 5GRJL 1YPZB 1DSFL 4GI6A 4MB3A 5F9JB 3L3GA 4I9XA 4L0PB 4U0RB 4EBQL 2X1WL 3BKCH 1T1YA 1QVOB 4FTVB 2ENPA 3WTSA 2UY7B 4Z7WF 3KPSE 3JT0A 3WHXA 2ICES 2GYSA 1ZXQA 3FUJA 4L3EA 3L54A 4GQPH 4UT9H 2EC9U 1QFWH 4GO9A 4LSPL 4XX5A 4Z95H 1LILA 3B8YA 3OKMA 2GI0A 3O45A 4M1DL 5E70A 1LP9E 1U8OA 3FO1A 3PWLA 3QGVA 3TESA 2Y6TE 3EFOA 2WLLB 4OVUA 3D25A 2CLVA 2X6UA 4XNXH 1F3JB 2HSIA 4MAUH 5D1QA 4BFFA 1WHPA 3UBXB 5IGXH 1KB9K 4JM2F 5GS1C 3T2OA 3ZLQC 3JV5A 4WO4B 3BPOB 1MDAA 1JCKA 1F97A 5HD8D 4UT7L 4HS3B 3PDDA 5EU6E 3T1WA 3ZDWA 2R8SH 2ESVB 4P2OA 4FQ1L 3DSNB 3ZDYF 5AUMB 5HY9B 4JQIL 1C5BL 3C60C 3HVNA 5CLXA 2Z6FA 2WBWB 1GA2A 2OYKA 4K07A 4PRIE 2GJZB 4XMPL 2K1MA 1AQDB 5C2UB 1MPAH 3AT8A 2C7UB 4MXWL 3I6KA 4M56A 2P8LA 2GTWA 2JI2A 3HC2A 3L3HB 4OD2B 4P9HC 5I16A 4APQA 4Y9FA 4G6FD 1TETL 4HJ0D 3VGGA 3FT4B 4NNXB 3VYOA 4PJHF 5JOEA 5KVFH 1CICC 2ODHA 4JO1L 5G2NA 5I15L 1VFAB 2VZUA 1OAYL 1NAKH 1OGPA 4N0FB 2UZYA 3U6XS 4NQSA 2I32A 1T4KA 1PPIA 2K70A 2VM4A 2J71A 3NSCA 5FGBC 4F1SA 4MCNA 4H25B 2VERN 3VDBA 1NFKA 4D0DA 1U93A 1A6AA 5AZEL 1A02N 1YQVH 5T3ZE 3OXSA 3SEPA 2AQNA 1CXFA 2UYLB 1A3ZA 3O3AB 3IFNH 2IQ9L 4LU5L 2BWIA 4A2EA 1EFXA 2Y69B 4Z7UB 2H1PL 3S2AA 1VGKB 4M7JH 1JNNH 3L7FA 3PHOB 3BAEL 4H8QA 3CC5B 5ELIA 5GJSL 1FO0H 1YDPA 5GS1A 2AXFA 2JCCB 5GS0L 2O6CA 1FC1A 5L2KA 4D0BB 2EDEA 4UINL 2X4RB 3GD1C 1VESA 3PQYD 4F15C 2VR8A 4L1BA 4X6DB 3P3TA 2HJKB 2KT6A 1REIA 2AAVA 3WKML 2PR4H 3HPJB 3ZYZA 43CAB 1W0VB 2QV2A 3B6SB 3BSZA 4PRHD 3P4MA 1P7BA 2ZXWB 3LIZH 4XODA 5SWSA 4PJ8D 4XOCA 3DJZA 2C8NA 1Z2KA 1FO0B 3EOAA 3VFTB 3B1UA 1FGVH 4WUKH 3DURB 2ZXAA 4PB0L 2WVVB 4F7MA 2YD0A 3NCEB 2Z93A 3KLAB 1MHCA 4MCZA 2B4CH 4NO2A 1W16A 1KT2A 3BWUC 5BRPA 3MRKA 3HS0A 4GMSH 3JWNC 1WIOA 1X44A 3IDMA 2W95A 3R8QA 4XXWC 1M53A 3LSOA 3GHEL 2NQDA 3VWJC 4OVVA 5FGBA 5EIVA 4J1UB 1OAXL 1KPUB 1IX2A 1Q1PA 3K4AA 3L3IB 2WVTA 3MTXA 4KGLA 3V6OE 1HVXA 4EI6B 4FDWA 1CIDA 4GINA 4QXGL 2R29H 2R27A 2ZONA 1TEGA 3Q6GH 5AAWA 1OHQA 3BUTA 4HKBB 1DBKH 3DETC 5HHQB 3NRQA 3RWGA 3CTTA 5BV7L 1H6UA 4AGOA 4N9OB 4OTXH 4D2NA 4PV9B 2FTAA 5EN3A 3C2AL 3IMBA 4FQQB 1Y1DA 4NEHB 3FYIB 5LN8A 4P5RA 2WN3A 4TSCH 4U0QB 3KPSB 3SBQA 2LAGB 1AFVL 1BD2A 1WYJA 3GJEB 4ZPVB 1V27A 4CBZA 3FTZA 4FXKA 2BSRB 4TVPD 3S3JA 5JHDA 3FQNA 4MAZA 2CJSA 2V7HA 2OMXA 3ULSA 1L5GB 3C5XA 4R4ND 4DPRA 5L4MA 4HWUA 1LO2H 1LP9B 3KBPA 2FHBA 2CCVA 3AT0A 4YNYB 3V6ZA 4XMVA 5TE6L 2VSKB 4HS8L 2BCKA 3PJSA 3ME0B 5T5NG 3ZT7A 5AFAA 3DJ9A 5KYWA 4J3OF 5I0VA 3BZ4B 2FWOB 3O8XB 5IFAL 1GYVA 5KEZA 1Q9OB 3IN2A 2YWYA 3KDMA 1P6FA 5B7FA 4GT7A 3VD4A 4XXWA 4MNQE 1T3FB 3MROB 3HHSA 5EU6B 1U91A 1XX9C 1SDDB 3ARGD 2VQUA 2Z35A 1T5WA 4K7PL 2EIBA 1II4E 2J3SA 3HBGA 4EKXA 2FEDD 4PRIB 1N3NA 1NCAL 2W0FB 5IHLB 5FO8A 2G2NA 3EYVA 1MCWM 4M4PA 2A74B 4S1RL 4CVZB 1RUKH 4KJYB 2Z9TA 4NC1C 4D9RD 3KWUA 5KYUA 4BZ1A 1I8KB 3KGSA 5D5MF 2EKSA 5SWZE 1F90H 3FB5B 4MQTB 3MPCA 4XOBA 5DJ0B 1ZV5A 4WWKA 3VMNA 4DH2A 4ODXA 2F19H 4ZD3H 1HYSC 2VR3A 2X41A 4OJYA 4JRFA 2D9CA 2EACA 4YSQA 1MRDL 3FU7B 3HI6L 1TEFA 4HUCA 5DD0H 2ZNXA 2O93L 3MGTA 3B7TA 1GC1L 3LB6C 2HVBA 4QXTB 4ANUA 4F5CE 3U7WH 5IHZB 3UMNA 1E3FA 2VW4A 3TBBA 4YDIL 2J2ZA 3C9NB 2DJ4A 3V4PA 3LYRA 4GAAA 3EDFA 2P24A 4MB4A 1RZJL 3MRCA 4QJ5B 4PJBE 4EEEA 1CLYH 4G1EB 4BBWA 4KKRA 4ADGA 3MKKA 2WXNA 4ECNA 2I9TA 4I0PB 1HTYA 5FF6B 5FR3A 1KEMH 1MWAH 1AZUA 2QGDA 3U4EA 2VL4A 4N5ED 2VDLH 1HHJA 4JO8A 2Y4SA 4OZGA 2AQRA 1I8IB 4G8AC 5DTFA 3KYOB 3X13A 4MMZC 3UJTH 3WMSA 1PGRB 3IETA 4I88A 5DQ9A 3PGFL 4FA8A 4OCWL 1QUNB 2XNAA 4M5YL 4ZQKA 5TQ0H 4CW1B 1J8KA 4XO5A 4NIYE 2FX9H 3CFKA 1AQKL 1AYRA 2JJSC 4CMMA 3ISWA 4PJCF 4O02L 1KJMA 4DKTA 3QCVL 4HG4K 3REWB 1M7IA 1MWAB 4NQVB 4HWEH 4PWIA 2Z8RA 2VDLB 1NMAL 2ZXBA 4OD1H 5I8KH 1IJNA 1A8ZA 3SKOB 4ZSOE 3UTQB 4G8GE 2GITB 1QX1A 2G9HB 4IGBA 3L7EA 4I3SH 3QUZC 4ZODA 3MLRL 3A4DA 2CO7B 2DRUA 4QYAA 5T3XL 4K5MA 2Y7NA 1OGAD 4HUXA 1NGQL 4L2YA 4FULA 5F7FA 3SYPA 1JPGA 4F7PB 1OP3K 3WSQL 4GXUN 4RZCA 3FN0H 4NZUH 1JHTB 3D39D 3K2MC 5IMMB 2W8CA 5E8OA 4UQ3B 1JI2A 3X11A 2WLIB 1XMWA 2Z0BA 1H8LA 1RZ8A 3RA7L 5D93B 1A6PA 2DQTL 3HIZA 4OJEH 1TT6A 3VX1A 4QRRE 4Q56A 5TD4A 2EUXA 4N9GA 1TTCA 1I9IH 4H1LH 2V5RA 3QI9C 5EU7C 4F37F 2X40A 3LH2L 2CLZB 3MLSH 4FNSA 4OAWB 3LVTA 2ZKHL 5DD5L 5FB8A 1GZPA 2ADJA 3WI9A 2EIJB 2VO8A 5JA9A 1MHPH 4Z3JA 2GTZA 3HKZA 5FHBL 5ICUA 4IMLB 5DEZA 4JN2A 1I3GL 5C0DA 4JNXA 4FZEL 4H1LB 2NR6C 1S7WB 4LDOB 3FDWA 1CFTA 4YFLI 4Q14A 2DWEB 3G9AB 1NM4A 3V9CA 1AR1C 4XMKL 4G71B 4OCXL 1R0AL 2VNCA 4YGVA 4NBYB 2GBAA 2OTPA 3L6FB 1J0YA 1DN2A 1WBYB 5FA4B 1B88A 3IFLH 4X4YA 1EXHA 2G0LA 1SLUA 4XRCA 3ZMRA 4AYMC 2F8IA 2W07B 4FFZL 4MNQB 4PN6A 5E6RB 3E6HA 1CFMA 2A6KA 2PABA 2R0LL 3OZLA 3PPEA 1BG9A 1CFVH 4MJ5A 4JE4B 3GM8A 4QRQB 2IBGA 2YRLA 1HKLH 1ZJBA 2XWRA 2K8MA 3M07A 4J3TA 3PWUB 1LO4H 1UH2A 5C8JA 4U7SA 3RDJA 1I1YA 3D2UD 5ICXB 2UWEA 4JDVB 15C8H 1G6RL 1EGJH 4F2MA 1RUML 3T2QA 4BM7A 4TF4A 2WY3B 5AD0A 3MJGX 2M83A 1JK8B 4HU8A 3UL4A 5INDB 1DVFB 1CYXA 2PN5A 5SWZB 2LQRA 5GGRA 2A4CA 3W56A 1GPOL 2YPKB 4ZMQA 5JR1H 3LEVL 1PKQE 2QVMA 2DWDB 4HCRA 1IUZA 4CBPA 1E5AA 3NPZB 1IGTA 3RWHA 1KJ2B 1QEWA 3BP4B 5I6PA 1PLBA 5CAYB 3UBFA 1A3LH 3DPDA 4LHQB 5JQ6H 4J5VA 3TL5A 2XHNA 4AQEA 3GZKA 4HLEA 2DLFL 4WU5A 3VXSE 5JIIA 1XIWC 3VXNA 2QPSA 2JLLA 2ZG1A 5CIPA 2N7AA 3QEHB 3O11A 3QEUA 4LSRH 4PJBB 3BWUF 5I73B 4JFHD 5HI5D 1BG1A 3QQDA 3CDZB 3ZR5A 2A9NH 1MH5A 5E6SB 2ZUTA 3KYKH 3O6MH 3FQRA 5DDHB 1GR7A 3V7AE 2BSSB 3V0VB 2J8HA 1J87A 3GMOA 3CHOA 5CINH 3CFMA 3LN5B 3RURA 3CHRA 1U3HB 2KZ1B 4KVCL 2CR3A 1CJYA 4AV5A 3L4XA 4IM8A 2X9XA 3PGCB 4PGDB 2L04A 5E2UL 5DRNA 2XYBA 3VXTB 4OV5A 1L3WA 3KLHD 4UOQA 4KI5E 5BZWA 4M3HA 4HJUA 4L4VD 4OGXL 4HHWA 3FS9A 3SDDD 5LDUA 2IWKA 3BP7A 4U1GC 1BQSA 2WP3T 2EDXA 2C9UA 1S5HB 4IKKA 1JWMA 2RD0A 2Y5TA 3KPQA 4P2QA 4JY4B 4ZMAT 5GZOC 4ZSOB 1GIGH 2H0JA 1DLHA 2VMCA 4G8GB 2P26A 3TBVA 3BD4A 5BQDA 3P0VL 3ULVD 2CAKA 2O1AA 2CQVA 4PD4K 1AC6A 3ZVVA 3GK8H 1QBBA 3EOYG 3FQ1A 1SYSA 5DFTA 4X0KA 5FGRA 3JWOL 3QDGD 3UJIL 4KX8A 3RZCB 2ZD0A 1OKEA 3KPPB 4TPRL 3IF1B 2XBTA 1RULH 2KZBA 2VLJA 4UOW0 1PJ9A 5DFWH 4Q9RL 3HS8A 4NAMA 5KBKA 2AQQA 1CL7H 4Y4FD 3EBIA 4P2RE 5F72S 2H32A 5J89A 3PGDB 1HH6A 4PVMA 3VXRD 1DCLA 5G5DB 2J5WA 4NIKB 4QRRB 1TLMA 1OD9A 1OOWA 5PCYA 3H0TB 3MJ6A 4X98B 5D7LE 3MUGA 1T6WA 2IANA 3O41A 4S0HA 2CHWA 5TK4A 3NJHA 2BVQA 1HOCA 4FQCH 4YDZA 1SYVB 2I85A 2QLYA 2E86A 2E56A 4FFWC 1CXIA 1JXJA 2BC4B 1B0RA 1WC7A 4GS7B 1U8HB 4Y5VA 4D8OA 5J6GB 5FS5A 2FGWH 3BPOC 3MJ9H 4DW2L 1YY8A 4CSPA 2HVKA 3O4LE 4WHCA 4Y5XA 4BSVB 2XWTB 4YH6A 3UPRA 1ET5A 5BRZE 3GF8A 4GAFB 4TKWA 3WIHH 5DYFA 2DKSA 1AH1A 4A68A 2VQ1A 1E67A 4RMRA 1CVRA 4FABL 1RXLA 2QELA 2NY7L 5D72L 4R7DB 2N1TE 3FTGB 3J07A 5K5YA 4GSQA 1LNUA 2L7QA 1L7TH 2PO6D 3ATDA 3WNKA 1QLFA 4G9FB 2IMMA 1X5YA 3WCYA 4B3EA 1IFGA 5EC2B 2OULB 2LW3A 5F9JA 5EF1A 2G75A 4HJGB 4P3DA 2CLRB 2IOMA 3UAJC 4QHPA 4QHLB 3KYMA 2WBJA 2PCXA 3GTTA 3VXUD 1Q94B 1DFBL 1P84K 25C8H 4X50A 2XVBA 1JWUB 2IG2H 3L9RA 3QW9A 3GINA 5C0CD 2Z91A 3THMH 3GIVA 3V4UH 2MOQA 2PCFB 1ZA3B 5TF1H 3VTAA 1KFAL 1VZHA 4RMWA 3QNZB 1MCPH 4ES8A 1PKQB 2FO4B 3QYMA 4BCYA 2WB7A 4PTTB 1F3JA 3CU7A 2PYFA 1NC4A 1URLA 4KK9C 3VGFA 4DF9A 4WAFA 1KGYE 4P4RB 1XCQB 4GXVL 4KFMA 4PGBA 4GUPB 2JJTC 1FORH 2EDMA 4GEJA 1HINL 4YUEH 4UT9A 3DJSA 3CZEA 5KS9F 1ZSDB 4LAQH 4DQAA 1HZHH 3VXSB 4LHUG 4CMHB 1MZZA 4S2SA 5HDRA 1U6AL 1XF2B 4FMFA 5BMFH 3RX5A 3ZL4L 1N26A 3I02A 4K2UH 5I2IB 4Z7NE 3WFDH 2I27N 2VMEA 3K6NA 2BNRE 1WITA 4X8XA 3ZPDA 5CHNA 4M1GL 3G6DL 1QFUL 2JCWA 4NNXA 1MCDA 1M05B 3NACH 3T4YB 3PHSA 1HXYB 3WNJA 3EBAA 1EZSA 4U1JB 3TIEB 2YLHA 2W9DL 3OHXA 2GJ6D 4OIAA 1EAPB 5AVTB 3GSOB 1KB5L 4KKLD 1UFUA 1XDTT 2A73A 1NEZG 2K9FB 2XN9A 4FMKA 3CCHA 3I6LE 4H25A 1AGEA 3W39B 3ARUA 5E24E 4NUGH 5DUMH 5IZ7A 3OC5A 3EGSA 1IAOA 4HF5H 3EJUA 5M94B 4NQUA 5ACZB 4N86A 3L1OH 2N7SA 3NIFB 1S4IA 4NUQA 4YVNA 2LHAA 2W0PA 1BECA 1CTNA 1MI5D 1YEDA 3SOTA 1JUFA 5BXFB 2FX8L 5GRVL 3EO0A 1BXXA 1SOSA 3DBXA 3QEQE 3U7AA 1VGEH 3DX9B 2OX5A 2ITFA 4J6IA 3FN9A 4ZYKB 2E9WA 3RL2B 2YGNA 3RPBA 2JCCA 1ACYH 1MOEA 4N1HB 3K71B 5JW4M 2WZPA 4PRNB 4P2RB 4ZNCD 1LDPH 3U0WL 4XP6L 2P8MB 4WLCA 3QZLA 4AMXA 3W38A 2HJKA 2VITB 3G5YA 3UO1H 4HZAA 3OJ2C 4YDJB 3B6SA 4FOMA 5D1ZA 2YLKA 1A1OB 1GGYA 5D7LB 3FRPB 3Q06A 4I77H 3L5WA 1PIFA 2XUWA 3EYOA 3STZB 3B5TA 3UC0H 1FO0A 5I19H 1ZEAL 3VFTA 5C3LD 3UBXG 4JM4L 5EWIH 1TVDA 3ARFD 1F6FB 2E6PA 4J2XA 3KLAA 1I1CA 5KOVC 5L88H 3O8XC 4Y9BA 1JYXA 4KMLB 3OM3B 4F58L 3O4LB 3C2SA 3VFWB 5FYLD 1YMME 1FZKB 2VC2B 3LIZA 5KSVA 4OCMC 3IFPB 4EVNA 1YEIL 1QLEB 1U95B 5BRZB 5C3IA 3DGCR 32C2B 4PWGA 1IJ9A 4GB9A 1WF5A 3HAEG 4S0SD 1N0LB 3QB7C 5AL0A 2A83B 1L7IH 4NENB 1X7SA 2EE3A 2A74C 4HEMA 1LWHA 3EZ8A 1FLTX 2I60L 4DPCX 2GABA 1BZ9B 4HKBA 1QG3A 3DOSB 3SQOL 1OB0A 4B27A 4B50A 2F7PA 1FH2A 4WJ5B 5CJXA 5IB1B 4K3EH 5TQ2L 1P53A 1ZHNB 5J1SC 3MLZL 3O6LL 4HDIB 4G6AD 3T0ED 3P11H 5DD1H 1Z9SA 1A5FL 4J3VA 4L1SA 2VDRH 1L0XA 2WTRA 4XBEL 4PV9A 4OLUL 4X5PA 3H9ZA 4Y5YB 3S3BB 3B4NA 3QUML 3WO3B 2Q1EA 4Z7OF 2R29A 5D2LA 2F58H 4Y89A 3BUIA 4ZPVA 1JTTA 1FL6B 1UA3A 3ES6B 2IOIA 1XCXA 1FV1A 1HU8A 4JHAH 3EJTA 4QHKJ 3QNFA 3KPOA 3WN6A 1ZHBB 3W81A 3O3EB 2P5EE 3UPAA 1M6OB 1IQDA 1UTDA 2D0FA 1W72H 3MVSA 1OANA 2CRZA 3BZ4A 5FCUH 5ETUA 3T6VA 5KSAB 2EXSA 1ADQL 5ESVB 5JO5B 1C5CH 4MS6A 1XB6A 3MROA 3QH3B 4EPSA 5D7IA 4ZXBB 1HILB 4TQEL 1JGVH 1NGXA 1G1KA 1MCRA 2F9BT 4AH2B 2HFFB 4PRIA 4EIBA 4Z7NB 2GFBB 3SCMB 2XZAL 2VXQH 4U3XA 2ATKA 2IQAB 4MTMA 2BNRB 1I3RA 3DJRA 4UTCA 4UT6L 4CVZA 4EIUA 3GKWL 1UG9A 1YPZF 3BPCB 3GMLB 4QHMA 1HC1A 1NC2D 3GSUA 3K6OA 4WFEE 1YYCA 3BKJL 1CWVA 3RIFK 3RNKB 3WL9B 1JWSA 3NH7L 4C57C 1S9WB 4H5SA 4RDQG 3TIDB 4CN6A 1H3XA 3F62A 1IC4H 3ARBD 4A2HA 4FQPA 1XH1A 3AW5A 4HS6B 1HEJC 1NFIB 4F8NA 1GY2A 1P4IL 2WUBL 5D7SL 1XTLA 3WY1A 1QNZH 2D03L 1ND0B 3DMMD 3CXDH 3FU7A 5E9AA 4Y4KD 4NXSA 3CVBA 1UGKA 3IE9A 2WQWA 1FUNA 2NXZB 3J2PA 5I1IL 3MBXH 3GBML 1ZGLB 5E2WH 3FO0L 4JL2A 5DRZB 4YHKL 4NZTH 4OGYH 1UHVA 2QQKL 4YE0A 4M5ZH 3MLYH 4B9YA 3QBTB 4ZMZA 5A2CA 4JS7A 1UD6A 3QEQB 3GUFA 3KHOA 3KW8A 2XG4B 2ZKYA 5KJRH 5IM7B 4H7VA 3V0WL 1OSZB 4NUPA 5EV7A 1KCRL 4R5TA 4W81A 5T5FH 3TVMB 3ZX1A 1SLXA 3IDIB 4WIQA 5IV2B 4JMNA 2JB6B 2Z8WC 5AW2B 3DX6B 2A9MH 2UXFA 3OAUL 2Q9OA 3EG9A 1SJEA 3DO7B 4K5PA 2BY1A 4KV5E 5J5EA 3VW3L 4JKPL 3OR6B 2V9QA 1E5YA 2HRPH 3A24A 3P1VA 3REWA 3I85A 1MWAA 4BV1A 2COQA 4LSQH 5CGYC 3ZT5A 3UP1A 4FEMA 2RMNA 43C9A 3LAFA 3K6SB 1H3WM 3QJUB 5MENA 3MGAA 3SKOA 3FTUA 4S1SH 3GXUB 3AS3A 2G9HA 3O9WD 3LHPL 5KANI 2DQGH 3V5KB 2QSQA 3U1SH 1N67A 1HI6B 4MJJA 4HIIB 4FYRA 2SEBB 2XQYG 1YMMB 3CZSA 3OSVA 4YJZL 2X2JA 1IKOP 1RVFH 3PHAA 3BN9D 1OL0A 3WEXA 3L81A 3Q3GB 4K15A 4F7PA 5EDXA 3DUSB 4OLWH 2BCMA 2OA9A 4YHYB 1YN7B 3C6EA 3EADA 3D0LB 3JV4A 5GRWA 1E3XA 3U7YH 2APXA 5IMMA 4Z7UF 3ECQA 4UQ3A 3QUHA 4H20H 5AVVB 5LBGA 3ZGIA 1EH9A 3IYLW 3MV7A 5IQ7L 4AKOA 4ZFOL 2VXSH 2J7LA 3HNVL 3MLXL 1XB8A 2JCCF 2HKHL 2OMBA 3K6IA 1DVFC 3BMWA 2HPOA 5H2BA 2ZYIA 2RFXA 4A7TA 1OQOA 5H35A 4X6DF 5LBSL 2CLZA 2EVFA 4OAWA 2EDNA 4GSUA 4NPYA 5F8RC 5KBPA 4HZLB 1BXAA 2XT1B 4R90L 3ILEA 3D4GA 5LQBL 4XI5C 1QQDA 2XFXB 1EXUB 4N2HA 3BUYB 4Z7AA 5FWRA 3PWPA 4QKXB 3UGUA 1NCNA 3HHMA 4XBPB 4AW7A 2NCEA 3ARQA 1YJDL 4QDGA 2O61B 4N8UA 2DWEA 2ZAGA 3WXVH 1YYML 2TAAA 5I73C 3TCLA 1XL4A 2P5EB 1SMAA 4LSSL 1E6JL 1P4BL 3LKNB 2J25A 1WBYA 1KXVC 5F1KC 5FA4A 2OMVA 4A7QA 1DQJB 5JPNB 2W07A 5FLUA 5BZXA 3EXLA 2G0KA 1U21A 2AJXH 3FU3A 1GGTA 1PX4A 4IJTA 2MCMA 1BBDL 2ZPKH 4IIQB 4QRQA 1Q1JL 2HH0L 4N2MA 5JUEH 2YSSB 4HH8A 5GRJH 4B3VA 1TZGL 2BPBA 2CH8A 4KHXH 3UTZB 4OY9A 4JDVA 3NK4A 4LPCA 5ICXA 1JGDB 1PX3A 3FTSA 3IJYB 5EEZA 3MRFB 3C6LB 4NPKA 3O4OB 3SGKC 2NY3D 4A1RA 2VLLB 4DCQA 4EBQH 4IW4C 3FN3A 2EDHA 4X6CE 3H55A 2VO5A 3H2QA 5HBBA 5AKRA 1KDJA 4QHUB 5GRUL 2P42B 1BA9A 1AP2B 5KUMA 3VXMA 2YPKA 5DR5L 3LQAL 4UZUA 8FABA 1RUQH 4M6OL 1GVIA 3HUJE 1BCIA 3BP5A 3C60D 4KUCF 3UADA 2GAZB 3BKYH 2QDVA 2R23A 1GKEA 1EGJA 1CGWA 4J8RA 2PTTB 3RZCC 5DS1A 2AK4A 3DX8B 1LP9F 5CZKA 3RG1C 4R2GD 2FYYA 4E9SA 5I9QB 3F7LA 1RK0A 4OUOA 4NERA 3G6AA 2FZ3B 1SOQA 1W2KT 3MJWA 4YZFE 2PXYB 4PJBA 5HHVL 1ET7A 4UT7H 3MA9L 2RA1A 2LU4A 1S6NA 3ARPA 3NCBB 4AUYA 1I7TA 2LGNA 4RQQB 4JQIH 1C5BH 1KXVA 4UZSA 5DDHA 4LBAA 2BSSA 4N2IA 3QIUD 3QO1A 2R1XB 4JY5H 4NQEE 2MOGA 1E8ZA 1XD0A 4MRBA 1WBZA 3AROA 4MXWH 1DQIA 2ZX9A 1G7MB 3F7YB 4XVJL 4ZMVA 3PY9A 4GS7C 3B56A 2XJLA 3HPLA 5HGDA 1TETH 3MZTA 4H1LG 3ZT6A 4DAGL 2OQJB 5C08E 1NGWB 2HYMA 3D0VA 4JO1H 1RERA 2AV7B 2XVKA 5I15H 1OAYH 4KZ0A 1NCWH 1MJUL 3EYUL 4POZD 3GBEA 2DYPD 3SGKA 3WUWB 1E28B 1AACA 2MOVA 1VJSA 2CKNA 3OB8A 3GJFB 1G7QB 3U2IA 4K8RC 1OF2B 3MOBL 4AIZB 1CIUA 2J4WH 4DQOH 3ECBB 1XCTB 4LE8A 4MA1C 4RMTA 4BINA 5HTSA 3TBSB 4MRCA 1XGTB 4LU5H 3NCYS 1D5RA 4AE1A 2H1PH 3C6SA 3HLAA 5DUBA 3KZ8A 4OFDA 1S9VB 3BAEH 4UOZA 1SMOA 2XU9A 3FQ4A 3PGDA 2XTLA 4HJIA 4NQQA 2AJYH 2HUEA 4KFZC 5L6YL 3MRIB 1MUJA 2ICWB 4HQQL 1J9SA 4QRRA 3H2WA 3KCPA 1FZJB 2Y7SA 3H4FA 5GS0H 4KNQA 4P48A 4GAGL 3MV8A 4F20A 4UINH 2YPVL 3GSVA 4CVXA 4OQTH 2IPKA 2RHEA 2VUKA 3CXHJ 1R75A 3NEXA 3WKMH 4FKHA 1X7QB 1THCA 3ML8A 1W80A 1MLCB 1SVBA 4YMPA 2YZ8A 3KPNA 4PS8A 2PPCA 3IU4L 1KTLA 3UIYA 3W0WA 3FH7A 1J5DA 3KPMA 3K1DA 1N8ZB 4PB0H 4DTGL 3KXFD 5KVDL 1DBAH 5EFIA 4BSVA 1A2YA 2XWTA 2Y6SD 4FL4C 2GC4C 5LCVA 4CMHC 4IBSA 1UZ8A 3VRJB 5CSGA 3NQKA 2DD8H 2ED6A 4R7VA 5EZOL 2YK1L 4WEEA 5EEYA 4PS7A 1SNRA 3Q9PA 3T71A 4JRYE 5CLWA 1ZS8B 3WIIH 2VZSA 1MKFA 4PP2A 3IMTA 4N2DA 3ERXA 2VW7A 1EEQA 3MBEB 3DVGB 1XD1A 2R69L 1IEAB 2MPAL 4Q89A 4G7YL 4G9FA 2V5SA 3CSYB 4Q8BA 4LDCA 2BY3A 4B97A 2Y3AA 3IXAA 4KO5A 2HJLB 2GG1A 2IDTA 4HJGA 3WIHA 2TSAA 4KI5C 5CNHA 4QHLA 4JR9L 3JYBA 4NRXB 4A38A 2MNWA 1Q94A 2WINB 4EZMA 1JWUA 1A7NL 1QTSA 4Y1TA 1U8NA 2JF1A 4X6CB 3FT9A 1HZKA 2JK5B 2DQ6A 4FYQA 4MJID 3TCTA 1O5PA 5I0XA 2N1KA 2PCFA 4MXVE 5EORL 1AFVH 5LGJA 2CRYA 3P77B 1BM3H 4M1CD 5J06A 5HGAA 3BWZA 3HUJB 2FO4A 4XP4L 5DWUH 3ZZQA 3FXIC 2WO2B 5CZVL 4PTTA 1NKOA 1Q0XL 3T1FB 5C0BA 2X0WA 4P4RA 2NZIA 1XCQA 4HEPA 5F1IB 3MOQA 4GAJL 1OK0A 4GUPA 5DQDL 1EUTA 3PPSA 5TE6H 4HS8H 2WQRA 4IS6B 4FERA 3AREA 3CWGA 2NYYC 3SKJH 1BOYA 3AY4C 4HIEA 4NLAA 3EFDL 5DFAA 1XF2A 1G9NL 3SDCD 5EBMB 4LEOA 2JB5L 4NO3B 1HHIB 2EDDA 3LKPA 2BVUA 4ATWA 1JGEA 3QDJD 4BSJA 4EIGB 3ESVF 4MQXD 3TBTB 5EZIL 2P52A 3IJSA 4NO5A 4K7PH 4Y16B 5BQ7B 1AS7A 2GIYA 1KCSL 3CVIH 4QWWC 5LKNA 1BFTA 3UZQA 1HYSD 3NK3A 3C8HA 3BI9X