3RDTA

Crystal structure of 809.b5 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLIAIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASKGADRLTFGKGTQLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
publication title A role for differential variable gene pairing in creating T cell receptors specific for unique major histocompatibility ligands.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2011-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA02
2C1OB 2VDRL 1R3HB 1JPFA 3IDXH 3SGKA 4GKSA 4TQEL 3KXFB 3VXQA 4L4VA 4HDIA 1ZGLM 4JQVC 5D2LF 3KPSA 4PJHF 5DHYB 3DPBA 4PGBB 1NC4A 2B0SL 2X4PA 1S7XB 4M6NL 4HXAH 5F89B 1PD6A 4Z7VA 2IH1A 4R97B 4POZC 4R2GC 3VXRE 2RR3A 4Y1AB 1FIGL 4Y4KC 1RUAL 1T6WA 2Q8BL 2FEEL 3ES6B 4TVPL 2GFBA 4GXUM 5D2LB 1X5AA 4PJHB 1DEEB 2W0KA 4YR6B 2XZQL 1DL7L 2AKRB 1EFXB 3SPVB 2AP2A 3UYOD 3HZKA 1SEBB 1VPOL 4LEXL 1WAAF 4K2UH 12E8H 3W39B 4ZS6C 5E2WL 4M62H 5E8OB 1EEZA 4J4PC 3FT3B 4JM2D 1JUFB 4P57B 2CLZB 3MV8A 5DD0L 5KOVC 3VDAA 4AIZA 5I71B 2E7CA 4XPTH 4LF3A 1AD9A 1YPZF 5C0DB 2J6EL 2V2XB 3O4LA 3EJYD 2C4FU 4I5BB 1UJTA 2YA1A 2DM2A 3ZYZA 3RGVB 1MFBL 1FZMA 5HGDA 3X3GH 4YXLH 5SX4I 2BY2A 1GGCL 3VMPA 4K23H 5BS0D 3RZCA 1QBML 1Z5LA 2ICEA 2AXGB 2DQJH 3IFOB 1BZ9A 3WE6B 1KOAA 1YN7A 2HJKA 5K33A 4Y4FA 1YPZB 1TJHH 2OJZH 3GI9L 2Q86B 5DR5H 1G7LA 1ZT7A 1F4YL 2P8PB 4YFLF 2ZCLL 1KC5L 3AY4C 1I1YB 5I74B 3ESUF 3QFJD 4PYHA 4Q7DA 3BZDA 4NPYA 4OF7A 4LK4A 3EO1A 5DJCB 4NC1C 3WNOA 3CK0L 1NJ9B 4NN7B 1ZOXA 2ZOLA 5DRZA 4AENA 2FJFB 3UTTA 1CLYL 2FB4H 3TA3D 5K9OA 3MLUH 1YNTA 1PLGL 1H5BB 1MLCB 4JZOA 4OIBA 5DVNA 1P7QA 2WLZA 2FO1A 3WFEH 5I76A 3EOYG 2GITA 2PR4H 4GG6E 3HE6D 4Z7VF 2ED9A 1EH9A 4ZUVA 1P5VA 2XTJB 4KJWD 1FVDB 1A6AB 2FNBA 4L4VB 4HDIB 2NTSP 4ZFOL 1IGFL 3DX7B 4NQCE 3KPSB 2BC4A 1T1YB 2FX8H 4KJPC 2F58L 2ZG1A 3HZMA 3N06B 1NC4B 4HG4K 4H26B 3VI4E 5FGBC 3TO4D 3C6SB 4XB7A 4G42B 4RMUA 3ROOA 4GQ9L 4L5FL 2EO1A 3DECA 5IQ7L 2YN3A 3LB6D 4TVSa 3U36B 3V6OE 4Z7WE 3BSZL 1K4CB 3RVWD 4ZSOE 5C0AA 4FFYH 2GFBB 4ZQKB 3QG7H 3CH1A 4RA3A 3C60C 4PRIE 3DX9A 4WCYH 1JZ8A 3WN5C 3MBEC 1KLGA 4KDTC 1FSKC 3QDJE 4YHPA 2HLFC 2VXTH 4KRPB 2AJZA 5EO9B 1IBGL 3I3DA 5GS2D 1U2HA 3QCUH 3QBTB 1RURL 3FO0H 4R90H 1B6UA 1EEZB 3GMQA 1GC1L 3ZDYE 1NBVL 5GRWA 5AD0A 2WK2A 2D0FA 3U46A 3I2CH 3MV8B 3EYUH 4GOSA 1S7UA 1MRDL 3WXWL 2VYRE 3INUH 4PRHA 1AD9B 5FGSA 4UILL 3SQBA 5L8KB 4GAGH 1FFNB 4HIHA 3QEQB 3QWOA 4MQ7A 3I50H 2ILLA 1AQKL 4J6RH 3WFDL 5I18H 1FLTX 2HN7A 4GAJL 5LQBL 5A3IC 3O2WH 5C0RL 2I24N 5A2JH 1XGTA 2PYEB 5CZVH 1T89A 2E7MA 1TQCC 3LQAH 5DQ9A 1F11A 5EWIH 3O45B 2XN9D 1FPTL 4HJGA 2GY7B 4DQOH 5L8LB 4WRLA 3LD8B 3PABA 4MXWH 4D0BB 5JQHC 3TWCH 1E4XH 1NCAL 1KCVH 2CIIB 1NGYB 2FBJH 2GJ6B 2EE2A 1C8PA 3OX8A 4CNIB 3GNML 3D1MC 4LLQB 2O26U 1T1WB 2ZOLB 3SKJL 3ULUD 5T5FH 4QYOB 1CN4A 4FQXC 5GGTL 5DQDL 1YNTB 2D9CA 5F93C 2V6HA 1Q9OA 3TIDA 2P1YA 1T1XB 4Y0GA 5IB1A 4X4XB 2GAZA 3C2AL 3VXME 4U7KA 1KEML 4N8CL 2GT9B 3HAEA 4BQ8A 5E6IB 2EECA 1INEL 2IG2H 1CD0A 4GXUN 1CK0H 3BUYA 4OZGA 1GGYA 3EKCA 3G6AA 4K55A 2Y72A 2BC4B 4OGXH 5JHDA 4KV5E 4OCSL 3UTSA 3ORJA 1GYAA 1FYTD 5GJSH 2R0LL 2ZPKH 1QOKA 1PY4A 5E99H 4ZAKC 1VGEL 5ISZD 4FG6D 2ZUQC 3IFPB 1UACH 3RTQC 2IBBA 5FYJD 5EUKA 3NTCL 3U83A 3ZE1E 1H3XA 2EC9T 3SO5A 1F2QA 4M93B 3B9EA 1A1OB 3PGDB 4LPTA 1MCCA 3CLFL 1KV3A 4K3GA 1KLGB 4ELMA 3VFNB 5JDSB 4XNMA 3LQAC 4YHPB 1LEGB 2VC2H 1CDJA 1T5XA 1X5FA 3MRFB 1K5NB 1N0XL 2DIAA 4Y5YA 4NQXA 5AD0B 3U46B 3RBGA 2WQRA 5IMLA 1CG9B 1QHPA 4GMTL 1S7UB 5GGVL 2NY3D 1RUQH 3VFPB 2NLJB 3U7WL 4OQTL 4LDEB 1DDHA 4L9DA 2CJUL 2YUZA 4G3YL 1GZPA 5KAQF 4JQIH 4NO2A 1CZ8H 3MRHA 2KL6A 4LLDA 4RGNE 3P11L 2YHGA 3QWOB 4U1LA 4MQ7B 1FZOA 5GHWL 2HT3D 1MNUL 4OFYA 3GFUA 1VB9A 1AXSB 1UH3A 1F6AA 3DXAD 4Q0XL 4YX2H 3SE4C 2H2PC 2HJLB 3QUML 1GHFL 3BPOC 2D7MA 2J88H 3C5ZC 3ME0A 4X5LA 1INQB 2R56L 5HI5C 1Q1JL 3T0EC 1KCRH 2XKUA 1SVZA 1OP5K 4WUUB 2L0DA 2QSQA 4JY6A 2WMPA 4PS4H 5I1LB 4N9OB 4JKMA 5C07E 5L0QB 2MCPH 4KTEH 1MCRA 5I16B 2XA3A 5C09B 6FABL 2EDTA 1UWGL 4PJIE 4ZFOA 4XP6H 3T0WA 5HHNA 1ZLUH 5C7XL 5JW4R 4OZGF 1YDPB 3QEHA 5EORH 5D2NB 1B0WA 2NYYC 3EDFA 3VXTA 1FZJA 3O9WB 5KS9A 3C09B 5EG6C 3SCMA 5IBUG 1H15A 4FFVC 2LFGA 1J5OL 1GXEA 4JO3H 3HAEB 4PJ9B 4R4FH 1MUJA 2ADJB 4M02A 4MJ2A 4KKLD 4OZGB 1CWVA 4N5ED 3LS4H 1MAML 1A1MB 4H5SB 1NGQH 5EO0A 5LGJA 4UV4H 2VOTA 5JUEL 5DUBB 3LPFA 3UBXA 1BIIA 1ETZA 2ATPA 3K1DA 3PV7A 4CBPA 3UCRA 4U1GC 5AZ2L 4XTRD 3MO1A 2VMFA 1MFAH 3BDYH 4Y2OA 5BZDA 3FN9A 5T5NG 4JDTL 4LVOC 3EYSH 3GM0A 1V3KA 3THML 4RGMC 1ORSA 3ARZA 2HVJA 3KNBA 3MGOA 3BGFB 3O6FD 1MH5B 4XH2B 5IR1B 5EC1A 3HPLB 4XNMB 3RX5A 4EZMA 1QA9A 4YBQC 1OAQL 3UYRH 3TVMC 1T5XB 3LMJH 3RDTA 3QXDA 1A7OH 3P3YA 4XMKL 4X6CE 3VRLE 5F7MC 4Y5YB 3GBML 5T3ZL 3RWFA 4KI5C 4LHUG 4JFHE 4EI5A 1YNKH 4Y16C 1QFWL 5J11B 2DMCA 1DDHB 1CIUA 4M7ZB 4JO1L 1XGQA 3QDGD 4NO2B 5D7LE 2AJ3B 4L8CA 3MRHB 1PSKH 4IOIA 2WBJC 1AR1D 3REVA 2J5LC 4P23D 4JFFE 4NFBA 4NWTL 1REIA 3ARUA 2BY0A 1TZHB 2HLAB 1F6AB 3U82B 4Q97A 2A6DA 5GGTA 4XPHL 1F58H 5DVMA 3NN8A 3BPNB 5HY9B 4XWOC 4E9LA 1C08A 2BSRA 3DV4B 4J3XA 3CSYB 5JXAL 2R8SH 2C7UB 3VDBA 5BV7H 4P2QA 3WFCL 2F8XC 1BVKA 3MJ8B 3SO3C 4EIGB 1NMBH 1A7RL 5EU3B 3QHTC 5B22A 2QSVA 5B4MC 1QSED 3PP3K 1UFUA 1QFUL 4K2UL 4U49A 3O3UN 1AO7A 1JGUL 1J1OH 5HHPB 3LEYH 5IEHB 4I0KA 3VXTB 5E0QA 3EBAA 1PY9A 3SCMB 2PO6C 4IRJA 4MA7L 1J0HA 4OZIA 3GMOB 2DMBA 2QBWA 1CXFA 1FRGH 1VHPA 3BQUB 5IMMA 1OM3H 2UWEA 4L9LC 1L4IA 3RWIA 2LTQB 1CFVL 1OGTA 2P24B 2FGZA 4JRYA 2H32A 2APTA 2W9DH 3CDYA 3CDGA 4I0PC 3QQ4A 4X8XA 2MQ3A 1JHLH 4XHJD 2E9BA 1JZ3A 1BBDH 1BIIB 1ETZB 3HC4H 2V7NA 3OXSB 1U8JB 4W6WB 4KRNA 3V52H 2DQJL 4P3CL 4GRLD 3VE0B 3MOBL 5T3XH 4X7TB 5C0BD 1WBZA 1OGAA 2YPKA 5DR5L 5DXWA 1L9NA 2NXYB 4OQTA 4NSKA 2DL9A 5DK3A 1QRKA 2IANA 2HVKB 5EC1B 4KY1H 3QG6A 5I75B 1QSFD 4WDIB 2Z35A 1J05A 1QRND 2FWOA 3SBWA 1Q8MA 1U95B 5B39A 4XCNB 1A4KA 3TN0D 2RJMA 3RWFB 5BO1L 4QWWD 4DUXA 3PL6D 4OJFH 3U7AA 3QUMA 2CH8A 4UQ2B 3VH8G 1XGUA 4ZXBA 2BNRD 1NCUA 3R0NA 1XGQB 1BGXH 3OB8A 2HFGL 5EZIH 3IDIB 1I7TA 3I6KA 3KXFD 1PEZA 3K80A 3UEZA 4WI7A 2ZZUT 4JO2H 3GI8H 3QFJE 1ITBB 3EDKA 4CVXB 2A6DB 1UB5B 4XVJL 5FO8A 1CD8A 1VADA 1F3JA 1PG7X 4MNHA 4FABH 4ESKA 1ZEAL 4KK6D 2XXCB 1JCKA 3EYOA 1BECA 5IIEB 3KPLB 4Y1AD 3ZE2F 4TNVF 1M1SA 5E5MA 4HJ0C 2WM0A 5JNYB 1H0DA 3E1F1 1QO3A 2J2ZA 5EIIB 2G5RA 1EFXD 2GSGB 3VCLB 3ZKXC 2QKIB 2R69H 5MERA 2ITDA 3WUWA 2UZYB 1ZA6A 4Y4KA 3UPRA 5CMAA 3K8KA 5CSZB 2I26N 1HIML 4HIIB 2AEWA 4LFHG 4MZ3A 5EFIB 1VACA 4JN2A 2DWDA 3HMXL 4A6YL 4B41A 5BW7A 1N5YL 1Z9SA 4RMTA 4OLUH 1A1NB 5E56A 1OAXL 3W0WA 5I1KL 3L3JB 1EJOH 5GGRA 3RIFK 4OLVH 3RGVD 3T04D 4DVBB 5HYSB 2DWEB 1BLNB 5L88H 5LWYL 4DN3H 5CZKA 1YY9D 2AVGA 3N50A 3BOVA 1JWSA 3S3SA 4FTVB 4WNQA 4ODSH 4DEPB 4RMSA 4DKFL 1ZXQA 3GSWB 2R23A 5DEZA 3OL2A 4L8DA 4RX4A 5D1ZB 3BESR 5DTFB 1JNNH 1IGYA 4NQVB 3BP5B 5KBNC 1E6JL 4FQLL 4HWBL 1E4XL 1KCVL 4O02H 5HHMB 1J10A 2FWOB 1S8DA 4K07A 1A4JB 2AQ3A 3NPZB 3CUPA 3H3BC 4UAOB 5T5FL 1CR9L 3WIHA 1DP0A 3VXOB 3CFJA 3DUUB 5B3NA 1DQQB 1JI1A 1RUKL 3DX8A 1TCMA 5EUOF 4KC3B 5FA4B 1UGNA 1B0GA 3MRRB 2RBLA 4YHNA 4HUMB 5ADPH 1J0ZA 2XN9E 1WWWX 1I7TB 4OD3L 4L4VD 4PRNA 1ZWIA 5HGBA 3KPRB 2APBA 3KPSD 4NDMA 4OZHF 1DVFC 1RJLB 1AGFB 1NC4D 3X13A 3QUZB 1VADB 4MNHB 1F3JB 4YHLH 4DKEL 5EUOB 2WUBH 3U4BH 2ZPKL 3V8CA 2VDMH 3EYOB 2F5AL 4DOHE 4X4YB 3ULUE 3JWOL 1AC6A 1CT8A 2X4SA 1RUMH 3FQUA 3V7MA 1F2XK 2XI9A 5DEFB 1H0DB 2AV7A 1UACL 3GKZA 4YDJA 2YMXH 4BQBA 2W0PA 1EHLL 4OZHB 2PTTB 5FGBA 5C1MB 2Y23A 4WEBL 5MERB 1P4LA 4R2GB 2DLFL 4ZOEA 3S36L 5JPMA 4GAYA 4Y4KB 5DJXA 2A0LC 3MYZA 1P4IL 4X6FA 3BX7C 5F1OB 4HC1H 4ORGB 5FCSH 2V7HA 3MV8D 2R2BB 1FYTE 3WN5A 2W65A 4H0HB 1M05B 1A7NL 3ILQD 4MGXA 2Q6WA 2OS7A 4GRMA 2F53B 1RUQL 1QBLL 4MCYA 4KVCL 5ISZE 4PJEE 3O4LD 3W0WB 5D9SB 1F4XH 1FV1A 3CGTA 1KGCD 1LK3H 4DW2H 5FYJE 1RQ5A 4BH7A 1H3WM 1CZ8L 1PEWA 4UT6L 1U92B 1KPUA 2AQ1A 3RZCD 4LSTH 4WNQB 1KJ3L 1RIHH 5CD5D 3ZDXF 2PYED 1Z9LA 3IXTA 4L8DB 4KZDL 2R9HD 1WF5A 3GMRB 1RVFH 1YQVH 4LNRA 1LVEA 2E27L 4HJJH 4I9WD 4LEOB 1YECH 2EIDA 4TUKH 1MIEL 3S6CA 2P8LA 5DO2D 5ILTL 1A14H 3T09A 4X8JA 2DQFA 4BZ2L 2BFVL 2IPTL 1ZVSB 2NY1C 3UTTD 4PLNC 1IGCH 2X4TA 3JBG7 3WKML 4LIQL 5KSUB 3L3HB 2P5WA 1P7QD 5C2BH 4NM4H 5LAXB 1SM3L 5HGGS 4MDJB 2V17H 3DXAE 1LMKA 5JMOC 2NR6D 5IW1B 3DETC 3B9KC 4JO3L 3DRQB 5E6ID 5F88B 4FQXA 3DTXA 3CSGA 1OY3B 1ZWIB 1SJEB 4OGYL 3O6LH 4NDMB 3G5ZA 4X99A 3GRWL 5HGAA 2LAAA 3HFMH 4G6JH 5D1QC 3ARSA 1A2YB 3IXAB 4TYUA 5I8CA 2VXSL 5J3HD 5IB5B 4QRRA 4PRPA 4TPRL 2CMRH 3MV9B 4P59H 1T7YA 5FO9A 4A6YA 3HMXA 4YDJB 3ARDA 4FQ2H 1HCVA 3GJFA 3MOQA 5E2UH 2YC1B 4H8WH 2EE6A 2H9GA 1LDPH 2QQKL 2IQAB 4MAUL 1LWRA 1OL0A 4OQ1A 1R5VB 1K6QL 2IMNA 4ZAKA 5JPMB 1RPQA 43C9A 3KPQA 4KK5C 3RTQA 1D9KC 5D70H 2V9TA 1AGCB 1DQLL 4YHMH 3SDXE 3V7AE 1XFPA 3H42L 5EIVA 3RBSA 4F8TA 3C60B 5J8OA 4BQ6A 3MBEB 4MNGE 5SWSA 4GRMB 4UUJB 4PRHD 3F7VB 4MQSB 4F7MB 5IW6A 5IGXH 3HS0A 4LBEB 4HWBA 2PW1A 2R1WA 3P73A 4ZDHA 1B4JL 4FNLL 4O5LL 1ND0B 2N7BA 3N1MC 4GW4A 2F5BL 1EMTH 3FQRA 4Q6IB 2IFGA 1VKXB 2HTKD 3IXTB 5D7IE 4JRXA 1ED3A 1I7UB 1LO2H 3L7EA 2OCFD 3RY4A 5L9DL 4OUUA 4RISL 3X3FH 5HVWA 1BQUA 4RAVA 3BIKA 4NNYB 5CBEB 1MSPA 4P4KC 1K85A 1QTYT 5F9WC 1AQDA 2D7QA 2VDPH 3RHWF 1TQCB 3TZVC 5AAWA 2MNUA 2DBLH 4X80L 1CDUA 1FNEB 1PQZB 3PV6B 4TRPH 4YAQB 1OTUD 4IDJL 4XPBH 1S7VB 3VFGH 2P5WB 4KUZH 4H8WC 5I30H 1M7IB 1HHIA 5DD3L 5ITBH 4LQ1A 1X5GA 1F4AA 1QLRB 2X41A 3IGAB 1MCLA 4ODXB 3S4SA 5I1GL 1MHPH 4KHXH 4PJ9D 1A9EB 5JORA 4TVPD 5EOCH 1XGRA 4FQXB 4YZFF 1XF2B 4V1DA 2ESVB 3HNTH 4OZFG 3TCXA 3IKCA 5MENA 4NO0A 1CL7H 2Y6SD 2UUDK 1KN4H 3QUXB 1UZ8A 1XF4B 4NT6A 5IUSA 3V7AG 1IC7H 3ETBF 1XZ0B 3TYFB 1BBDL 4J23A 4MJIB 3H7LA 3UC0H 4KJYB 1QSEE 2Z92B 3V8OA 2DI8A 3QB7C 1NCWH 4UDUB 4XRCA 2BSSA 4QOKE 5HI4D 2LV4A 2VLME 5FO9B 4LSDA 3F6IA 1OB1B 4N1EA 5T3XL 3GJFB 3MZGB 1WIPA 2ZSVA 4XX1G 5DHVH 3DURA 4K3HA 2O5YL 4N0UA 4PREB 2DF3A 1VFUA 4ZAKB 3FFCA 3DBXA 2JJWA 2G75A 3OKMB 4UTAL 5GGSY 3L5IA 4QHNA 4GW1B 2FX9L 2FX7H 5MEQA 4X6DF 2EKSA 3S34L 5CUSL 1U8HA 4PP1D 3TO2B 3MRGA 2IPKA 3ARWA 4PJCE 5I0ZA 5IB2A 4LGPB 2FEEI 4Q9QL 5E8EB 4U2YA 5IW6B 4F7CB 1DQML 2CUIA 1IAII 4BSVA 2YRZA 4X6DB 1F8TH 2R1WB 1FLRH 3W9DA 2Z8SA 3P2TA 3ZHDA 1KCSH 4Y16A 3MRJB 5FM8A 1QSFE 1ULVA 1ZGLP 4L3CA 1QRNE 4MLSA 3CZJA 4HBCH 4CN1A 3HNVL 2YUXA 3L7EB 2YRPA 2VLJE 2G60L 2FYYB 2M26A 4XCEB 4YGVA 2FR4B 2E7HA 4PY7A 1EEUA 2BJMH 3BIKB 3TGXA 4DGIL 1FO0H 4JANA 4DVRH 2X4NA 2CK0H 1KTLA 3VXPA 2CO7B 1X3DA 3BPOB 1S7RB 3C5ZB 3G5YA 3IFLH 4OGZA 4PJ7E 3GRWA 3T0EB 4KMTH 3KXFE 1T03L 3SCMD 3RJDA 4M1CC 4R7DA 1HHIB 3STLB 2QJDA 5FDWA 3JWNC 5AUMB 4NYLB 3V6OC 1C12A 4K3JH 4JR9L 2EDBA 3QUKA 2ZKHL 3QPQD 1WZ1H 1FE8H 2KDGA 4Y1AE 3FRPA 3BXNA 2X1WL 4Q9BA 3Q2CA 3EYFA 4HWZA 4JB9H 4PTUB 4WU7A 3QDMA 2QQQA 2PO6A 4CGTA 3VFVA 5C08B 2OM5A 5F1NB 1WV7T 5D2LE 4PJHE 2LVCA 3ZYJA 3PWUA 5INDA 1MCQA 3HR6A 3V5DA 4BZ1L 4YUEL 2DAVA 3C8HA 1ZVYA 3CFBB 3VFSA 4DK6A 1HHKA 5I19L 4J2XA 4PJ8A 4I0PA 3GEWB 6CGTA 1CI5A 4MYWB 1IKFH 4MS8C 4QRUB 1JNNL 1A7QL 4UB0H 1OVZA 3MLYL 4PJGA 5C8JB 4U1GB 5I1CH 1MQKH 4QTIL 1WAAE 4JN1L 4C59B 4Y5VA 2ICWA 4LVOB 2JJSC 2B2XH 1RHFA 1U8HB 4KI5F 1JI2A 2J8UE 4RGMB 3ARVA 4HF5L 1IARB 5ESVB 2E9IA 4FQIH 3MRGB 1NL0L 1GPOH 1NEZG 2W07A 3MGTB 4EBQH 2HFFA 1UM5L 4ODUA 2EZ0D 3TVMB 1MFDH 1NFKA 3RL2B 2W59A 4MXVF 3TEUA 2ZSWB 3FOMA 1J8HA 1YPZE 4JZNA 1BZQK 1CXIA 4LCCC 4JKPH 4HWEH 3VW3L 2X7LB 1T66D 1XT5A 1OAZL 3AS2A 3UBXI 3RQ3A 1YEFL 2EH7H 5D72L 3V5KB 1L6ZA 5IHUL 1DQJA 5C0IA 4XT1C 2XG5A 2WBJB 1RZKL 4AEIL 2J5LB 3OZ9H 5FEBA 4H25A 4Y4HC 4OCYH 2DQGH 1EO7A 1UXSB 3IAQA 4P2QD 4P9MH 3DUSB 3T4YA 2XZZA 2JLLA 4BSWA 2A6KA 2OJEA 3PNWB 3M8OL 3G5YB 3EFFA 1AO7D 2O93L 3VWJA 2IGFL 5TH2A 2XTJE 1RZ7H 4L4VE 3S37H 3BMWA 1HOCB 2PCPB 4ZUTB 1LO4L 4QNPF 5I1DB 1T0PB 3KPSE 5ITFA 1K2DB 4M43L 4I2XA 3EHBC 4MQTB 5LGHL 2FIRT 3E6HB 3B2UC 1RIVH 5SV4A 1WFOA 1I8MA 3UDWA 1T7VA 1T21B 3B4NA 4RFEB 1MF2H 3EYQD 1CVSC 4JRYD 4KK9C 1AGEB 4PV9B 2VZVA 4XB8A 3EYFB 3AMKA 2AS5M 3D85A 3EGSA 1O7SA 2ZWLT 4HGWB 1IKNC 2GW5A 4J1UA 4KKCC 1ZSDB 4FTVD 1YEKH 1R3LA 1RK0A 2VLKA 4L9LB 2C3VB 1WBYB 4LSTL 3TBVA 2IAMA 1HH6B 2YPLA 3HTLX 4DTGH 3HRZB 4I0PB 5D1ZD 1P7KB 3K74B 5DJ0B 3L3GA 4LSVH 5HHOB 3OAYK 1BQHA 3MUJA 3MV8E 2IAND 1Q0YH 5TPWH 3QCVL 4TUKL 2X2YA 4RGNC 4XWGH 5HHMD 5TE6H 4JKKA 1X5JA 4Z78B 4ZUSA 4JDZA 2J4WL 3D6GA 1BFSA 3BP6A 1CFNB 1XMWA 2NY7L 5DS8B 5A1AA 3W82A 2E8YA 4PJAF 3QEQE 2BRRH 7FABH 4M7JH 1HXMB 3QUYB 1CDCA 1DBJH 1A7BA 5DURB 4ODUB 4FZ8H 4ZXBD 4NHUB 4RZCB 2PYEE 2IADB 3S96A 1QBAA 1J8HB 1S5IH 2RQ8A 5FCUL 5AG8A 5BV7B 5KG9B 4D9LH 4AYFA 4H88H 5ENWB 3GSRB 3UYPA 4PJAB 1TJGH 3D48R 1BFOA 4X7CC 1KJ2L 3KPRD 3ILPA 4L8BB 4KPHL 1QR1B 3MBXL 4WIQA 4Z8FH 2GJ6E 1Y18A 2EIZA 3QUZD 4ZMAT 2YR3A 3B5TA 5HVHC 3LZFL 4WFGD 1DQJB 1NCDL 1FH5L 3O3DA 5IESH 2HYMA 4QHUB 1TJIH 5KVEL 1KJVA 4ZD3L 3TBYB 3MV7B 2VH5H 1AI1L 4YEFA 2XA8H 1GGIH 3NH7H 3S8WA 3R06B 1DVFA 1FNGB 1TVHA 1MY5A 3D9AH 2A6KB 1JL8A 1I1FB 4LL9A 2ZG2A 3IFNH 4POZD 3MRBB 3I3EA 4R2GD 4O2EA 1TPXC 4Y4KD 4YHYC 3O4OC 3MCLL 2QHLA 4B5EA 2Y7QB 1U3HB 2IEPA 4JZJA 4WGWB 5ITFB 1IGJB 1S3KL 3R4DA 4JPIB 4MB5A 5AEAA 5DMIH 3ZKXB 3GIZH 4ZPTB 4M1DH 4ETQA 4ZS6D 1CL7I 3UP1A 3OR6A 4JEGB 4MZ2A 3D39B 3JV6B 5DRWB 2B1HH 3W0WD 4I3RL 1YEGH 4J4PD 5JMRA 2F54A 4ZFFA 5J1AB 2HP4A 1E27A 5FKAA 1XGPA 4TTDC 4J1UB 5IV2A 1LO3H 1R3LB 1MFCH 4JO4H 4WHCA 4P2OC 4C4KO 5DD1H 4FZEH 5T3ZD 3N9GL 5K9QI 4RX4D 1WC7B 1CYGA 4QHKI 3V4VH 2BMKB 3L3GB 4BUHA 2NY2C 3WCYA 1S7QA 1IAMA 4MA1B 4P5KB 3N0PB 4X9GA 1A3QA 4YE4L 1EAPB 4KAQH 3FONA 2ARJQ 4LCWA 3O8XB 4CW1A 1I8LC 1L7TH 4G80A 1N0LA 2P44B 5JOFB 1S9WA 3TBWA 4NKQB 1VFAA 3NABL 4NZTH 5T33L 3WYRA 5F3BA 4XNXL 4G9FB 5DRXA 5KOMC 1YEJL 5DVLA 1MCBA 1ZLVH 3SJVA 3NAAL 1KNOB 3VA2C 2W91A 3PHSA 4WUUE 5DEGB 3G5XA 4QHLB 4BFIA 2DQEL 2ZUYA 5I1HH 5C09E 1AE6H 3HRPA 4YDKH 2W0LA 4FQJL 3HR5A 3B9KA 5IHZA 3JSSA 2GK0A 4OV5A 1NCWL 2JK5A 5D2NE 4Y89A 5E1AA 3MV9D 5E00B 4TULL 1NC2B 3ZDZF 4S1QH 1QFWI 3N1PC 3BPCB 2C1PA 4KJPD 1DQDH 1TVHB 2DQIL 5D1QA 3QRFM 5E2TH 4MD0A 5D8JL 1KN2H 5DLML 2RCSL 4Y5XB 1SYVB 4Y2DC 2AK1H 1JGDB 4HCRL 4HV8A 1G9NL 3UJTH 4RWYH 3FQNA 4MD4A 4OZGE 2H2SC 4NNXB 5DGQA 1IGIL 5IG7A 4E5XA 3K8LA 1L0QA 3C60D 4NQDA 4X7SL 1EUUA 1HSAB 1I9EA 2UVFA 2GTWA 2VXQH 1Q94A 3MBED 4NUJA 1FNSL 1HCFX 3TV3H 2R1YB 1IJ9A 2HLFD 4KKNA 5E5RB 1ONQA 1AKJB 1NGWB 2DTMH 3SDAA 1FL5B 3BZ4A 4XXDA 1EZVX 4QRPB 1FG2B 3QH3A 1SYSB 1XCQB 5I0DA 1FN4B 4HAGA 5HYJA 4XBEL 3V5HA 1UXWB 5ACZA 1L0YA 4GW5B 1YNLL 1LEKB 3KPOA 4HKZB 3WO3B 2ATKA 3DI3B 4K7PY 4HZAA 1B9ZA 3ALPA 1AFVL 4UINL 3HG1A 5I15H 3FQWB 5IBLC 2XV6B 1ZLWH 5A3ID 4X0KA 3OHXB 3FONB 1A6VL 4P2RA 1CQYA 5KVGL 1A0QH 1IE5A 1LQSR 5EPMA 4GKZA 5GRJL 1UC6A 1KJ2A 2FGWL 1WJ3A 5BXFB 4G80B 4OFVA 5M7QA 3VFWA 1E28A 1E0OB 4C54A 2P5WD 3J7HA 3NACH 1S9WB 2DKMA 1I3VA 2Y06H 3TBWB 1JGLH 4P4KA 3U0PB 4JVWA 1CE1L 1JZ5A 3I6LD 5EOTB 4YFEA 1JWUB 1X7QB 2AJXH 4K3JL 1U2CA 5E7BA 4LLUB 3TZVA 2NY1B 3AFLA 3T4AB 3D18B 4FQXD 1FE8L 4RFNB 2VIRA 3CX2A 1MELA 2HKHH 3FB7B 1CE6A 2OL3H 3KYNA 3L3KB 3VXRA 1UWXH 4WO4A 4Y7MA 3ZLQC 3VI3F 3NVQA 3F7YB 4QRRD 4ALAH 3RVVC 5F9OL 4QT5A 4M6OH 2QLVB 3BN9C 5J6GA 5HI3C 2NQCA 3P4MA 1W8NA 4U3HA 3OJMB 3GSOA 3GUTB 5J12B 5A16A 1W0WA 2X89A 4ZAKD 3BISA 3E8UH 4S10A 3LEVH 4O4YL 4LLAA 3IU4H 4L8SC 3RTQD 4JFPA 4X7FC 3TNNA 2J7LA 2H26A 1RD6A 1FAIH 1EGJH 4RNRA 5IG7B 3U9PH 1KG0B 1KPVB 2X44D 3GSNH 3QEGL 1J86A 3MRMB 2W9EL 5SWSD 1MHEA 1J1PH 5FA3A 3Q48A 1KYOK 3P77B 2AXFB 2BVUA 4KUCF 5HDBF 1DSFH 4IBLT 3QWRA 1D9KB 3LQZB 3TYGH 5GSRA 2YEZA 1C16B 3N1FC 4R4NC 3QRGH 3QXAB 4PUBL 2O61A 3G08B 3OKEA 5EIQA 3UTOA 4HWEL 1L7IH 3QDHA 2B4CH 2PN5A 4TN9A 3RKDC 1DN0A 3VXSB 1QUNA 3DIFB 2OK0H 3OKNB 1JV5B 4JRXD 1U58A 1BM3H 1M71A 5DJYA 1Q9KB 3BHBA 4R9HA 3LOWA 3ZHKA 3JUZA 3RNKB 2C3XA 3FO1B 1IZKA 2YWYA 1B0RB 4OD1H 4F7PB 2A38A 4JG0H 5CJOH 3B9AA 1HHHB 3B6SA 4TSAH 3GGWA 1RUPH 2H2PD 3VFTA 5KJRL 1MJ8L 3T77B 4ZTOL 3C5ZD 1KJ2B 3HI5H 5EC2A 2IC2A 3IJHA 2R15A 4K3DH 3QULA 5HI5D 2PYFA 3T0ED 4GG6A 1G7PA 2FRGP 4WHDA 2GCYA 5C2UB 2D31B 4P4KB 4YXHL 5F9WB 5FYKE 1MPAH 4MAYB 5IB4B 2VABA 4M61B 1A3RL 5GGSA 3TZVB 3TF7C 3VMOA 4LSSH 4NQCA 4ONGL 5I17B 4X98B 5IT2L 4V1DD 2BVQA 1LD9B 4MXQC 2NYYD 1QPPA 3QPXL 1U41A 4TSCH 3DUHA 4NP4L 1RZFH 2D9QB 1WUNT 5C08D 5CEZH 4FFVD 3E3QC 1LE9A 3V6OA 3MREA 1FVEB 4Z7WA 4HCRA 3E6FB 1FNAA 1I3RB 4OBSA 4ZSOA 4IDLA 2EDYA 3AU1A 1Z2KA 4LKCA 3ZZ1A 4Q9RL 4TNVK 1DBKH 2AK4B 4PRIA 3ZE2E 5I6XC 4EQ3A 1UEMA 1ZGLB 1CDHA 4JHAL 4AJ0A 1YUHB 2HWZH 3QDJA 2Q8AH 3QO1B 2HKFL 1KPRB 5TFSH 2V5YA 2V9QA 5F6IC 3FQXA 2MKWA 1S7WA 2QSCH 3RVXC 3FFCD 1VERA 1KIUA 4PD4K 4XWGL 4WI2A 3VRIA 5TE6L 3ARGC 5CIPA 2AJUH 3TNNB 4N0FB 4JG1L 3MRPA 4L4JA 1TIUA 4MNQB 1IT9H 4JFXA 2HH0L 4OCRH 4EUPH 1J0IA 1JWMB 2Q1EA 2NW3A 4FTVE 4YBQD 3TVMD 2NX5B 3TBTA 4LLMA 4P5TB 4RWHA 2JJSA 1SBSL 4UOJA 5DJ6A 4KI5D 2M8XA 3UAJC 5J06A 2E8ZA 1TETH 2FJGB 5TF1L 4FXLA 1DN0B 2F19H 2G5BA 4Y16D 5D6DA 2CKNA 5M95B 5HHME 5D7JC 4NKIH 2IBZY 1X5KA 5EU6B 1U58B 1MAJA 2NY5L 2AXJA 1EA9C 4XNUH 5GISL 1AR2A 4QCIA 1ZKAA 1FL6B 3OJDB 4LCCA 2WBJD 3CCHA 1V3MA 3HC3L 3RU8H 4N9GB 5IESL 1H9VA 2VZ3A 1JYXA 1KFAH 1TJIL 2XWBA 3C87A 2O5XL 3NZ8A 4HEPG 4O2FA 2HG5A 4KFZC 3VGHA 1MIML 3B6SB 4NM8H 2BVTA 1MLBB 3PGCB 3RAJL 5C0JB 1PZ5B 2YKLH 5GS1B 2D7NA 1JMZA 2WBKA 4LCIL 3LN5A 1W8OA 1T83A 4XWOD 5EC2B 1WGOA 5ID0B 4CMMA 2XG4A 5BZWB 4BH8B 2AJSH 5JW5A 3B2VH 3D25A 5HDQL 1KSRA 4Y4HA 3VXMA 4PJDF 1U8LB 3KPRE 4Z7WF 3O3BB 4XPAL 2I9TA 4NKDA 1LNUB 2AEPH 4LOUC 5EUOE 5B4MD 2G9HA 4ZO6A 5TDOA 3FN0H 1QFHA 1OCWH 2BVQB 5KSAC 5ESAB 3NZHL 5DHVB 2AABH 3CFCH 1YC7A 15C8L 4XCYB 1BWWA 2PO6D 1RZIA 2BNUA 1YEGL 3RI5F 4PJDB 4MVBC 5HYSG 2A9MH 1LE9B 4Z7WB 3LKNB 4OZHE 3OGCB 3S35L 4AH2B 2EIBA 4LPXA 4QHKJ 3T0XA 1WZKA 1JNHB 4OFPA 4YO0B 2VLRB 4U1KA 3STBA 4FZEL 3D0LA 1NKOA 1V3LA 2A83B 4LRNH 4I0PD 3K8MA 4JCMA 5F70A 4P46C 4PGEA 2D4DA 4DGVH 1NAKL 1XGYL 4D0DA 1INDH 1IKNA 2FD6H 3NFSH 4GKOA 2HJFB 5INCB 2P7TB 5I1AA 2NNAA 1D5IH 4HS8L 4URTB 5CJXC 4AMKH 4CJ1A 2W9LA 1TDQA 1UCBH 1YN6A 2JELL 2F53E 4EXPX 5ACMA 1YYML 5DYOB 5CIPB 3L6FB 3W0WE 5IM7B 2VE6A 5ETUA 1FGNH 1FCCA 1QKZL 2WW8A 4D9RD 3JXAA 1VFMA 4AK1A 4M48H 1U91A 4KWUA 4JFZL 4EDWH 3WNPA 1KB5L 3TBTB 4EN3C 1WWBX 1J8HD 2ZUWA 1BVLA 2Y4SA 4OI8A 5FYLH 3ZL4L 4F33A 1I1AC 1FO0B 2A1WL 3G6DH 1D5MA 1PG7W 4HS3B 3P9WB 3RPIA 5CKGA 4LHUA 5FO7A 1FQ9C 5I1HL 3LIZH 3ZDXE 4IM8A 1CLOL 5EH1A 4J3SA 5C07A 5FV1L 1WBXB 2JJUA 2NZ9C 1MI5B 1IM9B 2X4QB 3MV7D 2XWBB 2HG5B 2XT1B 4LARL 1KEGH 2W60A 3PJSA 4PJIA 4S1QL 2J8OA 5ICZB 4PLKC 4AEHL 4GUPA 1ADQH 5HGHA 1WSST 1HINH 1NAML 1D6EA 2ICWI 3OKDB 4TUJA 4HJ0D 1QR4A 2EICA 4NRYB 4GAFB 5MEPB 2ZNXA 2VKXA 4NKDB 1JPTL 1NGPH 4XCCH 3UO1H 2GEEA 3MNZB 3WUZA 5EU5B 4MB3A 2YZ1A 2QQNH 4AIOA 1YYLH 4XNQA 4F7TB 3F65A 3GHEL 4NJAL 1RFDH 1S7TB 5T3XD 1RV6X 3TV3L 4M7LL 4X4ZA 5IVXF 3D39D 3KYOA 3GO1L 3IDJA 4HK3J 1U93B 4XZUB 4YIQB 3MV9E 3L1OH 3D85D 3CLEL 4K7PL 3C8KA 3A67L 2WSKA 2YPVH 3K2MC 2VLKD 5IBUB 3QXVA 5F7DB 4DK3A 5JZ7C 3EDJA 1MJJB 2EH8H 4U1KB 4NUGL 1V05A 4YWGH 4EOWL 3D0LB 4E42A 1YA5A 5IVXB 2SEBB 1IC5H 1OLLA 3JWDC 3WXVL 1T2QL 4D0DB 3V4UH 1MWAH 1QVOB 3TT1H 4OBRA 1CDIA 4UDTA 5DHXB 4L3EB 1OPGL 5I1AB 1WQVT 2IALA 1K4DB 2NNAB 4MJ6A 4X6CA 4P2OA 1KTDA 2ARJB 3O3EB 3BE1L 2ENYA 3L95A 5K9JH 5DD6B 4ZS7H 4V2CB 2OP4L 3V0WH 4Y8AA 3OPZH 3EYVA 1D5XA 1E4KC 4Z18A 5CGTA 1IEBA 1ZLSL 3TT3L 4MSWB 2F9BT 32C2B 2A6IA 2WINB 1R24A 3BKYL 5D7LA 1ZHKB 1JGLL 3GKWL 5FB8B 2HT2C 3PWJA 2G2RA 1HEZB 3EZJB 3FMGH 4JFFA 1BOGA 2VDLL 5SWZB 2AJXL 4OAWA 3D0VB 4H1LH 1I8LA 2VITA 4L29B 4K9EH 4CUCA 4R96B 1NFIA 4P9HH 4TNWF 1A6UL 5EBWA 4MA3A 3PWLA 3BVNA 4GMSL 2ZUVA 5FKPA 5FO7B 4ONFL 5IW3A 4O9HL 5IK3A 4W6XB 3VH8A 4J8RB 1RZGA 1KIRB 2BVOB 3DWTA 4R3SB 3WEXA 1OQXA 2CKBL 4R97C 1DVFD 5DWUH 5DD5H 5HVHB 1GGUA 1UKSA 4GUPB 1AXTH 3ULUL 4RQQB 5GRVK 1UT9A 3F7RA 5KTEH 3E8UL 2ESVE 3CFKA 1W0YT 1CFQA 1EXUB 4W81A 3SHSA 2BZDA 3U9PL 2VR5A 2Y5TA 3NCBB 4ONHB 5D6CA 3L9RA 4MJIE 2XOTA 1SEQL 3BO8A 3PWNA 1TPXB 4Y2DA 5IFAL 3MYJA 3IB4A 3O4OB 2VL5B 4G9DA 2A0LD 4MHHI 4FMKA 5F7FA 4YZFE 3GJFK 4PRBB 5JQ6H 2ENSA 2F54D 5SV3A 4DZBA 3MMEA 5HPMB 5I71C 3EJZC 3MRQA 1JPST 3Q1SL 3TJEL 2BCKA 3FKUS 4FS0A 1R5IA 1Z9MA 3S37X 4YK4C 3AB0B 2QADB 4L4TB 1BEYL 1KENH 4JM2A 1F42A 4HQQH 4P9HC 5FYJL 2OXHA 1Q9WA 3ARPA 3O6MH 2LABA 1ZA3A 4LSQH 3CPLA 1C5CL 4PJBF 5IB3B 4FXKA 4WEMB 3K7UA 5BVPL 1KB5A 1AP2B 2D7PA 3IKKA 3X14A 4P2OB 1KTDB 1J18A 5ALBL 5E03A 3NCYP 4I18C 4LCWD 4X6EA 3KYKL 2VISA 4HUWB 4OCXH 4GXVH 1F13A 2Z93B 4PB0H 2VERN 2B8OT 4NNPL 3HI5L 2MHAB 3G6JF 4X6DE 2NY2B 2H8PB 4L3AA 3DV6A 5TQ2H 1T7WA 4PJBB 5AAMA 3B8SA 3QA3A 3MA7A 4YLQT 3MLRL 4UQ3A 1JZ2A 2FIKB 1H5BC 1SJVA 2NY1D 4LSSL 2E7BA 3QFJA 3QO0B 3SJVD 3JZ7A 3QXTA 3G6JB 4Q2ZA 4HZLB 4TSCL 5MI0B 4D8PA 4HKBA 3PWLB 1N2RA 1NAMA 2VQUA 4I8DA 4WGVB 2XTJC 3CVHL 1QG3A 3DETD 4FQCH 3NA9H 3B9KD 1OAUL 3BEVA 4PJ5B 1A02N 1HDMB 1VEOA 3QJHB 2EEAA 2VZOA 4OCNC 3T0EE 4J3VA 1DBKL 3HE6A 4K94L 2E9JA 1C5BL 4OB5L 5CFHA 1F4WL 4MLIA 5EU4B 5FHBL 5IQ9B 5KVFH 2VRAA 1EAJA 5GS0H 2W0FA 2VDQH 5D1QD 3BKCL 4HH9B 1OT1A 5DJAB 4R4BA 5GRUL 4MJ5A 1EJ6A 3O6KL 1UEYA 1JNJA 5EZOH 4F80A 1NSNH 4LU5L 4NZUL 4F57H 5L6YL 4WWKB 2D03L 3P4OB 4JFEB 4PV8A 3MXVH 5C08E 3LHPL 1K8IB 4LASH 2DQCL 3EJJX 3PWNB 4NHCL 4NO3A 4Y2DB 2CGRL 3MYJB 5DMKA 4C56B 4KK5D 4L8SA 1WCQA 1G7JB 3P9MA 4ZYKB 2EDXA 1D9KD 1JHTA 5F3HB 3MJ7B 1HILA 5IKCA 3SKNA 2OTPA 2X4UB 3ULVH 3MRQB 4DUVA 3ALWA 5EZJA 1JNLH 3GJEB 5I8KL 3LRSB 4PP2B 4PR5B 1TXKA 4KUCD 3BIBX 3MR9A 4OFKA 1NCNA 2VR9A 2NXZC 4CJ0A 4ZO9A 2P46B 8FABA 4HK0B 2CQVA 3MV11 1Z0MA 1I85A 3CNKA 1NDGB 3C5SB 3EO0B 1DANT 1ACYL 1LO0H 3GHBH 4NM8L 4CVZA 2Y07L 2VISB 4U1IA 5CD3A 3LD8C 1U8IB 3DRTA 4IJ3C 1BMGA 4N1CA 5TDPA 3MOAH 4XP1H 4HUXA 5BJTB 43CAA 3ZKQD 2A6JB 5GS0C 4KI5E 3UTQB 1YZZA 5EA0L 2ADIA 3WFZA 4U6XB 4P4KD 5E24E 1WTLA 3S36X 4HHAA 1NMCB 1Y0LA 5CJ5A 3B9VA 3QA3B 1JRHI 3TZVD 1UWEH 2AEPL 4LKXB 4XVSH 3K2UL 3FQTA 1T0NA 2EE9A 5DJDB 3FN0L 2CKBA 3W81A 1F5WA 3MZTA 4LCYB 4Q2ZB 4XXCA 2R4RH 2BHYA 4P49A 4WJ5A 3VXRD 4GSDL 1N2RB 3AC0A 3T0VA 4NGHH 2A9ML 3T2NH 1S9YA 1CFSA 3WSQL 5DMGC 3SY0B 4J3UA 3TNMA 4LGSB 4CU7A 4FXGA 1MCPL 3BP7B 3PWVA 1JYWA 1LDSA 5D71L 1ITCA 1JHKH 1TFHA 5T1DL 4PBXA 1UYWL 4HIJB 3OKOB 3T2PA 3KPMA 3ULVC 5F71A 1XAUA 4X5XB 1AHWA 2PW2B 1IMHC 3KJ6H 4QRSB 5C3LD 4WUKH 2X89D 5ACLA 1D5IL 1AGDB 3MLTA 4AMKL 4U6VH 4IHOA 1KT2A 4JKLA 4J3OC 1FYTA 3AGVA 3AXLB 3RUGF 2EEBA 2O5ZH 2HMIC 3BZFA 4Z6AT 2GJJA 2X1XR 3AMLA 3WKNA 4QNPE 3BZEA 5FUZH 5JLZB 4G7VH 4U1JB 5CSBA 3PDGA 3CFDA 3ZO0A 2HRPH 1HNFA 4UT9H 1Q0XL 5DMKB 3LPGA 3LKQA 1U8PA 4L8SB 1EO8H 4G8FA 1WCBA 1PVHA 3QWRD 2RFXA 3RUGB 1UQSA 1D3CA 4G43A 5T1LA 3G6DL 1S78C 5HHOE 4GH7B 4MWFB 3NFPA 3JWDL 2BOCA 4I48A 3FO9B 1HE7A 4JAMA 4I3SH 3LH2L 4W4OC 5H94A 3RJQB 4HBQA 2C9AA 2DIJA 1FJ1A 1A6WL 3O0RH 3QNYA 4ISVA 8FABB 2FO4A 3QI9C 4OTXH 1ORQA 3DARA 1Q72L 3KAAA 1RU9H 3Q6FB 1YEDB 3F7QA 1CICB 4D9RE 1MVUA 1XF5A 2ICWJ 5GZOC 5IWLC 4CRPA 2VDKH 3DYPA 5CP7A 5D96B 2XYCA 4OIIL 4WFFD 5I1IH 4OM1L 2JCCA 2OL3B 3C8DA 1I9IH 4I13B 3MRDA 1QNZL 2E6QA 4NBZB 5TE4L 5J9PB 4PJAE 3CVHA 2EKJA 4AL8L 4YHOH 1R5WB 4N90D 2R2HA 1S9XA 2XNAA 1TZGL 4GBXC 5TDNA 4NQCD 3O9WC 2XWJB 4QTHA 3OB0H 4F8QA 1YYLL 1N64H 2CKBB 1CTNA 4ODTH 1WK0A 2DQDH 2ZCHL 2X70A 1Q9LA 1D5ZB 3QIBC 3MV7E 4M1CD 3EOAB 1EEYB 1UA6L 4GG8A 4XP9H 1CGXA 3W5NA 1PW3A 5IJVB 5T1KA 3GMLB 4QRTB 2K7QA 2VUYA 2BDNL 4FXGB 2PNDA 2DYPA 3JUYA 3LS5L 3QHZL 3WDIA 4R26L 5KSAA 4Z77B 3VFMB 3GSNB 2DD8H 1IC5L 3QDJD 4XP5H 2CRMA 3KPPB 4XCFH 4OZFA 1IQDA 2H3NB 1CD1A 2CDEA 3T0BA 4JJHA 2IJ0C 1YEEH 3OGOE 1N5AA 1G9EA 4RRPA 3SDXA 2R0KL 4GQPH 4ORZC 5T3XE 4NZRH 4ODWB 3D39E 3GMPA 3BGFC 3MXWL 5I6XB 4MNGA 5E94A 5FYJU 2XQBL 5FF6A 3QT2A 4MS8D 1K3ZA 3AROA 4PB9H 3CZFB 1D5BB 3QP3A 4XNYL 4HS6A 1SJHB 2BK8A 2BERA 4WV1C 4CU8A 4LQFL 5CJXA 4HFWA 4F9LC 4ZFZB 3BKJL 4CN6A 3BRFA 5K93A 1U6AH 4G8FB 3ARGB 1WCBB 4JPVH 3FMGL 4QY8A 2M2DA 2I60H 3C5JB 3P0YL 1UQSB 5J11C 4P9HL 4QXTA 5D7IA 2XPGB 4F58L 5E70A 3VWKB 1PG7H 3HZYA 2JB5H 9CGTA 4HT1H 3V6FA 1I7ZA 1KELH 2JCCF 3MRKA 3O2VL 1YMMB 5KW9H 5D93C 3LKSA 5CCKL 4MDIB 3MLXL 4YHZH 1MI5D 5HJ3B 1ORQB 1IM9D 1XF3B 4AT6B 4N68A 1R3JB 2APWA 1UB6B 1NUNB 5I2IA 1QYGL 1MVUB 4FFZL 2X4OB 3SE9L 3DO3A 3L3DB 5CP7B 5D7JB 1IAOA 2DLEA 4P23A 4G9FE 2EYSB 3NCEB 4KQ3L 2JCCB 2XZCL 2Q76A 3CSPA 4BFBD 2VXUH 4Y4HD 3VXMD 3CVHB 4JFOB 3AREC 1P2CA 4XC1H 2R2HB 5I8EA 1I3GL 1N4XL 3D2UA 3SDDB 3VG0L 4LPWA 1DBBL 5L7XL 1OAYH 1HHGB 1IAIM 2EDFA 5AWNL 4ZUUB 4JPKH 5CZXC 1VCAA 3FCTA 3O11B 3NCJH 3OF6A 2CIKB 2KKQA 3BQUC 3MA9L 3I02B 1QSEA 5DC9B 1A6PA 2LTQC 3EHBD 4EI6A 5T1MA 5E2VL 1A6TB 4QOKA 1EDQA 2BSTA 3B2UD 5D7SH 4KVNH 1RMFL 3BKMH 1M7DB 3QFDA 3RPKA 4KK9D 3IDGA 5A2LH 1CVRA 4NJ9H 3F58H 3RWHB 4NQSA 4EUPB 3PXHA 5DFWH 1VENA 5E5UB 2QTEA 1CD1B 4KKCD 2VAAB 3WBDA 4RMQA 1MREL 4G8IA 2ADGB 4HWUA 5DI8A 1DFBL 1I9JH 4J3WA 4P3DB 3WLBA 4RIRB 2XFXA 2NXYC 5C0NC 4P46B 4UTBL 1G6RH 5E94B 4APQC 2OZ4L 3PHOB 4PTTA 3MPCA 1T20B 2UVEA 4PIRF 5IROA 1JPSH 1HZHH 1RZ8A 3BAEH 4QRPE 2X4RB 3WIFA 5KSVA 4OT1H 5FIEA 5TQ2L 1LP9F 1T3FB 4HFWB 1JVKA 4RGND 1HSBB 3E2HC 4AG4H 5IOPB 3EJYC 3U2SA 1BZ7B 1RJYB 4UIMB 5EZLA 4F37F 3LKOA 3GSVA 1M6OA 4LVHC 1E4KA 5LG1A 2AV1A 1QSFA 1QHOA 1AJ7L 5F1IB 5JHLH 4HIXH 1NLDL 2R29L 3CX5J 1QRNA 3DROB 5JW4N 4NC0B 1BJMA 1HQ4A 3LEXA 2C4FT 2VLJA 1LP9B 4LHUD 4I77H 1NLBH 4EN3B 3FB5B 3PL6A 1NEZA 5EOQH 1U36A 1I1AB 5C07D 1J7VR 1TITA 4HSQA 4DZ8A 1BFVL 2EDQA 3B9DA 4HKJA 2V2TB 2C1OA 4P5MB 1R3HA 4PJ7A 5GS0L 3N1GC 2VDQL 4HWNA 4WW2F 3KXFA 4IS6A 3MCKB 3RIAK 1AY1H 1GSMA 5DHYA 1UG9A 3IDUA 4PGBA 4OI7A 1S7XA 5C6TH 1NSNL 2BOBA 5F89A 4P48A 5FOJA 5DT1H 2D7OA 2P42B 1MCJA 4Y1AA 3ARBB 5DQJA 4WW2B 2J3SA 4U1MB 5GGUB 1T22B 2BY3A 2AKRA 1EFXA 3SPVA 1SEBA 1CLCA 3FO2B 4KKBC 3W39A 1I4FB 2QQLH 5C9JB 1DUYB 1HI6B 5E8OA 5DA0B 3VI3E 1JNLL 3HE7C 3GIVB 3IDGB 2FL5B 3FT3A 5E08H 1JUFA 1CGSL 4P57A 4N8VG 5JIIA 1WAAA 4TTDD 5C0DA 3H3PL 4I5BA 5C6PB 4U1HB 5JIHA 4P2OD 1IGMH 3RGVA 2J8UA 3IJSB 4JFHD 2IQ9H 2XXMB 4JGMA 3OJ2C 4GT7A 5JA8B 4TUOA 2AXGA 2NY2D 3IFOA 1FNFA 2EDOA 3QWQB 2ADFH 3WE6A 3LV3B 4N0RA 3U4EB 5KSVB 5JO5B 4KH2A 5D7LD 3NCFB 1YPZA 1LE5B 1Z3GH 1MJUH 4UAOC 3VXSE 4I18A 5LXGL 5HHVL 2C3WA 1P9MC 1CU4L 4JFFD 4BKLA 2P8PA 4HLZH 1FDLL 5EZLB 3DSFH 1I1YA 5HDBE 4GKNA 4DGYL 2VAJA 5DJCA 4UNUA 4UOW1 2YK1H 2X05A 1RZJL 3VD7A 4YQXL 4PJ7F 2FJFA 1U8QB 5E8NB 1PKQB 4OCWH 4O58H 4NFCA 1H5BA 1MLCA 5EO1B 5GGRY 4KZEL 1WZLA 1OHQA 1QEWB 1GGTA 2OTWA 4DN4L 1N7MH 2DOCA 2P8MB 4YHKH 4WWID 3LN4B 1JMXA 1A22B 4A2MA 1CTOA 2BXZA 3ARTA 3D3VB 4WI3A 2EDDA 5AYUL 1KBGH 4PJ7B 1FVDA 1X5LA 1A6AA 4IS6B 2FECL 2AJYL 4WUKL 3DX7A 2AGJH 5IBTH 1TVDA 1T1YA 4Q9CA 1G9MH 5GSVB 1EIBA 3ZT7A 1QLEL 4H26A 3C6LB 2GTZB 2BOBB 3C6SA 4G42A 3VGAC 3S88L 2E7LA 3U36A 4OF5A 1J9CT 5DQJB 1K4CA 1OARH 4PY8J 4Y2DD 1T2JA 5DMJB 4QKXB 1H3TA 2VDOL 4ZQKA 2AK4E 4GS7C 1MWAB 2A9NL 2H2SD 1QD0A 4HFUL 5J1SC 1JFQH 4HPOH 3OAUL 5EO9A 4OF3A 2J8UF 2IFFL 4LFHD 5C92A 1S9KC 3ARXA 2OZ4A 5E6ZA 4LLVA 5JIPA 4MD5B 3RNQB 2AI0H 3O0RL 1MEXL 2Y1VA 4MNQE 3UTPE 3WIIH 1RU9L 2VDNH 4OLZL 4JY5L 4P2YA 4F7EA 5DFVC 3A6CH 1FFNA 1HKLH 4WI4A 4YK4B 2J8UB 3QIUB 5I8OH 4H1LB 3Q5OA 3QEQA 2UV3A 4TSBL 3WV0A 4ZNCD 5DUML 2NX5E 2VL4A 1BIHA 2R4SL 5I1IL 3OV6A 4TUOB 2PYEA 3FB8B 5IBLD 3TH3T 1FL3B 2ZNWA 3O45A 3MLWL 2R0WL 4I18B 1UM6L 4EIZC 4BKLB 1CFBA 4NC2B 1OAKL 1G9MC 4RMWA 5EU6E 4D0BA 3GSXB 3HLAB 2CIIA 4GKNB 1NGYA 2GJ6A 1QZ1A 4UIKH 4NWUH 4ODBD 4CNIA 4LLQA 4YXKH 1T1WA 1P6AB 5DK2B 3VGEA 2DQHL 3PXJA 4QYOA 35C8H 4PGDB 1YJDH 4HIEA 3WNNA 1RULL 3RY5A 4G5ZL 4F9PC 1FP5A 4WFFE 1OWWA 1NCCL 1U8MA 1SJXA 1P4BH 2OTWB 2Z31C 1T1XA 3WS6C 1NMAL 1F00I 4X4XA 3MODH 3CFEB 3GB7B 4U1NB 2GT9A 3QZWB 1N6QL 3VXUA 5E6IA 2ZCKH 3L3OB 4N90E 4XCFL 2MQCA 4RMVA 3IU3B 2EYTB 1YEIH 4OLWL 4X9BA 3A6BL 3RVVD 5ICXB 1LO5A 1L9MA 4QRQB 3BN9D 5DUPH 5HI3D 1A9BB 3P9LA 1EPFA 5C0CA 3KYAA 3U6RB 4PJDE 4YHIB 1GIGH 4U6HB 4PRAB 1FCGA 4HMCA 4K3EH 3IFPA 4FFWC 1MFEL 3UJJH 5LBSL 2Z0BA 5H35B 2I5YL 4HG4J 1JJUA 2YD5A 2VLRE 2AJVL 1A1OA 3CDCA 3PGDA 3PWPE 5BCAA 3RI5K 3VFNA 2XTLA 2I60L 5JDSA 5HYEA 1LEGA 3MLZH 2BVYA 3MRFA 1K5NA 1JPGB 2KZWA 1WEJH 1CD9B 4LLVB 1A5FL 3TH4T 2FLBT 1CG9A 3MJ9H 1QFWM 3EO9L 1K8DB 1HYRC 3RA7H 4R4ND 4N1HB 4MMXC 3VFPA 1XIWC 2NLJA 5F96H 4YHZL 1LILA 3K81A 5B39G 4Q6IC 1OQOA 1EO5A 1YJDC 5IVZB 3WFBH 2D7TH 4F7EB 1EERB 4LSRL 4CDHA 3P0VH 5BRZB 5KVDL 4W4OA 3Q6GH 2NXZB 1RK1B 2D2OA 1AXSA 1OW0A 2Q3ZA 1MCIA 2V5SA 5BQ7B 4UT7H 3BP4B 2VXUL 4QXUH 2HJLA 5TE7L 2XQYK 5IWLA 1INQA 4G7YL 3SDYL 1QQDB 4Z0XB 4WUUA 4IJ3B 4DUWA 5I1LA 1VGKB 3WD5H 1CF8L 1MI5E 1A7PL 5I16A 5K9KB 5EN2B 5C09A 1JK8B 3CFIC 3P0GB 5FFLA 5FYKL 1EHAA 1WT5C 4AQ1B 4HIEB 1YDPA 4G6KL 3MUGA 5D2NA 5FHAH 3O9WA 4Y88A 1U8MB 3QUXC 2MPAH 1AD0B 3ZKNC 4MXQD 4MMZC 3ULVF 1CDGA 3HB3C 3K0WA 3QIBA 4F2MB 2WZPD 4NJ9L 1UM4H 4ODHL 2FATL 3WUWG 4PJ9A 4Z9KB 3VXUB 1SVCP 3SKMB 3PQYB 2ADJA 2H1PL 3I84A 4ODVH 4HKXB 3QEUB 1A1MA 1KCKA 1F90L 1KXVC 4H5SA 2Z4QA 4X7DC 1IC4L 3DX6B 1LO5B 3ULSB 2DLIA 5DZLA 4G6MH 5DUBA 3P9LB 5C0CB 4Z7QF 2NW2A 5B8CC 3FT2B 1HWGB 5ICYA 2XZAH 3MLSH 3GBLA 5CILL 1GOGA 1L6XA 3RVXD 1ERNA 1QSZA 2F8OA 4OSUH 2APXA 1DUZB 3ARGD 5IVXE 1MH5A 2J6EA 3U0TA 1U8OB 5GIRB 4XH2A 5IR1A 3HPLA 1OSPH 5T1LD 3TCLB 4BSJA 4D0CB 4ZTPH 4L3EE 4WV1A 4F9LA 4ZFGL 4I77L 5HSFA 1FC1A 2XQYG 4XP4L 3CMOH 3UAJD 3UZEA 2W38A 1HWHB 4XAWH 1RJZA 4KKAC 25C8H 2AJ3A 1RJCA 2ZUTA 3KG5A 5D7JD 4ZPVB 1A3LH 3C9NB 1IFHH 3AS0A 5SWZE 1FFQA 4LSPL 2B1AH 4NZDA 3WHE0 1TZHA 3T1WA 2HLAA 3FTGA 1B4RA 3J8F7 2CPCA 3FOLA 3QI9B 1FBIH 4HXBH 1HQRB 1ZK9A 3O2DH 4NN6C 4JPWL 5DJ8A 1I75A 1V7NL 5HY9A 1IQWL 3DV4A 3MUZ1 4H0GA 4QXWA 3WL9B 3U0WH 3P30H 4KHTH 1W72L 3CSYA 4C4KT 2C7UA 4N0YL 3BW9B 1A21A 4MA8H 3PIQA 5IP4A 2LU3A 4Z0BL 4RGOH 1I9RH 4TNWK 3OKYA 3MJ8A 4OCLC 1W2KT 3PGFL 5EU3A 5DMYA 3MACL 5IF0A 2DQTH 2DDQH 5CEXB 4JKWA 4U7SA 4LOUD 3MUGB 4GBXB 1R3KB 5HHPA 5T1KD 2JB6B 2MKLC 2XRAH 1NBQA 5IEHA 3W11C 4JRWA 1BBJB 1BOYA 5KSAD 2DYPD 3GMOA 3QIBB 3TPKA 2YSSB 4XMPL 3BQUA 1VFBA 3GBNH 4XPGH 3EFDL 4MVBD 1JGVH 3VFOB 3MFGB 1CLZH 1G7IB 2P24A 5CP3H 5CJBA 3SKUD 3MROB 5GGQH 4PG2A 3U7YL 4HUKB 5ESQB 4ELKA 2Z4QB 1C1EL 2R2EA 1CXKA 1URLA 3EOTH 4P46D 4R0LC 2X42A 3SDCC 5JW3L 3OXSA 2NW2B 4IMKC 3K4AA 1U8JA 1E4WH 5FK9B 5ICYB 3ECBB 4UV7H 1V7MH 1ZHBB 3VE0A 2ORBL 1J0JA 2UZIH 4X7TA 4OM0L 4OFIA 1MJUL 3IDYC 4L4TE 3KJ4C 3HMWH 1DZBA 3U0TB 1P1ZB 2HVKA 4UNTA 2OR9H 4M9OA 3BPLB 5JR1H 1EBPA 5GJTL 3P40A 4LAJH 4WDIA 4ZNEE 4WV1B 1U95A 2DN7A 2MQ0A 4QO1A 4XCNA 5E2JA 1U42A 2WIMA 4PJXF 2WV3A 1LK2A 4NO5A 1P69B 1I1AD 3N85H 3I85A 4UQ2A 3H9HA 4WU5B 1CXHA 1N7ML 4XMLH 1RJZB 3H9YA 4PJBE 1HXYB 4OLXH 2VWEC 3IDXL 4E41B 2XKNB 3IDIA 4JM4H 4HK3N 4PJXB 4HEME 5D93B 3FTGB 4CL7A 3FOLB 2EDNA 2NZ9D 4CVXA 1UB5A 3I9GH 3G6JE 4IIQB 5DJ8B 4HXAL 4IRSC 1BQLH 3BYYA 5IIEA 3KPLA 4RFOH 3AAZB 2YRLA 3D2UD 4GLRI 4PLKD 4YGAB 5JDJA 4UU9B 4NBYB 3H0TB 3OQ3B 2R0ZH 4S1DC 4NQEB 1CXLA 3N1QC 3SGKC 5JNYA 5DVKA 3UTZB 3R1GH 1JF5A 4WFHE 5E8DH 3PIQB 5EIIA 4PJ5E 3AREB 2GSGA 3OF6D 3VCLA 2ZJSH 2QKIA 5IF0B 1UKTA 4KGJA 4LAQH 4QOKD 12E8L 1KLUB 2GKIA 2VLMD 5CSZA 2K1MA 4M62L 4HIIA 2DBJA 3GK8H 1ZS8B 4J7RA 3I75B 1RIUH 2NY4C 3QCTH 5EFIA 4L1HA 5FECA 1VFBB 3QYCA 3OWEA 4JFEE 1A1NA 4XPTL 5J56B 4POUB 4GRWH 3RRQA 2VDNL 5JZ7D 3L3JA 2CR3A 2LU4A 3UJIH 4DVBA 1DBAH 4ELKB 5HYSA 2DWEA 1U8KB 2R2EB 3HE7A 1BLNA 1HKLL 5TQ0H 3X3GL 4C56E 4YXLL 4J12A 1BF2A 1H3PH 4FTVA 2MFNA 4K23L 4WY7H 5D5MF 3GSWA 3R8QA 3QNZA 4X4ME 3BD3A 4FQ1H 4OLEA 5LGKA 5D1ZA 1X6LA 3HCVB 5DTFA 1TJHL 2OJZL 4NQVA 3G9AB 1BJ8A 1J0KA 5CWSA 5L2JB 3KR3H 5F7HA 1JIBA 1Y6NR 3MJ6A 1KCUH 3NCMA 3ZTNH 3BP5A 3BWUC 3QUYC 4APQB 1HHJB 1C5DB 4JHWH 4CVUA 1KCLA 5D5MB 4ONOA 1A4JA 2CXKA 2HT2D 5CJQH 2FB4L 2VLJD 3E2HB 4Y4FC 3QQ9C 1OD7A 3UZQA 1ZLVK 3MFFB 1P9MA 2D0GA 5ANMB 3W2DH 5BV7C 3MLUL 4GFTB 3VXOA 1LK2B 4NO5B 2W1NA 3DUUA 1HK6A 1BAFH 1DQQA 5EBMB 5F72S 4LVHB 4C83B 3WFEL 1RY7B 3H9HB 2PR4L 2FJHB 5FA4A 3S35X 5BS0B 1MRCH 3MRRA 1W72A 2F8VA 3D3VD 4S1RH 5FYKU 3AM8C 5HYQA 3CXDH 3LDBB 1S7SB 3MLVH 2FLRT 3KPRA 2FHFA 1XCTB 3LRHA 5J6HB 4R7NB 1GGBH 5KSBF 5L8JB 1RJLA 1AGFA 2FX8L 2QHRH 3MJGX 3QUZA 5EUOA 1FGVH 1GH7A 4X4YA 1VEMA 3L7FB 4RBPK 4OD2B 5GQBA 3CU1A 3TA3B 2ZOKB 1ZHNB 3H2WA 5DEFA 3CVIH 1U3HC 4XVTH 4JQVA 3O3AB 5GRVL 3L5XH 4FFYL 3IAGC 5F7EH 3QG7L 2PTTA 4OZHA 5KSBB 3LSOB 2VLLB 4LSUH 4WCYL 1Z0NA 4U3CA 1O0VA 2VDRH 3B5GA 3F7PC 2VXTL 1G7QB 4XGZA 3QCUL 4TQEH 4BZYA 3ZKSD 3FO0L 3X11A 1G6RB 3T1FB 4R90L 2IBGA 4ORGA 2R2BA 3V6BR 2B5IB 3I2CL 5FECB 1M05A 2B0SH 3EYUL 3MJ9L 4LLYB 4M6NH 4OI9A 1N59A 3VGFA 4XNZC 3EJZD 2F53A 3MNWB 3DVGA 3INUL 2L4OA 5F96L 3TO4B 1FIGH 1RUAH 4HPYH 5D9SA 2Q8BH 3VRJB 3RX8A 4GAGL 4J4PA 3HE7B 3SN6N 3WS3B 1G7MB 5I9QC 4TVPH 5JA9A 2EDHA 4LDOB 1IAIH 3I50L 1U92A 4J6RL 4MA1C 1BHGA 2XZQH 1ZLWK 5I18L 1DL7H 2BSED 3CIQA 3RUGE 5CLTA 1VPOH 3O2WL 4LEXH 2VJXA 3QNZB 4E0RA 1OF2B 5CZVL 3O8XC 5E2WH 4FQQB 3LQAL 2Z9TA 5EWIL 3GMRA 1ROWA 5CWSB 3B3IB 2EXWC 4DQOL 4LEOA 2CLRA 2R39A 4MXWL 5DD0H 3TWCL 3B8YA 1NFDF 2FBJL 4NQTA 3TBSB 1EHXA 1OP9A 2YBRB 1ZVSA 3LRGA 5MEOB 4AIXA 1RHHB 4JY4B 1T04B 1MFBH 3RWCB 5KSUA 3L3HA 5FHAL 1WZMA 3AY4A 4K7PX 1UWXK 5LAXA 1MHHB 4MDJA 3BH8B 5LJYH 1QBMH 2JF1A 1NFDB 5ERWB 2GIYA 2APFA 5F9JB 1W72B 3RY6C 3UPCA 5IW1A 3KYMB 1N3NA 1HYSC 1UM4L 3DRQA 5F88A 5HYQB 2XTJD 4RAUB 3VXNB 3GI9H 2BNQB 2IG2L 1CK0L 4F9PA 1WLHA 5CHNB 1SJEA 4LCUB 1F4YH 3AVEA 4ODVL 2ZCLH 1KC5H 2Z31A 3WS6A 4OGXL 1A2YA 3VA6A 3GSQB 3IXAA 3NA4A 5GJSL 2YA0A 5E99L 1YC8A 4Y5XC 3ZKMC 3IYLW 5IB5A 1CLYH 3M1BB 2X9WA 1YEHH 2XZAL 1I1RA 4BYHA 4CMHB 3MV9A 5JW4Q 1IM3B 2UYLB 2F74B 1F4HA 1PLGH 2YD6A 3WNKA 2YC1A 5AG9A 1TMCB 2IQAA 2J8HA 1ZHLB 3VGAB 1R5VA 3E3QE 4KRPD 3JTSB 2VC2L 4XGZB 3G5VA 1AGCA 4GJTB 4WHTB 3X11B 4Z76B 2DIBA 1VFOA 3C60A 1HKFA 4GS7B 4FRWA 2F58H 1TNMA 3MBEA 5FV2A 1N59B 4KDTA 3RWDB 3RP1A 4UUJA 3DVGB 4GQ9H 4L5FH 5IQ7H 3F7VA 2P47B 4F7MA 3DHMA 5BOPA 1LGVA 3BSZH 4NKOB 1SMOA 4JQIL 1ACZA 3QEQD 3FFDB 4LBEA 3RVTC 3RWJB 3OTTA 1IFHL 2GJZB 2NXZD 2YD2A 3ZSSA 1ND0A 3BT2H 4PLJC 4Q6IA 1VKXA 4E0RB 4YX2L 4UMGA 4XHQA 1IBGH 1I7UA 1KJMA 1G7HB 1RURH 2J88L 3U30B 4HUVB 3EDEA 1B3JA 3H9SB 1GZQB 1NBZA 3CU7A 1NBVH 1KCRL 2CLRB 4NNYA 1YMME 2IPUK 5CBEA 2GJ6D 4PS4L 5E4IA 3WXWH 5GS0D 4LPYA 2MCPL 4KTEL 4FN0A 5IEKA 3KS0J 1FNEA 1PQZA 4UILH 3ROLB 3PV6A 4YAQA 4XP6L 3U48A 4RFNC 1NGXB 5EORL 1S7VA 3QNXB 4WTWA 1WISA 2QR0B 3W9EB 1M7IA 2VNCA 1AQKH 2JCCE 3WFDH 4GAJH 3IGAA 1QLRA 5LQBH 4ODXA 5CEZE 5C0RH 3KWWB 3SQOH 1N3NB 3VXUD 1A9EA 3GBNL 1JZ7A 1XF2A 4R4FL 4QHMA 2ESVA 1WFTA 2XY1A 1FPTH 5DMGD 3U9UB 2R1XB 1QLFB 4YPGA 1FC2D 3LS4L 3QUXA 2Z31B 5F1KC 1NGQL 1XF4A 3KLAB 2CLVB 5H2BB 1NCAH 4PJFF 3TIEB 3TYFA 1XZ0A 4UV4L 4MJIA 3ULVD 4Z5RB 4DCQA 3EOTL 4KJYA 3HI6H 5J12C 5C0CD 3GNMH 3WFHB 3DHJA 3SKJH 2Z92A 4UDUA 4X9HA 1MFAL 3D87B 5GGTH 2Z8VC 3BDYL 5DQDH 5KANG 4LP5A 1OB1A 3ARFC 1ZT1A 3EYSL 1FVCA 1U3ZA 5CEYA 4PFEA 2YD8A 4PJFB 3IETB 2C4XA 2V2WB 4PREA 2HMID 3C2AH 5B8CA 5DC0A 1KEMH 5JPNB 2OR9L 1INEH 2OXGA 3OKMA 4RDQF 1J88A 3UYRL 1MRFH 5IFHH 3VJ6B 4GW1A 1JF6A 3G5VB 3LMJL 4U6YA 1A7OL 1AIFB 4JFQA 1PBYA 4LVNB 4OZ4B 4YNYB 4OCSH 3TO2A 1PKOA 3KHOA 2R0LH 3N85L 5SWQB 2PTVA 1YNKL 2YOCA 2IPUG 1T1ZB 1S78D 1VGEH 5E8EA 1HH9B 3V6ZB 4F7CA 1PFCA 3RDTC 1PSKL 3NTCH 3IDMA 4X6DA 4XX1E 5A2KH 3H6JA 4JM4L 2H32H 2QSTA 1ZT4B 5K59F 3QI9D 3IVKA 3CLFH 1DLFH 1XIWB 3MRJA 3O6FB 3ET9F 4M5YH 4EI5C 3P4NB 1F58L 4PGCB 2XWTB 1KJMB 5GZOD 3DJ9A 1BQLL 3PE9A 3BD4A 4PGZA 2UY6A 3BGMA 1LP9E 2FYYA 4XCEA 1N0XH 2FR4A 1NBZB 4WUUD 2R8SL 4F37K 2P5EB 5BV7L 4RAHA 4GMTH 5GGVH 3SE4A 2KUTA 4MAYC 5C09D 1YY8B 5IEKB 3U7WH 1NMBL 4OQTH 3MGAA 2CJUH 4G3YH 4P4RA 1S7RA 3C5ZA 2IBZX 1NGZB 4MCZB 4GBXD 1IC1A 3FRUB 2VKWA 3QDGB 2AEIT 3T0EA 1J1OL 3O9WD 3P11H 3LEYL 3B5HA 3IF1B 4X5WB 5DJZB 2VSCA 3GK8L 3STLA 5AUMA 4NYLA 3QIBD 1JF1B 4U7MA 5TGBB 4Q0XH 5E8PB 1FRGL 2VN4A 1OM3L 4DJMA 3QUMH 4AQOA 2DM4A 4NZJA 4EUPG 4QHMB 3LQMA 2CO6B 4CU6A 1E4JA 3NFNB 2R56H 2Z91A 2W9DL 4PTUA 4YPGB 1C7SA 1KTRL 1DBAL 1JHLL 3M17B 3TJHC 1BD2B 5C08A 3DO7B 5F1NA 3HKFA 3T65A 3ZHLA 4IRJC 4DCQB 1S9VB 2E6JA 3HC4L 1W0VB 4M7KH 1UWGH 3CFBA 3V52L 4HMDA 5D7KE 5C7XH 4OF6A 4JFYB 3KLDA 2CDGB 3SKOA 4FQ1L 1ZT1B 1FVCB 4M3KB 4QRUA 1YMHB 5CEYB 1TNNA 5C8JA 1IEAA 4IMKA 5B8CB 2Q87A 2X1OA 4KY1L 5C86A 4XI5C 3QJFB 3DGGB 4LMQI 3Q5TA 4P5TC 4TOYH 1S5HB 4U6YB 4U31A 4JFQB 1TVBB 5FYLE 5GXBB 3NMEA 5ESVA 5A2FA 5JUEH 4OJFL 3T0AA 2FSEB 3MGTA 3DMMC 3QAZC 5AZ2H 3TVMA 3ZTJG 3RL2A 2ZSWA 3BH9B 1H8NA 1K3IA 3EDDA 4GRLB 1BGXL 4H0IA 4JDTH 3IDMB 5EZIL 3THMH 5C70A 2DLGA 2X7LA 1EUTA 3GMNB 3IVKB 1GGBL 4JO2L 3GI8L 3V5KA 4Q74A 2GUOA 5GS1C 2BVPB 5DRNA 1EFQA 4FABL 1OAQH 3HUJF 4Z7UF 1UKQA 2EE3A 3TPUB 2X9YA 3BGMB 2WBJA 1O5DT 1PKQE 3GBMH 4G8GB 5T3ZH 4QF1B 4XBPB 1UXSA 4K7FB 3DUSA 1F3DJ 5E4EC 5HDLA 3MSPA 3ARED 4NN6B 1DTUA 1QFWH 1RSFA 3KPNA 4LSUL 4NRXB 3T0DA 4P4RB 4IRSA 3PNWA 4JO1H 4EQ2A 2K9UA 2R69L 3D3VE 3ARQA 3HUJB 4Z7UB 2BNRB 3JV5A 4YDVB 3IAPA 1HOCA 2PCPA 4ZUTA 4NWTH 4X9FA 5DGRA 4U1SB 5I1DA 5CZXD 5I66B 3FZUC 1K2DA 3WIHH 2MTPA 3HZVB 5IMKB 3E6HA 3BQUD 4XPHH 1T21A 4RFEA 4OLUL 5D1XC 4WTZG 1U8NB 1AGEA 4PV9A 2Z91B 3SGDH 2V9RA 5F7KC 4HPYL 5JXAH 1J11A 1EJOL 4OLVL 2YD7A 4PG9B 4EVNB 5L88L 4HGWA 3OKLB 3T65B 3WFCH 4DN3L 4HUUA 4K8RH 5GRXG 1ZSDA 1IAIL 4L9LA 4WI8A 1A7RH 1UZ6F 2C3VA 1WBYA 5FDYA 4ODSL 5BW7C 4TTGA 1HH6A 5HD8C 1QFUH 1J8KA 3HRZA 2QV2A 1JGUH 4X6BA 3SKOB 5LVEA 3PDOB 5L2KB 1P7KA 5DJ0A 2DICA 2NXYD 5C0ND 4MA7H 4R0LB 5HHOA 4O2CB 2C3GA 1IEAB 3SDCB 4APQD 1OSZB 3WJJC 4PLOB 5ABDE 4OKVB 3GMMB 1CFVH 3IJYB 4O02L 4Z78A 1CFNA 4ACPA 4FQHB 3O41B 5DS8A 1N6UA 5EBLB 3IDYB 5FOBB 2ITCB 3KVQA 4N8PA 3KJ4B 4U33A 1HXMA 3QUYA 5C0GB 3EOBB 4NHUA 4RZCA 5DDHB 4P3CH 2IADA 3MRLB 4P2CG 3MOBH 2FHBA 5ADPL 5KG9A 1I8KB 5ENWA 3GSRA 4PJAA 2DJSA 4L8BA 1LEIA 4MX7B 5ID1B 1QR1A 5FYKD 2C26A 5GPRA 1TZIB 1JN6B 2GUOB 5DRNB 4YHLL 3WHXB 2WUBL 4NOBA 3U4BL 2VDML 3RWGA 3AM8A 1SMAA 3ZE0F 5DK0B 1KXQE 4QHUA 3TBYA 1RUML 1YEHL 3MV7A 5C9KA 4K8RC 2Q7YB 5BO1H 1G84A 2YMXL 3HI1B 3R06A 2QEJA 1FNGA 2X1PA 2GY5A 1I1FA 3KPNB 3FT4B 3Q3GB 4IRSB 3MRBA 3NBNA 1JPFB 2HFGH 4GKSB 2Y7QA 1U3HA 3O81A 2NY6C 3VXQB 3LN9A 1IGJA 2AXHA 4HC1L 4JPIA 5J13C 4HH8A 4XVJH 3MUHL 2X4PB 1ZEAH 4KKBD 4ZPTA 5FAAA 4Z7VB 2IH1B 5DRWA 3D5OF 3D39A 3JV6A 1F4XL 2VSDA 3OSKA 1LK3L 3HE7D 5FGCB 4DW2L 5DVOA 2NY4B 2KH2B 4H1LG 5J1AA 4HUUB 1N6VA 1RIHL 3HZKB 3BT2L 5DA4A 2YN5A 3JV0A 1NPUA 1KIPA 4X6BB 3L3IA 1WC7A 3OKKA 1HIMH 2BMKA 3A6OA 4Z7OF 1RVFL 1YQVL 2HFEA 4KGLA 4HJJL 4P5KA 1YECL 3VD4A 4A6YH 3HMXH 1N5YH 1EAPA 3GJFH 4IEFB 1A14L 1MCHA 4ZODA 2Y5EA 4AIZB 1EK3A 3O8XA 3SE3C 3SGEI 1OAXH 4LF3B 3O4LB 1X9QA 5I1KH 5BRZE 2N1KA 1IGCL 1FZMB 5HGDB 5JOFA 3EW3B 5LWYH 2MWCA 3VMNA 2B20A 5C2BL 4NM4L 5F21B 2V17L 3RZCB 5A2IH 1Z5LB 2ICEB 4DKFH 5LKNA 4G9FA 1PAMA 1BZ9B 1TCRA 1YN7B 2HJKB 3SQOL 3BRGC 4Y4FB 3QZWG 2BNQD 2DM3A 1KNOA 1G7LB 1ZT7B 1LEIB 4D94A 3O6LL 5DEGA 1E6JH 4FQLH 4QHLA 3H9ZA 4HWBH 1V5JA 3HFML 4GRWF 4G6JL 4NPYB 3RY6A 1JP5A 3EO1B 3HI6L 2EXYC 1DR9A 4JHBA 3RWGB 3JV4A 5DRZB 4AENB 3UTTB 5K9OB 1CR9H 5E00A 1NC2A 2CMRL 4P59L 3IRPX 4FQ2L 4W68A 3VD9A 3BPCA 5E2UL 4JZOB 2VR4A 5C0EA 1GRWA 1P7QB 5I76B 1RUKH 4H8WL 2GITB 1LDPL 4GRWB 3VXUE 4Y5XA 1SYVA 3IT8D 1JGDA 3PQYE 4ZUVB 4OD3H 5IFHL 1MRFL 5D70L 4YHML 4NNXA 3BJ91 2ZG3A 3ARDC 1HSAA 1NKRA 2WWKT 1X4ZA 3ULVE 5C0CE 4KRMB 4DKEH 3HZMB 5F7LB 4CKVX 2R1YA 4S2SA 2F53D 3AB0C 2QADC 2F5AH 3ROOB 3JWOH 4Z7NF 1AKJA 1NGWA 1OOAA 4ZUWA 5IGXL 1FL5A 5C0AB 4QRPA 5F9AC 1FG2A 1EHLH 1SYSA 1XCQA 3CH1B 1FN4A 3DX9B 4XNZB 4Z7QE 1DLFL 4WEBH 1UXWA 2DLFH 1EMTL 4GW5A 4N8VA 3S36H 4M5YL 5JXEC 3LVEA 1KIPB 5DFVD 1FORH 3L3IB 1LEKA 4HKZA 2AJZB 3PF2A 3OKKB 1LO2L 1P4IH 5I9QB 3H9SD 3K3QA 3X3FL 2YZ8A 2HFEB 3GMQB 3FQWA 3OHXA 1A7NH 3WJLC 3KHQA 2VDPL 1QBLH 4KVCH 4PRHB 2DBLL 5BXFA 4TRPL 4KXZI 4HIHB 4XPBL 2WBWB 3VFGL 4KUZL 4UT6H 5I30L 5MI0C 2H6PA 3U0PA 5SX5H 5ITBL 2HN7B 5EOTA 1KJ3H 1JWUA 1X7QA 4LLUA 1MHPL 1TCRB 1XGTB 4KHXL 3T4AA 3D18A 4KZDH 1NCTA 2XICA 5EOCL 5DQ9B 1F11B 2P48B 1A47A 2JIXA 3HNTL 4JFDA 1ZANH 4HJGB 3FB7A 2E27H 3L3KA 2Z31D 1CL7L 1KN4L 2GYSA 3PABB 1MIEH 2X40A 1VESA 1IC7L 1PX4A 5ILTH 3OX8B 3UC0L 3JWOC 4BZ2H 1DN2A 2BFVH 2IPTH 3F7YA 5J89A 3JV4B 4M7KL 4HC1A 3NIGF 2EDJA 1OTTC 1R6VA 3WKMH 4LIQH 2UZXB 3CSBA 3R8BB 4G8EA 4WWKC 5C0EB 4M8VA 4BQ9A 1Q9OB 3TIDB 1SM3H 4IOFC 3GUTA 5IB1B 2GAZB 4K71B 4Q6YA 4FFWD 5E7FA 5I1EH 2FX7L 3ARFA 4TOYL 3BUYB 1BJ1J 4OGYH 1KG0A 4ENEC 3G6AB 1KPVA 4HGMA 4U2ZA 2FHCA 3GRWH 5JHDB 3UTSB 3MRMA 4ELMF 1TTFA 4S2SB 3SGDI 3CC5A 3P77A 2AXFA 3V4PH 2VXSH 3DI2B 3GSUA 1QFOA 1VA9A 1G1CA 5H37H 1D9KA 3LQZA 4YC2B 4TPRH 4ZUWB 1C16A 5EUKB 3QXAA 1F8TL 4KQ4H 1FLRL 3G08A 4Y8DC 1VEPA 2JJTC 4LRIC 4PPTA 2QQKH 4KK8C 3VXSA 2WP3O 3KPTA 1XIWD 4MAUH 3U1SH 1KCSL 3KLHC 4CAGA 1K6QH 3DIFA 4ELMB 1XF1A 4N8VB 3OKNA 1PDKA 1JV5A 4OKDA 4HBCL 3TC9A 1Q9KA 1DQLH 3RNKA 3FO1A 3H42H 3MX0A 1B0RA 4F7PA 4NQXB 2BJML 2P5ED 3SOBH 1HHHA 4EJ1C 1NMCC 5IMLB 1FO0L 4DVRL 2CK0L 3JTTA 3T77A 3OB0K 4M4RA 1SQ2N 2DRUA 1GZPB 3IFLL 4E41E 4IMLA 4LLDB 4KMTL 2EDRA 4PJXE 4U1LB 2D31A 2H6PB 1FZOB 3FN3A 1B4JH 1CQKA 5CJ8A 4FNLH 4MAYA 4O5LH 5IB4A 3WIHL 4X9IA 4M61A 2F5BH 5I17A 1WZ1L 1P5UA 4X98A 2ESVD 3L5HA 1LD9A 4M9PA 2JIXB 4JFDB 5L9DH 4RISH 2K7PA 4NQEE 5KS9F 4JB9L 3QUXD 3IRZA 4BK5A 3ZKND 1BD2D 3G04A 3HB3D 2CXGA 4JY6B 4N