3RDTA

Crystal structure of 809.b5 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLIAIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASKGADRLTFGKGTQLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for differential variable gene pairing in creating T cell receptors specific for unique major histocompatibility ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
total genus 36
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2011-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA02
4S2SB 5I6XB 3OAYK 5CJQH 3HC0A 3IFPA 1J0HA 2HT2C 3T0EA 1RZKL 4UOW0 5B21A 35C8H 3REWB 4N0FA 2XV6B 3CJJA 3FO1A 2X70B 3EFFA 1E28A 4RQQB 1FFOB 1I3GL 1TJIH 4G7VL 4G8IB 2VABB 3K4DA 1LO4H 3M1BB 2VLKB 3U7YL 5IQ9B 4IRSC 1NCAL 2R9HD 5IM7A 4J1UA 1YQVH 4YHNB 4PGBB 2MFNA 4XX1G 4YHMH 3RKDC 3X12A 5I15H 2JB5H 3JV5A 4BKLB 2ZUVA 3BP7B 4RA3A 2GY5A 5DUBB 4XC1L 1JNLL 4G8EA 1DQJB 1G9NL 4XP1H 1HOCB 4APQC 3SDXA 5EU7E 3QIWB 1JZ2A 1RK1A 5F9JA 5SX4H 1VACA 4M1GH 4J3UA 3RGVA 5DTFA 3U36B 3CFBB 3C5JB 1A4KA 1OOAA 1NJ9B 3QDGA 3QO1B 2F5BL 3LKPB 5I1HL 1WFOA 1YY8A 4J1UB 4YHNA 3DUUB 3TNNB 1HH6A 1JYWA 4KZDH 4PJ7A 3CXHK 3OAYH 4HSQA 2ADFL 3HE7D 1KLFA 1GPOL 2UY6A 3GK8H 4M9OA 2D0GA 2WZPD 2LV4A 4YHYC 1DCLA 4NNYB 2OI9C 2QEJA 2B4CC 1NAKH 5GS1A 1Q72L 2AK1H 5CINL 1WAAA 4G6JH 4OGAC 5EU6A 5AAWA 2ZOKB 4GRWE 3WNKA 3BKJL 1DLHB 3WS6A 4UT6L 1F2QA 2VLJE 3BD5A 4PRNB 4PY8J 1A4KB 4LP5A 4QRTA 4ZSOE 1S8DA 3N0PB 4IMKC 3VRJA 3KPRA 4EIGB 1SHMA 4QHUA 4KKLD 2P5WB 1GGBH 1RHHB 2CXKA 2NX5E 1U58B 2QSCH 5F9WB 3W9EA 3GSNH 3DECA 1IC4L 2FX7L 1N5YL 2Y9RT 5I1CL 4E42B 1V5JA 1V8HA 1INDL 1JHTB 4RDQG 3X13A 4WO4C 4LIQE 5EIIB 4KKNA 1DBKL 5H94B 3FT2B 2C4XA 4BQ9A 1S7RA 1ZLUK 3LQZA 4K8RH 2VXTH 5TDOB 1A7PH 5B8CC 2Z4QA 3ZE1E 5C6PB 1P7QB 2H45A 5CSBA 4MQ7B 1UYWL 1FVEB 3RI5F 5D2LF 5IHZA 3FQUA 4G6AC 1G9MC 5DLML 4U1GC 5CJ8A 1MCPH 4FTVE 2NY2D 4WU7B 4UIKL 1OSPH 1N3NA 3T0EC 3E8UL 2HJFB 1OGAB 3GMMA 4NQSB 2CLRA 3ZHLA 5C0AA 5GHWL 3ALPA 3BEVB 1FNSH 4V1DA 5C71A 1YZZA 2ZNWA 1C16A 3HRZB 2V7HB 5AYUH 3SN6N 1JGLL 5FA3A 4LLYB 3MRKA 4IIQB 4MWFA 1I4FB 1SQ2N 1BOYA 3RVUC 1DBMH 3IAPA 4NNXB 2YD7A 2OJZH 4BZ1L 2WINA 5ACLA 1O7SA 3SDAB 1JL8A 1XGRB 4YFDB 5D1ZD 2Q8AH 3QEGH 1JP5A 3H9SE 2H2SC 2IG2H 3R0NA 4K23L 3STLA 1E27B 4HKBB 3O6KH 1CGVA 5MERB 5EBMB 5IB3B 1CLYH 3ULVE 4NQEE 4ZFOA 2YBRA 4XNQA 2DLGA 1MAKA 4Y5VA 3S37H 4UT7H 2F53B 1EEZA 1F4WL 5D2LA 3MBEA 1HHHB 4WWKB 5D9SA 2I9LB 1B90A 4OCSH 1IT9L 1NGYA 2ARWA 4HF5H 4D0BB 3LEYL 1KLGB 3NFNB 1OB1A 1DQDL 2PTTB 5J1SC 3O2WH 4QF1B 3UTPD 2YK1L 3RTQD 1WICA 2DF3A 2F58L 2J8UF 5HPOA 4LMQE 4KI1A 2ATKA 4Y2OA 2AEQH 4WO4B 43C9B 4PRHD 4HK0B 1QG3A 4UILL 1BFVL 1H3WM 1M05B 4QRSA 3CDYA 3KPNB 3NH7H 5IESH 2IAMA 4QCIA 4XP1L 4XCNA 4JHWH 3T4AB 4EOWL 3QWOA 2NY0C 1JHLL 4JN1L 2EYTB 3RJDA 3HMXA 3EYSL 3TJEL 4YHML 4PY7A 2CQVA 3WV0A 4JFEB 1MRDL 3DV4B 5E56A 4Q9QH 3IDMA 3BZEA 1AC0A 5GS2D 5F44A 3M8OL 1J8KA 5TJWK 4X4YB 4QXUH 2C9AA 5IIEB 1K9TA 2Q1EA 5IQ7H 1YEHL 4MD4B 1F4YH 3PIQB 1R24B 1VERA 1JZ8A 4LRNH 1VEPA 3QIWC 1ADQA 2GTWB 4OZFB 1RZ8B 5C0GB 5CAYB 2A6KB 4EQ3A 3C6SB 1OAUL 3GMOA 1FV1B 1FVDB 4C56B 2O5YH 1XGTB 4QTHB 2XQBH 5E8NA 5FO9B 1SEQL 1EV2E 3FHQA 3MMEB 4EN3B 4XBPB 1WC7A 4PP2B 3KYKH 5D1QD 1T2XA 1GRWA 1U3ZA 3DHJA 1I85A 3PWPE 4D9LH 2QHLA 4LL9A 4JRYB 1KACB 4X7SL 4ETQA 2Z31C 1T03H 4KFZC 3WFEL 4NRXA 1S7TB 1OQOA 3QG7L 4AH2B 4WNQA 4WHYG 4XWOC 4G43A 3QCVL 4JHAH 3B8SA 3EUUA 1KPRB 4X9FA 2GK0B 2PR4H 2P8LA 4FRWA 1HQRA 3ZKMC 4JCLA 3AROA 1S3KH 3PWPB 2ZUSA 3NFPA 4JO3H 4X4MA 4G6ML 4LCIL 4UNUA 4OFVA 4LLYA 4PGEB 5DI8B 1ZVHA 4ORGB 3JTTA 2J12B 3NABH 5I75B 4HC1L 4HUNB 32C2B 1I8MA 1KG0A 4PP1C 1A7RL 2Z9TA 2J6EA 3NMEA 1YUHB 4X99A 3EYQD 1RJLB 4ZG1A 4X98B 4P2RE 1ZA6A 4UINL 3LQMA 1QSEB 2IBZX 4JO4L 4K3DL 2W0FB 5JOPD 2D0HA 3G5YA 1NAMH 3SGDH 3O4LB 3WKNA 4PJ5E 4P48A 1YEFH 2VIRB 5E03A 1QFUH 1CI5A 3D1MC 5I1JH 2CLZB 3SDCD 5DJCA 3MNWA 2EH8L 3NFSH 3BP7A 1TPXC 3DYPA 1XIWA 4QNPE 4NM4H 1CTOA 2EDYA 4OFYD 2BNQA 1LO2H 5I1IL 3MACL 4XZUB 1KIRB 3PWUB 5IGXH 1NL0H 4MNQE 1BOGA 4OIIL 5F6IB 2PTVA 1YEJL 3WUZA 3RGVB 3ZHDA 2AKRB 3TYFB 4YIQB 3S37L 3X14A 4MAYD 1U8PA 3DETC 4LNRA 4M7JL 2IGFH 1VGEL 3BN9C 3DXAB 1J0IA 3IETB 2IH3A 1CS6A 1RIHH 4HH8A 5IBTH 2FX9H 3D2UD 3OKLA 3WDIA 3MV11 4L8DB 2BY2A 4FFWC 2VE6B 1MHEB 2ATPB 4PJBE 1A5FL 3ILQC 2X4PA 4BQBA 5I17A 3HA0A 4R4ND 4HIEB 4MB3A 2A0LC 1KF9B 5EB9A 5A3IC 4JCMA 3ZSSA 2Q7YB 1KIUA 1RUPL 5HBBA 1WBZA 1MAJA 5ETUA 4JQIL 1MWAA 1ITCA 1OAXH 4Y16C 4PJIB 1LO5A 4DTGL 3PWJA 4XPGL 4NO0A 1GYAA 2EDHA 4Y19A 4M5ZL 4XVJH 5F6IC 1R3IL 5KBNC 4H88H 3Q6FB 3GSQB 2IANA 5DO2C 3QIBD 1Z6JT 1LHZA 5GGVH 1T20B 5DWUL 1CFBA 3TN0D 3SJVD 1A7PL 1MJUH 4R7DA 4YEEA 2RBLA 5ANME 5DC0A 4MDIB 2XA8H 5FYJL 3U4AA 1A9EA 3C2AH 1FC2D 1S7QB 2X4SA 4FQLL 4IS6B 3HUJF 1IGTA 4OB5H 2B20A 5CGYD 4PJDB 7CGTA 1J8HB 1DDHA 4MJ6A 1KC5H 2FHBA 3W0WD 1N3NB 2Z91B 1KFAL 4Y4KC 1I1CA 3W11D 3HFML 1CDCA 3HZKA 4EDWH 1HDMB 3T0DA 5GRUL 4JY6A 3ZKXB 4CU7A 1PFCA 1MLCB 2ZOLA 1S7WA 1T1WA 4ZS7H 3P0YL 1EO7A 2IQ9H 1A9EB 5KSAD 2DLTA 3I75B 2H32B 3HZMB 3CMOH 1ZVSB 2M26A 2VL5B 2D7PA 2VXQL 4KTDH 1L9NA 1INQA 3T4YA 4M6OL 3O6LL 1MH5A 2G60L 5IWLA 1ADQH 3VWJD 1PGRB 2BZDA 1IAMA 3QIUD 4ZFOB 3RL2B 4GS7B 3GSUA 1IGJA 1OARL 4UT9H 1Q9KB 4EN3D 2NCMA 4PJFE 4H20H 3VA2C 4XVUC 3UZQA 2ZP0T 5D1QB 2HFEB 3IFPB 4PJ9A 1TJGL 2ITCA 3O6ML 3UDWA 3V52H 1IZKA 1P1ZB 1W72A 5DJZB 4QOKD 4Y8DC 1HXYB 3IF1B 4CVZA 2W9DL 3P0VL 4G8IA 5IFAL 2NR6C 5GRZA 2EO1A 1A7NH 5IHUH 4XNZC 1QNZH 1IFHL 5A2LH 5LBSL 1KTDB 2KQMA 9CGTA 1KCSH 3S36H 3MUGB 1K5NB 4Y2DB 2RGSA 4LKCA 1CG9A 2PW2B 3MCG1 1IEAA 3CZFB 1G7JB 1LVEA 5T1LA 5BVJA 4UTBH 3B9VA 4PLKC 5I19L 3SO3C 2EYRA 4BYHA 4JVPA 3SDXB 3GSWA 1CFQA 3EZJB 1CXKA 2ICWA 2Q20A 1TVBB 3V2AR 4BK5A 3IF1A 2UVEA 4JGMA 1Y6KR 3RA7H 1CGSH 5HDQH 1R5VB 3OR7A 3RHWK 2EC8A 3R4DA 3L3JB 5K9OA 2K3TA 4XWGL 4U0RB 3OXRA 3QEQA 4RGMC 3UYRL 4Y5YA 3V6FA 3DUUA 1UVQB 1MCEA 4RFNC 2G75A 3EO9L 3MODH 4LLMB 1PJ9A 2IFGA 1YEKL 1HIML 3OJDA 4L3AA 3ULVC 2CUHA 2D31A 2APXA 5EU6B 3CLFH 3DSFL 4GRMA 1GHFL 3GJEB 4FFYL 4M4PA 1MNUH 3CH1B 3HMXH 5BW7A 3ALWA 4MJIB 5DRXB 4DGVL 1N7ML 3RVVD 1E4WH 3IDNA 3K0WA 4TVPE 5DS8B 4OZIE 4LARH 4M8VA 1MF2H 4P5MA 4E42A 3D9AH 1SMOA 3O3DA 3P4NB 3LN4B 3QJHB 2F19L 3DMMC 4DGVH 2A6IA 3B2UD 3SHSA 3JWDL 5FO8B 3L5JA 5IWLC 4UDTA 3WJLC 3BYYA 4GW1A 4LCCA 3DSFH 2APTA 3VI4F 3MV7E 1MI5D 4PTUB 5FUZL 3QDJD 5T5NG 1QFWI 3MRFB 4OZFG 1DE4A 5HHQB 3I02B 3HE6C 4WTZG 3EGSA 3VDCA 2EZ0C 1BZ7B 3CSPA 1U6AH 4GKZB 4KV5F 3IDNB 5DS8A 1RJLA 1HNFA 3QI9A 4W70A 4PJGE 1KGCE 5CFHA 5SV3A 1WIPA 3GMMB 3ECBA 4K94L 3GSNA 4IRJA 4NQVA 1QPXA 3QUXB 1MH5B 2E6JA 3HG1B 3GSXA 5FKPA 3KPPB 1IEHA 4NN6B 1YNKH 2OQJA 2NX5A 4XI5C 1PSKL 1D5BA 4B41A 3N85H 2EDTA 1WV7T 4WW2F 1QTYT 4QHNB 4KK9C 2BVQB 1RJZA 2XN9B 2VSCA 4HULB 2HVJB 3K2UL 5F7DB 2IWGA 4YDKH 3KPRB 3NACH 5BO1L 1J5OL 1F02I 5EZJB 3I6LD 3D85B 2X4NA 2FJGA 2W1NA 4RMQA 4NDMA 4GBXD 4L4TE 3ISWA 4OD3H 4BZ2H 4XVTL 4S1SL 1YYML 3MV9A 1T0MA 3IRPX 4N5EC 2YOCA 2EIZB 4JJ5A 1AGEB 4OI9A 1MCWW 3MRMA 4FQCH 2PXYD 3L1OL 2XYCA 1LP9B 2X4RB 1WWCA 3I6KB 3UJTL 5FYJE 5IK3A 2DS4A 2VR5A 2UYLB 3TBTB 4TQEH 3TCLA 5DDHB 5FCUL 4KKBC 5AUMB 4NUJA 1EZVX 2J5LC 1IC7H 4ODVL 5DGRA 1O0VA 1VFBB 2BRQA 4KGLA 5IJKC 3NCFB 4PIRF 1B2WH 3LRHA 3HR5A 5E2VH 4AQ1B 5KSBE 2Q7YA 1OARH 3CUPA 2JCCB 1S7SB 4NQSA 4QKXB 1TJHH 2L4OA 3HNVH 1JFQL 1C7TA 5CBAA 3ARGB 4XPTL 1MFDL 4P5KA 4KK6C 3EFDH 5T3XD 5HHXH 4U6TA 2VXQH 4IJ3B 1EZVY 2CK0H 2P7TA 4NQXB 2CO7B 5H35B 3HC3H 4TNVK 3FFDA 1WWWX 1MFEL 4NKIH 1RURL 5ALBH 3VA6A 3DMMA 5IB1B 2F5AH 3CD4A 4LU5L 1LWRA 4PJ5A 3ZE0E 2Q3ZA 3VXUB 1E27A 4XBGA 4NP4H 1Z5LA 2WBJD 4JGUA 4UB0L 1UXWB 1LK3H 4E0RB 2DRUA 3NCMA 3BPCA 2X4SB 4ZO9A 2XTJE 4PGBA 4LSTL 3WO4B 1DN2A 2R69H 1DDHB 3SDAC 3ZMRA 1DL7L 3BWAA 4XH2B 5DFVD 4KRLB 1EHNA 1NAMA 2YD4A 1ZTXH 2MCPL 1TZGL 1FVDA 3TYGL 4HH9A 3ZDXF 4X0KB 3GHEH 5IG7B 3C2SA 3PJSB 2VRAA 3H42H 4Y89A 2EH7H 1MCLA 3MNZA 1CF8L 5HHQA 1UM4L 2X2YA 2R2BB 4RAUA 2C3VB 2DQGH 4TTDC 5F3HA 3NIGE 3PP4L 4HIIB 1FZJB 1U8OB 4MJID 3QPXL 4TQEL 5F89B 3ROOB 2Q87A 4B50A 1RZ7H 4J2XA 4H8WH 4ODSH 4JQIH 5HVHB 2JKXA 3BH9B 4GAGH 3QQ3A 4K9EL 3L9RB 3CLEH 4KK8D 4NKMA 2WK2A 4U1HA 4ZNEA 4KGJA 4LSSH 3NVQA 1HQRB 1J1PH 3H8NA 4J3SA 2IBZY 4HXAH 4YGVB 2WIMA 5BRZA 6FABL 5JOFA 4YHZH 1CICB 1UZ6E 3L5XL 3CCHB 3BOVA 3OB8A 4LPCA 3MV9E 1RJCA 2XN9A 4U1KB 4NIKB 3I50L 5D71H 5EULV 1CD9B 2FRGP 3E2HC 1L7IL 1OD7A 5HDOA 4HZLA 2ID5A 2IGFL 1NDMB 2VDQL 3BXNB 4KJWD 1G6RL 4I3SH 5T1DH 1PG7W 3PV6A 4LEOA 3SEPA 5INDB 2M8XA 4WEBL 3CDFA 2UUDH 5ICXA 3SDXE 1BQHB 4M62H 4RGNE 4O4YL 1D7FA 2BVOA 1Q1JL 4XC3L 4S1QH 1K4DB 2YD5A 2HKHL 2ERJB 2J8UA 3B9KB 5DMKA 2QQQA 3U9UB 1BAFH 4FQXC 1ES0B 4K3DH 3PP3H 2R2EA 5E6IA 2OZ4H 2GT9A 4OM1L 3QH3A 5HGDA 1FFRA 4GMTH 2I9LA 3DARA 4XXDB 2IAMD 4JFHE 3MJ8A 3UPAA 5JW4Q 1T66D 1CIDA 2NQCA 5JHLL 3G5ZA 1CU4H 3SE3A 5KSUB 1T04B 5EU7C 5HGAB 5F96L 4ZPVB 2NZ9D 3MV8A 1ZEAL 4G6MH 2AEPH 4NFBA 3HMXL 1CFNB 4MA8L 4WTWA 4FFYH 3U1SH 2V2XA 1QKZL 2IH1A 3MLXL 4P2QE 1MIEH 3WBDA 1SJVA 4K94C 4NT6A 1ZANH 1ZGLA 5CP7B 1IKNC 1R5IB 5DJ2B 2G9HA 3KR3L 4OGXL 4W68A 4APQA 5F9OL 4C56E 3EOAB 2P42B 1I9IH 3RGVC 3KLSA 1AO7D 4NWTH 2SEBA 4U0QB 4Y4FD 1CXFA 3GO1L 4UNVA 1YN7A 5LXGH 5I1AA 2IANB 1CXEA 2KL6A 4WFHD 5EFIA 3LHPL 4LASH 5E70A 4C56D 4NQDD 1VEOA 5E5UB 3S9DB 4PRAB 2VABA 1ZOXA 3B5GA 3O3UN 4OLWH 4ZNCD 1KYOJ 2P44B 4OKDA 1AQKH 5I19H 1KENH 3V4PL 2B0SH 3E0GA 3TIEB 2BY3A 5J1TC 4GKNB 3QEHA 4RBPH 3CZJA 4MD0B 4EVNB 1RK0A 5JZ7C 1HEZA 4ISVB 3WS6C 3GDBA 1Y6NR 5IQ7L 5BXFA 1CWVA 5D5MF 1SVZA 4Q9CA 4QTHA 2EE3A 4BH7A 4FQPA 5TGBB 2VOTA 2Z35B 4HIEA 1P2CA 4Q9RH 2BNQE 1EGJL 3A6BL 1A1MA 5D7LE 4BFBD 4Y4HD 1A0QH 2ADGA 2VB5A 4WW1A 4U6XB 1IAIM 3T0EB 4XX1E 4XCFH 5T3ZE 2VXVL 2FJGB 1R3JA 5KTEL 2E7LC 3B5TA 1EHLL 5FM4A 4DGYL 3HI6L 4POUB 4RZCA 2OZ4A 3C60C 5I30H 1SM3H 1ZT7B 1KTLA 5TFSH 4A6YL 5KW9L 1WZ1H 4PJ8C 3MRMB 5DMGC 3RL2A 3TH3T 3ZE1F 3UTTA 1U3HC 2AEQL 3U6RA 4XBPA 1EVTC 3G6DL 1T2QL 1GOHA 5I1GL 4ONFL 4FP8L 5F7WC 3WHE0 5D1XD 1XGPA 1FDLL 4M6OH 3SDCA 4WHDA 1EMTH 1V7MH 4M03A 2AI0H 5JDSB 1KOAA 4FFZL 1QUNA 1RUMH 4JZOA 1ORQA 3MV7A 3SE3C 2NNAB 3U9PH 3ARED 1AD0B 5IW3A 2FO1A 3LQAL 3HR5B 3GI8H 7FABH 1ZT7A 3VWKA 1W0VB 1RZFL 4TTGA 4I3GA 5SX5K 4FXKB 2GJ6D 1QR1B 3CVHA 1GIGL 1C1EH 3MUGA 1EAPB 1U3YA 1A7QH 5B22A 3T77B 2BSSA 2DI9A 3T2PA 4R6UA 4W6YB 1BZQK 4O58H 3QUKB 1AKJA 3ZL4L 32C2A 4TNWK 3SDCB 3UBXA 3D2UA 2HT4D 2A9NH 2DQEH 3G5ZB 2VL5A 4ZODA 1RY7B 4JB9H 3LSOA 1J11A 3LZFH 3ZT7A 1DBBL 5GIRB 4F33A 1GVIA 5FYLE 1A4JB 4E0RA 2Q8BH 4L8BB 1IGIL 4HGMA 4N0FB 3O9WB 1QSFE 3G08A 4PJ7F 1WFTA 3OB0H 4Z7VB 4ZO8A 2DYPB 4CKVX 1FNEA 3QFDB 8FABA 2VUYA 4PRIA 2XNAA 1RU9H 1V05A 4G9FD 3IXTB 2BVPB 5HHMD 5DJDA 1AQDA 4QHLB 2ZWLT 4LSVL 1Z2KA 1EA9C 3FT4A 4YK4B 1U8NB 4R96B 2EKSA 3MGOB 1P7QA 4FQIH 5DMYA 1F58H 3SJVA 4LSDA 2OL3L 1CDGA 2C3VA 4Q6IB 3VMPA 3UJIL 4WTXA 5ICZA 3VFTB 1N5YH 3MREB 3NPZB 1UWXK 4KVNH 5I71B 5KTEH 1QR4A 1Z9OA 1T1YA 2BSED 1T21A 4UDTB 1JUFA 2P8PA 3SKJL 5DFWH 3U0PA 2D9QB 2H2PC 4YC2C 1BP3B 2P47B 4HWZB 4NOFA 4GMSL 5L88H 2HLFD 2RR3A 5T1KB 2AEIT 1AGDA 2VNCA 1K3ZA 4DKAA 1IC1A 3WFCL 2YR3A 4CADB 5JR1H 1PY4A 5CINH 3L3IA 5IMLB 1CICA 2AK1L 4W6XB 3ZDZE 2P46B 3U9PL 3WN5A 2XXMB 2BJML 2VYRE 1PG7L 1S7QA 4FFZH 4RFNB 4AEEA 1GPOH 3QWOB 5E2UH 1EMTL 3UO1H 1A6AA 4KZDL 3NFSL 3JWNC 4Y4FB 5CILL 4DW2H 2HVKB 4U4BA 2XWJB 4OLWL 2CJUL 3IS1X 4HWZA 5FIEA 4YBLC 3E6FB 4LEXL 4DN4L 4DKFH 4HMDA 2Y06L 4A6YH 1L0XA 1CFTB 2Y23A 5ICYA 5HD8D 1G9NC 3GO1H 1U8IB 5LGHL 3D18A 4NWTL 1PD6A 4V2BA 3UBXI 1XGYL 4GO6B 3QJFB 3EW3B 3BZFB 5J1AA 2FJHB 4ZSOA 1AGCB 1TZIA 4P46D 4YO0B 1YQVL 3Q3GA 3SPVA 1AE6L 4FG6C 1S5HA 3WIIH 5I9QB 5C8JA 3GEWB 1D5ZA 1WEJH 3VXSD 4AT6B 4R90L 2PYEA 4YHIA 4P9HL 2DQJH 4XCNB 4H26B 4GW1B 5IK3B 4JFPA 3FB6A 4PYHA 1JHKH 5K59F 2AEPL 4JDZB 1LP9A 2X4RA 5L0QC 4JDVB 3KPQA 2OR8A 4X7SH 1RIVH 4NSKB 4JFXA 4XAWL 4GAJL 5D7JC 5K9QG 4GRLD 1LE5B 2R2HB 2XKNB 1NPUA 2WINB 2BOCA 4D9LL 2H41A 1DQMH 3MV8B 5K59E 1JNHB 1AGCA 5BV7L 4QRPE 3MC0A 1H5BA 3OZ9H 4OFPA 4RQQA 3BSZL 4PJBB 4JY4A 3I85A 4PJAB 3T65A 4YNYA 3LEXB 4FZEL 4GSDH 5GSVB 4NQUA 3KYOA 3QDGB 2E7BA 4XTRC 5ITBH 1UM5L 2DQIL 3P40A 2OCFD 1KIQA 1QLEH 3T0WA 4N8VA 5J8OA 2PUQT 3QFDA 5CUSL 1F3DH 1PKQA 2DAVA 4WW2C 4OV5A 4F3FA 2F8VA 1EXUB 1DQJA 5DQJB 1ULVA 4Z95H 4ZAKA 5DSCB 1WZLA 2E9IA 1EERB 1V3JA 2JJVA 4QF1A 3O81A 4WEBH 5SX4I 2RCSH 3G04B 4EUPA 5D2NC 5C07B 3QNZB 1DLHA 3CK0L 3VFVB 4JAMA 4NM8L 3HC4H 1AE6H 4GG6E 2H3NB 5KJRH 4U2ZA 2Y6SC 1G6VK 1KLUB 1NANI 5F96H 1XMWA 3EDDA 2VIRA 3VCLA 2P5WA 4XH2A 4OAWB 5C1MB 4PBXA 3F7PC 4AENA 1YY9D 4P23C 1UWEH 4YDLC 2X7LB 3MLRH 3PDGA 5MI0B 3UROR 3PWLB 4TNVF 5LGHH 1X44A 5DVKA 3MR9B 1KPRA 2A83B 3Q6GL 3BDYH 4L4VE 2OP4L 4HH9B 1X5XA 3LIZH 5C0CB 4WV1A 5E2WL 4E41D 1MQ8A 3P2TA 4DN3L 1NBVL 5CILH 2XWTA 4R8WH 4B53A 2VLMD 3TZVC 4P5MB 1U42A 4PGZA 3VFPA 3GJFH 1ROWA 4DAGH 3X13B 4XB7A 5DJ6A 3CFDA 5DC4B 4Z7UF 2HG5B 1F4WH 3C6LB 3U0TA 4D0DA 3JZ7A 3UZVB 1AJ7H 4K3HA 3WFCH 3DMMB 5IB1A 5JNYA 4RFEB 3E6FA 1A6UL 2FX8H 1MFBH 2PF6A 1BQLL 1PBYA 4U1MB 1BF8A 1HKFA 4B5EA 5I76A 4KC3B 2IG2L 1KCVL 3QEGL 5JIPA 2Q8AL 5IOPB 3V79C 3FJTA 5C0FA 3UTZB 5I66B 4HXAL 3CFDB 4AG4H 4OCRL 1J1PL 2DI8A 1EVUA 5HYSG 1DBAL 3JV4A 4PBWD 1NFDB 3QB7C 1XF4A 1JTOA 2Y07L 4Y1AD 1F2XK 4X8XA 1FO0B 5IVZB 3O6FB 5F9DC 3CX5J 1OSPL 4LU5H 4H8WL 4ODSL 1KN2H 4GKSB 2K9UA 3VD5A 5CEYA 3VXRB 1B88A 5MEND 5IB2B 1I1AD 1SEBA 3EFDL 2B5IC 1NUDA 2JJWA 1UM4H 1GJIA 3X3GH 4F33B 3C6LD 5FGBC 3MLVH 3ZTNL 1QSFB 3VGFA 4MB5A 1I7TA 1MCHA 2OQJB 5L2KD 4PJIF 1T0PB 1QLFA 5SWZD 4IOFD 2BC4A 4PJ9C 4M1CD 3OAZH 3MRRB 2Z93A 4OI8A 4HUXB 3ZO0A 4HHAA 4OZHE 2WW8A 2EDBA 2HVJA 4Y2DC 2DQEL 1V3LA 3DX8A 3KPMB 1XH3B 4GRWB 2AS5M 1LD9A 4WDIB 1BVKA 4F58L 1OPGH 4XNZB 3VXUE 5E8DH 2G5BA 2X41A 4P23A 4ODTH 4PJFF 1O7VA 5M94B 3UX9B 4XCCL 3HUJE 1YEDA 5GRVK 1MUJA 4OZIA 1C1EL 3ULUE 3SJVB 5HYQA 2JIXB 3VXUD 1UH2A 3WXWH 4JPKL 5CZXD 5I74B 3ARQA 1A14L 1KGCD 3LQAH 7FABL 3O2DA 3DVNA 4D9RE 1FJ1B 4WFED 1RUML 3SDDD 1Q9WB 1NC4D 4FHBD 2IEPA 2AI0L 4F7EB 4DZ8A 2IPKB 4PLJD 1JYVA 5CBEA 3K46A 1ZA3B 1YN6B 4M8QB 3OKLB 1VB9A 5T5FL 3I3BA 4L8DA 5H37H 5ESVA 1I3VA 3HNVL 4CVXB 4FP8H 4ONFH 2XWBA 4IRZH 2BOBA 2FEEI 5AEAA 2FH6A 4JFOB 3QZWB 5IV2A 3B2VH 2ZUQB 2W60A 1A6TA 3EYFB 1X5KA 2P48B 2YA1A 4L8CB 1JNLH 4YFEA 1FG9C 1JPST 1WBZB 3LD8C 4XXCC 1FBIH 4LRIA 4YDJA 3BX7C 5MEOB 2VXSL 5C08A 4LLQB 1I3GH 4G7VH 4L9DA 4F9PC 3O0RH 5F7YC 2EDEA 3IJSB 3KJ4B 4BZ2L 4ODUB 3D18B 4PRNA 1NBZA 4P0DA 4P4KC 3NACL 2BHUA 3IJHA 2XT1B 2XRAL 4P9HC 2VWEC 4QXGH 1R3JB 2FCBA 1NAMB 3CFCL 5H94A 4N0CD 1HKLL 2C1OA 1A8JH 4X6DF 3FB7A 3V5HA 1WZMA 2BVEA 3P11H 4HUKB 4MA7H 2LTQC 4LLQA 4MJ5B 2ILLA 3K4ZA 1KTKE 1RMFH 2EC9U 1XR9B 3KPQB 4HKJA 4OLVH 1I9IL 3B3IB 4HIIA 3THML 1YMHB 2GAZA 4IRJC 5E6YA 4OGXH 3T08A 5BS0E 5ILTL 4DCQB 1F6FB 4NZDA 3UTSD 5AZEL 3N1QC 4MSWB 4Z7UB 1ZWIA 1TVDA 3TIEA 2C5DC 2DLIA 1T22B 3L5WB 4PS4H 3VWKB 5FFLA 4JY5L 1NGZA 3PGCA 3HRZA 2A38A 3WLWC 3GIZL 2ED7A 3QEQB 4PJEE 3SGJA 3MLZH 4GXUM 4WWKC 2BC4B 3SKMB 2YPLA 3LRSB 2HT2D 1RULH 1FC1A 1P7KA 1EPFA 3OKYA 4LARL 1HCVA 4U3CA 1JRHL 1KJVB 5CGTA 3SO3B 4OLEA 3RU8L 5IB3A 3BP6B 4EUPH 3B9KA 5DMKB 3KLHD 1B0WA 4HKBA 2NTFB 4F57L 3LPGA 1HH9B 2R9HC 5T3XE 2C7UA 1QYGL 1JF6A 5TF1H 3W2DH 3PWVB 1TCRA 2GCYB 2PXYB 4KJQC 1YEKH 1D5BB 1KTDA 2HKHH 3C87A 4YE4H 4K7PH 3BPOC 3ULUD 5KAQG 1J18A 3B6SB 4XPAH 4APQD 3P30L 4UZGA 4HFWA 3UJJL 3KPSA 3DTXA 4FABH 3SDXF 1H15A 2ZUUA 2EKSB 1AGBB 1U91B 3MGOA 4PB0H 5F7MC 5GS0C 3QSKB 2HJLA 4PRPD 2X9XA 3TGXA 4UV4H 5KSBF 2CXGA 4Z7NE 4D2NA 3RA7L 4HK0A 5EU5B 1DEDA 5TE7H 3W0WE 1MFAL 4LLUB 4OFIA 3MRGB 4GG6B 3KPNA 1QBLH 3R06B 3IAQA 3LQAC 2N56A 2R0WL 3K8KA 5F88B 4LIQH 4QRRD 3WHE1 1W8OA 1ZT1B 4NO0B 2C3GA 3V6FB 1L4IA 4IRJB 1ONQA 4XVSH 4OGAD 4YQXL 1P84K 2VQTA 3SKUD 1KB5H 1Z3GH 3JUZA 2PYFA 3LV3B 2PTUA 3GHBL 1AH1A 1XZ0B 3L3IB 4TULH 2FDBP 3DIFA 1G7HA 4F7MB 3EJYD 1WVZA 4GRWH 1RZ7L 1EGJA 1KC5L 1HI6B 2AV7A 3O6MH 3R8QA 4NC2B 1FNEB 8FABB 2WSKA 3BGAA 2ICES 4J23A 3BMVA 3CPLB 5KN5A 1JMXA 3O3DB 3VFOB 3FQRA 3RZCB 3F7YB 4U1NA 3KHQA 1YYLH 1G9MH 3DIFB 4HX1B 5DEZA 3UTTD 3FFCE 1MHCB 1BEYL 1NSNL 4IM8A 5DZOA 3VJ6B 1XR8B 5I8KL 5HHVH 3RWGA 5IW1A 2V2WB 2DQTL 5EU3A 4QT5A 4G6KL 2Y7QB 5EOCJ 5HYSB 5DA0B 2Q76B 3V5KA 4PJEA 1KN2L 4G3YH 3AREA 3GSUB 1E6JH 4P2OC 5CWSA 3MLPA 3K8MA 4U1IB 1H3XA 4TVPD 3BRDA 3ARXA 3H9SD 3OB0K 5GRJL 4X0KA 4Z78A 3PDDA 3PJSA 1NCCH 3QFJB 5D1ZC 5D1XB 2LQRA 4FFVD 4ZTPH 3E6HA 4MQ7A 1X3DA 1P4BL 5E7FA 1XR8A 4XPBL 1AP2B 2Z8SA 4PJGF 2GSGB 2FIRT 3MRNA 1GZQA 5TE4L 4CMMB 1B0GB 2HMID 1H5BB 3GSWB 3SKOA 3RDTC 1QHOA 2EIBA 5JQ6L 3P9WB 3GNMH 4JPVL 5FV2A 3TV3H 5KS9A 4FTVD 5BVPL 1FFNA 1T6WA 3CVHB 2OTWA 4M00A 4L9LA 3V0VB 4S2SA 3MRHA 1IM9D 5AZ2H 3ZKSD 1LDPH 5BRZB 5JOFB 5E2JA 4XPGH 3VE0A 5JDSA 2B5IB 1XGRA 4ZO6A 4IOIB 1GZQB 4CMMA 3QHZH 3PWNB 2AXHA 1LO0L 3TT1H 3VD7A 5I1DA 2HFGH 2CSPA 3NCJL 5E5MA 3TP4A 1YEFL 4ZSOB 3VRIA 1QLRB 5E08L 4FQJL 2BSRA 4NN7C 2XIDA 2LU3A 3LIZL 4OD3L 1FPTL 4J6RH 4YQXH 4TVPH 4KTEL 3MBEB 4OFKA 2OL3A 3DX9B 3MRIB 3UTSB 4OZGE 2FWOB 2BVPA 3FO0H 3A6CH 3O8XD 1ZE3C 4PV8B 3JUYA 2NLJB 3KXFE 3W0WB 1RZJH 3BUYA 5KJRL 2P8MB 2VR9A 4XNMB 3FN9A 4JO3L 3BD3A 1U92B 1OQXA 4JVUA 4R4BA 4PJHB 1NL0L 4HWEL 1A22B 4QWWD 5GS0L 2ARJA 3LPWA 4JZJB 2D7QA 3BPLC 3WFEH 3JWDC 4XPHL 3P30H 5E9DB 4LHJB 5EZLA 3RUGF 1SBSH 3N1FC 5ILTH 1AXIB 2FWOA 4R4FL 1I9RH 4M7KH 2IJ0C 1S9YB 4R2GB 4ALAL 4F3FB 5ITBL 4UQ3A 2EDDA 4KMTL 3HMWL 5C0AD 3RIAF 1UA6H 4QO1A 4NCC1 1JWUA 4JO4H 5DR5H 3STZB 3NIFE 2D7NA 2V7NB 3QYCA 1MLBB 4JVWA 4P2OA 1FQ9C 4UINH 4AEHH 5HVFB 5KSVB 2DL2A 1BIHA 1LEGA 3DROA 5DJYB 3RQ3A 5F3BB 2F19H 1OAUH 1A7RH 3TBWA 2UV3A 4AIZA 4I2XB 4NOBA 4JFZH 5IOPA 4GAJH 1N7MH 3P4OA 4LRNL 2HH0H 3GJFA 4P46A 3KGRA 1AHWA 2VKWA 4TUJB 4PJEB 5DUBA 4FA8A 1GHFH 2DQJL 1IM3A 4P4RB 2NX5B 3B9EA 4AL8H 3VW3H 4ZUVA 4OD1L 5IVZA 4NN7B 1B4RA 4U6HB 2FL5B 3PXJA 2E7LA 4PP1D 1NMAH 3A0OA 4YGVA 3EO9H 3D39A 3MODL 3EOBA 3GUTA 2VJXA 4HDIA 2HTLC 3PGDA 5DA4A 2UVFA 3RY5A 2H8PB 2COQA 4OLVL 4BQ8A 1G0YR 1HEZB 1T7ZA 2O61A 3O3AB 1Y6MR 2VLJB 5EC1B 2YD8A 5EBLA 5HDQL 4EI5A 4N1CA 3SDCC 2A2QT 2X44D 4PR5A 4ELKB 4H26A 3I84A 3DO3A 2VN4A 5D1QA 1MHHB 4Z7WE 4D8PB 1TQCB 3FOMA 3UO1L 1MHPL 2IPUK 3BZDA 1HILB 1VFBA 1X6LA 2NY0B 4FQHA 4WU5A 4PGCA 1JYNA 5ITFA 1HXYA 4CVZB 3ZYZA 4RMVA 4JPKH 2EDLA 1JZ4A 5EBLB 1KEGH 3FT2A 2VXSH 4NQCB 3P0VH 4TSBL 5CBAB 3L6FB 2QR0A 4ZOBA 3SY0A 4ODTL 2V9TA 1JTTA 4POZC 2NY5L 1SVCP 2R2HA 3TO2B 4S10A 2Z92A 3V52L 1FVEA 4KVNL 4PB9L 1PKQB 1A21A 4WEMB 4JHWL 1DANU 3EDJA 5A3ID 4PJ5B 1DBML 3W39B 4WCYL 4K3JH 3OKNA 5SV4A 4CW1A 4P3WA 5FA4B 1EO8L 3LEXA 4Y16D 1BX2A 1BJ1H 5C09B 3VFUB 4RGND 5IQ9A 3KXFB 5IW6B 2EYTA 1T1ZA 1GC1L 4ODHH 2X9YA 1DLFL 2BXZA 4ORZC 4PJBF 4LKXA 3QUYD 3MRLB 4NRZA 1T3FA 3KYMB 4OCSL 1I8KB 5ID0B 1G7MA 3OJDB 4FTVB 2F8XC 5GRUH 3OKOB 4HPYH 4P23B 4TPRH 1HSAA 1MAML 3BE1L 5DTFB 3V6OE 3OXSA 3RY6C 1KFAH 1R24A 5A40E 1AO7E 3HPLA 1DBKH 1T0NA 1NBZB 2YKLH 3G08B 5E8DL 1INDH 4Z8FL 4PJ7B 4DOHB 4M7LT 4MNGA 1P6FA 5F7NC 4KUCD 4D0BA 1OSZA 1Z9SA 4NZUL 4OGYH 3NZ8A 4HCRH 5DD6A 1FG2B 5FYJH 3V5HB 3U46A 2A6JA 4HLZG 3LY6A 5GS2H 1AR1D 3CXHJ 1MJUL 2X89D 5F1OB 1KCRH 5FUOH 3WN5C 1BECA 3KAAA 2BOBB 4Y1AA 2OYPA 5L6YH 1NDGB 1BHGA 1CLZL 3B3IA 2MPAL 2XG4A 2VDNH 3H3BC 4H88L 1IQDB 3RAJL 2DD8H 1J0KA 1KELL 1JMZA 4DCQA 4AEIH 2AV1A 5E8EA 3HZYB 4NO0D 3GSRA 4XP9H 4BA8A 4Z77B 3DO7B 1J8HA 2DN7A 1I1AA 1QFHA 4S11A 5DF0A 1A4JA 2VITA 1DSFL 2CDEA 2VKXA 4MAYA 4EN3C 4NQVB 1ZLWH 4LGPB 1J88A 3OG4B 4HS8L 4R2GD 1WCBA 4F9LA 4YHPA 1K2DB 1Y0LB 3TN0A 4O00A 5ESAB 4GW4A 5KW9H 3SGKC 3MOQA 1ZS8A 2KKQA 5HGDB 4JRXB 1LQSR 2ZNXA 3Q6GH 4FZ8H 2PO6A 1SM3L 3KPTA 4XC1H 3F12A 1FGNH 3NZHL 1UWEL 3GIVB 4F2MB 5C6TL 2HN7B 5I8OL 3BP6A 3MCLH 2NR6D 4UI2A 5T33H 3RHWF 1JGVH 3RWIA 1WBXA 3WFHB 4G9DB 4UT6H 3RWEB 3STBA 1T4KA 1U8HB 3QDJB 2V5YA 3FL7A 4LDEB 1QBML 1NC2A 4PUBH 3O6FA 1X4ZA 4YHPB 5EUKB 5ESAA 2YRPA 1TCRB 1M7DA 2GCYA 4CN4A 3OJMB 4Z95L 5E8PB 2YC1B 4PRDB 1C5DA 3QUZB 5DT1H 3KS0H 5IB2A 4UQ2B 3O2DL 1H5BC 1UGNA 1MRFH 3BUYB 2OK0L 5I1JL 1QLEL 2IPTL 1BFOA 5FYKD 1OLZA 2J4WH 1Q0XH 5C0IA 5BS0D 2V2XB 1F8TH 4WUUA 2I07A 4IOSD 5E2WH 4M1GL 1EHXA 1MJ8L 5MEPA 1S78D 1J0JA 1D6EA 4EIZC 3T2NH 1G9NH 1HHJA 4HIHB 4MHHI 2P7TB 3ULVD 3FO9B 3NABL 1DEEB 1PVHA 4Q6IC 4XMPL 3A67H 4QOKA 4E9LA 4HQQH 3RWFA 4MD5B 2VN7A 4NM8H 4K8RD 3RWDA 1YNLH 3P4LA 2YPKA 3OG6B 5IMMB 1Q38A 1KV3A 4AMKL 5ICYB 5FKAA 1CE6B 3RVVC 4YDLB 5JLZB 2W60B 1ZK9A 5IHBA 1XF3A 3VDAA 4Z7OF 5DRZA 3A67L 2FJHA 4D0CB 3P4OB 1N59B 3S8WA 5IVXF 3AMKA 3S37X 5ISZE 2BDNH 3VFWA 3ZDYE 1OTTC 3VWJA 5B3NA 4GMTL 1JPGB 5IJVB 3HAEH 3MUHL 2VAAB 2M1KA 3T2NL 5TGBA 4TYUA 1H0DA 4DKFL 4DN4H 5IB4A 3PL6A 2X6MA 5HJ3B 2O5YL 1T5WA 3N1GC 1Q0YH 5T3XL 3BP5A 5CSZA 2NXYB 4JFXB 5BV7H 4HK3N 4M7KL 2IH3B 4MJ6B 1OY3B 1FVCB 1XAUA 2JCCE 2PO6C 4LVHC 1VGKB 1EX0A 1RIVL 2YUZA 2E5EA 4C4KO 3TIDA 1UXSA 4JZOB 1NCDL 2O61B 3V5KB 4C59B 5CCKH 5GS0H 5IFHH 1GZPB 3VGAB 3BD4A 1B4JL 1CZ8L 5F1IB 4P9HH 5C0BE 4RMSA 3VXOA 4OF0A 1XEDA 5GJSL 1C08A 1H3PL 5HYIA 2XZCH 5T3ZD 3FOLB 3O2VH 3V7MA 3ULVL 4ZOCA 3O6FC 5DJCB 5C0ND 1RZJL 1A6PA 4LDOB 4HEPG 4LSQH 3EYSH 3MCLL 3ARUA 4OV5B 1EIBA 5CEXA 5KVDL 2D9CA 3GIVA 4Z7UA 3DBXB 4OBRA 4MXQC 3QDME 2E3VA 2E9BA 4MZ2A 5LKNA 3VXMD 1IBGL 5EBMA 4KVCL 4M6AA 2O26U 3MOBH 5CKAA 4KROD 1IGFH 5I6XC 2OMNA 3MOAH 1DVFB 3QEQD 4P2RD 3Q1SH 1UWXH 1P84J 3TT1L 4H25A 1XF2B 3QXVA 5F93C 4LPUA 4Z76A 5L2KE 5IROC 5FGBA 3ARTA 1RJYA 3GMQA 3QI9D 1NLDH 2I60H 4IOIA 4NSKA 4Z7VE 3OKNB 4KHTL 2BP3A 2X4NB 3S97C 3UTZA 5BJTA 2MPAH 1VFUA 3SE9L 3H42L 2MCG1 5BVPH 4QHMA 5JIHA 2H1PH 2FGZA 1K5NA 4Y2DA 1H8OA 4WFFD 1ZTXL 4UV7H 3JXAA 3F8UB 4FQ1L 3D0VB 4ELMF 4ZTOH 3U2SB 4QRRA 1T89C 1BFSA 3D0LB 3CH8A 5C07E 2GUOA 3PABB 5HGAA 1D9KD 1OVZA 4O58L 1FYTE 3ZL4H 4ZUSA 4YPJA 3GFUA 3NTCH 1KIRA 3S5LG 3SGEH 4GBXA 5DSCA 5DQJA 4DUVA 3LMJL 4PRPB 1LK3L 4X7TA 5E00A 3OGCB 4TRPL 2QSQA 1C5BH 5FYJD 4M3JA 5JPNA 2DJSA 4DOHE 3DVGB 3E8UH 2PXYA 1CVRA 1Y18B 4MDJB 2IBGA 2WWKT 4LSVH 1KJMB 1T7YA 1PDKA 3N1PC 3R06A 4V1DE 5F7LB 1OTSC 4ENED 2XACC 3S4SB 1EO5A 4PJAF 4JZNA 5KG9B 4G5ZH 5D5MA 1TETL 4JEGB 3O11B 2HAZA 3MLUH 1FDLH 5FECB 2R0ZH 5I8KH 1F5WA 2LVEA 4IMLB 2HFTA 1I9JL 5DJZA 1NFDA 4ZOAA 1S7VA 4I0PB 4I77H 4LLVB 1G9ML 1XZ0A 1AGFB 4WJ5B 4CADA 3AS2A 2AEWA 3KPLA 1EEUA 5DRXA 5I73C 2YRZA 2CLVA 1EFXD 4X7DC 2NW2A 1QBAA 1FIGH 1ZT1A 4XMKL 1M7IB 3O4OC 4MD0A 3BMWA 1HWHB 4KDVA 4KK8C 5AD0A 2NY6D 3VRLE 2V5MA 5E99H 1AI1H 4PLNC 5C70A 3LKRB 3BPNC 1I9EA 5FA3B 1CL7H 1VPOH 3CC5B 1P2CB 3GMPB 1HHGB 1MOEA 3U0TB 4D0DB 1INEH 4JFYA 1J86A 4XVTH 1Q72H 1QHPA 3RX8A 4NC0B 3FOLA 3I3EA 3BWUC 3ZE0F 3G9AB 1KBGH 3RWGB 4PGEA 1UKTA 3OF6D 2ADFH 4RRPG 2X4TB 2IBBA 4BUGA 5EG6C 4LIQL 2VZOA 2P24A 3VI3E 3VD9A 1U58A 1MFAH 3AREB 4OLZH 3LKRA 3RKPA 4EI5B 5J11C 5JW4M 3MPCA 2YUXA 1XF5B 4NQDB 1QSEA 4UU9B 1YPZA 1X5GA 3VGHA 5T1MB 2ESVB 1XF4B 1FO0A 2BNRB 5IVOA 5CKGA 3MGTA 4MJIA 3C9NB 1KPUA 4FQXD 4KH2A 1K6QL 5I8CB 3R1GH 4PGCB 4D9QD 3W2DL 3DX7B 2BMKA 1M05A 1JWMB 1QFWM 4NBXB 4EUPB 4NWUH 5DD3L 4POYA 4O2FA 4Z78B 4LLDA 5EC2A 2E6PA 2AJXL 4U3XA 3U79A 4DUWA 2BSSB 5HGGS 1JNJA 2QR0B 5BRZD 1DE4B 1JRHH 2R1WB 1U9KA 5C0EB 5CJQL 2NW3B 4FOMA 5ENWA 1B0GA 3V4PH 5EUOA 3NPSB 4HHAB 4YBQD 4CVWA 2WUBL 3U30C 4MAUH 2ICWJ 4MZ3A 2GTZA 5D72H 4N0UA 3QI9B 1MY7A 3T0XA 5E5MB 3TBYB 3LCYA 3G04A 5E7BA 1CYGA 1MNUL 3T0AA 3O4LD 3F5WA 3U7WH 1S9VA 2F74A 25C8L 3EYVA 4P2RB 2DM4A 1KULA 2VL4A 5D2NB 3OJ2C 3LEVL 2F53A 2AJVH 2GTWA 3IJYA 5AZEH 1I9RL 1NFDE 3OGOE 5FOJA 3O4OB 1SBSL 4MQXD 5FUCE 3U4BH 2PYEE 1G7MB 3V8CA 3MR9A 5KZCB 3IFNH 1BQUA 4XBGB 2FZ3A 3I3DA 4QY8B 5HYJE 2R56L 3S34L 1X5AA 4WHTB 1RZGA 1MCOL 4HBCL 3K80A 5HHNA 2IALA 4GRWF 1ZXQA 1PQZB 2ZSWB 5E6ID 4ZO7A 4DZBA 2ZZUT 1E28B 4MA8H 2BXYA 3DVIA 3DWTA 2KBGA 4C55A 5D72L 5K9JH 3WNOA 4WGVB 1LE9A 2PN5A 5JZ7D 2XN9D 4J3XA 4TOYH 3UC0L 2LAAA 4UTBL 1FO0L 4HLJA 1P5VA 4LSUH 4AH2A 5FDWA 3D25A 4MCZA 1UZ6F 3L5XH 3N1MC 5F97E 3TZVB 4KTEH 2PW1A 1FZKB 1HXMA 4LSPH 1KCSL 3BYTA 4G8EB 1OTUC 4GLRH 4Y4HC 4Y88A 2ICEA 2FLRT 5EFIB 5IHUL 5GQBA 5E08H 1PKOA 1KCKA 2CRYA 4ONGL 2W9DH 5TH2A 2HFGL 3BQUA 3DROB 4S1QL 1LO0H 5IIEA 4HGWB 5C7XL 3ROOA 4L5FL 2H32A 2YPVH 3QHFL 5E9DD 4XNXL 4JO1L 5IBLD 2KZWA 5ACMA 3MBXH 4PJ8D 4LDLB 1AO7A 1RZ8A 3RNKB 43CAB 3H6JA 4NKOB 4HPOL 1JWUB 3DYOA 5SWSB 3WE6B 1T5XB 4P9ML 4NQDA 5D7IF 3GNML 1FYTD 5KOMC 5JXED 4LSRH 1NEZG 4QRTB 3MMEA 3MUJA 1EFXB 1E6OH 1XR9A 3FT3B 4HKJB 1BBDL 4XHJC 5FYLD 3V6OC 5D7KE 5DHVA 3IU4L 4IIQC 3CMOL 4KXZH 1MREH 3FFCD 1UENA 3MV8D 1W72B 2CK2A 5GGUB 4XNUL 1BLNB 2Q3AA 3L7FB 2XKUA 4JR9H 1A64A 3MLSL 4LSSL 1NLBL 4UB0H 4LCWE 4WNQB 3LRGA 4GG6F 3OAUL 5EORH 3CLEL 1ZSDA 2CDFA 4NHCL 3PGCB 1AI1L 5F88A 4P3CL 4CRPA 3CDCA 4QHNA 3QG6A 2X09A 4NO2B 4Y5VC 2CDGA 3HC3L 2PW2A 4G42B 3VFSA 3QZWG 1LEIB 1LE5A 2V2WA 1OF2B 2ZCHL 3GSOB 3TH2T 3JTSA 2H32H 2Q76A 1YUHA 4WTZA 3RVXD 2A9ML 5C09E 2WWKO 1CT8A 5IHLB 3L3OB 2FSEB 5J3HC 5E2VL 1DR9A 3G6AB 4MYWB 4D9QE 2OS7A 3UPRB 3LKNB 5D1XA 4XVJL 3IDXL 3PWVA 2NY4C 3O11A 5AUMA 1FNGB 3D87B 3T0ED 3VFSB 1KT2A 4ODWA 4U1NB 1PG7X 2J3SA 2JCCF 3S3PA 3NA9H 1EXUA 2AJYH 3SKOB 3DGGA 3BZEB 1I7ZA 3KPLB 4ZFZA 3WL9A 4HGKC 1WTLA 1ZLWK 4NJAH 4LLWA 3IJSA 1J1XH 5GSRA 3OL2A 4YHYB 5IW1B 1NC2B 1BVZA 1CTNA 2H2SD 2IQAA 3QXDB 1A2YB 1KLUA 3BQUC 5D6DA 3HNTL 1CXHA 3NFNA 1JK8B 3KPRE 1L0QA 5C2BH 3KNBA 1OP3H 3NCCB 1D3CA 3QIWA 4Q2ZA 3CFKA 1X5FA 1K4DA 3WCYA 2EE9A 5ADPH 4P9MH 1G7LA 3RZCC 2H1PL 3OKOA 1MEXH 2R23B 3FHAA 4H1LG 2VAJA 5GPRA 1RIUL 4NZRL 1NANH 4ZD3H 5F9WC 3ZKQD 1T5WB 3MJ9H 4KHTH 3I6GA 5B3JF 3SCMC 1ZMYA 3RTQC 4YH6A 4PRID 2V9RA 4WFHE 5I1IH 5GGSB 4Q74A 1QACA 5IMKA 4JQXA 1CN4A 3TJHC 4MS8C 1I85C 1L6XA 3BGFC 4R8WL 1RPQA 2C1OB 1MFNA 4FQCL 4RMRA 4Z7WA 1IC5L 2NY3D 4OZ4A 5BQ7B 4UU9A 5EO0A 5F1SA 5CJXA 1OGAD 5I18H 1N2RB 1BQHG 4HIXH 5DURD 1G7PB 4KVCH 3AGVA 2YEZB 3RWJB 1MCFA 1K8IA 1OL0A 5JNYB 2OP4H 3QRGH 1T5XA 5DD5L 2LTQB 4TUKH 5TE6H 5HHMB 5BO1H 4LSUL 4X8JB 1AHWC 4OD2A 4G9FB 1DANT 4FG6D 5GGTA 1E4WL 4KRPD 4QGYA 3U9UA 5EIIA 3N85L 1WQVT 3IRZA 4ZUUA 2FNBA 3VWJB 1GL4B 1UACH 4YUEH 5J4MA 3UBXG 1FL6B 4Z0XB 3QCVH 1B4JH 4ZDHA 2GSIB 5DD1L 4LCUA 1UKSA 5KSBA 4RNRA 2DQFB 1SEBB 3TCLB 2VZ1A 2W92A 5FM5M 5JPMA 1XIWC 4M5YH 4JFQB 1URLA 3GRWA 4KMQA 4U3HA 4ETQB 3LB6C 1YJDL 1GGUA 5TDNA 3EYVB 2QQLL 4KJPD 2I5YH 4MNHA 4GW5A 3ZDZF 3QA3B 4ONHA 3SE4A 3U7WL 1JPSL 3T0BA 3BW9B 3IDIA 1UQSA 1IGYB 2HRLA 4X5XA 1S7XA 3VGBA 2Z31D 4NPYB 5LQBH 1IGMH 3MRHB 4MHHG 4ZUSB 5BOPA 3VXPA 3BEWA 3MCKA 1MHEA 4H5SB 4CN1A 5D6DC 1J12A 2EYSB 1YEDB 1MCRA 1KYOK 1IMHC 1NCNA 4K71B 2AJXH 3BDXA 2V7NA 1ES0A 4N0RA 4BM7A 1SJEA 2PYED 1A7NL 3WIIL 5BV7C 2QQNH 2ZUQC 4HQQL 2BVTA 1H9VA 3MXVH 5EA0H 3WSQL 2Y5TB 2AW2A 2DIJA 4JKPL 5JUEL 4GRLA 4JN1H 4QEGA 3ES6A 2ITDB 5CBEB 4JM2B 4KMLB 1S7VB 4I0PA 4YWGH 4FQXB 5KN5B 4FXGB 4DVBB 5KANI 1TVHB 4TSAL 4KY1H 2MHAB 4KUCF 4WU5B 2ICWB 1MJ8H 3QZWA 1QSZA 3HI1A 3MO1B 4HJGB 5IV2B 3EFFB 1KTRL 1MCDA 1CDYA 1R3KA 2ADJA 2IAMB 2CJUH 4L8CA 4TN9A 1EAPA 5DUMH 1BWWA 1HI6A 5C0DB 1N0LA 1M7IA 4C4KT 2Z91A 4GXVL 3QQ9C 4X6DA 3O2WL 3KPOA 5I8EA 4ZNEE 5CIPB 4N8CL 1IGCH 2FLBT 1ZAGA 3G6JB 3AS3A 1JPTH 3DETD 1MJJA 4DK6A 2Y36H 4A2MA 1S9XB 2VXUH 3BN9D 4KJYB 3MSPA 1JPGA 4MJ4A 4F8QA 3VXSA 1MLCA 5ALCH 4UT7L 3LSOB 5IMLA 5SWZB 4NKMB 1ED3B 3HZKB 3INUL 3GMPA 5DK2B 3E3QE 2CKBA 4K07A 5FA4A 1RJZB 4PJHF 1TENA 3QFJA 3HZVA 3LS5H 5FB8B 4TUOB 5I1LA 5DRZB 4P2OB 2WANA 5IEKA 4I4WA 4F58H 5C6TH 1R5WB 5E5RB 3WIFB 4DEPB 4R4NC 1I3RB 2A0LD 4PJXB 1VESA 2EXWC 1HSBB 3NA4A 3PWJB 4BZ1H 4DUXA 3AM8A 3P3YA 4Y1AE 5D7KD 2OL3H 2O5ZL 4FQIL 4NQCA 1FNSL 4HV8A 1NFIB 2ZOKA 3WNPA 4E41A 1BPVA 3ARFD 1T20A 3S5LB 4UOJA 4LLVA 1D5MB 3SDDB 1ADQL 3B9AA 5T1MA 3HPLB 1DVFD 1I1AC 1TETH 1EUUA 2J8UE 1VGKA 3C6LC 1Q9LB 5J6HB 2FECI 3DX6B 4NRYA 2YMXL 4OKVA 1RU9L 4ZAKD 3WHXA 3A6OA 4H0IA 3QIBC 3EBAA 3UDWC 1MPAH 3O45B 5JOEA 2R1XB 1OAXL 3TN0C 3HB3C 3TA3B 2P45B 1VKXB 4IEFB 1B6DA 5D70H 3EYOA 1ITBB 4X7FC 4JFPB 1MRCL 4O5LL 1F6AB 5DVNA 5FKPB 1E4XL 2X10A 4XHQA 1L6ZA 3SDYL 2B7DT 2DM3A 3WKML 1IGYA 4JFYB 4NQXA 5A2JH 3BJ91 1IC4H 2VDLL 2A9NL 4OZIF 4N0UB 1I3UA 3C2AL 3QDAA 4Y4KD 2RQ8A 4WRLA 4R96A 2CRIA 5ESQA 1PLGL 4FQHB 4ODXB 5C3TA 5L9DL 1P53A 2W0PA 5DWUH 1AJ7L 5HTSA 1FN4A 2X70A 3BKJH 4HPYL 3RWCA 3BRGC 3SDDC 3VI4E 4YDIH 3MRPB 5JA8B 1S7UA 1R3IH 4PLJC 1IEBA 4LBEB 3HRPA 2ZG2A 5IGXL 4CNIA 2OL3B 3DX9A 3MRIA 5D7LB 4DAGL 3MRBA 2PETA 5KAQF 3OPZL 4OCXL 3KNBB 4H0GA 4KRPB 5MENA 2FGWH 3VDBA 4L8SC 5F1KC 3TO4B 4U7SA 4HFWB 2Q86B 3QUML 3DTXB 1QFUL 2KDGA 2IALB 3G6DH 5LAXA 1XGQB 3MZTA 3CH1A 5GZNC 4M6ML 5C0JA 1CD0A 4XVUD 4GRMB 4IHOA 5EUOE 4OUUB 4K3JL 1IBGH 4WVRA 5L0QB 4L4TB 1KJ3L 1HINL 4LBEA 5F89A 2X7LA 2YHGA 3VMOA 4JHZA 2JK5A 2FX9L 2ENSA 5FDYA 3L3KB 3QUZA 1FZKA 1MCWM 4JG0H 4Z7WB 1A0QL 1DN0A 4PG9B 2FB4H 3RPIB 2ATKB 3RPKA 3BDBA 3CVIL 1WBYB 3LV3A 1ZS8B 5TQ2L 3HAEB 2NY1B 5GJSH 5ALCL 5D93C 4KDTC 6CGTA 4I3RH 4JY4B 1NGWA 1REIA 3IKKA 1JPTL 1WITA 1TPXB 1NCDH 4HAFA 4HWBL 12E8L 1K8DA 3HE6A 5JHDE 3HKFA 2K7QA 4Y19D 4I4WB 1E4XI 5DJXA 2EH8H 5E8OA 1R5WA 4N8VB 3AY4A 3MJ7A 1OHQA 3C6LA 3BHBB 3LKOB 1FZMB 3MXWL 5B38G 1QEWA 3HG1A 4FZEH 1TNMA 5L2KA 1ZKAA 5HY9A 5GGQL 1SEQH 4HEME 5J9PB 4KY1L 1RAMA 2DJUA 3DURB 2CLVB 2VZTA 1EJOL 3W5MA 2B4CL 4ZUTB 2VLKD 2R15A 4HWUA 3RDTB 4LFHG 2AJ3B 5GJTL 1PX4A 2QKIB 3VJ6A 4YHOH 2BOCB 1IM9B 4P2QA 2KQNA 3JV6A 5DHVB 3D3VA 4RGOL 4L1HA 4Z5RB 1ZHKB 2V5SA 4LHUG 3LKOA 4Z9KB 3KWWB 1E4KA 2R2EB 1S3KL 4YX2H 5MP6L 2ED9A 5HY9B 4WWKD 4U7MA 4XGZB 3TESA 2BNUB 1YNLL 5LCVH 4P2YA 4OQTH 3BVNA 2YSSB 4GQ9L 2CDGB 2NMSA 1DUZA 4NN6C 4WI3A 4OV6F 5DVLA 4PP2A 4RGOH 1TZHB 4PY7B 3TF7C 1INQB 5DDHA 5EU4A 1IGML 3UBXB 4GG8A 4JG1H 4WI4A 1QSFA 4KTYA 2APVA 1A47A 2BY1A 4L8SA 4MCYB 2XICA 5ITFB 2JCCA 3W9DB 3JTSB 5A1AA 4LFHD 1KB5A 1T22A 3L5WA 5E94A 2QQLH 4KJQD 5E9DE 3VXOB 3HMWH 2R1YB 4YDVB 2W0LA 2EZ0D 2ESVA 5IROA 2GJJA 1BAFL 2ENYA 3BVNB 4JFDE 3TVMD 4CAGA 3UTOA 2IPTH 1LNUA 4XC3H 2YK1H 4CU8A 1R6VA 4O4YH 5DHYA 2VQ1B 12E8H 2EE6A 4M62L 5FO7B 1KT2B 3WJJA 2YC1A 4PRDA 1DQDH 3ARGC 1JWSB 1YN7B 5ID0A 3QUZC 4I5BA 3DX7A 2X40A 5BOZG 4DVRL 3PDOB 5I2IA 5E94B 4C83B 4WI9A 5HDLA 4QRUA 4HG4K 2CUMA 4N9GA 1IARB 2GFBB 5MEPB 3T1FB 2VDKH 4QRQA 1A6VH 3A6CL 5D71L 4LHQB 4EVNA 1JCKA 1KNOB 4ISVA 4YK4C 5F1NB 1PZ5A 1XCQA 4WY7L 4NO3A 4P57A 5BCAA 5DRWA 4KHXL 4N5ED 2HG5A 4G42A 5I1EL 1G7LB 3NH7L 3QRGL 3U46B 4U1JB 3AY4C 1T21B 2XY2A 3P4MA 5KOVC 3MRQB 4Y8AA 1OGTA 2NPLX 3EJYC 2PXYC 2UWEF 2F54E 4HIXL 3EOTH 2J8HA 2NTSP 4YHLL 4HKZB 3WNMA 4K7FA 4JE4B 3OXRB 3DUHA 4P3DB 1ZLSL 1S7SA 4GAGL 3DRQB 3WN5B 3MRDB 5FM5O 4I18B 1HHIA 4ZXBA 5DRWB 3H0TB 1CF8H 1EBAA 4YDIL 4HLZH 1CLZH 4ZD3L 1VENA 3P4MB 3QUXD 1E4KC 1IGIH 1UCTA 5EO0B 1KCRL 5CZVH 2CKBH 3VD3A 2VLRD 1QD0A 3ARBB 1UJ3A 3PL6B 4JB9L 1P4LA 1Q9LA 5J6HA 5H8DA 1NCWL 3UYOD 2OJEA 3HNTH 5B4MD 3MV7B 4QXTB 5GS1C 2ZCLL 5FF6B 1G6RB 1CR9L 3Q0HA 2OJZL 2R69L 4Q0XL 3JBG7 5KG9A 1G1CA 2KPNA 3TPKA 3RVWC 1NCCL 3EYOB 2EIDA 3K1DA 1WZKA 3V5DB 1KEML 4O5LH 5DURB 2DOCA 1MI5A 3QEUA 1NEZA 3QDJA 3ESVF 4YZFE 3KJ4C 4IMKA 4TPRL 1NEUA 3ESUF 3V4VL 5GGTH 2WQ8A 4WI5A 3SDAD 2AJYL 2JE8A 1RZFH 3BGMB 2QJDA 4G3YL 1HE7A 4QTIH 5DFVC 3DX8B 1MFEH 1EK3A 3CSGA 3HLAA 4NKIL 4OTXL 2HMIC 3R0MA 3KDMB 5C0BD 1N6VA 3PQYE 4RMUA 1F11B 3STLB 1YEGL 4M48H 3ZLQC 3IDXH 3RRQA 2Y7QA 5FF6A 4X83A 2V2TB 1JFQH 4PRPA 4X7TB 5E00B 3GSXB 2F5BH 4X5WB 3ALXA 3W9DA 3IDYB 4Y5VB 4PJBA 4HIJA 1QFPA 1WZ1L 2XZQL 1WJ3A 2YA0A 1B2WL 4HS3A 3FQTB 1UQSB 5C09D 3LS4L 4GFTB 2ZCHH 3TLRA 3U6RB 2YEZA 1AQDB 3RWJA 3GSNL 5MENB 1T7XA 1EHLH 2D3VA 5DMJB 1LNUB 2CGRL 5HHOB 1BFOB 1ZLUH 3LS5L 3WUWG 1CQKA 5EORL 4CDGC 1LO4L 1WWAX 2AKRA 3TYFA 1TJIL 2CDFB 2NXZC 4JFFB 3VI3F 1DFBH 4HIJB 1NAKL 5FGRA 5LG1A 1S9WA 1FL6A 1RZKH 2LAGB 3FAWA 1PY9A 4IDLA 4R26H 1W0YT 1FNFA 1YEEH 1DQTA 1MIMH 3ARZA 1RK1B 5F9JB 1A9BB 1I1YA 2XXCB 4ZXBC 1RUAL 2ADIB 3RFZC 1HOCA 4LOUC 3P9LA 3ELAT 4U1JA 3VG9B 4Y5XC 4LP4A 2X42A 4UV4L 4X4ZA 5LXGL 4TSAH 3PIQA 5IW6A 5CSZB 4NUGH 4K94H 1PZUB 3MBXL 3CU7A 3UJJH 1BJ8A 1HZHL 5CD3A 1I75A 1Z0MA 4LKXB 4XNXH 5F9OH 2F54B 3MYZA 1S7XB 1XF1A 2NW3A 3OHXA 1NMAL 1S9XA 4KJYA 3KYAA 2Q6WB 4YE4L 4EQ2A 1JTPA 3K7UA 5D4QA 3S4SA 1DQQB 3CDGA 4QHLA 5BXFB 1MIEL 4DQOL 2DQCH 5EIVA 3VW3L 4AL8L 3DV6A 3IFOA 3I9GL 1JV5A 3VXNB 5C0CD 5BV7B 2CD0A 2IAMC 4R97B 1JI2A 5L8LB 3BP5B 1WT5A 4QHUB 1Z9LA 1HH9A 2DWDB 4UAOB 4W4NA 4M93C 3FTGA 1JGEB 1JF1B 1II4E 1LILA 4JRYA 3BT2L 1P4IH 2J5LB 2NZ9C 4AIXA 5LWYL 5LQBL 1ZLVK 1FG2A 2G5RA 5K33A 3ROLB 4EXKA 5FXCH 3SBWC 3Q2CA 1GOFA 1F42A 1K4CB 3REVB 4MA3B 3C60A 1JRHI 4PFEA 3P9MB 2I5YL 3SQOL 1YDPA 4JQVA 1MCOH 4HBCH 2VERN 4LVNC 4XP4L 3AMLA 3CC5A 3VXTA 3TC9A 3AU1B 5KSVA 1G9EA 3BGMA 4PRAA 2XFXA 3PE9A 4WHCA 4NN5C 4Q9BA 4R4FH 1QRNB 3FB8A 3MFFB 4OD2B 4Y4FC 2AXFA 1MFCH 2DDQH 5DD1H 1LGVA 1UB5A 1N64L 3QJHA 1JZ7A 5ID1B 1A6AB 1T1XA 2GI7A 4N5UA 1JYXA 3SQOH 4MAYB 1WWBX 1UACL 1W8NA 5C0AB 4S1DD 1BD2E 4MJ5A 4UAOC 4BH7B 5DD0L 2EE2A 1AP2A 4IIQA 4MWFB 4M9PA 1A1MB 4IRSA 4X8JA 5TH2B 4QXGL 2DIAA 2BNQB 2P5EA 2WIIA 3I50H 3T1WA 5JW3H 1LO3H 1I1FA 2CIKB 1YECL 1WTGT 1D9KB 3CXDL 5BJTB 4JFED 2QQKH 4UIMA 5DJAB 3NOIA 5HHPA 3H7LA 5LBSH 3NN8A 4NKOA 1RQ5A 5JPNB 3EO1A 4EZMA 1N8ZA 1DTUA 2JJUA 4JKLA 4LHUD 4QHKJ 1PEZA 1NFIA 4K9EC 1HHHA 1K6QH 5E8PA 3DVNB 4G80B 3CSYB 4M93B 2DQHL 2J88H 1NCBH 1M7DB 1MHCA 5D2LE 2Z31B 2D7TL 1XGPB 1HZHH 3MA9L 1EEYB 3M17B 1EH9A 1QA9B 4I0PD 1FORH 2R0KH 2EH7L 2ICEB 3EHBD 4G8GA 3F7QA 3QA3A 1M6OB 2UZIL 1W0VA 2EICA 4X9BA 1MEXL 1ORSB 3EDKA 2FJFB 3V6BR 5D1XC 3J7HA 2WBJB 4OLZL 5EN2A 5A43C 5MEQB 1G84A 1SJHA 1H3UA 2MCPH 4NO5A 1ZSDB 1BJMA 4M43H 4M6NL 4OFDA 1YEEL 2DKMA 1BWMA 3CSYA 5T3ZL 1AXSB 4HJ0C 1T04A 1KXTB 2Z92B 3IDJB 3QPQC 1KBGL 3WFBL 4JRXE 4HUUB 1KCUH 3P0YH 1OF2A 2FD6H 2V5TA 5DJ8A 1GXEA 3WXWL 5IR1A 1GAFH 3RWHA 3S6CA 2AGJL 5DQDL 4K2UL 2GJZB 4PTTA 5B8CA 4Z0BL 5EZLB 3ABZA 3MRGA 1YJDC 4B7IA 2BRRH 3D39D 1CFSA 4YR6A 1CICC 2OTUA 5C9KA 3MJ7B 5DK0A 2XNAB 2XWJA 2ICWI 5E8OB 4X6EA 4PREA 3LS4H 1LMKA 5HHVL 4Y4FA 3OTTA 1U0QA 5DQ9B 2AP2A 1BEYH 5E8NB 4MCZB 4PJEF 5FO9A 5B39G 1FSKC 5J9PA 4C56A 1R0AH 3REVA 4EI5D 1HQ4A 4Q6YA 3SCMA 1B9ZA 1S7WB 1T1WB 5GGVL 4Y16A 3BESR 2ZUYA 3ARFA 4XRCA 3ZTNH 5CJBA 1SYVB 2DL9A 5CJ5A 1QBBA 4LLWB 2R0ZL 3P0GB 4XMLH 1YEGH 4M48L 3FQXA 4LQ1A 5F72S 1IC7L 4ODVH 3D85D 4NC1C 3U0WL 1RHHA 1UXSB 3MRJA 3QUYA 4LGRB 1S7TA 5EO1B 3TCXA 2ZUWA 3DGCR 1DUYA 4R2GC 1P7HL 2C3WA 3T3PF 3KWWA 2GIYA 5ERWA 1OP3K 4C57C 1L7TL 1C5BL 1JWMA 4EDXB 1XT5A 4PJ7E 3UPRA 4JR9L 1YYMH 2JTDA 3NFPB 2R4RL 5BZDA 3MBEC 2DWEB 2F54D 2HT3D 3ARBD 5HGHA 5DI8A 3QO0A 3I6GB 1J5OH 2D0FA 1NCWH 2EDJA 2X4UB 3TFKC 1HSBA 2AV1B 1U8JB 4UV7L 1BBJA 5IBTL 3G6JF 4Y4KA 2MQ3A 1RIHL 3RUGB 2CKBL 4L29B 4CU6A 1MSPA 3BHBA 5C9JB 1PSKH 4O2FB 4M7JH 3MLWH 4WI6A 3S7GA 3O9WD 1SY6A 5JA9A 4HW6A 3ARWA 2PO6B 5HGHB 1LO2L 4G80A 2YPVL 3QHFH 5F3BA 4NKQB 4NM4L 4J3VA 3PGFL 3GMNB 4TSCL 2GTZB 3OKDA 3VWKD 3N9GH 1ZLSH 2R0LL 2IFFL 2RJMA 3GKWH 4JN2A 4YHLH 1NAML 1F6AA 1F13A 5J0BA 4PY8I 2E9JA 2FBJH 1N6QH 1RUKL 1A1NB 5D2NA 5EU5A 4MVBC 3CXDH 4N9GB 2NZIA 3QDMD 1PZ5B 3EJZD 3PWLA 3D9AL 4TOYL 4U0RC 3MUZ1 4LSQL 4RBPK 3CDGB 2VDKL 4ZFGH 4HXBH 3LH2L 5T1KD 4KQ4H 2BSTA 4G7YL 1JGUL 4K7FB 3V0WL 5MHSE 3CLFL 1NC2D 4I9WD 4OZIB 1FAKT 1YY8B 4LHUB 4GW5B 5D7JD 4GRLC 4NHUA 1CFVL 3WNNA 4CNIB 2DQUH 3HAEG 4U1KA 3CNKA 4G9FA 3WD5H 3T4AA 4GQPH 1MHHA 4RWYL 4KUZH 1A1OB 4U31A 3TZVA 1GGIH 4HT1L 4O02L 2OX5A 3C60B 3P9MA 3IGAB 1RMFL 2ZG3A 3HHRB 4N8PA 4Q2ZB 3IDMB 5HI3D 3ARDA 1WBYA 1X5HA 5E6ZA 2XQBL 3FCTA 2ZPKL 1F4XH 4Y5YC 3OZ9L 1I7UA 2NW2B 1KPVA 4NKDB 3ULUH 2PO6D 3QQ4A 1OT1A 2VLKA 1RI8A 4JANB 5CP7A 2ORBH 2R2BA 4RAUB 1P4IL 2MJWA 4LVOB 3QCUH 4KKAC 3ZDYF 5ID1A 5AD0B 5JW5B 4DGIL 1H8SA 4F37K 1QQDB 2I9TA 4UQ3B 2GT9B 2J7LA 2NY1D 1NDGA 5DD3H 3O6FD 1VACB 3UAJD 1EDQA 1ZT4B 2Y1VA 4HJGA 4ZUTA 3N50A 5E4EC 3RGHA 1MRDH 1YY9C 3QQ4B 2RAMA 5KSUA 1ZHNB 1A3RL 4AJ0A 3VFUA 1FBIL 3IKCA 2LFGA 3AM8C 5LGKA 2DTML 1XGYH 4MXQD 1WAAF 1IAOA 4FN0A 5IMOB 3WJLA 1QSFD 4NUGL 3AB0B 3NCEB 4H20L 4KKCD 1U93A 2J6EL 3B2VL 5JO5B 2AK4D 2XTJC 1Q9KA 4WUUD 3MZGB 3GKZA 4BSJA 1IRAY 1F8TL 5HDBF 1IGJB 1CFTA 15C8L 1X4YA 5F7UA 2WWMD 1UWGL 3ULSA 4IRZL 2QBWA 4L9LB 1YEIL 2OK0H 2G60H 1LD9B 3QI9C 3HZVB 4NUJB 3BZFA 3KPMA 1EEYA 5ICXB 2SEBB 1A3LL 3NPSC 4H1LB 5I8CA 1QFWL 1ZHKA 2XQYK 2R39A 3H2WA 1R3HA 4OJFL 4BFIB 1KB9J 1NKOA 1UH4A 1DFBL 4XPFH 5I66A 5GGRB 3MA7B 3PP3K 3CVIH 4TVSa 3TM6A 1QO3A 3QXTA 5HPMA 1UT9A 4WWID 4GMSH 5CHNA 2YSSA 2HWZH 4HV8B 4G6FD 2K1MA 3CVHH 4DKEH 1RZIB 2E27L 2VDOL 4GKNA 1A1NA 5EUOB 5F9AC 2Z8VC 3T04D 4D3CL 3LN9A 1WAAE 3LKQA 1JI1A 4OB5L 4XMKH 5EU6E 4J4PC 4B0MM 1HINH 4RFOH 3TO4C 4P59H 4YHKL 3SOBH 2D4DA 1BD2A 3PWUA 1BOGB 2XZQH 4L4JA 1U8LA 3TBYA 4QGTA 1FL5B 4BSVA 2ZKHH 3ARSA 5DZLA 4I48A 5F7KC 1U92A 3ARDC 4U7KA 3DI2B 1WCBB 1PYWB 3VG0L 5DYOA 1A2YA 3SGDI 3MTRA 3VGDA 4M5ZH 3MLYL 5DLMH 5I73B 2E9WA 1ZGLB 1KTLB 3IXAA 1T80A 4MLSA 5DRNB 2FYYB 3E1F1 4LCYA 4MD5A 1CL7I 4QTIL 1RV6X 5F8RC 4WDIA 3MRCA 4P5TA 3QRFM 5GGTL 5C08B 1RUPH 5EBWB 4M1CC 4KROB 2Q8BL 1OD9A 2HJLB 3GMLB 5ESQB 2VXTL 3PQYA 4R3SA 4FQQB 4QRUB 1OAYH 4Y2DD 2NYYD 4OCRH 3HI1B 3MO1A 2OR9H 3LZFL 2VISA 4I13B 5B39A 5C0GA 1A5FH 3P4NA 5E8EB 3GSRB 3NBNA 5SWZE 1Q9WA 3IXTA 4WU7A 1GGBL 4FQ1H 5GISH 5C0DA 3BH9A 3WXVL 5IJVA 3WKMH 1VKXA 2VITB 2OLDA 3WIHA 2FATL 1OM3L 2CLRB 2VZ3A 3VXMA 3KPOB 5CZXC 1EBPA 5CZVL 3GBLA 5FO8A 1MAMH 4JDTH 4XT1C 5J13B 2EEDA 2X4OB 3OXSB 3WUWB 1MQKH 1M4KA 1YMMA 3SDAA 1OP5K 3GI8L 4MDIA 3CCHA 4GT7A 3DSNA 5B39B 4CUCA 3UTQA 1KJ2B 2B1HH 3NGBC 1BBJB 3MLYH 1OAKH 3ARPA 3CFEA 3VXRD 3GSNB 4ZQKA 3Q1SL 1CGUA 5LJYH 5IMOA 3QISA 1FSKB 4DEPC 2CH8A 3MOAL 4L3ED 4PJXA 3H7BA 4PJFB 3PV7A 2W91A 4DN3H 2DLHA 5D2LB 8CGTA 4TNWF 5DMIL 3WUWA 1JV5B 3VXNA 2A77L 3GB7A 4X9GA 1EFXA 3FT3A 4KHXH 4NC1E 4M1DH 3HI6H 3ETBF 4K3EL 4LAQL 2HJKA 4X99B 3O4LE 1D9KA 2F9BT 5F7DA 2NY2B 4GLRI 1I1FB 5I15L 3LDBB 3B83A 3VFMB 3RVTD 2E27H 5EU3B 4X6BB 1QLRA 4OI7A 4QNPF 1BLNA 2EYSA 3L7FA 2AJUH 1UH3A 3V5DA 3X11B 3WHXB 5I1KH 4JM2D 3A6BH 3VFWB 1F00I 3ROLA 3SQBA 3EO1B 3EIFA 2QADC 4ONHB 1TQCC 1MWAH 3CK0H 3NN8B 5GGRA 2OSLA 3B9KC 1ZV5A 4MNQB 3EDFA 1TDQA 3BIKA 3QG7H 3DURA 2CIIA 4LK4A 5CEYB 1U8IA 5GRXG 3KDMA 3DXAE 3MROA 4PV8A 4PJ9B 5CUSH 2EDOA 5HI5D 3S35H 5TQ0L 3ZTJG 4OT1H 5EO9A 3RWFB 1CFNA 2OXGA 3KYKL 3RX5A 1C8PA 3Q3GB 1J0YA 1T7WA 5AYQA 2HTKC 2DBLH 3AXLB 4P5TC 4G8FB 1J87A 1QSED 3C8KB 3OR6A 2DQDL 3HI5L 4GAYB 4N90E 3LN5B 4L8BA 3KVQA 4I48B 4MNQA 1NMBH 2GUOB 3PABA 3VMNA 1FAIL 5BMFL 3TNMA 3ARGA 3HE7A 3WMSA 3AUVA 3VG9C 5INCA 2MSPA 3MXVL 1MJJB 1CFQB 4LF3B 3DGGB 4NZTH 1YEHH 4BELD 5IT2L 1BGXL 1Z5LB 1WIUA 2BFVH 3EYUL 2GJZA 4PTTB 3VXUA 1QKZH 4F7PA 1WFUA 1ZA6B 5A16B 4YX2L 4LCCC 4JFFD 4JREB 4Q9QL 2RB8A 3S36X 1XGUB 1JZ6A 3KPRD 3CFJA 3GM0A 1NC4A 3PF2A 1LK2A 4OUUA 4OSUL 4P2QB 1NUFA 3TNMB 2JB6A 3GJFB 3OKKB 3BO8B 1CU4L 3HNSL 1F4HA 3WEXA 3BH8A 5GJTH 2XKSA 3KLHC 3OHXB 1XIWB 1S5HB 4OLXL 1BIIA 3JV0A 1OTUD 4ACPA 2ZPKH 1MCKA 3HI5H 2DQDH 4R7DB 5GGQH 1I7RA 5DR5L 4UILH 1MCCA 4JDZA 3MNZB 3RPIA 4F7PB 3JVGC 1DUZB 2GJ6B 4KPHH 3EYFA 3TPUA 4O9HH 1IKNA 4RAVA 4TUOA 5JLZA 4Y1AB 3ULUC 4M5YL 4JM4L 5MEQA 3OX8A 4KRNA 5KVMC 5E2UL 4QRQB 2WM0A 3SO5A 5DT1L 1FZOB 5GS0D 4UDUB 5HI4D 3FONA 3MYJB 4HWBH 4QHKI 4YDJB 3NIGF 4HCRA 4OZFH 2Y5EA 3LEYH 3CFEB 2VLJA 1CFVH 2R29H 3CX5K 4I3RL 1CVSC 3CU1A 5C08D 1G6RH 4I3SL 4JFDD 3F7VB 2H26A 1MWAL 1UJ3C 4OZGB 5JXEC 1TQBC 4MQSB 1N5AB 4V1DD 2J1KA 3ZHKA 3H9ZA 2V7HA 2AJUL 2XN9E 3QP3A 3ZTJH 3C08L 1NKRA 1JGVL 1N4XL 2DYPD 3EJJX 5ADOH 1JF1A 3SKJH 4YXKL 1K8IB 3EOYG 2XPGA 4IRSD 1CLCA 4UBDD 1C12B 4X4XB 5D1ZA 2P5ED 4PJIA 3WS3B 1FGNL 3NZHH 3RKDD 1JVKA 4UTAH 1OT2A 4NNPL 1D6VH 5DD5H 2AV7B 1U8JA 4OZGF 4PYGA 4TVPL 4O2CB 1BREA 2DICA 3H9HB 5DMIH 3MA7A 4PJGB 5K9QI 4S0SD 1CK0H 1TNNA 4Z7NF 4M6MH 5GHWH 4HS8H 3BZ4A 4PJCA 5EOTB 2R0LH 4WJ5A 2A74B 4M61A 4QRPA 2OMBA 3ZT6A 4DFHA 4ZUVB 3M07A 3F6IA 3MRBB 5I76B 2B1HL 1JJUA 5TF0A 4OCXH 5D1ZB 1FNLA 5C0BB 1ZWIB 5AZ2L 3QNXB 4J7RA 3RVXC 4ODBD 3HE7C 1PW3A 5AG9A 2B2XH 2ESVE 1KJ2H 2VDNL 1MQKL 3MRJB 4UIMB 5DJAA 5L6YL 1CDHA 3MJGX 5IVXA 1U3JA 2VC2H 4PRHA 1CBVH 2MQCA 3NAAH 1AXTH 1PYWA 5ADPL 5ETUB 4Z7VF 5EC1A 5SWSD 1TZGH 1OM3H 3MRDA 2FIKB 3SKMA 5E95B 4YNYB 4IRSB 2NXYC 2YPLD 4NZJA 4M61B 4QRPB 5GSVA 1N0XL 4PR5B 5F21B 3MRLA 4ZS6D 3V0AC 2IANE 2DWEA 4M3KB 5FYKH 4NQEA 4FMKA 1P4BH 2NXZB 4LSTH 4N1EA 3FFCA 4ZFOL 1NH6A 2E8YA 4YPGA 5IBUB 1A7QL 1OAYL 4PJ8B 2AVGA 3REWA 5GRJH 3IDGA 1MRCH 4JRYE 4XB8A 5BS0B 2VH5H 4JO2L 1A6ZB 5D7JB 3BQUD 4NBZB 5F8QC 4MX7A 2B8OT 5ISZA 2E8ZA 2G75B 4LLMA 4CVUA 4Y4HB 3FQTA 5EPMB 5ANMB 4KI5F 5FOBB 4JPWH 5E9DA 3HN3A 3RDTD 2DKSA 5DUPH 2FH8A 2DQTH 4ZMAT 4S1RL 4HUMB 1XFPA 3LQZB 3RZCD 4P49A 1P1ZA 5I1HH 2ITDA 3GMOB 3MJ6A 4KI5E 3GMNA 1FGVL 4GBXB 1HHKB 3D69B 4J3TA 2ZKHL 1VFAA 3UCRA 3CFBA 1TITA 3STZA 1YMMB 4ZFZB 3WL9B 4X6CB 3SCMD 2NY4B 5JXEA 2AXGB 3HLAB 4HKXA 2ZJSH 4P59L 1LEGB 2PCPA 4XCYB 3EAKA 4RAVB 2VZVA 3HZYA 4Z77A 3TJHD 4PB9H 3GGWB 3D25B 4MS8D 2OTUB 3RVUD 1A6WL 1CG9B 2A6IB 2LU4A 1YN6A 2DMCA 4M8QA 1KN4H 3S88H 4LCCB 1GGCH 4TSBH 1EHAA 3QULA 4NHCH 4F7TB 2NY7L 2AGJH 3KYNA 5DQDH 4F37F 1U8KB 3C5SB 2FECL 5H2BB 3MLSH 2Z35A 5JW4N 1F4AA 2ADGB 4WW1B 1BZ7A 2F74B 4U1LA 2FL5A 3IKCB 3LVEA 5D7IA 4PJHA 1NCUA 1A6TB 2ZCKH 3BKYL 2XZAH 3O8XC 3ARBA 2ZSVB 5C0AE 3D39B 4KRPC 3KHOA 5KS9F 2B0SL 1C12A 4X4XA 3L3DA 5EO1A 3FQRB 1DUYB 5TE7L 3MLTB 4K3GA