3RDTA

Crystal structure of 809.b5 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLIAIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAASKGADRLTFGKGTQLIIQPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for differential variable gene pairing in creating T cell receptors specific for unique major histocompatibility ligands.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
total genus 36
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2011-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rdtA02
4PP2B 4K3HA 5E0QA 1A4KA 4QRPA 1R5WB 3SO3B 2WNGA 3RWDB 4V2BA 3M1BA 4U6YA 4DFIA 2EDKA 1GOGA 3VFRA 5ID0A 5IVNA 1NUGA 3V0WH 2P48B 2FB4L 3F58L 2EICA 4MLSA 1PG7X 1QA9B 3H7LA 1YEHH 3PGFL 1H3TA 4PJBE 1W72B 4KRMB 4AEHH 1XF2A 5BRZD 4YBLC 4JFQB 1AE6H 5E03A 3U0PB 4X7FC 1EAPA 4XAKE 5IFHH 4K7PL 2CDEA 3RBSA 3QXAB 2VXQL 3OGOE 5AYQA 2VXTL 2NY1C 5KSBA 5DS8A 1MCHA 2IH3A 4JFPA 4NO0B 1OM3H 3SGKC 1KPUB 2DMKA 2V2WB 3HI1A 1SMOA 4GRWF 1HK6A 3CDFA 4JG1L 1X5GA 4LLQB 4JPIA 5E8PA 2ATKA 3S3PA 1I4FB 4MD4B 1MY7A 1KYOJ 1LP9B 5B8CC 4HS3A 5EBMB 5H8DA 4KXZH 3VGBA 3ZSSA 1D6EB 1G9MH 3QNXB 4HXBL 3D3VE 1S9VB 4DUXA 3DPBA 3VXPB 4HH8A 5J1SC 4QO1A 1HEZA 4MXQD 3N85H 4D9QE 3OZ9H 1EEQA 2FO4A 4PV8B 1ACZA 4G6FD 4WNQB 5GRYA 4XHQA 5I74B 4LHUD 4LSVL 3IAQA 3QYCA 5C9KA 3S8WA 4LKXA 3W0WA 4PJFB 3QUZB 3TC9A 2YD2A 2XNAB 2GJJA 4BQ8A 4W4NA 5F72S 1G7PA 4C4KT 3WNKA 4ZNEA 4I3RH 3EW3B 5C09A 3AGVA 1QFWI 4PD4K 1ORSB 4TSBL 4FQ1L 1R3LB 3MREA 4XMPH 1MLBA 1PFCA 4DAGL 1NLDL 1Q9KB 4X8XA 2XZAH 4BZ1H 1VPOH 1OAUH 3LKQB 4I48B 3IJHA 2EDQA 1QSEA 4Z7WA 1CE1L 4ZO7A 4PGBA 4J1UA 4PGCA 2IFFL 1AHWC 5JW5B 1T04A 3CC5A 4OGYL 5GGTL 1BFTA 1RIHL 3QI9A 3GHEH 4WUKL 1DN2A 1MHHA 1H0DA 1DBKL 1HCVA 1ZGLP 3GMMA 3SQOH 4HG4K 1A1OA 1YY9D 3OKKB 5HHOA 3U4EB 4HUUA 2DQEH 2ERJB 2VN7A 3P40A 5IV2B 5IMKB 3RGHA 1N2RA 3NPZB 3D3VB 1A9BA 4RZCA 5ILTL 5F9JB 4C83A 2XWBA 3QNYA 2Y6SC 2G75B 4KRPB 2IQ9L 4DGIL 1FSKB 2XRAH 4N9GA 1OQXA 1F6AA 3OJDB 1QA9A 3KYMB 3WJJC 3S36L 4Y5YC 5HYJA 4XBEH 4GKSA 4XVSH 1QFHA 1SBSH 1NBVL 3ZL4H 1AGEB 5ADPL 1NCAH 5L2JA 3B2VH 3OGCB 1FBIL 3HMXH 4H8WH 3PQYA 3WLBA 4HDIA 3KVQA 4MX7B 3QIBB 4KHXL 2Z31B 5DQJA 3O9WB 2WK2A 4FQHA 4Y5XB 2IBZX 5JZ7D 2IALA 3OAUH 4TULH 3IDYC 2ZUQB 4MGXA 2CO6B 5TQ2H 3D0LB 3D87B 4KH2A 1ITCA 4K7PY 3BKJL 4XNZC 5FYJU 5KVEH 4OM1H 1WIUA 2PCPA 3LS4L 3VFSA 3WIHL 2WANA 5E2UL 2A0LD 1QSEE 4YHMH 1ZT7A 3VFOB 1D6VH 4N90D 2D7NA 5JPNA 5I8KL 5ERWA 1KCSL 4RAVA 4F15B 4JB9H 4LLWB 3TH4T 5I2IA 5BS0B 1NCTA 2GKIA 4Z7UE 1FRGH 5HGHB 4LSDA 3ARBD 2APBA 4N8VB 1M7XA 3RTQB 1CICB 3OXRB 1QSFB 1C8PA 1LO5A 3BRDA 2FD6H 1C1EL 2APXA 3LEVH 3FRUA 3FAWA 4G42B 3WFEL 2VZ1A 4LNVA 2Y06H 2NZ9D 5CZVH 1T66D 4PV9B 2X4RB 1XCTB 2WIIB 5F3HB 2FBJH 2XN9A 3QQ9C 5IGXH 3QPQC 1EHLL 2R23B 1Z3GH 3ARPA 2BY3A 4YR6A 5D1XB 5L0QC 2OQJA 1QQDA 2XTJC 3LKPB 4JRYD 5KSUB 1MVFA 5D1ZD 5J9PB 4IIQB 2DBLH 5F7WC 2EDJA 1F8TL 1RZJH 2X9XA 2WP3O 3QA3A 5ACLA 2I9LA 1JPFB 1JGVH 4APQC 3R0MA 1A7OH 4KVCL 4WEMB 1CN4A 1ND0B 2P5EA 3QWQB 5IUSA 1F3JA 4GMTL 1VENA 4WV1A 3QISA 4P3CL 4RISH 4KJWD 5GZOC 1PEZA 1KJ2L 2ICCA 1R5VA 3BP6A 4QRPE 1GGIL 2XZAL 3LQAL 4KJWC 1C12B 4XMPL 4KY1H 1PX3A 2VKWA 3EZJB 3HI6H 3DSFH 5C0AE 2HMID 4MB4A 2MJWA 3CD4A 2VISA 4KRPC 3PDGA 1MIEL 1LMKA 1T5WB 1L7IL 3D39E 2AEQH 1T6WA 4CVXB 4F8QA 4JB9L 4NC1C 2HRLA 1V3MA 3L3HB 2FEDC 2EDEA 1FIGH 2ITCB 3KXFD 3FN3A 1QLRB 4C4KO 3VXTA 3ZYJA 1CBVH 1JYXA 2F5AH 2CIKB 5ENWA 1FO0H 2NTFB 3DSNA 3BPLB 2Y7QB 3QH3A 4ENEC 4Y5YA 3WDHA 4GJTB 2IWGA 5DYOA 3PHOA 5F88B 3PL6B 5E4IA 1DQJA 1R3KB 3CNKA 4PJ7F 5C7XH 2BVOA 3IDUA 1U36A 2GJZA 1AHWB 3BGFB 5TDNA 4Y4HB 1FL5A 1NBZB 2X40A 5GGRA 5M95B 4DN4L 1DN0A 2A1WH 3RI5K 5C0EB 4D0DB 2NXYC 2RIKA 2DLGA 4HUKB 4P46D 4WW1A 3ARYA 3QXDA 5D72L 4Z7VA 4ZUVA 3QG7L 4MA3A 2EDYA 4M62H 3T0BA 2EE6A 4GKOA 4WTZA 1HH6B 4I18A 2W07A 1CVRA 3VXNB 3KPSA 4LLUB 3CFDB 5IQ7H 3W9EA 5ESAA 4ZTPH 1XCQA 4ONGL 5DHYB 4WUUB 4APQD 2EIDA 5JZ7C 2H32B 3FZUD 3MBEC 4M93C 4RMQA 5F1SA 3T0VA 3CFBA 2HJFA 3IU4H 4FQXB 5TDPB 5I1KH 4FQ2H 4Z8FH 4U3CA 2XTJD 3TBWB 4G9FB 3QFDA 1F4YH 4DQOL 2Z92B 4Q6IA 4U1HB 4XP1L 4Y4FD 3V6ZA 1F5WA 3I9GH 3ZE0E 1YNLH 5T5NG 2BVOB 4K3GA 4AQ1B 1GAFH 4PJ9D 1YPZE 3TIDB 3QUYA 4GFTB 1ZS8B 4XCCL 1LP9F 4QRSB 2E7MA 3QUML 2A2QT 5J12C 4ZFOB 4BUGA 4YHLL 1NGWA 4A6YB 1NCUA 4XC1L 2GAZB 1FNEB 3NA9H 4JM2D 4DZBA 3DI3B 4QGTA 3TYGH 3SHSA 5IEHB 4Z7WF 1RVFH 4CVXA 3QUMH 4HUXB 3E2HB 3V52L 3OKDA 1E4WH 3KPNA 1QBBA 2HJLB 4UT7H 4Z7NE 4OZGE 4NN6B 4LLMA 3VRLE 3I9GL 3IFNL 2XWTA 4WWKA 2W92A 4GKNB 5DHYA 2VWEE 4KKLD 1AGBA 4YGAB 5CJOH 4GXVL 1UACL 5TE4L 3UTPD 4LRNH 3LY6A 2HVJA 3VXUE 2P8MB 4YAQA 5MENE 4G6MH 1J9CT 1H3VA 4X6EA 5DJCB 3LRHA 4WWKD 4Q6YA 5TFSH 4MNQE 5EU4B 3ARGC 3C87A 4Y5VC 3RX8A 4M8QB 2EO1A 4JPVH 3QEUA 1FZKA 3TYFB 2KUTA 4CNIB 3T0EA 4OF8A 3BDYL 5JHDD 2B5IC 4GRMB 2IQAB 4Y2DB 4PS4L 3U36A 3AM8A 4N9GB 4ZTPL 1LDSA 1H5BA 2APVA 2Q20A 4Z7OF 3C5SB 4Y1AB 5B38A 5BV7C 3RJQB 3RWJB 4DKDC 5D2LB 3DUSB 2D0GA 2XV6B 3TIEB 5DXWA 3BKCL 5IB5B 4J2XA 1NBZA 2FECL 3HC3L 4PJ7B 2YK1H 1QYGH 3K80A 3REWB 1ZT4B 3GSQB 1TENA 3I85A 3NZ8B 1K8DA 2G5BB 5D71L 4MXQC 1KCUH 3G6DH 4R4FH 1B6UA 2ICWJ 4G42A 5D7JA 1BPVA 1XGUB 1U9KA 3IFPB 4U1MB 1YDPA 1JPST 4I5BB 2MMXA 1XMWA 3AB0B 4X9HA 3SCMA 5DC9B 5E6IB 1GZPB 2EDRA 2HTKC 3OKLB 4OF3A 2FL5B 4LRIC 5CJQL 3MJ6A 4FFVD 5E8DH 4AK1A 4MAYC 3L5HA 4KAQH 5T1DH 4U1JB 2VJXA 2Q3AA 3E6FB 3MJ7B 4X5XB 3T1FA 3GBNL 1QFWH 2C7UB 5MENB 3L1OH 1M6OA 4JFEA 3UBXA 1MIEH 3VFSB 3QHZH 3Q6GL 1MVUA 3MROA 1KENH 5HHVH 4KPHL 4OV5A 3MRGA 4PRAA 1BFOB 1NCNA 3DSFL 4GW5A 2BXYA 4PJGF 4PJBA 4PRAB 3P4MA 2EC9U 2IMMA 3QIBA 1K5NB 3KWWB 1QNZH 1OAXL 3GKZA 5LCVL 1W0WA 4QOKE 1DLFL 2EIZB 1HQ4A 1KTDA 3SBWC 5IMKA 1AI1L 1F58L 1PLGH 1TIUA 3MJ9A 4S1QH 4D9LL 2O93L 3L3KB 1K85A 3EYFB 1NC2D 3GDBA 5A3IC 3OBAA 5JNYA 5DT1H 4HPOH 1ZT1B 3CMOL 3MLXH 1A2YA 3IJSA 1N0XL 1J87A 5E8PB 4HBCL 3IXAA 5FM4A 3V5KA 3GJEA 1QHOA 4JGMA 4LPTA 2FEEI 4JHBA 3H8NA 3PJSA 1TJHH 4XGZA 3V5HA 1U8HA 2P8PA 2E9JA 3QZWG 3RNQB 5CJXA 3GJEB 3KYAA 4G9FE 4RNRB 4KROD 1NC2A 2V9TA 5F7NC 4F7EA 4E42B 3C5ZA 4CW1B 2R2CA 5F3BA 1L4IA 4OIBA 5I73C 3WIFA 1IILE 3WJLC 2R1XB 1NPUA 1NFKA 4NO5B 1N6UA 5FYLH 2PXYB 2VDPH 1XGYL 4JM2C 3RJDA 3HUJB 4ZTOH 2DDQL 5MP6L 3TH2T 4ZPTB 3P0YH 1F3DJ 1T03L 1U8NA 1UZ8A 5IVZB 4OSUH 2CLRB 3RZCB 2A9ML 4ZSOB 4J3VA 1RD6A 4H25B 1T89C 2HLFC 1FYTD 4UNUA 2CKBH 1DR9A 3MV7B 3H42L 1QBML 4JRXE 2WZPD 1FFNA 4UAOB 4APQA 1V3JA 1B4JL 4X6EB 5JW4N 4WHTB 3UTOA 5BQ7B 2B0SH 5E1AB 3D0VB 5KVEL 3QDJB 3KPSD 2R39A 1U8NB 4UV4L 3QIWA 3ARGD 1QLFA 3RAJL 4PJCB 3W0WB 4AIZA 4BK5A 1JCKA 4I9WD 1NDGA 1MHCB 2WBKA 4UOJA 4O51B 4AT6B 4FP8L 4IM8A 3RNKB 5E8OA 3MLZL 1BJMA 2QHLA 2H41A 3C60A 4JR9H 5GGRY 1WJ3A 4M48H 5FHAL 4PLKD 1ZVSA 1F45A 1ZK9A 1CCZA 1TNNA 3LEYL 5EZOL 3TZVB 4Q9QH 1DBBL 2EZ0C 4QWWC 3X11B 1I7ZA 1HN1A 2YD4A 3UTQA 1N64L 3L3DB 4FP8H 2VLME 1XZ0B 3GK8L 3JTTB 1U3HA 1TQBB 3P4LA 2VDMH 3C6LA 1IFHL 3A6OA 3BW9A 4M8QA 1SY6H 1NCBL 2FWOA 4LSPH 3NZHL 2R0ZH 4X7DC 3BPOB 4NDMA 5MI0B 1ZT1A 2QQLH 5GRVL 4B7IA 2V2TB 1H5BB 4JRXA 4LCWB 3VRJA 3FB6A 4PRHE 3QDJE 2IPKA 4YBHA 4GRMA 4YXKL 5DC0A 3VFVB 2EDBA 4RX4D 5C0BD 4NQDA 1T83C 5AD0B 1FN4B 5D5ME 1R3JA 3PABA 1U8JB 1RIVH 2YD1A 1KEGH 2BNRB 3R1GL 4P59H 4Y4KB 2Q8BL 3ZTNH 5SWQB 4ZDHB 1F6LL 1BF8A 4NQTA 1HHIA 4OIAA 1OLLA 4UQ2A 3IU3A 1R0AL 1NGWB 4FQPA 5DJXA 1EERB 3WE6A 4JDZB 4G3YL 3GI8H 4XWGH 2N4IA 4PRDA 3IF1B 4WFHD 1F4WL 1G7JA 1XGPB 4LSTH 4OLWL 3ZE2E 4Y16B 4KV5F 1P4IL 1EFXD 2D7MA 1XIWB 4I3RL 3HHRB 1I3RB 4PV8A 3NIFF 1E0OB 1HZHH 3KNBB 1GGCL 3VA6A 2CDGB 1ZLSH 2VMFA 4NC0B 4EDXA 2WWMC 4P46C 1BVLA 1U3YA 4WI3A 3SPVA 2ZG3A 2BDNL 1O0VA 2XPGA 1OD7A 1GL4B 1GGTA 4LDEB 2Y36H 2NCMA 5DJ0A 2ATKB 4FZ8H 1RZ8A 2VIRA 4H88L 3SDXB 2BSRB 4PJ5E 4X7TB 4H26B 3SCMB 4MQ7B 2X9YA 5KBNC 2PKDA 1U6AH 4U1MA 1RAMA 4NM8H 1NANI 2IPTH 2BCKA 4LOUC 3X13A 3UCRA 1KXVC 1QFPA 1VSCA 2VDLH 1S7XB 1T1ZB 3VFMA 4HT1H 1XFPA 2DJ4A 4OUUA 2XYCA 2VZUA 5FA4A 1UFUA 2EDHA 4KKBC 2WV3A 1PJ9A 1E6JL 2C3HA 3B9EA 1S7QA 2BHYA 1S7UB 1T2QL 1QRNA 4OQTH 1OAZH 5ACZA 3P4OA 1XCQB 1S3KH 5BMFL 1T66C 1YN6B 3UTPE 2F19H 5EUOB 2Z8RA 1XF4A 3G6JA 1T2XA 3QB7C 1QFWM 4CVZB 4MSWB 4KRPD 4MAUH 5DJ6B 4MDJA 4JM4L 4PJGE 3DETC 2OXHA 3ARSA 4NSKB 5A2JH 3SJVD 1A64A 1OAYH 2GJ6B 4F8TA 1BMGA 3V0VB 1CFBA 1JGEB 2Q76B 4M6OL 4E5XA 4LCCB 3UPRA 4AIXA 1BEYL 5KOVC 3OKOA 4QOKD 2NY6B 3MC0A 3O2VL 3DURB 5CHNA 2ITDA 5GSRB 4WGWB 5CAYB 3PWNA 4FXKA 4OJFH 3CH1A 2CKNA 2VL4A 1KB9J 4G3YH 2P44B 1FNEA 3RUGE 4XCYB 4RA3A 3UROR 1X7QA 1QBLL 5DJ0B 3N06B 1UM4L 2CMRL 2JCCB 3DO7B 4K2UH 3U9UA 4TNWK 4OF5A 1RK1A 1HDMA 1IC4L 4CMHC 3LS5H 1V3KA 5DRWB 5CEZL 4G80B 1E28B 2ZKHH 1KELH 4Y1AE 1FGVL 3MLSL 5DI8A 4UDUB 3NIDE 4ERSH 5HYSA 1S5HA 4ZAKC 3WHE1 4WV1B 1ZHBA 3T0DA 3WDIA 5ISZA 5BS0E 5IROC 4XNQA 1P2CB 2NXZD 3IF1A 5CSBA 3W2DH 4OTXH 5C0FA 5D8JH 4BSVA 8CGTA 2CDFB 5HDBE 4KJYB 4ETQA 1QR1A 4I9WE 3KR3H 1KN4H 4PJAA 1GXEA 5K33A 5GS2D 1MAMH 3MOBL 2EDWA 3DIFB 3MXVL 3IFOB 3RL2B 1RUMH 1JWUB 2E7BA 1EHNA 2JJSA 3JWOL 5F9OL 5GS3A 2JK5B 3MA7A 2PO6D 3QIUB 5DFTA 5EOTB 2R4SL 1LEIB 4Y5XA 1UG9A 5EZOH 3WV0A 1OHQA 5IW6A 1BBJA 3ARFD 5J06A 3ULVD 3OJ2C 5BW7C 1ZV5A 4WW1B 5C0CD 3OX8A 1AXSA 1KCLA 4JPKH 4AH2A 5FO7B 3BP4B 3WFZA 3BZFA 4UIKH 3TVMD 2A74B 3OHXB 5IB3A 1DQJB 4O58H 3PWVA 3WN5B 5KG9B 3MRFA 3WXWH 4JGUA 5DVLA 5HVWA 4G5ZL 4L4VD 2F8XC 2IJ0C 2JIXD 2Y7QA 2A6KB 5FGBA 1RIVL 3HAEA 1QSFA 5I6XB 1LE5B 4EI5C 1UEMA 2KZWA 2R1YA 2WBWB 3UTQB 1E6OL 3GEWB 4OCYL 1BX2B 2DQFB 3OB0K 5CP3H 2HYMA 3WO3B 4JPWH 3WS6A 4P99A 4JDTL 1ETZB 4FN0A 4P46B 1G84A 3BSZH 2X1XR 2AP2A 2AXGA 1P6FA 3CXDL 3SOBH 1NANH 2J8UF 4MJ4A 1RZFL 4PB0H 4HMDA 1Y0LB 5FUZH 2VLKE 1OF2A 1X5FA 3E8UL 3QEQA 2PCPB 4JFFB 4MQSB 5L88L 4IJ3C 3CC5B 4G9FD 2EC9T 3WHE0 4JFED 3O6FD 3IGAB 1K6QH 3D0VA 5HDQH 1MFAH 2EKSB 5F1IA 5C0AD 1OSZA 1F6AB 5GZND 3CFEA 4RWHA 2R2EB 1MELA 3Q5OA 5HSFA 2IPTL 5GGUA 4IMLB 3U0WH 5E99H 1NGZB 2BNQE 2DJUA 1A9BB 1AGEA 3CX5K 3NABL 4FFWD 4X6FB 4LHQB 1JHTB 3DGGA 4H88H 4HPOL 5LGKA 5GS1B 1MJJB 4JKPL 1EEUA 4PJGB 4Z76A 2YC1A 4OI9A 3VXSE 5MHSE 2VERN 4GG8A 1U95B 2B0SL 1YEEL 5DEGA 3U82B 3HZYB 3SY0A 3CUPA 3HE7C 4XXDB 1MPAH 3LQMA 5IMOB 4X0KB 3ZE0F 3QEGH 1NC2B 1EGJL 4K9EH 2MPAL 4K55A 4X9GA 1C08A 2OX5A 3C5ZB 1R3JB 1H5BC 4XVJL 5IB1A 3VXOB 2AEQL 2ADJA 4KKCD 5HGAB 3VJ6A 1EHAA 1I8KA 3BD3A 3BEWB 5H37G 2PW1A 3KPOA 4W70A 1T0PB 2RCSL 12E8L 4DKEL 4GAYB 3IS1X 1WBZB 1WITA 3GSNH 4RFOL 3OKKA 3U4EA 5HHOB 3AROA 1M71B 5E5UB 3IJSB 1AQDB 1F4AA 2ZOLB 3HRZB 2KKQA 5TF0A 5A16B 1EO5A 2YRPA 2VIRB 3PP3H 5FYLL 3HR5A 2W60B 2WMPA 5HGHA 4I3SH 3KJ6H 1AQDA 1UA6L 4OCNC 4RGOH 5IMLA 5D1ZB 2NY3C 2AJZB 4OT1H 1EAJA 1KTDB 5J3HD 2H3NB 5I71C 3L3KA 4RIRB 5BQ7A 4BK4A 1I8KB 1RHFA 3EOTL 3FOLA 1DBAL 5IB2A 1HNFA 5F97E 4P9MH 2OCFD 4ONHA 4UT6L 2FHFA 5JXEA 4I18C 2DBLL 3G6DL 4U1NA 2NY1D 2FGWH 4AIZB 3B2UC 4UAOC 1FFQA 4KMLB 1PKQA 3NFPB 3S7GA 5DD1H 4WIQA 3PV6A 3RVTD 1JMXA 1P4LA 2J7LA 1HHIB 4B50A 5M94B 3EKCA 4KQ3L 1XR8B 5J13C 3GHBL 1SVCP 2FSEB 1DFBH 3G6JF 1BOGA 3HG1E 3QULA 4OFYA 4LSUL 2EKSA 5F1IB 4MWFA 1CDJA 1RPQA 4QHNB 1JI2A 3QUXD 3DRQB 4FQXD 1SVZA 5F7EL 3MRPB 3LEYH 3FO1A 5T33L 3IJYA 4XGZB 4ZS6C 3BEWA 3T77B 1AJ7H 4RGMB 4P2OA 5KS9F 4FQLL 4WI8A 2QKIA 1DE4A 3MO1B 5IWLC 1VFAA 3FN0H 5FK9B 1TZHB 3GI9L 1N4XH 4CN6A 4L4VB 1RZFH 4PB0L 3RPIB 1PDKA 4DOHB 2G75A 5EU6D 1SYVA 1B4JH 3FMGL 4EEEA 1FCGA 2UZYB 4JPWL 3NPSB 1SM3H 2MOVA 2CGRL 1CU4L 1EGJA 2IQAA 4WRLA 4S10A 1BZ7B 1TZGL 2Z0BA 1JP5A 3HG1D 3O2DL 4HMEA 2R2EA 3MSPA 5DJAA 7FABL 4MNHA 2QSVA 5KVGL 2UUDK 4GW4A 1A1OB 4F7PA 5DJCA 1CXFA 2GJ6E 5IW1A 3LD8C 5FB8B 1A21A 3T4YA 4G6AD 3BZEB 2ZCHH 4HIHB 1JWSA 3RQ3A 1DDHB 5AUMB 1IM3B 1QPXA 2EIEA 4OLVL 1PVHA 2X4OB 1RK0B 1GPOH 1ULVA 2X4TA 4NZTH 4PJEE 3STZA 4U2ZA 5D7LE 1WF5A 5C0IA 4NNPH 4OLZH 2AJ3B 5K9JL 4RFNC 1F4XL 2WUCL 2MCG1 3GSXB 4KUCD 5CKAA 3KPNB 1IZJA 4XPHL 3MOAL 3H9HA 1ZTXH 1EBAA 2DF3A 1X5ZA 3MRLB 3MGAA 4JKWA 4F37F 2VLLB 3DV4A 3WL9B 5E2VH 2VL5A 2VDOL 4ETQB 2HFEB 5L6YH 1NDMB 3C08L 1YEFL 4LVEA 5CZXC 3IETB 2OTWB 3KR3L 5KG9A 4QHUA 5AZ2H 1RIHH 5IMLB 4JFDD 2GUOA 3E3QC 4RGMC 5HI4D 4MJ6A 2CLZB 3C2AH 2GSGB 2A6DB 1JNHB 3TO4D 1A7NL 1TVDA 3V52H 2BP3A 2QQKL 3AS1A 4DCQB 4X4YA 1CTNA 2QQQA 2N56A 1JUFB 3JTSA 1BLNB 3TNNB 43CAA 4PR5A 4NRZA 1R5IA 4NKIL 4ZS6D 1FNFA 2NLJA 3GSVB 5DUBA 3TT1H 2ARJA 4Y88A 3EJZD 2CKBB 5JDJA 2CDEB 2YUWA 4X98A 3HNSH 1RZKC 5D2NB 4OCWL 4QY8B 4BSWA 5E8NB 4JQVC 3VXSD 5MHSD 1UM4H 5MEPB 3GRWH 3ARFA 4LL9A 5IP4A 1OPGL 4PTTB 3B4NA 5CHNB 1F2QA 3QUYD 3PL6D 2ZG1A 4JO2L 3TJHC 4N1HB 4U6YB 4Y5VB 1VFUA 4MA3B 5EUOF 3BWUC 3QWOB 3VXOA 1HYSD 3MRRA 2VN4A 3RWCB 1MQKH 2CIIA 3EDEA 1UYWH 4IDJH 2FDBP 4S11A 4QRPD 5CEZE 1YEIL 3LN5A 5D5MB 3SGJC 4OZIA 4L8SA 3DX8A 4PY7A 4GG8B 1WFNA 4Z7VF 1MLCA 1QRKA 2YD8A 1D9KA 5BCAA 5EZJB 3SBWA 2FO1A 2OI9B 1T21B 2W0PA 4XH2A 1WWAX 1AKJA 3UTSE 5J6HB 3MUGB 4PJHB 1RZJC 2NY0C 4IMLA 3CLFL 1OGAE 4JREC 1HIMH 3ILPB 4GOSA 4U1JA 2FLRT 1P7QB 1YNKH 1ED3B 2Z91B 1U8IB 1CXHA 3C2AL 3HC4L 1CLZH 5GSRA 3C5ZC 3R06B 3O41A 4YJZL 2VC2L 5DQ9B 2JCCF 3BDYH 3NMEA 4L9LB 1NL0L 2A9NH 2AEWA 1CFSA 1IEBB 3MCLH 1X7QB 3WNOA 1UM5H 5CS7A 4I0KA 5TFSL 1YJDC 4ZFOA 5IOPB 2FZ3A 4LKCB 4L3EB 5IESH 4M1DL 4QHMA 3SKOA 3ZT6A 1FG9C 4HLZH 3KYNB 1P84J 5DD3H 4MA7L 5I1GH 1CD1B 3O2WL 4X4ME 4YFLI 4R0LA 4PGEB 4MD5B 4QXGL 5IB5A 5F7YC 4KVNH 3IS0X 4ZFFB 2W0KA 5FOJA 3QJHA 1A1MB 1AXSB 3HI5L 1X3DA 5IM7B 4G8FB 1KGCD 1VFBA 1J0YA 5I18H 4OLWH 3JVGC 3VFMB 3O3EB 1OD9A 3PHSA 1B0WA 2BRRH 5ANMA 2D03H 1E4XI 2B1HH 3TN0D 5MEPA 1FORL 3I3DA 4NQCA 1AGBB 1LQSR 1NGQH 2YWZA 3SGJA 3ARRA 1RZ8B 4E41D 4L4JA 3K4AA 5KSVB 4U7KA 1NKRA 4OLYH 1S7TB 3L95B 5E2WL 3GSVA 4P3CH 4OI8A 4ZUVB 4EDXB 4JQIH 1BIIA 3EYQD 3Q1SH 3I6GA 1UJ3A 1YMMA 5I6XC 5F7KC 4C56A 4NQDB 3OKNB 5HHMB 1CFTA 3QI9D 1BQHA 2OTUB 4HBQA 2YPVL 5ECJE 4B41A 1AQKL 3CVIH 3C6SA 4P57A 5TDNB 3NH7L 5DD6A 3LV3B 2CXKA 2IEPA 3WDJA 5GRUL 4ZD3H 4ZO6A 2F53A 1N5AB 2FJGA 3B2VL 1LD9A 1N6QL 3WNMA 4NNPL 4OLZL 2H8PB 1NBVH 3QUKB 3ZL4L 3EDKA 4UDTA 1XR9A 5ALBH 1EFXA 1HWGB 2FR4A 1H15A 4HJGB 2AQ3A 1YQVH 5FECB 3MCKB 2Y06L 3TZVA 5GXBB 3T8XA 2I27N 4Y16A 1VEPA 1GYAA 1C1EH 1QTYT 3I3BA 2O26U 2DWEA 4YDIL 4KKLC 3AXLB 2OSLA 4LASH 3CLEH 4P5TD 4DKAA 4DGYH 3N1FC 3NGBB 4JAMA 1CDGA 2C1PA 3KYOB 2A1WL 3T65A 3MYJA 1KIUA 2HTLC 4XMKH 1DDHA 3BIKB 2XG4A 5IFJA 2MQ0A 1YEKL 3H3PL 4U1GC 4XCNB 4YHML 1GIGL 3ARWA 2B4CH 5FYLE 2X10A 3O3BA 2DICA 2ILLA 3DWTA 4RRPG 4YPGA 1CGYA 3L3GB 4OZIB 3KXFA 3H0TA 5D7LA 3LH2L 2P5WE 1ZVHA 4YHKH 1JPSH 3BRGC 4HQQH 4WU7A 4P48A 1AR1D 2OR7A 2DMBA 2PW2B 2PF6A 4HIEB 4ZS7H 4JQXC 1MCSA 1Y18A 3FB6B 5GS0C 5F21B 3UJTL 4H0HB 4OFIA 5HHME 2KBGA 2VXSL 3FB7B 3FQTA 1DN0B 2Y1VA 3K8MA 1S9KC 3ZTJG 1ZSDB 1NMBH 2BOBA 3ZLQC 3OKMA 2GTZB 3I50H 3PHOB 1H0DB 4X9FA 3PP4H 1A5FL 3ZT7A 4MCYA 2VL5B 5DDHB 2NLJB 2NTFA 2ICEA 3I6KA 2E5EA 3G5YB 4ZAKA 1N6QH 4U7SA 5I1GL 1JN6B 3QBTB 4JKPH 3H9SD 3TVMB 2X89A 2HFFA 4F15C 1HHKA 1BM3L 5I15H 1XR8A 1P9MA 3M17B 4UT6H 4Z5RB 5D93C 2PYFB 2ZPKH 3IXTA 1XF3B 1KEMH 3IDNA 1ZANH 2DYPA 1ZWIA 4OGXL 2EE9A 4QHUB 4K9EC 1WUNT 2V5TA 2IAMD 4O2FB 2HFTA 3CU7A 4PRIA 4OD3H 1U3ZA 4LBEA 2W38A 2A83A 2Z8VC 2DWDA 1G7PB 4U0RB 3TWCL 5C0GA 3PV7A 5JA9A 2EDNA 1JGLL 2GHWB 5JR1H 1CK0H 1KJMA 3FT2A 1UENA 3BO8A 4YHNB 2AV7B 3UC0L 15C8L 1RFDL 5HGGS 4X83A 4I3SL 2GJ6D 2XKSA 4HUMB 5HHMD 4QT5B 1S7SA 4RMUA 5EBWA 2VXQH 1AY1L 4I0PB 4NHCH 3VXPA 3QUXA 4D0BA 2YHGA 4JZOB 5TF1L 5H37H 2P46B 4H0GA 1ZHKB 2JLLA 4BZ2H 3STZB 2I9LB 2R29L 4HC1A 4GG6A 3VXMB 3VFVA 4E41B 5EBMA 2BJML 1YEIH 1M7DB 3JBG7 4RGNC 3UTTB 3O8XA 5TDOA 4HKZB 1IM9D 2J6EL 3P11H 3UTTA 5C92A 5I8CA 3MUJA 4G5ZH 1G7QB 5HJ3B 5GSVB 4M7KH 1H8NA 1DLHA 5JW3H 5CIPA 5E94B 2WWMD 4NQEE 3ZYOA 4IOSD 1YQ2A 2VXVL 1Q72H 4NZRH 4RZCB 4PPTA 3P2TA 4YDKH 3T0AA 1AR2A 1U3HD 3SE8H 3OAYK 4MDIA 2X1WL 5F71A 3MCLL 4C54A 3G5ZA 3AS0A 4PRPD 5DK0B 4FZEH 1FVDB 1HSBB 1IJ9A 3H3BC 3IDGB 4TUOB 2HA1A 3DYPA 4UIMB 2VLJB 1EEYB 1NCAL 1HOCA 4PTUA 3O3DB 1INEL 4KK6D 5EB9A 5JMOC 4KXZI 3SJVB 1YEGL 3QDME 1SJHB 3C9NA 2B39A 3P0VL 5EOCJ 4K7FA 3WFHB 1MHPH 4ODVL 2BDNH 5CP7B 1ONQB 1JHKL 3HE6B 5HVHC 1HHKB 5DJDB 1AP2B 2IH1A 1D5IH 3DV6A 1IGIH 4F7TB 1AXTH 1ORQA 3VFWB 5GGVL 3VXME 5MI0C 5D7IA 2J5LB 4OZHE 4RQQB 3BPOC 1CTOA 4PD4J 2ICEB 4Z78A 3CX2A 4M7ZB 4GUPA 3PNWA 2FL5A 5D7JD 5D9SB 4BH7B 5EWIH 3BUTA 3HNTL 3DROB 5GRJH 5IJVB 4OIIH 1MI5B 5ITBL 4DUVA 4UTBL 3LZFH 5CP7A 2FATH 5ICYB 1FNSL 3WFCL 4Q74A 1GC1H 5I1LA 3GMQB 5EO9B 5DWUH 2VLRB 1LE5A 2CH8A 2ZWLT 4OCWH 3HNSL 5KZCD 3WS3A 2X9WA 5CGMA 3O45B 4GH7B 5K93A 3TT1L 4Z7WE 4MB5A 3TM6A 4XNUL 3EAKA 5J11C 3H0TB 1DP0A 5D7LB 1IKFL 2YWYA 1SMAA 1U58A 4BKLA 4ACPA 4E0RB 4FQCH 4UU9A 5TE7H 3JWOH 4Q0XL 4QKXB 3X3FL 1IM9A 1QFUH 1XH3A 4JKKA 1J1PL 3AY4A 2J6EA 3Q5TA 4HC1H 2H6PA 4DQOH 3VXMA 5E4EB 5B22A 4HUNB 3LKQA 1YEFH 3WFDL 1T1YA 5I1KL 1ONQA 4JY5H 2P5WD 4I0PA 4R96A 4D0BB 4ISVA 3RZCC 1FG2A 5IESL 5CJ8A 3NIGF 4R2GB 1TDQA 5T5FH 1J0IA 1Z9OA 1G9ML 2VDKH 1OAQH 3BO8B 3KPSB 4LLUA 5AYUL 1H3XA 4N0FA 3DGGB 2Y6SD 2Y25A 3G5VA 4R7DB 2EXYC 4JAMB 1LO4H 4WO4A 4X7EC 1HHGB 4XI5D 5K9QI 2AXGB 4BQBA 4Z7QE 3QUXB 2BFVL 3PQYE 4WUUD 3QUYB 1K4CA 1PZ5A 5J1AA 3RAJH 2G2RA 3DLQR 3QG7H 2DJSA 5IBLD 1IEAB 2BNUA 3E6HA 3U2SB 2BY1A 3RDTD 1G9NC 4POZC 4HK3N 4MMZC 2XXCB 5C2BH 1OSPL 2UZIL 4U1LA 2AEPL 1UJ3B 5ESVA 3QXWA 4KFZC 4MVBD 3EFFA 3BH9A 2EIBA 3LKOA 1IBGL 3JZ7A 3SN6N 1HXYB 4N1CA 5CP3A 1HH9A 2W60A 2VAJA 5MEQB 3ALXA 5CJXC 5JUEH 4OSUL 2BC4B 2C3VB 3MNWA 1V7MH 4NYLB 2HN7B 2X4QA 3RWIA 3UYPA 4DVBA 5HD8C 1FPTH 1JK8B 4IRJC 1WFOA 4ZO8A 4ELMB 2FYYB 1RUPL 5ETUA 1T1XB 4MNQD 4HWZA 4OZ4A 1U93B 1I7TA 4Z77B 1DQQA 3O6FA 3QCUL 3VXUD 1QKZL 2GTZA 3HZMA 4XAWH 5T33H 3TCLA 3RDTC 1IGYB 3OB8A 4IRJA 3R1GH 5LKNA 5EULV 3V0AC 4UOW1 1HILA 3ZDZE 3CSPA 2PR4H 5GJSL 4CADB 4PG2A 1LVEA 3H7BA 5HVFB 1SJEA 3SE3A 4KJQD 1N0XH 5EUKB 3BIKA 5FHBL 2FH6A 5F96L 1GH7A 4PJDA 5B39A 2XIDA 3M8OL 3TJHD 5HYSG 5C0EA 4XWOD 4K23H 2OBGA 4NPYB 3REVA 2VZOA 2PXYD 4GMSL 4EBQH 4GMTH 32C2B 3K2UL 3RKDD 1JZ7A 2LAGB 3F5WB 3C08H 4NT6A 3D18B 4PBWD 3LQAC 4P4KC 4QRQA 1EO8L 4L29B 2PTVA 3R4DA 4YK4B 2YRLA 3CFKA 3MGOA 4HS8H 5GJSH 1BD2B 3ZKNC 3S96B 5CGTA 3UAJC 4YDJB 1WIOA 1CLCA 2GK2A 1S7VA 1AGCA 4HX1B 3WIHA 5EU5B 1FZOA 2WIIA 5D2NC 4UT9L 1MFNA 5EA0H 3L6FA 3UX9B 5HGDA 5GGQH 3F5WA 1HHHB 4KTEH 4L8DA 5EIIB 3E8UH 4HJGA 5L2KB 4AENB 2ADIA 4NQEB 4UB0H 2A77H 1KTKE 3S35H 2DQHH 4C56B 2RJMA 1HHGA 1L6XA 1GIGH 4OUOA 1KJ2A 3ELAT 3PGDB 3QWOA 1H3PL 3WN5A 4JFEE 3ZYZA 4X6BB 4FNLH 3R8QA 4UBDC 3PDOA 2IGFL 1J7VR 2V2XB 5C0RL 2CRIA 4EQ2A 4H1LB 2R2HB 2M1KA 1HKFA 1XF5B 4KRNA 5I8KH 5L7XL 5IFJB 3MBXL 5C71A 1T4KA 3STLB 2DQHL 3LS4H 3WIHH 3WXWL 2W65B 3VWKD 2R23A 3HLAA 1YJDL 1XIWD 4UB0L 2UYLA 4O58L 2DDQH 1D9KC 5T1LD 2PTTB 1CE6B 1NAMH 2D4DA 5TQ2L 3F6IA 4AEEA 1ES0A 3VXSA 1F2XK 3BGAA 1ZGLA 3X3GH 1FJ1B 4RCAA 1ZHLA 5KVFH 3P9LA 5J12B 5GHWH 1DBBH 2XN9D 4U6XA 4L3CB 5IHUH 3TO2B 2QHRL 3B9KB 4OZFB 5HPOA 5C07D 1FLRL 4IRZH 4QRUA 5CMAB 3Q6FA 4UUJB 4PJXF 2AV1B 1FP5A 3VE0B 1U3HB 2JB6A 4XVSL 2Z4QB 1BLNA 43CAB 2V7NA 5LAXA 4S1RH 4U1SB 3X17A 5IMMB 3HC0B 5L2KA 1NUNB 3F6LA 4J3TA 1RUML 3UYRH 3HCVA 3MXVH 3GMLB 4JN1H 5HGDB 5H35A 2HT4D 3U6RB 3MRLA 4F33B 3LHPL 1NFIB 3C60B 2ARJQ 5SWSE 2XN9E 3KPLA 1TTGA 4OZFG 1AO7D 1IRAY 5HYIA 5MEQA 3CDYA 3ULUE 2CK0L 4GUPB 2NY4B 5BOZG 4LKCA 3NCCB 5DFVD 3B9DA 4PYGA 5F9AC 4WHTA 4WFED 3QUXC 4QHLA 3GSWA 2V5YA 4WUKH 5DMGC 5GGTH 3QCUH 1WAAA 5ITFB 4KQ4L 3GGWB 1B2WL 5DWUL 2VDPL 2ZP0T 4N0CD 4UILH 5IKCB 4HPYH 2E27H 4PJAE 3PQYD 4W6WB 4BFBD 5B3NA 4P3WA 4WI9A 1YEJL 1GAFL 1FC2D 2A6IB 4G8FA 1DVFD 1JRHH 1K2DB 4BM7A 1ORSA 4KUZH 5C1MB 4AG4L 3I75B 3BPCB 3DXAE 3FO0H 1KJ3H 5KTEH 3MRIB 2XA8L 4IEFB 1UVQA 3SKMA 5BO1L 3V5DA 5EO1A 4RFEB 5DMYA 3G5VB 4J4PC 2CPCA 12E8H 2Z8WC 2LU3A 3G5XA 3QDJD 2OJEA 1KLUB 1YN7A 3BPLC 4AJ0A 4P2OC 2M8XA 2MWCA 4UV7H 2GEEA 4F3FA 4JO3H 5H2BB 1CDBA 1UWXH 3PHQA 5IB4B 2UWEF 5D1XA 4HS6B 2HH0L 3CMOH 3MLXL 3U46A 1TCRB 5T3XL 2FYYA 4PGJA 1G7HA 5IQ7L 1KT2B 1FN4A 5DHVH 4L8CA 1PG7L 2GFBA 2P49B 3PJSB 4NRZB 3ULVF 5J0BA 3OZ9L 2UY7A 1HQRB 4OF6A 4ZUTA 3TFKC 5BMFH 1X4XA 2DRUA 3K1DA 1UEYA 2BC4A 5D72H 1A2YB 1ZLUH 1H3GA 1KN2L 3D85A 3NA4A 3FHQA 5DEFB 3QI9B 2NY3B 3BW9B 2X4UB 3DBXB 1KTLB 5KW9L 3RGVA 2HMIC 3VH8B 3B9AA 4DN4H 5JIHA 4KPHH 3U79A 4LGRB 4KKCC 1T21A 4RQQA 5BV7L 3F7QA 1OP5H 2C4FT 5HTSA 2YN5A 1I1AA 1CGXA 3OV6A 4M7ZC 4XPGL 3FL7A 4H5SB 4NQXB 4JO1L 1NLBL 4U1NB 4F7MA 5JLZB 4FQJL 2ZSVA 5F7LB 3MACH 4ORZC 3WFDH 1ZVSB 4L4TE 3MV7A 2X4SB 5D7KD 1T83A 4K7PH 1KOAA 1XGPA 5IK3A 3CXDH 2ZSVB 3RX7A 3SOBL 4LLWA 5CJQH 1TZIB 4EJ1C 5F7DB 2J8UE 2JJVA 1UZ6F 1MCNA 4EKXA 1A6TA 4PTTA 4OCSL 2GSIB 1R24B 4G7YH 1J10A 4TNVK 4QNPE 2DIBA 4P5TB 3I6LE 1KG0B 1EO7A 3EYSL 1P1ZB 5J8OA 1WCQA 1LNUA 2BVQA 2NX5B 4QY8A 3L9RA 3EJYD 2AQ2A 1SY6A 3LB6D 3MXWH 4F7EB 1C7TA 3MRCB 4GW4B 2HT2C 4WO4C 3TNNA 2LU7A 3EYOB 3C60D 3B6SB 5F8QC 1S78D 3C9NB 5CIPB 5E94A 3SKNB 3KPMA 1YNLL 5JR1L 3QFJD 1Q0XL 5HI3D 1OAZL 1INQA 4E0RA 2ICWB 1FZMA 4LDOB 3BGMA 1RUQL 3IXAB 5IFAH 4MJ6B 3MV8E 4NO3B 1A7QH 5I0DA 4P2RA 4U6HA 2AJVL 5TH2B 1CGWA 1KACB 4JPVL 2FBOJ 3DUUB 3QAZC 2V2WA 3KJ4B 1CD9B 2RB8A 3RA7L 3ULVH 4EI5D 5ABDE 5FDWA 1AXTL 5EBLA 2FIRT 1A6AA 4X6FA 1M4KA 3IDYB 3S5LB 5AG9A 4Y8DC 4HUVB 1EAPB 4LRNL 3TO4B 2Y5EA 1MAML 4XPFH 5FYJD 2Y36L 4Y5XC 4HIEA 3KPMB 5FDWB 2R0ZL 4G8EA 2E8ZA 2VDNH 5BW7A 5ICYA 3IFNH 3ZE1E 2MTPA 1FL3A 4JN1L 2DQUH 3RVUD 3C09C 4I0PC 5AG8A 2RBLA 2O5ZH 5GRXG 2DQDH 1MRFH 4BFIB 2CRMA 2C26A 3JVGA 3MLWL 5C3LD 5DHVA 2ZKHL 4WTXA 5EN2B 5CWSA 2ZCLH 5LWYH 3AM8C 4U0RC 3WHXB 4TOYH 3U9PL 3GUTB 3QUZA 4NN7C 5CJ5A 3VCLA 4M3JA 2PO6C 1T7VA 1TMCB 5IVXB 2CGRH 5EZLA 1KCSH 4OLXL 4ESKA 5E6ZA 1R0AH 1OTUD 1PSKH 1YNTB 4LP4A 3MV8A 3W0WD 2I60H 2ORBH 4D3CH 4WNQA 1AO7E 2DM3A 3K2MC 3L3OB 4GQPH 4WY7H 4JLRB 1MWAH 5FYKL 1BOYA 4Y7MA 5CCKL 3O2VH 4WEBL 5HI3C 3LKSB 4C57C 1MCPH 2HG5A 2YPLE 2AQ1A 4ZODA 1IAMA 1QBMH 4F57L 4WFEE 1BEYH 2YA1A 4XMKL 5A40E 4K07A 2X4UA 2F74B 3DBXA 3LQZA 3HKFA 1QSFD 2Q6WA 4MDIB 1NFIA 3S34L 3D39A 5FGSA 4WI5A 2QADD 4N0UB 5AEAA 2DLTA 4CW1A 1D5MB 4L3CA 2QKIB 4H8WL 3VDBA 3QQ3A 4NKOA 1ZEAH 2DQIL 1VKXB 2CLVB 2D7OA 2HFGH 4ZAKB 3RUGF 1ES0B 5DR5H 4JFHD 3T3MF 2XZCH 3NIDF 5CINH 3TZVD 2GCYA 4G9DB 3UC0H 2AABL 4EI6B 4DN3H 1S3KL 1KJ2H 1INEH 4OQTL 1CF8L 2VB5A 4RBPK 4Z7QF 1R24A 1OVZA 4YHIA 4YHOL 5D1XD 1TJHL 4KJYA 2WQRA 1LO2H 1QR1B 5FKAB 5ID0B 4YGVB 5I74C 4JM2F 4G7VL 1VFBB 2Z9TA 43C9B 1Y18B 2P43B 3VD7A 4YXHH 5DT1L 5EIVA 4MA1B 1ZHBB 4EBQL 2YPLA 4LCCC 4O2EA 5EU4A 4WU5B 2VQ1A 4CRPA 3GGWA 3QWRD 2I26N 3ZZ1A 5CD5D 2FRGP 3BPNB 1OAUL 1FIGL 1A5FH 3MRJB 4PJIF 3O2DA 4XX1E 4MHHG 1P2CA 5I66B 4X7SH 2LABA 1MAKA 4LMQE 4Z5RA 5DA0B 4XBPB 4MCZA 1KNOA 3KYOA 2DYPB 4YDJA 3DECA 4DWHA 1VACB 1AO7B 4CJ0A 5IKCA 4K3DH 4BQCA 4NC2B 3V6FB 1IGML 3PG2A 4L29A 3UJTH 1HDMB 1FH5H 3GM8A 3RFZC 5D6CA 4YX2L 1IGTB 4N0YH 5E00B 1QD0A 4J6RL 3U7WH 5D7LD 2V5MA 4PRNB 4HQQL 3MNZB 5DHXB 4KVNL 4PGDB 3BVNB 1RULH 5E2UH 4QXGH 4DEPB 1YEEH 4H20L 1E4XH 2H32A 2ED9A 3BQUB 3PGCA 1V5JA 2VLRD 5DD5L 1U95A 2ADGB 5DEGB 1WQVT 3SO3C 4V1DD 5D70L 4FFYL 3KPLB 4KKAD 4NUGL 5IW3A 5EU6B 3BP5B 1QACA 1R5VB 2BSSA 3O4LE 1Q94A 2NQCA 4NQSA 3SKMB 4E5XB 1JF1B 1KCUL 1MNUH 2VC2H 1N3NA 5D1QB 2P5EB 3RVXC 1LE9A 3N1GC 5HHQB 3NZHH 4PRBB 4U0QB 2Z4QA 3QJHB 1YNKL 3VWKB 3Q6FB 1I8IB 3ZKXC 4R0LB 4NJ9H 2O5YH 3CK0L 1UXSA 3EYUH 1L0YA 4U4BA 3VXNA 4X9IA 4WW2F 1AC0A 3UO1L 2FCBA 5L2KE 1S8DA 3EYVA 2CDFA 2HT4C 3SDCB 5HHVL 3BAEL 4GO6B 3Q6GH 4JR9L 2WUBL 4MJID 4EQ3A 4BFGA 3HS0A 3M45A 3MNZA 3V0WL 1RJZA 4FRWA 4IDJL 3TBTB 2GIYA 5IJKA 2AXHA 5LBSH 3SDAC 2MQ3A 3CX5J 3SDXA 2Q6WB 1IT9H 1UM6L 25C8L 2FR4B 3SDAD 4TSAH 3DO7A 1DUYB 3GRWL 4OM0L 4LVNB 3PGCB 5B38G 1U3JA 2HT3D 2Q1EA 1MCKA 4JE4B 4N0CC 1GHFL 2LE9A 2HLAA 3KNBA 3QFJA 4TSBH 2ZCLL 2FIKB 5IG7B 2DN7A 4Z0BH 2VQ1B 1B0RA 4HJ0C 3CIQA 4I1NB 4BH8A 1RUKL 1X5HA 5ADPH 3EDDA 1A0QL 4YC2B 4WW2A 4NNYA 4Z7NF 4P2QA 2LU4A 5IF0B 5DTFA 3MLYL 3VFUB 5C0NC 5DQJB 4TSAL 1I3UA 5DQDL 1IE5A 3L95A 3UJJH 1A1NA 4Y19B 5FKAA 3VU2A 4X80H 4LSVH 4U31A 4WUUE 1OWWA 4G43A 1BD2A 3DMMB 4PS4H 4MA7H 5L6YL 3IU4L 4A2MA 4KDTC 4X6BA 4JJ5A 4OBSA 1X5KA 5F6IB 1J12A 4M61A 4LCYA 3O3UN 3BAEH 1PEWA 4W81A 1I9IL 1CFVH 3V0VA 5D1QA 1MCFA 4PV9A 5KJRH 1NCDL 1ND0A 4LPUA 1WTGT 3RWCA 1U91B 3P77B 5C0BE 4ZG1A 5CFHA 3QNZB 4HWZB 2OL3B 1U92B 2BVYA 4JDVB 1NSNH 4PGEA 1OP3K 3BP5A 2CUIA 2F9BT 4F80A 1T22B 4YDLC 1YMME 3GSRA 1MCLA 4LSQH 1SYSA 1FORH 4DW2L 1EEZA 1QSFE 4BH7A 3TYGL 3GIZH 2F54B 2PXYC 1D9KD 1S7QB 4DTGH 4NO0D 4P2QE 4X98B 4ODBD 1CG9A 1T1ZA 5EO9A 1IAKB 1FFOA 2HRPL 2QSTA 4A6YH 1AFVH 4U7MA 5D70H 5DVOA 2RAMA 1ZE3C 2Y07H 1BD2E 1QFWL 2IH1B 4AMKL 3LIZL 1ACYL 5EOQL 3RHWF 4MNQB 1JYNA 4MCZB 4M4PA 5DC4B 1IGJA 2F58L 3VXUB 2NZIA 2LAAA 2XQBH 3N85L 4PRDB 2VUYA 3R0NA 4R90H 2E7LA 2F19L 3NAAL 2CJUH 4C56D 4JLRA 4N8CL 4O2EB 4XC3L 4UQ2B 1I3RA 5HI5D 3C8HA 2G9HB 3MQIA 5F44A 4ODXB 1S7UA 1IGFH 1TPXB 4HGMA 3N9GL 1SJHA 4LSUH 1DFBL 3S3JA 4NOBA 3FQRB 4Y19D 2KQNA 3HC4H 2KPNA 5IIEA 3D39D 3MRRB 4OFYD 3TCXA 3ZKND 2FNBA 5DLML 5EBLB 3TT3H 1T6VN 1DQLL 2DB8A 3TH3T 2AJZA 2DL2A 2FX7L 4P4KD 5C08D 5CEZD 2BSRA 1LEGB 1RU9H 4AQOA 3LOWA 4ODUB 4Y4KA 2HTKD 5FB8A 1LO0H 3OKEB 5CSZA 4P2CG 1P7HL 1KFAL 4HZLA 4FHBD 2QLVB 4YDVB 1IQDB 4IS6B 3LEXA 1UH2A 1P4IH 3NACL 4XI5C 4GAGH 1IQDA 4K8RC 3SDAB 4LCWA 1TCRA 3K8KA 5DVKA 4JO4H 4QCIB 3GNML 4NQED 1IC7L 4LVHC 4BKLB 3MNVB 4K71C 3RPIA 3V8CA 5GRWA 3QDGE 2NW2B 4LPYA 1YEJH 5EPMA 5E8OB 1QBAA 3PP4L 1GC1C 1TQCB 5C0CB 5J13B 1XGTA 1R3HB 1M6OB 3DX9B 5BZDB 1PY9A 2HJKA 4P59L 4F2MA 3X11A 4IRJD 3O4LA 2I9TB 1BVZA 3MFFB 4J1UB 4PREB 3SGEH 3QDMB 1FG2B 5BV7B 3QIUD 1ORQB 1GHFH 1U41A 5DSCB 1T5XB 1G6RB 5KZCB 1DQMH 1LK3H 4AM0B 4Y2DC 4NQXA 4KK9D 1CR9H 1T5XA 3UTSA 1P69B 1YPZF 3K81A 4K94L 3J8F7 3VRJB 1TVHA 1CG9B 4ORGA 1S5IH 2RR3A 1CVSC 1DVFC 4KVCH 2AK4E 3UYRL 9CGTA 2AXJA 2JJWA 5I71B 2DI7A 3U0WL 3QPXH 1BZ7A 3VWJB 2OJZH 2GW5A 3B5TA 1G7MB 5GGSB 1U8KB 5BOPA 1YEDB 2UVEA 1UCBL 3MV9A 5EBGA 1NGXA 2EYSB 5C6TL 5DFVC 4K94C 3QIWC 5DRZA 3JUYA 3PXJA 3OF6D 3GHBH 1XF2B 1F02I 3GIVB 4X0KA 1S78C 4PJ9C 5D4QA 3ROOA 5L88H 1NGPH 2EDDA 2ZCKL 5FUZL 4XP5L 5FV1L 4NBYB 4ELKB 2HT2D 3HR5B 4WO4D 2FD6L 1WCBB 4ZXBA 5CBAB 3FQTB 2ZUUA 3S4SG 2LV4A 1N26A 3EJYC 1MI5E 5F1OB 1BZ9A 4NHUA 3UPAA 3QT2A 5C70A 3HE7B 4ZUUA 1L0QA 3NTCH 1VFMA 3SKUD 3MRIA 3ES6B 1LDPL 1KC5H 1WTLA 5GS1C 2Z35B 1FV1B 1A3RL 4LHUB 3DRQA 1SM3L 4I0PD 3G6AA 5DMIH 5GQBA 4QHKJ 5DGQA 4ZUWB 1BVKB 1B9ZA 3BKML 3GHEL 3T2OA 1NC4A 3S35L 1X9QA 1FDLH 2PTUA 4FMFA 3DARA 4DJMA 2N7AA 4A6YA 2X70B 4KK5C 2CD0A 4PP2A 2NMSA 3QHTC 1JV5A 4I2XE 3VXQB 1JBJA 4LLAA 3LDBB 4U05A 7CGTA 3WXVL 1HSBA 4OI7A 3MNVA 4HXAL 2IAMA 3A6CH 3DRTB 3HI6L 3EO1B 3TBSB 1G7IA 3D6GA 5EU6E 1CFNB 4DKFL 4F33A 5T3ZL 4TVPE 3RWHA 2OK0L 2HLAB 2CQVA 3C6LC 3NIFE 2C1OA 3MJ7A 2YPLD 1KN4L 1FIEA 2BY0A 3TN0B 1IC7H 1NBYA 3IKKA 3GNMH 3WS6C 1U8OB 5DD6B 1WICA 3ZKSD 4LOUD 4MJIE 3ECBB 1HE7A 3MOQA 4X5WB 3EIFA 3WN5C 3K8LA 5JTWA 5FGBC 1KIQA 3WD5L 4M1CC 3EFDH 3TEUA 3P4MB 3IDXL 2Y23A 5JIIA 5DDHA 3V9FA 5IB4A 3RVVD 4M7LL 3SDCA 1AD9A 4HWNA 3CVHH 5I17B 1YPZB 4P2RD 3QIUA 1J86A 2OP4L 1A7PL 1EMTL 1CLZL 2EH7L 2PYEB 3ZE1F 2Y9RT 4NN7B 1ZT4A 1DQLH 4I2XA 5IGXL 4PJHE 2YZ1A 1MFDL 5T1KA 1T3FA 3SE9H 3NN8B 4HUWB 3T2PA 5ANMB 3WIIL 5CZVL 2R4RH 2AXFA 4OZHB 4DAGH 2YBRA 1KXTB 1QPPA 2NY5L 3QHFL 4P2YA 3LEVL 3RWJA 3TCLB 3MXWL 5DMGD 5IFHL 2D7TH 3BZ4B 5DZOA 4ONOA 5E6YA 5HHQA 4AEHL 1I7TB 1S7WA 3MV7E 3V7AG 4AENA 1OWRM 4XVUD 4GS7B 1CFSB 1IEBA 4C55A 2WBJC 5CILL 5CD5C 4PUBL 3SDXE 2CXGA 1Q94B 2V5SA 3HLAB 3JV5A 4NQSB 1BWMA 3X13B 1SJVA 5CBEB 4LLDB 4LU5L 2HP4A 4NFCA 3TFKD 3NIGE 2DQTL 5DRXA 2P8MA 3I6KB 4Y89A 2ENSA 1M1SA 1HXMB 4PJIA 5F6HI 1J88A 3QRGH 3LMJL 4PBVC 1CXLA 3QHFH 1BBDH 4KUZL 2AK4B 1ED3A 4Y16D 3KJ4C 1CGSH 1KCKA 4CMHB 3OB0H 4HPYL 2QJDA 3HMWL 3HZVA 3TJEL 2BFVH 5D1XC 5L0QB 1OTTD 4HKJB 2DQJL 2XZQL 4Z7UF 1I1AD 3JV4B 1J5OL 1MF2L 4JY4A 3A6BL 3V6ZB 4R4NC 3MV9D 4NFDA 1EZVX 3SE4A 3EO1A 3HCVB 3NOIA 4XRCA 1FO0B 3FB8B 1CIUA 2QSQA 3NFSH 1U6AL 2YPLB 1BQUA 4X4MA 1AH1A 2R4SH 4NCC2 4D8PB 1JV5B 5HGBB 5EUKA 5CMAA 5DD0L 4FZ8L 4PJFF 3VD3A 1QG3A 4GRWE 5IHZA 3SE4C 1A6ZA 2IQ9H 3F7VA 4P5TC 3GSUB 1YECL 3QDGB 2V7HB 4JFFE 3QZWA 1X5AA 1UADC 3DUHA 4L4TD 3JXAA 1A6ZB 3F7VB 5DD0H 1KJVB 2VLKD 3SDYH 2ZUXA 1PQZB 2VABB 1MFCH 3FHAA 4UV7L 4ZMAT 2JIXB 3L3JB 3WSQL 1Q38A 2BNQA 1KELL 1JIBA 2ZUQC 5IHLB 1F4WH 4BH8B 4Z0XB 2MHAA 1WFUA 4DVBB 2IADA 1LP9E 1OTUC 1INDH 1D5MA 3X14B 1U8PB 1MHEB 1GZQA 1MI5D 4YEEA 2ID5A 3WFCH 1UZ6E 2YZ8A 4BA8A 3BYTA 3VWJC 3ZMRA 1EPFA 2APWA 3QI9C 1R5IB 2ADIB 4NQEA 4LSSL 1YPZA 4YXLH 4JFHE 1BFSA 1FO0A 4Q6IC 4Y5YB 4S1DC 3PDDA 5IOPA 4YE4L 1NUFA 1H3UA 3WSQH 3FTGB 3NCBB 3DV4B 5C0RH 3TBWA 4U1IB 3L3OA 4LQFL 1ZA3A 4M6OH 1A9EB 3EHBC 2ADFH 3IT8D 4UOW0 1OAKL 5J1AB 2E8YA 3LKRA 2IALB 5JPMA 4XPBL 2FLBT 1MIMH 4KROC 3NCEB 1TTUA 35C8L 4PJCA 3Q2CA 4JFFD 4AZ8A 5KVDH 5ADOL 1UCTA 4JDZA 1XIWC 1WAAF 5LGJA 4MAUL 4XNXH 3G6JE 3KPTA 4N1EA 3VFPB 3VXTB 3SE9L 3D18A 4LGPB 3RP1A 2ZSWB 5DZLA 4RWYL 1JPGB 1VA9A 4FQLH 2EH7H 1TQCC 4HIIA 4I2XB 5JW4M 5B39B 3KAAA 1PGRB 1FGVH 3MLSH 1BFVH 2H32H 4L8SB 4LCCA 1FL3B 3UPRB 3VW3H 1CZ8H 2EDLA 2X4TB 3IRZA 5F1KC 3MFFA 3BISA 1WEJL 5JOPE 1CFQB 4KMTL 2ESVD 4ZPTA 1AKJB 3HUJE 5A43C 1X5YA 3ARDC 5DRNA 3LB6C 2VR9A 1S5IL 4X5WA 3ARGA 1W0VB 4PFEA 2DQCH 6FABH 1VB9A 3GIVA 3QUZC 4GAJL 3GBMH 5E8NA 3VG9B 5FK9A 5EC1A 4GBXC 3V4PH 1ADQL 2BNRA 4NO2A 3VRIB 4N0UE 4PJXB 4PBXA 4Q97A 2YA2A 1IGCL 4PJBF 5HHOD 4ZOAA 3S36X 2V5RA 5JOFA 4I48A 3VG0L 1HWHB 5JORB 3EYOA 4MAYD 2B8OT 4QHNA 5A2IH 3O0RL 4X4YB 3BKYL 3O3AA 2DLIA 4TQEH 4EUPB 1ZLWH 2NY5H 4YBQD 5DK2A 4AG4H 1MHHB 1U3HC 2F5BH 3MO1A 4PY8J 5CSGA 4CU7A 6CGTA 1IAII 3BOVA 2X1OA 5EA0L 5C6WH 5I1CH 1HSAB 1DZBA 1Q9LA 2I25N 4RISL 4F9PA 2Q8BH 1UXWA 2P4AB 1T2QH 4OCRL 2F15A 2X7LB 3INUH 3WL9A 3SDXF 3VG0H 3LN5B 4M7JH 5D5MA 5D1QD 3GSNB 4O2CB 1JNLH 3JWDC 5E8EA 5B3JF 2K1MA 1URLA 4XB8A 1T0MA 1A3RH 4K7FB 4PJDE 2VRAA 3RIFK 3RGVC 4P9HL 1GGBL 3IB4A 3ABZA 5C2UB 2AEPH 2DWDB 1Q9WB 4V1DB 2HJKB 4JFYB 1SQ2N 1PAMA 5J9PA 3MV11 4S2SB 4Z78B 1MCEA 4NQCE 5HD8D 1AI1H 1F58H 1NC4B 2DTML 3OGCA 1DLFH 5AWNH 4JKMA 4PGZA 1BP3B 3HRZA 4AM0A 3TV3H 4U33A 5JIKA 3IDMB 4F7PB 1LO2L 5IHBA 1UKTA 1W72H 2LVCA 5C9JB 2NTSP 4MVBC 4IS6A 4M7JL 2FH8A 1WT5A 1QKZH 3HE7A 4GQ9L 4JANA 1KENL 1XT5A 5IHUL 5FHAH 1K9TA 2VQTA 5AUMA 4PJFE 1NGXB 5IQ9A 2CJUL 1G6RL 3T08A 3U0PA 1JJUA 2A6DA 4EVNA 5SWSB 3GBNH 3V6OC 4DGVH 3WKML 2DM2A 1B6DA 3O8XB 4QRRD 4AL8H 2HFGL 1NAML 1WBZA 2VLKA 1BWWA 5ADOH 3M07A 5F6IC 4YUEH 3O0RH 1QFUL 5FM8A 4KDWA 4C83B 1K3IA 1DQDL 1P9MC 1C08B 1KULA 1LK2A 4OAWB 3ESVF 1EFQA 1ADQA 1MSPA 2LTQB 4Z7WB 1BHGA 1H8OA 4NP4H 3GO1H 4MJIA 3HZKB 4EOWL 1JNNH 4ONFH 4ZFGH 2ESVB 5GIRB 1Z5LB 4JJ5B 4TVPL 1BOGB 1W0YT 3FONB 3LN4B 4H8WC 4LASL 4NQCD 3EO0B 5IEKB 3MJ9H 2OXGA 4RFEA 4D3CL 3DMMA 4PRIB 4UNTA 4QHKI 1XGYH 4M3KB 2ZCKH 4FG6C 2AKRA 1TLKA 1G1YA 1RI8A 4BFIA 1W0WB 4R6UA 1AD0A 1KB5L 2BSED 4KI5D 4BELD 4KK6C 5ITBH 2D9CA 1LO4L 2VR5A 4PJFA 1Q9KA 4B7LA 4G6JH 3MLVH 4NNYB 3HZKA 3MRNA 1S7SB 4LDLB 1P7KA 3GSNA 4NKDA 2GFBB 1S9YA 3RY6A 1NAKH 3QXTA 4R4BA 3VFPA 2DQDL 1J8HA 2W9EH 1SEBA 3TV3L 5F9OH 3CH8A 5ELIA 3IDIA 4UI2A 3Q5YA 4UTAL 1UXWB 2HAZA 3ZDZF 3OSKA 4DOHE 1WC7A 3I84A 1DQTA 3U30B 4HEME 2XKUA 1XAUA 3T4AA 4HC1L 2DKUA 5C6PB 1MJ7L 2X4PA 5DVNA 4K94H 5L9DL 4QCIA 5D7JC 5E2WH 4HFWA 5SWZD 3SDCC 3ETBF 2VZTA 1JGUH 1NGQL 2R1YB 3KPPB 1RZGB 2BMKA 4JZNA 3FOLB 5IB2B 1J8HD 3E3QE 4D2NA 1NLDH 1II4E 2B1HL 3IJHB 3ZKXB 1VGKA 2PW1B 2BRRL 3FQRA 3UXFA 4CNIA 2FHCA 1IC4H 3GB7A 3WMSA 4U2YA 3L9RB 4K2UL 3SDDA 1G6VK 2B5IB 3L1OL 2MQCA 3CUPB 1KIPA 3DIFA 4XXDA 3VXRB 3NFPA 1W0VA 4Y8AA 1FNSH 1EK3A 4S2SA 3KLAB 3CCHA 1T22A 2BSTA 4JVUA 1T7XA 3ORJA 4YHZH 5T1DL 3HNTH 5KSBB 1NAMA 3QRGL 4WVRA 4JFZH 2J88H 3IFLL 2DQTH 3OAZH 3W82A 4Q9RH 5FUOL 1I8LC 1JWMA 4HHAA 3BQUC 3THML 1F42A 3HG1A 3ZE2F 3WCYA 1IC5L 3IRPX 5I16A 3CPLA 5KAQG 2H2SD 1IBGH 3L3GA 4DEPC 4X6DE 4JFXA 3GMLA 3RKDC 3DO3A 3OWEA 1IGIL 4HIIB 1BQSA 5EU6A 4PP1C 4JFDE 3U9UB 5JW4Q 3RIAF 1V05A 1IGJB 1ZS8A 4D9LH 2K9UA 4X8JB 5IBUB 5K9OA 4MB3A 4XTRD 3W11D 2H45A 4RAUA 1OSZB 1T7WA 3FFCD 3D48R 1FGNH 3B9VA 3R8BB 1KGCE 3MRMB 3N1QC 5HHOE 4FXKB 3RVTC 5JOFB 2NR6D 3HE7D 2IPUG 3BPNC 2Y72A 3GKWH 3MRMA 3TBTA 3DJ9A 5AYUH 2VLRE 3U6RA 1G7HB 3AC0A 4N8CH 1QP1A 4NC1E 1EFXB 3GSOA 3QP3A 1I7RB 4MLIA 1F3DH 3SE8L 3REWA 2EDXA 2JJTC 3FO2A 4LRIA 3MGOB 1FC1A 3QUMA 1CXEA 3OTTA 1HXMA 1BBDL 5GZNC 3MRBA 3LMJH 3ARBC 1EHXA 3OKOB 3P30L 1MIML 4QF1B 3W5NA 5FFLA 4GBXB 3TPUB 1XF4B 1JTOA 4PJEA 3ZDXE 3LIZH 1E4WL 3KHOA 2VWEC 3OX8B 4HIJA 4FQCL 1IGMH 1AFVL 2A6IA 3D9AL 1F00I 4Y4KD 4BQ9A 1I1RA 1BJ8A 3WO4B 3JWDH 2P8LA 4L8DB 4POZD 2A0LC 3WUWA 2LFGA 5I30L 2C3XA 4R4FL 3SKJH 4EIZC 2DLFL 1W8OA 4NKIH 5I1DB 2R2BB 3QEHA 5DUPL 4Y4HA 2YMXH 2WLZA 5D5MF 1KJ3L 3DNKA 3DGCR 3OR6A 4GKNA 5IJKC 2FIKA 4YH6A 2NXYB 5HVGB 4TUKL 4IHOB 3S37H 2E6PA 4BFEA 1JPSL 3B8YA 3O6KH 4OCXL 3BGFC 4GRWH 2GCYB 4G9DA 1OW0C 3AXLA 1E4KC 1JGLH 5I1HL 3ARVA 4P2QB 3PL6C 2B2XH 1VGEL 3LKRB 1ETZA 3OG4B 5ISZB 4GLRI 4HAGA 2JK5A 4QXTB 5DMIL 5AZEL 1MREL 5I1EL 3WD5H 1RHHA 3B3IB 2Z91A 2VISB 5GS0D 2ATPA 4HV8B 3MFGB 4KROB 4EN3C 3X12B 4QRRA 4NWUL 5I2IB 5EORL 1T1WB 3VFTA 2BRQA 3TN0A 2N1KA 3LV3A 4G6JL 5J6HA 4Z7UA 1AGCB 3ARFC 3BZFB 2MKWA 4YWGH 2FBJL 1NMAH 1SHMA 1U2CA 4UT7L 4QXTA 2Z92A 4Q6IB 4M62L 1JPTH 4U1HA 4LPXA 1ZOXA 2ED7A 3O6FC 4N0RA 4YQXH 3H9HB 3WFEH 1CD8A 1RJLA 3CFBB 4P5MB 2ZCHL 2IBZY 4WHDA 2JKXA 2HTLD 4LVOC 4DKFH 1FLRH 4IRZL 2Z31A 4G8GE 2XY1A 4I77L 2QHRH 1S8DB 3EYVB 3AUVA 3A6BH 3KPRD 4R3SB 4DK6A 4HGWA 1AGDA 2DL9A 1CL7H 3FQNA 4NQVA 1NJ9A 1WZMA 4GXUM 1JWSB 4IIQA 4H1LH 1JMZA 1PKQE 1Q9OB 4OGAD 2JJUA 2V2XA 1XGQB 25C8H 3KPRB 5HYJB 4NQDD 3WBDA 3MRDB 4X4XA 5DJ2B 3QAZB 5ESVB 1TITA 1FVCB 5I1AB 2I5YH 3QRFM 4J23A 1XCTA 1CR9L 4PR5B 1A1MA 5CEYA 3L5WA 1CXIA 4N0YL 4XMLL 1JZ3A 1J0KA 4QRTA 4XRCB 3TVMC 2YPKA 2X42A 4DCQA 1AHWA 1IL1B 2D03L 5B8CA 5CD3B 2WIMA 1AGFB 1QSZA 2GK0A 4KRLB 5BJTB 1KIQB 2NY6D 3VXRA 4WO4B 4KTDL 4X7SL 2K3TA 1ZGLM 2CIKA 4KUCF 3FJTA 4OB5L 1BAFL 3S4SA 1EXUB 4FTVB 4XP4L 4OD1L 3T77A 1TVHB 1FAIH 1ZA6B 1UWEH 3QQ4B 4KZDL 3VFWA 3TWCH 5C6TH 5BZWB 4FA8A 2IANA 1UCBH 2DKSA 4YXHL 5C0BB 4N8VA 4FQHB 3ULVL 4X8JA 4G6FB 4PJ9A 3UTZB 1KB5A 1AQKH 4P9HH 2AERT 3ALPA 3JV6B 4Y4FA 4NUGH 1C5DB 3ZO0A 3KXFE 3HE6D 3LPWA 5E1AA 1N7MH 4P23D 3FQXB 5DMKA 2AXFB 4K23L 1QO3A 1UB6B 3MYZA 4S1QL 4HWBL 4OLYL 3GJFA 4ZOBA 2JTDA 5DURD 3TT3L 3O45A 3TBVB 5I1IH 4ZYKA 5F3BB 1YNTA 1G1CA 2QR0A 4KZEL 1FH5L 4ZUWA 1HEZB 3QDMD 1AC6A 1VEOA 2O5XH 3TO4A 3PWPE 3PABB 2BHZA 4DUWA 4R26L 2KL6A 4LFHD 3ARFB 3G08B 3WKNA 3C5ZD 5J89A 4CL7A 4Q9CA 1F90H 3NCYP 4QTHB 1FVDA 1BZ9B 3O4OC 4EUPA 2H2SC 4M5YH 2JB5L 2CKBA 2XQBL 5I1IL 4ZS7L 3SPVB 3EOAA 3VGAB 1I75A 3EFFB 1J8HE 5HI4C 4HWBH 1N59B 4P2OB 3V5HB 4F7TA 5HGAA 4I0CC 2NY3D 3DETD 2P24B 3AFLA 5HHNB 3BD4A 2YD9A 3MRCA 2EYSA 2VLRA 2HRPH 3MV8B 5J57B 3DUUA 3CDGB 4HJJH 3VW3L 3C6LB 1ZMYA 4UZGA 3VMOA 2WQ8A 1F6FB 4JFEB 1RJYB 4X6CF 2Q7NA 2FX7H 1MRFL 1QLFB 2BVEA 1EHLH 1CIDA 2AABH 1I9EA 4KGJA 2F8OA 2AI0L 3B8SA 5C0CE 3VXUA 2N7BA 4ODHL 4ZPVB 1H9VA 2EEAA 1JZ8A 2NY4C 3VCLB 4ODSH 5F1NB 3SDCD 4G6AC 1BIHA 1KCVL 1GZPA 3BE1L 2PO6A 2HFFB 3QDMA 1FV1A 5DSCA 5F89B 1OAKH 1E4JA 4QHLB 5GSVA 4V1DE 3GMPB 3LN9A 5MERB 1R3IH 5BZDA 3DI2B 1AR1C 1IM9B 5TPWH 4NHUB 3O4LB 2I9TA 4P4RA 1A6TB 3HFMH 4MD4A 5IW1B 4XPHH 2NY2B 1WBXB 5TDOB 4R8WH 5CCKH 1D6VL 3CDCA 4KDVA 5D96C 4JFZL 5FYKH 2Z93B 2O61A 3PWJA 5JORA 1HQRA 1B0GB 4M1GL 4JQIL 4ZUTB 4E41A 3MJ8A 4L3EE 4PLKC 1SEQL 4B0MM 3G5YA 2SEBA 4L8CB 1FFOB 4NQUA 4NO2B 4N5UA 2YXFA 4KQ4H 3GMQA 2G5BA 5BRZE 3U9PH 4HG4J 1PW3A 5BXFB 3HPJA 4NO5A 3GJFB 4AT6A 4UUJA 1OCWH 5FM5O 2BOBB 2X1PA 3FFCE 5DEFA 1D5ZA 4QTHA 2X09A 3F7YA 4YFLF 5IQ9B 4MJ5B 1T04B 3P9LB 4PRIE 1SJXA 2RQ8A 1SBBA 2K7QA 1NMAL 4QXUL 2EECA 3ARBA 5SX4H 4ETYA 1Q9WA 4V1DA 1TCMA 1NC4D 1BQLL 4GRLB 3IDMA 4N8PA 4PJXA 4FMKA 4W6XB 2QR0B 4FQ2L 4WJ5B 5DD3L 4JZOA 5DVMA 1NLBH 4PJ7E 4G8GA 1S7RB 1T0MB 3TESA 1KG0A 3TBYA 3ZT5A 1IEHA 4H25A 1UB6A 3NFSL 4GRLD 4TSCL 5GGTA 5FUCC 1I85A 2AGJH 2D0HA 4JFYA 1DBMH 2EZ0D 3HUJA 1CDCA 1J8KA 3RWDA 3HR6A 1MHPL 1KJ2B 2VO5A 1RZKL 2R0WL 3GSRB 2XG5A 1GPOL 4NZTL 4HFUL 3O6LH 4OCXH 1K8IB 5D7SH 2DBJA 4PJIE 3EGSB 3S37L 3MLYH 4KGLA 3VI3F 1NKOA 1QVOA 3CLFH 4ZOCA 4G80A 3NCFB 2ZOKA 2EYRB 5KOMC 3HAEB 4R2GD 4P4KB 5C08B 4O5LH 5D7JB 4PG9A 3MBXH 5I1AA 3WLWC 5JHDE 2GY5A 5K59F 1LD9B 1KPRB 1I1FB 1IAIM 5FGRA 5HPMA 3QEQB 4LVHB 4XP6L 1YEHL 1ZLVK 2X05A 5DK2B 3ARED 5I8EB 1EJOL 5DFWH 4ALAH 3S96A 1UKSA 4K8RH 5DD5H 1MQKL 5ESAB 1DUZA 1UXSB 3MRKA 2OTUA 4YUEL 3BJ91 4PJ7A 3FQNB 5DRNB 2VZ3A 4NT6B 1ZGLB 3L3JA 4JM4H 2F5AL 2DQFA 3KWWA 1U91A 3P77A 2XACC 5C09E 2HKHL 4N5ED 3GI9H 1CYGA 5GGQL 3VFUA 1DSFH 3EJJX 2IANE 4PG2C 3RDTB 1TVBB 4PJDB 3PHQB 1T4KB 4OD2A 2GTWB 3EO9L 3WLWD 5E7BA 5E7FA 2R2HA 2R15A 1MJUH 5GRVK 3QDGA 1A3LL 1YN7B 2FJHB 3QCVL 1U8MA 4XCEB 1D5BA 3BH8B 1A6UL 3O3BB 3DUSA 3TIEA 1AY1H 1OL0A 2YRZA 4IRJB 1NGZA 2H9GB 4XVJH 1DUYA 3CZFA 3CMGA 3CXHK 1EO8H 2NY0D 4KQ3H 3FO2B 2AJYH 4G8GD 4QRRB 3VXSB 3PIQA 4JFDA 4OLUL 2P5WA 5GGVY 4M43H 1H8SA 5FUCE 4P57B 5IF0A 3BVNA 1PD6A 3VD9A 5GJTH 4RX4A 3V4VL 3RKPA 2JIXA 4LCWD 5L8KB 2VR4A 3DX7A 3LRSA 5JQ6L 1UJ3C 1NCDH 1A7OL 3L3HA 3NPSC 3DXAB 4TNWF 4WDIA 3RWIB 1U8QB 4HW6A 4QGYA 1XF5A 4Q2ZB 2W9EL 3QZWB 1RZJL 5E99L 2WW8A 4PJCE 5LGJB 3BWAB 4LCUA 1H15B 4ZUSA 2XWTB 4WWKB 3QH3B 1HXYA 5FV2A 4YZFE 3THMH 3QEQE 1DBAH 4HXAH 3MLPA 1DTUA 2BERA 3EOTH 4XAWL 2A73B 2NR6C 3QUYC 4AEIH 1I9RL 5JHDB 3CFJA 2VYRE 4QRSA 2YKLH 4J3OC 4QRUB 2W1NA 2GK0B 1UQSB 4X4ZA 1O5DT 1C5BH 4WCYL 8FABA 1CWVA 3AU1A 4D94A 5DI8B 2J4WH 1CGVA 1U92A 4FFWC 4PRHA 2UWEA 4LCIL 4TQEL 3U36B 5DJ8A 1FPTL 1A0QH 2UY6A 1J0ZA 3BKYH 2BXZA 5HY9A 3WEXB 1A8JH 1FVCA 3BSZL 3VD5A 4TVPH 2ZUWA 4RAHA 1WFTA 3UYOD 3BHBA 5EC2A 4JDTH 3MRDA 2BSSB 3CVHB 1MRDL 4N0FB 1CL7I 4AH2B 5E4EC 1N8ZB 3W9DA 1JTTA 3FT4B 2DM4A 3VGFA 3BQUD 4UINH 4WEBH 1UJTA 1MQ8A 1AD9B 2EDOA 5I17A 5IHZB 4O9HL 1S7RA 1YMHA 3A67L 2C1PB 1MJ7H 2YUVA 4O00A 5E08H 1YYMH 1EVUA 4HGKC 3HB3D 5J11B 2OZ4A 4U3XA 5EO0A 4NBXB 4PRBA 4PJEB 4UTAH 3NABH 4WFHE 3WKMH 4LF3B 5JDSA 4EN3D 4G7VH 3FRUB 5HDBF 3NCJH 1RURL 3VH8G 4UT9H 2F54D 3CFIC 1YUHA 1N8ZA 3W9DB 2XICA 3MRQA 1EDQA 3ULVE 2IBGA 4CVZA 4M7LT 1NBYB 2B1AH 2OMNA 4LNRA 1UQSA 4I8DA 2BZDA 5H94B 3ULUH 3VFGL 1I3GL 1KF9B 3I2CH 3BN9C 3RU8H 4YC2C 2UWEE 4MHHI 4EZMA 2FHBA 3ESUF 1NEZB 5I19L 3V2AR 1I7ZB 3S36H 1TXKA 4XNMB 1WVZA 4GLRH 4XNXL 3UEZA 3GFUA 5DD1L 4GMSH 2AAVA 1YYML 3IVKB 4R4BB 1QLRA 2GSGA 3HMXA 4OTXL 2J5LC 1G7LB 3VWJA 3VMPA 1FZOB 3ULSA 3X3FH 1DANU 2EDFA 3B9KD 4GKZA 1GGBH 4LARL 1MREH 1ERNA 4MX7A 2CRZA 3ARDB 1EZVY 2YPVH 4QNPF 1MCOH 4PJ5A 1A7QL 1A7BA 5B21A 5LQBL 5IFAL 4PY8I 1DANT 1KPVB 3BZEA 4XXCA 1JF6A 2OLDA 5MEOB 1VEMA 4LAQH 5EFIA 5CLWA 3IKCB 4FTVD 3P9WB 4L8SC 3D3VD 3UZEA 2I60L 4LEXL 3KYMA 4WU5A 1UA6H 2D31A 4RGOL 1FVEA 2FATL 3GM0A 1K4CB 1PZ5B 1G7JB 1U93A 3RL1A 1CLYL 5IBTL 5FAAA 5EG6C 3KGRA 3U7YH 4WHYG 4NKOB 2H9GA 5IVZA 1WIPA 1PG7W 2CIIB 4K3DL 4NKMA 5GISL 4Z6AT 5L2JB 4XXCC 5JXAL 4KKBD 2SEBB 1D5ZB 1N2RB 3L5XH 3EYSH 5C0CA 2RCSH 3I6LD 3LQZB 2ZNWA 1EVTC 4IOIB 1GGYA 3JWDL 1PYWA 1Z6JT 2BNQD 1DUZB 4NNXB 1F11A 2BY2A 2CO7B 5GGVH 4RA0C 1A6WL 3SDYL 2H26A 5D1QC 4E42A 1EGJH 5FA4B 1QUNA 3P30H 1LO0L 1XZ0A 3SCMD 3U0TA 4C59B 3MV9B 2ICWA 3G6AB 1KPRA 4RGNB 3HUJF 2XN9B 2NX5E 5DUBB 5TQ0L 1JZ2A 1PLGL 3DYOA 4FQJH 4PP1D 4EI5B 4XPGH 2AJYL 5KSAC 5JIPA 3TBSA 3RNKA 2Q3ZA 5E56A 3OKEA 4KMTH 4DFHA 2AJXL 5ISZD 4HXBH 5ACMA 1WBYA 4RRPA 1KNOB 4P3DA 4PJ8B 3CSBA 3HN3A 2AJVH 1IGFL 4U1KB 2IBBA 4MS8C 2GUOB 4NUJA 5CEZH 2P7TA 1NFDF 2V6HA 3FO9A 4FZEL 1OAQL 5F89A 1OTSC 4PGBB 5GRZA 3B6SA 4RDQG 3MRPA 2NXYD 4UNVA 5SX4I 2NX5D 5ALCH 2BNUB 3E6HB 4WI6A 3DV6B 1G7IB 3GRWA 1ZVYA 4LKXB 4CDHA 4S1SH 2HKHH 1VADA 1FQ9C 4MMXC 1UC6A 3DVNB 1G7MA 1HKLL 1Z9MA 1LK2B 2GYSA 2VZVA 2L0DA 5BS0A 4PB9L 5C09B 2DQIH 3FT2B 5ISZE 4CUCA 4WTZG 5DGRA 3DVIA 1MHCA 1NDGB 2P24A 5I75B 2XFXB 2Y07L 1Q9LB 5FOBA 1IGCH 4WHYH 4KDTA 2VSCA 2MFNA 2YR3A 1D6EA 2FB4H 3C6LD 3F58H 4TUOA 1NMCC 4L4VA 4MA1C 4P2RB 1IAIH 3IFLH 1OSPH 3O6MH 4PB9H 2APFA 4O02L 4BSJA 4WWID 4P23C 4P2QD 4MJIB 4WI2A 5C07A 4WY7L 2H6PB 4WV1C 3PXHA 1EUTA 1MFDH 4JM2A 4JFOA 3BYYA 3S5LA 4UILL 3QNXA 5D7SL 1GC1L 3WLBB 1MH5B 3D2UA 3QQ3B 2OP4H 1G7QA 5LXGL 4FFVC 2VLKB 1R3HA 4N0UA 2MNUA 3VMNA 1M7DA 3L5IA 1L0XA 2EH8L 1EEZB 5JNYB 1BJ1J 5KJRL 4JCLA 3GMNA 3EHBD 3HZYA 4NO3A 4EVNB 2HG5B 2PETA 1CT8A 4L4TA 4ZXBC 1TJGH 3RWEA 4U1GB 1J1XH 4Y4FB 1ITBB 1D5IL 4RBPH 3RNQA 5D7IB 2NY6C 1PG7H 4MAYA 2EYTB 3PWLB 1VDGA 1BQLH 3MJ8B 1FZKB 4ODVH 1K2DA 4LQ1A 5IV2A 1W72A 4O51A 5EZLB 3UJJL 1YA5A 5F1NA 4LPCA 3QQNA 1I1AB 4LHJB 3FN9A 3MA9H 4OKVB 3EOBB 1LEGA 4U49A 3RU8L 2GSIA 4YHYC 1I3GH 4IMKA 5D1ZA 4OQ1A 3MOAH 1OCWL 1CQKA 3BN3B 4PGCB 5GGUB 2VAAB 1XEDA 5IEKA 4HULB 4FABL 1TZIA 1IAOB 3FB5B 3AVEA 1M71A 5DTFB 1Q0XH 3WFHA 1RIUH 3QO1A 4ELME 4P46A 1FAKT 4QT5A 1VADB 1MUJB 3W39A 4UV4H 1RMFL 5T5NF 4M6ML 4ZSOA 4LAQL 2YPKB 2X44D 3FQWB 1KJMB 4ODTH 4PJ8C 4XP1H 4YHPA 4M9OA 1OF2B 3DHJA 4FFZL 3JWNC 5EC1B 3C09B 4D9RE 4QOKA 5LQBH 5ICXA 2H8PA 3NZ8A 4U6VL 1CT8B 3T1FB 1T20A 4LEOB 2QADB 1BECA 2IGFH 2R0LH 5TPWL 2K7PA 4OCSH 1R3IL 2DI8A 3D69B 5INCB 4WFGD 1U8PA 1OP3H 4S1DD 3STBA 2ZOLA 1IKNC 2QQLL 4YDIH 5H35B 3UO1H 3ZHDA 4POYA 4HH9B 5EU3B 3V6OE 5T1MB 5CKGA 3EYUL 1JHKH 5EO0B 4TRPH 2R56L