2FLBT

Discovery of a novel hydroxy pyrazole based factor ixa inhibitor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
200
structure length
151
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGDERTLVRRNNTFLSLRDVFGKDLIYTLYYSVQAVIPSRTVNRKSTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Discovery of novel hydroxy pyrazole based factor IXa inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 37
structure length 151
sequence length 200
ec nomenclature
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2flbT00
3M1BA 2YPLE 4Y5YB 1CFVH 4OKVB 5AUMB 4X6CB 1HHIA 3QDHA 3T4AB 1UQSB 1UFUA 5DUPH 4ZUSA 2Z4QB 3FO1A 4G6AD 4BK4A 2LABA 3N85L 3MRHB 4LOUD 1FO0A 4G6KH 3UO1H 2B7DT 3PHSA 3QO1A 3R0MA 1EUTA 1XR9B 4HDIA 2PO6D 3E3QE 4ZS7L 2R4SL 3QCTL 3MLZH 4JZJB 2D7PA 4K9EC 3KPSB 4OCSL 5I30H 1G7HA 2AEQH 2VLLB 4RFOH 1ZWIB 2N56A 4NZUL 5GRXG 4HFUH 4I77H 3OGOE 1B0GA 4YDVB 3SE9L 4QOKD 1BVLB 3K2UH 1HHJA 2F54D 4PBWD 5EOQL 1R5IA 3D85D 4O2FA 1S7XA 2D7NA 4Y2DB 1NFKA 4WENB 5EFIB 4RNRB 4PJ5A 3JV6A 4Y4FB 5CJQL 4JLRA 5ICXA 1IAIM 4OGYH 5JNYA 1IFHH 3WDJA 3CC5A 3I3BA 2OSLB 1A8JH 4NQCA 4BFBD 2HKFL 4ZUVB 5IB4A 3LQZB 3TNMB 4LGSB 1Z3GL 4O5LH 3HPJA 2VDKH 3FOMA 4PLKD 1L6XA 4I9WD 3UZEA 4WW1B 3TPUB 1MJJB 4LARL 3HFML 1ONQA 1TJHH 4L3EE 2XWBB 3E6HA 4J3TA 3MV9A 3FB8A 4U6XB 2VLMD 4Q2ZA 2QADB 3CLEL 3FT4A 4PY7A 4LLWB 1FYHB 3ISWA 4J23A 2QSQA 1W0VB 1I3GL 4LSVL 5LGKA 5GSVB 2VITB 2IBZX 4LKCA 2J8OA 3QSKB 4X7EC 4NKDA 4JRXD 4AENA 3U4EA 5IGXL 3QBTB 5DK0A 15C8H 1Q0XL 4LIQL 2DD8L 2E7HA 4HGKC 3JV5A 1NMBL 5EG6C 4TRPH 5DJZB 5BO1L 4P23C 4X9HA 3M45A 4XP6H 1TZGL 1NUGA 3JUYA 3T77B 4CVXB 1K8DA 4G80A 4RA3A 4IDJL 5IVZA 3TT1L 4HWZB 5EUOE 1JNJA 1F5WA 3MREA 1TZHB 5ADOH 1KOAA 1QZ1A 1L7IL 2ZSVB 5IJVB 1QHOA 5TE7L 4TNWF 2YPVL 3N1MC 2VLRD 5DDHB 5GGVH 1MNUH 1F97A 3T2QA 4UIMB 1CGUA 4GJTB 1HSAB 3VW3L 2VZ3A 3SPVA 1CYGA 2EKSA 4HV8B 3IVKA 3O3EA 3LS4L 3DO7B 1MI5B 3CXHJ 4I3GA 4NO2A 2FHCA 1JGEB 2KZWA 5J11B 1JNHA 2QHRH 1FGNL 1QRNA 3SJVB 3CXHK 1MRFL 2IH1B 3BDYL 4PJFF 3BN9C 5KVDL 5C09D 1KSRA 4PJIA 4JO2L 1WEJH 2LU7A 1BMGA 1YNKL 3HC3L 4LVHB 4F58L 1A0QH 2IBBA 3LV3B 1GVIA 3B9AA 4FTVA 5MHSE 2AV7A 3GGWA 2R69L 3QIBB 1VKXA 1QEWB 1RUPL 5EN2A 1KCSL 3B5HA 3K0WA 5F7EL 3WKML 5SX5K 1BFOA 4EI5D 2OJZH 4PJCF 4OCNC 4JVUA 4HC1L 2P48B 3ULVD 3O11A 3U0WH 1AY1L 4YHNA 3BZFA 2NXZC 3RPKA 2A6KB 2PTTB 3IDYC 1YMME 2CDGA 4YHZH 5B8CA 1R5VB 4UUJA 3GMQB 4F3FA 4RCAA 1KLGB 2KQMA 3PWUA 5GS3A 4OF6A 1GPOH 4TVSa 2P8MB 1K4DB 5MEQA 1TXKA 3QI9D 3GMMB 2H8PA 4MNQB 4PRIB 2XZCH 1HI6A 1I8LC 4JHAL 4RAVA 1Q9OB 2ADJB 4U1LA 4EN3C 3RY6C 1GJIA 2FECI 4MA8L 4E0RB 4JM4L 2WM0A 3LEYL 1AKJD 4NUGH 4IRSB 1YNLL 1FIGL 5C0GB 3VFGH 3LS5L 1YQ2A 4WUUE 4APQA 3UTSD 4G7YL 4KKBC 1CQYA 3MV8D 3U30B 4HS8H 2E7BA 2X4QB 1MFNA 3ECBB 5DFTA 3ULUL 1HNGA 4U6HB 5IBUG 1N7ML 1DUYA 4BSWB 3STBA 2F5BL 5IFJA 3GI9L 5KSVB 2Z0BA 4DUXA 4R4NC 5AD0B 1BPVA 1MCPH 3QXWA 4OLXL 4BA8A 3O6LH 4CU6A 4AIZA 3DI3B 1XGUA 1LP9E 1BQHG 1EO7A 4NO5A 4PJEF 5GZND 4HIJA 4YHOL 5JW4N 3VD4A 1CE6A 4EJ1C 2ZUWA 2QEJA 5I1EH 1G9EA 4UOW1 1E28A 1A47A 1DBJH 2I25N 4CADB 5LWYL 1ZSDA 3BP4A 3QUZC 2Q8BH 4XMPH 2YSSA 3QWQB 2VISB 4B0MM 2AERT 5K9QG 5D8JL 5MEND 1QLFA 4QRSB 1JE6A 3EJJX 4U7MA 2CK0L 5E6YA 3VG0L 4QHNA 4C59B 1GGBL 3W5NA 4NHCL 1JUFA 4MVBC 5GS1B 4R7DA 1RURH 4KTYA 4DW2L 2R9HD 4HSQA 3BP6B 1MCIA 2ED8A 4QXWA 1Y0LA 4WFHD 4ZYKB 4Z7WE 2G60L 3NCCB 4ONHA 4PJDF 1MCJA 3T0BA 3GSNH 2KUTA 2P5EA 1URLA 2R56L 2QKIA 3GSOA 4KVNH 1RZ7L 1LK2A 3HC0A 1WFUA 4LVNC 3J8F7 1QSFB 3QFJB 4NZRH 5DGRA 3CVHA 3WNPA 2ADGB 4KGJA 2C26A 1FE8H 4R7NB 5D9SA 4K23H 3ME0A 1EVUA 1HQRA 4OUUA 4ZAKA 3RX5A 2NW3B 5F7UA 3FFDB 3WHE0 4IRJA 2V7NA 1ZLVK 2NX5B 1AGDB 3L6FB 3N85H 1AXIB 2BSRA 1OTTC 3MRNB 4HAGA 1I1AC 4JN2B 1MIEL 4GW5A 1T7VA 1KJ2A 4B41A 5D96B 3KWWA 1OTUC 4O2EA 4Z7OF 4ZS7H 2F53B 2R4SH 5DC9B 3STLB 3QCTH 4J8RA 5I1LA 5HJ3B 1FSKC 3PL6B 4OCSH 1DQML 3FCTA 4NZUH 5K9QI 1KUMA 4PG9A 5FGBC 4Z7VF 4QHUA 1HHGA 4BSVA 5J89A 1EO8L 2BVQA 4IRZL 4LCCB 4MXQC 1S8DA 5HHMD 5EOQH 1MCQA 4BFIA 3VFSB 3F8UB 4WWID 4JKMA 3OQ3B 5IK3B 5JLZB 4G8EB 4KRPD 3R4DA 4WTXA 4MD4A 4HQQL 5CJQH 3L3JB 1A7QL 2H41A 1J10A 4G9FD 1U8HB 3X13B 3FQNA 1G0DA 1Z5LB 2HKFH 4P9HL 5DI8A 3QUKB 3HAEA 2LTQB 4NUJA 5C0RL 1Z3GH 3GEWB 3JSSA 3QEHA 1G1CA 5LGJB 4K94C 4ZOBA 2Z91A 5EU6A 2DJUA 3MRJB 4LARH 4QHKI 2GJ6D 4I2XE 1XF2B 5CIPB 3HFMH 5E2TH 5GXBB 2V2XB 2WW8A 3ULVF 4XBEL 2YXMA 3IDGA 4IOIA 3E2HB 4JHBA 4Z0XA 4J12A 1YY9C 3CLEH 4FQXD 4O2CB 3HG1A 5CEYB 1QR1B 4QXGL 1PGRB 1AD9B 4LSVH 2HWZL 4N1EA 5F44A 3CNKA 4HCRA 3MRDA 4JEGB 3WCYA 5FA3A 1FGVL 1I8KA 3K74B 3C5ZA 1JIBA 5IGXH 1XH3B 3LSOA 1OCWH 1AQDB 1HNFA 1YDPB 1Q0XH 3V5HA 4LIQH 2F8XC 1NMBH 1ZVSA 5BO1H 1QHPA 4NSKA 1IGYA 1TZGH 1DQQA 1YEJL 4L1HA 1CICC 4FHBD 4LMQE 4PJ9C 4PRHA 5A1AA 3NGBB 4MNGB 1DLHA 4P2QB 3FRUA 3TT1H 5INDB 1T80A 3HI6L 5D7KD 1X5FA 3RDTB 3P0YL 2MKLC 1CFTB 2RR3A 4JFFD 2ITCB 3B9KC 5TE7H 1NC4B 2YPVH 2C1PA 2ICEB 4Z6AT 4LSUL 2H2PC 3DVGB 5ENWA 2ATKA 5E00A 3TFKC 5FOBB 4GFTB 1AGEB 3G5YA 3BW9B 5ILTL 4N8VA 3VW3H 3E6FB 5FKAA 5IB1A 1CTOA 5D5ME 5I15L 1DFBH 1G6RA 2Q3ZA 3LS4H 4WHYH 4YNYB 1OAQL 1F3RB 3RTQD 2OYPA 4HULB 5DRZA 4M1CD 1DDHA 5EPMA 1PG7W 1X5YA 1RIUL 3MV7E 4NBYB 5D7IA 5DJDA 1QTYT 3G5ZA 1ADQH 3GMPA 1FGNH 1UZ6F 3F6IA 3ZDXE 4PRAA 2B0SL 1MRFH 3TZVD 3BDYH 4ODTL 5KVDH 4X6EB 1PJ9A 3VMPA 3HC3H 4F58H 4XPGL 2BP3A 4GRWB 3DECA 2R69H 4UU9A 4YBHA 5IBLC 4AIXA 1OP5H 4QHLA 5FYLD 3QUMA 1KCSH 4JM2D 1LEGA 5CSZB 5F7EH 3WKMH 1LO4H 5CCKL 4Z7UE 1RZ8B 1JF1B 4HC1H 4HIXH 2OSLA 1CI5A 1CFBA 1GGCL 2R1XB 3VXRB 1CR9L 4V1DB 1U93B 4KK6D 4OD3L 1HQ4B 4IEFB 3CK0L 1AXTL 4GUPA 5DJ0A 5F1IB 2ZUXA 1YPZE 4GG6F 4YDLB 4S1QL 3F5WA 3PGCB 4A6YL 2WAHA 2KQNA 4LHJB 1ZHBB 3EYQD 4JHAH 4X7DC 2EDWA 5CJ8A 3UTTD 5BXFB 2FJHA 3O9WA 4MA8H 4PV9B 5HGDB 5D2LF 4FNLL 5B3JF 5E08L 4JM4H 3MJGX 4FZ8H 2G75B 2XRAL 3LEYH 4GW4B 3DMMC 1JPST 5ACZA 1YNLH 2WIMA 1FIGH 3VXPB 3LS5H 1FDLH 4GRLA 4O02L 5EDXA 1KLFA 4H0HB 5T1DL 4G7YH 2I9LA 4OZGB 3HE7C 1PYWA 4ZFFB 1HDMA 1TQCC 3OKEB 5CBEA 3FT2B 3ULUH 3V79C 4IHOA 1TVHA 3ARFB 1N7MH 1JYVA 1YEDA 2F5BH 2VZOA 4N8PA 5HI3C 5DVNA 1Q8MA 5L2KD 4FQQA 4G7VL 5C07A 5DD3L 1UZ8B 4OLXH 3Q5OA 1A2YB 3V7AE 4QRPB 1XZ0B 5JW5B 3FHQA 3BISA 1KB5A 2ENSA 1AIFA 2VQ1A 1RJZB 3KVQA 4RGNC 2FDBP 3MTRA 3A6CL 4Y1AD 4YHOH 4P57A 4UV4L 3GZKA 1TETL 2CQVA 2YWZA 3MA7A 3DVFA 3UCRA 1QO3B 5F7FA 3QPQC 5LWYH 1DVFD 1ETZA 3FQUA 3VGBA 4KH2A 3RNKB 3MQIA 4UIMA 1D5MB 4UQ3B 1CDIA 3OB0H 5D8JH 4Q0XL 1H8OA 4KZDL 2CK0H 3BEWB 1LO0H 3L5HA 4K3EL 5HHOD 5JPMB 2I9TB 2QHLA 1GGBH 5EZJA 4NHCH 2Y5EA 4HS3A 3UBXG 1U42A 4DW2H 2C5DC 3G6DL 2IAND 3FFCB 4BQBA 4LPYA 1JPTL 5C0CB 3VRJA 2G60H 5MEPB 5EBLB 5IVXB 4F7TA 4RQQB 3T0EC 5BS0E 5K93A 5F9JB 3L9RA 2DIJA 5F7WC 2R56H 1ZEAL 3HPLB 2VAAA 4JQIL 5DHVH 1RZ7H 4NN5B 3IDIA 1S7TA 1HH9A 3MCKB 3NFNA 2WWKT 4EKXA 4YHYC 2ZSWA 3S37X 1LHZA 3WIFA 1HKFA 1PKQB 2ADIA 3R8QA 4QHMA 2M1KA 1B2WL 3DX6B 3RVVD 5T5NG 2DTMH 4L9DA 3RZCC 3H0TB 5C0AA 5DK2A 5F6IC 2H1PL 5EOCL 5I0ZA 2A2QT 2NLJA 3QDGA 3L7EB 1DEEA 3SOBL 3LPGA 1MIEH 3IJYA 1ZLUH 1T7WA 1IQDA 5JOFA 3CFKB 4QWWC 4PJAB 5IEHB 5DR5L 5TGBA 2A6DA 2JJTA 4ZQKA 1KLGA 5I75B 4J3XA 4WIQA 5JDSA 3QXAB 1IGJA 1A21A 2DI8A 1EO8H 4IRZH 3P77A 4YDKL 5CP7B 4PLOB 4OF7A 3BH9B 1TPXB 3PABB 1NGZB 1JWMB 5E6ID 4HK0B 4HQQH 2ZWLT 2GT9B 1A7QH 1AR1C 5FYJU 4JRWA 4MQXC 5KOMC 4P9HH 5C0RH 4XI5C 4AJ0A 4EN3A 3RY6A 2BDNL 2DWDA 3TBYA 4YHPA 1CFSA 2VDQH 3DLQR 3RA7L 2DYPA 4OJFH 1KTLA 5HTSA 3QEQE 4JM2F 4BUGA 3FO2B 4Y4KB 4YO0B 4BKLB 2CDEB 4XBEH 3V0WL 1JMZA 4HBQA 1BFSA 2IMNA 2WLZA 4AL8L 5I8CB 3BP7A 3I02A 3PQYB 4PJHA 5IHZA 1TENA 4QXGH 5EC1A 1UJ3C 4YJZL 4L29B 1NC2B 4PP2A 3QUYA 2PYEE 1OTSC 2HWZH 4NNXB 1TFHA 2H6PB 5E8PB 3EYOA 1U3JA 2WZPD 3KDMA 5KSAD 3UBXA 1XMWA 2DAVA 3TIEA 5FYKH 5BW7C 3GSXA 4KUCD 1FGVH 3ARDD 1XGYL 2WK2A 3E3QC 3MV01 3RWEA 4QEGA 2VDRL 1H15B 2YN5A 5IR1B 3O4LD 3GNML 3GSQA 4JGMA 4MNHB 4I0PB 2A9NL 4KJPD 3K81A 4OT1L 5GRYA 3QUXC 2XZZA 5GS1A 2NXYC 1KG0B 1YEJH 1TQBC 5CBAA 3QUZA 3JV4A 4OGZA 1WZMA 5HHPB 3MRBB 1I7ZA 3GSVA 3NACL 5FO7A 1BD2D 2XZAL 1EEYB 3HI6H 3D2UA 2C9AA 3CMGA 4HH9B 4WVRA 1D6EB 3L3GB 2EDEA 1K2DB 4GMTH 4X6BB 2CKBB 4NRYB 3KYMB 4U0RC 1B6UA 4UNTA 2Y36L 1AO7D 4LSUH 3V6FA 1AR2A 4PJCB 3LPWA 3OAYH 3NCEB 3BQUD 1P1ZB 4ZPTB 5ILTH 4RWHA 5D7LE 1J0IA 4KV5E 4AQ1B 5GSRA 4H88H 3MFFB 2HFTA 5H2BB 2EYRA 2A0LD 4EI6B 2FJGA 1OAQH 5DYOA 3RIFK 1U8JA 1AQKL 3CSYA 5CKGA 1H3XA 1CU4L 4GLRH 1UKTA 3EDFA 3MBEC 2BOBB 4ETYA 1IM3B 1YECL 1RIUH 4WNQA 3KNBB 1Z9LA 3LKSA 3AFLA 1Q0YL 1WTGT 2B0SH 4GW1B 2PO6B 4ODTH 2E7LC 1MY7A 2V2WB 2PYFB 1CL7L 1HSBB 1I1AA 1KT2A 3STZB 4G43B 3FONB 1GXEA 4M3JA 4RFEA 2F8VA 3UPRB 3EO0A 4UTBH 1R0AL 5J1AB 1S7RB 2GK2A 4M8VA 4QOKB 2F54B 3JTSB 4MJIE 3D85B 5E9DD 5DUBA 3DX8A 5CCKH 4HUXA 4PB9L 3H9SA 1MWAL 5FGBA 3IDMB 2XTJE 5IOPA 4L4JA 2BJML 1GGCH 5F70A 4KRLB 3IU3A 3TO4D 1CR9H 5SWQA 4OD3H 5E03A 3QO0B 4ISVA 1A3QA 1RSFA 2XG4A 3CK0H 1AXTH 1TCRB 4XCEA 3ARZA 5F1NA 4KROC 3NZ8B 3H3PH 4A6YH 1I8MA 4IS6B 3U1SL 3EOAA 4ONOA 4MCZB 1TJIH 3SDYL 2YUWA 2P5WA 2OMBA 4FNLH 5E08H 4W70A 3GIVA 2XRAH 3S35X 4OM1H 4M6AA 1FC1A 1MRDL 4RMQA 3TVMD 3VWKA 4NQSB 4U31A 4O02H 5T1DH 2NY0C 2ERJC 1Q9LB 1FFPA 4AIOA 2E8ZA 2AQ1A 3HTLX 1C16B 4BQ8A 4PGBA 4JRXB 1T04B 4JFDD 2X1OA 1U2CA 1F6AB 3MA9H 4LSQL 4PJDB 5A43C 2MCPH 4WV1C 5MI0B 4G7VH 1DLFL 2P7TA 5DD3H 3MRLB 2HMID 3OKDA 5IW3A 4M5ZL 3QFDA 4LIQE 4GKSA 4NYLA 5EUKA 5D6DC 1A1OA 4JCMA 4OQ1A 4BZ2L 3A6CH 4JN1L 1NUDA 1S7SB 4UV4H 5CILL 1TZIA 1TETH 1FJ1A 3IFPB 1P4BL 1CICA 1BOGB 4M7LT 4WW2B 3OKLB 2HA1A 1Z9OA 1LDSA 5E2VL 5IT2L 3OB0K 3Q3GA 1J18A 4Z76B 5INCA 4UNVA 1FRGL 4S0TD 2VLRB 2Z8VC 4Q0XH 3KS0H 1EK3A 4F7PA 1FZMB 5IB5B 4LGRB 4KZDH 4OFVA 4K3EH 3B9KA 2E8YA 4FZEL 3U82B 1KJMB 3VFTB 3UDWC 3GMOA 3U0TB 4NQEE 3QDME 5AYUH 1D5BA 3KPRD 3OJDB 1A9BA 3RWCA 1JPTH 4LF3A 5BQ7B 4HXBL 4Z7VB 5JHDE 4LCUB 1ZEAH 3MJ9L 4U1HB 4G9DA 4JQIH 4HEME 2A74A 1OP9A 5SX4I 1MQKL 3HZKB 4OZHF 5E4EB 4O9HH 2BNUB 5J6GB 3L3DB 1TCMA 1OQXA 1T20B 2EDXA 1DQDL 1MUJA 3G08A 1ZE3C 4EVNB 1B2WH 1S7WA 4C83B 1ND0B 32C2A 1OAZL 3LB6C 1NDMB 3OKNB 3CVHL 3H9YA 3B5GA 1WCBA 5EOTB 2CLVA 3MYZA 2H1PH 5EOCH 3ZKSD 4PGEB 1LEIA 4Y5XC 1J8HE 1MCWM 3TEUA 3FQXB 1LGVA 1FG2B 3SOBH 2FSEB 5DQJA 1ZLUK 1FAKT 1MCNA 1RY7B 3DXAD 4ZXBA 4YK4C 1MHHB 4EUPB 3VXRA 3B2UC 3TNNB 1U93A 5GGRY 4YHLL 4FFZL 4G8IA 2KZ1B 4PB0L 1R3LA 2O5ZL 5DR5H 1JZ8A 2EDFA 4X8JA 4M62H 3WFEL 4XMKL 5E8DL 4K3HA 3CFEA 1P5UA 4YDKH 2JIXD 1NMAL 4JDVB 5MERB 4B53A 1TVBA 2BC4A 3BZEB 3EO1A 4H1LG 1U95B 5KG9A 1HHKB 3BH8A 4PY8J 4XP9L 2DQEL 3QI9B 4X98B 4WDIB 1QQDA 1N4XH 4LSPL 2OI9C 2YR3A 4ALAL 2HLFC 1CXLA 1V3MA 4HWBL 3IYLW 1D5ZB 1WBYA 1U8LB 3SDDC 5I76B 4D94A 1R24A 1WVZA 2FEEI 2BDNH 4XP1L 4ZFFA 4U1NB 5HYSG 3RA7H 2NY4C 5FKPB 3GSRB 4D0BB 3MV8B 3PGFL 4XX1G 3DMMA 3IDJA 4HZLA 5EU7C 3OGCB 1PZ5B 4U1KB 1U8QB 5GS0D 1A3LL 1QBML 1A6TA 3CMOL 2VLJA 2JB6B 1Q9WB 3UMTA 3HE7A 3WHXA 2HTKC 4AL8H 2AAVA 3ULUE 3NOIA 2LE9A 3B3IA 2ZOKB 4CDHA 2ICWB 3EJYC 1I7UB 3LN4B 5E0QA 3O3AB 4OI9A 4Q7DA 2YD2A 1DL7L 1K4CB 4MZ3A 5IVOA 3ARBD 3GMRA 2X4RB 5FYJL 1CXFA 4OBRA 1I4FB 4LCWB 1S7QA 1XGYH 1MHEA 1SY6A 1RZJC 3EJZD 5I9QB 4HCRL 2DL2A 3GNMH 2ZPKL 2BNQD 4PJFE 5DRNA 2GFBA 2A9NH 4MDJA 2HFFA 4JDZB 1X7QA 2NY7H 4L8CA 5F7LB 2DQGL 2A77L 5MENB 3UPCA 3T0DA 5DVOA 4EIZC 2QLVB 2EIDA 3PNWA 4TSBL 3NACH 4YGAB 1YJDC 2JCCA 2XZAH 4HAFA 4PJBB 3VXSE 4Y89A 2N4IA 1XF3A 4U1JB 3D3VE 1A1NB 1B9ZA 3GKZA 3RIFF 3OAYK 1WZKA 2DMKA 4Z7QE 1SBSL 4RWYL 3T0EA 5ERWB 2QADC 1KNOB 2Y07L 4RSVA 4CNIA 3MNZB 4DQOL 3DGGB 5SWZE 3EYFB 5E99L 2HTLC 2DQTH 4HK3J 1JRHI 3F7VB 5ISZD 2X4PB 1AQKH 1RUKL 1CU4H 3PF2A 1O7SA 3GMNA 3CZFB 4HLJA 2M26A 4WHDA 3RJDA 3RWDA 1YECH 2Q8AH 4XPBL 3RZCA 3MRRB 1QSEE 2ARWA 1JMXA 3BO8B 4H1LA 5E7FA 1FL5B 2DL9A 4IOSD 1A4JA 2QR0B 4W4OC 4MJ6A 1CG9B 5D2LB 3DX9A 1CL7H 3DGCR 4OQTA 5C70A 3T3PF 2BVTA 3NN8B 3O6FC 2D4DA 4Z8FL 2CIKB 3NPSB 4OTXL 5I16A 4ZPVB 4XGZB 3HRPA 2FL5B 1R0AH 2X7LA 1DBAL 2NY1C 5HHMB 2EDNA 4KPHL 4NQDD 1K85A 4PB9H 2AEPL 3RWJB 1T03L 1MWAH 2CK2A 4KRPB 2P8PA 4X5XB 1A5FL 3KPPB 5FCUL 2BJMH 1PG7L 5H35B 1U8PB 4K9EL 3SDXB 3QWRD 4G9FB 4P2RA 2HJLA 1MAML 4JFED 5IV2A 1X5AA 2J6EA 1V3LA 4ZS6C 2OTWA 5K9OB 5IMLA 2VKXA 8CGTA 1BQSA 4K3JL 4S1RL 3EYVB 4TYUA 4X6FA 1T21A 1M1SA 2G5RA 1YYLL 2GJ6B 4JVPA 4GO6B 1S7VA 3U1SH 4OCXL 3WYRA 5D6CB 5CZVH 1T5WA 4Y4HD 4H5SB 2BNRE 4FQXB 1FNLA 2DM3A 3CX5J 3ROLB 3QNYB 3C8HA 1MRDH 3EFFA 1T1ZA 3KYOB 2BOCA 2YPLA 1QLRA 5D5MB 4WWKD 1T3FB 1GGUA 4F15C 1C12B 1UJ3A 1U3HC 4MQ7B 1MFAL 4HMEA 2X10A 1U92B 5HGHB 1P2CA 4LSQH 3EZ8A 4P46D 1U8OA 5E2UL 5FYKE 4FQLL 4P5TD 1DLFH 3K4ZA 2D31A 1KBGL 3K46A 4E42A 4KDWA 1E27A 1IAOA 4M5ZH 1NBZB 3V5DA 1JPSL 5FB8A 3I2CH 4BSJA 3KS0J 4K7PY 3VXNA 4BZ2H 4P3WA 3VH8A 3WDIA 4JN1H 3RWIB 5EO1B 1HIML 3DO3A 1P4BH 1KB5L 2C3XA 4U4BA 3VFWA 5I17B 1AGFB 4OZIE 5E2VH 5IT2H 4JFFB 4Q9RL 1P84J 3P4NB 4Z7OE 3CX2A 1FRGH 2BCKB 3OR7A 2GK0B 5DHYA 5HPMB 4G6ML 3W2DL 1RQ5A 3TJEL 2GITA 3KPOA 4FZEH 4QGTA 3WO4C 4XPFL 1MSPA 1P84K 2FB4L 2VDPL 3UTPD 5JW4R 4EXKA 2W0KA 2X4NA 4L8SB 3RTQB 2OXHA 3LZFL 4HXBH 2DM7A 4L3EA 5I1IL 1T2JA 4OB5L 1KPRB 3MJ9H 5GGRB 2JELL 3MO1A 5J13B 4KQ3L 5EOCJ 2BXYA 4D9RE 3QIUB 2EZ0D 3TYFA 2I07B 1MQKH 2DS4A 2XFXB 4I48A 5HDBF 5JXED 4ONFL 5JA8B 4YFDB 3ARGC 4LL9A 1CVRA 3TZVB 4LEOB 3C60D 1DQDH 5F3BA 1M6OB 1BM3H 1OAZH 3BXNA 4YBLB 3S5LB 4XRCA 2E7LA 3QQ4A 1ZHKB 3IFLL 3LN9A 4ZUUA 3TH2T 2VTFA 2SEBA 3UPAA 1LO5A 4E41D 4OFDA 5HY9A 2MNUA 5E5RB 5FK9A 2XWTB 4X4XA 3RVTD 1BBJA 4QRRE 1OGTA 4MD5A 3NFPB 1J1OL 3MXVL 4FFZH 4FFYH 1BX2B 2ZUSA 4PB0H 2O5ZH 5KSUA 4IMKA 5FDWB 2UWEF 5CP3H 2PW1B 1IKFL 3O8XA 3QIWA 5F21B 1I3UA 1LQSR 3ARQA 4FOMA 3MZTA 5EUOA 1NQBA 5DK3A 5T5NF 4JZOA 3WFEH 4XMKH 5E8DH 1NMAH 4DVBB 2AK1L 3ZE1E 4MA1B 5EIIA 4XP9H 2DQEH 5DJ2B 1JN6A 4XVJH 4JANB 4NWUL 4TTDC 3UTTB 4NO0D 4GQ9L 4HWBH 1IM9A 1FV1B 2EDOA 3AXLB 1L0QA 4F33A 7CGTA 1ZANH 1Q9LA 4XP1H 1JTPA 2VE6B 4LDLB 4O00A 4HLZG 1YN7B 4X8XA 1VCAA 1FNSH 3PGFH 3SDAC 4YE4L 3P3YA 3KPNA 4QF1B 3HCVB 1A3LH 1S9VA 1KIRB 1QBMH 5GRJL 3CMOH 4H26B 1N6VA 3OHXB 3KYNA 1NEZB 1G7IB 1UACL 5L2KB 4YHIA 3VD9A 1NMCB 3QA3B 3UZVB 4TUKL 5ITFA 2DKMA 4S1DC 2D7MA 3G04A 1SM3L 3K8KA 3KGRA 1RZKC 4WV1A 5F1OB 3NIFF 1DL7H 3F12A 1QA9A 3ZE2E 2A83B 4Y1AB 1KPUB 2AQ2A 3TC9A 2DBJA 1FZKA 3TA3C 2HVKB 1J7VR 5D6DA 3BPNC 2HJFA 2ZPKH 5DGQA 1DVFB 2VB5A 3ZYJA 3PWPE 4WGVB 4GKNA 1FN4A 4WU7A 5K59F 2DQGH 3QCUL 2A77H 1XFPA 1YMMA 5HHOB 4Z5RA 1N64L 5JPNA 1FH5L 5FGCB 4TSBH 4UOW0 3K1DA 2NY2C 3MLTA 3G6JE 4G8GE 2IANB 3QHZL 1R5WB 3UDWA 2GJJA 5DMJB 3KPLB 1LE5A 1W8OA 4M7JL 1IEBA 4XCYB 1RK0B 2GYSA 1D5XB 5BOZG 2FCBA 4WHTA 4MA3A 5C8JA 1HHHB 3SBWC 3TBTB 3C5JB 4RWYH 3TO2B 2Z8SA 1S7UA 2VL4A 1A6VL 5DJ6A 4DQOH 4HIHB 4KJWD 5SWSE 1X5JA 3RNQA 4HBCL 2FIRT 3EGSB 4HUMB 4RMWA 1X6NA 4WUUA 4D9QD 4GG6E 3I84A 3I6KA 2R8SL 5E99H 2P8LA 1CBVL 2CR3A 1SJEB 4PJ5D 2E27L 3GJFH 1RUKH 4HF5L 5CGYD 2R2EB 5A3ID 2NPLX 3VI4E 5F9DC 2ID5A 3UTQA 1PQZB 3VXQA 4XPBH 4NQCD 3OF6D 4C55A 5DJCB 1DUZA 1KXTB 5BJTB 3LHPL 4Y5XA 3DRTB 5C08D 3K8LA 2EE3A 1LP9A 1FORL 1OSZA 4R2GB 1WBZB 4Z8FH 4JDVA 4NZJA 4OTXH 3MV9D 3PV7A 3JWOC 3RVXC 5E2WL 4N0UB 1DBAH 2WUBL 1XGPA 2XWJB 3WEXB 5C0JB 3S3JA 1RJLB 4OAWB 1KTDB 3CU7A 3NCYP 2AEPH 1Z9SA 1T03H 5E6IB 2PXYC 1A5FH 3P73B 5FCUH 5JIPA 1CT8A 1VFMA 4UINL 1PG7H 5AWNL 2O5YL 4K9EH 5FA4A 2FLRT 2VUYA 1MAMH 5FECB 4N0FB 2DLTA 2MQ3A 5CEXA 4DTGL 3SDDA 4Z7WA 1ORSA 1PEWA 5I1JL 4S1RH 4K3JH 1C08A 4X9GA 1YYLH 2X1QA 4P4RA 1S9YB 3RIAK 1EHLL 3FRPA 1HYRC 3QPXL 4OCXH 1CIDA 2CO6B 4ELKA 4L4TE 3REVB 1SJXA 4E5XA 2E7CA 4GRMB 5DVKA 4YR6A 1MCFA 1T66D 2FWOA 4K94L 3BN3B 1EEZB 2AS5M 3LKOA 3FB7A 3BKML 5KSBB 1MFDL 3RWGB 2OBGA 5JTWA 4JKPL 2V5TA 3UYRL 4MXVF 2J2ZA 5KSAB 4POZD 1MFAH 3DX7A 3ARDB 5D1ZC 4YHKL 2V9RA 4JPKL 5E2UH 3P0VL 3LKQA 4FQLH 4FXGA 4W68A 2ORBL 3FMGL 2LVCA 5FUOH 3O3DA 4PRBA 2YA2A 1ZAGA 1JPSH 2K7QA 5IMOB 1V05A 4YWGL 4NQVB 3LD8C 3VGHA 3OXSA 1JTTA 4NRXA 2XTJC 5HYJE 1BD2B 5GGSY 1FVEA 1HIMH 4P3CL 1LE9B 1KB5H 1QRND 1IGTB 1E6JL 4HUWB 4ZTPL 1EGJA 3MUGA 1ACZA 4Q9RH 1AXSB 3OAUL 3BAEL 3HB3D 4G6MH 3W2DH 3OV6A 1MVUB 25C8L 4N1CA 4FTVD 3TJEH 3FAXA 5FO9A 3BQUB 4XPFH 5LJYH 3EOBB 3KLHC 2FB4H 2IFGA 4WY7L 1T1WB 2E9IA 3HZMA 3O2WL 1FFOB 4I2XA 4JFXB 3LZFH 4M7LL 3CDFA 3TWCL 1RJYA 2YMXL 1FVDB 3T04D 4UBDD 4JY4B 4OB5H 3BWAB 2JELH 3ZKND 4KQ3H 4MCYA 4TUJA 1OM3L 5IW1A 4Q6IC 3VXUE 3W0WE 1UVQA 4JAMA 5BCAA 4XZUA 4ONFH 4MX7A 3GRWH 4RBPH 2PN5A 4KHTL 3DV6A 4LQ1A 4UDTB 4R97B 3AS1A 1YA5A 3MLSL 5IQ9A 4OM0L 4CMHB 4OUOA 2F15A 1HXMB 3BMWA 2CDFA 2BVYA 3KJ6L 3RP1A 2CJUL 1FFRA 3IFLH 4OGXL 1BZ7B 2JKXA 1F3JA 3FQRA 5E9DB 3O6FA 4DZ8A 1JPGB 2VLKE 1TJGL 3QDJE 1JGDA 2WINA 3RHWK 5D93C 3MXVH 5E1AA 4AEIL 4APQD 3ES6A 3U46B 5IKCA 2HFEB 3WE6B 4BUHA 2YZ1A 3WUWA 3NBNA 4MLIA 4J1UA 1J0HA 3DUSA 1IKFH 3S98A 4R90L 4CDGC 1AGCB 5I66B 1ES0B 4RAHA 3BGAA 4XBPB 3LKRA 2AK1H 5DEGA 2GSIA 1JK8A 3C9NA 3GSWA 3MROB 5ESQA 4DKDC 4W6WB 1G7MB 5DTFA 2K1MA 2C3HA 3QZWA 4LLDA 4NWUH 4NN5C 4GQ9H 5AYQA 1NCTA 1YN6A 3HR5A 5J12B 2DWEA 4YBQD 5GIRB 3TVMB 1A7RL 5KVEH 3RAJL 1P9MC 3QJFA 4KVCL 3KPQB 4MYWB 2VRAA 1GYAA 1UKSA 4XTRD 4ODSL 2VABA 1GZQB 1G7PB 1Q72L 2R29H 3MV7A 4GXVL 3SO3C 5GRJH 4JFDB 1RPQA 2NR6D 1G7LB 1NFDB 3REWA 3MRCB 4K3DL 1UACH 4UNUA 1U3HA 3MLPA 1RULL 2FYYA 4TUKH 4YXHH 5E8NB 4AEFA 4X83A 5TDOA 3WL9A 1CK0L 1IAMA 1SM3H 5HPOA 2H26B 2P5ED 3QWOB 4FS0A 1PAMA 3RUGF 1WT5C 2X44D 5L7XL 3MJ7A 3AS0A 2IC2A 4Z7UA 1F4WL 4YIQA 1EHAA 4JRYE 2HN7B 4GBXA 2O5XL 4MAYC 1KLUA 1SY6L 1ED3A 4PRNA 3QCUH 5FIEA 3U2SA 4I18B 3T1FB 1TTFA 2QQQA 4ZAKD 1N64H 1FH5H 4IRJD 3U7YH 4PGZA 5GGUA 5ESAB 1YPZA 3BIAX 3AUVA 3KPRB 3MLRL 3QHZH 5EBWB 3DVNA 4POUB 4OGAD 4Q74A 4R0LC 4ZFOA 5I8EB 1RHFA 2AJZB 3BDBA 43CAA 3UYPA 2PR4H 3L7FB 2BY0A 2IAMC 2EXYC 5T1LA 3DPBA 1A6VH 5HGAB 2V2TA 3EYUL 2A6IB 2V9QA 3HNSH 4HBCH 4XMLL 1ZT7B 1QNZH 3B6SB 2X4TA 2R8SH 2XKNB 1F00I 1HILA 1RHHB 4TVPD 1Q94B 5D1XA 1V8HA 1LVEA 1VDGA 2EYSA 2E27H 2HFGL 2V9TA 3ARGA 1L9NA 5AZ2L 4HF5H 5BZWB 3GJEB 4NPYB 2XWTA 5K9KB 5HYQB 3OX8A 5EO9B 4PJGA 4J3OC 3HLAB 1ZK9A 2AJ3B 5DMYA 3L5WA 2N7AA 4BELD 5MEOA 3UAJD 4RA0C 4ZUWB 1VFAA 3MRIA 2ITDA 1FORH 5EU6D 1NL0L 4KJQC 1K8IA 3LN5A 3QQ3B 4PTUB 2XT1B 3V6ZB 4H8WH 4R9HA 2WUBH 2JIXB 3OZ9L 3QG6A 1FLTX 2IQAB 1UENA 1MAKA 2DDQH 3HG1D 3M07A 4KK9C 2EXWC 4LVEA 3WN5C 1DTUA 5FYJD 4UINH 5E8OA 1I9RL 5AWNH 3AXLA 4NQTA 4AM0A 2O5YH 2VZ1A 3P11L 1XCQA 5I8KL 5CMAA 4WFGD 1B4RA 3DURB 5M94B 3C5ZD 1JHLL 4HGMA 4DTGH 5A16B 4R8WL 5I1JH 4R4BA 3T4YB 5T1KA 1JRHL 2O93L 4JPWL 5BS0A 3N1QC 1ZGLM 4P48A 1EHLH 3Q6FA 4EBQL 4OZFB 3BI9X 3IRPX 3QPXH 2ARJA 4L3AA 4PRHD 3S3PA 3VFRA 3BD5A 4LOUC 1AP2B 5CGTA 3SDAA 2J8UF 2C1OB 1ZHLA 4HPOL 4XXDA 3LKPB 1AGBB 3RL2A 2APFA 2ED9A 1QPPA 4UILL 1I1YA 2IBZY 2PO6C 2BVPB 1RZGB 3ZDYE 1H5BB 3BKMH 2R23B 5SWZB 1FCCA 1MFDH 1DE4B 4JKPH 3B8YA 3ZMRA 2JB5L 1EXUA 1B0RB 5D2NB 2VZTA 3P4MB 3UYRH 3ARBB 1HEZB 1ZT1B 3AVEA 3VFOB 1I3RA 1EFXB 1XR8B 4XT1C 2YD5A 3BJLA 4YHKH 1UH2A 4JPKH 2X89A 4OZHE 3P0VH 5DJXA 2OXGA 1OF2A 2BNQB 3GMLB 4BH8A 2ORBH 1BGXL 4FQ1L 1R3JA 2QV2A 3FMGH 4RRPA 3TA3A 2XNAA 2Y25A 5CEZD 1M71A 2R2BB 1NCCL 1Z2KA 1F3DH 5LKNA 2VYRE 3W11D 3LKNB 3OPZL 3LRSA 2A6JB 5AG9A 4P3CH 1OAXL 4PLKC 1AO7E 1E6JH 4ZTPH 1D5XA 4NIKB 5TDPA 4TQEH 3D39E 3OAUH 3BAEH 1QVOB 1S9WA 1YY8B 25C8H 2DBLH 3JWNC 1Y18B 1ODAA 3O81A 4RGMC 3WO3B 2AXFB 2G9HA 3SBWA 3QEQA 4NNYB 4I3RL 4WY7H 3CFJB 2O61A 3O2WH 5ISZB 5EU3A 4M7LH 1QP1A 3LDBC 2BHUA 2YMXH 2LU4A 4PJ7E 1U8IA 5I0DA 2B5IB 1OM3H 3MUZ1 4RBPK 4XNQB 3KXFE 1SYSB 4I5BB 3DVIA 5T3XL 5F89B 4LPXA 2Z8WC 3EDDA 2PYEA 3MLSH 5IFHL 3KR3L 4OM0H 5F88A 5CS7A 3MGTB 5D7IE 1NCAL 1QD0A 3KJ6H 2CJUH 4OGXH 4F7EB 3O9WD 3OAZH 1YEKL 4NQDB 1TJGH 1D5IL 2R0LL 1J0KA 3PP4L 4ZDHA 3AB0B 2RFXB 5IHBA 4GRLD 3ZL4H 4AEIH 3LAFA 3FQTA 1I7TA 2BSTB 1H3PL 1NBQA 3V2AR 1IC4L 3QNZB 4YC2B 2PXYA 3LRHA 2E9BA 4JFEB 4R90H 5GGQL 3NZHL 2YK1H 3SKMB 2R0KL 4TSAL 1RD6A 5F7MC 3KJ4B 4U1GB 5KN5B 2H3NA 3H7BB 1N8ZB 3ETBF 4HHAA 4H0IA 5C07D 5I19L 3DV4B 2FR4A 3DYPA 3GBLA 4WFFE 5GGTA 3OG4B 5ACLA 4OZIB 3GSNA 3CUPB 5T33H 1U91B 5ESVB 3SKOB 5SX4H 3ARSA 1RFDL 5D7LA 4KKCC 5EORH 3BPLB 1MH5B 5E4EC 1A7RH 1ZMYA 3OMZA 3DIFA 3RAJH 5C2UB 2VL5A 4O58L 5GRZA 4KVCH 4XAKE 3ROOB 3HUJF 2EDTA 2RHEA 5T1MA 2LVEA 8FABA 2IALB 4ODSH 1Q72H 5HHXL 5TE4L 3RVWC 4GXVH 5ETUA 5H94B 9CGTA 1WWWX 1FVCB 4K3DH 4FXLA 4EI5C 4FQHB 4ODWA 4P5TB 2W59A 5I6XC 3ULVC 1UXSA 4LCYB 5D1ZA 3B2VH 2HLAA 1HH6A 2F9BT 1KCLA 1T6VN 1IGIH 4KAQL 4XAWL 4IJ3C 3RPIB 5CWSB 2X4UA 1AJ7H 1JZ3A 3AY4C 3Q5TA 2X09A 1G6VK 4Q6YA 3BGMA 5D72L 1SHMA 2GAZB 1QYGL 2W0FA 5HGBB 4MJIA 3ARPA 1FZJA 1AXSA 3NCJL 5L7XH 2DI9A 1P53A 1F4WH 4JHWL 3QI9C 2HP4A 4QLRA 2O5XH 2X4SA 4NRZA 4QRRB 5BZDB 4UB0L 3LQAC 3TT3L 1OGAE 4JJ5A 4M8QB 3MGOA 4Z0BL 5C0AD 4P3DB 1B3JA 2F74A 1CS6A 1WIOA 1T1YA 1KB9J 2JJWA 3QDGD 3QEGL 1K6QL 1PFCA 2H32H 2GUOA 3IXTB 3MJ8A 3IJHB 3RKDD 4L8BB 1KB9K 3HA0A 1VGKB 4X6CF 1N59A 5GHWL 5DRXA 1F11A 4FQ2L 3TH3T 3ABZA 3PWLB 2E6PA 4U1SA 3TBWB 4L8DA 5KS9B 3WS6C 1U8KA 3FQWA 4NNPL 2NXZD 3EYUH 1HN1A 4OLVL 5KVGH 1IAKA 1CFQB 3SCMB 4XMLH 4X5WA 5I2IA 1KACB 1U9KA 1UG9A 3C60B 2FD6H 4Q6IA 5F3HB 1N2RB 5DJAA 2Y7QA 3WXWL 2HFGH 1T4KB 5AZ2H 5F9WB 5GZNC 4XH2A 3EKCA 2BHYA 3S36X 4HS6A 3SY0B 4IRSD 1FNGA 5EFIA 2JJSC 1XCTB 3NA4A 4E41B 5I9QC 1VENA 1CF8L 1WZ1L 3MRGB 4EN3D 1FYTA 5BRZA 4DOHB 2HT2C 3ARTA 3RL1B 3S4SB 5I66A 2G5BB 4H1LH 1JJUA 3IS1X 2W38A 3OJMB 2MHAA 4UV7L 4DZBA 4HZAA 4K8RD 2R9HC 1KIQA 1K3IA 3OZ9H 2YZ8A 4PREB 4HJJL 3G9AB 4X4ME 1VFBB 1FL6A 1R3HA 4OV5A 1I9RH 3QUYD 1J05A 4XBGB 5I8KH 2X2YA 4NO0B 3VFUB 2JTDA 4K7PX 5GJSH 4PTTA 1BZ9B 4NQEA 3QDMA 5DRWB 2CGRL 1N5AB 3I6GB 4R8WH 4M4RA 2FJFB 2FBJL 3WNKA 1JRHH 3G6JB 5JHDA 2X1PA 3IFOB 2WBJC 3TBSB 4EBQH 3VXME 3IXAA 3BPOB 4OD1L 1V3JA 2J5LB 4HPOH 3ZHLA 1ADQA 4M61A 5HBBA 3D2UD 3L3IA 4KMTL 4UILH 2C3VA 1KELL 2KKQA 1XGTA 1NGWB 4MVBD 2E7MA 3O3BA 4U1IA 3V6BR 3D0VB 4WGWB 3KLAB 1UB6A 1A7BA 4NCDA 4UQ2B 3X12B 2JB5H 2W07A 3CFDA 1J8HA 2NTSP 3VFPA 1I8IA 1F3DJ 2PCPB 3VXOA 5HDBE 4JY6B 2BK8A 4ZO7A 3SDCB 4OCLC 1WT5A 4NGHL 3C8KA 1BGXH 3HZYA 4FQ1H 1FFNB 4JO4L 4HC1A 5E7BA 3M1BB 4FABL 1MLCA 1RK1A 1I1FA 2UVFA 4JGUA 1HHIB 3HRZA 1NCCH 1CE1L 3OPZH 4OCWL 4ZUSB 3FO1B 1RZJL 1OAXH 1FO0B 3MCLL 2F53D 4PFEA 3QO1B 4HDIB 4UTAL 3U7WL 1EJOL 3VDAA 1OTTD 4K55A 3VFNA 2UWEE 1BZQK 1NCWL 5ID0A 4S1SL 1EGJL 1G7HB 4P4KC 4R0LA 1YJDL 3HE6C 1RUQL 4LU5L 5DFVD 1B0GB 3DBXA 3VD5A 1HHJB 1BF8A 1R5IB 3MRKA 4O2FB 2IAMA 4YPJA 1S7XB 4JFPA 3THMH 4XNMA 4I3RH 3FOLA 1GAFL 3H9SD 2ATPA 3JV6B 1F6LL 1KEML 4L3CA 4JLRB 5ICXB 2W0LA 2ZNXA 5JNYB 3GHBL 3KHQA 2WWKO 2CLRA 3CC5B 1VHPA 2FX9L 4WI4A 4NQCB 3WNOA 5IB4B 4FQIL 5JMRA 1BLNA 1HZHL 5I1AA 3HPJB 3VFVA 2HVJB 3FOMB 1IRAY 5T3XH 1OAUL 5IUSA 4F9LC 3X14A 1ZT4A 1I75A 3NA9L 5CKAA 5EU5A 5IFHH 3KR3H 5FXCH 2XQYG 3NMEA 5MP6L 3I6LD 1CN4A 1ONQB 1NCAH 3OAZK 3E6HB 3MV9B 4LBEA 4AMKL 3FB8B 2RBLA 2P5WD 4MMXC 1YEKH 4Q2ZB 4JFHE 3FT4B 4PJFA 1C1EL 4PY7B 4AEEA 1D5IH 2R0LH 4ENEC 2EDLA 1CD8A 3PP4H 4BZ1L 3VWKD 5B39A 5ANME 2JK5A 3DURA 4UT7L 2XA3A 1YY9D 1H3PH 4LKCB 4TNVF 4F8TA 2AJUL 5JA9A 4NKDB 3WN5A 5GGQH 3NZHH 4AENB 3U4EB 5DMGC 2R0KH 3VXSA 4TSAH 4ZSOA 5DK0B 4G42A 3D3VA 4L8SC 5I19H 4ZUTA 5TQ0L 1NGYA 3VMNA 2F19L 4X99A 4M1CC 1BJ1H 1P6FA 3BE1L 2V5YA 1K8DB 4G80B 4K2UH 5HHVL 1RFDH 4J3SA 5DHVA 5IVZB 2YXFA 3SE8L 5IHLB 5L0QB 2NW2A 2ZOLA 3MREB 3IS0X 4MDIA 2EH8L 4DKAA 4O58H 1UH3A 4QRUA 2BY3A 3WV0A 1T5XA 2LU3A 2YUZA 5HHXH 5TE4H 4PJHF 3PWVA 1JNNL 3GMLA 4QNPF 4P2OC 1QSEA 4JM2C 3B9KD 2VH5L 4HWEL 1HWGB 5LAXA 3SPVB 4S0SD 2I24N 3O3EB 3IVKB 2QQLL 4L9LA 4JREB 1IL1A 3VXTA 4ODUA 2A73A 4KAQH 4RFNB 3QAZB 4XAWH 5DUPL 4Y88A 3EAKA 2V5SA 4NO2B 5HD8D 3CPLA 3T1WA 3QB7C 5D72H 3CFBB 3WJLA 4HT1L 1JNHB 4GT7A 3VG9B 3DARA 1QRNB 3NCJH 3OWEA 4JO3L 4BM7A 1GHFL 1YEEH 5DXWA 3BVNA 4ODVL 5I30L 1XIWC 3EYQC 3O2DL 4HUUA 4NFDA 4PJIB 5CJXC 5B38A 5C1MB 4LRNL 4UB0H 4WI3A 4PJEA 1EBPA 3TT3H 3GI8H 4Z0BH 1MELA 4CAGA 4EUPG 2AV7B 3GGWB 3MPCA 5FO8A 2D0HA 2ICES 4UT9L 1VKXB 4UOJA 5EN2B 4I8DA 4TSCL 4BZYA 3QEGH 5DQ9A 4ZXBD 5DD6A 1BFOB 1K6QH 4G5ZH 3N1GC 4EDXA 4X5LA 3IDNA 3VXRD 5IBLD 2AJVL 5D1QC 5EC2A 5C9JA 1DANT 3O11B 2EEDA 4PBXA 1JF5A 4YHNB 3BZFB 4O5LL 2CDGB 5B8CB 5J6HA 1ITBB 4UUJB 2BNRA 1JHTA 5C0BE 2BVOA 1U6AL 5T3ZH 4NNPH 5GISL 4ZFOL 3PWUB 1DSFL 4OLVH 4F9PC 4NN6C 4ORGA 5HI5C 3X17A 2NY6C 5FEBA 5MEQB 4R96A 4PJ8A 3QQNA 1CDCA 1T7XA 2H8PB 3WXWH 3NVQA 5GQBA 4RAVB 1HI6B 1F8TL 4U1LB 4Y16C 2XN9E 3M17A 4CN4A 2DQJL 1CXEA 1J5OL 1CF8H 1UEYA 5TDNA 1WZ1H 2J1KA 5BV7H 4APQB 3NCBB 5FDYA 1W2KT 3QG7L 3ARFD 1ZLWH 4MXVE 1VADA 4J3VA 1LNUA 2FATL 3PHOA 5KW9L 4UV7H 1I9JL 3UJJL 3W81A 2VLJD 4J2XA 1DUYB 3C6SA 5IFJB 1A6ZA 1FL3A 5E4IA 5F9OL 3HE7D 4QRPD 4XP6L 5EZLA 1CGVA 4HJJH 3WFCL 1FZOA 5HI3D 4AIZB 1XGUB 3L3OA 1HXYA 2Z35A 4HLZH 4I4WA 4HUKB 1BQLH 3PP3H 4NO5B 4HIJB 3HN3A 3C6LB 4IMLA 4CN1A 1CE6B 1JZ4A 2CGRH 4FFVD 4NN7C 1E28B 4GAYA 4RGND 4UIKH 3RVVC 2FBJH 3K7UA 1ZSDB 3DJ9A 4UAOB 3BP4B 2Y72A 2YSSB 4QT5A 2I27N 1W72A 1QLFB 2Q1EA 4NHUA 4QHNB 1JUFB 3GM0A 4R7DB 3X3GL 3FFCD 3PG2A 2BZDA 2W65A 2GTWA 4NKQB 4LSTL 3NIDE 4KMTH 1MF2L 4EQ3A 5GRVL 2GCYA 3BT2H 1Y0LB 3QYCA 5TJWK 4EI5A 4ONHB 3DWTA 1AHWC 2P5EB 4HJ0C 4AG4H 2QKIB 3GSOB 2IG2L 5E5MA 1LK2B 3HC0B 3T0ED 2ZUQB 3AY4A 1PLGL 1A1MA 2HAZA 4NQXA 1QR4A 3CVHB 4CL7A 1F4XL 2ICWI 4C56E 2F58L 3JV0A 4IIQC 5E6IC 5TH2A 3S37H 4NGHH 3WLWC 3CLFL 1RZKL 4JO4H 3A0OA 5D9SB 2QSTA 4FABH 1HQRB 3T65A 4OUUB 4ZAKB 4HKBA 4TUOA 4M93C 2DLFH 4DUVA 1CE1H 4IRJB 2V7NB 4OCWH 2H9GA 3RZCD 2R0ZL 2BSRB 3MCLH 1FIEA 4J3WA 4GW5B 1KJ2B 2AJXL 1AKJA 2OZ4A 4N5UA 2M8XA 3KWWB 2HT4D 4O2EB 3U7WH 4HUVA 3BJ91 4A6YA 4J8RB 5I1LB 2EDJA 3O45A 3MUJA 2JCCE 1NCWH 2RIKA 4S1SH 1NCDL 1BAFH 4QCIA 3DI2B 4LLMA 2X9WA 1YJDH 3FCTB 4PG9B 4QWWD 1RUQH 4LU5H 4QHUB 4JVWA 4BSVB 4EEEA 2BVQB 3GFUA 1S8DB 4FP8L 4OLUL 2R2CA 4ELME 3WS6A 1GAFH 3SY0A 2Q76A 1KEMH 4PR5A 3FO0H 3ELAT 4FFWC 4GRWF 3GHBH 4NUGL 1G7QA 3B9VA 2FX9H 3IAQA 3FQNB 4HIIA 5DI8B 3HAEB 4FQIH 4NUJB 3I3EA 1F90L 1G9NC 1HZHH 4Y8DC 3QEHB 1AR1D 3WKNA 4KJPC 1OAUH 3U7AA 2JJSA 2Z91B 4WU5A 4MXWH 3NA9H 2PNDA 4MQXD 5EU6B 4P5KA 5MP6H 4RISH 4XI5D 4JB9L 2OJEA 3BP5A 4AEHL 1GL4B 3S97C 5I71C 1MCPL 3RGVC 3IDGB 1NH6A 4IOIB 1HKLL 4PBVC 4Z0XB 1NC2D 1X44A 1C1EH 4Q9QL 3HG1B 3PWPA 1MJUL 4BZ1H 2CMRL 3LEXA 2YPLD 4UT7H 3BUYA 4RDQF 1BJ1J 3SKJL 3MRDB 1NJ9A 1DBJL 4C4KO 3JWOL 2AJUH 5FA3B 3RUGE 4EQ2A 1I8KB 2IADA 3C5ZB 3G6JA 4G8GA 4XX1E 3LSOB 2FIKA 4XMPL 3IFOA 2EIZA 3U4BL 1TVDA 4MQSB 1XF5A 4DKFL 3V5HB 3D5OF 2BMKA 2A0LC 3I75A 5TQ0H 1ZVSB 3PHQA 4QTHA 2F19H 5E5UB 4P2RE 4NSKB 1X5IA 1IGYB 1DQQB 4OZGF 5LVEA 4X7SL 3WIHA 3HKFA 3BE1H 4PRHB 4S2SB 2DKSA 3V0VA 1DLHB 3FRUB 2WBJA 5HHVH 3SE8H 5GGTL 5SWSA 1UYWH 3SKNA 4GG6A 1EEUA 1DEDA 4RIRA 1XF4A 2EH8H 5D7SL 1DBKL 4KDTA 3S6CA 4LHUA 1J12A 1BWMA 4XC3L 2C1PB 2G2RA 3SDCA 1JNNH 5ENWB 2ATKB 2AXHA 5E00B 3G5YB 1U3YA 4ERSL 4DVRL 4N8VB 4K23L 5GZOD 5FKAB 5IB1B 2QQLH 1G6RB 3IB4A 1RIVL 3TO4C 2L7UA 4LLQA 1BP3B 2WWMC 5DRZB 5EWIL 4L3ED 1X4ZA 1DDHB 5EPMB 1MHPL 5D7IB 5DJDB 4HT1H 3U83A 3G5ZB 3GMPB 3HNTL 4JO3H 4NKMA 5LGHL 3EHBD 1GHFH 3L3KA 1LWRA 4PRAB 4ODVH 4DK6A 3S3SA 3O2DH 1J86A 5IVXF 4LRNH 2JJUA 2WIIA 4NBXB 5CGMA 4ZO8A 2EDQA 4D2NA 4UU9B 3J7HA 4QHLB 4UT9H 3QUMB 2YUVA 3M8OH 3NCFB 1LEGB 4TSCH 4YZFF 5IIEA 4P4KA 3HE6A 3VI3F 2MOVA 2AJVH 3T3ME 5FYKU 1IGCL 2BSSA 5KBNC 1NGXA 1WFNA 4L4TA 5CHNA 5C0FA 1YUHA 2X1WL 3RVUD 2HVJA 2NZIA 5LBSL 3O8XD 3QIWD 5KOVC 1MCKA 3MR9A 1U6AH 4GUPB 5DJ0B 5GISH 2ENYA 2HMIC 1DSFH 5JW4M 2AXJA 3FZUC 4UZGA 5E2TL 3TH4T 4MSWA 3F5WB 1UM6L 5D7JC 3IKCA 5DEFA 5T3XE 1AD0A 4KMLB 4PJAF 3Q48A 4OLYL 4F9LA 1F8TH 1FNEA 2FJHB 1IM9D 3O9WB 2J8UE 2DQJH 2CIIB 4N68A 1J5OH 2RQ8A 2D2OA 3I9GL 2HJKA 5ACZB 4GRLB 1ZLWK 4NM8L 4PIRF 2I9LB 1J9CT 3IT8D 1NEZG 3HI5L 3QG7H 3ZKMC 1PYWB 4XCNA 1OCWL 2FATH 1HDMB 5CBEB 5KW9H 5HYJA 3UJJH 1I9JH 4XPHL 1R3KA 1TVHB 4IHOB 3AGVA 7FABL 1YEDB 1J1XL 4JG1H 5F9OH 5GRWA 3X11A 4FQQB 4WUKL 5C07B 2EDRA 3MRPA 2P47B 4CVUA 1XGRA 3WFCH 1A6WL 3PP3K 1KB5B 2VQ1B 1AIFB 3PGDA 2YD3A 5MHSD 1P7QA 3SGKC 5IROA 2ESVE 4P57B 2X70A 1ZGLA 3MA7B 4LCIH 4HK3N 3MYJA 4NOFA 4K71C 4XVSH 4OFPA 5E1HB 1ETZB 3FQUB 1VERA 2J3SA 4M7ZC 1YMMD 5EZJB 3VXUA 1DFBL 1DN0A 3KLSA 3W0WA 3AC0A 3RY4A 3X3GH 1L7TL 4HS3B 4LKXA 4LSTH 5F71A 4U3HA 1MF2H 4P2OA 4JM2A 2DQCL 3VRJB 2WBWB 3CFBA 4F7TB 1ADQL 1CWVA 2EE9A 3L9RB 2APVA 3GUTA 2IG2H 2VAAB 3IDIB 1S7TB 2Z93A 1HH9B 3NFNB 5I1DA 3LOWA 1PLGH 2VLKA 1INEL 1CGYA 1MCSA 3QDJA 4WTWA 2ZSWB 3WIFB 1DQJA 1F4XH 3VGEA 2ADIB 4WUUD 2F58H 4QHMB 3WFZA 3JBG7 3CLFH 4L4VE 1RZKH 3SQBA 1MWAA 2EIEA 2GJZA 2DIBA 2MQ0A 5C0AB 2QTEA 5DK2B 2EYTA 2LFGA 1QFUL 1LO4L 1XIWA 2GIYA 1J87A 2D03L 5CJXA 3RI5K 2NLJB 3QDGB 1EHXA 4GKZA 4HIXL 1OW0C 3LB6D 1DEEB 2R0ZH 2YD6A 4N90E 1U0QA 3FO9A 3IJYB 5EBMA 2AJXH 1IQDB 5JOFB 5GS0C 1NAML 3U9PL 5TGBB 2A6DB 4ZQKB 3B2UD 5D1QA 2ZG3A 3QR2A 1NCDH 5JDSB 2AK4E 4N5EC 1IGJB 4IBLT 4ZOAA 2NXZB 3CDCA 3NABL 3P77B 3IDYB 4FP8H 4FXKA 5T3ZE 3BIKA 4OLUH 4POYA 3G5VA 2IEPA 1A9EA 5T5FL 4LP5A 5CIPH 2FH6A 1PBYA 4F9PA 4Z7NE 1S3KL 3ARBC 4FZ8L 1E4WL 3DUUA 2NNAB 3P4OA 4Y19E 3D69A 4F37F 3FL7A 5CD3A 5DMKA 1FDLL 1CDUA 2HLFD 1F90H 2BHZA 2K3TA 4PG2A 4EN3B 4Y16A 3TBYB 2DWDB 4YHPB 1CFSB 1A7NL 2ZG1A 2DYPB 3HUJE 1KTLB 2BXZA 3G5XA 4JB9H 3HMWL 2VMFA 3L5JA 4AEHH 2J88L 1OARL 1KIPA 3O4OC 1D7FA 3U4AA 1HKLH 3BP7B 3I02B 4Q9QH 4JRYA 5DO2C 1HOCA 4OIBA 4PJHB 4QYOA 5IHZB 1XGQA 5EC1B 1MJUH 1UT9A 2CMRH 2HTKD 3C6LA 3LVEA 3QUYB 4PP2B 3BEVA 3W5MA 4LCWD 3EYOB 5F6HI 3KDMB 3WNNA 3SKJH 1RZFL 3U0PA 4Z78A 3JWOH 3UBXB 3MODL 1MHCA 3TIEB 3ULSA 3GSXB 4UMGA 3RWEB 4PJXE 5AAWA 3U4BH 1DCLA 1WJ3A 4DKFH 3GSQB 3VDCA 2CKBL 3QCVL 1BVKA 1LO0L 3KYAA 2CUHA 3AU1A 5L8JB 1ZHNA 4X7SH 1IC5L 5CBAB 4CW1A 3QUZB 3JV4B 3MJ9A 4ZODA 2AXGA 1I7ZB 5GGTH 3GSVB 5FO7B 3D2UB 5C0DA 4QXUL 2IH3A 2XV6B 3C2AL 2VZVA 5D7SH 1DBKH 3L1OL 4PRPE 5EO0A 4X6CE 4XC3H 2AJSL 1CGWA 4J6RH 5EU7E 3BDXA 3V6FB 1UC6A 3MGAA 2DRUA 2E9WA 2Q6WA 1AHWA 2R1YA 3RX7A 3TJHC 4ERSH 3GBML 4DVRH 2DTML 4ZFZA 1ZA6A 3QULA 3AB0C 5D71L 5GSRB 4WW2F 4LVNB 4GAJL 2EYRB 4AK1A 2MMXA 1RIVH 2FJGB 5DYOB 1U8JB 3CSYB 4H8WC 4JFQA 5DD0L 3MBXH 5EWIH 4LDOB 4IIQA 4J4PA 3KPSE 4CJ1A 1INDL 1MHPH 5FHBL 2HTLD 4OIAA 5CP3A 1SQ2N 2IQ9L 3QXDA 4WNQB 5DJ8A 3HNTH 3LKSB 3U36A 5LGHH 2Z9TA 3F62A 1R3IL 2XYCA 5EULV 1I1AB 1KT2B 2W60A 2XG5A 4YAQA 4Y4HC 4JDTL 4RFEB 1E4KC 1C5DA 4HWBA 2FO4A 1H0DA 3EO0B 4LAJH 4Q9BA 3O3UN 3CDGA 1FSKB 5IESL 3O6FD 5DUBB 1ZVYA 3DX8B 3VWJC 1RU9L 4HUXB 3Q1SL 3H9SB 4WWKC 1CFNA 5IOPB 1IGCH 3RX8A 4P9ML 3IU3B 1ITCA 4Z77A 5SWQB 1C5CL 4ISVB 4KKAC 5LBSH 2VDQL 2Z92A 4H25A 4P46C 5IG7A 4OJFL 1BQHA 4XCEB 2GSGB 3P9LA 2D7TL 4JY5L 5F1NB 4P5MA 1KYOJ 4KK5D 1UM6H 3O4LA 4LDEB 5HSFA 1JNLL 4NJ9L 1I8MB 3ZKXC 4U3XA 5HI4C 3EOAB 1LILA 3GB7A 4OLYH 4M48L 2Y5TA 1LP9F 2P5WB 4OZHA 1L4IA 4V2BA 1A6UL 3GIVB 3I9GH 1JV5A 4J3UA 3RGVA 3VWKB 1VB9A 4NM8H 5FYKL 4HWNA 3HI5H 1FFPB 5HHQA 4U0QB 4NDMA 2YC1A 3P30L 4N0CC 2NQCA 3QJHA 4PGBB 3MV7D 2C4FT 4XPHH 3INUL 1WLHA 1AO7A 7FABH 1J1XH 2P49B 5GJTL 2P24A 4WUKH 2P7TB 1U3HD 2W9LA 1A6PA 3D39A 3OKDB 4S2SA 5C92A 4P0DA 1A6WH 1A4KA 4U7SA 3QFDB 4B50A 3QHTC 4GKSB 2RB8A 4NYLB 5EUKB 3SGJC 1A1OB 5F8RC 5H37G 5J7CC 2K9UA 4XCCL 4D8PA 5JXEC 1TZIB 1FJ1B 1MCOL 1CICB 4GMTL 4PJ9B 4KXZI 5IB3A 1OT1A 2VKWA 3Q3GB 4GBXD 5INCB 1SEBA 1MI5E 5C6PB 3VD7A 5F9WC 1JWUA 2BRRL 3TCLA 4N8CL 3GJFA 3G6AA 4PJ7A 1BVZA 2IPKA 4F7PB 4H88L 3OBAA 3B9KB 1F4HA 2X41A 3GMOB 1L7TH 3KXFA 3RVTC 5GRVK 1W72L 3SJVE 1CXIA 1D5BB 1A9BB 2DQCH 1F58H 4U05A 3RWCB 4X6DE 1WAAE 4LF3B 3QIUD 2PUQT 1U8MA 1JGVL 4G9DB 2KL6A 2A74B 3TO4A 1VESA 3C5SA 1INEH 5FGSA 3ULVL 4PJBF 5IQ7L 1RUML 3HS0A 1PZUB 1S9XA 1MUJB 3G08B 1R6VA 1S7WB 5IB2A 1XT5A 32C2B 2QQNL 4UTBL 1DQTA 5D1XD 4OF8A 4ZNEA 3ARGD 1WCBB 2CLVB 1QFUH 1LEIB 4HIEA 2D03H 2IFFL 4HX1B 5DQJB 4ZXBB 4HJGA 5GS2H 4PV8A 1OHQA 3O41A 4G8IB 3LQAL 1NAMH 3U9PH 4MNQE 1R3LB 4LPTA 1UM5L 4KI5D 4PRIE 2D7OA 1RVFL 4XHJD 1NFIA 3BPOC 5JXAL 2OZ4L 1Q38A 4X8JB 3H3PL 3OR6A 4URTB 3NABH 3CFEB 1TVBB 2BC4B 3EO1B 1NDGA 5T5FH 5KG9B 4NC2B 3BH8B 1TJIL 1QQDB 2CIIA 4Q97A 1S3KH 1E4WH 4OM1L 4PYHA 5D7JA 2GY7B 1WBYB 4MJ2A 1I7RA 1UB5A 5IP4A 1X9QA 4XNYH 3ILPA 1R24B 1A14L 4OZFG 4TTDD 5GRUH 1A7NH 1BHGA 4ZTOL 1PD6A 1CVSC 2C3WA 4MJ4A 5BS0D 1SBBA 1TDQA 3DMMB 3IDJB 4HZLB 5E8EA 3HMWH 3WFHA 4PJGE 3MA9L 5FFLA 1PDKA 2FEDC 3SDXF 4LVOC 2J88H 2MCPL 3PV6A 1OARH 1A6TB 2GQHA 1EFQA 2N1KA 2VLJB 4S10A 3TV3H 1FBIL 3SDAD 4XVTL 3HE7B 3WHXB 3CFCL 3VE0A 2E6QA 1MY5A 3MLUL 5JZ7D 4XB7A 4LSSL 3B3IB 1Q9KA 5DUML 5A2FA 4P2YA 5K9JH 4P23A 1OGAA 4JFYA 1RZFH 3W9EA 5FF6A 3GMRB 3MODH 2C7UA 5JO5B 2VO5A 4S1DD 4DFHA 3OKOA 5CJBA 1S7QB 1RAMA 1MHEB 2X89D 4RGNB 2EC8A 1X3DA 2DIAA 5DRNB 2GFBB 2CKBH 4D0CA 3QCVH 3VJ6A 1U58A 4MDJB 2HFFB 5CGYC 3U9UA 1X7QB 5D5MF 4L8CB 4QXTB 1IEAA 4GS7C 1IC5H 4HKJA 5AYUL 5I8OL 3PNWB 3AREC 1LD9A 2JCCB 4HFWA 1QSFE 5FCSH 3QFJE 3IJSA 3WIHL 2PTUA 4QXUH 1N3NA 5D70L 3SKUD 4D0DA 1XF3B 3C2AH 3GRWA 3TESA 3DXAA 3L1OH 4KMQA 4EXPX 2QBWA 3LQMA 2Q86A 4NC1E 3ZDXF 5IW6A 3QRGL 2AJSH 4O9HL 3FTGA 5FV1L 3GO1L 3T0EB 1SVZA 2NX5E 2UZIL 4CNIB 4WO4C 3GBMH 1KC5L 4LHQB 2B4CL 3K1KC 5D71H 2J7LA 4WFEE 4GAJH 3QEQD 4LLAA 4NKOA 4YHYB 4GXUM 1VEPA 3T8XA 4Z7UF 5DD0H 1MEXH 3SGDH 5JORA 1MFEH 2DM2A 3GMNB 1T0PB 2Z31C 4X7CC 1INDH 5DEZA 5FHBH 4YDIL 3RWDB 1JYNA 2IQ9H 1NAKL 3RZCB 1ORQA 4H1LB 5F6IB 3CH1A 4R2GD 4X4MA 4F7CA 1A4JB 1R3IH 4MJ6B 2PYED 3DX9B 4DK3A 5ICZA 4M62L 1KGCE 4NC0B 4JDTH 1BECA 4JCLA 5I16B 3R06A 1T66C 5DS8A 2X7LB 3MNVA 4YPGA 5CD5C 3PWNB 1KEGH 4WTZG 5IESH 1N4XL 6CGTA 4GSDH 43C9A 2RAMA 1RU9H 2NNAA 3Q1SH 3RVXD 2P8PB 3AAZA 4KGLA 4P9MH 3VXMA 5GGSA 4C58B 1I8LA 3V8CA 5C0EA 4P2RB 1C5CH 3FAWA 4PLJD 2HJLB 4B5EA 4F2MA 5IV2B 2P43B 1YMHA 2EEBA 2D7TH 2OTWB 4JY5H 5IMLB 2EECA 4MWFA 2BY1A 4JREC 1JPFA 1T0MA 4X6FB 1H3UA 1T21B 2VR4A 3TP4A 1JNLH 4NJ9H 4BQ6A 2PW2A 1E6OL 2OLDA 1S7VB 1EAPA 4TOYH 3HC4L 3MLXH 4PY8I 1WICA 4M48H 1GC1C 1T5WB 1QKZL 4KJYA 3ALXA 5FOJA 4M7KL 4KI5F 5D7LD 2A1WH 1A6UH 2YBRA 4NFBA 5FGRA 2C4FU 1T1XA 3EFFB 1T1ZB 2BOCB 3HB3C 2YPLB 1QLRB 1GOHA 1LK3L 2YD8A 5JOEA 2VC2L 3QEUA 3P30H 4DWHA 1UJ3B 4DJMA 4MNGE 3INUH 4P2QE 1P2CB 3OJ2C 2Z8RA 1U8OB 2BVUA 2NY7L 5GJTH 1GGYA 1EUUA 3WIIL 2D31B 5D1ZD 2C4XA 1RV6X 2CLZA 2P46B 1E27B 1IAOB 3CXDL 4E42B 4DUWA 3PUCA 3V5DB 3VGAC 5C0IA 2UWEA 5FB8B 4ZFGL 4HKXA 4Y5VC 3VXNB 3VH8B 3QUXB 2NXYB 4XCCH 1CGSH 1MCOH 4XVUD 4MJID 1TQBB 3VFWB 3TYGL 1Z9MA 3C09C 2XTJD 1T22A 2DLIA 1YNTA 2XICA 3KLDA 2OS7A 5DURD 3OR7B 5DHYB 2BRRH 1MREH 2B1HL 1EO5A 5M7QA 4N8CH 2UYLA 2GITB 3KPOB 5LQBL 3Q5YA 2GTZA 2OL3A 4U0RB 5IF0A 2DQTL 3FJTA 1W72H 5IBTL 2GY5A 1M05A 4DEPC 2YEZA 1N5YL 5ALBL 5HXMA 2X4NB 3UP1A 3FB5A 2Q8AL 4PLNC 4L3EB 3KLHD 4F7MA 5FYLL 1JGVH 3MO1B 4NT6A 5TF0A 4YDJA 5C0NC 3TYFB 4EUPH 3FT3A 1I85C 3GHEL 3MBEB 4I48B 3ULVH 1H3WM 1KCVH 5IQ7H 1RUMH 4OF0A 1BJ8A 1JP5A 2CXGA 5ANMA 1IZKA 4RZCA 1OP5K 5HDQL 3WJJC 5F3BB 3B8SA 5FM8A 1NCUA 2QQNH 1M4KA 3D18A 2FGWL 2R1WA 4V1DE 3BXNB 5HYIA 1QBBA 4XRCB 3QQ4B 4QRTA 4ZUUB 3KYKL 4KUZL 4YBQC 2SEBB 2FH8A 4X7TA 2IFFH 1LO5B 2VN7A 1GZPA 5HY9B 4Y4HA 5FK9B 4X4XB 3VRLF 1BBJB 1OGTB 4MD5B 1OLZA 1KFAL 2EDDA 3LQAH 5JIHA 5ADPL 4R3SA 1UM5H 3VWJA 5IWLC 2XTLA 2APWA 1RVFH 5KSUB 2GSGA 2NR6C 4WWKA 5JXAH 4TULL 4ZOEA 3O8XB 3QIWB 2OZ4H 3TN0C 4XNUL 5LG1A 1CD1A 5EUOB 3UTZA 5DF0A 4JZOB 4M4PA 1HCVA 4HEPG 4JZNA 4ODXA 3IETA 4P46A 5EIIB 3MRFA 5CZVL 1WC7A 1UCTA 2X4OA 2APTA 1JN6B 4KROB 1QG3A 2IJ0C 4TNWK 3HMXL 5CSGA 3W39A 2WQ8A 4HGWA 1IM9B 4NM4L 2OCFD 4F33B 1UWXH 4NQED 4JKLA 3QDMD 3OKKA 1A14H 4JFOA 4M6OL 3P9WB 4AZ8A 4ZTOH 2DQHL 4YEFA 5JHDD 1D9KC 3T0WA 35C8L 3KPNB 1S9VB 2V5RA 1N0XL 3V9FA 2NY0B 4I0CC 2B8OT 5TPWL 1FBIH 2LV4A 4BQ9A 4XVTH 2F8OA 1FYTE 5BRZE 3KYNB 4OD2A 3CFCH 4YHIB 3BGFC 4OGAC 3MLUH 4LSSH 3I2CL 5DUMH 5ITFB 3G04B 4WV1B 3BZDA 2YRPA 1NBVL 1EDQA 1QA9B 3F12B 5C7XL 4PJ9A 1T0NA 1J8HD 3FB6A 2AW2A 2YA0A 1CXHA 1FZKB 3SGJA 4O51A 2ZZUT 2HJFB 4NZDA 1OAYL 2FECL 5C0CE 1PSKL 3CFIC 4KV5F 4GKNB 1P7KA 5KSBF 1FN4B 4WU7B 3HZVA 1YMMB 2PKDA 1BWWA 3QRFM 1Z0NA 1J1PL 3DNKA 1GIGL 4Z5RB 1MCRA 4RX4A 5I8OH 1WZLA 5JPNB 4KUCF 5C0BA 1INQA 3U6RA 1JFQL 2UVEA 2DB8A 1J11A 3MLTB 1WBXA 3EOYG 1J0YA 3UAJC 3WIHH 5D70H 3VI3E 1PKQE 1BFVL 4M9OA 3GK8L 1LE5B 2EICA 3UJTL 1IEBB 2DJSA 5ABDE 4OFKA 1M7DA 1FP5A 3QRGH 5DC4B 4WHTB 2XN9A 1P4LA 4MA3B 5C8JB 4ETQA 3E0GA 3GO1H 4U7KA 3Q0HA 1S7UB 2UZIH 5DJ6B 5HVGB 1BM3L 5BV7C 3ARYA 1U3ZA 3DRQB 1KC5H 2X6MA 3RNQB 2B4CH 4U6YA 4U2YA 4WUUB 2IAMD 3I6KB 2VZSA 1XAUA 3MRMA 2P8LB 1FLRL 2VIRA 4PJAE 3EFDH 4MGXA 1MCHA 2JLLA 4HX1A 3HI1A 4MZ2A 3F7RA 3W9DA 3UTQB 3VXQB 4YDIH 4AT6A 1NAKH 3S36L 4KK8D 3ULUD 4FFYL 1JGUL 1DUZB 3TIDB 5F9AC 3OL2A 4Y5XB 3T09A 4P59L 3CDYA 1KULA 1LP9B 3MOQA 4XP5L 4YK4B 1OSZB 4OKDA 4C4KT 1YEGL 3IAGC 5I1GL 1B88A 2P44B 1XGPB 4IDLA 4TPRL 1MFBL 4QY8A 1QBAA 3EYSL 4XVJL 1BIIA 2XOTA 3PDOA 3SO5A 1X5XA 2A9ML 1PEZA 3FN0L 1CT8B 1QFOA 2XQYK 5FA4B 1ZANL 3UC0L 3N0PB 2EXWD 2W1NA 5J56B 5J9PA 1FCGA 2WUCL 2OI9B 4K7PL 3VXSD 2LQRA 2VDOH 4Y5YC 1FNSL 5CEXB 3PQYE 3SDDB 1VA9A 4Z7WB 3V4PL 1ORSB 1OOAA 3WMSA 4BQCA 3D3VD 5I1KL 1C08B 1MLBA 3IRZA 3HHRB 1UH4A 4P4RB 1E6OH 3HC4H 3W11C 2NY4B 3OXRA 4ELKB 1QKZH 3F7YA 4E5XB 4RMTA 4M7KH 1G9NL 4JPIA 4YR6B 5SWZD 2FWOB 4JZJC 4C56A 4DCQA 3LKOB 4UI2A 3F6LA 1B6DA 3FB7B 5GGVY 4CBPA 1ZLVH 5JO5A 1LK3H 1OB1A 3RQ3A 1CLZL 1EFXD 1KCKA 2VC2H 4NBZB 1EZVX 3L3HA 4XPTL 5L2JA 1IGFL 1RZIA 3OJVC 4Y2DC 3DX7B 1QSED 3D48R 4Y4FC 3BRFA 3LKQB 3WIIH 4FXGB 4LFHD 4QXTA 3VRIA 2H32A 3WS3A 3D87B 4TTGA 3CXDH 5A2JH 3O3DB 4NCC2 4PRBB 1G0YR 4ZFGH 4ZSOE 4BFEA 3NH7H 3OXSB 4PJCE 2Y6SC 4NRXB 1NFDF 1FVEB 1ZOXA 4GG8A 4ELMA 3TYGH 3OF6A 1C8PA 3QH3A 5DWUL 2XACC 3MUGB 3AREA 1S5IL 2XXCB 5ACMA 5C08A 4YQXL 3RWHA 2B1HH 3NAAL 3MLVL 1NBYA 1T89C 3TBVA 3O9WC 4OCYH 2HT3C 5FO9B 5LQBH 4NWTL 3RWFA 1J8KA 5IBTH 3ILQC 3ZZ1A 3AS3A 4GRLC 5ID1A 5DSCA 2WNGA 2FNBA 3HZMB 5ALBH 1N5YH 4WO4A 1Q1JL 5L8KB 4I2XB 4AH2A 2OQJA 5M95B 5ICYA 3UX9B 1LEKA 1RJYB 5FYLH 1W0YT 5J06A 4MCYB 4TUJB 4OZ4A 5IW1B 1WUNT 2BNRD 4QOKE 2F54E 1UVQB 3GHEH 4JAMB 4XZUB 4MX7B 3ZTJG 2Z31A 3DV6B 1ZS8A 4WEMB 4XPAL 3CIQA 5HDQH 2A38A 5IQ9B 2GI7A 4PJ8D 2CUIA 2FGWH 2Q20A 3PWNA 5HYSA 5KANG 1ACYL 1KENL 1T2XA 2CDFB 3RUGA 5DVLA 1MIML 3KYKH 1CL7I 4KUZH 1F3JB 5FYKD 1EERB 3FQRB 3O6FB 3PIQA 4DZ8B 4U1MA 4I9WE 1JGDB 2WINB 3RBGA 4JQVC 4LNRA 1HCFX 4PJEE 1KFAH 3G9VA 5E1AB 2NY1B 3ES6B 4GAGL 1PY9A 1DBBH 5IKCB 5ADPH 3T0AA 3WUWB 4J1UB 2F5AL 4TULH 3DUSB 2K7PA 4XNUH 1WF5A 2VLME 3IF1A 3LKRB 3MRQA 2ICWJ 5DEGB 2GSIB 1JK8B 1FNFA 3C9NB 3UZQA 3GSWB 3ULUF 5ESQB 5J11C 4NCC1 5JOPD 1Y6NR 2E5EA 5DTFB 1SEQL 2ZG2A 3HMXH 3QZWB 1UXWA 4LLDB 1UWXK 4JRXE 2FZ3A 3PDDA 4NM4H 1YN6B 3HR5B 4PJDE 2RJMA 2DWEB 4LVHC 3AMLA 5A2KH 1H3VA 4M6OH 2DQHH 3QIBC 1QFHA 3MJ6A 3MMEA 3QJFB 4KKCD 3CX5K 1KCRL 1S78C 5JR1H 1LO3H 1NCBL 1BIHA 35C8H 5IMKB 2VABB 4X6DB 3CSBA 3MV7B 4D9RD 1N0XH 3H9HA 5BW7A 5TPWH 3QXUA 3REWB 5KANI 4F15B 5FUOL 4PGDA 2AKRA 1U3HB 3RVWD 3RKDC 2FYYB 1RUAL 1UWEL 4LLVA 3MZGB 4X9FA 5TDOB 3WL9B 3QUXA 2JJTC 4EDWL 2VLRE 1NBVH 5C7XH 3SGEI 2VN4A 1A7OL 3JTTA 4X4YA 3GSUA 2CRMA 4OFYA 4FG6C 4PRDA 2MPAH 1W0WA 2QQKH 4Z7QF 3MJ7B 4Z7UB 4Y5VA 3B83A 4QRRD 4YIQB 1OAYH 4GBXB 1PSKH 1EX0A 2WP3T 1B4JL 1G7JA 1KLUB 4Z7VE 4PRNB 1ED3B 2D4FA 3U2SB 1Z0MA 1QACA 1J1PH 1SYVA 4IRSC 5CZXD 1GIGH 1VSCA 2Q7YA 3ZT7A 2CXKA 1JFQH 4LLYA 5GGUB 1DZBA 5FUZL 1YPZB 4YEEA 2AV1A 3U30C 4KTEL 3DVNB 4N0RA 4ZD3L 5C09E 1BFVH 3WO4B 3FHAA 3GK8H 4ZFOB 2ADFL 3UJTH 4HKZA 3JWDC 43CAB 1U41A 3MBEA 3MNWA 4K8RC 2J8UA 3GRWL 2EEAA 3SCMD 5EIQA 2XPGA 5T1LB 3R8BB 4NZTL 1JWSA 2IGFL 4BYHA 2V2TB 4PP1C 1QFWI 2E6JA 2X4TB 4UDUB 3TLRA 3ULVE 3QUYC 1HILB 1I85A 5D1XB 1FLRH 4PD4J 5JIKA 3HAEG 3S96A 3WUZA 2EYSB 4W6XB 3ARGB 2V7HA 4FA8A 5KAQG 3RBSA 4WJ5A 3WJJA 1U8NA 3OX8B 1X5HA 3BYTA 1K5NA 1GCFA 4PJGB 1KJVA 2P42B 2R2HA 4WI9A 1AC6A 3S36H 3L5WB 1JGUH 4X9IA 5SV4A 4X0KA 3F7PC 4PD4K 5MEOB 5I74B 4P59H 4WI5A 1VFAB 3DTXA 5GS1C 3MRIB 2ITDB 4XP5H 4CMMA 2YHGA 1F45A 1K8IB 1CGTA 3LN5B 2ESVA 1YEGH 2HT2D 3BKCL 5I1GH 3PWJA 1GGTA 4RAUA 5IWLA 4TPRH 5IMMA 3QG6B 1VACA 4OCRH 4PUBH 1MFBH 3CH8A 3TN0A 3EYSH 3PWPD 3UTSE 5GS0L 2A9MH 3FN0H 2VR9A 3MV8E 5F7HA 2DQFA 5E8OB 1CDJA 4AM0B 1XCQB 5CMAB 4IOFC 2OM5A 3UC0H 4BJLA 5KVEL 2WUCH 3QNXA 5TF1L 4K7PH 1DR9A 1F2XK 4NC1C 4G8GD 5BVJA 1MRCH 3JVGC 5EA0L 3V4PH 3B9EA 4R4BB 2R29L 5T1KB 4J7RA 4M43L 5I1KH 5BS0B 2YPKA 1EPFA 1WFOA 1E4JA 3MXWL 1JF6A 3Q6FB 1OLLA 2ARJB 4KTDL 1C7TA 1FC2D 3VFRB 1AI1L 1D9KA 3SDAB 5D96C 4CRPA 4LCWE 4YXHL 1ZHLB 4EIGB 2WBJD 1G9NH 4DGVL 4XXDB 3L95A 2UV3A 5SWSD 1JTOA 4MJ5A 4M6ML 2OTUA 3RL2B 1I1YB 3PL6C 5F7DA 4L4VA 3K3QA 4BH7A 1GH7A 4LHUD 1CLZH 4LCCC 4N8VG 5ALCL 1EXUB 5MENE 4OZIF 1UZ6E 4XPTH 3CU1A 3V5KA 1IGFH 3D25A 5DFVC 1I3RB 3SDCD 2VDLL 3P9MA 1U36A 4KKLC 4PGCA 4PJBE 3ALPA 1ZA3A 5DJXB 3DROA 5F72S 1OF2B 4DAGL 3MOAL 1S5HA 4WFHE 4BH8B 4CGTA 3SE9H 3V8OA 2CUMA 1R3JB 3TA3B 2MKWA 3BPNB 2XNAB 2MFNA 3U7YL 2LTQC 1OD9A 1M71B 2AK4A 4YUEL 3CCHA 4ODBD 1X6LA 3LRSB 5L8LB 3K8MA 3N1PC 3QISA 5DWUH 4XNXL 5TDPB 2PR4L 4HW6A 1S5IH 1NGPL 2NY2B 3L5IA 4YQXH 1S9WB 3E2HC 3Q6GL 4Y19A 3NAAH 3MLVH 1A64A 3DRQA 5IVNA 3HNSL 3E1F1 1QNZL 3WBDA 4NWTH 5B4MD 1A6AA 2HG5A 2G9HB 3VWKC 4W6YB 4P4KD 3HUJA 3PDGA 3QEQB 1V3KA 3HE6D 2O61B 4MD0A 1Q1JH 5D2LE 5B3JE 5EU3B 2OL3L 3DOSA 5HHNB 1K3ZA 3P40A 1KPVA 5DJYA 1I3GH 2NY3D 4L4TD 3TIDA 5IEKA 1DBML 1U8IB 5EU4A 3O6KL 2ZCKL