4HQQL

Crystal structure of rv144-elicited antibody ch58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL01
4OZHE 2Y6SC 3E6FB 3V4UH 3OKKA 2RCSL 4JRWA 3C87A 2GAZA 1PZ5A 2GTWA 3P9MB 3TA3D 3MLZL 4Y5XA 2FYYB 1V7MH 5CMAB 1LO0H 4GAGL 4ELKA 4WI5A 1E6JL 3MOBL 5F9OL 3DX6A 2Q7YB 3RWDA 3BX7C 3NFPB 4N0CD 2Y1VA 4R96A 2VR9A 4K8RC 1Y18B 3BPCB 2W9DL 2NTFA 1RJZB 4MXVF 1MFEL 2QADC 1IZKA 4LPCA 4LEOA 5L6YH 4R4NC 2QL1A 1IGTB 3OKEB 3VGBA 3O3AA 15C8H 4U1GC 3UTPE 1CXIA 4TULL 3G6AA 3DBXA 1C5CH 4ONHB 1HXMB 1NJ9A 1K5NA 3WFBH 4HG4K 4YNYA 4TNVK 3PWNB 3DVNA 3FB8A 1YEIH 1T3FB 1WVZA 5ACMA 3MV8E 1XT5A 1OAXH 5ECJE 5IBUB 1BFVL 4QHNA 4X5WA 3EFDL 3NCMA 4XRCB 4ODSL 3BD4A 3EZ8A 3QRGH 1QO3B 2L7JA 5ANME 4IMLA 5DA4A 5DVKA 5J06A 3SCMB 4M6NH 1SEQL 2NY1D 4JFFD 5J1AB 1ZLSL 1JPTH 4O5LH 3V0AC 4N8VB 2VDLL 1KJVB 1RK0B 3D87B 1RIHL 4LPXA 5CD3B 4L29A 3MRDB 1QFWI 3QT2A 4JZJC 2ADJB 4R4FH 1F6LL 4R97B 3CZJA 1BHGA 3ULUH 3ARGA 3B3IB 1J11A 4JHWH 2J8UB 2BNQB 4DFIA 4LLQB 4DAGL 3OMZA 4N0FA 5TDPA 1HQ4B 3O0RH 4S1QL 5DD6B 3D85B 5I74B 3THMH 2XTJC 3WL9A 3LCYA 3NABL 2DQIL 3TPUB 3TP4A 3QDJE 1JRHH 3VA6A 4OBRA 1CL7L 4N0YH 3QR2A 3UJTL 4KHXL 1YUHB 1LNUA 1B4RA 4XP1H 4X80L 4G80B 3G9AB 3DMMD 2ZJSH 5T1LD 2VLKD 2X4NA 3WXVL 1DCLA 2C9AA 5D7JA 3DV6A 3ORJA 3ULVC 3T1FA 5B4MC 5J89A 4RSVA 4MAYB 5D2LF 1X5LA 1A64A 4OBSA 1MJJA 2X89D 3EOAA 2XZZA 3FN9A 4LLUA 4LMQI 1CU4H 1P2CA 5HGAB 1D9KC 3CVHA 4NCDA 1S7WA 1D6EB 3QBTB 4UT7H 1XIWA 1RZKH 1VADB 1CDBA 1QLFA 4PLOB 2ILLA 1FJ1A 2ID5A 1FAIH 1Q9OA 4JFEB 2QR0B 3F7QA 3VXUD 3V6FB 4ZS6C 4DFHA 5CINL 3PGFH 3D9AH 4PG9B 2VXQH 5E2TH 3KLHD 1Z2KA 4PJAF 2J6EL 3QUMB 4OIIL 4EDWL 2XI9A 4AEHH 2RGSA 4EDXB 1A22B 4HMEA 5I71C 3MC0A 2IANB 2AQ2A 4JFFB 5HYSB 1IC1A 1ZK9A 4ZUVA 5T1MB 2OI9C 4YXKH 1JF5A 1OOAA 2LFGA 3BIBX 1JTPA 2O61B 1MJUH 3WSQL 5GJTH 1BD2B 4I9WE 1GRWA 2B7DT 4HK3N 3KYKH 1ZVYA 3KPNA 4D9LL 2NY6C 3AS2A 5IFAH 4TVPE 2HFEA 1LEGA 4RFOH 3OGOE 2A74B 3K81A 3MCG1 1IQDB 1BIIB 4Y5YC 3E6FA 1X5KA 3BPNB 3HAEH 4HQQL 3ZDXE 4PD4K 1ZE3C 4GG6F 2FYYA 1NCDH 1S9VB 5CMAA 3WHE0 2R0KL 5CJQH 4TSBL 1VB9A 1RHFA 1QBML 1U3HA 2EIBA 3NFPA 1BREA 3EOTH 1QFWM 5T3ZH 3V5HB 4RWYL 1U6AL 1T2QH 1Y18A 1FRGH 4H26A 5ISZB 5K33A 5IW3A 4C83A 3SDDD 4Y19B 4V2CB 3T65B 4YE4H 5DTFB 2BRRL 4LDOB 4PY8I 1HXMA 5D1XD 1U3ZA 1MCHA 4XPFH 4GMTL 4RGNC 1S7RA 3CX5K 4Z7UE 3OR7B 4OFVA 4KRNA 3PWNA 4OLVL 1T3FA 1KUMA 4MHHI 1KACB 4NM4L 4RX4D 5GGRA 1QFUH 5IHUL 1KJ2B 3L3OB 4PY7B 1AR1D 4X9IA 1XF2A 4XRCA 2ICEB 2A73B 3J8F7 3T0VA 1LHZA 5DJ8A 5A16A 1QO3A 2J88H 1Q1JL 4L4VE 1IM9D 1UEMA 2X4OB 3MLWH 5GRVL 4AZ8A 2LTQC 3TBSB 2O5ZH 3GSNH 3SCMA 3VXUB 4FTVD 5DD1L 3N1PC 1MCWW 3D5OF 1NCBH 4KRMB 1VSCA 3G04B 4M7ZC 1G7IA 2VDPL 4UNUA 4XVJL 2QQKH 3QPQD 1EJ6A 1E0OB 4G8GE 1MCPL 3PG2A 1JYNA 3RTQD 5KG9B 5F9AC 1K2DA 4KRPD 1NAKH 1OGAD 2DLFL 3S96A 2AEPL 4MVBD 3MRRB 2HMIC 5IK3B 3IAQA 1CGXA 5F1IA 4LLDB 2XQYK 2WUBH 5CJXA 3WUWB 2UUDK 2QQLL 1E6OL 2D7MA 2J8UA 2FATL 4RIRB 2BNQA 5FGCE 4LAJH 1J05B 5CEZE 2DJ4A 3RVXD 5DD6A 4FABL 2JTDA 4HIIA 4QO1A 1EO8H 4MQXD 2OYPA 5IBLD 3MROB 1NCAH 4HXAH 3G6JF 5GIRB 4U6YB 2HH0H 3TGXA 4J3SA 3D69B 1SYVB 3QDMD 2W65B 2ATKB 3O6LL 1ZOXA 5E1HB 4LU5L 1IKNC 5KVDL 3GMNA 3SKMA 1RUPL 1PBYA 4LSSL 4XPAL 1NDGB 1GHFH 4GOSA 3V6OA 2PXYB 4ELME 4F8TA 2H9GB 1J86A 1MNUL 3ZYOA 1HI6B 4OJFH 4M61B 2XPGB 5I9QC 3QJFB 3KXFE 5FKPA 4NGHL 3LDBB 3FQUB 1LO2L 3O3DB 4PV9B 1VADA 3TPKA 1BQHG 2ZUQB 4NHCL 2B1AL 5E2JA 1Y0LB 4NFDA 4PRPB 2QR0A 3K1DA 1B88A 3PHOB 3QUMA 3ZKSD 1HHJB 2WINB 4LVNC 4MDIA 5EU6E 1AQDB 3AMKA 4JFFA 3LS4H 5HYSA 5T33L 5T1MA 1FZKB 2P5ED 1OP5K 2A0LC 3K2MC 3MA9H 1MRFH 2VLJB 1ORSB 3O4OB 3NFSL 2FB4H 2Y5EA 3E3QE 5EZOH 1UWXK 5K9QI 5D1QC 1PZUB 3VGAB 4OIBA 3RWIA 4ZYKB 3IFNL 1X5XA 2AEWA 1G7JA 4HF5L 5JHLL 5GRJL 5I73C 5HHXH 3REVB 2A74A 1HYSD 1F5WA 1BIIA 1IQDA 4TYUA 2CR6A 4Z8FH 1F3DJ 1NEUA 3D3VB 4HT1H 2NY2C 4NQDD 4UTAL 1CXEA 1S9VA 1TETH 3WCYA 4QXUH 1CFVL 4M5YL 3PE9A 2FX7L 4HJJH 4KK6D 4TOYL 3AXLA 4WFEE 4Q9CA 4LRIC 2W9EL 3C5ZB 4EQ3A 5ISZA 3NCCB 1R5VB 1UWGL 2AV1A 4ZPVA 4Z0BH 5T1LA 4QRPE 2VLKA 2ESVB 1TNNA 1UCBL 4OLEA 3AUVA 5DTFA 3NIFF 3SDAB 3GHBL 3CFCL 5FYLH 5E99L 2EDDA 1KGCD 2B1HH 1NCCH 2X89A 1ITCA 1QP1A 3U0PA 4NNPL 2WUCH 3L3OA 1T7XA 3VXQB 5CJOL 1AGBB 2ZUTA 3EIFA 3KR3H 3V95A 1CG9B 4JO1H 4OQ1A 3VD3A 4QOKE 2X4OA 1DQML 3RY6A 1DQDH 1HQRB 5A2IH 4HKJB 1QHPA 3QHFL 4I2XB 5MHSE 2EDYA 3IJYB 3TBSA 3QFJD 3VXUA 1L6ZA 3WNMA 2CDEB 1FLRH 1YMMD 5DXWA 1QQDA 3G04A 2YUXA 3OAUH 3BVNA 4MB5A 4PJ5E 2GJJA 4HUWA 1FSKC 4N1CA 4P9ML 2XZCH 4P2OC 4PJGF 5L7XH 4Z7VE 4KROD 5B3JF 5KG9A 2P5EB 2RCSH 3MRRA 3MLZH 4GAGH 3HZYB 2E7LA 1G6RL 4RIRA 1AH1A 2MCG1 3JTTB 1J05A 2DLTA 1E4XL 4P5TB 3R4DA 5D2LB 4MA7L 3DARA 4WFGD 2W9DH 5DRNA 1MFEH 4U1HB 2I9LA 4OFDA 5GIRA 3D69A 1K4DB 2QBWA 4TULH 1KJMB 2ATKA 1AY1L 4K2UL 1JPFB 3LH2L 4G6AD 3B5GA 1DN2A 4OFYA 4P57A 2V5MA 4UBDC 3IT8D 2FBJL 4NKDA 4NQSB 1T21A 4QLRA 3T8XA 4PJAB 1ADQL 1T0NB 3HI5L 5CEXB 3SDDA 3CU7A 5FFLA 4M48L 1UH3A 1ZHBB 5D1XA 3FTGB 1HI6A 3H2WA 4M61A 3LD8C 2XPGA 1KLFA 3CZFB 3MOAL 2AJYL 3A67L 3FQUA 3O3DA 5H35A 4HUMB 1ZLVK 3QEHB 5LGKA 4MWFB 5F9WC 1OVZA 2KL6A 1Y0LA 4PRPA 4Z78A 4EXKA 4J4PD 1A1OB 8FABA 3QEQB 2WP3O 3PHOA 1IM9A 1GGYA 1U95A 3FFCB 4OAWB 4NP4H 1SHMA 3ZE1F 1ORQB 2PYEB 2WINA 3MRKB 4TUJA 4X8XA 4X7CC 5I76B 4GXVL 4HC1A 3I9GL 2MQ0A 3VRLE 4GG6B 2BXYA 1CFNB 4OZGF 4GXUN 3VI3F 4M5ZH 4Q9QL 4HZLB 2VLJA 4ZXBD 1ORSA 4X4YA 3QH3A 1FZJB 4KROB 3RTQA 4XT1C 3NABH 3QUXC 2EDNA 4AYFA 4PJXE 4KK9D 1HCFX 2BCKB 4EIGB 5IR1B 2AK4B 1BJ8A 5JDJA 3ZYIA 3BQUB 3QQ9D 3REVA 4OD2B 4OQTL 1UGNA 5IM7A 4WW2C 2GI7A 5CZVL 1R5WA 5K9JH 4AH2A 1KIPA 5FYKU 4MB3A 3EJZC 1A5FL 3H9HB 3LPWA 3MRNA 1N59B 4ZUSB 3IS1X 2NXZC 5C3LD 4IRJD 2JK5B 1LK3H 3QNXB 1W0YT 3C5ZA 1IFHL 1QKZL 1MF2H 4G3YH 2JLLA 2VDNH 3ARXA 1VEMA 4B7LA 4B0MM 2ESVA 2F5AL 2AXFA 2R29L 5JOFA 1M7DA 2HTKD 4URTB 3SDAA 4EZMA 3C6LC 1CDCA 4ZFFB 4FQ1H 5DQDL 2J6EH 1T6WA 3S37X 4EDWH 2Z8WC 3IKCB 3KYMA 4OGXL 4BZ1H 1AGBA 5F3BB 1CG9A 4JRXB 2A9NL 1OWWA 5FM5M 1TJGL 3L3HA 1HQRA 5ESVB 4HKJA 3WIFB 4ETYA 3BKCL 3VWJC 1WFUA 4YLQT 3DPBA 3OKDA 5LGHH 1D5ZB 5GPRA 5EUKB 3HC4L 4M1DH 2MQ3A 1VFMA 3UTOA 1UM6H 4C56D 1BOGA 2FH6A 3G6JB 2B4CL 4LLVB 4ISVA 2P5EA 4P9HH 4UU9A 5IBTH 4HQQH 3Q2CA 4H1LH 1FGNH 3N1QC 1S7TB 4XPGH 1DEEB 3C60D 5KS9E 2DQGL 4XCCL 1FNLA 4TSBH 5HDBE 5JXAH 2WW8A 1QBMH 1UEYA 3D2UB 5MP6H 4P5TA 5J13C 1MCSA 4KDTC 1NBZB 4Y2OA 5D2LA 4NBZB 4APQD 3HLAB 4U1HA 2CMRH 4NQDA 5BV7H 3MLUH 1K4DA 1UCTA 2BRRH 5D9SA 4RMQA 4CL7A 1HHIA 2Z31C 4NN5B 1DTUA 4IM8A 3LPFA 4OLVH 2D4FA 4ZSOB 1Z9SA 5IHUH 3IGAA 4ALAL 4RA0C 2MPAL 1T0NA 4H8WH 3RX7A 3NCBB 4P5KB 5FUCE 3OSKA 2FEDC 2XXMB 3CSGA 1RQ5A 4PG2C 3FTGA 2DDQH 5IVOA 3BPLB 5DD1H 3CZFA 4PJ9B 1RIVH 1F2QA 1HEZB 4DGVH 2ENYA 2K3TA 2X4RB 4MWFA 4CDGC 4Y8AA 1KN2H 3WFEH 1F2XK 1XGUB 1PG7W 3QEQA 4OAWA 2IADB 3ARWA 1B3JA 5F8RC 4MX7A 1FNFA 3FB7B 3EYQD 3QFJA 4YHLH 3O2WL 2FECI 3NAAL 1YMMA 4PJCF 1E6OH 3E3QC 1LO4L 4JM2F 2R2EB 2OTWB 1IGJA 4HZLA 2IG2L 1CDJA 3GIVB 3U0WH 1UZ6F 4FABH 2CKBL 1FZJA 1NSNL 4WWKD 3QQ3B 1KPRA 3BEWB 3TVMC 4AMKH 4P46D 3WFCH 3FO0L 2BCKA 1C08A 4NQCE 2VLLA 2YA2A 2AK4A 3G08B 4M1CC 5CSZB 2L4OA 3AC0A 3BIAX 2Y6SD 2G75B 2W9LA 4BFEA 2VAJA 5DWUH 4NZJA 5C09B 1I8LC 1TVHB 1JIBA 4JVWA 3KPPA 2YKLL 3QSKB 4H88L 4PJ7E 5JR1L 1AHWA 4LSSH 3KPRD 3UMTA 4DUVA 4XPAH 4TSAL 1U8MB 3H9HA 1JBJA 3FRPG 3TV3L 3TYGH 3KYOB 3B2UC 2QADD 2JK5A 3QNXA 4M7JH 5I1HL 2VITB 3ULUF 5F7KC 1BZ7B 1LO2H 4NHCH 4UOJA 2B1AH 1VGKB 5EC2B 3RIFF 3W9DA 2CGRH 4FQIL 4YFLI 1QZ1A 1CR9L 3W39B 4ZFFA 1EMTH 3MLPA 1OF2A 2FJHB 3BXNA 5H94A 2VH5L 3OKNA 4LMQE 3IKCA 5DF0A 4F8QA 3PV6A 1NAMH 4D8PB 4IS6B 4LCWE 3GIZH 4IRSB 3EGSA 5FIEA 4W6WB 3WIFA 5E6IC 4DN3H 4J4PA 1D5ZA 4G9FD 4LF3A 1GAFL 2FJGB 4JVPA 3ZE2F 4S0SD 3GSXA 4LVHB 5CWSA 1VFOA 1OGTB 4AJ0A 3PXHA 5F6IB 3G6JA 1WCQA 2Y06L 4DZ8B 5JHLH 1MCJA 3EO9H 4LLVA 4JR9L 2W07A 3B6SA 3C8DA 3H42L 5AD0B 5HGBA 1WZKA 1YEEL 4NHUB 5KVEL 5KN5B 4E5XA 2ARJA 1ZEAL 5ICZB 4NKIL 1DEEA 5I1DB 1YYMH 1FCGA 1PEWA 3NGBB 1EO5A 4YZFF 4F7CA 2IPTL 2FX7H 4PJHE 4IJ3C 1NBZA 5EZJB 4TOYH 3KPSD 1LGVA 4WHYH 2W9EH 3CJJA 3NA9L 2FJFA 2CUMA 1UWGH 4UAOC 1D5BB 5A2FA 2V17L 1TQBC 4MXQC 5ESAB 2P8PA 4ZAKC 3CFCH 5E99H 2P5WD 3WIHL 2Z4QB 3QO1A 2AERT 3ARQA 5KTEH 1HE7A 4O2FA 1UVQB 4A6YB 2VDRL 4YHNB 4GW1B 3QI9D 3DRQB 3ULVD 5L88H 2AJXL 2V7NB 3VW3L 4I18C 4LOUD 4WCYL 2OTUB 2ZOLB 4P5KA 1DQMH 1UM5L 3QHFH 5ESQA 1IL1B 4OZGB 4RA3A 2EKJA 5B8CC 3ZKQD 3MRHA 4JG0L 2WLZA 5FYJD 4ZS6D 4P9MH 4NBYB 3LPGA 2GSIB 4F2MB 4XAWL 1LP9E 4LCCC 2YD3A 2BVPB 1G84A 1A6UL 3LY6A 2R0ZH 3FB7A 4S1DC 1FYTB 1GOGA 4YHOL 2H26A 3OKMA 2AJUL 4TVSa 5F1OB 2BZDA 4BK5A 1GC1C 3SKOA 5I16B 2R2EA 2XICA 2EC9T 5JW4Q 2CXKA 4RISL 1E4XH 3GIVA 3RPKA 4MDJB 5CLTA 4MA7H 2FLRT 3H7LA 2I24N 3KYAA 3UX9B 3BEWA 3VFOB 1U2CA 3VD9A 3G08A 4PJBE 1H3TA 4MJ6B 5CSZA 1AY1H 3BYYA 3C60A 3WNOA 4WUUB 1HILB 2X4SB 1TVHA 3FOMB 1T03H 3U30B 3U7WH 3O45A 1MRDL 2G9HB 4APQA 5ALBL 5J0BA 1MCLA 3SGJA 1XH3B 4M48H 1TNMA 4K8RH 3UTQB 5C9KA 3OJVC 4RGND 3T0EE 4TTDC 3L6FB 1MLCB 3DX8B 4LSDA 4YHYB 5B3NA 5KANI 1MWAA 3W39A 4PJGA 5HYJE 3HMXH 2VXTL 3DVIA 2XRAH 3FAXA 1P69B 2R69H 1HOCB 5IJVA 1T20B 4GXVH 1V5JA 1A6WL 3L3GB 2Z93B 4IS6A 4D8PA 2C1PB 4LSVL 2J3SA 3NH7H 1CGYA 5C0NC 5JA8B 3X12B 1YEKH 1KCVL 3U7YL 1EFXB 2FJGA 4ZOCA 4ZNEA 3QB7C 3JV6B 4OZFH 1NLBL 3ZDZF 3CPLB 1OGTA 1T5XB 9CGTA 5L8LB 4DZ8A 2GK0B 5IESH 4CVXB 3K3QA 2HMID 3SO5A 4NHUA 4WIQA 3FO9A 4JRYD 3S3JA 3RWHA 5CZVH 3V8CA 5KN5A 2X5PA 5ICZA 1X3DA 1I3RB 4WWKA 5I1DA 1F3JB 3MLYL 2H45A 3HE7C 3P30L 1A5FH 4OLUL 5E0QA 5GRUH 2WWKT 2AS5M 1EIBA 5ENWA 1G1YA 3GSOB 1QLEH 3MJ8B 5T5FL 5IB3B 1WIPA 3IJHB 4X9HA 3EYUL 1D5BA 3MUJA 4XP9L 3GJFK 5C0AD 2EC8A 5ESAA 2XKUA 4OUUB 5FEBA 3T3PF 1ZXQA 1RZJL 2Z8VC 4HAFA 3IDUA 1XR8B 2XN9D 1II4E 3LKPA 3B9AA 5IMMB 1FGVH 1KC5L 2VNCA 3U4BH 2JJVA 1JGEA 4A6YA 4HIXH 1M7IB 2UUDH 4ZTOL 5DQDH 4GW1A 3DRQA 3L5IA 2YD1A 4XX1E 2JB5L 4MAUH 5D7IA 1QFOA 2V7NA 5GGVL 4BQ9A 2OTUA 2A9NH 4K7FA 2B39A 2ZOLA 5IVZA 1F6AB 1DE4A 3GJEB 1OLZA 4PJCB 3BKCH 4JM2B 4PTTB 5JPNB 4Y2DB 1KB5L 1QSEB 3HC4H 4L8CB 3GMRA 4TSCH 1A7OH 2H32H 3LB6D 5GGSB 1CF8L 1HKFA 2G60H 3FT4B 3OG6B 5J6HB 1DUZB 2YZ1A 4P4KC 2Q8BL 2VDKL 5C6WH 2P45B 4KHTL 2G5BB 3GRWL 3TJEL 3TCLA 2JCCE 1FYTA 4G9FA 3QXDB 1R3IL 2EYSB 2DQGH 4XCCH 2NY3D 4PJDE 1KF9B 2VOTA 4X4XB 4TQEH 2P7TA 1BX2A 3IU4H 4LHQB 1GZQB 5B39B 3STLB 1UACH 2EO9A 3S37L 1YMHB 1KNOA 1XGYL 4HWBA 3VFUB 2ADGB 4AL8L 2R2HA 3GUTB 5F9DC 1B4JH 3X14B 5I2IA 4MJ6A 2RR3A 3AROA 4LCYA 1HILA 3VFNB 1KN4L 4X98B 2NY2D 2X4SA 2VDQL 2HFGL 4PLKD 3L5HA 1VFAA 3KLDA 3FOMA 2VKXA 4P2QD 3X17A 1IQWL 2RJMA 1ZVSB 4U6HA 3KPSA 2FH8A 2G9HA 3QCVH 1OP5H 3S97C 4ALAH 3L5WA 1RAMA 4KH2A 5C2BL 3WO3B 5SWQB 1UWXH 5F3HB 2XKSA 1T22A 5T3ZD 5DRWB 1LQSR 4YBLB 3Q0HA 3V0WH 5SWZB 5D2NC 2P5WA 3P0VH 5D96B 3X3GL 4GW4B 2PKDA 4I4WB 4YHIB 4F7TB 3QI9A 3O8XB 4GRLC 1EO7A 1MLCA 1AFVL 4W6XB 4I3SL 4R4BB 2R0LH 1RVFL 5DS8B 1GGCL 4Q0XL 4XB8A 2DYPB 3D0LA 2H6PB 3Q6GL 1HOCA 3U4AA 4D9RD 2DBLL 1O0VA 3LN4A 4M62L 2D7TL 5EBWB 5C0BB 5FM5O 4QHLB 4OM0L 5DI8A 3QWRD 3RP1A 3B5HA 4PREB 2CKBH 3FRPA 3OPZL 1BEYH 1Q94A 5B38B 4C4KO 1DBJL 4KRLB 2X70B 1A47A 3FO0H 3O3BA 4P2OD 1MFNA 4XXCA 1T5XA 3PNWB 4IHOB 3HUJB 3SE8L 2YD8A 3OKOB 5IT2L 4OV5A 2GK0A 8CGTA 3F5WA 1Q9KB 4OZIA 1FQ9C 2P47B 3PJSB 3HE6B 4WDIB 2YKLH 2XZAH 2D0GA 1QPPA 2HTLC 1A7PL 1S78C 4WY7L 1TVBB 3GSOA 1YEFL 3LEVH 5DC4B 2DI7A 2FHBA 5IF0A 1LMKA 3HAEB 4JLRA 5D5ME 3P2TA 4D0DB 2GT9B 3P77A 5F7HA 4P59H 3C5JB 4MNGE 3M8OL 1XR8A 1H3VA 5IMMA 4YX2L 1AI1L 5B21A 1M7IA 4MJID 1LWRA 4CKVX 2NMSA 4Y0GA 3GFUA 3O4LE 2F54E 3ARFD 4RGOH 3TT1L 1NC4D 3GJEA 4PJCA 2YPLB 4NZTL 2X41A 4JM2A 4GS7B 2NQCA 4JDTH 1CD8A 2PYFB 5GGSA 2F5BL 1DZBA 3VFGL 1DUZA 4RZCA 5DUBB 4KJPC 4RMWA 1V7NL 1P4IH 2B4CC 4UQ3B 2ITCB 4HFUH 1YEEH 7FABL 2EDLA 3GSNB 2QHRL 1ZEAH 5TF1H 3RVVC 3NTCL 2EYSA 5MEND 1PG7L 4KJWC 5GRZA 1FFRA 3VXPB 2IPTH 3AFLA 1MVFA 4HFWA 4K7PX 1RU9L 2BOBB 5D1ZD 3RX8A 1GZQA 4QHMB 3STLA 3QUXD 5DJ2B 1YYLH 4ONFL 1Q9LB 1ZLVH 1YMHA 1V3MA 3VFUA 4ODVL 2R2CA 2ADGA 3QQ4A 5C08E 3W5MA 3NBNA 3H9SB 3V52L 1J8HB 2XWJA 1NFKA 4NRYA 4PRHD 2MMXA 5IEKB 3PQYD 4CJ1A 2HLFC 2OXGA 4FOMA 3VFNA 3WIHH 3O6FB 3V0VB 3GMOA 5F7LB 2BNRD 3EJZD 3MR9A 1CYGA 4NFBA 4LKCB 1N2RA 2NXZD 5DQ9B 3RNQB 3FQRA 1U42A 4XPHL 5C0AA 5FYJU 2AABH 2FSEA 4JKPH 5DRWA 3E8UL 2VE6A 1IKNA 5FM8A 2XN9A 3T0EC 5SWZA 4LRNL 4JN2A 3S7GA 3CK0L 1XZ0B 5K59F 1AD9B 4QHKI 3S35X 3UZQA 4I4WA 2QQNH 1SEBB 1BP3B 4YHIA 4ODXB 3O8XA 2YD9A 4G8IB 3C6LD 1IC4L 4L8SC 2K1MA 5JHDE 2W0PA 3ARFB 5DS8A 1CXFA 1X44A 4BKLB 4HGWB 4XAWH 4Z7WF 5ICYA 1VERA 4LSQL 5DD3L 3T2OA 3QXTA 4JDVB 2R1WB 5EBWA 3PXJA 3VWJD 1HHHB 4TNWK 4QHLA 5HHPA 3P0YL 4DGIL 2ZUVA 3WDHA 1IEBA 4L4TB 3MLSL 4F9PC 5IB2A 4Z5RB 5GQBA 5B38A 5IV2B 3BP6B 3C8KB 2EDEA 1CD9B 5E94A 4JJ5B 5EO0A 2CK0L 1ROWA 3MUHL 3UC0L 1FL5B 2R0WH 3OKOA 3ARDC 3RZCB 1NEZB 2ED8A 2AVGA 3MUZ1 4MS8D 1Q9KA 2VLME 3UO1H 4ZOBA 4WDIA 4EXPX 2N4IA 2F19H 3SKJH 1MRDH 3EYSL 2YUVA 3DX9B 5JW4N 3ZT7A 5F1KC 3MOQA 5JQ6H 5FB8A 3KPQB 1ZGLP 2DI8A 2DI9A 4PRHB 1MHHB 4XGZB 4MNQB 3PWVB 2BVOB 3HAEA 3TBWA 2Y72A 3RGVC 4P2QA 3C5JA 2Z31D 3I84A 4M3KB 4FNLH 5JDSB 2FIKA 5GGVY 3V9FA 1SY6A 4QT5B 3I50H 1H9VA 3CFEB 1FCCA 2EH7H 2A6IB 1D5XB 3WS3A 4N8CH 5A43C 4S2SB 3VXMB 2NX5D 2VXUL 4DKAA 2YWYA 4AIZA 2FEDD 1FPTL 4YDJB 2YZ8A 4AT6B 1CICC 1JTOA 2VXVL 4X4MA 5AG8A 4GW5A 5E8EB 1KCVH 4X7EC 3H7BA 3D0VA 5EO1B 1OAQH 2PNDA 1NLBH 3HRZB 3WUZA 4UNVA 1MCNA 2D9CA 3WO4C 5DUBA 4W4NA 4WUUE 4FQ2H 4GRWE 3BSZL 2HRPL 1MRCL 4KMTH 3OJDA 5CIPH 1S7UA 4YFDB 6FABL 3PP3K 4WO4B 2AK1L 2Y5TB 3QWRA 3P9LB 3MZTA 4OCWL 5ILTL 3BGFC 3MLYH 1XFPA 5DUML 4OKDA 1VACB 1DQJB 1UJ3A 3DLQR 3I6GA 4TPRH 4LNRB 2XT1B 4QHMA 3VU2A 2VUYA 4ONGL 5FUOH 1GJIA 1Q9LA 4TVPH 3BP7A 4KI5E 4E0RB 1GVIA 2CQVA 4PGBB 2FBOJ 4YEEA 4M1CD 1WFOA 3EYUH 1GXEA 4WNQB 3H9SA 4GG8B 1J8HA 3MMEB 2DM2A 1I9IL 1RI8A 3G5VB 4YDKH 4JO3H 5IEKA 1AJ7H 5F88A 2YBRA 1KCUH 1OTUC 4O2CB 4ZTOH 5CGMA 5KSAD 3K4ZA 1KT2B 2JB5H 1QYGL 3ES6A 4TNVF 4LKCA 4OLZH 5IMKA 3RNQA 5E6YA 3AM8C 4EEEA 1GOFA 1KULA 4HX1A 4OD3L 4P2RE 4JPWL 2VKWA 1OAUL 3X3FL 1G7QB 3MV7D 2DRUA 1KB5H 4XMLH 4LCIL 1XZ0A 3T77B 1O7SA 1VCAA 3L7FA 4JFOA 5CILL 1NANH 4MJIA 1SEBA 4NQXB 4FQXD 3MYJB 4G8IA 5J56B 3KYNB 5HHOD 4KQ3H 3UTTE 4XVTL 3ARFA 3S3SA 4LSPL 1Z6JT 2GK2A 4BKLA 5ID0B 2VXSH 1NC4A 4HGWA 4R0LB 2EEAA 4NJ9L 2BK8A 1QSVA 3GRWH 1KB9K 2VN4A 5J9PB 3MLTB 1NLDH 1S7QA 2H2PC 2V2TB 4KGJA 1R3IH 2VZ3A 2R1WA 4KI1A 1FE8L 5E6ID 2EO1A 4NKOB 5ERWB 3HR6A 2IH1B 3OQ3B 4WEUD 1AO7D 3S37H 5E2UL 1FBIL 1HHGB 3TO2B 1SVZA 3W2DH 3KWWB 5IV2A 4QWWC 2AJSH 2VQ1B 5LVEA 4G8EA 4O4YH 5LAXB 3PWPD 3BPOC 4AL8H 4HS3A 3SE9L 3N06B 5JOPE 4Q6YA 1MVUA 2CDGA 3DGCR 1D5MA 2OQJA 5I17B 5F6HI 1JHKH 2D7PA 1G1CA 2NY4B 4GFTB 3TYFA 5D1ZA 1IQWH 2YMXL 5CEZH 2DQJH 4B50A 3QWOB 4U1KB 1QFWL 4X6DF 3MLXL 4YPGB 3GSQA 1FFOB 1MHHA 2NW2B 4PRHA 3DV4B 1ED3B 2IALA 3PQYA 2YPKB 4ZTPL 5GS3A 2W59A 1NGZB 4Z95L 2BVOA 4MXQD 1MI5D 4L3CB 4ZAKD 2BNRA 2Y23A 1YNTA 1KJ2L 4QRRE 3IDMB 2HKHL 3CFEA 1HIMH 4JO4H 1UQSB 1D5XA 2VL5B 2RFXA 1EZVX 1IGMH 4P2YA 5E00B 5GGUB 3Q6GH 3SE3C 1JP5A 2OZ4L 4TN9A 1KPVB 4M62H 5DD5H 1LE9B 4X8JB 4YDJA 1M05A 1EHXA 4WU7B 12E8L 1N3NB 2H8PA 2C7UA 3C6LA 2EDTA 5C07B 1T7WA 1IGFH 1LO5A 2CRZA 5E8EA 1JGLL 4BFGA 5DHYB 5EO1A 5HJ3A 1F42A 4NO3A 4LIQE 4CMMA 1F4XL 4XPTL 3ILPB 1VDGA 5IT2H 5MEPB 4FQQB 4K3DL 4JFQA 3UTSB 2WAHA 4LPWA 3VWJA 2R1XB 4S1DD 1DBBL 1YY8A 1FG9C 1AO7B 2Y5TA 3P9LA 5CD5D 1GGUA 3O6KH 3EJYC 1AKJD 3EYOB 4G7YL 2ZWLT 3B9KB 1DQJA 3OAZH 1WAAE 4O02L 1F4WL 4GKZB 5KVGL 1MCCA 1YEFH 4LAQH 3DX7A 5ITFB 1A02N 3TF7C 3HC0B 3S36L 4PGBA 3MODL 3L1OH 2B0SH 3SOBL 4H1LB 3AVEA 4NZUL 3QIWD 2Y36L 4GG8A 1PY9A 5DO2C 3KJ4B 3EYVB 1MFDL 3G5VA 2X05A 3PGCA 1NGXA 1UA6L 3DI2B 5J7CC 3PHQB 2P44B 4O2CA 2EH8H 4YWGL 3FN0H 5BJTA 5GGQL 1X7QB 4QRQB 1WF5A 4KTEL 5EPMB 1ZHLA 1K6QH 2D4DA 2WBWB 2X4PA 4I0KA 4Q6IB 1OM3L 4Z7WB 1R3HA 1C12B 5IKCB 2X4UB 2ITDB 1JNLH 3TT1H 5C0BE 1H8NA 4GMSH 1JJUA 5BV7B 5JPMB 1IEAA 3L3IB 2FR4A 4JZOA 2YOCA 3V5KA 4K23H 4TTDD 3ZE0E 3LKRA 4NQXA 1S9WB 3ZYJA 4QKXB 2F5BH 3MYJA 4NPYB 1OLLA 2FGWH 4XXDA 3SGDI 3KYNA 4KU1A 2NX5A 1WZ1H 3L9RB 3HUJE 4EI5C 1V7NH 4IIQC 4L8BB 3ZKNC 1CLYH 1E4KC 5ID0A 4YFEA 4R0LA 3CUPA 3HPLA 4NT6B 3GDBA 1QUNA 4M7LL 3MLTA 4PB0L 2EC9U 2QHRH 3WV0A 1NH6A 2V2TA 5EOQL 5MEQB 4QYOB 1MELA 1WGOA 2ZUSA 1F4HA 4HLZG 1UH2A 3OV6A 4MJ5B 5C0ND 2PETA 4NKOA 4ORZC 5ERWA 5DT1L 3MRQB 1R6VA 1L6XA 1N6VA 2GUOB 1JWMB 1WBYA 5IVXB 1HHGA 4L5FL 3RI5F 3BDXA 3AY4A 1QNZH 2VQ1A 4V2BA 1CS6A 1A14H 1F02I 3BIKB 4I0PB 3EZJB 3DI3B 4F15C 3WFHA 4X5XB 3WEXB 3RL1A 3X11B 4QTHB 2ZUYA 4JB9H 4U1NA 3VD4A 3PGDB 1S5HB 4Y5VB 1WV7T 3HE7D 4X6EB 3M17B 5IG7B 1IAIH 3BUYB 3QXWA 4L3EB 4ZPTA 4OKVA 3MFFA 3BZ4B 4X9GA 4FZ8H 4PLJC 5IQ9B 3TCXA 4YPGA 1JL8A 1FFOA 3E8UH 3ALXA 3P4MB 3VFTB 1NGZA 1ZANL 2OLDA 1J1XH 4P23B 5F7EL 2PW2A 3LV3B 1MIEL 1JGDB 2VLRB 4G43B 5KSAA 2CLVB 1IC4H 3QO0B 4ZD3L 4AEIL 4E41B 4DZBA 2A6JB 2B2XL 2VL5A 3UBXA 4NUJB 2H3NB 2GJZA 5E00A 5GGUA 4LSQH 5DD3H 1NUNB 1AC6A 2N7AA 2AJVH 3MV7A 3MRMB 4HWEL 2VC2L 1KPVA 1LE9A 4X8JA 4X99B 3FHAA 3QIUB 4N8PA 5D7LD 4FQXA 1VFBB 4NWTH 2IAMB 3CFIC 3EFFB 2ZOKB 2D0FA 3L7EB 4DGIH 4PP1D 1ZGLM 2XG5A 3GJFH 1HCVA 4Z77B 4M93B 2J6EA 1S8DA 3CVIL 5DJXB 2GSGB 4FMFA 1NAMB 3BP5A 5HHNB 4M43H 3UC0H 5E8PA 3ILPA 3QAZB 3U7AA 5BOZG 1MAKA 2Q86B 5GXBB 4Y5XC 5KSBA 5MEPA 2EEDA 1BFTA 3GEWB 4UIMB 1AO7A 4DN4L 1OPGH 3QG7L 5CEYA 3VH8B 2NY5L 1GC1H 2CUIA 4HDIA 1MAML 4P4RB 2NXYB 4KI5C 2JKXA 4ZUUB 3PWPA 3GKWL 5EZIH 3DHMA 2B5IB 3BMWA 3QDGD 1BGXL 5D6DC 5EU3B 1XCTA 3L5XH 2JB6B 4XWGH 2VLKE 1GCFA 2XFXB 4NYLA 4J3VA 4LCUA 5LWYH 3NFNA 5ADOL 2BDNL 4QRQA 3S34L 2VB5A 4Z7WA 4JFDB 1C12A 3F7YB 1FPTH 1MI5A 2X4UA 2ITDA 2F53D 4ZAKA 1RK1B 5IIEB 4HGMA 4UT9H 3GBML 2EDFA 3MRGB 4ERSL 5EA0L 3RRQA 4CMHB 2AEQH 5BXFA 1N4XH 5AAMA 1OARH 4JGUA 3DUUA 1S9WA 3U48A 1I7TB 1QRNB 3MRLA 4I18A 3L9RA 2LABA 3MCLL 4Z0XB 4L8BA 1J18A 1BLNA 4YDVB 1U92B 3VMOA 1MRCH 3ARGC 4XC1L 4C59B 4NT6A 4X6FB 6FABH 4R6UA 3QDHA 1WEJH 3DXAB 4GH7B 2AXJA 4ZFZA 4TTGA 4Y4KB 5ILTH 4OB5L 3K74B 4K71C 4MJ5A 1ZHNA 1ITBB 4DVBB 4MMXC 2DWDA 4ZDHB 4KVNL 4ONGH 1HKLL 4LCCA 2RQ8A 4X6DB 3O41B 5DEZA 2WANA 1XGQB 4HWZB 1F8TL 1MCIA 5GS0C 5FHAL 1P53A 4I0PA 4X5XA 1N64L 1DLFL 3X11A 4BFIA 5D7JC 1AKJA 4BH8A 4PGEB 1N5YH 1P1ZB 3MXWL 3LRSA 3QDGB 2R9HD 1N6QL 1S5HA 4X6CB 1QYGH 3FT3B 3M17A 5JLZB 3BUYA 4R2GB 1AE6L 2UZYB 3KPMB 4XMPL 3QIWA 3RL2B 3IDIB 2DMCA 4BK4A 1XIWC 2WBJD 3P4MA 4JPWH 3VMNA 1YQVH 5I8EB 1H3PL 4P23A 1N8ZB 2DTSA 3S3PA 4ZQKA 4N0UE 2OL3L 4G43A 1W0VB 4ODWA 5IFJB 3CC5B 1MHPL 1ACYH 1CFTB 3BE1L 4LSPH 2OR7A 4OCMC 5I8OL 2VZSA 1I7UA 2H3NA 5D72H 3HI1A 4OZHF 1E28B 2GFBA 2GITA 3MRMA 3R06A 4FTVE 2YC1B 1FE8H 4UI2A 3N9GL 1PFCA 2FO4B 2I60L 1LDPL 1NKOA 2C4FT 5GJSH 2XWBA 1AP2B 4LLWA 5E2UH 1HH6A 2GQHA 4Z77A 3DRTA 1C1EH 3AAZB 4KJPD 1OHQA 1OGAE 4JFYA 5DJXA 2YHGA 2GSGA 2D31B 3T0WA 4ZUWA 5LBSL 4KKCC 3LKOB 3JV4A 2NYYD 4LHUG 2Q86A 1IGCL 3UZEA 3CDFA 5JXEC 4U1LA 25C8L 4UIMA 2BVUA 4DKFL 2YWZA 2WWMC 1U3HC 4KJWD 4ZO8A 1QSFD 4FP8H 1TCRB 4OZFB 4ZUUA 3ZSSA 1X6NA 1QFWH 5FECA 5I1CL 3QDME 3TNNB 4ETQB 4HHAB 2YPVH 4JZJB 3TT3L 5EU3A 3J7HA 2HLFD 4MQSB 3ROLB 1M71A 3WS6A 3MNZA 4KUZH 1OP3K 1L9MA 1NMAL 1JPGB 5C0DA 5IHLB 1OAZH 1O5DT 2XTJB 2JELL 3H0TA 3DVGB 2OZ4H 4JFDA 4EN3B 1RUQL 3F7YA 3FHQA 4ODUA 4U0RB 4WV1A 3SCMC 1FO0L 1QHOA 3SQOL 12E8H 2E7MA 5I0ZA 5DK2B 2MHAA 3MRGA 1I75A 4TUKL 1CQKA 3GSRA 5GS2D 1JGLH 5DZOA 1WWCA 3W0WB 1AQKH 1G9ML 4G6FB 1N0XH 5DHVH 4OCRL 5FO7B 1ZT1B 1F90L 1DBAL 5SWSB 4K3DH 2E6PA 5CJXC 4N1EA 4R97C 2XA8H 1U92A 5HHMB 5E2WL 3V5DA 4X6FA 5T5NF 2BY2A 1D9KB 1VA9A 3HB3C 2XACC 3KVQA 4PJEB 5I66B 2WQ8A 2H32B 5I74C 1KIUA 1CDIA 3ZKXB 1B0WA 5KVGH 4UT6H 2BHYA 1MSPA 1S7XB 1OTTC 4LVOB 3BKYL 1J5OL 5C0CB 4GO6B 1IBGH 2MCPH 2HN7B 4L1DA 1XGQA 4K3JL 3SOBH 5I1LB 4D0CA 1CFQB 2XXCB 2KZ1B 1DBKL 1DQQB 1IMHC 1D5IL 1QEWB 1MFDH 2IQ9L 1QSFB 2OBGA 3KPOA 3VXRB 2OI9B 4N0CC 1UA6H 5JUEL 1G6RA 4QGTA 3SJVD 1P1ZA 4JREC 3QDGA 1H3WM 4YWGH 3TBVB 4Y1AD 2HVJB 1MQKL 4MAYC 3V6OC 3BRFA 2BY1A 1MQ8A 3M1BB 3G5XA 5KAQG 2QSTA 4Y4FB 1MEXH 2EIDA 4R26H 2NY6B 3RL2A 4DWHA 5I6XC 3T3ME 3V6BR 4Y5YB 4LHUD 3JV0A 2VZUA 4NWUH 4R7NA 3RGVD 2GJ6D 3MUGB 4U6TA 1KGCE 2E8ZA 1N8ZA 3BKJL 5L2KD 2XQBL 5IFJA 1ZA6A 1YNLH 4X9FA 5JORB 3BWAB 1C16A 4ZO6A 2F53A 3GB7B 1SM3L 3R8QA 3QNYB 3HI6L 5CZKA 3WNNA 4KK5C 3QFJE 1SQ2N 3ZDXF 3TBTB 1RJYB 2BOCB 1X4XA 1HSAB 3IJSA 2L7UA 4H0IA 5DT1H 1CQYA 2W0FB 4G6JH 2FO4A 3UJJL 4BYHA 1WK0A 3FOLB 3U2SB 5F1NA 1INDL 2YSSB 3VFPB 2IFFL 3AAZA 3C09B 4HKZA 1T5WB 1V3KA 5CJBA 4V1DB 3BPNC 1NGQL 4XAKD 4A2LA 4KUCF 1KTDA 4PUBH 3DTXA 5FCSH 2LTQB 1AXSA 2AJ3A 3UPRA 2HLAB 1KTLB 3O6ML 4Z7UF 4J6RL 2ZSWB 2CKBB 3FQTB 4WFGE 3E0GA 3RPIA 4M02A 2Y25A 1S3KL 1A0QL 1IC5H 2VABB 4N9GB 3VI4E 4NQEB 3TNNA 1MAJA 3PIQB 4OQTA 4M6OH 2YN3A 5CKAA 1NGPH 3SJVB 1LK2A 2FECL 3CXDL 2XTLA 1A6TB 1OTUD 4K7PH 3PP3H 4AEIH 3C6SB 1E27B 1GL4B 3N50A 3IDJA 4JHAL 4NDMB 2WBJA 1CZ8L 1URLA 2CLRB 1T1ZB 3RY6C 2VC2H 3FT2B 1BVKB 3GK8L 1DJSA 1J1OL 5J12B 3OR6B 5DK2A 3UTPD 3KLHC 2EIZA 3FQWB 1A4KA 4LBEB 5IVXE 4FZEL 2D03L 3SQBA 5C9JB 1UWEL 2R8SL 4GKSB 3ARPA 3W0WA 3EYFB 1SBSH 5HPMA 3CFBB 2DWEB 1CBVH 3GM0A 1YA5A 1ZT1A 5FO7A 5JW4R 1GIGH 2J8OA 1U8PB 4PBVC 2H2PD 5T1KB 3WXWH 3ZHDA 4PJ8B 3S35H 1A6PA 2CDFB 3U83A 2HKFL 2OP4L 3MREA 1I7RB 2OSLA 1EPFA 2V9TA 3EO0A 2KQMA 1H0DA 5DEFA 4PRIB 1TVDA 1BGXH 1S7XA 4QWWD 5D4QA 4ELMF 3PP4L 1A3LH 3UTZB 5C0CA 3DGGA 1NFDA 2HN7A 1X5JA 1A6VL 3ARTA 3A0OA 2WV3A 1DQQA 1QEWA 3BESR 1QSFA 3VCLB 3VXRA 4QNPF 4HLJA 4E41E 5TH2B 3OG4B 4GAJL 3P4NA 3H9ZA 4UV4H 3MRBA 3TBVA 2HVJA 3MNWB 5D1QB 4DKDC 4FG6D 3BJ91 1KIQB 1MCFA 3M1BA 5D1XC 3WBDA 4OZHB 3TO4B 1AGEA 4Y16D 3IYLW 5E95B 5I73B 3LDBC 1J0ZA 3GBMH 3OZ9H 1BJ1H 1IGIL 3QXAA 5H2BB 2ZUQC 1S7SB 4H20L 3MUGA 32C2A 1I1YA 1AR1C 5M95B 5E8DL 1NC2D 4DKEH 4OD1H 3BEVB 5GGTH 5DEGB 5JORA 2D7QA 5KW9L 2YD2A 1LD9B 2NCMA 1I1FA 3DOSA 1I9RL 3GB7A 3U9PL 3F58L 3TN0B 1WTGT 1CGWA 1I7ZB 4OB5H 3TBTA 2BOCA 4O51A 3MV8B 3S5LB 5A3ID 4C56E 1X5ZA 3D39D 1HKLH 1IEHA 3FOLA 2YSSA 2ZG2A 2BHZA 3R8BB 1I3VA 1T5WA 5ANMB 1F8TH 2KDGA 5FHAH 2HVKB 5KJRL 1EBAA 3RVXC 3P0GB 4HK0A 1CFBA 1ZMYA 1U91A 5IBLC 3ZLQC 5DFTA 2HLAA 5T3XD 4F9PA 2ZSWA 2I5YH 2CKBA 3EJYD 3FQTA 1CFSB 3JZ7A 4XCEA 1P9MA 1AE6H 3HZKB 4XMPH 5GISH 2VABA 3C5ZC 2E9BA 5DJDB 5HGGS 4N9GA 3MV9D 4NQEA 3PIQA 5C8JA 4RQQA 3S4SA 4K94C 1EX0A 1LO0L 1OSZB 4WHDA 3SDAC 3SJVA 4RMVA 2J12B 5DO2D 1IAKB 3KJ6L 3WJLA 1CD0A 1N6UA 2OL3H 4Y1AA 3CFDB 4JG1H 1MHPH 1A3QA 1A6TA 1LO3H 1NBVH 3TWCH 3FKUS 4P5MA 1UM4H 5L6YL 4Y16B 3QDJB 5IOPA 4YO0B 2OM5A 1C5CL 4Z7VF 5DMJB 4M6MH 4NKMA 1R3LB 1YEJH 2BY0A 3GSUB 2GJ6A 3WFBL 3Q6FB 5BS0D 3KPLB 3FT2A 2OJZH 1YEIL 5L2KA 4HH9A 2E6QA 4NRXA 3WHXA 1BBJB 2X6MA 3N9GH 3OR6A 2C1OB 2DL9A 1X6LA 2I60H 1DL7L 2COQA 3FZUC 1EHNA 3BH9A 3QRGL 3EYFA 4EI5D 2A6KB 3HHRB 3ZKND 3MJ9L 2DWEA 4M6NL 3EOBA 4NOFA 1IGCH 3UYRH 1FNHA 3MJ7A 3QIBB 4O5LL 5T1KA 3DWTA 3LD8B 5GRYA 1FZMB 2Q8AH 3CLFL 4X6CE 1YDPA 4NZDA 5DURB 4PY8J 4P5TC 4XCNA 5BRZD 5E9DD 5JNYB 4PRDA 4BJLA 2NY5C 5GHWH 3V7AG 5CBEB 5HGHA 3BZFB 4R4FL 5KZCB 1R24B 5I1CH 3TIDB 1IM3A 2OS7A 2QV2A 1JF1B 4JY4A 4NKQB 3ULUL 4S1SL 4Q9RL 1ND0A 3UTZA 1YY9D 5CIPB 2VR5A 3KPTA 4OGZA 4YUEH 3DSFH 3KPRE 4KK6C 4QXWA 1CE6B 2X4TB 2ICWI 1JRHL 4XCFH 2IBZX 1BAFL 1NMAH 3VXSE 4N0YL 4XNZC 1U0QA 2IBGA 4QCIA 4U6XA 4LQ1A 4XP1L 1YEGH 5FO8B 5D7IE 4LKXA 3ARBB 2ZJSL 1FO0H 3SQOH 1JZ2A 1ZWIB 3D25B 1CTNA 2ADIB 3W11C 3WIHA 3SDYL 1S7SA 1YJDC 4HPOH 4OTXH 4CN1A 4HV8B 4XZUB 3HG1D 1T04B 1HSBB 3O2VL 4JFXA 1YECL 1G9MH 4QHUB 2Q6WA 2H2SC 2WIMA 4DJMA 1T83C 2XNAA 3BEVA 4PJXF 3AM8A 3JWDL 4OCRH 2R1YB 1MIMH 4UT7L 5IJKA 1LD9A 1DBAH 1JK8B 2H1PH 1RZKL 3B2VH 4BSJA 3QZWB 5E2WH 1R3KA 2GIYA 1FAIL 1R3JB 3S88H 3D18B 2EDBA 5LJYH 3VDAA 5EOTA 3U0TA 1KB5B 4M4RA 1QLRB 4G9FE 1EUTA 5I1IH 4N9OB 2CH8A 1RURL 2VXQL 5E2TL 4LPVA 4KROC 3MV8A 4CUCA 1KBGH 4WJ5B 3O2DL 5DK0B 2D2OA 5F96H 2W0KA 3BKYH 4JFZH 1A1NB 3BQUC 2X10A 2BMKB 4YXKL 5LXGL 4L4VB 2FCBA 1CL7I 3ZTJH 5ANMA 4KKNA 1A7QH 5GJTL 1Q0YH 5EU6D 5IFHH 2HVKA 3MLVL 1UYWH 2NR6C 2XOTA 5IFAL 1MQKH 4G8GB 2IPKB 3KPSE 4PR5B 4RFOL 1CFSA 4PGCB 1K8IA 1EEQA 4QF1A 3K46A 2UY7A 3UBXI 4XVSL 1FIGL 4DUXA 2J4WH 4EI6B 1NCDL 4WTXA 2P5WE 1OSZA 4Y8DC 4JFPB 1LEKB 3ALWA 5FGCB 3CFDA 5F7FA 3ULVE 1I8MA 1T2QL 3NIGF 1FRGL 1GH7A 4FQJH 4XWOC 4Y16A 4KDVA 3OKYA 4YE4L 2VQUA 1NPUA 3VJ6A 4UDUB 3HI6H 4G6KH 4RFEA 4XPFL 4LL9A 3Q6FA 3KPLA 5CSBA 4NC1C 2WZPD 4J4PC 1NC2A 5HGDB 1QFUL 5FYJE 1KIRB 2ZNXA 1BJ1J 4YHKH 5HDBF 3UJJH 3PWJB 4I0CC 1T2JA 2J88L 4U2ZA 3MLWL 4G7VL 3VWKB 4ELMB 2IFFH 2A6KA 2O5ZL 3GSNL 3MRJB 5ALCL 3K1KC 1ONQB 3KXFB 2HWZH 4DQOH 4YXHH 3MTRA 1HZHH 2I9TB 2O93L 3EKCA 1MHEB 3G6DH 3LN5B 3QIBA 4O2EA 4OZIE 1XF4B 3QP3A 1NL0H 3O6MH 4KK9C 1I8KA 2Q76A 5IBUG 2GTZB 3QG6A 5JNYA 3QQ9C 4H25A 1S3KH 2OXHA 4JDZB 1HYRC 5EWIH 4L8DB 5F21B 3VD7A 1NAKL 3BZFA 4PJ5D 1R24A 4QRSA 4HUVA 3O81A 4WI9A 2WUBL 3MBEB 2AP2A 1YN7B 4KKBC 5F9JB 1F58H 4IDLA 5CIPA 5GS0D 4K3EL 4NN5C 1G7HB 1EO8L 5D7JD 2AJZA 3F6IA 1CE6A 2X4TA 3ZTNH 1NCAL 4HXAL 3RUGE 1CDGA 2HH0L 1DEDA 4K9EL 2VN7A 3MV9A 4G42A 3DROB 3IXTA 2ARJQ 4X0KA 5FO8A 4UTBH 1BF8A 2HTKC 4NNXB 3MRPA 3T4AA 1XIWD 5CP7B 1V05A 3BAEL 4EUPH 1T1XA 4RGNE 3WN5A 1IAMA 1U58B 5CHNB 2D03H 2DIAA 1GHFL 1UWEH 1ES0B 4HV8A 1TCMA 4XZUA 2R8SH 1KOAA 4YIQA 4QXTA 3FO2B 1SYSB 2GHWB 2R1YA 2YA1A 4HKBB 2XWTA 1FLTX 4M7LT 3CCHB 5E24E 4QRPB 5HHQB 3ZYZA 3RA7H 1R3JA 5IQ7L 2HKFH 1KB5A 1QLRA 1ZS8B 4MA3A 4Z7UA 2X09A 4EI5A 4IIQA 1RUKL 1DN0B 2J2ZA 3RAJL 1H15A 5DK0A 1UXSA 3IRPX 1KYOJ 3PP4H 4FQLH 1A1NA 1RD6A 2J7LA 3I6KB 4GRWH 1TQCC 3GRWA 2C3WA 4JRYE 4QOKB 4KKCD 4UILH 4POZD 4I5BB 2FB4L 5EZOL 4WTZA 3PL6B 5JW3H 5FOBA 5E9DA 5JXED 4OLYL 1AGDA 1YEHL 3FO1B 3SGJC 1B0RA 1I1AB 4HBCL 3QEUB 2WIIB 4M8QA 1FV1A 5IROA 5TE7H 4RAUB 4PGCA 4Z7VB 4Z8FL 2P1YA 1UB6A 1CXKA 5HYSG 5C0AE 1B6UA 2IBBA 5DMGD 5KVMC 3L3KA 1MFBL 2P42B 2XN9E 5DQJA 3GMMB 4H20H 1P4LA 2PTVA 3T09A 4YAQB 4HJJL 3KNBB 5FGBC 1LEKA 1BJMA 2P43B 3VE0B 3QCTH 3GSVB 1VFUA 5TF0A 3ZDYE 5KW9H 4CVZB 5GGSY 1AGFB 4IJ3B 3U9PH 1EEZB 4NQVB 2YD7A 4UDUA 1BBDL 3C08H 3VG9B 2NW3B 3IFLL 4IRSC 3SCMD 2PO6B 4UAOB 1G0XA 2C4FU 3VFRA 2B1HL 1K4CB 3CLEL 1KIRA 2WUCL 4LVHC 4X7DC 4MD0A 3PWJA 4JO1L 3T0XA 4PJHF 4QRTA 3EYQC 1CGVA 3VWKA 1XF5B 4UQ2A 4POUB 5H37H 1DQDL 4R9HA 4JPVH 4J8RB 4R3SB 3T2NL 2BSED 3ZT5A 3MRJA 2EYRB 1JWSA 3OAUL 5KJRH 2BNQD 1MHEA 4WWKC 1XF4A 5IGXH 3NGBC 1SBBA 3M07A 2XZCL 2APFA 3GJFB 2H41A 2GTZA 2EYTA 2UVFA 3D85D 5IMOA 5B8CB 5L7XL 1RZ7H 3FFDB 3L3DA 4P3CL 4NJAH 4JDZA 2P8LB 5F7NC 1VKXB 1OTTD 1QR1B 1A9EB 3MBEA 5EU6A 1YN7A 1S9YB 4PJIB 2WK2A 4NN6C 4YHPB 5DRZB 1WICA 2X9YA 3KJ6H 5CBAB 4P2QE 1G7HA 2JJWA 3GMQB 3TBYB 1DVFB 4OM1H 2BC4B 2QEJA 3FCTB 4HGKC 5FM4A 3BKMH 4MAYD 4PJXB 5D6DA 3KS0H 1ETZA 2DM7A 2R23B 4E9LA 1LP9F 4FQCL 4NNXA 3WUWG 2C3GA 3RU8L 3CVHH 4NO5A 3WDIA 5DDHA 3ZL4L 4JFED 2P24B 5EOCH 1DL7H 1IRAY 5KSUB 5BVJB 3TZVB 1NGYB 3FO2A 3DUSB 1DQTA 3RWCB 4D9RE 3MJ9H 1U8NB 3QNZB 3MRFA 2J8HA 2IAND 1VPOH 4KK5D 3OXRA 4QRPA 5FO9A 1JPSH 2DQFB 3CLFH 5IMLB 3BDYH 3MACH 1ZS8A 3S8WA 1BD2D 4JQXC 1WBZB 3OB0K 3CH1B 4NP4L 2CR3A 3PABB 4P99A 1Y6KR 2BX5A 4KY1L 4LIQH 4S1SH 1RZ8A 2AV7B 5TDNA 4Q9RH 3RNKA 3I6KA 4M5ZL 3VFMA 1A7RL 1ULVA 3DURA 1WITA 1A2YB 2VZOA 4I5BA 4F3FB 2HT2C 3PL6A 4RDQF 2F8VA 4OZ4B 2VZ1A 2NY0D 2I27N 3BT2L 1BAFH 3ECBA 1I4FB 4PJ5A 3HZMB 4F33B 1I1AA 4RAVB 3QEUA 1MCQA 2WIIA 4M8VA 1DDHB 3JWOC 4RAUA 5I1JL 2PUQT 5ISZD 4Z7VA 4Y19D 1QBBA 5CGTA 5C0JB 5K9JL 5L0QB 1MCOL 1SJHB 2A77H 3B5TA 3QI9C 3UXFA 3SDYH 5KS9B 2OTPA 5L8JB 5E8NB 4YHYC 3O2VH 2IGFH 4ODHH 1YECH 1T4KB 1WUNT 4LOUC 43CAA 5DSCB 1LK3L 1UKSA 3ULSB 3JWDH 5FYKD 1MF2L 4G3YL 2VDNL 5IP4A 3ZMRA 5IVNA 5IEHB 2NW3A 2PO6A 2EE2A 1CLOH 2KBGA 4FQ1L 1RURH 2CSPA 2DLHA 4JAMA 5SV3A 1WWBX 4JVUA 4BZ1L 1KENH 3O2DH 5BZWB 4XXCC 5LXGH 1RUAL 5I1GL 3IVKA 3LQAL 5LGHL 4PJFB 4M1DL 5HYEA 3V79C 5MENE 5GSVB 3MLVH 2SEBB 1UM6L 3ARRA 5DVMA 4N1HB 2A2QT 1PW3A 5HHVH 4GLRI 3QHTC 5CGYD 4NO0D 2P8LA 4P9HL 5IBTL 2MFNA 4XVSH 1FIGH 4P4KB 1FGNL 3P9MA 3VXOB 4XPGL 3BD5A 3PQYE 5JXEA 4OFYD 2NY0B 5DRZA 5JXAL 1HHKB 3A6CH 4YBQC 2Q7YA 5I75B 3FRUB 5MP6L 4NQTA 2BNRE 1G7MB 2DQTH 1DVFA 3GMQA 3OXSB 2BC4A 4U3HA 4YHMH 3TBYA 3BPCA 3FCTA 1RJZA 2R56H 2ZCHH 4Y89A 2CMRL 4PJXA 1IGTA 2PXYD 1BQSA 3OKEA 3RY5A 1INEH 4NQCB 3MLUL 5BV7L 4ONHA 3TH4T 3CIQA 2CIIB 2IMNA 5AZ2H 1FL6B 2R23A 4JPIB 2JCCF 4JM2C 2J5LB 3V4PH 1XGTB 2A9MH 2XIDA 3IS0X 4IOFD 4Y2DC 2HA1A 4HULB 4PJDF 3B8YA 1HDMB 3CSBA 4PJ7B 2M2DA 4PRPD 5L8KB 5E70A 4H8WL 4HJGB 1L9NA 5DK3A 2AI0H 4HWNA 4G7VH 2EXWC 3TZVA 2Y9RT 4MMZC 3D1MC 4R8WH 3VGDA 3QNZA 2DDQL 3SGKA 4CGTA 5ALCH 1X4YA 5J1AA 5MEOB 1RIVL 4ESKA 1BQUA 5E4EB 4DGVL 1PKQE 2DQFA 1RULH 1HXYB 2VLJD 1KN2L 4OLWL 3SPVB 4N8VA 3WFEL 1KJVA 1RK0A 2ZP0T 5CD3A 3MRDA 4GRLB 3CH1A 2ADJA 5DJ0B 1FVDB 4HUXB 5D7KD 5DHVB 4YHLL 5FHBL 5JOEA 5HD8C 3B3IA 5F7WC 4UNTA 1JNHB 2HJLB 3ULUC 4PRBB 3ZHKA 4K3EH 4LCWB 1KFAL 4LLQA 2EDKA 1HQ4A 1FNAA 3D3VD 2ZUXA 3V6ZB 3U0WL 2N56A 3D85A 3IDYB 4ZO7A 3EOYG 5GRXG 3TPUA 4NO0B 4AMKL 3WFCL 4UOW0 1OSPH 2BVQB 5EUOE 4K9EH 4PYGA 4L9LB 4XTRC 4FQPA 1YUHA 4YGVB 4DOHB 4QGYA 5DWUL 4G80A 2FDBP 1U8JB 3C5ZD 3LQZB 3LSOB 4U1MB 4D2NA 4CBPA 3T4YB 3BAEH 1P7QB 2ESVD 2JIXB 5D96C 4NIKB 3SDAD 4FFYH 1U8IB 3O8XC 3LEXB 4M9OA 3BYTA 4MAYA 5E8NA 3TYGL 3D48R 1T4KA 5IB4B 4PJHB 5DSCA 5FF6B 4M7JL 4XP4H 2NX5E 5HGAA 3ULSA 3F7VB 2A1WL 1D6EA 3SDCB 4X7TB 3P11H 2WWKO 5DMIH 3T04D 5CCKH 2JF1A 1KTRL 2Z8SA 3KS0J 5HY9B 1LILA 4LNVA 5IQ7H 5IEHA 2MQCA 4JFEA 3LB6C 2CGRL 4CNIB 2MTPA 3V6FA 1EMTL 3B43A 4J1UB 4PG9A 4JKMA 3QUYB 3BHBB 5BQ7B 3TESA 1RUKH 3IAGC 3RAJH 3FZUD 4EDXA 1B6DA 3C2SA 1NAML 5BZWA 2IANA 5DJZB 4AQOA 2IPUG 4MJ2A 4D3CH 3GIZL 4MCZB 4CU7A 3DVFA 2NY3C 5CUSL 1J8KA 2O61A 3BO8B 2PCPB 2LVEA 5D5MF 4DN3L 3SDXE 1BD2A 4MZ3A 1JZ4A 5GSVA 1YEHH 1A4JB 2F8OA 2HT3C 4W4OA 4P5TD 5CJ5A 4HBCH 4N68A 4OCNC 4GRMB 4NO2B 3EO9L 4FHBD 4HMDA 3VGEA 1ZT4B 4K07A 2FZ3B 1UH4A 1LP9B 3VXOA 2BSTB 4W6YB 4PLKC 3DHJA 2VISB 1MFBH 3GO1H 4HAGA 1YYML 1UC6A 1JI1A 3U6RB 5EFIB 5C0GB 1EVUA 4LPUA 3OXSA 3V5HA 2DKMA 2ED9A 4F7MB 2Z91B 3VDCA 4MNHB 3N1GC 4Y19A 2EDJA 4LARH 3T65A 1PDKA 3HCVB 4PJBB 1BBDH 5TE6H 3IFLH 4HIHB 3OR7A 4FRWA 5KTEL 4POYA 4PP2B 4JPIA 4WEBL 3FL7A 4GS7C 1XGTA 5TE4L 3EUUA 1NDMB 3W11D 3CLEH 5L88L 5HHOE 1KJ2A 4PY7A 4JANB 1HDMA 4YR6B 2ICEA 2A73A 4HJGA 2RHEA 3QEQD 4Y4HB 1M1SA 2H2SD 3FFCD 1UKQA 2PYED 2OZ4A 3T2NH 5FV1L 3RIFK 3ARYA 3VFVB 5KSBE 4HC1H 1RMFH 3KAAA 3MLRH 3T0EB 1HXYA 3SPVA 4N90D 5DMKB 4BQCA 1UJ3C 4P3CH 4NN7B 1SVCP 2Y07H 5KVFL 5DJYB 4HEME 3DYPA 5DJ0A 1FVDA 4HUXA 4PFEA 5HYJB 2AK4D 4L8SB 3WD5H 5IK3A 3BQUD 2R0ZL 4LLDA 5ACZB 3WUWA 2BJML 4KTDH 1JUFB 1JNHA 4NC2B 4U7MA 4R90H 4GKNB 5TQ0L 3U9UB 2C3VB 3CDCA 3V6ZA 2I25N 2NNAB 1JV5B 1I9EA 4ENED 1YC8A 2NR6D 3IXAB 5K9KB 3WHE1 3MROA 3M45A 4NO0A 4U6YA 2BVQA 3BMVA 3UAJC 1P6FA 4C58B 1SYVA 3TM6A 2MKLC 4L9LA 2W65A 3ALPA 1U8JA 3LSOA 4FQCH 4S11A 1MI5E 4U1MA 3RU8H 4F7EB 3T4YA 1T03L 3A6BH 3U7WL 3T0AA 3ARDB 3ZL4H 3A6OA 1NDGA 2VDOL 2C3HA 3F12B 2PXYA 3EDJA 2H9GA 5D93B 4XWOD 3ARFC 4K8RL 4PJHA 3O3EB 2OX5A 3EHBC 1KEGH 3QJFA 4WI6A 3REWB 4JRXD 3SDCA 4X7TA 3S98A 4PV9A 3DIFB 2LU7A 1L7IL 3R0NA 5F7DB 3VXTB 2X1XR 3K4AA 3H8NA 1QTYT 4CNIA 3FQXB 4OCLC 1NCWH 4J1UA 5HXMA 1YNKL 3CFJB 3HMXL 5BQ7A 2XRAL 2R69L 1HHJA 4KY1H 1I8IB 1NQBA 1AQDA 1JZ7A 5EDXA 3AREB 4PJIE 4MD5B 2DBJA 1FZKA 4AG4L 3NH7L 1A7RH 4MCZA 3RZCC 3STZB 1YEKL 5D1ZC 1EV2E 5JIPA 1CICB 3LQMA 4ZYKA 2CIKB 3BT2H 1KCRH 3D2UD 1TJIL 4M1GH 4N5UA 4GRMA 4NO2A 1Z9OA 3NVQA 2VZVA 5I1JH 3RWJB 5IESL 5J3HC 2FZ3A 4KZEH 1YEDB 3D3VA 4Q2ZB 3WO4B 2HG5B 1LP9A 1MCOH 2JCCB 4KKBD 1L0YA 1H5BB 3B9DA 4D0BB 4P3DB 4Q97A 4PJDB 3H3PH 5GRUL 5D70L 5C0GA 1QLEL 3BGFB 4YFLF 2Z92B 1YQ2A 2XV6B 4F7MA 4ZUTB 3QULB 1R5VA 2Z91A 1MCDA 4ZODA 4KK8D 4M7KH 4QY8B 3HCVA 1G9NH 3IFOB 5IUSA 1J1PL 1WFTA 2OJEB 2QKIB 4KAQH 1FGVL 1TTUA 2MKWA 3U4BL 1RIUH 4XP6L 4PJ9D 4PP2A 4I13B 2OL3B 1Z0MA 4HIXL 4LHJB 1FNEB 3VXQA 4MAUL 5E1AB 5L2JB 4JANA 1YJDH 4U31A 3FAWA 4Y4HA 1JZ3A 1MH5B 2ZPKL 4BZYA 1RUAH 5I1GH 1CCZA 4I2XA 3IJYA 3LQAH 2V2XB 2CDEA 3FMGL 2WNGA 4H5SB 3VFVA 1GZPB 4OUOA 3FQNB 1A7OL 4TSCL 1BPVA 1FVCB 2G60L 1IZJA 2CK2A 1XF1A 5FA3B 3F8UB 1V3LA 2Y7QB 1JWUB 2ATPB 3PV7A 4MYWB 4AEEA 2ED7A 5HYJA 4MS8C 3E1F1 3F6LA 3HZYA 5C09D 1P5UA 3JTTA 4TQEL 3IU4L 3WNPA 1UACL 3KLSA 5EU5B 5F7MC 1RZFL 1JFQH 5E5UB 3O3UN 1MCKA 1B4JL 1KJMA 2W91A 3TH2T 2EKSB 3LMJL 1JPFA 3K7UA 1UENA 5BVPH 3BPOB 3BD3A 1DBMH 4NQSA 3QCVL 2WBKA 4PJAA 5C6TH 1JGUH 4XBGB 5CEXA 2AKRB 3ILQC 1EBPA 1X9QA 1PAMA 1ZHBA 3HNVH 3QJHB 3O3EA 4R0LC 3V0WL 1I1CA 4PJFE 4JFHD 3REWA 3P0VL 3I02B 1FO0B 5D5MB 5D7LE 4OGAC 3DIFA 3QEHA 4IRSD 3LHPH 2VO5A 4WWID 3WE6B 4MNGB 4OLWH 2YD4A 3OWEA 2R0LL 1A1OA 1T83A 1CE1L 3IDNB 3FFCA 1RZGB 5E08L 1ORQA 2PYEA 2UYLB 5GGTA 3GBNL 3AY4C 3MRKA 5FHBH 5I76A 4FQHB 2D9QB 3AREA 3ZO0A 3O4LB 1XR9B 3Q1SH 4GG6A 2YUZA 4MD5A 1CFNA 2F54B 1KFAH 1FZOB 2EE9A 3STZA 1FN4B 1T66C 4KVCL 1BEYL 2QHLA 1FFPB 2CIKA 4YJZL 5IR1A 2BSSB 3BQUA 1VGEH 4XNXH 2NZ9D 3VFSB 5FCUL 4OD2A 4KWUA 2W60B 4JE4B 4DK6A 1YEDA 5DFVC 4RMTA 5EU4B 2XZAL 1KLUB 1TZHB 5KSAC 4P3DA 5LGJB 2KH2B 4PJDA 1NMCC 3CDYA 2GYSA 1N59A 4ZUSA 3GMLB 2BSRB 3QQNA 4LP5A 2NPLX 5ICXB 3LEVL 2Z92A 43C9B 2VJXA 4ZUTA 2A1WH 3QULA 4JPKH 4HS6B 2F53E 4MA8H 5C08B 4P59L 4QY8A 5D2NE 1T1WB 4FQXC 4XBPB 4XNYH 3VDBA 1T7ZA 6CGTA 2OL3A 2ORBH 3PDOB 3ZSTA 5DGRA 2VDML 3GZKA 2ADFH 1P7HL 3OKLB 4S1RH 5L2JA 5F3BA 4JRXA 1Q72H 4RGOL 1WAAF 1JVKA 1QPXA 5C0RL 5ESVA 4JHZA 2RAMA 5CUSH 1AXTH 1M6OB 1CK0H 4IOIB 1CD1B 1FYTD 1P84J 3IRZA 5EUKA 4JDTL 4D9QD 1GZPA 3B83A 4OF5A 3W9EB 4DOHE 4XC3H 1J12A 1YPZE 3SGDH 1I3GH 3JWNC 5FA3A 4U1IB 1P4IL 1EAJA 3RHWK 5D7SH 4HFUL 5JHDB 1WCBB 1JWUA 2ATPA 3JVGA 4I3GA 4P9HC 3QUZB 1BIHA 2HYMA 5TF1L 1S7TA 5DVNA 5ETUB 4WUUD 1MHCB 3KJ4C 3P3YA 2HT2D 3D2UA 5EU7C 3OTTA 3P4OB 2ZNWA 3HNTH 5EU5A 1YYLL 3ZE0F 3HLAA 4M9PA 3NZ8B 3DECA 3HUJF 4YK4B 2V6HA 1EHLH 3OB0H 2EKSA 4ZSOA 2QSCH 3AMLA 4WEBH 5TE4H 4XHJD 3BN3B 4NM8H 2DJUA 3RDTB 5ADPH 3TLRA 5HBBA 3OBAA 2BFVH 2AKRA 4H8WC 1MWAH 2YD6A 4F57L 2AABL 3MO1B 3L3JB 4JKPL 4HK3J 3QPXH 4RGMC 4PJ9A 2V5RA 4EUPB 1FO0A 5D5MA 2QQNL 1HEZA 5DYOB 2E7CA 2X4RA 3HPJB 3QCUL 4WW1B 5J1TC 4JY5H 4HJ0C 3PDGA 2VIRB 4MCYB 1XGUA 4KMLB 1CVRA 1EFXD 3IDNA 5KVFH 2IADA 1SJXA 5DGQA 1TPXC 2BJMH 4U49A 1ZTXL 3VFWB 1XR9A 4E42B 2CLZB 4X4ZA 3O9WB 4I0PC 3N85L 1G7LB 1NFDE 5TQ0H 5CD5C 2OTWA 1MJ8L 3UDWC 1FZOA 1EJOL 2AXGB 2FX8L 2GCYB 3NCYP 1FN4A 2ERJC 1FHGA 3QQ3A 4LQFH 4Y5VC 4DTGH 5EIIB 1JHTB 4M4PA 3QIWC 3X13B 2G75A 2R0WL 4WI2A 4CVWA 3IF1B 4GRWB 1BFOB 2O26U 5C09A 3SO3B 2YRPA 1J9CT 4HUKB 3OKKB 3ROOB 3UO1L 5EU4A 2F19L 2GTWB 3CH8A 4P23C 3SKJL 2WMPA 4Y5XB 4YBQD 2VDOH 4PLNC 1U8MA 5LGJA 1DUYB 3EDFA 5JQ6L 3QFDB 4ELKB 4LDLB 3KYOA 3RWDB 5B38G 2PTUA 3HA0A 2VITA 4R96B 4XHQA 1ZT7B 4HS6A 1BZ7A 1B2WH 1FFQA 3C8HA 4N5EC 4O9HH 1L7IH 1VGKA 3Q48A 5EC2A 4FNLL 1FYHB 3QIUC 3N1FC 1T1WA 5AZEH 3DBXB 3G6AB 4JM2D 5DR5H 3I50L 1K5NB 5FGBA 1R5IB 2AGJL 4Y2DD 1QSED 2EH7L 4KFZC 4CN6A 3FB8B 2FJHA 4N8CL 1YNKH 3TC9A 4XMKH 2O5YL 1WWAX 2DLEA 5FUZL 3OKLA 4QHNB 3AS1A 2EXWD 1Z5LB 4AG4H 1CVSC 4IRSA 3HAEG 4IMLB 4P2RB 1JZ5A 4IOIA 1ZVHA 1FH5L 1IKFL 4MZ2A 1OAQL 5CLWA 1TJIH 2NXYC 3UTTB 4FQ2L 1F4YL 3SE4A 4J23A 4U1IA 5AD0A 4L29B 1WCBA 4HPYL 4IMKA 4KMTL 4HWBH 1J10A 2X7LB 2YUWA 2D7OA 5HD8D 3ULUD 4JKLA 5FAAA 1MHCA 1K9TA 5F72S 5I0DA 2V9RA 5D70H 4TPRL 3WS6C 4Y1AE 5TDPB 1Q8MA 3P4OA 5EZJA 1HH9B 5FUOL 4TVPL 3C5SB 5GRVK 1I3UA 4XTRD 4WVRA 4HIJB 4WV1C 1YC7A 1J1PH 4YDKL 4JO3L 4J3XA 5TPWH 1AJ7L 5SWZD 2Z4QA 1LNUB 3UROR 2MJWA 3LEYH 4XP6H 3EDEA 2LU3A 1KCUL 5L2KE 1UVQA 4YHNA 4CMHC 3O8XD 1MOEA 1LE5B 3KLAB 3ULVH 3RDTA 2C3XA 4OLZL 3DV6B 1J0HA 2APVA 3MNVB 3T1FB 4NZRL 3CMOH 2ZPKH 2DYPD 3EOAB 3L3JA 4LLUB 1IL1A 4OZGA 4TUOB 4OT1H 1P2CB 4XMLL 3FMGH 5FA4B 3SBWA 3CVHB 1S7WB 4PP1C 4EUPA 5DYOA 4BELD 3GSWB 5C0BD 1QLFB 4KQ3L 4G8FB 1FJ1B 1Q9OB 5FYJH 2VIRA 4MCYA 4QRRB 3NCEB 3RWFB 1J87A 1YN6B 1DFBH 2VXSL 2GSIA 4F2MA 5MI0B 2JE8A 1PLGL 2BVPA 1L0QA 1NLDL 4MGXA 4XAKE 3OF6A 3JXAA 1AIFB 4JQIH 3W82A 3O9WA 4ZUVB 4BA8A 5HI5C 5I16A 4LSRL 3HE6D 2YA0A 1U9KA 2GCYA 4MDJA 4JQXA 5IB1B 1BQLL 2HT3D 3W2DL 5J11C 5JA9A 3VFOA 1RZFH 2AJSL 4IRZH 2EZ0C 3U46B 4O4YL 4HG4J 1P4BL 1JHTA 5TQ2H 1U8HB 3LMJH 4WUUA 2HFEB 2A38A 1BFOA 1JHKL 3EW3B 4I8DA 3ROOA 5CEZL 2DQJL 1KCSL 4EJ1C 5HI4C 1DUYA 5AEAA 1XH3A 5KSVB 2OR8A 3QFDA 1W72L 5C70A 1U3HB 3WIIL 2DKUA 5J8OA 1ZT7A 4H26B 5T1DH 3UTQA 2EEBA 4C83B 3F7RA 1NEZG 2YPLD 2DD8L 5AWNL 3L6FA 3DX8A 4UINL 5HDOA 2KZWA 1HIML 1R5IA 1S7RB 3QEGH 4JO4L 4AIXA 3OB8A 1CE1H 1IGML 4OGYL 1JNNH 1U8KB 3K2UH 5GGRB 3QISA 5E08H 1SJEB 1T20A 3GBNH 4EQ2A 1CDUA 5DD5L 1XF2B 3T0DA 3L3GA 1Z5LA 2Z93A 3UZVB 2C1PA 5DJ8B 5A16B 4GBXD 3VMPA 4GSDH 1KLGB 2BRQA 1IGFL 3INUH 1QOKA 3LKQB 4P2RA 3V8OA 3X12A 5BO1L 4G5ZH 4KVCH 1EFXA 1G7IB 3JV6A 3CPLA 1JN6B 5D8JL 3UTTA 5FCUH 4B5EA 5GZNC 4NCC1 5DD0H 1DP0A 1A6ZB 4CVXA 1F3DH 1K2DB 2JJSA 2X7LA 3H9SD 1B9ZA 3RWGB 1J8HD 3S96B 5SX4I 2R9HC 1I3RA 2OR9H 5F1IB 5DZNA 1F3JA 4UDTB 3O6KL 3O6FD 1C5DB 4YXLH 1ZV5A 3G5ZB 4NUGL 1CLZH 4LAQL 3MJ8A 1HH9A 5IB3A 4HIIB 3IJHA 2WBJC 5E7BA 3C5SA 3L1OL 3UAJD 2B0SL 5M7QA 4EN3C 1N7MH 3I6LD 4HIJA 4OUUA 4W68A 4U0RC 3TA3B 3OJ2C 1X5HA 1TTGA 2DJSA 3NZHL 5DLMH 4NBXB 2MOVA 1GGIH 3GHEH 2EH8L 3FN0L 3K80A 1N0LA 3GMNB 2VDMH 4MD4B 2C5DC 3SKMB 1K6QL 1LE5A 3KLAA 4JREB 3MNVA 2Q87A 1JNLL 1F6AA 4GMSL 5C0RH 3EHBD 1V8HA 2EDQA 3JV5A 4PTTA 5JPNA 1G6VK 4TUOA 4Y2DA 1QSEA 2GY7B 5FA4A 3MV11 5FKPB 4K23L 4L8CA 5I6XB 3GSWA 1S5IL 2FGWL 3FT4A 5J6HA 4G8FA 1WZ1L 3I3DA 3D39E 4OF3A 4PD4J 4JN1H 3BOVA 4L4TD 3BWUC 1CLYL 2VWEC 4QRRA 3RWFA 1YN6A 3ZKXC 4IDJL 1X5GA 4GBXB 1BZQK 1EFQA 4LVOC 2NYYC 2G5BA 5A2LH 3MJ9A 4JKWA 1VHPA 4MDIB 3QXDA 1AIFA 2NY1B 3RZCD 4LSTL 5LQBH 1KXTB 3T3MF 4X4XA 1I1RA 1Z9MA 5T3XE 1PY4A 5B39A 3IDGB 1KG0B 5IB1A 1BWWA 4YC2C 5HVHB 3CX5J 1BZ9B 1QNZL 3RWIB 3U46A 4FFZL 4H0GA 3GUTA 1A14L 3X14A 3MV9E 5I15H 4Y4FC 4B53A 1G7JB 5J3HD 4MNQD 1U8HA 3SKUD 3UYOD 4X98A 4HUNB 1KELH 3EO1B 4JB9L 1QR4A 1ZVSA 4Z7QE 1I85A 1IAIL 5JMRA 2UWEE 1SY6H 5KSVA 5EULV 4FZ8L 5SWQA 5F3HA 4WTWA 4F57H 3RVWD 3U1SH 5BCAA 1WAAA 4FFVD 3VXMD 2N1KA 3AXLB 2IC2A 5BS0E 4HCRH 1J1XL 4HXBH 4WFHD 3DMMB 4GW4A 4F7TA 2AV1B 4ZPVB 5T1LB 2VLKB 3QCUH 4LSUL 1UFUA 5FYLD 4R4BA 1SMAA 2ZCKH 1RJCA 4KQ4L 3HNSL 2DYPA 1U8KA 3TFKC 3U0PB 4YHZL 2H6PA 1SJEA 2AJVL 3C09C 2Q3ZA 1ZTXH 1FDLH 3VI4F 3N85H 4NWTL 1EDQA 4QRUB 1MJ8H 2E7HA 5EZLB 5C0BA 1WT5C 5C0FB 4MXWL 1KLGA 1CN4A 1EJOH 2FX8H 4WO4D 4CN4A 3LKQA 4PREA 5BRZE 5E9DE 5F44A 3HTLX 1QQDB 2X70A 3BVNB 3F62A 1P9MC 3O2DA 3PNWA 4HUWB 4IHOA 1JN6A 3UBXG 4M43L 4PPTA 2MNUA 3HUJA 2VR4A 3LVEA 1A6ZA 3G9VA 1FL3B 1MJ7H 3LOWA 3PJSA 3HE6A 3RWGA 4W81A 1OPGL 4OCXH 3WJLC 4LLMB 4MA1C 1WWWX 5F70A 1GC1L 4UDTA 2Z0BA 1L7TH 4F7PB 1BM3H 5C2UB 1C5DA 5EZIL 5IVXF 3RI5K 3G5ZA 5I30H 1PSKH 1TVBA 3RY4A 4OSUL 1PEZA 2BVYA 2CRIA 3L5XL 5DRNB 4XWGL 2I9LB 4BH7B 4D0DA 2GT9A 4XB7A 2W92A 3TA3A 5J57B 5DUPH 5J12C 5LWYL 2AGJH 2PTTB 2G2RB 3HG1E 4P57B 2QQQA 2O5YH 4MD4A 4NKDB 4OCYH 1T21B 1AC0A 4J3OC 4OFKA 5FUZH 4ZFGH 3T8XB 3ILQD 3SDDB 4RCAA 2YPLA 4UT9L 4H1LG 5D1XB 2AEQL 4OGAD 1GPOH 4I3RL 5GS1B 4PJ8C 1ERNA 1IKFH 1FH5H 1N4XL 1RFDH 3ETBF 1OARL 4PB9H 1EVTC 1U36A 2PYFA 4N0UB 5CS7A 5H35B 4QNPE 1D6VH 1F4YH 4Z78B 4UQ3A 2ITCA 4UIKH 4AEFA 8FABB 4GBXA 4HPYH 1IM9B 1U95B 3CX2A 3GSNA 4CU6A 1WEJL 4JY6B 4X6BB 1E4WL 4TUJB 4FTVB 4UB0H 1N5AB 2K9UA 5AYUL 2I26N 4G9DB 3VXPA 2NY4D 4UMGA 3BN9C 5HYIA 1T66D 2XZQL 3BH8B 1IAOB 2BOBA 1CXLA 3IDGA 5DJ2A 1KG0A 3QHZL 4ZS7H 4X4YB 1OQOA 4I77H 4MLIA 3QH3B 1TIUA 3RTQB 3SKNB 3BGAA 1BZ9A 4KRPB 1FP5A 1T6VN 1OGAB 4OIAA 3TO4C 2O5XL 5JZ7C 1IC7L 4GT7A 4F58H 3BP4B 4Z7OF 4WGVB 5DFVD 3O6FA 1N5YL 5IM7B 3V0VA 1EGJH 3EO1A 4K55A 5DFWH 1R5WB 2VYRE 3S6CA 4AH2B 1KIPB 3VGGA 1OCWL 3V7AE 2VRAA 3IETB 5DQ9A 4NZRH 3MRNB 5IJKC 3AB0C 3V4VH 3QDMB 1KPUB 3HFMH 1YQVL 3DO7B 2HJKB 1UG9A 5IWLA 1AD9A 3TN0C 3DMMA 2F74B 2ICCA 4ODXA 5C07D 2AXFB 5JOFB 1ACYL 1DSFL 1M7DB 4LASL 1NUGA 1QD0A 1KXVC 3MFGB 2LVCA 3QDAA 4PRAB 4RRPA 5D72L 1PLGH 5ID1B 5TDOB 1WIUA 3KYMB 1QSZA 5F89B 5I19H 4JDVA 3UTSD 4OLXH 1HHHA 4KKLD 4QRUA 5EZLA 4LSRH 3WLBB 5C0FA 3L3HB 5GJSL 4FXKB 3RKDC 4L4TA 1BQLH 3OKDB 3RZWA 5I8KH 1U8OB 1FIEA 4Z5RA 5C7XH 3BP6A 1C1EL 3C8KA 3PHSA 3B9KD 3MYZA 1P4BH 4JJ5A 1BOGB 1WTLA 1FL5A 4FFWC 3WDJA 4U3XA 4OLYH 2ZZUT 3RZCA 1NEZA 4ISVB 3K4DA 1FL3A 4UU9B 4LLMA 1KCSH 3DX9A 5FV2A 4U2YA 4FG6C 4FP8L 4F7PA 1E6JH 5D71L 3MOBH 1W72H 5F9OH 1PQZB 3KPQA 4DEPB 5HTSA 4Y16C 4XGZA 4MNQA 2YPVL 3WIIH 3PWVA 4Z7NE 3CDGB 2CPCA 4BH7A 4NQDB 4CU8A 2DD8H 5AWNH 5JDSA 5D9SB 4QT5A 4UINH 1UB5B 2IWGA 2PTTA 1HHIB 2G2RA 4KUZL 2A6IA 4X6CF 3VH8G 2ZCLL 3VRJB 4OGYH 4P0DA 1OAZL 1BFVH 4S2SA 3VXMA 3IGAB 1ZSDB 1GOHA 3EFDH 2W1NA 4XNZB 4ODSH 4AT6A 2FEEI 5A40E 2DB8A 2KUTA 3QIBC 5A3IC 5BO1H 5GS1A 5JIHA 1SEQH 3LKSB 1AQKL 4HJ0D 4RX4A