4HQQL

Crystal structure of rv144-elicited antibody ch58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL01
4EIZC 3OX8A 1LQSR 3FQUB 5L88H 1IVLA 1VGEH 2DL9A 4N0RA 5CAYB 4ZOBA 5IGXH 4KKAD 4O5LH 5DJAA 1I3GL 1BF8A 1W0VB 2RR3A 4ZFFA 3KPNB 4H20L 1ZVSA 3W5MA 1KOAA 1F4WL 3AXLA 2V7NB 2GAZA 2VQ1B 1G7LA 4C4KO 5EZJA 4Y4KC 1IGCL 1KPRA 3U0TA 4GKZB 4YXHH 1M7IB 5B3JE 4YHML 1YYML 2V17L 5K9JH 2IH3A 4K94H 4AZ8A 4NGHH 5C08D 3QUKA 3MV11 1K5NB 2X9XA 1NUDA 4CVZB 3B2UD 3SY0B 4OQTL 3AREA 3D3VD 3O3DA 1ZHNA 3JZ7A 3G5VA 4DVBB 3UROR 4Z76A 3GJFH 4S11A 5IB5B 2LU7A 3IT8D 43CAA 4CDHA 1D5XA 4MNGB 4U6YB 4BFEA 1KCVL 3DVGB 1S5HB 3U2SA 4OKDA 4ENED 1Q9OA 3ULVF 4P5MA 2WZPD 2O5ZH 1CFVH 1EVTC 1BBDL 3IAQA 1HWGB 1L6XA 3BRGC 1NGWB 4K71B 1R3HA 5IMMA 1MWAL 4OUUB 5JNYA 2R2EB 3HUJA 3CFKB 2DM3A 1HCFX 4YH6A 2P8LA 4WWKA 4AL8L 4MCYA 4EI5C 3JUZA 4G6AD 2P24A 5I1IH 1AXSB 4HD9A 2LU3A 3JWOL 3L3DB 3QP3A 1MHPH 2I27N 1IT9H 3FZUD 5F7UA 2COQA 1H5BC 2P1YA 3MLVH 1MPAL 3WEXB 4KK8D 3OKLA 1UB6B 4OFKA 1QRNA 2NY4C 5FA3A 5KG9B 2YD6A 2P5EA 4PJ5B 1RUAH 1X7QA 1PD6A 1U8NA 2Z4QA 4LMQI 5E7FA 5HHVH 4DKEL 2IPUK 3HRPA 3ARZA 5FGRA 4MNQE 3P30L 4YXKL 5DMIL 3TBVA 2FYYB 1P53A 4HWBA 3BQUA 3SDDD 5ESVA 3HE7D 1Q94A 5ALCH 5DRWA 5CJOH 3WIHA 4MSWB 1A1NB 4KV5E 3KHOA 3KDMA 3WUWA 4OGXL 4JM2C 1G6RL 1HOCB 3TIEA 3ARVA 3TA3D 1MY5A 4XI5D 1UKSA 1QSED 4PJAF 2FEEI 5AEAA 1A3QA 3GSNL 3EJYD 4U1MB 1HIMH 2NTFB 1G7MB 4O51A 4Q9QL 2JIXA 4C54A 1TZGL 1P4IL 1IAMA 3DX8B 4MGXA 5E8OA 2VLLA 2VSCA 4YHOL 4PJ8C 5GGQH 5T5NF 3MLTA 4M6ML 3E3QE 1NANI 3MRQB 4PRHE 4FXKB 3DV6A 3GSRB 1RK0B 3LIZH 5EOQH 2A1WH 2YPLA 3HAEH 1AGBA 3BQUC 4KQ3H 4QY8B 2VXUL 5ADPL 4JDTL 3QO1B 4DUVA 5DK3A 2CIKB 1WZ1L 1KULA 3I6KA 3OHXA 3BN9C 4NWTL 4JFED 3BKYL 3O6LH 1FBIH 4K3DH 3IFOB 4KUCF 5SWZB 5I17A 3P73A 1RJLA 2O5XH 5C0JA 1FZOA 4M5ZL 1U8LA 5EORL 5EA0H 4I5BA 4NO2B 5DHYA 1CBVH 2VZTA 2CKBA 5TE7H 4RZCB 4DW2L 4GXVL 3T77A 1T7XA 4DK3A 4QHUA 2CLZA 3KJ6H 1FYTB 5JW4R 2GHWB 1AD9B 1JFQH 3NH7H 3RVXC 4PBWD 3PGDA 2BK8A 4G8GD 3ALPA 1R3JB 3ARDC 2VITA 2BVQA 2NY5L 3GMOA 4PGBA 4ELKA 5E4IA 3TH2T 4R4BB 2FX7L 2A77L 4FFZH 4G8FB 1IGFL 4K3HA 1WFOA 3IJYB 2HRPL 1AXTL 4L3EE 5GJSH 3L6FA 5DFWH 1TZIB 3EO9L 3QJHA 5CZVH 5GGSY 5AZEH 1AD0B 3BE1L 2X9WA 3T8XB 1X44A 1ONQB 3FN0L 4HHAB 1YQVH 4HG4K 4Z77A 1D5IL 3PHOB 5FO7B 1QR1A 5F96H 2BSTB 3MRIB 4P5TB 1YJDC 2VUYA 3TIDB 3P4LA 5FO8B 5I74B 4OFYD 1EHLH 4A2MA 5DEGB 1NSNH 2DKUA 4OD1L 3X11A 3ALWA 5BXFB 1YZZA 3VH8G 3TH4T 5I9QB 3NFNA 1K9TA 3P4NB 4EXPX 1KPVA 1BBJB 1RU9L 1HKFA 2JJTA 5I1GH 5DRNA 4GW4A 4QHNA 3IJSA 5EO9B 5E94B 1KTDB 1Q0XL 2A6JB 3QQ4A 5E1HB 4YHZL 1JPSL 3OKMA 4IOFC 4E9LA 1T5WA 4U7KA 4GKNB 4M7ZC 5EFIA 1HZHL 2AEPH 3MGTA 3WNKA 1A3RL 1A7OH 2J1KA 4WI6A 5C0AD 1T4KB 5JHDE 1X6NA 5L8JB 3DO7A 1WWWX 4GAYB 5C07D 2A6KA 2HN7B 4ZO6A 3C6SB 4POZD 4RFNC 4OZIF 1R5VA 2Y7QB 1U3HD 4P2YA 3HZKA 3RVUD 4JKPH 1A14H 1L7TH 3DBXB 4P46D 2YD1A 4OFDA 2VLJB 3O3UN 4J3VA 3EHBD 5H2BA 2XRAL 1IGTA 1C16A 2IBZX 2Z31B 3PWUB 4TULL 5CBAA 3BP6A 1MCRA 4D0DA 3LKPA 1XF5B 1D9KB 3FFCE 3CSYB 4LEXH 1NCBL 2JJTC 4X6EA 2NX5B 3DX9A 3UBXI 3JV0A 1RUQL 4JFPB 4I8DA 1GYAA 3LVEA 4KI5D 1XCQA 3AB0B 1ZT1A 4OCWL 3B8YA 4PJEB 3O6FD 3B2VL 3HNVH 1FV1B 1OGTA 5IB3A 1UCBH 1RHHB 5IT2H 4XCCH 1KB5L 3DX6A 5J1SC 2F53D 3INUH 2BCKB 4HZLB 3ARYA 4CU6A 4M4PA 2APFA 1EXUB 3ARBA 1AHWA 4F80A 4G8IA 3OF6A 1NDMB 2BNUB 3MGOA 1T83C 1IKNA 2EDNA 2CPCA 3L7FB 1YYLL 3VXMB 3WS3B 3WDHA 4R2GB 5I73B 5GGRY 1ZA3A 4NUGL 4XPAL 3C8DA 1Y18A 1RZ8B 4H20H 1ZANL 4I18B 3MUGA 1ED3B 3FQNA 5DVLA 3F62A 1ZGLM 3VWJD 5I19L 4V1DE 1IGCH 1NMCC 4NQTA 4YHMH 43C9A 1YYMH 3MBEB 5I1AA 1G7JB 1I7ZB 1WFNA 4BH8A 4F2MA 5GRJH 1LD9A 3GM0A 3QUZD 4H5SB 2NXZC 4R97B 2AK4D 1TFHA 3C5ZD 1FFPA 1M05B 1OCWL 4OQTH 4HG4J 5JPMB 3KPRA 4RX4A 3F7RA 4LLWA 3RPIA 1KELL 1QTYT 5HHMD 5KZCD 4I9WD 4MXQD 3QCVL 2Q86B 2WQ8A 5CHNB 2D31A 1GZQA 1AHWC 4Y16A 4XXDA 5GRVL 3E6HA 4L3CB 4BSJA 4N5ED 5TFSL 4NRYA 4H1LB 4KXZH 1MWAH 2FATL 3X14A 4ONGL 5D2LA 3WE6A 3U46B 3QUXB 3C60A 3BAEL 4UQ3B 4AL8H 4Q97A 4XPBL 1U93B 4BH7B 4WV1A 2CQVA 3G5XB 4JY5L 3HE6D 4MD4A 3U9PH 1HE7A 3ZT5A 2EEBA 3JWOH 4EQ3A 2RB8A 2HJLA 3O0RL 5F7EH 5SWQB 5E8EB 4MYWB 1MPAH 1ZVHA 4F58H 5DJXB 1CFTB 1WIPA 2MWCA 2Y72A 3CFBA 3G6JA 3OAYH 4OKVB 4HBCL 4RQQB 4DKEH 5A2JH 1EFXB 3EYSH 5C8JA 4I3RH 4ZNEE 1JI1A 2M1KA 4QRRD 3GMQB 5IG7B 4OGXH 2RFXA 3CUPB 3HAEG 3FO1B 5T1LD 3W5NA 4H88L 1VACA 1MCDA 2XNAA 3GSOA 4HIXL 4JJ5A 4QRQB 1H3GA 4F9LC 1ROWA 2VQUA 4U1SB 4CNIA 3GSNH 3L95A 4KJWC 5D1QB 3KPSB 1BWWA 4MNGE 4LDOB 4UDUB 4FN0A 3V0VA 3KXFD 5F9DC 5C0BA 8FABB 1TZGH 1BMGA 1P4IH 2C1OB 1H3UA 4H8WC 1FFOB 4NQDB 5GRWA 3CH1B 3VXSA 1IQDA 4OT1H 4YNYB 3BMWA 1BFOB 2YR3A 4PD4K 4M6MH 3WN5C 3VFGL 4DGYL 2BNRA 5SV3A 3VFUA 1NUFA 1ZGLA 1BHGA 1MI5D 1KLUB 3RWIA 5TGBB 1TIUA 1F13A 1FP5A 4NQUA 2C4XA 2VXUH 2GSGA 2R2BB 5BO1L 2PYEB 3H9ZA 1QNZH 2F5BL 4Y4KD 2PYFB 5F7DA 1EFQA 1YEKL 5ADPH 1HH9B 3W11C 1XCTA 3K2MC 4X5WA 4PJ5E 2DWDA 1H15A 4UT7L 2QKIA 4NWTH 3A67L 3BKYH 3FB5A 4PLNC 2W1NA 3RX5A 1KLGA 3V4PL 3BP4B 3U9UB 5I30H 3D87B 1JYWA 5T5FH 3TNNA 1XGRA 2QADC 4CAGA 2ORBL 4M5ZH 12E8L 5EORH 3VXPA 3TJEL 3C2SA 5IHZA 4DW2H 4AM0A 1KCUL 2RBLA 2R1XB 4GXVH 4OZ4B 4WI8A 3S5LG 1CFNB 2Q87A 2H9GA 2H3NA 4QYOB 2FRGP 3O6MH 1HNGA 5BV7B 2V2XA 1JGEA 2HRLA 2FX7H 1IGFH 4P4KB 1A6TA 5C0CA 2HRPH 1AXTH 1S5IL 1U8JA 1RZFH 3V0WL 3WHXA 3EO9H 3BE1H 1NFDF 3U4AA 3FN0H 1Q9KA 4YEEA 2C3XA 4FXGB 1NFKA 2XWTA 2W0FA 1QHOA 1D5IH 5TE6L 5DA4A 3VRLF 2NY4D 3WFEL 5CJQL 1GL4B 5BRZB 3ARED 1CG9B 1WCBB 3KS0H 3MV01 4G8GE 4OD1H 4JPVH 1MFNA 2YRZA 4K7PX 4ZMAT 1S7UB 3BIAX 5F3BB 4IHOA 3HG1B 1T7YA 1AO7D 3DROB 5DTFA 1A9BA 4HK3N 5ADOL 2RGSA 3VG0H 2AS5M 5CEXB 4JM2D 1OP5K 3WBDA 4Y2OA 5SX5H 1R6VA 3HC3L 4X7CC 5SWZE 1U3JA 1Q0XH 2XPGB 4YHZH 4XCFL 3AU1A 1RFDH 4WI9A 3BH9A 2FSEB 4ZUVB 1HZHH 3ILQC 2AV7B 1EBPA 4ORZC 1A3RH 2H26A 3EYVB 1LO5A 1FYTE 3MV9B 4K9EL 1CT8A 4YBQC 4PJ8D 4DEPC 5F1KC 3SDCB 1QRND 5IMKA 5I8OL 3MLYH 4PRIB 2P5ED 3CXHK 4PP1C 1S7RA 2W0PA 1KNOB 5C1MB 1EUUA 2NY2B 1DEEB 4R0LB 4DQOL 2XRAH 2V9TA 3GMNA 4PD4J 3BQUD 4GRMB 4LFHG 1MFCH 4DZBB 3KLSA 4KJYA 4TULH 5HHNB 4ZAKB 4WRLA 5F9WC 1F90L 1AGCB 3WFBL 5GS1A 2G9HB 1QLRA 3MV7B 3S4SA 1LNUB 1S7WA 2C3VA 4HGKC 2BSRB 4JQVA 4L5FH 4NQCB 1HHHA 3SKNB 3FB6B 4KK6C 2ZNXA 4ORGA 1UWEL 2H2SC 4OCNC 5I8KH 3F12B 3OPZH 1MRCH 4FMFA 3B2VH 2VR4A 4ZYKB 4WI2A 4PGEB 2FJFB 4PV9B 1OAQL 1DFBH 2EIEA 5CD5C 1OSPL 4OZGB 4L8CA 3PQYB 2OQJA 2XWJA 4D9RD 1RJZA 2IAMA 3RVXD 5JOPE 1DE4A 3ESVF 1MCPL 1JTOA 3P4OB 1W72L 3ARDD 1LDSA 1N2RB 4MJIA 5HPMA 1GC1H 2ARJA 3JSSA 4MA8L 4PB0L 1YYLH 4MB3A 4D9LL 4LASH 4LLMA 2H1PH 4XPAH 5D1ZB 3A6BL 2D0FA 4XB8A 1ZANH 3PIQA 4NDMB 1NL0L 3JWDC 5GS1C 1FNGA 3QWOB 4MA1B 5I19H 3LH2H 2V7HA 5GGSA 2NW3B 1CVRA 3T0AA 1QA9B 3GO1H 1DUYB 3SKOB 3OJVC 4JQVC 4NM8L 4KTEL 2NLJA 4HPYL 3HNSL 1RQ5A 2YUWA 2WLZA 4U6TA 1MEXH 3HAEB 3ARTA 4XWOC 4UINH 2ATPB 3IDGA 4ZUTB 2X4RA 3EOBA 1XF2A 3SO3C 1FSKB 3SJVD 3TO2A 3A0OA 1CGVA 3O3EB 4WGWB 3SGEH 3D5OF 3RTQC 2AJSL 3QCVH 1HXYB 3UJJH 2VSDA 4F15B 4UB0L 4RA3A 4UIKL 4PJEE 3TN0B 4XVTL 2I25N 3GIVA 4IOFD 2XICA 1J0YA 1HINL 2FATH 3ARXA 4ONGH 4YK4B 2XA3A 1JPFB 1DBAL 5E7BA 1SEBB 1MCLA 1TETL 4B7IA 5HVHB 3VD4A 3QDJB 1R0AL 1V3MA 5LBSL 4HCRH 1T6WA 4H25A 4JY5H 5LVEA 3L5IA 4OF5A 4TSCL 5MEQB 3O0RH 4PPTA 5GQBA 3W0WA 4BFIA 3VXRE 5KN5A 4MJ6A 4X98A 5FHBH 2XXMB 4PLJC 3WIHL 1I7TB 5T1MA 3BPCB 1NEZG 1JGVL 4HBCH 2JJSC 3EZ8A 1WSST 2WINB 3CXHJ 3WD5L 1HI6B 1RMFL 3IETA 5L8LB 3RL1A 4IDJL 4OLVL 3V9FA 3D9AH 3QH3A 4FTVD 3ABZA 1BQHA 3MNWA 1GOFA 3QIBA 2Z8RA 5ITFB 3PL6A 5E99L 2ZWLT 5L6YH 2J4WL 2X4OB 1SJHA 4MQSB 2HJKA 3BKJL 1CL7I 4OI8A 1MCJA 3S5LB 1DBJL 3N9GH 3FQTA 4HK0A 1I1YB 4V2CB 4E41A 3NGBC 1CI5A 4IMLB 4Y5XB 2HVJB 3PWPB 1SVZA 2NXYC 4MZ3A 1D3CA 4QRPB 5FF6B 3C5JA 5J12B 3BEVB 4I2XA 5BJTB 4AIZB 3TVMB 2ILLA 3VFGH 4DGYH 5JR1L 3R06A 3EUUA 5DD6B 5L9DL 3RIFF 4LSQH 3RQ3A 4U6HA 4M6NL 3QI9A 5E24E 1X9QA 3MJ8B 3B5GA 4JJHA 3ZT6A 1A1MA 2YOCA 1T6VN 4FNLL 1E27B 5GGRA 3P4MA 4F8TA 4LCWA 3H9SB 4XCNB 2F5BH 2L0DA 5DZOA 3RWCA 1YEKH 4P0DA 4Y8AA 4NZTH 2YD7A 3ZMRA 2HLFC 3QIBC 3PL6C 4UT7H 2CKBL 1WV7T 3A67H 1YNKL 3NIDF 3V4PH 3HLAB 4NT6B 3HRZA 3VDBA 3WO4B 2XQYK 4CUCA 2ORBH 12E8H 3LEVH 3MODH 4PJHB 4GW1A 5JQ6H 2A9NL 2GJ6A 3MV8A 1DVFA 3TJEH 1A9EA 1H8SA 1JL8A 2WP3T 3QULB 1PX3A 5DUML 5HJ3A 2IEPA 1KCUH 1GOHA 2J6EA 2VC2L 2ICWB 2EC8A 4LLUB 4OUOA 3THML 2A74B 4QRSB 1BVLA 3MRDB 4MB5A 4XMLL 2UVFA 3S96B 3KPSE 3VI4F 2EYSB 3K74B 1WAAF 4PR5B 5LXGH 4NNPL 1OP9A 4BQBA 4WU7A 3BGFB 4NQDE 2AJ3A 1GAFL 1MRDL 4KMTH 1S5IH 1IKFH 2BVUA 2VDML 4WI4A 1ZEAL 3S8WA 4NQXB 1NGYA 1A6VH 4KPHL 3F65A 4X99B 4OIIH 5KVDL 4Z7OF 1X5GA 3IFLL 3H3PL 1F02I 4FQXB 3U7WH 5DRZA 5TE6H 5TPWL 2BNQB 4OI7A 3WFEH 1A7QL 4L29A 4ODVH 4JHBA 4YIQB 4HSQA 3L5WB 2OLDA 4LEOA 2PYEE 1PAMA 2R2HB 3V5KA 3QDAA 2OX5A 1DVFC 1VERA 1MH5B 4Y16D 4EDWH 3R1GL 1U8KA 5FGBC 1RJYA 2N7BA 3HC3H 1KENL 3ARWA 3BXNB 1BOYA 1S7TB 4AQ1B 3FRUA 1T1ZA 4KJWD 1NFDA 3L9RA 5DQ9B 4XT1C 1SEQL 3UTQB 2DICA 4R7DA 5DJZA 2C26A 4Y5VC 2KQNA 1KTRL 4W6WB 2EH8H 3O6KH 4Y89A 1WVZA 5I15L 3QIUA 4QHLB 3EO1B 2B4CL 1J1OL 2VZVA 5JA9A 4K9EH 2GK0B 2OK0H 2EKSB 1IAKA 2D4DA 4XNMA 5DJYB 4M93B 4N1HB 5I8OH 4EI6A 3U4BL 2IH1B 2Z35A 1MWAB 5B8CB 5I8CA 2HTLC 5F71A 5AG9A 3ULVD 5FK9A 3L3OB 4IRJC 4YHKL 4DQOH 2FX9L 3KLAB 5MHSD 3ZDZF 5I71B 3GKZA 3BPOB 5DURD 2FL5A 2XT1B 1J8HD 3MROA 3AC0A 5DS8B 3W11D 1F90H 4LU5L 4QRUB 3WFBH 1MJ8H 2EDFA 1P2CA 4Q9CA 5BRZE 1MJUL 1S9XA 3H0TA 1KIPB 4QXUH 5LWYL 1FNSL 4XP1L 1FFNA 3E6FB 3RIFK 3TO4B 5C0EA 3DXAA 3V0AC 3HMWL 3QSKB 4DGIL 2QADD 2CDFB 1LEIA 3RZCC 1L4IA 4JVUA 4R7NA 3WNMA 4PG2A 1DQJA 5J6HA 4W6XB 1YMHA 2FO4A 5CKGA 3EOYG 1OAQH 3MRNB 5JHLL 2YZ1A 4QCIA 2W9LA 1KLFA 3KR3L 4PV8A 1G6RB 3CMOL 2HVKA 2CRZA 3RY4A 2WLYA 2KKQA 3JV6B 1HQRA 4JEGB 4XGZB 3WNLA 5E9DB 2BNRD 3C5SA 3VW3H 2YN5A 2V5MA 3GSNB 1QEWB 3HPJB 5BVPL 1BVKB 3IU3B 4MA8H 1XR8B 4PB0H 5BOZG 3S36X 4D9LH 3MV9E 3B9KB 1U91B 3STZA 2R8SL 4TUKL 2V2WB 3FCTB 3A6BH 3AAZA 4LKXB 2P47B 3VXTB 2A73B 1NEZB 4U0QB 1NL0H 3GMLA 3BH8B 4EIGB 3BRFA 4PRIE 2GEEA 3LN5B 1OAKL 1JJUA 1I8KA 1AKJA 1CLZL 2ZOLA 3DSNA 3V6FA 5B39A 4NM8H 4KTEH 3BZFA 3SCMC 4CJ1A 4OCRH 5HVWA 5EU3B 2BOBA 2SEBB 3H42L 2APVA 4YO0B 4F7TA 2FX8H 3BPNB 4I48A 1A5FL 3MV7E 4JAMA 2ADJA 5E2UL 3O3AB 4Q6IA 3VXOB 5EZLB 1R3KB 2AJSH 3G6AA 1R5WA 1MHHB 3MXWH 4WFHE 1C12A 1S7XA 5D1XA 2XWBA 4GS7B 4UIKH 4HAGA 3MA7A 2BZDA 4XVTH 2BHZA 4HKJA 2A6DB 1LE9A 2DOCA 2FJHB 4M8QB 1HINH 3P11L 3SE3C 4I0PA 2JK5B 3U1SL 1DBAH 4OZGE 1TETH 3KPQA 4HWEL 1ZWIB 4KUCD 3BEWA 3DHMA 3RX8A 3V6BR 4YBQD 5LBSH 5IEKA 3RA7L 4TN9A 5CFHA 4BSVA 2EDKA 4JFOA 3ULVL 1CE6B 4PP1D 1YEIL 4HWBH 5KSBB 3MLZH 3IJHA 4WEUD 4M02A 1H3XA 4HMCA 1A7PL 1JP5A 1T1YB 5IM7B 3WIHH 2DJUA 3ES6A 4LARH 1A47A 1ZA6A 1AR1C 2VLRA 4U31A 4XH2B 1WZKA 1SBSL 3DETC 1JUFA 3ZHLA 2DQIH 3WD5H 2FWOA 1FO0A 1RMFH 1LK3L 4QGTA 4IDJH 4OLVH 4X80H 2C7UA 2AEQL 3BKML 4BQCA 5D1XC 1S9YB 1IARB 5CSZB 1UM6H 2YUZA 4KK6D 5DJ6A 1NKOA 2H2SD 2ZKHL 3FFDA 3BKJH 5CMAA 3IB4A 4TUJA 2NW2A 5DLML 3LRSB 1K4DB 4IS6B 3OKOB 3TA3B 3UBXA 5CD5D 2XOTA 1QSEB 4JN1L 1OQXA 4DFIA 3MRLB 1P4LB 1T20A 4JRYA 3QFDA 2WBJB 3QUYA 4LHQB 3X3FL 3CFEB 2CLVA 4IIQB 5DEZA 2NY1B 3VCLA 1YDPA 5T3XL 1Z9LA 2FBOJ 4C55A 3WKML 5DK2A 1PZ5A 5T1KA 3QXDB 5CLWA 3QNYA 5JR1H 3QFJD 4W68A 2NY6C 3T0EB 2WP3O 3QDJE 4M00A 3V52H 3P0VL 3NAAL 1KPUB 2B1AL 2CR6A 1T80A 3AM8A 4FNLH 1HWHB 1YJDH 4D8PB 5HDQL 2HWZL 5IROA 5J8OA 1JF1A 3OAZK 5F7LB 3CU7A 4MLIA 4H26A 4RGOL 3TP4A 4YFLI 3QNZA 1OF2A 4O02L 3VFOA 2YD3A 3ILPB 2W60A 5K59E 4ZDHA 2CKBH 5D2NB 2DDQH 4X4ME 4XWOD 1QP1A 5DJDA 5SX4I 4HWEH 3QQ3A 3EKCA 5HGAA 2FIRT 2O5YL 2EYTA 1QSFE 1VEPA 1YEFL 3MYJB 2A9NH 4YR6B 3E2HB 3WXVH 1MIML 4NNYB 5DUMH 3PP3H 5EPMA 3RWEB 4UI2A 3L1OL 2EDYA 5DMKB 5MEOB 1EJOH 4LQFL 3D69B 3SKUD 1K8DA 3VGHA 5MERA 4MJID 5E8PB 5KSAC 2DN7A 5JW4Q 4KY1H 3EYFA 5E03A 1PKQB 5DUPL 5JOFA 4XMLH 1PEWA 5F1IB 4ZSOB 5IBLC 5FM8A 1KG0A 4LLDB 4NNPH 1IAIH 1KB5B 2ZUTA 3SDXA 3PWPE 5I1DA 1JPTH 1IL1B 1XZ0B 1GAFH 1LHZA 1XIWC 4AENB 1MRDH 4OCYH 5C6WH 1V7NL 5EIVA 1CXKA 2VDMH 2AKRB 5IMLB 1ZEAH 4RFEB 1ZXQA 2ERJB 1TZHB 5KVDH 3O4OB 3IFLH 3QEUA 3T1FB 3H3PH 3TNMA 5TPWH 5C71A 3CD4A 4PLJD 3P0GB 1A8JH 3PABB 1OM3H 3NPSB 1F97A 1A7QH 3WJJA 1JZ2A 3PE9A 4RAUA 4ETQB 5DQDL 3ZDYE 3FT2B 4UNTA 1K4CA 2X40A 4MAYC 1U3YA 1Z9SA 2R23B 1ES0B 2XN9D 4EVNA 3PDOA 4PJBB 5DRXB 4P2RA 5JO5B 5FB8A 1K3IA 3R1GH 5DJ2A 4HUWB 3C2AH 4MDIA 1DBMH 3GMMB 5DC0A 4ZS7H 2YC1A 4HFWB 5I8EB 3EDKA 1WQVT 4PJHE 1SEQH 2G2RA 4YPGA 4QT5A 1JTPA 1MLCA 4WFFD 3U30B 4M7JH 5EUOB 5IKCA 4CVUA 4M62L 2NXYD 2B4CH 1J1OH 3D39B 1K2DB 2RIKA 4N9GA 3V6OA 4J3OC 4P2OB 3LKQA 4K3GA 3W0WD 1F11B 2WV3A 5IVXB 1RIHL 5IW1B 3UYPA 5L0QB 4PJ7F 4PTTA 4GMTH 3C8HA 4NYLA 5L2JA 2HT2C 4PRDA 2JLLA 4MQ7B 3WFCL 3C6LA 3JWDL 4J1UA 4NP4L 4WEMB 4JHWL 4YHKH 3JV5A 3S88L 4MJ5B 2FX9H 3RNQA 3RWJA 5FYJU 1TLKA 1N6VA 4QNPF 4U1IB 4ZUSB 3RY6A 3KPMA 1U8IA 2QQNL 3CDGA 4LGRB 3ARQA 4O4YL 2HLFD 3QIBD 3NCMA 3PL6D 3IRZA 5D7JC 3QEQB 4Y2DB 1QFUL 3NFSL 4M61B 3MRCB 5LWYH 2YA1A 2GQHA 3IXAB 3QG6A 3WLWC 32C2B 3HMWH 2QQKL 4DGIH 5BOPA 3LN4B 2GYSA 3QEGH 3RGVB 3FQXA 2BSSB 4E41D 5AUMA 2Y5TA 3BWAA 3CVHA 3BP5B 1II4E 1PYWA 1K8IB 5JHLH 1YY8B 4U6VL 4NJ9H 3KR3H 1VFAA 3CMOH 2P5WA 4KZEL 5ENWB 2JB5L 1DLHB 3IAPA 2DM2A 3O9WB 2BVTA 3JVGA 4PRPB 4XPFL 5BVPH 1JGUL 3FOMB 5I1CL 3B4NA 1REIA 3TBSA 3L5XL 4HIJB 4OJFL 3QDMD 1JK8B 4WHCA 4QOKB 3LKSB 3W9DA 1BZ9A 4TUKH 1IGYA 3CFDA 2WBKA 4GG6F 4JQXA 1T7WA 2AJXL 3DYMA 4PJIA 3E1F1 4NC1C 2CGRL 5ISZB 2YA2A 4GOSA 4POUB 2ESVD 3FN9A 5FOBB 1CLZH 2VNCA 5C6TL 3CLFL 3LQZA 5JDSB 2J2ZA 2VISB 1NLDH 1U95A 4XRCA 3CZFB 5ACLA 2DF3A 4X4XA 3P0YL 3AS1A 3V5DA 4JPIA 4OV5A 5DHXB 3QIWA 1I8IB 3H42H 2LTQB 3VG9B 1DVFD 2E9BA 3LPGA 3V8CA 3RKDD 1A5FH 5HYJA 1C5DA 3BZ4B 3CNKA 4Z7UA 3QRFM 3C5ZB 3WUWG 1F45A 3V4VL 5E2UH 4XNXL 2YSSA 4W6YB 5C70A 1NBZB 5MP6L 3KYOA 5JMOC 4CMMA 4KKCC 1QLFB 1P1ZA 1F58L 4GAGL 2OMBA 4YJZL 4AYFA 4ONFL 1MF2H 1JWMA 5D7LB 3P11H 1WTGT 4ZO7A 4ALAL 3VFNB 1A6UH 2CH8A 1B4RA 4L9LA 4NN5C 4J3TA 3HB3C 1HHGA 5L2KD 4PGCA 4YHYC 2RCSL 1CTOA 3NZ8A 3ULVH 5J56B 5EH1A 5FUOL 2HTLD 4J8RA 1A7PH 5DK0B 5K9QG 1FN4A 1ORQA 3KPLB 4F57L 3IDMA 4JFFA 2D7TL 4G3YL 4U1LA 5DDHA 2J5LC 4JB9L 4Z9KB 4NN7B 4PJDB 3MFFB 1BD2A 1Z5LA 1LK3H 3MCKA 1UWXK 4JO4H 5KVGL 3LDBC 4I1NB 4KGJA 3TZVA 2AEQH 1E4XI 3BKMH 4JY6B 3RWFA 3DYPA 5EN2A 5EWIL 4UV4H 2OS7A 5IB4A 1JWSA 2ZKHH 1ZSDB 3RZCD 1Y0LB 2M2DA 4NO5A 4ZFZB 1V7ML 3D85D 4HULB 5B3JF 5DLMH 4BKLA 5ID0B 2DQEL 3BHBB 4AT6A 4JN1H 1TJGH 1JMXA 4HMDA 1QQDB 3X3FH 5IFAH 4MHHG 4EXKA 2DYPA 1HHKA 4ZPTA 5MEND 5DD5L 4KJQC 4KROB 1YPZB 3LHPL 1B0GB 5JXEC 4QTHB 4Y4FB 3MLUL 1DLFH 3AY4A 2PETA 5A1AA 2FHBA 4PG9A 3QDGA 2C4FU 4Z0XA 3P0VH 3NAAH 2IGFL 2H8PA 2B1AH 3VFMB 4JFQB 4XP9L 3VMPA 4XMPH 4JR9L 4O2FA 1FNLA 2J3SA 5HDQH 1JPGB 5KSBE 1MI5B 3TZVC 4ZUUA 2VQTA 4RGOH 3CCHA 4D3CL 2P4AB 1FFRA 4O02H 2A83B 3SCMD 1XGTA 5LGHL 3VWKC 1KFAH 1PQZA 4X6CA 1NCTA 3DLQR 4JN2B 3WV0A 4NZRL 4KWUA 2J6EL 5L7XL 1MIEL 4XZUA 5IB1B 5D7IB 3TBWA 1YEFH 2ATKA 5DYOB 1MIMH 4HUUB 3ZYZA 1WISA 4RMUA 5DVMA 4XPTL 1LEKA 4LQFH 3MNZB 1ZT7A 1G9EA 1FL6B 4N9OB 4XVJL 1T04B 1CDUA 1ORSB 5HHOA 5DUPH 3GBML 4KV5F 3EDJA 4U3HA 1ZOXA 3IVKA 5DJ8A 4OZIE 3OX8B 2N56A 4Z7WA 2X4QA 4JLRB 1KF9B 2L7UA 1G0DA 2IQ9H 1I85A 5GXBB 2QSCL 3OKDA 1RZ7L 5DI8B 5DJAB 2C5DC 3F6IA 3UTTB 4ZFFB 2VR5A 1HN1A 1UFUA 1ZVSB 3AXLB 1W72B 2R0ZH 4WY7H 3JXAA 1G7LB 3T0EE 5EZJB 5CEZD 4RGNC 1I9IL 2IH3B 2DQGL 2EO1A 3QUKB 5AWNH 3TCLB 2G5BA 2PXYC 1DQTA 5HYSA 3AREB 3S3JA 3HHRB 1ZHNB 2F58L 4S1SL 1MCWW 2H32A 2XZZA 3G5VB 4LPYA 3DMMA 4M8VA 5D1XD 4Z76B 1BAFH 3G5YB 43CAB 1HSAA 1YEGL 1CICA 5D2NE 1OWRM 1AC6A 5E5RB 3U2SB 5EIQA 4FFVC 1VHPA 1Q9OB 3TBYA 1TQCC 3MSPA 4OBRA 4AQOA 3KYNA 4IRZL 1R3HB 5IMMB 4ERSH 5JNYB 4M62H 4U1HA 4NKDB 1FVCB 2DTSA 3P9MB 4JDZB 4K2UL 3MRFB 4WWKB 1EHAA 5FFLA 4MCYB 1H3PL 4OAWB 4FQPA 1PKQE 2P24B 3MACL 1RIHH 1CLCA 1U92B 1GGTA 2CO6B 4ZSOE 5EU4A 3O8XA 4Q58C 4R8WL 2NY6D 4YFLF 3ULUL 3WFCH 3JWDH 4NP4H 3ZSSA 4JZNA 1OARL 4NSKA 1T2XA 4JHWH 5JW3L 1KCSH 1B88A 1S7SA 3OKLB 1QRNB 5FA3B 3UAJC 2P5EB 2FEDC 1K85A 1P7QA 1X7QB 2DQHL 2Z4QB 1U8NB 4FS0A 1BFTA 3GK8L 3OXSB 4MD0A 2XKSA 3SEPA 2NY3B 2CUHA 1JCKA 5GISL 5EU5A 3TBVB 5C09A 2QQNH 4O4YH 1BQUA 4X6DE 5ESVB 1Q94B 5DRWB 5AZ2L 1QFUH 3NFSH 5C0IB 4OGZA 4XCEB 3KDMB 3WUWB 2IALA 2XY1A 1VFBA 3OG6B 2X05A 4JRXA 4PFEA 3TIEB 2QQKH 4KGLA 1JVKA 3N06B 2NR6C 2YD9A 4Y19D 3OR7B 4YBLB 1DQQA 1XH3A 3QUYD 4M1DL 4AEIL 4FABL 4NBZB 4NFBA 4HXAL 4O51B 4PREB 5FYKD 2JIXB 1L0XA 4KZEH 5KSAD 5T1KD 3EYUH 1FGVL 1FLTX 3O8XC 3MA9L 4XPFH 2ZPKL 3T2PA 4M1GL 5IBLD 5E8OB 3PGCA 3QXWA 4S1RL 2EDOA 4XC3H 2GJZA 1JGUH 5FGCB 4BK4A 4OLUL 5EUOE 1P7KA 5I1CH 1VESA 4LGSB 3CX2A 2VLKA 4G9FA 4OJFH 3FO0L 4WWID 3LKRA 1XIWD 4WUKL 2IBGA 2CMRH 2QSVA 4FQLL 2D4FA 2CGRH 4N8PA 5CEZL 2J8HA 2X1QA 3EIFA 2YPLB 2B7DT 5INCA 3MQIA 1SMAA 1N5AB 3IKCA 3CLFH 1EHXA 3I6KB 1NAMB 3P77A 1AQDB 4JFDB 4B50A 3OBAA 1KXVC 3GM8A 3MCLL 2ZG2A 1J0HA 1B0WA 4MAYD 1W8NA 5D5MA 4XXCA 3SE8H 5JUEL 4GW5A 4QLRA 4Y5YB 3VFRA 5I17B 4M6AA 3QUMA 4EN3C 3PWLA 1ERNA 4UILH 3S9DB 3QEQE 3B8SA 1FZOB 5C0JB 4I5BB 5DHYB 1NCUA 2DJ4A 5GGUB 5B38A 4QHUB 2CLZB 2HG5A 5A2LH 1F58H 4LVHC 4LCCA 4F7EA 4ONFH 2LQRA 1JNNH 5C3LD 3PGDB 4MS8D 2AQ3A 1EZVY 4P2QD 3S34H 3GMOB 1ZHBA 4PGBB 4ELKB 4Q9BA 2RCSH 4PRPE 5DQJA 1MAMH 1NJ9A 3L6FB 3QJHB 2HT2D 4L8BA 1FO0L 4U2YA 1T7VA 4LF3B 2BC4A 3LKOB 4YHIA 1RSFA 5EU6B 3PWVA 2ICCA 1QR1B 3N1PC 4QOKE 2Q3ZA 4F57H 1L7IL 3GI8H 4HJ0C 4XXCC 3FOLA 5ISZE 2VDKL 4ISVA 4YDKL 1A7NH 5E56A 1X5XA 4JB9H 4O2EA 3X11B 3QNXA 5B22A 3WFHA 1A7RL 5KVGH 5D7JD 3MRBB 1OP5H 3RVWC 3NFNB 5D70L 1UZ8A 4OD3L 1OT2A 5EWIH 3FAWA 4OCSL 2EE9A 2R0KL 4LCCC 3REWA 2Y36L 4GW4B 4RWHA 1V7MH 3MUHL 5FYKL 3BWUC 2ZG1A 2AV1A 1F6AA 1EUTA 2DAVA 3VU2A 1G1CA 5DD1L 4MX7A 5C9JB 3QWRA 2OTPA 5EFIB 5LAXA 5HHQB 3MGTB 1G7IB 5IMOB 5DD5H 2IG2L 3LHPH 1JNLL 3B83A 5D7LE 1KJ3L 5EOTA 4ZS6C 5J11B 4RBPK 4U05A 5FHAL 3X13A 1I8LC 2A6KB 4NPYB 2B5IB 1R5VB 2VWEE 3PP4L 1JGDA 3HZKB 4XHQA 3I75B 1UEYA 2IGFH 3G9AB 4X8XA 3SPVA 4D9QD 3PGFH 3TH3T 4MXWL 4JR9H 4PTUA 3GGWA 5BQ7A 1C16B 4WDIA 5CBAB 3BP6B 5HGDA 2OR8A 4D0DB 5ALBH 3MRJA 4N1EA 3CJJA 5CSGA 2Q8BH 4X6EB 4HBQA 1PZUB 3L3GB 5E2VL 2Q8AH 3ZHDA 1LO3L 4NZRH 2J6EH 1J5OL 4PJDE 1CD1A 5M94B 1CZ8H 1O0VA 5L7XH 4Z95L 1MIEH 1XCQB 1ZT1B 1F8TL 3H9HA 4KK9C 5IB3B 3N85L 4XPTH 3DX6B 2DBJA 3GSUA 2PO6C 3DIFA 1MQKL 4KKCD 1YC8A 3UTZA 3IDXL 3KPOA 4XVJH 5FV1L 3RKPA 3GBMH 3OKKA 5DD3H 3ARBB 1DDHA 3WLBA 4HKXA 2UWEA 5TH2A 1VA9A 1N0LA 4MA7L 4ZFOA 1U8QA 1FIEA 3HB3D 4ZUWA 4HPOH 4LSTH 1YPZE 4AY0A 1RZ7H 2J8OA 1Z3GL 1ZA3B 1Y18B 1N6QL 5H37H 3MUGB 2Y9RT 3VMOA 4AMKL 2A6IB 1NC4A 1RUML 3ZKXB 5CKAA 4JM4H 1I9IH 3QIWD 43C9B 5I1AB 3ARGA 4HX1B 1U8PA 4F2MB 4GRLA 1LD9B 1NDGB 5HYJD 4OZFA 2E9JA 2NNAA 1IFHL 5GHWL 1FFPB 2ZUQC 4S1SH 4YGVA 5EZIH 4P4RA 3KPRB 5CJBA 4LLWB 5D8JH 3RPIB 3S4SG 4U1KA 1YEGH 2P8PA 1QG3A 5E1AB 5JDJA 2D31B 3B43A 4Y16B 5D7IE 1M7DA 4BSWA 3ROLA 3E6HB 1OTUC 4ONHA 2OBGA 3FL7A 4NRYB 1AGDA 3X14B 5D2LB 1BQLL 4K2UH 3C60B 4KJQD 4O58L 4L4VD 1H3PH 3VFPA 5JXED 3MACH 4Q7DA 2CK2A 4WV1B 2KBGA 4MD4B 1PFCA 1KTKE 2Z93A 5E00A 2NZ9C 3S3PA 2HJLB 5J0BA 1CFSA 4PRHA 2BHUA 4J3UA 4JFFD 4P5KA 1NANH 1F6FB 1OARH 4JG1L 1U8HB 2CDEA 5JW3H 1N26A 3F7YB 1YEHL 4GRLC 5CGTA 2FR4A 3UTTE 2KZ1B 2DWEA 2DQHH 3G6JB 5IFJA 1OGAD 3TZVD 1PLGL 4GBXA 5FM4A 4U1JB 1LP9A 2GCYA 3VFSA 5CGYC 5C8JB 4LLYA 4UV7L 5HTSA 2V5YA 5DURB 3VWKD 5AZ2H 1RZKC 5J9PA 3RJDA 1F6LL 3BDXA 3J7HA 2RFXB 2Q7YB 1JIBA 5GZNC 4HS6A 2Q3AA 1MAJA 1OAYH 2XNAB 3GSOB 4Z7VA 4JJ5B 5KAQF 3M07A 3L95B 3D0LB 4M1DH 4AEIH 4CNIB 4FABH 2DYPD 4HXAH 3O45B 1HILA 3V0VB 5C0BB 1NBQA 4OF0A 1SYVB 4YC2C 1XGYL 1FGVH 3BZEA 3MA9H 1XF4A 3VXSB 2ZPKH 4G6FB 1IQDB 4M1GH 3GSWA 1B9ZA 4OLUH 3HZVA 4KZDH 4LHUD 4QHMA 3K2UH 3FO0H 2BNRB 3VFUB 4WUKH 3JTTB 4FQLH 1ZGLB 5DSCA 4TRPL 2H6PB 4GBXC 5CEZH 1BIIA 4LCUA 3MOQA 2DQFA 2GSGB 2R4SL 5F7DB 3MREA 4QXGL 2X89A 1XCTB 2X4UA 4NQEA 4X5WB 4N0UE 1H15B 1E28A 4MNHA 2VL4A 2EE3A 2QKIB 1UXWA 1EO8L 1ZLSL 2PXYD 4H0IA 3GI9L 5D7KE 1KLGB 1YNTA 1ZLUH 4GKOA 4NBYB 4W4OA 2YK1L 15C8L 3TNNB 1S9WA 4CADA 1XGRB 4MD5A 3MLSL 2BVYA 5BMFL 1TTGA 5FUCE 3VXPB 3GSQA 3MX0A 1IEAA 5HHOD 2AEIT 2HFGL 4YPJA 1T03H 4AM0B 5SWSD 2YD4A 3G9VA 1IEBB 3V7MA 5BZDA 2H9GB 3OJDB 2H3NB 3L3JA 1ZTXL 4L4JA 2JCCA 2YMXH 1P4BL 1JBJA 5JHDA 3EFFA 2V2XB 4QF1A 2DIJA 1A6TB 4X7SH 5C0CB 1T2QH 1U8JB 3KAAA 3LSOA 3OL2A 5FGCE 4BELD 1FO0H 3BD5A 4UBDC 1UB5A 3NVQA 5IEHA 4HJJL 2XWTB 3VGFA 3T4YA 3T08A 3RDTA 3LPWA 2AAVA 3ZSTA 3UAJD 1L7IH 2FEDD 1J7VR 1FE8L 2VDKH 4HKBA 2YPLE 4YDKH 3I02B 3FFCA 4X7DC 2ZUUA 2X6MA 3SE9L 3B6SB 1A7RH 4XBPA 3GRWH 1CICD 1E6JL 1TQBC 5DTFB 1A9BB 4JFDE 4WVRA 1S9VA 1AP2A 2AJZA 1YMME 4XP4H 4OD3H 4OCSH 2N1KA 2R0KH 1QPXA 3TWCH 2GITA 2NR6D 2YRPA 2F54E 1J0ZA 5FYKH 5J4MA 1NC2D 4PLOB 5DD1H 4H0HB 1TJHL 3AU1B 4MA3B 2LV4A 3BH9B 2LABA 2NY0B 4XP5L 1M71A 3O8XD 2V6HA 2IG2H 3BKCL 1CT8B 1JNLH 5C0GA 1CGSL 1GHFL 1KJ3H 2GKIA 3T3PE 4Y4HB 5FHAH 5HYEA 4P3CL 2BHYA 3DTXA 3PP4H 2QHRL 4N8VA 3UDWC 1P84K 4PJEF 1INEL 3NN8B 3FO2A 25C8H 4V1DA 3GMNB 2O61A 4LSPL 3IF1A 2B2XL 4LLQA 3U36B 5EU6E 1EO7A 4OLWL 5IJKC 5ACZA 5FYJL 2GSIA 4JRXD 1QLRB 4UAOC 5IHLB 4IRSC 3S4SB 5E2VH 1QFWM 3DARA 1U3ZA 1LO3H 1S7WB 2C3VB 5H37G 1TPXB 4DN4L 3W82A 3MLWL 7FABL 1HHHB 1I7RB 4EN3D 4ORGB 1G9MC 1F8TH 4GG8B 5TQ2L 1JHKL 4UNVA 3N50A 1O7VA 1CDBA 4WFEE 4DCQA 3B5TA 4L8CB 3CSPA 1YQ2A 4J3SA 1RJZB 4Z8FH 5F9JA 2IAMB 3NCCB 1DE4B 3O4LD 3EW3B 3PHQB 1GZPA 1P6FA 1RUKH 2DQCH 5FYLD 1EVUA 2EECA 2C3HA 4MA7H 4HDIA 4RIRA 3TEUA 4LLMB 1BJ8A 4LRIA 3FB7A 3X3GL 2MSPA 3ZDZE 1N6QH 1YNLL 5F88A 4LP5A 3EAKA 4AMKH 2V7HB 5GGSB 1RUMH 9CGTA 3EDEA 2V7NA 4HJ0D 2G75A 2AGJH 4XTRC 5E6IB 2Q76A 2NLJB 3U0PB 1RV6X 5EBLA 5INDA 4ZNEA 5FO9B 4GKZA 1M7IA 1IFHH 5GHWH 5IHBA 4CMHB 3RVWD 1K5NA 3IDGB 2X4RB 2XKNB 1XF2B 2ICWI 3BPLB 5KVFL 3BO8B 1CF8L 2I9LA 4F7MA 5DR5H 1UH2A 3A6CL 3I6LD 3QCTL 4RMRA 4XNZC 1HYRC 2RQ8A 3MJ9L 2Q1EA 2MPAL 4HW6A 5D7SH 3IGAA 2BXZA 2E6JA 3ME0A 3HZMB 3MRGA 4F33A 3HE7A 5F8RC 1EEUA 2DQDL 1BQLH 1NCCH 3WFDH 2F19L 4YUEL 1B2WL 1XFPA 3MUZ1 2R2EA 2FHCA 4H25B 4LAQH 2CIIA 3LEXB 4Z78A 2AEWA 4CW1A 1AXSA 4BFIB 5TDOA 5KN5B 4MJ6B 4JG1H 4X98B 5DHVB 4X7TA 1R3IH 1YEHH 2X1XR 3SGKA 2YD8A 1OHQA 1AR2A 3QA3A 5E0QA 3GKWL 3WEXA 2D03H 1UB6A 1PLGH 1K6QL 4PJ5A 1P84J 1A6WH 1T7ZA 5B39G 5KANG 3CVHH 1G9NC 3QH3B 1WUNT 3MNWB 4MMZC 1DQDL 2HJKB 1E4KA 3KPRE 4X83A 4KK9D 5IQ7L 5FUZL 3SQBA 5A40E 4JFHE 4N0FA 2AW2A 3FQTB 2PO6D 4K71C 2VDPH 1UACL 5DVNA 1XGYH 1MRFL 3N1GC 3MRPA 4R4NC 3RGHA 4MDJA 1JYNA 3EBAA 3OGOE 4NOFA 3C5JB 3KWWA 2VZ1A 4HWZA 2PW1A 2V5TA 1SJVA 1E6OL 3Q0HA 5D2LE 4JO1L 2P8MA 2DLEA 1FIGL 3R06B 1W0WA 1KCRH 4U6HB 1FORL 1U41A 3QI9B 4TRPH 4CU8A 3V95A 1A1MB 4X6FB 3MRQA 4IMKC 1OY3B 5GGRB 3PDDA 3P4MB 2R4SH 4K3JL 3GSRA 4LCWB 3RWCB 3QUML 4G8GA 4QXGH 4D0BB 4YHPA 4QY8A 4OI9A 3K7UA 3TFKC 2K7PA 3G6JE 3QO1A 1EO8H 3VE0A 1V5JA 1ZLSH 1DP0A 4ELMB 3GI9H 2X1PA 3TPUA 4DOHB 4DUWA 3HRZB 2HMIC 15C8H 4E5XA 3MLSH 2EXWC 4K94L 4NGHL 2GJ6B 2VZUA 3IFOA 3MV8B 5EOCJ 1A9EB 5JZ7C 1RIVH 3UJIL 5HJ3B 3SDAB 2F8XC 1KJVB 4LL9A 1N0XL 4RGNE 4L8SA 1OTUD 3T65A 1BVLB 5T3ZL 1ZTXH 1RURL 1I3RB 1U8OA 2YEZA 2G60L 1P4BH 1MFEL 4RAVA 4YDJB 1B3JA 5C0BE 2DQUL 4QTIL 1AD9A 4UUJA 2VLME 2AJ3B 3X12A 1R3JA 3VXSE 2O5ZL 5I0ZA 2NZ9D 2EH7L 4R4BA 1YC7A 4HJJH 4MNQD 5FDYA 1F4YL 3IJYA 5DRZB 4PJCA 3TESA 4GRLD 3MUY1 1JYXA 2D7OA 1EGJA 4EBQL 4L29B 4PY8J 1ONQA 2Y1VA 1J1XL 2GFBB 5IUSA 5T3XE 3FONA 1MHPL 3OB0K 1IT9L 4LEOB 2BSTA 4P9HC 1A6AA 5K9KB 4JFYA 5CGYD 4TVPE 5IBUG 3V5KB 1E6JH 4HLZH 5C07A 1MFAL 2IPKA 1CGWA 2PTTA 4HCRA 4OCLC 4NKOB 1R3LB 1CR9L 1RZIA 1U8KB 5GZND 3GMRB 4S2SB 1JHTA 2HLAA 5DJ0A 4KK5C 3Q5TA 2DLTA 3FRUB 1T1ZB 1Q1JL 2MQ3A 3L9RB 1UA6H 1TJHH 2O26U 1KTDA 5DJZB 5DC4B 4XP5H 3QIUB 3LB6C 4K8RL 2MOVA 3AMKA 3QCUH 5A2FA 3BKCH 2G5RA 3L3KB 4PRHD 3ZE2E 1IAKB 1CGSH 3NTCL 4JHZA 4XNMB 1QYGL 1FCGA 1M1SA 1CTNA 2R29H 4P3CH 5GRXG 4EI6B 5F93C 2Z35B 5I8CB 2DM7A 2QHRH 1VCAA 4WW2A 2F53A 3PV7A 4GBXD 5F72S 3C6SA 5C0CE 1INEH 4P5TC 1PY4A 4RWYH 5I74C 2XA8L 2Z0BA 2B2XH 2VL5B 3B9DA 1I1AA 4OZGF 1IBGL 1WBYB 3MROB 4XVUC 3NIFE 4OLWH 3AFLA 2XKUA 5FYJH 5I9QC 3HMXA 1P2CB 3LIZL 4JFZL 4UT9L 1X6LA 3H0TB 4DN4H 1D9KA 2R56H 1CN4A 7FABH 1FFNB 5C0EB 3HR5A 3FHQA 3DXAB 3QXTA 3MXVL 4X9BA 3WL9A 1LEIB 2F5AH 5TQ2H 1QOKA 5EC1A 3VWJA 1DQJB 1VADA 1RPQA 1DBBL 1YMHB 2FO4B 3RUGB 5FIEA 5KTEL 4QCIB 1FV1A 4ZFOL 4PV8B 3KJ4B 2IMNA 3STBA 1C7SA 3QUZA 1HEZB 3UTSB 1UJ3A 2AK4A 1HQRB 1NCDL 2BCKA 4HZLA 3HFML 2P42B 3C5SB 4L3ED 5EA0L 3STLA 1CBVL 5TE7L 3LS5H 3C09B 2ZUWA 1WTLA 1IGIL 2PR4H 4M7LT 2FB4L 1INDL 1NDMA 3VXUB 2BNUA 2XZCL 3D2UD 1JN6A 1JFQL 2IFFL 4LNVA 3L7FA 3AAZB 1FG2B 3KLDA 3VXRA 5DMJB 4UBDD 1YNLH 3KYAA 1QBBA 3U0WL 3SGDI 3GMLB 1AE6L 2Z31C 2H32H 3J8F7 5MI0B 4LCYA 1I8KB 1AKJB 3Q5YA 1LGVA 2ZOLB 3V6FB 4FFZL 5TE4H 5B39B 1D9KC 5F97E 5CZVL 4PJ9B 3F7QA 1AFVL 2BOBB 3MBEA 5GGTA 4MB4A 1EHNA 4F7TB 3LN9A 5F96L 4H5SA 1UWGL 3AB0C 4PBXA 4I48B 1NCAH 5KVFH 5JPMA 4JAMB 4JANA 1FQ9C 2ADJB 4Q6IB 3A6CH 3G6AB 3QCTH 1ADQA 1C12B 1S7XB 1BQSA 3DWTA 1N4XL 1R5IB 2MNUA 3BD3A 1CL7H 3GJFK 4K7FA 3MA7B 4ZXBB 3UCRA 2MPAH 4BZ1L 4HKJB 5JHDD 2Q86A 2GY5A 3H2WA 3NCJH 5K59F 3Q5OA 2VAAB 4C59B 4I0PB 4NC2B 2DQDH 1U6AL 4H1LA 3KPQB 2F19H 5I6XB 1B2WH 3BEWB 4GLRI 5T1LA 5IEKB 3LV3B 4R2GC 1IZJA 4AIOA 2IANE 5I73C 5ITBH 1W0YT 4BSVB 3MBXH 1YN7A 4I18C 3I6LE 4UDTA 1U93A 4Z5RB 5GIRB 2AEPL 3IJHB 5FGSA 4NNXB 1A7OL 1EEYA 3FFCD 1IE5A 4KDVA 3KXFA 1ZLWK 5IWLC 2VLRB 2OI9B 1ZE3C 3MBEC 4JRWA 4M6OH 4ZO8A 3UTOA 3GKWH 2HA1A 1UWXH 4R97C 1K6QH 1FO0B 1SM3H 2FWOB 3OAUH 5CP7A 4JKPL 1A14L 2K7QA 2X10A 4IRSD 2C7UB 1KN4L 1EFXA 2W92A 5CJXC 3SBWA 2FBJL 3ROOA 3LD8B 3L3HA 3GMQA 3FFDB 4KU1A 1DQDH 3HR6A 4F7PA 1KCKA 4J23A 5CMAB 5IQ7H 4TUJB 2NW2B 5FUZH 3ZDYF 5F7FA 5JIIA 1MQ8A 4QRQA 4N1CA 1UACH 4KTDL 4U1SA 1T1XB 1T20B 4JRYB 1LO0H 1MRFH 3QFDB 3QUXC 3QUYB 5D6DA 5HVFB 1S9KC 2CLVB 3VCLB 4UTAL 5D71L 2Q6WA 3VI3E 3HNVL 3ZTNH 5DK2B 1PZ5B 4NQDA 5T1KB 3INUL 1H0DB 4NHUB 1MOEA 1E6OH 1WLHA 4JO1H 1IC5L 4WUUE 3QNYB 4YNYA 4V1DD 5JA8B 1FIGH 5HYFA 1EX0A 4W70A 4OZHA 1BFOA 3QXVA 4U0RB 4RSVA 4DN3L 1FORH 4PJHF 4PYHA 3KYMA 3QZWA 4FFWC 3RWGA 1T0PB 3RX7A 2IADB 3G5ZA 4XAWL 4OLXL 4K3JH 5TGBA 3QUMH 4H26B 5IBUB 1V3JA 4XTRD 3SBWC 5AD0A 2VH5L 1OF2B 2IBBA 4EI5A 2W60B 2BY0A 1KC5H 3FT3B 4D2NA 5CUSL 5DJDB 3QQ3B 5HGAB 5L8KB 1H5BA 2EYTB 3U83A 1DZBA 3PNWA 3BP4A 3U9UA 3BUYA 4RMVA 5GRJL 5D1QC 3CFCH 5D6DC 3UJIH 4P48A 5EPMB 5KOVC 1JRHL 1N0XH 2RAMA 3FQRA 3RWDA 3TT3L 1NGQL 1DTUA 5MERB 2KL6A 5E95B 5ESAB 3EZJB 5GGVL 2R1XA 5T3ZH 1URLA 3F58H 1AO7A 3DUSA 1T3FA 1RURH 3B9AA 3UXFA 2G60H 1MFEH 2DQUH 4QTIH 5I18L 4JM2A 2UZYB 2VDRL 3SDXB 5I1DB 1RULL 4PJGA 4JCMA 3BISA 2EH7H 1FVDA 1KGCE 2HAZA 1F4YH 3TNMB 3T2NL 4NO0B 1C5CL 4EBQH 4HGWA 1J1XH 4FXGA 4ONOA 4RAUB 1TENA 3U9PL 1BFVL 5JQHC 5F7EL 1K4CB 4LCWE 5BRZA 4PJ8A 1ZS8A 4KAQL 4TYUA 4F58L 1UQSA 4EVNB 1MFAH 2JB6A 4LAJH 1S7VA 4JREB 4P2RB 5FB8B 4UOW1 5F3BA 1IAIM 1CR9H 4L1DA 5EG6C 4ELME 4MDIB 5GSVA 4F3FB 3PDGA 1JE6A 3EYSL 4JHAL 4DOHE 1P9MC 4I3RL 2X4TB 5ACMA 1IM3A 2VXQH 3DV4A 4NFCA 4NIKB 4L4TB 1Z9MA 1Q1JH 2NYYD 4JPWH 5EIIA 3BUTA 2G2RB 4YPGB 4QT5B 2GJ6E 1LO2L 3KNBA 3MV8E 1MLCB 2EXYC 5F6HI 2CUIA 5IKCB 4GO6B 2XPGA 4K8RH 3IDIA 4R4ND 5J1AB 4N9GB 5BV7C 3P2TA 3LKQB 3LZFH 5GRUL 5C3TA 3NTCH 4P4KC 2ZUSA 5DGQA 3QPQC 3EYVA 1QYGH 2Z91B 4PRDB 2P7TA 3C6LB 4J1UB 4U33A 3MJ7A 4OT1L 4PRIA 3PWJB 4PJ5D 4C83A 2XA8H 3RWJB 1OLZA 4HUMB 2RHEA 3QAZB 4MJ2A 2E7LA 1IBGH 4AEFA 1WJ3A 1WF5A 2J8UA 1CGUA 4BQ9A 1SJEB 1U8IB 3ARDA 4GRMA 3TFKD 1N7MH 4JFZH 4UT9H 3QQ9C 3O11A 2YBRB 3QG6B 2CK0L 2BVPA 5HYSG 1QNZL 3MV7A 2HMID 1LNUA 3MXVH 3KPPB 1JWUB 2EXWD 3FQXB 2BSRA 1DSFL 4RA0C 3SKNA 1FJ1A 3FB6A 3IFNL 2Y5TB 5E8NB 5AUMB 5JZ7D 4NJAL 3Q2CA 1DBBH 3SDYL 5KTEH 4J4PC 4M9PA 4RISH 5I30L 3N0PB 5T5FL 2D2OA 2P5WB 2QR0A 2FJFA 4RDQF 3JV4A 1NCDH 1OP3H 4GJTB 3HFMH 2IQAA 3ZE0E 5D6CB 1PSKH 3SDCC 1IGIH 3M8OL 3SJVA 3TBSB 2FB4H 1INDH 1FAKT 1NLBL 1N2RA 3W9DB 1BZ9B 2XZCH 4OF7A 3CFDB 2IFFH 2E7LC 2NY2C 4OZFH 4PJIB 4R0LC 2PW2A 3U0WH 3IFPA 1AE6H 3EO0A 3O6ML 5C6PB 4X9HA 1J0KA 4G6JH 5B3NA 3CZJA 4ZAKC 3VXNA 3LQZB 1U95B 1RZFL 4LKCA 4EQ2A 4P9MH 4X4XB 1QFOA 1N3NA 1QA9A 3V5DB 1AFVH 4JPIB 4OV5B 5BS0B 3QIWB 2CRYA 2QSTA 5SWZD 2BY3A 3ULUE 3RI5F 1UWGH 2J5LB 1C5DB 4Z7UB 4DTGH 5T1DL 4D94A 4JFXA 4JPVL 2YSSB 4XP6H 5KSBF 1UT9A 3KYOB 2AXFA 3DXAE 4KK5D 1N4XH 4CMMB 1FYTD 1KJ2A 3VG0L 5SV4A 1P1ZB 4BZ1H 3DVNA 2BRRH 4U3CA 5IR1B 3RUGE 1MHEA 1U6AH 2M8XA 4ZFGL 4I0CC 1DN0A 4L9LB 2Z9TA 2ADIA 4FTVA 4ZPVA 3UTSE 4O2CB 4XNUL 1G0XA 2UZXB 1QSVA 1OAUH 3OWEA 1HHGB 1JPFA 3QISA 4PGCB 5A2IH 4OFPA 1SEBA 5D1ZC 5J13B 1C5BL 1RFDL 3NZ8B 2FJGB 4APQB 1QFWL 4NM4H 1JZ5A 4MA1C 3PJSA 4J8RB 2ZOKA 3VXUE 1AH1A 5D9SA 1FN4B 3WO3B 4P5TD 5J89A 2XTJB 3IDMB 4MWFA 1BGXL 4FXLA 5DDHB 1CGYA 3MLYL 4XVUD 1BD2B 1Z5LB 3OXRB 3MCKB 3PXHA 1T83A 3T1WA 4DAGH 4O9HL 1KN4H 3RWFB 1FSKC 3R0MA 1MFCL 5EN2B 4YLQT 2FBJH 5E2WL 3K8KA 1QSFA 5SX4H 4PY7B 1JWSB 4PRAB 3CPLA 4NO5B 3T4AB 3TLRA 4F15C 5JOPD 4AH2A 4XPHL 1D7FA 1PG7W 4LIQE 3TN0C 5C92A 5A3IC 4PRNB 5TF1H 5B38G 4L5FL 4KTDH 4BK5A 5JIKA 2V2TA 4YK4C 3S5LA 4R6UA 5I8KL 3OPZL 5HVHC 1MRCL 1HHKB 2DYPB 4PB9L 3DRQA 4U2ZA 5D71H 4ZPTB 3UMTA 4UTAH 4RBPH 4KDWA 1KXTB 1EEQA 1CLOL 2ICWJ 5CWSA 4GRWH 1DFBL 1NFIA 3W2DL 1IC5H 3QDGB 1J1PL 4Z0XB 4DN3H 3NIGE 1I1AD 2H8PB 3LRHA 3KVQA 1JZ6A 4K23L 4O2FB 4XAWH 4OLXH 4X9GA 2Z31D 1CXLA 1GC1L 3TPKA 2LAGB 1KEML 3RVVC 4ZUUB 4P9HL 1D9KD 3CCHB 4LASL 2VH5H 2WANA 2H1PL 2VLRE 4L9DA 3IKKA 1XGTB 3SE4A 5GS0D 1PQZB 4IOSD 4X6CB 5CUSH 5KJRH 3LH2L 1M6OB 3GO1L 2Z8VC 4UOW0 3BVNA 3TBWB 1CDJA 4KRPB 4NT6A 4G42A 1SYSB 2HFFA 4OIAA 1LEKB 1JRHH 1SY6A 1MEXL 4PJHA 1BWMA 4Y5XC 3FAXA 4UINL 1ZT7B 1NGQH 3TT3H 2C3WA 3U7YL 4U6XB 5GGVH 4X6DF 4HUVB 2JELL 5J12C 5J6GA 2ICWA 5K9QI 3IVKB 5DJ8B 3WCYA 1X5ZA 3TVMC 3RI5K 3UJJL 3VXRD 5I18H 3U79A 1Q9LA 4Z7WB 2VDRH 1OPGL 1EGJL 1KIRA 2F8OA 1WITA 3DGCR 1XF1A 4OTXL 4R2GD 1GGBL 1QRKA 1RULH 2WNGA 2DI8A 3OKDB 3GUTA 4F9LA 3LY6A 1QKZL 5I16A 2OR9H 1FNFA 4DFHA 3QPXH 4HIIA 5CEYA 3T2NH 3LQAL 2DTML 3SE4C 1C5CH 4HCRL 4K07A 3MBED 5K93A 3WS6A 1BFVH 1CXHA 5EUOF 2G5BB 2A38A 4KAQH 1D6VL 3VD3A 1OD7A 5FHBL 1Q38A 2X4NA 4XX1G 3WN5A 4GQPH 5HYIA 2H32B 3WO4C 5FV2A 3DMMB 2IC2A 5FM5O 4CBPA 1HSAB 5FKAA 1CICB 3FQWA 5F1OB 4JHAH 1YY9C 4ZQKA 1FLRL 1Z0MA 3O81A 1J8HA 1EJ6A 1LO2H 5F70A 3D9AL 5HBBA 3KYNB 5D96B 1NBYA 4U1HB 3QUXD 4NQVB 3UTQA 1YN6A 5L6YL 3OZ9H 3BGFC 4M43L 3NACH 5GRUH 3N9GL 4S0SD 5EU4B 2MCPL 3O8XB 3CFJB 2GK0A 3MLXL 3MO1A 4FQXC 2CD0A 1BP3B 4MAUL 3WS6C 2C1PA 3MMEA 5IW6B 4JZNB 4NSKB 4Y7MA 3HMXL 3W9EA 4FFWD 1INQB 2IH1A 3K81A 5B8CA 5F89A 4E0RA 4UT6H 1P7QB 1I75A 1CQYA 3VGDA 2R1YA 1EFXD 3L3OA 2PNDA 1NQBA 1KJMB 5GS0L 3KLAA 1T21A 5EU5B 4LSQL 5HYQB 5C09B 4FOMA 2R4RL 4K3EH 5DS8A 1DN2A 1TVBA 4PJAA 4QRUA 4Y88A 2CK0H 2IALB 4C57C 5KVEL 5IV2B 1T2JA 4C56B 1UVQA 3VH8B 1DSFH 2GTWA 4NZTL 3ZL4H 4WTXA 4P2RE 3IFNH 3LQMA 1DQQB 1XH3B 4NJAH 5D1QD 1CD0A 3KPSD 5DGRA 3SDYH 4E42A 3CDYA 1JV5A 4PJXB 3IDUA 3QHTC 4L4TE 4NQDD 3LEVL 3MODL 5JQ6L 1LE5A 1ND0A 1KEGL 2NMSA 1G6RA 3PGCB 1P69B 1P7KB 4M93C 3M8OH 4WIQA 2W65A 3OGCA 4LVNB 5B8CC 2VLKB 4G9FB 5E8DL 3RAJL 1IQWL 1NLBH 3V6OE 3HPJA 4HJGB 3O3BA 3F7VA 1MCKA 4LNRA 4CDGC 3DJ9A 3NCYS 4LBEA 1U91A 4TUOA 4R26L 5GGTL 5I71C 2PYED 3BPOC 5INCB 5LXGL 3ARFB 4EI5D 3JWOC 4I4WA 1UXSA 2MMXA 3BH8A 4KMTL 1IKFL 4HKZA 1HCVA 3U7AA 1A6VL 4OIIL 3U7WL 1ADQL 5D5MB 4GW5B 3TO4C 1KACB 4GQ9L 1E0OB 3MYZA 5ABDE 3BN3B 4ODVL 4XNYH 4S1QL 5IIEA 1TMCB 3EJZC 3PWLB 1E4XH 1OSZA 4PBVC 5C2UB 5T1DH 4OBSA 4AJ0A 4XBGA 5D72L 4JPKL 5H35A 1FGNH 3DECA 1YEEL 5JMRA 2HG5B 1R3KA 1R24B 2AXGA 2E6PA 2VYRE 4F7EB 1MHHA 2EXYD 2M26A 4EDWL 1ZT4B 4WO4B 3ZLQC 3G04B 4KHXL 5CIPA 3BIKA 4PJDF 4ZFGH 2ZUXA 5ANMA 2P5WE 2FJHA 5GRVK 3MJ6A 3QJFA 1MJ7H 1N59A 4XNUH 3B9KC 4NN6B 3UC0L 1LWRA 5I1JL 4P4KD 4YFDB 4YWGL 3QPQD 1C5BH 3GJFB 1NJ9B 1RJCA 3T09A 2EH8L 3O6KL 4L8BB 1QFWH 3Q6FA 1S8DB 3VA2C 4QKXB 1B4JH 2BC4B 3X17A 3K8LA 3GHBL 2OK0L 3IAGC 2XFXA 5BRZD 3CVIL 1HSBB 4PJIE 1BGXH 3C87A 1T1YA 4N90E 5M7QA 4XH2A 4O2EB 3DVFA 3MZTA 4L8DB 1EPFA 5HGBA 5DT1H 4O9HH 3UTPE 4KFZC 3BPNC 3BI9X 1YPZF 3QQ9D 3QFJA 5JORB 1UZ8B 2EIZB 1ETZA 5E2WH 1DQLL 5BS0E 1MSPA 4G8EA 3REWB 1PW3A 4FQIL 3BN9D 1S9YA 4GS7C 1MJ8L 3EFDL 2AV1B 1F6AB 4XPHH 5F9OL 4Z7UE 4QXUL 4J4PD 2VDLH 3WUZA 4MX7B 3TF7C 3LRSA 5LAXB 1K4DA 3MNVA 5K9OA 3MV9D 2FIKA 4PB9H 5KVMC 2KPNA 3U4EA 4DKAA 2GTZA 4OZIA 2AERT 3N1QC 1EEZA 1CLOH 1T5XA 2FNBA 1TJIH 2WBJA 5EOTB 3CFEA 4S0TD 4IIQA 3GIZH 1FPTL 3W2DH 3X13B 3SKJL 2L4OA 4PRID 1CXIA 1J1PH 3ARPA 3BP7A 3RTQA 4WFGE 5D7IF 1BJ1H 2NY5C 3AS0A 1SJXA 3SPVB 2NY2D 3VW3L 3QXAA 3PHSA 4K23H 4PTUB 1A3LL 2VJXA 3GGWB 5J06A 1KPUA 5BQ7B 1T0MA 4HXBL 1KEMH 4ZAKD 4P9HH 5HGDB 1XR9B 3MV7D 2XTJE 3NOIA 3OTTA 1GGYA 1X5LA 4ODBD 4X4YA 4JVWA 1FAIL 3RNKA 1BD2E 1J0JA 4WFHD 3MOAL 4WEBL 2XG4A 5D2NA 4X9IA 2VLJE 3H9HB 2P45B 1MELA 2BSED 4OCRL 1EAPB 1SMOA 3TA3C 3GSUB 5FM5M 2JJSA 2FX8L 4YR6A 5EO1B 3KPOB 2WBJC 2ZSVB 3U7YH 4OSUH 4IIQC 4X5XB 2NX5E 2NY1C 2E7BA 4Z7NF 2JELH 5BV7L 4X8JA 1G7QA 1FZJA 2XN9A 3WLBB 2ENSA 1WT5C 4HKXB 2UWEB 5E8PA 5TH2B 3MXWL 1OPGH 1EGJH 4ZFOB 3T0EC 1U8QB 4OTXH 1GGBH 4ZUWB 4BQ6A 2APBA 1TVHA 1KB5A 5EDXA 1A22B 3HN3A 1BM3L 5EU7C 4LSDA 1QKZH 1IL1A 1XZ0A 3K4AA 5IVZA 3QDGE 2AKRA 5FA4A 5DFVC 3LQAH 4N8VG 4F9PC 2DTMH 1NC4B 1TZHA 4NOBA 2MKWA 3KHQA 4G9DB 2Z8SA 3ARGB 3NA9L 3PABA 5IBTL 1U8PB 2VDNL 5B4MC 4U1NA 4HWBL 1UADC 2NNAB 3MLZL 5D2NC 3RL2A 2XACC 1D6VH 4X6DA 4ETQA 3VXME 4RNRA 4LARL 2X70A 4JKKA 2R23A 4U1KB 4CVWA 2DQIL 3E2HC 4X6CE 2P8PB 3VXQA 4MXVE 1MCNA 1TCRB 2DLGA 1XF3A 5I66A 1FLRH 3HS0A 2CXKA 4X80L 3DUHA 1M7DB 3TN0D 3ROLB 4BSWB 2VABB 4IJ3B 5FYJE 5TJWK 3R8BB 2IJ0C 4JZJB 4ONHB 4F7CA 5IJVA 5DZLA 2WM0A 1UM6L 2AJVL 2HKHL 3TC9A 4KUZL 4LPUA 1AGDB 4N8CL 3QDJD 3CX5K 4M43H 4Y1AB 5EUOA 3EGSA 4XWGL 4TSBL 5JW5A 1UM5L 1K2DA 1XGQB 2MCPH 3HCVA 1TXKA 2ERJC 4YE4L 4PJFB 5E00B 1G84A 3MLXH 5F6IB 3O4OC 1CFSB 4URTB 2B20A 4P5KB 4Z7WE 4MAUH 1P7HL 3CC5A 1UH4A 3HMXH 2CDEB 4WTZA 3NPSC 3IXTB 3T3ME 5E5UB 2DWEB 4S10A 4FQHB 5IFJB 3RVVD 4NQSA 5ID1A 5F9AC 2BJML 1LP9B 3VFSB 4MJ5A 5GS0H 3V52L 2N4IA 4OGYH 4NBXB 1QSFD 4LLYB 4XNQB 3I85A 3BZDA 4U1GB 2R4RH 4M48L 4U1IA 3QDMA 5J9PB 1X5HA 1YJDL 1MAKA 1FL5A 2AP2A 4G7VH 4PGDA 2J7LA 1KN2H 3QEQA 3ZDXE 5KVEH 3DX7A 5CZKA 4Z7VB 2ESVA 5MEPA 2NXZD 4B0MM 2BSSA 2DDQL 1HILB 3V6ZA 5CBEA 3U30C 2OJZL 2W91A 3GZKA 3NABH 3BP5A 3PWPD 2ZUYA 1YY8A 3BZEB 4P2OC 1XF4B 4HH9A 4KVNL 1KEGH 2ICEA 3GSWB 3WXVL 3L7EB 4NC0B 3TVMD 5ENWA 5L0QC 2FZ3B 3HZVB 5FECA 5C7XH 4YGAB 4PRBB 3O9WA 4QHMB 1EJOL 4PRPA 5FGBA 3QR2A 5E8DH 1IQWH 3RAJH 1FL3A 3EYQC 3D25A 3FOMA 4KY1L 5DSCB 4YDVA 3G08A 1O7SA 4HIJA 1A6ZA 4P23B 4POZC 1BIIB 4R26H 5BZWB 5GGTH 2LFGA 1IAIL 4GRWB 1ZV5A 5F6HJ 2IFGA 1MLBA 3V7AG 4Y5VA 3JWNC 1JPTL 1VGKA 3MREB 1XMWA 4OCYL 1PEZA 4WU5B 2X4UB 4NQEB 2CO7B 4Y2DC 2E7CA 3T3PF 5EBWB 5JDSA 4PP2B 3Q1SL 5L2KA 1ADQH 1QBAA 2E6QA 1KJ2L 1OM3L 4GQ9H 5C09E 3RGVC 2FCBA 4S1QH 3S35L 1HYSC 5DJCA 5D72H 4IRJA 4JPKH 4BZ2L 1YY9D 3BZ4A 4H1LH 1Q9WA 5HGGS 1HXMA 1YEEH 4R4FH 4C56E 2Q20A 2CUMA 2PF6A 4ZTOH 1HH6B 3O9WC 5ERWA 3C2AL 4KHXH 5FYKU 1DBML 3TYFB 4PJXE 2JCCB 3QQNA 4ZS7L 4S1DC 2FDBP 3PWNB 2AVGA 1QACA 4OF3A 1P5UA 3UC0H 5I1JH 4QF1B 4RGMB 3L3IB 4YWGH 4QEGA 2I26N 3RZCA 3LSOB 4LVOB 1T22A 1NCWH 2HT4C 3D85A 4M7JL 4LSSH 1OTTC 4FQXD 1UB5B 5IEHB 3GSXA 4WJ5A 2VLKE 4G9FE 2BNQD 3T4YB 3P9WB 3CX5J 3GHBH 2Y06L 4KMQA 3RDTB 4JGJA 3CVIH 3MCG1 2GIYA 3OB0H 2R15A 3I9GL 5MENA 4GMTL 5IESH 4P99A 5M95B 1FNAA 3FFCB 2IPTL 4TPRL 2LTQC 3VG9C 3H3BC 4XBPB 5AYQA 1KIUA 1U9KA 4WW1A 2AJZB 3MFFA 4FQ2L 2I24N 3C5ZC 4P57A 1DQLH 4HEME 3U82B 5D5ME 3B5HA 5EC2A 1T0NB 2GITB 3OV6A 4FQIH 1LILA 1X5YA 5C0DA 5AAMA 3EFDH 4ODWA 4BFGA 1GGIL 5F9OH 4GKSA 1L0YA 2I07A 4ZFZA 5DWUH 4U49A 2YXFA 3SCMA 3DVIA 3HG1E 4OF6A 3QEGL 5BVJB 1M71B 2VWEC 5GJTH 2HFTA 3T04D 3MRKA 2ITDB 3F5WA 5C0GB 4NJ9L 4Z0BL 1FPTH 3CMGA 3R0NA 3SKJH 2OXGA 2UUDK 1YPZA 3DTXB 3VJ6A 1DUZB 4DZ8A 4N8VB 2YN3A 2C4FT 5BW7C 4B53A 5HSFA 3FO2B 4JQIH 5T3ZE 1A3LH 4Y0GA 4HXBH 2O61B 2BERA 3IF1B 1BLNB 4JFQA 4NN7C 2MQCA 4ODXA 3OKNA 3SE3A 3VFWA 4UMGA 5ACZB 3H8NA 2GSIB 1CU4H 4ODTL 3VD9A 1SY6L 1Z0NA 4HUKB 2FO1A 3SKMA 1FAIH 3BESR 3TO4D 3CFIC 4ODSL 3MOAH 4KVCL 5E2JA 2WIIA 5JXAL 4WEBH 1NLDL 3EJZD 3QRGH 5I1KL 4YEFA 5IB1A 5D7IA 2X42A 4LSVL 3BGMA 1OW0A 5DYOA 4DCQB 5C08B 4HUUA 2HT3C 5F9JB 4KROC 5BV7H 2VZSA 3BOVA 3D3VB 2VXTL 4Y4FC 1GZPB 3S36L 4FQ1L 4NQCE 2W07A 1T04A 1ORSA 1CLYL 4U7MA 3VGEA 5HY9A 2B1HL 4HDIB 3B9KD 1CFQA 4W4NA 1GH7A 4RIRB 4I0KA 3LS4H 2VIRA 4H8WL 1BM3H 1MF2L 3FB7B 4G80B 5TDPA 4JLRA 4UU9A 4K9EC 4XAKE 2GI7A 3ILQD 5F88B 1KUMA 1D5ZA 1A6UL 3PQYE 5DI8A 1A4KB 3UTTA 4KKLC 2E8ZA 3IDYB 1W72A 2E7HA 2G75B 2Q76B 1B90A 4NO3B 3NA9H 5IBTH 4HLJA 2VDNH 5EBLB 4BFBD 5INDB 2X4PA 2KDGA 5D2LF 2K9UA 3BMVA 4NCDA 4R9HA 3TCLA 4XX1E 3M45A 4XPGL 3DGGA 2ZJSL 2D7QA 4DGVH 4KRLB 2ADGA 1OW0C 1OVZA 2I9LB 4FFYH 4F7MB 4DKDC 3EYOB 4JO4L 2DIBA 3G5YA 4I3SL 5HHPB 1ZMYA 3C8KA 3FJTA 3UPCA 1SHMA 3G6JF 2WWMC 3K0WA 2AJVH 2HKHH 3IGAB 3O2DA 4UV4L 1WBZB 3SDDB 4KUZH 3MRGB 4F33B 1A2YA 3HE7B 5I75B 4ESKA 4N8CH 4QXTB 3GRWA 2APTA 4NKDA 1UENA 1FVCA 1ZAGA 3P9MA 3OSKA 4JDZA 4XWGH 4TSBH 1UM5H 1UZ6E 1F5WA 3MRFA 4YE4H 2CIIB 1TJGL 2UWEE 4Y19A 4Z78B 4OAWA 1WK0A 4ZTPL 5DMYA 4CW1B 3JUYA 5IFAL 1U92A 5TDOB 1RHFA 1ZLWH 5H94A 4EDXA 5ESQA 5LCVL 3FB8A 4X7TB 1J18A 1I7UB 1FCCA 1DLFL 3QA3B 5KSAA 2GT9A 1UKQA 2BJMH 4N0UA 3AREC 2LVCA 2XZAH 3OXSA 1CDYA 5E4EB 1J9CT 4M48H 4KKBC 4XMPL 5FXCH 3I50L 4Z18A 1XIWA 4ZNCD 2X7LA 1RIUH 6FABH 5HHXH 2VN4A 4AEEA 5C0IA 4XCEA 4OLYL 1UYWL 2MTPA 1AGEA 1KFAL 4F37F 3IDNA 4YAQA 4N0FB 2OTWA 3OR7A 2OJZH 1Q0YL 2WBJD 2NY1D 4MAYA 4JFEB 3MRPB 4WWKC 4MDJB 4PREA 4KVNH 5I2IA 3UJTL 2YXMA 3DOSA 3KWWB 3RTQD 4HWZB 3P9LB 1NKRA 3V4UH 2HH0L 2PW1B 4H1LG 3T0ED 2P8MB 1NEUA 1VFMA 1EZVX 4Y1AE 1EERB 3QO0A 1W0WB 3QB7C 3QDHA 4PJFE 3WMSA 5HGHB 5DFVD 3BDYL 4GH7B 3H9YA 1GGUA 4M7LL 3FTGA 2NY3C 2IQ9L 4QRPE 4G8GB 2OSLA 4YHPB 3ZE2F 4HH8A 4P2QA 1NMAL 1N5AA 3FT4A 5B4MD 2DJSA 5FUCC 1H8NA 1NAMA 1OTSC 3VE0B 2R0ZL 3Q1SH 4WY7L 1AQDA 4JFDA 1ZVYA 1LP9E 1YMMA 1KJ2H 3TPUB 1PDKA 4K55A 3S35H 4E5XB 1U36A 4YBLC 1WC7A 5TQ0H 4GMSH 4OD2A 3IYLW 2JTDA 4Y5YA 5AWNL 2F54A 3DPBA 3L5JA 2HJFB 4BZ2H 3H9SE 2E5EA 3CAFA 5ICYA 2J88L 4IM8A 5I0DA 3NIFF 4L8SB 4GXUN 4Z7VE 5GGUA 1WAAA 3DRTB 3T65B 2EDBA 1BAFL 3DHJA 5DMGC 5D7JA 4N68A 4XBEL 1U8OB 2YEZB 1FNEA 5D93B 4RAVB 2I9TA 4IOIB 5C0FB 4YDLB 4UUJB 2VAJA 1BIHA 3BJLA 3X12B 3SN6N 1UGNA 3ZZ1A 3VRJA 5E2TL 1QO3A 5KANI 4ERSL 5CD3B 1NGZB 4JZOA 4KMLB 4PJCB 2Y06H 4EUPA 3QZWG 4LF3A 3H7LA 2K3TA 3SO5A 3HNTL 3I9GH 3LOWA 3LKOA 2X4SA 3FONB 5EU6A 1KTLB 2PCPA 3ZT7A 2W38A 4GRWE 4HS3A 5C0AB 2IPTH 4TPRH 4UZGA 1A6AB 4MMXC 4JFYB 1J05B 5FOJA 4Y5YC 1IM9A 1KCSL 5C07B 3OR6A 2FECL 2IPKB 3WIIH 4NQEE 2DQTL 1A4JA 2PTTB 4FQ2H 7CGTA 1U3HB 1GRWA 2ARJQ 2VDOL 2NPLX 1RZIB 4NUJB 1WFTA 3MRBA 4P46B 4AK1A 5I76A 3I6GA 1CQKA 2E3VA 1JHTB 2BNQE 2HLAB 3MR9A 4HV8A 5DJ0B 1GGIH 3VGAB 5HXMA 2GUOB 4NKMA 5CGMA 4OLZH 3D39D 4P2OD 1G7PA 2F8VA 5C9JA 2QV2A 1X4XA 5HHQA 3H6JA 1G7IA 2EDRA 4Z0BH 3RPKA 5IMOA 4P3DB 1S7QB 3QHFL 4WHTA 2JCCE 3O6FB 1GJIA 2KZWA 3EYQD 1F3RB 4F37K 3EYUL 2AABH 3I84A 4WW2B 4HUXB 1ZK9A 3W39A 3SQOH 2F53B 5KS9B 4NPYA 2YPKA 2DKSA 2Y4SA 3D0VA 4X5LA 1N8ZB 4XC3L 3I75A 4LRNH 1I1AB 1B0RA 4GXUM 4M5YH 4DVRL 2CMRL 5IK3A 4DWHA 4ODTH 3QEQD 4Y2DD 1BVZA 1SY6H 1FC2D 2XTLA 4TOYL 3REVA 1I1FA 4ODSH 4KVCH 3HR5B 4HC1A 3RGVD 5JXAH 3L3GA 3RFZC 5AYUH 3WL9B 1HYSD 2AJUH 4WNQA 5IW3A 3UX9B 5I1KH 5EC1B 3VWJB 1VADB 1UC6A 2QLVB 1W2KT 1GOGA 3MPCA 2GJJA 3O2WH 4LSVH 3SE8L 2EDJA 3RWHB 1FZMB 1F00I 3I3BA 1U0QA 3QUZB 1UJ3B 3O9WD 2AK4B 4UILL 2ZZUT 4PRPD 1F4XL 1IAOA 2VXTH 2WUBL 3STLB 3S36H 4FQ1H 3PG2A 5J11C 5IVNA 1CLYH 4S1DD 2B1HH 5HHMB 5KZCB 2B5IC 1F3DJ 4QOKD 4X0KA 3K4ZA 3VGBA 4H8WH 2B4CC 1JN6B 2HT4D 1JNNL 1YA5A 3VXRB 5ISZD 1FZKB 1OTTD 3W81A 1A1OA 3VRIA 3WIFA 5JW4N 1I3GH 3S34L 1QFPA 3CSGA 4LCYB 5E9DE 3ELAT 1F4WH 4I77L 4NWUL 3VI3F 2EYRA 4GUPA 3U48A 4JO3L 1MAML 1WZMA 2A6IA 2AQ1A 4L4VA 5EO0A 5JXEA 2V17H 4MJ4A 3HE6B 3ULSB 4HX1A 4IRJD 3DNKA 1NDGA 2YRLA 1BZ7A 4XPGH 3SHSA 1MREL 3GI8L 3ZE1E 2ZJSH 4JANB 1A7NL 4Z7QE 5GSRB 2OR7A 5A43C 5E08L 4I3SH 1OGAA 2XY2A 4K7FB 1C08B 1KCVH 5D7LD 5E1AA 3ARBC 4QO1A 2CDGA 3TM6A 2BOCB 1EH9A 5CSBA 5DEFB 3VWKA 1IKNC 5C08E 1BBDH 4QRRB 1QBML 4HFUL 5T1LB 5KSVA 4CL7A 3D3VE 5A16B 1AIFA 5LQBL 1YN7B 4ZTPH 3ZKMC 4ODUA 4UDTB 5LCVH 1C1EL 1EEYB 3ZKXC 3ARRA 5HI5C 3KXFB 3CXDL 3WXWL 4X7EC 1AC0A 2VE6B 1OWWA 1WIUA 1U8HA 3F7YA 4FHBD 4U3XA 5CP7B 3MZGB 1F3JA 4LHUA 4M7KL 1L0QA 3PGFL 3P30H 4YXKH 4U1JA 5DMIH 3KGRA 4FP8L 3I50H 4R96A 1KIQB 4LLVA 4XMKL 3ROOB 3L3HB 4OLYH 5ALBL 4F7PB 2Q7YA 1UYWH 4Y16C 5I1LA 1G6RH 2Q8BL 4J3WA 4Y4KB 2Q8AL 2DLIA 3KYKL 3N1MC 5JW4M 4R90L 1Q0YH 1CZ8L