4HQQL

Crystal structure of rv144-elicited antibody ch58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CH58 Fab heavy chain
total genus 44
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL01
2DQFB 2V17L 3IF1A 2AK1L 1AGFB 2VWEE 3ZLQC 5L0QC 4GXUN 4XNMB 4M7ZB 5FGCB 2Q7YB 5KSBA 2DAVA 1KIRA 2ICEB 3G5VB 3C60B 3VFOA 4KI5E 2QJDA 1NC4B 2VR4A 3HG1D 4XRCB 1WEJH 1WFOA 5MI0B 4G9DB 3WD5L 4JY6B 3PQYD 2EE2A 4KH2A 1KB9K 4R0LC 2NTFA 2H26A 4P3DA 4TVPD 3FB5B 2BSSA 3UJJL 3I2CL 1FYTB 2P8MA 2EDJA 1LEIB 4XB7A 2NR6C 2NY3D 1X7QA 2J5LC 5E8DL 4EDXB 3ZT6A 3G6DL 4RFNC 1U6AH 1MFCH 2XZQL 1ETZB 1PKQA 1SEBB 4I0PA 1N5YH 1KELL 1I9JL 3AC0A 4ODWA 5EBGA 3ARGC 1J5OL 4ZAKB 1CFBA 3RAJL 3ECBA 1WBXB 5CJOH 3ARXA 1VKXB 2ZCHH 4LLAA 3PP4H 3RY5A 5C0BB 2D0FA 3TZVA 4XWGL 4N90D 3BO8B 2ENSA 3RZWA 4OJFL 5FGSA 1Q38A 1XF4B 4JFOA 7CGTA 3NZHL 2P8MB 2MJWA 3U2SB 3BWAB 2GSIB 3W9EB 1VFAA 4M7KL 5D8JL 3FQNB 4KK8C 3D3VA 3BP6A 3DUUA 4X7FC 4Q9CA 2F19H 4M6AA 3ARRA 3FQUA 4J3UA 3BIKB 4PTTA 2YD2A 4HC1L 2QKIB 1EVUA 2Q7YA 5KSBB 4M48L 3SE9L 4NZTH 3BP7A 1UADC 4MCYA 1IARB 3KPSA 5KJRL 5I71B 2AJ3B 1K4DA 4C4KT 4ZSOB 2CDFA 3T0ED 3UC0L 1FAIH 5DT1L 3RPIA 4CMMB 1R5VA 4NP4H 1SY6L 1BQHA 2C4FU 4L4TA 4NSKB 5TDNA 3P77A 3EW3B 3EYUH 4LKCA 1J05B 1J87A 1E4WH 2O5XH 1J18A 3ULSA 4YX2L 2WIMA 3S37H 4PJCF 4OLWH 3VGFA 1XCQA 3M8OH 3BQUA 3L7FB 3WNOA 2BC4B 3P0GB 2JIXA 4PFEA 3S4SB 4AIOA 3JV5A 1U3YA 3C08L 4DFIA 3QUKA 4RA3A 3RWHB 3OKEA 3QDGE 1D5XA 1JUFA 4EVNB 1J0ZA 2AAVA 4JANA 1VERA 1IM9B 4APQB 4P57B 2N7BA 4HPYH 4LLQA 4JO4H 2ZUTA 2NW3B 4U1IA 4R3SB 4X7EC 2MNUA 3GSOB 5EC2B 2GTWA 4YX2H 2EE9A 2FD6H 4PJHB 4IRJD 4EN3C 1NL0L 4NNPH 3MBEB 4MXWL 4XMKH 4UQ2B 3QQ3B 2E9JA 3QP3A 1I8LC 1QFHA 1WF5A 1NCCL 3EBAA 3DIFB 4OGAD 1I1AA 1JF1B 3GJFH 5JOFB 2N1KA 2WP3O 1VFBB 3AM8A 4BELD 1N5YL 4P2OA 5E2VL 4YNYB 3E6HB 2V17H 2Q8BL 1YYMH 5B39G 1NSNH 5T1DH 1MHPL 4YFDB 3UO1L 2QQQA 3REVB 2R0LL 2VLRD 3GSWA 2DQCH 4RIRA 5J6GA 3WHE1 1MI5E 3C6LB 2X4TA 1N59A 1W72L 1ZT1B 2VXQL 2B4CC 2B8OT 1VACB 4FFZH 3SGJC 1OF2A 1WWCA 2JB5H 1MUJA 4OQTH 4K2UH 5HYIA 3CX5J 5K9JH 4I13B 3V7AG 1QBBA 1MCQA 3CFKA 1S7VA 3B6SB 1YNKL 3SCMC 3BDYH 4UIKH 5BJTB 3AFLA 4JFOB 4YDIH 5C2UB 2J7LA 5D5MB 2FECL 4XNZC 3SO5A 1NC4D 3VRLF 4MWFB 4HWNA 5EOCJ 3W82A 4OZFA 3B5TA 1XR8A 3SDDD 4DK6A 4XVJL 4Z76A 1MCKA 3E3QE 12E8L 1NGPH 3HC4H 1BFOB 2EIZA 3MFFA 1PJ9A 4DKAA 1T1ZB 2GK0B 4RZCA 2P1YA 3QFJB 1QLRA 2DJ4A 2OBGA 1OSZB 4BZYA 4LLMA 4PJHE 5MP6L 1GHFH 1JPST 1YY8B 1DQML 2CKBB 3VXMB 1ZTXH 4UUJB 5BV7L 2IPKA 2IALB 4F3FB 1VESA 4P4RA 3PP3H 2ZUUA 5F7HA 3LV3B 3BRGC 4N8VA 4F9LC 3EFDH 4CAGA 4M43L 5HYSA 1OD7A 1CFTB 2NTFB 2XRAL 1SBSH 5DJYB 5C8JA 4JHBA 5IQ7H 4KKCD 3U1SH 3JSSA 3LPFA 4YO0A 3OAYH 5HDQH 2B1HH 3OAYK 4IJ3B 4YUEL 2EDHA 4ELKB 1AJ7H 3BVNA 1DEDA 2ZNWA 1ACYH 4WU7A 4JFFD 4R96A 1HH9B 1IGIL 4GG6F 2R9HC 1C08B 1QBLH 2FJHB 1AQDB 2VTFA 4JPKH 4J4PC 3KPNB 3QHZH 3O4LD 4OCWL 2MHAA 3SKUD 4GRLC 4ISVA 2VIRB 4EZMA 1VADA 2P5EB 4LHUG 4DN4H 1MJUH 5HHPB 1R5WB 3UTTE 1HXYA 1YEHH 4YHIA 3ZDYE 4M9OA 3L5WA 1DFBH 3GI9H 5GGRY 2FGWH 3PG2A 1C12B 1UCTA 3VXRE 1IEHA 3MTRA 5K9KA 2K9UA 4RAUB 5F1NB 3S5LB 3VFVB 3P9MB 1OM3L 3ZKMC 4WUUD 3ULSB 4PLOB 1CICD 1YEEL 1PZ5A 1P5VA 1EK3A 2DQIL 2H9GA 5GHWL 1ZHLA 1TJHH 4L3EA 3RDTA 4PGEB 3MMEB 2BRRH 1FCCA 3L7EB 5E08H 2R2CA 1FFOB 3GSQA 1MCJA 1RZKH 1JWMB 4MCYB 3WNMA 2WWKO 5EZLB 1ACZA 3H7BA 4KKLC 3ZKQD 4M62H 5L7XH 3QIWD 5F9OH 5T33H 3NABH 2FJFB 3IU3A 5CEXA 4UDTB 3VGEA 4YHZL 3D0VA 4JHAH 2X4NA 4HCRA 5DD0H 4ZO9A 2EZ0D 4HKZB 4ZFOL 5KZCD 3UJIL 3BKJL 1QP1A 1NMAH 5C08B 1IAOA 1PKQE 2IH3A 2YPKB 3MUHL 5TQ2L 4F33B 3BH8A 3CDYA 3SE8L 2F54E 3GMOA 4JKLA 4BSWB 3L3IA 4WO4B 4JFDA 1L0XA 4R2GB 5D7IF 1A7PL 4IRJB 5E0QA 3UEZA 4OZIF 1G7LB 3M1BA 2I5YL 4U6YA 1UB6A 2PXYA 4Z7VF 1FJ1A 4FZEL 2NYYD 4YE4H 4HEME 1GGTA 4UILL 3VJ6A 5JIKA 3HR5B 4OT1L 1A7RL 1AR1C 5DGRA 1YJDL 2FJGB 2NY4D 4YEFA 2OYPA 4JHAL 3TBSB 5KAQF 5TH2B 1RUMH 2JB5L 4OQTL 2GQHA 5ADPL 2NY5C 3MV7E 1RFDH 4TQEL 4F8TA 3C2AL 2HLAA 4IDJH 2AJSL 1IGIH 1MFNA 2OXGA 3ZKND 2YBRB 2VQTA 5DUMH 3V9FA 4K7PY 2FX8L 1JYXA 3BSZL 1IFHH 2IANE 2FDBP 4F80A 4DGVL 3GEWB 1YNTA 3O8XB 4QY8A 4EI6B 3UTZA 3CZFA 4X0KA 1MJJA 3TBTB 5KSBF 4NGHL 5HHMD 1I3RB 1ZANH 4XPGH 3RX7A 1RIUL 5H94B 12E8H 4G6KL 1NL0H 2R1YB 4J4PD 2FGWL 4LU5H 3KPOA 3C60D 4HLJA 1ZGLP 1EHNA 3GNML 4KMQA 5C2BL 4UV7H 3ARUA 1N6UA 3ESVF 5MERB 5ALBH 5E00B 2WZPD 2CMRH 3KJ4B 4U33A 4Y19D 4TVSa 3TA3D 3RTQA 1DBKL 3IGAB 3G5YB 3BZFA 1NFDB 3LB6C 3VFSA 4Y19A 1GGIL 1UJ3B 4F57L 3ARBA 1FZOB 4NN6B 4NQUA 1FAIL 3BGMB 5EC1A 1KSRA 2ICWB 4GKZA 3DPBA 4HWBA 2JE8A 5ESVA 3A67L 2Q6WA 3QNXB 4OCWH 1R24B 2C3XA 4PR5B 3ARGB 3U7YL 2OX5A 5C8JB 5CEYA 2J88L 5GGQL 5HBBA 2XT1B 4YR6B 5FK9A 1YYLL 4WDIA 4XCNB 1ORQA 2EO1A 1AGCA 2DBJA 2EYTA 3WLWD 4JZJA 4HCRL 4OF0A 1ACYL 5IJVB 1YNKH 2H32A 3DMMA 1CVRA 2XZQH 2XWJA 1AFVL 4CADB 4LLMB 4CN4A 4ZOBA 3AREC 1T6WA 3MNVB 4QRRB 1HKLL 1CXEA 4PV9A 4KHXL 5I8CB 4H20L 1CK0L 4WFGD 1N0XL 4KGJA 2YD7A 4P99A 2BFVH 1KPVB 2BHUA 5JXAL 3O11B 1AKJA 4HMDA 2PUQT 1BF2A 1HKFA 4XRCA 4KTEL 3M45A 4Z5RA 4W6WB 1DFBL 1BWMA 4CU7A 4NQEE 1DZBA 1DQDH 3WYRA 1H3XA 1T03H 4DKFH 5DO2C 2WBJC 1BQHG 2VDPL 3SKJH 2EC9U 4MD4A 1QSFA 2C9AA 5IVOA 3MLVH 3VFRB 1IKNA 5L2JA 4N0FA 3IT8D 2A74A 3D85D 3O6FD 5FO8A 4OF3A 2PO6A 1P7HL 1RZIB 3QI9B 1JYNA 3VG0L 2VUOA 3ULVD 4CL7A 1TJIL 4DUVA 5I1GH 3P4NA 4O02H 3P4NB 4JHWH 4CJ0A 1CLZL 3QIUC 1XGYL 3FN0H 5CEZE 1KYOK 4R9HA 4DWHA 1K5NA 4XCFL 3UYRH 4I18C 3P0VH 1OAYL 1PLGH 4I77H 5CJ8A 1DDHB 2B1HL 3HCVA 5C0CD 3LN5A 5K9JL 3O0RL 1KCSH 1EGJA 5AG8A 5DK0B 1U8NB 4ZODA 5FYLE 1EERB 5CP3A 4LSDA 4RGOH 2VMFA 5BZWA 3O9WC 4XC1H 3TNMB 4LLWB 4X99B 5DD0L 1NEZA 3GNMH 4O9HL 4PRNB 4PJ7B 3MLTB 4N68A 2NY7H 1M7XA 5KSAA 1IC4H 3ARDC 3QXAB 3X11A 5E8OA 2GCYA 4MJ6B 4WO4D 4KROB 5D72L 3DRQA 3MLWH 1MWAA 3O3AB 3FRUB 4ZNCD 4F7PA 4NRZB 3T2QA 3C5ZC 3QO0B 2R0KL 3UXFA 1MAKA 4XHQA 1NGPL 2UY6A 3HC4L 2APTA 1YJDH 1A3RL 3BIBX 3OV6A 3UPRA 4JFFE 1OAKH 1G6VK 3BUYB 1WC7B 2K3TA 4E5XA 5ISZB 3DSNA 2DIBA 3HTLX 1A6ZB 4LIQL 4B7IA 2Q6WB 1WIOA 3OJMB 4IJ3C 1E27A 4ORZC 4OZGF 2AV7B 1KCUH 1UG9A 4PYGA 4OKVB 4A6YH 4R4BB 5C0AD 4X6FB 2Y4SA 5MENB 1CR9L 1OSZA 3MRPA 5BRZB 4LIQE 3OJDA 3CU7A 3P9LA 1RK0A 1BBJA 3QB7C 1A9BB 2XXCB 2AXJA 3JUYA 3QUXD 3BHBA 3M8OL 4OLXL 3U9PL 2GSGA 5BVPH 3VFTA 3CVHH 3VXRD 5IG7A 1QR1B 4RSVA 5FO7A 5HGBB 5T33L 3KGRA 4MNQE 4KTEH 1ZLSL 3TCLA 3Q3GA 4J2XA 4JRYD 4Q0XH 5EN2A 3KYMB 2HRLA 4QXGL 1EVTC 4KK8D 2VQUA 3U4BL 2DQGH 4EBQL 1JZ2A 2A73A 1DANU 1KYOJ 3SHSA 5CWSA 4XMLH 4UUJA 4HCRH 4KAQH 3UBXB 3FT3B 1U8OB 2VLJA 1C5BH 25C8L 4CMHC 2UWEE 1IAIL 2X4TB 3CVIH 1DQMH 3TN0C 4CKVX 3GSWB 5E2TL 1A6PA 1BF8A 4Z6AT 1KCSL 5JXAH 5KTEL 3RNQA 1UXSB 1IEBB 3QIUD 1DEEB 1FFNA 3P4OB 2R1WA 1OGTB 3G5ZB 5E6IB 4XTRC 1XF2A 5KSVB 2AS5M 1KTLB 4DZBA 1DBMH 4XAKD 4UQ2A 2KKQA 2VDPH 5L0QB 4NQVA 5H2BB 4YHKH 2QTEA 3L3GA 5T1LB 3V4VL 3VFPA 1OCWH 4JFFB 4R8WH 1GRWA 5I2IB 2MCPL 2ZZUT 2B5IC 5FA4A 4PJEE 1J5OH 4L5FL 2X2YA 1RD6A 4PGZA 4AH2B 4XP9H 2DKMA 2OR8A 4R7DB 1G1CA 5TE7H 1DQDL 3O4LB 4UT9H 4UQ3A 3SDYH 2A1WL 3C6LA 1QO3B 2HWZH 4U0RB 1VFMA 3NCEB 4XCEB 1TXKA 4XBEH 3P11L 4FXKA 2BVPB 3CLEH 2R4SL 3B9KC 4KKCC 4HKJB 1I1RA 4JRXD 4AEIL 4MMZC 4C4KO 1NFKA 4A2MA 3VFUB 3PWPA 3RGVC 1P4LA 1PZ5B 3QZWB 5JMOC 2MKWA 1LO5A 5DVMA 1FH5H 3NA9H 1UYWL 5JO5B 5D1ZC 3SO3C 3AUVA 3PHQA 2PYED 3I3EA 2A6IB 4XC3L 5IHUH 3KPRB 5IESL 1YYLH 2FATH 1I8IA 4FFYL 3EOBA 5IOPA 3HE7C 4Z0XA 3MYZA 4IOIA 3MFGB 5FYKH 1DL7H 1T89A 2APVA 1OW0A 1YY9C 4JREB 5DK3A 4D0BB 1QSZA 3OB0K 4JFYA 4OGYL 5IW6A 3V0WH 2A0LC 4XP1L 2WUBL 1H3TA 4L8SA 3U30C 4NFCA 3TJHC 3JTSA 1TVHB 5C0GA 1FL6A 5KAQG 4RBPH 2PW1A 5ANMB 2GY7B 2Z91A 2P5EE 1CXLA 1JGDA 2GI7A 4I1NB 1EGJH 3MV9B 4HH9A 1P7KA 3T3PF 5HXMA 4JRXB 5KN5B 1RZJL 4Z7VE 5GIRA 2GJZB 2OCFD 3JTTB 3VDBA 1HSAB 4UDTA 4Y16B 2DLHA 4U0RC 3MO1A 5FYKL 5I30H 1MVUB 4UV7L 4X6FA 1EEQA 4HWEH 5I73B 5HHOA 1N3NA 3E2HB 4ODVL 1F3JA 2JJWA 3GK8H 4PBXA 4MJ5A 1MHEB 2YPVL 4NKIH 4HIJA 1E6JL 3S98A 2FH6A 3EZ8A 2DMCA 4UBDD 1UA6H 1H0DB 3ARGD 1B4JH 1I3VA 1WIPA 3ZKNC 2JJTA 3EOAB 3SO3B 4Q9RL 1QA9A 4NNPL 1RIHL 2HVKA 2IPKB 2Y07H 4PJAE 4PJXA 5J6HA 1OSPL 2B1AL 2FL5B 2UVEA 4BJLA 2VO5A 1BD2B 3R1GL 3AROA 2R0ZH 3VXRB 4P5MB 2A6KB 1L7TL 3U9PH 5BVPL 1Y18A 4IDJL 4ZFFB 2RFXB 3EO0B 4J8RA 5E2VH 1Q8MA 3QHTC 3PGCA 3STZA 2FRGP 5FYJH 2ESVD 2XPGA 1EFQA 4M6NH 1Q9KB 4WO4C 4XP9L 4YHIB 3UROR 1I7RB 4K8RL 1HHIA 4TRPL 2IH1A 1AKJD 1KUMA 1KIRB 2ICEA 3TVMC 5K59E 4XCYA 4NBZB 2R39A 3VCLB 2X4PA 4L8BA 3L3OB 2XWBB 1HQ4A 2FSEB 4YHZH 2DJUA 4AG4L 3IGAA 1RZ8A 2R0ZL 1MCOL 5HJ3B 4LCCB 3OJDB 3DGCR 4KAQL 1T1XB 2VLRB 1ED3A 2J8UF 3RUGE 2I9TB 4YDIL 2JJSA 4HGWA 1CGYA 1MAMH 5D1QC 4QTHB 3V0VA 4CMHB 3SDAC 2VLLB 3UTPD 2XY2A 5C0FB 3LZFL 3TO4A 1FZKB 2XTJD 4QRTA 3V7AE 4Z77A 2W91A 1YEJL 3NACH 3SDXF 4ZYKA 3IDMB 5FYJU 4LEOB 1I85C 4M61A 2DM3A 1TTFA 1T1YA 1NGXA 1X4ZA 3TN0A 3SDXA 2MQ3A 5DA0B 3SE3A 3GJFA 5IM7A 2YBRA 4MDJA 5E56A 3RU8L 4ZD3H 3OJ2C 1KLGA 5E5UB 4RQQB 2DLFH 4NYLB 1T21A 3QDHA 3VGAB 1HYRC 1KC5L 3NN8A 4F7EB 1RUPH 4PJBB 3TIDB 2AQ3A 2IQ9H 1TFHA 3EJYD 1RZKC 3DMMB 5D7LA 1D5IL 2X5PA 3ROOA 3HMWH 4G8IA 1J1PH 5GJSH 4DN3L 3B2VH 4APQA 3I6LD 3LPGA 3CZJA 5J3HC 3EYSH 1L9MA 1P6FA 1X5JA 4R26L 4LSVH 3WNPA 4E41D 5F21B 5AWNH 4GBXA 4R4ND 1KN4H 4IM8A 3OKNB 3OKKA 4HULB 5MEQB 3JUZA 3RWDA 4DKFL 1P2CA 3QIBD 3QR2A 4ZFFA 3I75A 4L4TE 4OGYH 1U6AL 4F7MA 5GS3A 5I1LB 5EU6D 1AC0A 5GS0L 5A16B 5EU3A 3MCLH 4POUB 4Y16C 2P43B 3AMKA 1OWRM 1QVOB 4HPOH 1L7TH 1LO5B 2CKNA 4MX7A 5I17B 1CQKA 4UNTA 3ZE0E 5HYQA 1JNJA 2VE6B 4LCIH 3BWUC 2AKRB 5TE6H 3RZCD 2FO4A 1HHKB 2X05A 4ZDHA 5IVZB 4PJGB 2W07A 3OXSA 3MOAL 2BY3A 5F6IB 2NX5D 4LPCA 4O00A 2XKNB 5T1KD 5F7WC 1ZT4B 3U0WL 1FIGH 1I1AB 3WO4C 2BK8A 3BIKA 1IILE 1JZ8A 3FO1A 2F74B 1HZHH 3L3IB 4QY8B 1A64A 1G9MH 2HT4C 5F1OB 4BUGA 5IMLA 1NGYB 3C5SA 3FAWA 2X44D 1KJ2B 2WIIB 3VXSA 4GG6B 3K2UL 1FAKT 2AXHA 3L5WB 2BNUB 43CAA 4FTVB 2BNRA 4FMKA 5I74B 5HVWA 4JANB 4Y4KD 1F4YH 4JKWA 1MCPL 1TVDA 3LQAL 2XFXA 4G6MH 3QUMB 5IFAL 3QNXA 3GSNH 2AI0L 2ITCA 1HHHA 2Q3AA 1FLTX 1R0AL 2F53E 4YHYB 1E4WL 3QUMA 25C8H 1I7UA 2Y07L 1N6VA 4PB9H 3RA7H 5D7IA 5ESQB 2QADB 1F4WL 4XC3H 5IHUL 4B50A 5LWYH 5IBLC 5IESH 4DAGH 3GMRB 5DDHB 1EAPA 1CXHA 5IT2H 1JF5A 3KXFA 3HE6C 1LD9B 3L3JB 4H8WC 5HDBF 3F5WB 3UTPE 3V6FB 5FUCE 2BSSB 5B4MC 3ZE2F 4G7YH 1SYVA 3F7PC 1U8LB 4LIQH 2MSPA 4ZPTA 4JKMA 2HFGL 5C0JB 3FOMA 1W2KT 3L5XL 5HHQB 3AU1B 4EUPH 3NZHH 5DJCA 4KJYB 1YEJH 2PR4H 1S9YA 4HWUA 5DHVH 3H9SA 4ORGB 1LDPL 5ILTH 1G9EA 3MMEA 2H6PA 3W9DA 4PLKD 2FJHA 2QSVA 4QRQA 1OAQH 2HTKD 4PTUB 4NZTL 1DQJB 5EU3B 3QQ9C 3VI4E 4EN3A 3BN9D 2DTML 3G6JE 4OZFB 4PB0H 1C8PA 3LRGA 1MJ7H 4RGMC 4X6DE 1UXSA 3N1MC 5KSUB 1E27B 4MSWB 4NNXA 1DLHB 4DVBA 3QEGH 3VDCA 4OCMC 4XPHL 3K2MC 3PNWA 5IIEA 4I18B 2VXUH 4OCXH 3WFHA 2AEQH 3EGSA 1F42A 4QRRE 1JI1A 2EDKA 1L4IA 1A6TB 4WTXA 1MIEH 4JY4B 3OB8A 15C8H 3RY6A 4TUKL 5HHOE 2K7QA 3CVIL 4G6JH 3IFOB 1XGQA 3DMMD 4LGRB 5BOPA 5AZEL 3PGFH 3UTTB 3DMMC 4JY6A 3SDDC 3EOTH 5D7KD 4KGLA 2VAAA 1GAFH 3T0BA 1WITA 4FQIH 3JV4A 3LPWA 4OF7A 5IK3B 1WAAA 5IK3A 4HK3J 4HK3N 4GLRH 1NGXB 1RULH 4QXGH 4MLSA 4LEXH 3WIFB 2D31A 1BVLB 1CGSH 4KTDL 1MELA 3QIUA 1GHFL 2HG5A 1KB5B 3SJVA 2P8PA 4PJ8B 3MCLL 1Q9LB 3MROA 3RZCA 2HP4A 3RHWF 3TZVD 3BPLB 2BMKA 1Z3GL 2Q8BH 2LE9A 5GGSA 4R3SA 5BZDB 2VLLA 1OP5H 1RVFH 4G43A 2HTKC 3AS1A 4N9GB 1ZHBB 4FQQA 1YECL 4ZUVB 5DMYA 5IV2B 1AR1D 3LD8B 3Q1SL 1U8HB 3O81A 5F9WC 2JTDA 4ZPVA 5ITFB 1A02N 4UTBH 2P42B 5ID1A 1FZMA 4ZQKB 2YC1A 4IMLB 4NKMA 2BY0A 3PHQB 1BFSA 5EU4A 5HI5C 5CEZH 2NY1B 3O9WD 3LQAH 4YWGL 2X1OA 5D1ZA 4YGVB 3PE9A 4FQJH 4WWKC 4OB5H 4EN3D 1H3VA 3MZGB 1HHJA 1I7TA 1H8OA 4MA7L 3S3PA 1JHLL 2QQNL 1OP5K 2OTWB 2PTTA 4XCEA 2YUZA 4O5LL 4BKLA 4RISH 5BZDA 3GSNA 4NQDD 3RUGA 1X5GA 1RZJH 1G0YR 2RQ8A 3O3DB 4KK9C 3UTSA 1CG9A 1YPZA 1MSPA 4TOYL 5E2WL 2FX9H 4R6UA 3VXMD 4LQFL 4H25A 2Y9RT 1Q94A 2VSDA 4FTVD 3MCKA 4P23C 2GJJA 3WL9B 2HWZL 3BPNB 5SWZB 1DLHA 3MRCA 1KG0B 3VFNA 1U8IB 3QPQC 2E6QA 5GSRB 1CWVA 4NNYA 2AV1A 4JFXB 3X3FL 3VWJB 2JIXB 2ZCLL 5I1CL 1ES0A 4CU8A 4BUHA 1DANT 4JQXA 1AH1A 4PRBA 4HZLA 5FECB 5GIRB 3S96A 4V1DE 1BZ7A 2KQMA 4LSUL 3DTXB 3ZKXC 1PG7L 4YXLH 3T65B 5E2UL 2VC2L 5MERA 2ADJA 2OJZL 4F2MB 2WMPA 3K8KA 3U0TB 2Y6SC 4XX1E 3QJFA 3SGKC 1OB1A 4OGAC 3QDMB 4TNWF 3R06B 1E4JA 1BVKA 5LGKA 2H3NA 3HI6H 1RK1A 1RZGB 4NRYA 4PLJC 5M95B 4ODSH 1D5IH 2YSSB 1G9NC 1CGWA 5I8KL 1CD1B 4WI9A 2CRIA 4WUUE 4WUUA 2H26B 4P3DB 2XTLA 4Y4HA 5I71C 4M4RA 2ICES 3MA7A 3TPKA 1AGCB 4DGIL 4JN2A 5BRZD 1P4BH 2GFBB 2CKBL 1BQHB 2F8VA 5DQJA 2HRPL 4Z7NE 4AT6B 4ORGA 4K9EC 4HV8B 5D6DA 5DMGC 1UXWB 2AKRA 1PY9A 3DVFA 3SDCC 3GO1L 5ACLA 1QFWL 3QEQE 2PXYB 1EX0A 2R69H 4X7TB 1AO7A 5J06A 1YEDA 4OB5L 1MFEL 1XFPA 3CH1B 3QUYD 1HNGA 2PCPA 1R5IA 3EJYC 1FVCB 3OPZH 4KVNH 4JFDD 4Y0GA 1MFBH 4GKSA 1A6ZA 1XF4A 2GTZB 3G9AB 1I75A 4QT5A 4PJCB 1N7MH 3D18B 4OQ1A 2BNRD 2X4RA 2XKNA 1CG9B 2ZNXA 4LEXL 3RJQB 3MRKB 1D5XB 4OFKA 5IGXH 3CIQA 3VD5A 4NQTA 2DLFL 1YNTB 2P46B 4GS7C 1F6LL 2VISB 4IRZL 3FB8B 3MOQA 4NJAH 2BC4A 2CDGB 5IB5A 4PGEA 2GCYB 4KQ3L 5JO5A 4JDTH 3IFPA 1CE1L 2YRPA 2Y06H 5CEZL 1ND0A 4ELMA 4Y4HC 2D0GA 4N0UE 3CFIC 1HOCB 5BQ7A 1MOEA 1INEH 5ITBH 3O8XC 1FV1A 1Y6MR 2ILLA 4MXQC 5FO9A 2RR3A 5BVJB 3SGJA 3E8UL 1FZJA 4X98A 4YH6A 4D3CH 3MRIB 1F4XL 2A73B 4MA7H 5JQHC 4K8RD 3IRZA 2V2WA 4P46A 5FGRA 5IVXF 3BEWB 1N26A 2DS4A 3MODH 5D6CA 4C56A 1G0XA 3BXNB 4PG2C 1UENA 2YPLA 4IHOA 1NLBH 1G7PB 4KK6D 1TZHA 3IU4L 3QIWC 1U3HA 4TNVK 1IGFL 2YZ1A 3GM8A 4WWKB 4XNMA 5AG9A 3ZDXE 2B39A 4OZIA 5DYOB 4U1MB 5L2KB 1MLCB 1OTUD 5GGVY 4TVPL 5EOTA 1BEYH 2VLJE 1F2QA 1ZANL 5ICYB 5I1CH 1DCLA 1MLCA 5HDQL 3VGDA 1ZWIB 2YWYA 3QFDA 4N5UA 5ISZD 2R1WB 2BVTA 2WWKT 3GMPA 3ZKMD 4RCAA 2YK1L 3IRPX 3MLVL 3NTCH 3VRLE 3AS0A 1BLNB 1KLUA 3F7VA 5DC4B 1OTTC 4JFZL 5J9PB 3BZEB 1WBZB 5DQJB 1A4JA 3KS0H 4KKNA 32C2A 3BRFA 2G9HB 1FFPA 4R4NC 3QUYA 4K7PL 1ZLWH 4YDKL 1HIMH 4U4BA 4P4RB 3ABZA 4RDQF 3WKMH 4XNQB 3DI3B 3MC0A 1F90L 4P2RD 2FCBA 1U0QA 4I48A 2F15A 1P7QA 2DQTL 2ARWA 4O2FB 5CBAB 4PY7A 1A6TA 2OTWA 2PTTB 3IFLH 3SKNA 1NGZA 4WDIB 4DAGL 4GW1B 1S9WA 4XP4L 2G60H 4J3TA 5HYJB 5C0EB 1FL5A 4TVPE 4XPFH 3QXAA 4MJ5B 4PY8I 1JV5B 2XQYK 3EDEA 4LFHD 2VDQL 5BMFH 5GZOC 1DSFL 1F6FB 3MRJA 5BZWB 2XA8H 2QQKH 3ARBB 5F6HI 5EZIL 3W0WD 5EU7E 4MWFA 1HCVA 2KPNA 2C1PB 4PV8A 3WJJC 4S0TD 4F15B 3CMGA 3UCRA 3O2VL 1E4XH 4Y89A 4OZGE 2GW5A 3G6AB 3PGCB 4Z7NF 1A9EA 1I1CA 3DBXA 4WY7H 4M62L 1DQTA 3QH3B 4JKKA 4KDVA 4CUCA 1XGUB 3EKCA 5MENA 4X6EB 4Y2OA 4OZGA 4YO0B 1ZK9A 3T0DA 3BRDA 2WLZA 3C5JA 4Y5YC 4OLUH 2BCKB 2JKXA 1BREA 3WL9A 1KIUA 1K2DB 1MNUL 4GW4A 5FOJA 3LEXA 4HIIA 2QLVB 4F3FA 5LXGL 4RFOH 3RGVA 5TPWL 4NZDA 5J1AA 5CAYB 1U8JB 1CT8B 4NQXB 5C09E 4M7LT 4MQ7B 2VDRH 5JW3L 1YN6A 1XR9B 1SJHA 5AEAA 3UX9B 1B3JA 5F3HB 3DXAB 3IJHB 1H3PH 1YMMB 4KVCL 4TUKH 3UZVB 4H8WL 4KDTC 1IM3B 4Q0XL 5DQDL 4RGOL 5TH2A 2Y06L 4PRIE 1NKOA 4OGZA 2W0FA 4G7YL 3MRQB 4F37F 1JN6B 2WAHA 4OZ4B 4Y7MA 4FQJL 3SKOA 2HVKB 4JZJB 1J1OH 4L8CA 3MRGA 1XGPA 2AK4E 2BY1A 2DYPD 2ZKHL 4G3YL 4F7CA 3QG7H 1JPTL 2W9DH 3IDXL 4YHOL 3QQ4B 4HUNB 2FBOJ 2XZCL 2P5WD 4IIQC 3BZEA 1PG7W 2VZSA 3QFJD 4Q58C 3L3GB 4Y88A 4KK5C 3GMMA 1JGEA 3GMLB 4HLZG 4OV6F 5F88A 1MVFA 3TCXA 5I1EH 1FPTL 1MAJA 3LHPH 3KR3L 1T5WB 5E9DD 3VWJD 2KUTA 4Y16A 5CP7A 3VXOB 1KTDB 2HJFB 1TLKA 3RTQB 2ARJB 5DRXB 4L3EE 1XF1A 4X7SH 2DI9A 1D5BA 5FKPA 1HILA 4WHTA 2OR9H 3ZHKA 1A2YA 4MD4B 4YHPA 1IC7H 3M17A 4MB4A 4U6TA 3VGBA 3RWJB 3MYJB 1KN2H 4OZIB 3HUJF 1ZSDB 4FXKB 4ALAH 4Q2ZB 5FKPB 3DVNB 5JHDD 2WP3T 3AU1A 1VPOL 3WKNA 5D7SH 2HFEA 5JA8B 1D9KC 4XBPA 1MH5B 3RWEB 4Z9KB 1NCDL 3DYMA 2WWMD 4MHHG 3RX8A 5ECJE 4ERSL 3GMMB 4RA0C 2A6IA 3D3VD 3OAZK 4NO0D 3WKML 3ARFA 5CJQH 4ETYA 1A6AA 2FH8A 2D0HA 3BMWA 4C57C 5D1ZD 1FVEA 3VD9A 2OR7A 1WBYB 3Q5YA 3P11H 1DVFA 1M7IA 3BZ4B 5IIEB 2GIYA 4EOWH 1NFIB 4CVZB 5I18L 4I0CC 1IM9D 2F5BH 4UINH 4QRPD 4D0CA 1VDGA 3HR5A 4LOUC 3IXTA 3LS4L 3NFPA 1B0RA 1OHQA 4PJDE 3QPXH 2XA8L 1FJ1B 3NGBC 1ETZA 1TETL 1X4XA 3ELAT 4GG6E 4W70A 4I0PD 4MQ7A 2Z8SA 5F88B 4MA1B 1H3PL 4KVCH 3RRQA 5HD8D 3CXDH 1NGYA 4QTIL 4XP6L 1OY3B 4LQFH 1TJGH 2L4OA 5TDPA 4OI7A 1AO7E 3BN3B 3QNZA 3P0YH 4WV1B 3S37X 1ITBB 4ZYKB 4KJYA 2W38A 5JUEL 1I8MB 1Q94B 3ARDD 2D31B 4MHHI 1C16B 1KT2B 3UTSD 2NXYC 3D69A 4MJIB 4PTTB 4LRIA 2C3VB 1NMBL 1RZ7H 4OLUL 4NHUA 1OCWL 4BKLB 3QO1B 5SWSE 2EDYA 3FRUA 1GVIA 2PYFA 4YWGH 2I9TA 4HC1H 4HKBA 2VERN 1UH2A 3V6FA 5M94B 2ENYA 1MRFH 4V1DB 4PJ5D 2R23A 3LH2L 4PRHA 5C09B 3PWJA 1LE9B 3OQ3B 2J5LB 3GKWL 4JFZH 4Z7WB 1KNOB 4J3VA 1OAUH 4UOW0 4ODVH 4GRWE 4RAUA 1YEGL 1X6NA 4HXAL 3RGVD 3DSFH 3FT2A 1I8LA 4MD0A 3S88H 4L3CB 2IAMD 3EGSB 1P2CB 5ID1B 1V7NH 1XGTB 3QUXC 1S7RA 1S7RB 3HAEB 1IL1A 1OSPH 3RY6C 4NUGL 4BSVB 1H3UA 1JWSA 3O4LE 4L1HA 5HGAA 1G7LA 5ALCL 4FTVA 4DOHB 1WISA 3CFEA 2FATL 3MLRL 4NRZA 1S7UA 1KB9J 2X4SA 4OFIA 4QHLB 1RZIA 3NN8B 2CGRL 2R15A 4UV4L 5I0ZA 4MXVF 3VXQB 35C8H 1BECA 2WQ8A 4PJIF 5EBMB 1PBYA 3VGGA 1JTPA 1SJXA 4LSRH 3SKMA 1T66C 1UM5H 3UJTL 1JP5A 1IBGL 2ESVE 4GW4B 1GPOL 1D6EB 5DK0A 4PYHA 8FABB 1U91B 1KPVA 3S5LG 3PIQB 3QI9D 5IUSA 3MLRH 1A1OA 4P4KC 1XGQB 1OQOA 1U58B 4XVUC 3QDGD 1FPTH 1VGKB 1KB5H 3ARPA 4OCRL 4WW1B 5C07E 1J0HA 3C6SA 4XXCC 3QDGA 4WI3A 5D1XB 1ADQA 3QUZA 1GSMA 3SDCD 4Y5VA 2VRAA 4JM2F 3TLRA 5INCB 3VWJC 3X12B 5FHAH 3SCMA 2BOBA 4N1HB 3MJ6A 4KV5E 1AI1H 5GS0D 4G9FB 5GRJL 4R4FH 1ZVSB 4NHCH 3MFFB 2F5AH 1DQQA 4NO3B 3BEVB 2F54D 3EO1A 3K1KC 1A6UL 2R4RL 4IMKA 1ORSB 4YK4B 4HWZB 1I3UA 1NAKH 1A1MB 3GBML 2YKLL 5I18H 4RMTA 4R2GC 1DDHA 1FLRL 1UC6A 2W9EH 4QO1A 1KJ2A 4GG6A 3AY4C 3NCCB 4N9GA 4ZUVA 5BMFL 3HMWL 4C55A 1DSFH 4G42A 1WZLA 1EO8L 1JRHL 2QBWA 2EH7H 3S4SG 3SDDA 2OK0L 3U36B 5J6HB 2VYRE 3D48R 4XPTL 3AB0B 4E0RB 3KG5A 3IYLW 2EDFA 1X5HA 5JIIA 1AIFA 1CGXA 2YS4A 2ED9A 1MHHB 4J6RH 1WFTA 2FO4B 2F19L 5BVJA 4HUWA 1H8SA 2PCPB 2CKBA 4KQ3H 2D7TL 3KYOA 1FO0B 4RAVA 3K74B 4X7SL 3GMNA 4R0LB 5DURB 4MX7B 5I17A 5EBMA 2OR9L 1QBMH 2CGRH 3I6LE 4ZUWA 5GS2H 3NTCL 5C6WH 1CXIA 3MBEA 5K9QI 1RZ8B 5CKAA 3K80A 3DV4A 3RHWK 1QFUL 1HHHB 4JFEB 1WWBX 5DVKA 5AZ2H 4OTXH 4WHDA 3MBED 4LASH 4K23L 2J8HA 5HYJD 5ADOL 5JLZB 3EYVA 3QZWG 1KELH 4GBXD 3HS0B 4P49A 4TSCH 3SKOB 3EYVB 4UU9B 3DX8B 5TGBB 3E2HC 1NLDH 5CSZA 3ROOB 3IFLL 4NKDB 4LLVB 4FTVE 2A83B 1JPFA 1EJ6A 2YA2A 5F44A 4LSPH 3ZT5A 4MA3A 5IVNA 1AXTH 4XCCL 4L8DA 1S5IL 4P5TB 4R26H 5JHLH 1X5IA 4QXUL 4NQED 1GL4B 1QEWA 8CGTA 3KLHD 3HKFA 2V5MA 4LSTH 4JZOB 1F6AA 2XZAL 4ODUA 3CFCL 1YEHL 3UZEA 3RKDC 5EUOA 5L88H 2K7PA 1NCCH 3UTQB 5C86A 2G5RA 3C09B 2VE6A 3MRKA 3BPCB 1BZ7B 1D5ZB 3T1FA 5JHDB 2PTUA 4YDLC 5KS9F 2M26A 1GCFA 2OS7A 1RZFL 1E28A 4I2XA 2GJZA 2QHRH 4MQSB 2W9EL 3SDDB 5DZLA 3MRMB 3HMXL 2W65A 3ARBD 4FHBD 4IOFD 2VN7A 4OZHA 1HYSC 1KCVH 3KLSA 5IR1A 4YC2C 2HH0H 2DQEH 3JWDH 5IW3A 2HLAB 1FNGA 4H88L 4W81A 3Q6FB 4Q74A 1PAMA 2XNAA 5HGGS 1XF3B 4QHNB 5EFIA 1UCBH 5DA4A 4YK4C 4RWYL 5I6XC 4G6AD 2HMIC 5K9QG 1AI1L 4YHMH 3UP1A 2R69L 4KI5F 4FQ1L 5J13B 1NFIA 4CVZA 1IQDA 3MJ7A 4GKNB 2IMMA 3L3DB 5I76B 2YD8A 4KJPC 3IETA 5TQ2H 4GUPA 5DRWA 2I60H 2VDML 3KPRE 3D9AH 4POZD 4PREA 5CD5C 2PYEB 4G6ML 1T7ZA 1TZIB 3GJFK 4PY7B 2EKSA 1A6AB 4EDXA 3QDGB 3VGHA 3GHEH 5ENWA 4CW1A 4L4TB 4U1HA 3LMJH 4XGZB 2DOCA 4TTDD 3V6OC 4JCLA 1MRCH 5D2LB 3RVWC 4NKMB 3T0EE 1PEWA 3QUYB 1RZGA 4P3WA 4LBEA 1LEGA 1HHGA 1MAML 3O6MH 3I50L 1Z9OA 4G8FA 1TZGH 1H5BA 1XEDA 3B4NA 3REWA 3TO4B 5EZLA 4OD2A 1UZ8A 4QTHA 3V0VB 3BISA 2VDRL 4N8CL 2FO1A 3VWKD 3WO3B 5D70H 1HQRB 4GMSL 4XI5C 5EZOH 5GZNC 3JV6B 2X6MA 4PJ9C 1JWUB 4CN1A 4DJMA 1FHGA 3VRIA 4GBXC 5CHNA 3KHQA 1A7OL 5E6IA 1ES0B 3C08H 1CGSL 1LVEA 2BNQA 4AK1A 4DTGH 5CJ5A 1I7RA 5JR1L 3VXUE 5EPMA 1IE5A 2JIXD 4G6KH 1HHGB 2OTUA 1OAQL 4HK0A 1ZHBA 4FQQB 1CFNA 1BQUA 3MV11 3VE0A 3NFSL 2UUDK 5D7LE 2X4OA 2CMRL 1XZ0B 1GGYA 4ACPA 5I19L 3OF6D 1UWEH 2IFFH 3DUHA 3D0LA 2W0FB 1FYTA 1VACA 1T83A 2EXWC 3UAJD 1H0DA 1SYSB 2I07B 4EQ2A 1F00I 3MLSH 1T0PB 1A4JB 2L7JA 1AXTL 1U8PB 1ZAGA 3LIZL 4IRJC 2FNBA 5IVXB 5F3BB 3P0YL 5HGDA 1JIBA 5JUEH 2CXKA 1EAJA 1LDSA 5D1QD 1PYWA 3MV8D 3WLWC 4V2BA 2Z4QB 1QLEH 2WW8A 4FQ1H 4ZOCA 5FO7B 5I1IH 4U6XA 4FP8L 3CFJA 4ZPVB 3RL1A 1YEIL 1BFTA 4LSRL 3OKOB 3DRTA 2QSQA 4ZFZB 5ICZA 1OWWA 4FS0A 5D96C 1KTLA 2E3VA 4DZBB 4HGWB 3DRTB 5CZKA 3DO7A 4G8FB 5HYFA 4MDIA 3HAEA 5GGSY 5IKCB 5MENE 1WTLA 5DUBA 5JORA 4WFGE 2J3SA 3O6FA 4MAYC 3ROLA 3U4EA 2I27N 4OZFG 2DICA 1P1ZA 1W0VB 1YEIH 3ZTNH 3LH2H 3STLB 3QQNA 4AENA 4LF3A 2EEBA 2JJTC 2IANA 4V2CB 5A3IC 2EDBA 2YD1A 4BFBD 1AXSA 2WM0A 3ARDB 3O0RH 5FYKE 4IOSD 1SVCP 3D39E 1CLYH 1B2WL 4BYHA 5EBLA 4MVBC 4WW2F 3X11B 2FYYB 3QDJB 4M5YL 4N8VG 4Q9QL 2R9HD 2VB5A 4LGSB 3D9AL 1KIPB 2ITCB 3AAZA 3NFNA 1T20B 1ULVA 5D72H 2HTLC 5A2FA 3PP3K 1R3LA 3LQAC 5DD6A 2EEAA 3BJ91 4NQCB 3HN3A 3O3BB 1F13A 4FN0A 5J13C 4PR5A 4LMQE 2MPAH 5IB2B 1C5CL 2I9LA 3WNLA 3GM0A 4G8GB 1FVCA 2I60L 5F7MC 4ZAKD 5F9OL 3NCBB 4K3EL 4Z0BL 2F74A 5FYLD 2FECI 2AJVH 3EDDA 2XKUA 3HE7B 5HDBE 3DIFA 2BVQB 2FJFA 1KTKE 1ZWIA 4UTAH 3QUXA 4OM1L 1BFVL 4K71B 3QI9A 1QBLL 3MOBL 3NGBB 5BXFA 3VWJA 3NIGF 1G9NL 1U93B 5KS9A 5KVFH 1KPUA 5ANMA 5HVHC 3X3FH 5L2KA 1BWWA 2MFNA 1A7PH 2IAMC 5IROA 5TF0A 3FKUS 1AGBA 3RX5A 1MCBA 5JW4Q 1EHXA 3C2SA 3ZYIA 4FG6C 3O3UN 4LCWA 3MX0A 3ULVE 4E42A 2YPLB 4NQCA 2VLJB 1PVHA 2VSCA 1MCWW 1BP3B 4JG0H 1SJVA 4N0CD 1WSST 3DXAD 1CDYA 5AAMA 1Z9MA 5I9QB 2DDQH 5LBSH 4D9LL 5E8PA 1DN0B 2DWDA 5CGMA 3DRQB 4XGZA 1J0KA 3R06A 3T0EB 2OQJA 2OL3A 1ERNA 1BOGA 4FA8A 1M6OA 4O2EA 1KN2L 2DKSA 3BKCL 6FABH 1IJ9A 4OAWB 3VD4A 1KTRL 3VXUD 1A6UH 5GHWH 5IGXL 4L8SC 3VA6A 3FHQA 5J1TC 3ARFD 2JK5B 4G6JL 3NZ8B 5EUOB 2QV2A 4MJ2A 1KXVC 2P5WB 4OIIH 1WBXA 2PXYC 5E8NA 3KPLB 2FEEL 4NQCE 1U92A 2BOBB 1YUHA 4G43B 4UB0L 3RAJH 4XNUH 5SX4H 4HEPG 3DX6A 5CILH 2F54B 4J3XA 3CPLB 3UJIH 2DM7A 5C08E 1MLBB 5B3NA 3I75B 2AVGA 3BWAA 4X9GA 3RZCB 4HIEB 1NDMA 4QHUA 3DV6B 5EWIL 5CFHA 7FABL 3MLXH 5CJXC 3QULA 1CDCA 1NAMA 1U91A 5FUZH 3GI8L 3RIAK 3ZMRA 1XIWD 2V6HA 3DGGA 2RCSL 2FHCA 1IGJA 2BVOA 3QEQA 5EU7C 4NZRL 5HJ3A 5I75B 3GBNH 1FGNL 1F45A 4HQQL 2EIZB 3INUH 3QEQB 4RFEA 5F6IC 1ZVYA 5GS0C 5D1ZB 1RHHB 5ERWB 5DMKA 4G7VL 1EO8H 2WINB 4L9DA 4Z95H 2H32B 4MB5A 4NFDA 4XAKE 1CGVA 3GB7A 4Z7VB 5C0ND 1P6AB 2IJ0C 3D39A 5DUBB 1JHLH 2QQNH 4UU9A 3IS1X 3PDOA 3KYMA 3BD3A 2XG4A 2VLRE 3OKMA 3ARVA 5C6TL 1KIQB 5ICXA 4GRMB 1XGUA 4XBGB 3HRPA 2QSCH 3TO4D 1G7IA 2N4IA 5MEPB 5BS0A 2ADJB 2Y23A 5D71L 4OM0H 1Q9LA 1NCNA 2Y1VA 2QHRL 1FC2D 1DLFL 3JWOC 2BP3A 4PJHF 4PGDB 1UEMA 1BBJB 1HH9A 4W6YB 4HZLB 5FECA 4AY0A 3VFMA 1REIA 1JF6A 3LKSA 4S1RH 2QSTA 1JZ5A 5IB1A 2DQEL 5DJZA 4JVPA 4XVSH 1EHLH 1Y0LB 4BH7A 3LKRA 4WVRA 2MPAL 1FFOA 4P23A 5I1HL 4H1LG 4QXTB 4WEMB 2MTPA 2DN7A 1BX2A 3C87A 3GRWH 4YHML 4YDJA 2E9BA 1CFVH 3T4AB 3BYYA 4KQ4L 1P7QD 3GGWB 3GKZA 4XC1L 5D93B 3CSGA 5FKAB 5EO0A 1HWHB 4I8DA 4K71C 1AFVH 4PJXB 5TDOB 4LPUA 4UT7H 1C1EL 5DJAB 2PXYD 4KJQC 4BSVA 3HE7D 3MJ8A 4MJ6A 4XB8A 1OP3K 5FDYA 1UFUA 4MCZB 3PIQA 5CMAB 3C5ZB 1J10A 2VISA 4G6FB 3FMGL 4X8XA 3TBSA 3Q5OA 1T0MB 3PQYE 2A9NL 1RIVL 2DMKA 4HGMA 4U7KA 3V95A 3QFDB 3V8CA 5SV3A 3MV8B 3ET9F 4NWUH 1A3LL 1WWWX 5EBWB 5DJDB 5FCSH 4NSKA 2GITB 3MNZA 4JR9L 5FUCC 3KDMA 5DRZB 4UB0H 4UNVA 1RJZA 4Z95L 4W4OC 2EH8L 5K93A 4PJ9B 1F3DJ 5CBEB 5I1IL 4XCFH 4IHOB 4YHOH 1W72A 4YE4L 2QKIA 4FP8H 4OLVL 3KVQA 3QIWA 1EDQA 1N64H 3EO9H 3BPCA 5H35A 1KCKA 4Z0XB 2W60A 4Z0BH 4W6XB 2GHWB 1SYVB 1YEFL 3U48A 3O2WH 3G5XB 1F58L 2R56L 4NM8H 3FTGA 4I0KA 3S3SA 3T77A 3RIAF 5KZCB 4AEHL 3QXUA 3U4BH 1LEKA 3PWPB 1C7TA 5C0AE 3T0EA 4RZCB 3WXWH 2AJUL 4F7MB 5I1LA 4LFHG 4HQQH 4RX4A 1XT5A 1CE1H 5HGHB 4YZFF 3VXNA 1J88A 3TN0D 1B0GA 4OLZL 5AYUL 5TGBA 2E7BA 3F7QA 3OHXB 3SEPA 4OSUH 3D69B 4MJIA 4LLQB 4FFZL 4XCNA 4E42B 5ACZB 5E2TH 1GH7A 3FOLB 4GSDL 3EDKA 4N1EA 4DN3H 4FG6D 1AJ7L 4YBQC 3DVGA 2YMXL 4DKDC 2BJML 4HKZA 2HN7A 5A2JH 2FZ3A 4L29B 1IT9H 3DURA 4CGTA 2DRUA 1OT2A 1E6OH 4I0PC 1A22B 2FB4H 3QJHB 4PJIB 1AHWB 1KJ2H 3PV7A 4OCYL 4JPWH 1IAIM 3MJ9L 4NOBA 5GISL 5KSBE 4LEOA 2L0DA 3QJHA 3KJ6H 5DZNA 3T04D 4P2OD 5DRXA 3QHFL 1YPZB 1Q1JH 4LVOC 3B9KB 4AZ8A 3E1F1 1ZHKB 1OM3H 2CK0L 1O7SA 1T0NA 1W8NA 1L7IH 1E6OL 1CLYL 3F58L 1YEEH 3CK0L 4F7TA 4S1RL 1VPOH 3WBDA 3L3HA 3GI8H 3HZVA 2EKJA 1LK3L 4C54A 1QPXA 2P45B 1HXMA 5D2LF 3SE8H 5ESQA 2B0SL 4HS3B 4TNVF 1D7FA 1IC5L 4NPYB 1CD9B 3EZJB 1NQBA 2G60L 2EDOA 3DJ9A 1MEXL 3M17B 5D1XC 2HVJB 1BJ1H 2OSLA 4P2RE 2P44B 3DV4B 5D7IE 5LGJB 2ARJA 2FLRT 3PP4L 4G9FA 3GKWH 1XH3B 4XP1H 3ZTJH 3MJ8B 4HHAB 6CGTA 1RIVH 1OAUL 1P53A 3PWUB 4NBXB 4U6YB 1RUKL 5TQ0L 4GAGL 5A3ID 1QSVA 4JGMA 3RL2A 1J8KA 2O26U 1INDL 1WQVT 1AGDA 1X7QB 4DGYH 3C5ZD 4UDUA 1BHGA 5BV7C 4D9RD 4H5SA 4HG4K 2ERJB 4GQ9H 5F8QC 3FQTA 1AIFB 1FDLL 3RWCB 2B2XH 2DLEA 5DMIL 3RPKA 3W2DL 3KLAB 1RUML 1CDUA 3UTSB 1RQ5A 4M48H 3ZTNL 4BQ8A 3EO9L 3O41A 2VL5A 1KIPA 3TYFA 2X1WL 4Q6IC 4TUOA 5E4IA 2O5ZL 3HZYA 2WSKA 3C2AH 3L9RB 2ZG2A 1HILB 4HH8A 4HHAA 4WHTB 5DUPH 3KPQA 4ZO6A 1QKZL 1AC6A 1M7DA 2DD8L 5DQ9A 3QSKB 3V6ZA 2FSEA 3V4UH 1QVOA 4PJBF 4EDWH 2E27L 2EYRB 3AM8C 3RGVB 3CFEB 4JRYA 1DBKH 1WLHA 1TVBB 3HPJA 1NUGA 4JFYB 5IW6B 3BMVA 3MZTA 5T1LD 1C12A 4X80L 3ZDZF 4EXPX 2IAMB 2IAMA 5IROC 3P4MB 5FUOL 2UZIH 4DVBB 4A6YL 2YD3A 1PEZA 3V0WL 4Z7VA 1M05A 2P5EA 5FGBC 3S35X 2VAJA 2G2RA 4TNWK 3HUJE 3DSFL 1V05A 2ZKHH 4NO2B 2CK0H 3MRQA 2P5ED 4WGWB 1S7QA 3CK0H 4NRXB 1R3JB 4PG9A 4CDGC 3N9GL 5JPMB 5CEYB 3UTQA 2DLGA 1D9KA 3ES6B 4XH2A 4ZG1A 1UJTA 1BIIB 3PQYA 5MP6H 1CDBA 5EOQH 5I30L 1YN6B 3ARED 5GS0H 4KROD 4WV1C 5JW4N 1FL3B 2ICWA 3MLXL 4GKZB 4YDVA 3P30L 4YDVB 2J88H 1BPVA 3VD7A 5EUOE 2EIEA 2QQLL 4QHKJ 4NWTH 3BD4A 3KLAA 3CDCA 5T5NF 4PLKC 3DVIA 1YC7A 3PJSB 4P5TC 1U41A 5I19H 1JRHH 1G7JB 1SYSA 1NCAL 3MCG1 4ZNEE 1IT9L 4XVSL 1EHLL 2PW1B 4MS8D 1WT5C 4KPHH 4PJHA 1K6QL 1WFNA 2BXYA 4YHLL 2ED8A 3SGDH 4WI6A 3WFEL 4WWKA 4JY4A 3H9YA 3TF7C 4MAYA 2FEDD 3BAEH 2R1XB 3QEQD 3OKLA 3VW3L 2X70B 1ED3B 1KC5H 3SDCB 5C0BA 3F58H 4F8QA 1KACB 3NFPB 5ESAB 2XN9B 4N0FB 3MJ7B 2LTQC 4OUOA 4GRLB 5E8NB 2DJSA 4NNXB 3SCMD 5C9JA 3RVWD 2BSED 1JNHB 4QRSA 1YJDC 1GOFA 3K2UH 5DJ8A 4PJAA 4R97B 2R2HB 1HDMA 1EEYB 1IGTB 1QRNB 4YIQB 2AJUH 3QZWA 4RFEB 3T4YB 3B9AA 2OL3B 3WSQL 4XVUD 3QEUB 3W9DB 1QSEA 5IR1B 2NY4C 2RFXA 3EO0A 2C3GA 1JRHI 4P59H 2HA1A 4KDWA 2Z8VC 3TYGL 1F2XK 3NCJH 1QNZH 4O2FA 5JW4M 2IC2A 2DL2A 5GGUA 1O7VA 4WGVB 2Z92A 1MRDH 1T66D 3HS0A 4DUXA 3BPOC 4M43H 2Y5TB 5EUOF 2YMXH 4AH2A 1I3GL 3QIBB 1U3HD 4HJ0D 4Q6IB 2P47B 4TPRL 5I1DA 5SWSA 2ITDA 5DUML 4JEGB 3TT1H 4O9HH 2AEIT 4WFHE 4YPJA 3U0TA 1LO2H 5HHOB 1S5IH 4JZOA 5DJXB 3O6KH 3RKDD 1FO0L 4GAGH 5JHLL 1FBIH 3MLYL 2DQFA 5BXFB 2VH5L 3CPLA 4DQOL 1UJ3A 2R0WH 3UYOD 3S34H 3VXTA 5BS0D 4LPVA 1MCRA 2CRMA 5T3ZD 3FB8A 4X4XB 5DJ0A 3LEVH 1IEBA 3W5MA 3T2OA 4Y2DC 3VFNB 3F6IA 4G8GA 2P8LA 5F9WB 4NPYA 1FNFA 1IZKA 4MNQA 1XAUA 3EHBC 2WUBH 1I1AD 4QNPE 3BDXA 3BUYA 4K94C 4KI5C 3WFZA 1KGCE 1CGTA 5IFAH 2AI0H 1J0YA 4F57H 3ZE0F 4M8QA 4EI5A 3S34L 3IDNB 1AD9B 1UM6L 4MNHB 1GYAA 4F33A 2EDRA 1H5BC 1DR9A 2YSSA 2DKUA 1KCRH 5AD0B 4CNIB 3VXTB 1D6EA 5C07A 4R0LA 3ISWA 1IGML 4LCIL 3H7BB 4PPTA 3S6CA 3QCVL 4A6YA 3N9GH 1LWRA 4HKJA 1C5BL 3MREB 1RJYA 4IBLT 2YC1B 1IAII 1N5AA 4PJEF 1JZ6A 2UWEF 3BQUC 1RK0B 1IRAY 4ETQB 2Q8AL 3X13A 3DO7B 4XPAL 3WUWA 2N56A 3QEHB 4CVUA 2ZUXA 3FO0L 2XXMB 1V3KA 5ALBL 1RJZB 4FQHA 2IBZX 1U95B 1XCTB 3DX9B 1CLZH 4WFED 1JWSB 1GJIA 3CMOH 1OAKL 1ZA3B 3BH9B 4FRWA 2AEPL 5IB2A 5EIVA 2UWEA 5GZND 1N0LA 5CSZB 4XI5D 1HWGB 4PJEA 4TRPH 3OR7B 3DUSB 1XGRA 4LPXA 1EEZA 1MRDL 3OPZL 1C5DB 1QG3A 3FT2B 3QUML 3U7AA 3SGEH 2CDEA 1MJ7L 1L7IL 4HS8H 4U1LA 4X7DC 1S8DB 4PRPA 1E4KC 2PETA 5CUSH 1J9CT 4PGCA 3VXNB 3O45A 2Z9TA 3AVEA 4JQIH 1RHHA 3WXWL 3KYAA 4OFYA 2EIDA 4WEUD 1LK3H 3TIEA 1MCIA 4DEPB 5JIHA 4RGNC 1T3FA 3WFEH 4FQ2L 4YFLI 4HKBB 1A6VH 4FQCH 4WW2A 5JDSB 4XNXH 3DARA 1U8OA 4IRZH 3QO1A 4F58L 1CT8A 4NQXA 1LE5B 2ZWLT 3PABB 4FNLH 4KTYA 4JDTL 3ULUF 3FONA 3U46B 3ZSTA 3WFBH 2AP2A 2LU3A 3RWCA 5KW9L 4WI5A 5K59F 4W68A 4YEEA 5KANI 3ARGA 1U8HA 2HFGH 1A6WL 1N3NB 3HAEG 4QOKB 3IXAB 2EC8A 4YAQA 4OZGB 2P24B 4X5XB 5C0IB 4BQBA 4XXDA 1MRCL 4DK3A 4L9LA 4OCSL 3QG6A 4Y4KB 3OSKA 1AE6L 2ZOLA 3TC9A 3QDJD 2LU4A 4LLDA 2Q76B 2Z31C 3U82B 2NY4B 4YBQD 3G04B 4OZFH 4U7SA 4Q97A 5CIPH 5J3HD 2Q76A 1EFXD 1P5UA 4RAHA 2Q87A 2VDNH 1U3HB 1DL7L 2X4UB 3N85L 3H2WA 5H94A 4PY8J 4TPRH 1J8HD 4IMLA 4PJBE 1NLBL 2PKDA 4OCLC 4GSDH 3IU4H 1CXFA 1AE6H 5A2LH 4XT1C 4EDWL 4P2QE 2Y36H 1T0NB 4P3CH 1CN4A 4LAJH 4NO0A 1PSKH 4L4VA 4WW2C 4X9FA 3QWRA 3KXFB 1GGUA 3MA9H 3JZ7A 1CICC 2GT9B 4K7PH 1OPGL 3HNVH 1KB5A 3SJVB 1HEZA 4AYFA 4NFBA 2XI9A 1EZVY 5JHDE 4EVNA 2W9LA 4HBCL 5KSAB 1W0YT 1GAFL 2VLJD 4PLJD 4U2ZA 5E94A 4PRDB 5AAWA 4M8VA 4ONGH 2G5BB 1I1YB 3I6KB 5FYJD 5E24E 2YPVH 4E41B 3GMPB 3H0TB 5E8EB 3BQUB 3L7FA 4OI9A 4BK5A 4WUKL 1DVFB 5LQBL 3BZFB 3HZVB 1CFSA 4MB3A 1YDPB 3NH7L 2ATKB 1MY7A 2XICA 4DVRH 5EZIH 3U7WH 1A7QH 4GW5A 4HT1H 3U9UA 2EO9A 1TJIH 3D6GA 5DYOA 3JWDC 1E4XL 3GSOA 3DROB 3FMGH 1LQSR 4HUUA 3FOLA 5IBTL 1MCPH 4XP5L 5CLTA 3IXAA 4LMQI 3FOMB 1R3IL 1R3HA 2JJUA 1IL1B 3WXVL 2Z8WC 1TENA 3BP6B 4LSSH 5IVZA 4XVTH 3QDJA 1UWXH 5D4QA 3ULVF 4KMTL 3TBYA 5FF6A 1M7IB 3BZ4A 1ZHLB 3F12B 5JTWA 4G6AC 4PRIA 3L3KB 3EYQD 2GJ6D 3T2PA 2KL6A 1IGTA 4P2OC 5A16A 4PRPE 3S97C 3ZHDA 2A1WH 4AENB 1R5VB 1B4RA 4JCMA 5CZVH 3V5KA 1R3IH 3RU8H 3GMLA 3TV3H 1MCSA 1ZA6A 4PV9B 3O45B 4WIQA 4Y19E 4NKDA 3N85H 4ELME 1X5XA 4LKXB 2RHEA 5IMKB 5I75C 3O2DA 1H8NA 3C6LC 3LKPA 4JB9L 4GOSA 3K4ZA 4HIXH 4PUBH 3C8KA 1I9RL 4ZFGL 5C71A 1F97A 4QT5B 1X9QA 2NW2B 3TFKC 4BSWA 1ZSDA 2QADD 4PJBA 5IFHH 5B21A 3IAGC 4MNGA 4FQHB 4H26A 4X4YB 3MQIA 1LMKA 2NNAA 5DVOA 2JELL 2ZCKL 4KKAC 2DD8H 4O4YH 4AL8L 4X7TA 4XNZB 3U6RB 4Y5XC 4OIIL 3WFCH 3H0TA 5KW9H 3BAEL 3R0MA 1MF2H 3GSQB 1K8IA 5GGTA 2DI7A 4FQXA 1DBBL 4ONGL 2LTQB 2Q8AH 2XFXB 5IMOB 3OG6B 3WO4B 2CLVB 5JNYB 4EI5C 5IFHL 3O8XD 1QEWB 4PP1D 1RUAL 3C8DA 3IKKA 4YQXH 1Q0XL 4L9LC 4UIMA 4ONFL 1G7MA 4OZHE 4GS7B 2DQGL 2BX5A 3UBXA 4EBQH 4XBEL 4F15C 3QISA 1U2HA 2R4SH 2VNCA 4XNQA 3D3VB 2B1AH 1PW3A 3NIDF 4I2XE 3R1GH 2C7UA 3WFCL 1RURL 4NKQB 1NBZA 3IDNA 5FUZL 4PP2A 9CGTA 5DTFB 5F3HA 5DI8B 1X5ZA 2BERA 3A0OA 5HHPA 3N1QC 4IMKC 5EN2B 1S78D 4K8RH 4Y8DC 3ZL4L 2X4UA 1MCCA 4M6OL 4ODTL 2CDEB 1D9KD 4K7FA 4S1SH 4UT6H 4JFEA 3RWJA 4XVJH 4LHQB 1NGQH 3TGXA 5C0AB 3IJSA 3IF1B 4KMTH 3WNNA 1GZQB 2HT3D 2E5EA 1FVDB 3GO1H 1V5JA 1LGVA 2IADA 4I0PB 2E7MA 4R96B 2CUIA 1W72B 3HZYB 1T5WA 5TDOA 4Z8FL 1C7SA 1P7QB 3QH3A 2HKHH 5KSAD 4DN4L 3ZL4H 5CD3B 2NZ9C 2HLFC 1XF5B 4JPIA 3CFBA 4M61B 4KRLB 1U8QA 4JFDE 3LS5L 4YXHH 1U8QB 3DHMA 3NPSC 1PQZB 1RFDL 5I8OH 1FGVL 1XF5A 2JCCF 3P2TA 3O6KL 5C3TA 4C56E 5D2LE 1FZKA 4M7KH 5D8JH 3VXMA 4DZ8B 4FFWD 1Y0LA 4F7PB 1OLZA 3WS3A 4PRHD 3O11A 4KC3B 2DQIH 3PWUA 2FGZA 3UTTA 5AD0A 4TSAL 2HKHL 4PJDB 4R7NB 2DQHL 3ARYA 4WNQB 5J0BA 4FOMA 5DZOA 3MBXL 4N0UA 1TTUA 2AJXL 4U1MA 5EORH 3BPNC 5IHLB 1YMHA 1BZ9B 4I48B 4KHTL 2B20A 1MF2L 1NFDF 2Y6SD 4MMXC 4L8SB 1ORQB 2X10A 4ZTOL 2RB8A 5FM5O 2NY0B 3ZDXF 4KWUA 4NO5B 3K46A 4LOUD 3BJLA 4S1DC 2ATPA 1JFQL 4F9PC 1PD6A 2ZCLH 1BBDL 5F7DB 3DOSA 2QQKL 4JPKL 2BHYA 2YEZB 5C6PB 1QKZH 3VXRA 3RWGA 4L4TD 3DETC 4Y19B 3JV0A 1F02I 1HOCA 1M7DB 5DQ9B 3FO0H 3QCVH 4KZEL 4QKXB 2P7TA 2R23B 4OGXH 4PRHB 4YPGA 1OARL 1QQDB 2QHLA 2VZ1A 2X42A 2YXMA 2D03L 2V9QA 1F3JB 4WU7B 4HV8A 5MEPA 1IGJB 2BVOB 3TWCL 1T80A 4X4MA 1VA9A 2KBGA 1YEKL 1S9YB 3BT2L 4OV5A 4KK9D 4F37K 4PB9L 4XMKL 1CF8L 2GEEA 1NBVL 3SDXB 1CLOL 5IVXA 1RJLB 3LAFA 5D7JD 1LP9E 1UWXK 3NABL 1KPRA 4NT6A 3VWKB 3CZFB 1FYHB 4XWOC 1IBGH 3FB6A 4QHUB 3GB7B 4MGXA 2VDNL 1FG2A 1RIHH 4H0GA 4MNGB 5CD3A 1NGZB 5TPWH 3G6JB 3RWIB 1RK1B 5E08L 1LD9A 3CH1A 3GSVB 3I9GH 1KCRL 1G7HA 3MRDB 1RMFH 1G6RH 3ARWA 3IETB 4FNLL 5DMGD 4I18A 1T3FB 2VZTA 5HPOA 5JPNB 4MAYD 3D25A 1QBAA 2P8LB 2XACC 4F2MA 3NIDE 1FGVH 1K8IB 3QUKB 3QI9C 4MD0B 4Z76B 3CDFA 3S3JA 3D2UB 3Q1SH 2NXYB 4UTBL 5E4EC 1Z6JT 1I8KA 1ZEAH 1XF3A 5SWQA 1JPTH 2W9DL 4YHLH 3TV3L 3DUSA 4PRIB 2NTSP 4QRQB 4U3HA 4V1DA 1OOAA 1RMFL 5C0BE 1NCWL 3G6JA 1Q9OB 4DW2H 4P0DA 2WBJD 3R4DA 4X9IA 2AJ3A 1MHHA 3RKPA 4V1DD 2AEPH 4JRWA 3CUPA 3MRBA 3EFFB 3PJSA 1MHCB 2A2QT 1A14L 3IU3B 3NH7H 3SBWA 5J11C 2WUCH 4JPVH 1IC4L 4LKXA 3NACL 2ADFL 5IMKA 2GYSA 5EG6C 1UKQA 3QBTB 4ZUTB 3H9SE 3FB7B 3GSXA 3K8MA 1I7TB 3MYJA 5DSCB 4NQSB 5L6YH 3S36X 1NANI 5IBTH 1QR1A 1D9KB 4RFOL 3WNKA 4HJGA 1B9ZA 3WN5B 1NJ9A 4PRHE 3TVMB 1YQVH 3QAZC 3T4YA 2E7HA 4HFWB 5L9DL 1TZIA 4S11A 4MAUH 1OP9A 4QOKD 3JVGA 2KH2B 4JPWL 5EU6A 1L6XA 3RWGB 3QPQD 2BSTA 1D5MB 4KZEH 3L5XH 1B0RB 2CIKB 3V5DA 4GKNA 3LKOA 2X9YA 2EDQA 3KXFE 2F58H 3TNNA 4K9EH 3S35H 3O4OC 3ZTJG 2A77L 1TVHA 2WBJB 3STBA 3QEGL 2NLJA 1HXYB 3BN9C 1VEMA 3D18A 3QRFM 3LQZA 1FO0H 5HVFB 2F5BL 3NVQA 5GZOD 1B0GB 1BZ9A 2AK4D 1NCTA 2DTMH 3WS6A 5T1KA 1XGYH 2YN5A 3FN0L 4HSQA 3VA2C 3V6ZB 4F7TB 3O3AA 3TO2A 1VGKA 1MPAL 3FB6B 4NUGH 1CYGA 4PJDA 2AW2A 4R7NA 5EOCL 5HHOD 3PWLB 4L3AA 4M7ZC 5T3ZL 2DQUL 2DQJH 3CSYB 4U6XB 4NKOA 4LP4A 4QXTA 2EXWD 3UAJC 1OGTA 2Q1EA 3G5ZA 3N50A 3QWQB 5HI4C 2YOCA 1GC1H 1AGEA 1MCHA 5TE6L 2B4CH 3I6KA 2O5YL 4OGXL 5GSRA 3ZT7A 1K4DB 4QXUH 5E8DH 5IWLC 5DWUH 1HIML 1ZKAA 1H15B 4Q9RH 2YR3A 1YPZF 3I3BA 1JNLH 5ID0B 3EIFA 4QRPE 1R3HB 3WV0A 5GRYA 5CBEA 4NO2A 4X7CC 5DFVD 1N6QL 1KJ2L 3H9ZA 3T3ME 3HB3D 3EDJA 4X5LA 3ZYZA 1GC1L 4ODXB 1JPFB 2P8PB 4PJ8A 1PG7X 4U2YA 5B3JF 3QWRD 3OGCB 4WI7A 1UWGH 4Z7WF 1YDPA 1WC7A 1K4CA 2Z31D 2YPLD 1HH6B 5E6IC 4L8CB 1KCUL 4K7FB 4OFVA 4GG8B 4G8IB 4GG8A 4OZ4A 2GJ6E 4P2RA 4S0SD 5GPRA 5JXED 3CFDA 3O2VH 2WINA 4BM7A 3X14A 5JDSA 4XMPH 5JORB 2V7HB 2VITA 2XN9A 3I9GL 4YXLL 3EJZD 3MJGX 1F3DH 3CX2A 3PHSA 4BK4A 5DFTA 1BJ1J 1NAMH 3VXUB 1UZ8B 4JO1H 4M5ZH 4HXBL 5IB4A 1ZLSH 3RVXC 2A6JB 4LLWA 3B9KA 4YBLB 5CGYC 1NDGB 1MIML 4C83B 4X8JA 5K9OB 4TN9A 3G5XA 1EJOH 5I9QC 3K81A 1EEZB 3R8BB 4TQEH 5F7UA 3WFHB 1FFPB 1UT9A 2CLVA 4YGAB 4GAFB 1CXKA 2V2XA 2CUMA 3EYUL 4PJCE 1QFOA 2EYSB 2A6DB 4E0RA 2M2DA 4JPIB 2UYLB 4Z8FH 5TDPB 3QIWB 2JF1A 3SDXE 2OI9C 3MLWL 4OUUA 3RDTC 4Z7UE 4PJGF 2BNQB 1WIUA 1EEUA 2YD4A 5F7EL 1DE4A 1XIWC 1FL3A 1MVUA 1JGLL 3BKYL 2ZOKA 5IB1B 1MWAB 4XAWH 3MPCA 5B39B 3MV9A 4HH9B 3G6AA 1U92B 3L3DA 5I76A 4HMCA 3VFGL 5LGJA 1IGFH 1RHFA 3AMLA 5FEBA 5C0DA 3MLTA 1EO7A 5E95B 4Q7DA 1HINL 1RUQH 2P5WA 3TNMA 3KPOB 4JFQA 3KPRD 4GMSH 3MGOB 5F96L 3L5JA 1CE6A 3Q2CA 4XXDB 1S7WA 4MLIA 2AV7A 1CIUA 1R3KB 5H37G 4Y4FA 2F58L 5ETUB 2BSRA 4RMRA 5E1AA 5DHVB 1JGLH 1ZVSA 2WBKA 3RWHA 2W1NA 4KHTH 3HE6D 3O8XA 3UPRB 3HPJB 3UDWA 1BQLH 2R2BB 2MKLC 2IPUK 4L5FH 2EKSB 3WEXA 1D3CA 3KHOA 1N59B 1ZT1A 5TDNB 5FK9B 1HQRA 3CH8A 3AREB 1MFDH 2EH7L 4K2UL 1X5FA 3QXDB 4PJ7A 4Y4KC 4ZUTA 2X89D 2GAZA 4AM0B 3MR9A 2VXTL 3LRHA 5F70A 5C07B 3ZZ1A 4KK6C 2O5YH 1NCWH 2OJEB 4OCYH 2BNRB 4NDMB 1JGDB 1MFEH 1NBYA 1UVQA 1DUYA 4O2CB 3SGKA 2BVUA 2ZCHL 4P4KB 1F8TL 1DUYB 1WCQA 4O2CA 1KFAH 2ARJQ 2J8UB 3DYOA 3HPLB 2D7PA 3X13B 4A2LA 3TT1L 1I9JH 1XH3A 2NY5H 3P40A 4L4JA 3T3MF 3I84A 3J8F7 3BUTA 3VG9B 5ESVB 1KJMB 2JB6B 4ODUB 4OIBA 3LD8C 2R0WL 1IKNC 5DURD 5C70A 1NUNB 2BZDA 3T2NH 4CJ1A 1JPGA 4AEIH 4IS6B 5HYEA 1MQKH 1LE9A 3B5HA 3MACL 4ODSL 4L8DB 4UBDC 1INEL 2GY5A 2CDGA 3H9HA 4ELMF 3GGWA 2DF3A 2YPLE 5JW3H 1K2DA 4O5LH 4NRYB 1U3JA 3IDMA 3KLHC 4NKIL 5GSVA 4FFYH 4GBXB 1VB9A 4WI4A 3IDYB 5LVEA 4TULL 3ALWA 4OF6A 1MNUH 2VZOA 1MCLA 1F11A 3OKLB 2BHZA 4PRAA 1KJ3L 3SE9H 3FQRB 2XOTA 4BA8A 2PYEE 3FQNA 5DJZB 1OTSD 3T3PE 5KOMC 1A5FH 3QAZB 3PV6A 3BH8B 3N1FC 4U3XA 2V5SA 3HC3H 2ADGA 5E99L 3L1OH 4K94L 5HYJE 1RZFH 2D7MA 5CP7B 3L3OA 3W5NA 4IRSB 4YIQA 1KGCD 5AWNL 2FEDC 3S88L 4Y2DB 3KYOB 1NCBH 5L6YL 2YEZA 4TTGA 2C4XA 4OKVA 4QXWA 4U1GC 4OIAA 4PUBL 1BFVH 4GKOA 4LGPB 4KRPD 2XQBH 3LSOB 2IQAB 5F7EH 5HHNA 2NCMA 1DP0A 4Y16D 1UA6L 4OAWA 3RNKA 3FFCE 5EUKB 2OL3L 4G5ZH 4H1LA 5D1QB 1QYGH 3D5OF 1XZ0A 5MI0C 2DQTH 3WCYA 4FXGA 4B53A 1RZJC 2VDMH 2APBA 1W72H 4LCWE 3NMEA 2EDLA 4Y4FD 4PJXE 4Z78A 3CDGB 3HLAB 3P73A 2D03H 1ZLVK 3UJJH 4YDKH 4X99A 1FN4A 3F12A 1EEYA 4JQIL 2DWEB 4ZFOB 5KS9E 1JWMA 1YYML 3NIGE 4MA8L 1OGAD 1S7TB 5SWZD 1CLOH 4JKPH 4WFEE 3L7EA 2JCCB 2RAMA 3PDDA 4X6CB 5KN5A 3RVVC 1J8HB 5D5MA 3G04A 5DEZA 1S3KH 4XHJC 1Z3GH 3W11C 3VGAC 1PY4A 1MCOH 4BFIA 4MA1C 5KTEH 1XMWA 4OZHF 3RDTD 3DNKA 2OXHA 1QFWM 3N1PC 2H2SD 4G42B 1AO7D 1ZLUK 2FX7L 4ETQA 4M6OH 4ODTH 2RGSA 2XZZA 5C08A 3BE1L 4YHYC 1G7JA 5HTSA 1F8TH 4P46B 3WJLA 3L5HA 4PJ7E 2GUOB 4J23A 3MRGB 4NQDA 1L0QA 1NUDA 1AQKL 3FCTA 4UDUB 3PXHA 3WDHA 5HGDB 5B8CC 3EO1B 1IFHL 1CS6A 3FRPA 3EDFA 4QF1B 1JF1A 4N0UB 1NSNL 5GRUL 3GFUA 5CINL 1HI6A 5B39A 3S7GA 4NGHH 4GW1A 5E8PB 4ZS6D 3T2NL 1BJMA 5B4MD 2C3HA 4BQ6A 3HZMA 4U6HB 2O61A 2A38A 4TTDC 3LS5H 1UQSB 4YXHL 7FABH 2DQJL 5J56B 5IJVA 4L4VB 4XMPL 3K3QA 4UIMB 4MNGE 4I3RH 1U8KA 4P2QB 4POZC 4RMQA 5EULV 3O6LH 5K9KB 4U1NB 2EDTA 3GHBH 1I8MA 1YPZE 2CJUH 3QYCA 3EYSL 1BQLL 4GAJH 3PWVB 2B5IB 1ZGLM 1MCFA 3UBXI 3UYPA 4BZ1L 4CVXB 5KVEH 4EUPA 2IALA 3HB3C 1ZMYA 4YUEH 1RUPL 3TH4T 4WJ5A 1VHPA 3B3IA 4ISVB 5CJQL 3MXVL 3MV9E 4ESKA 3DX6B 5IHBA 1YN7A 4PP1C 1XF2B 3VRJB 3ZYJA 1J8HE 2WLYA 3QFJA 5ANME 1JGUH 5C0DB 5E9DE 4Z7QE 3LN9A 3T0AA 3KAAA 5TE4L 5JW5A 2VXTH 3RWFB 2H41A 1Q0YH 4QRUA 4ELKA 3CLFH 5GXBB 1UWGL 3MRJB 4LNVA 5IB3B 5HPMB 1ZXQA 3MLZL 1IAMA 3MOBH 3SGEI 3OZ9L 4YXKH 4UQ3B 4H20H 1TJHL 5D6CB 1OVZA 5DD3H 3EYFA 1FIGL 5F1IA 1T20A 2DTSA 1WEJL 5IT2L 4PP2B 4C58B 4NQEA 4I5BA 4HG4J 2IPTL 1T04B 3EOTL 1U8MB 2Y25A 2C7UB 5LGHL 5FA3B 4JAMB 4CADA 1BD2A 3I2CH 4QRRD 2XN9E 2YRLA 3QXWA 5EIQA 4WRLA 2EXYD 2C1OA 4KQ4H 3BO8A 4LSSL 3OR6B 5ID0A 2Q86B 3U0WH 1HDMB 4LPYA 3RVTD 1NMAL 1CF8H 5IMOA 1F4YL 1A4KA 4FQXB 5EPMB 3G9VA 5D2NC 4HD9A 1BLNA 1KLUB 5I1GL 2FEEI 1WCBA 4LCUA 3B9KD 3BGMA 4GRLA 5EC1B 1QFWH 1J1OL 1DVFD 2IPTH 2H2SC 3RFZC 5IKCA 3EYQC 1XR8B 5FYJL 1MFAH 4X5WB 2VLKA 3MO1B 4JY5L 1QYGL 3F6LA 4UILH 4K07A 4JM2A 5GGVH 3B3IB 3SE4A 3PL6B 3BKYH 5LG1A 3ILPA 3GBMH 4HXAH 5FYKD 3RIFF 3UBXG 4JAMA 4K3EH 1E4XI 1II4E 1S7VB 5SWZA 1MLBA 5HDOA 3OWEA 4OZHB 4TULH 4BSJA 2ITDB 2VABA 1KJ3H 3RQ3A 1XGPB 2HJLB 2R2EB 1WFUA 2F5AL 2NY6C 4JO2H 5DHYB 3ZDZE 3DECA 5IBLD 3PGDA 5D7JB 1G6RA 2AEWA 3WUWG 1Q9WB 3QCTL 5GGUB 5JQ6L 2FX8H 3ZO0A 1GIGH 5SX5K 3NAAL 3HUJB 3FO2B 3QRGL 4RISL 3KPRA 1RZKL 5T5NG 1BIIA 3PQYB 1Q9OA 2X09A 1A2YB 4YHPB 2E8YA 3E6HA 1ZHNA 2OI9B 3RDTB 4EJ1C 2GFBA 35C8L 5HYQB 2ZSVB 4XTRD 5IW1A 1BVZA 3G6JF 1QFPA 4J6RL 4GQPH 2SEBA 1RUQL 5BCAA 1CGUA 1JPGB 3ILQC 1DBBH 1QZ1A 1W0WA 1UACL 1MIMH 5GRVL 1SJEB 5F1SA 3GSXB 2MOVA 5MEQA 5IFJA 1BVKB 4M1GH 1G7QB 1TQCC 5ISZA 3PGDB 4QHNA 2ORBH 4P57A 1VFOA 2HFEB 4RMUA 1EFXB 5IBUG 2R1XA 2PW2B 5IBUB 4GLRI 4G8EA 4XZUA 4WO4A 5C2BH 5CKGA 4M6MH 5E6ID 1MIEL 1JCKA 3OKEB 5EU6E 1S7SB 2IG2L 1PX4A 1YEGH 3U2SA 1QBML 3B2VL 3MNZB 1IM3A 4Z7UA 4WNQA 2OM5A 4LVNC 1OTSC 3LHPL 5DJDA 4M02A 3BD5A 4L4VD 2BSTB 2XV6B 3MUGA 4J3SA 4JLRA 4M1GL 3MV01 4U1GB 5IWLA 4MDJB 3GHBL 1JE6A 3S36H 2P24A 4X5XA 1HKLH 1CK0H 3CC5B 1OLLA 2HLFD 3B8SA 5E7BA 3T8XA 1FSKC 4I4WA 4Y1AD 2YUXA 3MRDA 4JFHD 4HMEA 4JZJC 3WEXB 3PF2A 1S7UB 2X4SB 4RFNB 5D1QA 4U1HB 1ZVHA 3CXHK 4NQCD 5F7NC 4Y1AA 5TE4H 5L7XL 1V3LA 4XPTH 4LCCA 3W0WA 1LO0L 1T7YA 1FVDA 5EBLB 2CXGA 4WWID 2Y36L 5L2JB 3IDIA 4N5EC 1PSKL 3NOIA 4YGVA 4UMGA 4WEBH 4Y4FB 5ETUA 1MFDL 3QDMA 1S7WB 4K3GA 4LRIC 2HH0L 1VEPA 4LF3B 1SY6A 3FCTB 3UYRL 4EEEA 3SKJL 1FN4B 3P0VL 2NX5A 1NFDA 3VFSB 3MUY1 2ED7A 1DQQB 4RGND 2IBBA 3N0PB 5ITFA 3V5HA 5GGQH 5C0EA 2VZ3A 4QRPA 3VG0H 3QCUH 3SGDI 1ZLUH 4I9WE 5DEFB 4PJIE 5TF1L 1BGXL 4FZ8L 4MAYB 3TYFB 4Y1AB 3OKMB 4PJ5A 4UT6L 4RMVA 1G7PA 1UACH 3DETD 3C9NB 3TT3L 5I16A 3MROB 1O0VA 2AQ2A 3FB5A 1P4IL 5DJ6B 4FMFA 5D2NB 5D2NA 4HIJB 4DGYL 1KPRB 4NT6B 2JCCA 4FQPA 3QWOA 4I3SL 4M7LL 2EH8H 2CLRA 3OGOE 3H9HB 3V6OE 3UMTA 4FFVC 3QO0A 4XCCH 3ULVC 5E7FA 3IAPA 1A3RH 2CH8A 3NAAH 4JLRB 5F1KC 3V8OA 4QRPB 2NMSA 3W39B 4YPGB 4P5KA 1YEKH 5IQ9A 3RY4A 4GXUM 2WANA 1B88A 3KNBB 3WS3B 3ARZA 4PGCB 2Z93B 3OXRB 1CR9H 1NC2D 2XQBL 3CCHA 1S78C 5AZ2L 1L6ZA 4LPTA 5F7YC 2Y72A 1GIGL 3KPSD 4WFHD 3IDXH 3PDOB 2DQHH 4D0BA 5A2KH 4IRJA 5BO1L 4HK0B 2GTZA 4JO4L 3L3HB 4P4KA 4JKPL 5IMLB 1QSED 2EDXA 4KRPC 4OLZH 1K5NB 5IEKB 3ULUH 2VC2H 1GXEA 2DB8A 3M07A 5B38A 2J12B 1ONQA 2J4WL 3ULVH 1BJ8A 3QDMD 5D6DC 3PWJB 4LKCB 4G6FD 4U1JB 3VFUA 2ESVA 5JNYA 3KPQB 1EO5A 3TBYB 1MJ8L 2VDKH 5E00A 3NCYP 8FABA 4HGKC 4MZ3A 4BH8A 3CFCH 3FN9A 4ZSOE 4HS6A 4N0CC 3TFKD 3MLSL 1H5BB 4TYUA 5F71A 5M7QA 3PGFL 4NN5B 1A47A 1BMGA 1OARH 3MUGB 3P73B 1H3WM 4Y4HB 2V2WB 4KFZC 3FQTB 2IFFL 3T0XA 2AGJH 4HWBH 4YFLF 1FIEA 4N5ED 5DEGB 4JM4L 2GKIA 1PX3A 4HIEA 3DVGB 4YFEA 3RWDB 2KZWA 5FO9B 5ENWB 4CW1B 1RY7B 5HI3D 4NQVB 2BSRB 5E1AB 5C0BD 2UV3A 4MXQD 1CFSB 2X4NB 3KPMB 3MODL 1KJVB 4ZNEA 4EOWL 3IFPB 4UINL 5SWSD 3OHXA 4X6DF 1RI8A 5C0RL 4HDIA 1WCBB 1EH9A 5KSUA 4LASL 3WJLC 5JZ7C 3OKYA 5C9JB 2VXVH 4ZAKA 1KOAA 4MCZA 5C0NC 1MFBL 3VFWA 2X4RB 5JPNA 3V6OA 1G84A 1Q72H 1DQJA 4EN3B 4KRNA 2X7LB 4KPHL 4WCYL 1SBBA 3SJVD 43CAB 2C1OB 1AD0A 3ZSSA 1BAFH 2HTLD 5FM4A 4U31A 2J6EH 4LHUD 4TUJA 4JM2D 5DJXA 4I3RL 3G08A 1DN0A 2DWDB 2AJZB 1IQWH 2UYLA 5DO2D 4ZS6C 4LDLB 2AJYL 4PJ5E 3FQRA 1RU9H 4RRPG 1Z9SA 1IAKB 4M5YH 4XPBH 3G5VA