4HQQL

Crystal structure of rv144-elicited antibody ch58
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
212
structure length
212
Chain Sequence
b'NFMLTQPHSVSESPGKTVTISCTRSSGSVASDYVQWYQQRPGSAPTTVVYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDNSSWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CH58 Fab heavy chain
publication title Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hqqL01
5SV4A 4JEGB 1VB9A 4LSVH 5E95B 2BFVL 3L5WB 4MGXA 2J8UB 5KG9B 2NY3C 3D85A 1T7WA 2P5EE 1FCGA 2PTUA 3GSUB 1HKFA 5ISZB 3CCHB 4KVNL 4X6CF 5IR1B 4ONFL 2GSGB 4YFDB 2OP4L 4X6CE 1RMFH 3T0VA 2XZQL 1N5YH 4ZUTA 3BH8B 1EFXD 2NXZB 2EKJA 5I76B 2HMID 3BGAA 4LEOB 5DK0B 3ILPA 3EYFA 4Q74A 5DQDL 3RP1A 3HFML 3TNMA 1QKZH 4PLKD 2BVOB 2EDKA 2HRPH 1P53A 1KB5H 4FQQA 1CF8H 3MRGB 2A2QT 2DLEA 5F7YC 5HHMD 2ICWB 5I1DB 2N7BA 3PUCA 1G7LB 3TO4D 4GLRI 2H6PA 5E7FA 1F4XH 1AD9A 2FX9L 1FO0B 4K3GA 2J8UF 2AJYL 3S36X 3HE6C 3AM8C 5EZLA 2Z0BA 3OAZK 2VLKD 5E6IC 4ZAKB 3FT3B 1CXEA 5L2KB 5ISZE 5ERWB 1EO5A 1HQ4A 1IAIM 4HC1H 4OM0L 5ADPL 2C4FU 4KZDH 5JW4M 4AEHL 5I18H 3NZ8B 1GC1H 3MACL 4QRUA 1ZSDA 4TSAL 4WEBH 2A9MH 1UB5B 1FVCA 2NYYC 3JTSB 3O41B 4MNQB 4I1NB 4UT6L 3NIFE 1BX2B 3QIWB 5F9WB 1R5VB 1I8MB 1YPZB 1UC6A 2R56H 1HXMB 2P8MA 1MOEA 3NVQA 4MXWH 4TOYH 2DI7A 3VFTA 5L8KB 4HUKB 1VACB 4HFUH 1I85C 3IRPX 5DGQA 1X9QA 2NXYC 4WGWB 2QQQA 4Y4KB 5TE7H 1DLHA 5JW3L 1D9KD 5HHPA 3X14A 2XV6B 2PXYC 5D93C 4JFHE 5IT2L 4WEBL 3VFVA 5D1QD 1LD9B 4N8CH 1Y0LA 2IJ0C 2W1NA 4F7TB 3REWA 4TTDC 1IAKA 3UX9B 4FFVC 5L2KE 3U30C 2XPGA 3MBEC 5EUKA 4FQPA 2EE3A 2OSLB 1OCWH 4OUUB 1PGRB 3S4SB 1ZMYA 1LEGB 4R90H 1TJGL 1AR1C 1FFOB 5C0CD 2WBJB 4XT1C 3ARGB 3TH4T 3O9WD 4MNQE 1OW0A 2OI9C 1YPZF 4WFEE 5J1AA 1LP9E 2GIYA 4H25A 5TE7L 1YPZE 5AWNL 3C60B 5E9DD 2EXYC 2Q20A 3JWNC 2WUCL 5DS8A 3C6LD 1AFVH 5IHZB 3EOTH 4O2FA 2EIBA 2Z35B 3D0VA 1MSPA 4F15B 5ESVA 1IGTA 1NKOA 1QLFA 2HT4C 2QL1A 1S5IH 4UOW1 5B39B 3JVGA 2ZUYA 4LNRB 1BFVL 2CK0H 5EU4B 5DZNA 3ZKSD 3QXTA 4PJ7A 1OPGH 2HWZH 3JBG7 3QDJB 3WN5B 2ATKB 1WCQA 5HDOA 3T2PA 4WUUB 1A6VL 4GW1A 5HYSG 1K4CA 3MJ9H 3FQNA 3LMJH 3M1BB 2BVYA 5E5RB 2AEIT 4FZEL 5GRVK 4UILH 4ZYKA 5DR5L 2VC2L 1A3LL 2FATL 5CEXB 3H3PL 3ZKQD 3U4EB 2HFTA 4QXWA 4U1HA 4UQ2A 5FCSH 2WWMC 1I4FB 1D5XB 4JJ5B 3AY4A 2QKIB 5DZOA 3OKDB 4M1CC 5DLMH 5GRXG 4JFDD 4FTVE 4EOWL 2NMSA 2XG4A 2IG2H 4I0KA 2VSDA 2CK0L 1URLA 4G8IA 3DHMA 4P23C 1OPGL 4HMDA 1ZT7A 4CKVX 4YHMH 5H8DA 3QUZA 5IP4A 4ODUB 3CFBA 5LCVH 1FZKB 1YUHA 2O93L 3LMJL 1B0WA 3QG7L 4Z7WB 1T2JA 3C8DA 2DTSA 4UV7L 4XX1E 3QDJE 2ADJA 4IHOA 1KBGH 3ZDYF 5BV7B 4S1DC 4NNPH 3ZDYE 5DXWA 4WUUE 1AQKL 3K4AA 4OLUH 4XMKL 3S9DB 3AB0C 3NA9L 3Q3GA 4ZUTB 1JZ7A 3MLXH 2YD4A 4HF5H 3NCMA 4JO3L 1AKJD 5AZEL 4X7SL 1SBBA 2PW2A 3EYFB 3SHSA 3WO4C 5JXEC 4K71B 5DEZA 3I50L 4ZXBB 4QHNA 1FNGA 1VGEL 1A7OH 4S0TD 4ZFZA 4HXAL 5HYFA 4FQXB 3SCMC 2ZG3A 4G6AD 4G8GD 1M4KA 1QQDA 1EEZA 2E7HA 3DVGA 1WIPA 4ZO7A 4M6ML 2CUHA 1RK0B 4PRHD 4FNLL 1KC5H 4F7CA 3MTRA 4OGZA 2B4CC 4K9EC 2H6PB 1IEBA 2BVUA 3G08A 5BVJA 1LHZA 1AD9B 3RL2A 2A0LC 2A73A 1LDSA 4Z7WE 1C5BL 1G9NL 5J6HA 3GRWA 2BSED 3N50A 3GMOA 2YOCA 5A16A 3M07A 2Y6SD 3CFEB 4WI8A 3NGBC 1HQ4B 1RZFH 3L9RA 1DQLL 1RJYA 3B9DA 1S3KL 1VA9A 5T5FH 4AL8L 5DRWB 4QRUB 3MRLB 1ZSDB 4F8TA 3MNWB 3C5SB 3MUJA 1OTUD 3QI9B 5J12C 3MCKA 1J5OH 1UM4L 2Q6WA 5FYLE 1MHEB 4ZOBA 5IK3A 4B0MM 4Y16A 3BQUD 2AP2A 1D5MA 2P8MB 3MLZH 3VFTB 3TZVA 4A2LA 1CD1B 4LARL 4XBEH 1PYWA 3C8KA 1A7QL 4JPVH 1KN4H 4OF6A 1LE5A 5E2JA 3UTSA 4KI5C 1B0GB 1DLHB 4YHYB 3KPSA 3ET9F 5HHPB 3RVWD 3X14B 4HUNB 1H15B 4YGAB 3AS2A 3MJ7A 2LU3A 3MGAA 3IJSB 3QCVH 2ZUXA 5T5FL 5IVZA 2DQCH 1T6VN 4V1DA 1BF8A 3OKEB 1N0XH 3BO8A 3P30L 1XGYH 3RWDA 3T4YA 3SE9H 3P4LA 5DRXB 3REWB 4C56D 5DMKA 1IAKB 1E27A 4MVBD 1VDGA 2G2RB 3G6DL 1QEWA 1IJ9A 2XPGB 5EUKB 4L1HA 1EERB 2BRQA 4MB4A 4WO4C 1NAKL 1KN4L 2A74A 3AC0A 5JQ6H 1FBIL 1WAAF 3PV6B 5IMMA 5B38A 1WAAE 4WI7A 12E8L 1YN6B 1RD6A 2NY2C 4WI9A 2FO4B 5FYJE 4JRXD 4PLNC 5DVMA 5DS8B 3QCVL 4O2CB 4Y4FC 5C0BA 4KJPD 4WWKB 3QO0B 1I7UB 2EZ0D 2ZUQC 4BH8A 5CBAB 4UNVA 4ZO9A 3DETC 5TDPA 5L88L 4M3KB 4BSWA 3WIIH 1KB9K 2AEPL 3PQYB 1IM9A 5F8RC 3BH9A 3RL1A 3VFRB 4PJ8A 1F4HA 4N8VG 3TBYB 3SDCD 3IDMA 2MHAA 2AJXL 2NX5A 4BQCA 3EFFA 3TBSB 5BW7C 4EIGB 4PJ7B 5BQ7A 3TBTA 4FP8L 3SDDB 3HB3D 4TNVF 1H3GA 1T1ZA 3DYOA 2F58L 3W0WA 1QD0A 4OZIB 3WFHA 3FQNB 3V4PH 3HI1B 3FRUB 5DFTA 4I18A 1T66D 3W82A 5HYJA 3GKWL 3I3BA 1V05A 1FIGH 5E99L 4JG1L 4UQ2B 5SWZE 5J9PB 4FFWD 4ODBD 4ODXB 5HPMB 4Y2OA 4O2EA 4Z7VA 2ADFL 1VADB 5E2UL 1CE6B 4ZDHB 2B1AL 5CSGA 4CW1A 3RPIA 2VXVH 1KCRL 3O0RH 1ZT7B 2KBGA 2E6JA 4XCCL 5JHLH 3QUZB 1JGDB 1CXFA 4IDLA 3ZKXC 4N0UB 2CKBH 3PQYE 3W2DL 2ZOLA 1YUHB 1YEKL 1OTSC 5L8JB 4PY8I 4K2UL 2FJGA 4J12A 4PG2A 2PCPA 4KAQH 1OOAA 2DB8A 2AJSH 3ARXA 2OXGA 5EU6B 4OTXH 4PJ7F 2C3VA 3KJ6H 1J8HE 4JO2L 4I77L 1K8IA 4L9LC 4OCSH 4O02H 3WJLA 2B0SL 3P2TA 5HD8D 4IRZH 1T20A 1ZLVH 3DVNB 1JHLL 5CMAA 4OZIE 4FG6D 2WWKT 5D70H 2E5EA 3B43A 2APBA 3HE7A 3VGEA 1MCKA 4H88L 4M7JL 5HHXL 3LEXA 4RQQB 3ZLQC 1XMWA 4LF3A 3TBVB 2CKBL 2ICEA 3N9GL 4ZFZB 3UC0L 3MOAH 4MJID 4KXZI 3VXOA 1KJ3L 1IC7H 4MQ7A 3M45A 4LHUG 3DVGB 2DYPB 1TMCB 3ZTJH 4QHKI 4EI6B 2PO6C 1NMAH 4QXGH 4DAGL 4JKKA 4F7CB 1BOYA 2E6QA 4XGZB 5ICYA 3FMGL 5JIPA 3QDGB 4XPGH 4G8EB 1Q0YL 4N0UE 1IEBB 1NGPH 2BP3A 3G08B 5BVJB 5DT1L 4CRPA 4LSDA 3RL2B 3DX6A 3O4LB 2E27L 4PBVC 4Y5VC 2AV7A 5EU6E 3TH3T 1T83C 2YUWA 4LSSH 2ILLA 4L4TD 5KOMC 4AM0A 2VABA 1KT2A 3L9RB 4FQIH 3VH8G 2VDNL 4XHJD 4ONHA 2IALA 2J6EL 3FQXA 3DV6A 1A6WL 3WDJA 2YC1A 3VGAB 5DI8A 3RKDC 1A1NB 2Q6WB 2DI9A 3BW9A 2CJUH 4MA3A 3WV0A 4MAUH 4QXGL 3SDYL 5JMOC 4G6JL 5IWLC 1D5MB 2XQBH 4WIQA 3TZVB 4Z95L 1NGPL 3W81A 1UGNA 1PYWB 4KZEH 2VAAB 2R0LH 2J2ZA 1A6TA 1E4WL 2R0WL 5JW4R 4GFTB 1JWSB 5KVDH 2IQ9H 3WFDL 3UTSB 3BPCA 4WRLA 1G7IB 1C12A 4NUJA 3KPSB 4MXQD 2BNQB 25C8H 4P5MB 3MJ7B 3QDGE 3H9ZA 1LO0H 3UPCA 1F90L 1UCTA 5IVZB 4PJCB 1D3CA 1NUGA 1S9VA 2CLVA 2WP3T 3ZKNC 4V1DB 5KOVC 3KS0H 3O4LE 1Z3GH 3DRTA 2ZCHH 1H3UA 1ACYH 3R1GL 3RWDB 1OP3H 3RTQD 5HGDB 2ADGA 3NPSB 3VFOB 4XNZB 5DMKB 2CJUL 1IILE 2BSRA 2JB5L 4L3EE 1QEWB 2D2OA 4MHHG 3OSKA 3FT2B 2XN9A 5DJ6A 3QQ4B 4NO0B 4QGTA 5EUOE 2R0LL 4KXZH 2A74B 4G7VL 3QIBD 3OR6A 3E2HB 3TCXA 3LH2H 1FH5L 1CE1H 1YEFH 2ZSVA 4QTIH 5IBUG 2VH5L 5F88A 1ND0A 1EHLL 1R3IH 1KLGA 4DW2H 5F9JA 4JFFB 3IJYA 2ID5A 2O26U 4MB3A 4A6YL 5DJCA 5C0BB 5CJ5A 4Y19E 2Z92B 4WNQB 4BH8B 1NBYA 4MNGA 3RWIB 1FN4B 5A43C 4JFZH 3UTSE 3QWOA 1JHKL 1SY6L 2BNQE 3OAZH 3BH9B 3QEGH 4P4RB 4X9BA 3RL1B 3V5DA 4PJ8B 4WHTA 4PJCF 3TO4A 2HRLA 4PJCE 2RGSA 2NX5B 5D7KD 4EDWL 4ORZC 4V1DE 2Y9RT 3EFFB 3GSVA 4UIMA 5C7XL 2QR0B 3LH2L 3WIFA 3TBTB 4RFEA 3CSYA 1YEFL 2VLKA 4QF1B 3X12A 3CXHK 3W0WB 3WFEL 3DX7B 5F7NC 1VFBB 2UWEA 3GMQA 3MV7D 5BO1L 3FZUD 4GKSA 1CN4A 2YA1A 1DBBL 5HYJB 4XCNA 4V2CB 2JELH 1ZKAA 3BGFC 3RNQB 3VXSB 5KTEH 4OIBA 4N0FB 3HUJE 1RULL 1YEIH 5D2LB 4QY8A 3QHZH 1N2RA 1P2CA 4JFFE 4O2EB 1F5WA 5C0BE 1SYSA 1RVFH 1S7QA 1N4XL 4LSTH 4NN7B 4PYGA 5CLWA 1BD2D 4JY6A 4WENB 4ZNEE 2DM3A 3U1SH 4X4YA 1Q1JH 2RB8A 3KLAA 5FOJA 4LCIL 4YGVB 1T22B 4HXBH 2ZOLB 3QZWB 4I8DA 1UH3A 4ZOAA 2FJGB 4PJXA 3GMNA 4ENED 3L7EA 5EOQL 4XVSL 2E6PA 2BVEA 2CMRL 1W72H 5D1QA 4DKAA 2A77L 1KLUB 2XWBA 1T89A 1F6LL 1HHGB 4JM2D 3BGMA 5T1DL 2OTPA 1OM3H 2X9WA 1T20B 3WS6C 4PJ5D 3BSZL 1KIUA 5KVGH 3D9AH 4N90D 2C7UB 5F7DB 3BUYA 5FEBA 4P99A 3KVQA 5T1LD 3HE7B 2GK2A 4TUKL 5FK9A 3O9WA 2Y5TA 2CPCA 5EA0L 3VXSE 3LEXB 4CU7A 3IVKB 2K9UA 5D2LF 2X7LB 3P0GB 3GSQB 5D2LE 4FABL 1T1WA 4HXBL 1NMCC 4Z7VF 1FAKT 3SO3B 4NN5C 4MQ7B 4YEEA 1C08B 4JRYE 3JV6B 3QUXD 4U1JA 3OBAA 3HC4H 4FQ1L 3EJYD 1I1FA 4XNMA 2JTDA 1SBSH 3LEVL 3KPNA 5GS1C 5ICYB 1KENL 2AS5M 2VE6A 3DX6B 4RFOH 4M5YH 4JR9H 2H3NB 2AV7B 3QCUH 1TJIH 2X4PA 4EDXA 5CILH 3DURA 2EDBA 4AM0B 4EI5D 2IFFH 5I75B 1JL8A 4RFNC 3U7YL 5HI3C 1MWAH 3UCRA 4ONHB 5A1AA 4XVTH 2IALB 4RBPK 2GY7B 5MEPB 5BOPA 1GPOL 3GMRB 2HG5A 5IW6A 2YC1B 4QXUH 4PV9B 3BW9B 4HC1A 1MQKL 4G6MH 2R1WA 4MS8D 5GHWH 4XZUB 2HJFA 3B9AA 3QDAA 3G5XA 4MB5A 2FL5A 5JLZA 4P46C 4H5SA 4M4RA 4N1EA 1OAXH 1OGAD 3N1MC 3BPCB 5C0AD 4NJAH 4EBQL 2W9LA 3BE1L 3INUL 3OF6D 5EOTA 1AE6H 4YDLB 4H0IA 1IC4L 3BKCH 3BYYA 1S9VB 2CLVB 4FZ8H 5K9OB 1MRFH 5H37G 3WN5C 2KKQA 4WFGE 1ZWIA 3L95B 2R15A 3O6KL 5DF0A 1MJ7H 4OGXH 5HGHA 3ARWA 4GAFB 3H9HB 5GIRA 1QRND 2H9GA 3TF7C 1INEL 1RUQH 1I8KA 5FV1L 5E94B 4U0QB 5DFWH 1EFXB 4XCFH 4WV1B 3NTCL 3ZL4L 5DJ8B 5I1EH 5HHNB 5F88B 5MI0C 1YNKH 3HC0A 4BJLA 1KLGB 4YHOH 5F9JB 3BP6B 3IJYB 5DJCB 3SJVD 1G9MC 3W5NA 4ZFGL 2BY1A 4EJ1C 4HPOL 5F3HB 4MNGB 3AS1A 3QQ3A 4G8GA 5CZVH 1MFCH 4EZMA 2AXHA 2HVJA 3QWOB 5FHBH 5HHMB 3B8YA 4MQXD 4R9HA 2Y07L 2VLME 4PRHA 4Y2DC 8CGTA 3V5DB 1QSZA 3TO4B 2VXQL 3DJ9A 1MAJA 1FDLL 3GSVB 2FWOA 4RFEB 4DTGH 4ELMA 2AJ3A 2VLKB 3MJ6A 5B8CA 2BHYA 2PETA 3MV8A 2QHRH 2X1OA 3O4OC 3CLFH 1BREA 4UQ3B 3GMQB 2NTFA 2KDGA 2IGFL 5EG6C 4XCNB 2R0KH 4JCMA 1KXVC 2DDQH 4KI1A 4K71C 3GMLA 1XR8B 3HR6A 3MJ9A 3MLSH 4HWEL 4K3EH 5HYQA 3GHBH 3TA3C 2K7QA 3EDFA 1CGSH 2XICA 4LASL 1N2RB 1P2CB 2BDNL 4U1IA 3N85L 1S7QB 3I6KA 1XGQB 3CDCA 2XTJD 2K7PA 1KUMA 5FV2A 4DTGL 1A7PL 5C0ND 3KLAB 4OCMC 2VUOA 2E9JA 3ORJA 1CXLA 2EIDA 2B8OT 1D9KB 1BFOA 5BVPL 4WTXA 1G84A 2GCYB 3B3IB 4KPHH 2J8HA 4PJXB 4P3CL 5CLTA 1VEPA 5DGRA 5D1QB 1NGYA 3ARUA 3MLSL 2VLKE 1RZKC 3IDNA 2DBJA 4POUB 3GHBL 2VN4A 3RVTC 1NAML 4UBDD 3HAEH 1SJHA 5IJVB 2CXKA 4HS8H 2R23A 4YHLL 2LVCA 3MC0A 1MUJB 5HY9B 2OZ4L 1X5YA 2HTLD 2A6JB 2WUBL 1P4BL 4C4KO 3MV9D 3O9WB 4OAWA 2CR6A 2VDPL 4IOSD 5D7SH 3NH7H 4LSPH 4LCWE 4TULH 2MSPA 1K4DB 5E9DB 1U8OB 4NKOA 4JRXA 1T7VA 3SQOL 4JKPL 1F6AA 4XC1L 4KPHL 5T3ZE 1JYXA 4NT6B 4U1JB 1P7KB 5DD0L 1MFBH 1I1FB 4XNMB 5C0FA 3KPNB 4JHAH 3GBLA 1PLGH 1DLFH 2Z31D 4ESKA 2VE6B 2YHGA 4IIQA 5GS3A 4PJXF 5KW9L 5BJTB 4JM4H 1D5IH 1M71A 4DUWA 4EDXB 1GYAA 3O3DA 5FM5M 3EGSA 3DURB 1UXWB 1DE4A 2JJVA 3K7UA 3EUUA 2F8XC 4DZ8A 1WIOA 5CJOH 1KTLA 2HG5B 5IW6B 1OW0C 3NIDF 1U8KB 1H8OA 1QSVA 3NIDE 4C58B 4OFYA 1ZA3B 3TN0D 4GKZB 5C0CE 2R1WB 5JNYB 1UXSA 3MLWH 2PYEE 3RWFA 2HJFB 4OZGE 5CKAA 1H3WM 4GMTL 3IS0X 3G5XB 5J0BA 3WO3B 1XR9B 4Q2ZA 3U36A 5E9DE 3AFLA 4APQD 1U3HC 4X5XB 4H5SB 2FD6H 4JFDB 2OBGA 4HX1B 5ABDE 1BVKA 5DUBA 3V7AG 4AG4H 2VLRA 5D7IB 4M4PA 1U8NB 4XPTL 4UTBH 1G0DA 2CUMA 4HPYH 3BXNB 5D71H 3PHSA 5T1KD 3WMSA 5T3ZH 2IAND 5GS0L 5KN5A 2YUXA 1ZWIB 4IOFD 4M7KH 5J7CC 3ELAT 2O5ZL 3MNZA 5HGHB 4PJBA 3HI5L 4PV8B 5GIRB 3QHFH 5I8OH 4WHDA 1U8QA 1I8KB 5ESAA 3UPRB 5CZXC 3WIHH 1X4YA 1KV3A 5IIEB 4JJHA 4CL7A 1AKJB 3U0TB 3MQIA 4NN6B 1JZ2A 1E4JA 1MLCB 5E8EA 3HC0B 5IFHH 4G7YH 2ZPKH 4X4MA 2YPKA 2IAMD 5E2WH 2ZSWA 2DOCA 5CEYB 4MJIA 3ZSTA 3QQ3B 4JFDE 3UP1A 4G8GB 4O4YH 4WUKH 3OJ2C 4ODSH 1T0NA 5F89B 1XZ0A 3ZKMC 2DKUA 4YEFA 5I8KH 5D7IE 4PRHB 4HZLA 4E42B 2CK2A 3I2CH 2GK0A 3KR3H 4I0PD 1MCPH 1A0QH 1JPTL 3ALPA 4JPKL 3BHBB 5JOFA 3WIHL 1V7MH 3DUHA 3S35X 3STLA 2AJ3B 3KNBA 35C8H 3ZMRA 2B5IB 3EYOA 4YBLB 4L4TA 3CDFA 3MRCA 3L5XL 4JCLA 4U7KA 3UTZA 3LN5A 1WBZB 2NZ9D 1KCVL 3F6LA 4ODSL 5GS0D 3PG2A 3CVHH 5KVFH 3C8HA 3O11A 5FGSA 1GSMA 3QFJD 1I7ZB 4NQDE 1MLBA 1CFVL 2DTML 4JQVA 3RIAK 1WTLA 2DL9A 1CXIA 1CBVL 4ODHL 5K33A 1MCPL 3UBXB 4GMSH 4O51A 1RUPH 3KGRA 1UM5H 2I07A 1RY7B 1LO4H 3PL6D 4P57B 5C3LD 1MFDL 2AJVL 4G42B 4RAVB 5CGYD 1FZOB 3ARFC 1GVIA 1SQ2N 3L3DA 2P4AB 3C08H 2WBKA 1WZ1H 4NCC2 3K4DA 1RURH 3UZEA 2FHFA 1NJ9B 4XCYA 5DHVB 2R9HD 2AGJH 4L4VD 5DZLA 2HP4A 3SKMA 1ZLUH 2Z9TA 3TJEH 3P73A 1DEEB 1KPUB 4JDZA 5JXAL 1NGYB 2CKBA 2VDQH 4IBLT 3VWKC 3PWLB 4I3RH 3WJJA 3IDNB 4LIQL 4NUGH 1MI5D 4C56B 4RSVA 1ZHBB 1SJHB 3U9UA 5J13C 1A6UL 4IRJC 1KEMH 2QQLH 4XNUH 5HJ3A 2R23B 4R4NC 5FA4A 2WQ8A 3DWTA 1T5WB 3CK0H 1CXHA 4Y16C 3T2QA 5FIEA 3B83A 4OAWB 4XXCA 1DL7H 3B9KA 1A1MA 1KN2H 1XF4B 3OXSA 2AK4D 4HK3J 1MFAH 3BOVA 4JRXB 4NKOB 1CFNB 4XPAH 4NPYA 1ZT4A 1IVLA 2YPVH 4R0LC 4OT1H 4D0DA 4KRPD 5DMIL 5CJXA 4H20L 4KKCD 3IAPA 2P47B 1TCRA 2J6EA 2H2PC 2D7MA 5MENE 2DQGH 2FRGP 2CDGA 1J86A 2Q8AH 4F7EA 2X4RA 1KEML 2QQLL 1BVLB 5F1IB 4KVCL 2YWYA 1J0YA 5I1GH 3SDCB 4L8SA 2H26A 2BHZA 3FN9A 1CVRA 3VD4A 3O3DB 3EGSB 5D7JC 5KSBB 4C56E 1JN6B 1S78C 2DQHL 4DZ8B 3U2SA 1VFOA 1C1EH 3BP4A 4YNYA 1AGDA 1R3KB 3FOLB 5J6GA 5CEZH 1KTLB 4PY7A 2HFEA 1XGRA 2BK8A 3EAKA 3ARDC 5D9SA 3RY4A 1BIIA 4OLXH 4YDKH 2X4UA 3IDIA 1HIML 3NOIA 1YMMA 1Q38A 2B20A 3KPRE 1JWUB 3KYNA 4ZG1A 4XC3L 4JRXE 2E8ZA 4JGJA 4HEPG 3VXPA 2JCCA 1Z2KA 1BVKB 1FIEA 3TJHD 1ACZA 2X89A 3PIQA 3MSPA 4JZJA 7FABH 3WLWD 4J8RA 2LU7A 1GRWA 5D72H 4W70A 1TETH 1DUZA 3GGWB 4ZSOB 4HKXA 4HGMA 2VMFA 2YPLD 2EH7H 5KN5B 3BPNB 1AR2A 5D8JH 4DEPC 3QDMD 2CRIA 1OP9A 2XI9A 2NY3D 3MNZB 4A6YA 5KSBF 4JM2A 1OARL 5KSBE 2X4NA 5I17A 2IMMA 3LKPA 1U8QB 1T5XA 2QBWA 7CGTA 4I18C 5ESAB 1SY6A 1IC1A 4ODWA 1EEQA 1RPQA 1UKSA 4YHIA 2BRRL 1PKOA 2X10A 3DRQB 1S7RA 1GL4B 1U8HA 2KPNA 1XF2A 1S7VA 3MPCA 2VIRB 1EHAA 1LK2B 4I48A 1G7QA 1QFUH 3WFCL 3EHBC 5CHNA 2ZSWB 4G6FD 1QFWI 4MJIB 1ED3A 3ULVD 2F8VA 4ACPA 1T0NB 5JUEH 1XZ0B 3QUXA 2D31A 1S9KC 2M2DA 3PGFL 3I9GH 4HZLB 3AGVA 4TSBL 4LVOB 3H2WA 4Q9BA 4MQSB 4ZSOE 1NBZB 5JOFB 4L29A 1R0AL 5KVEH 4PJGE 1FYHB 1NFDA 3HE6D 4RBPH 4PJBF 3EYOB 2NY5C 4L4TB 3L3IA 4NC1E 4EI5A 2BXYA 5E6ID 4E41A 1QFUL 4ZFFB 3MOBH 1C8PA 3THMH 1HZHH 1TQCB 4DVBA 1JGVL 1FORL 3MUHL 3QYCA 3LN5B 1HYRC 3OKYA 2GEEA 5A2JH 2NYYD 5LAXB 1MJ8H 3O11B 5F6IB 5F1NA 1MLBB 3OGCB 4E0RA 4OLYH 1KIQA 3DPBA 4R6UA 3M17A 3TYFA 3PV7A 5EZIL 3U7WL 4O51B 2IFGA 4WI2A 3CD4A 1SJXA 5GGUA 1ZK9A 3TBWA 4MJIE 3V52H 1BEYH 5HVWA 1BF2A 3ROLA 2V2WA 3SPVA 1CLYH 3OMZA 5C0AA 4XCYB 4NOBA 2NXYD 3T04D 5HI5C 4OJFH 4UIKH 5LBSL 4AMKL 3O2WH 3O3BA 3P73B 2PXYD 4ETQA 3DHJA 1D7FA 3ARSA 2CKBB 4FFZH 4DKEL 3RTQB 3NCJH 1OP5K 2CRYA 3ARPA 1NDGB 4TRPL 4G3YH 4M48H 4D94A 4HJ0C 1DBJL 4TTDD 5FA4B 2DF3A 2XYCA 2AEQH 4FFVD 5GRYA 2LV4A 1JGEB 3MBED 2APTA 1QFWH 4HUVA 3UYRL 5FUOH 1Q9OA 4P2OC 3QIBB 5C9KA 2XXCB 3ZHKA 1AR1D 3BP7B 1S5HA 2C1PA 1OT1A 5B38G 4UIKL 1Q8MA 4M1DL 1ZT4B 1T03H 5GZOC 1XF5B 2EXYD 4QRRE 1R5IA 5C70A 4FFYL 4PJDA 2V7HA 4WU5A 4JO4H 1KJMB 4E5XA 4N1HB 2VB5A 2CDGB 2X4RB 1IQDA 3MROB 4MAYA 2HT4D 3WKMH 3I3DA 3V6BR 3FTGB 4L8SB 4DGYH 2H26B 1IKNA 1OHQA 1S9YB 4HUWA 1YNTB 2NW3B 2H45A 5F6HJ 4MHHI 5EO0B 4YNYB 3MGOA 4YAQA 1AGDB 1G7JB 4CMHB 3B2UC 4OCNC 4JREC 1OT2A 2BNUA 2YK1L 4PY7B 2HFEB 5C09A 1QR1B 4R4FH 4BFEA 4D3CL 1OAUL 3O45B 3MV7B 5D9SB 1MIEL 1BIIB 1MWAA 2ZG2A 3IDIB 3KPOA 5C2UB 1YEEL 1YMMB 2MCPL 2A9NH 4H1LG 4R97C 2B4CL 4RGMC 4K9EL 3TP4A 3KYKL 1EAPB 2H2SC 3KYNB 4H26A 5FUCE 1M05A 4M5ZH 3DX9A 5I1KH 2P44B 2BZDA 2WWMD 3U0WH 1TZGH 3VXPB 2FB4H 1IGMH 1HH9A 3F7QA 4TNWF 1BD2B 1DVFC 3UDWA 3OWEA 3GM0A 1N64H 4HJJL 1AH1A 4JZJB 4J8RB 1RJZB 4F33A 2HVKA 4P23D 3CNKA 3WFBH 3ECBA 5A3ID 1G6RL 4JPWH 4HKXB 1FV1A 5MERA 2W65A 3BPOC 3WHXA 1AI1L 3O6LH 2EDOA 5FYKL 1MY5A 1INDL 1BZ9A 2ITCA 5D7KE 2DQTH 3TV3L 4KJYA 4NKDA 4A6YB 5FB8A 4JM2B 1ORQA 2X4NB 4JRWA 5I17B 1U58A 3LKPB 1T5XB 2QQKL 1KG0A 2X5PA 1CQKA 4S1DD 4PJ5B 5LGJA 4K8RC 1A3RL 3GO1L 2BNRD 1BECA 3DMMC 3MV7E 3T77B 5D2NE 3NFPA 4NM4H 3RAJH 1S7RB 1U8HB 1XF2B 1S7VB 1JPGB 4XWOC 4I48B 1G7QB 4M43L 4OZFB 5JXED 5CHNB 1A1OA 5TQ2L 3MRFA 4AQ1B 3P9LB 1ED3B 3G5YA 4JAMB 1CR9L 2LVEA 3AMLA 3GUTA 4TVPL 1IQWL 1F4WH 3GZKA 3QUXB 5DD5L 3SCMD 1BD2E 5ALBL 1KJVA 4Q7DA 2BY3A 3WE6B 4F37K 5J11C 5E70A 3S35H 1PY9A 1LGVA 4MNHA 1MHCA 3IETB 5AUMA 2UUDK 1A9BB 3OKOA 4GAJH 2J4WL 1T89C 3BAEL 2W91A 3BKMH 4YHPB 4J3XA 4U1KB 3EBAA 1NFDB 2DRUA 2A0LD 1H9VA 4JM2F 3HI6H 3HZKB 5I1JH 4CBPA 3L3IB 3LZFH 3HMWH 3O6ML 4EI5B 3HMXL 4PUBL 1X5JA 4NQEA 3IFNH 1UG9A 4ZODA 5EO9A 3MFFA 4PJ5E 3IU4H 4LBEB 4NWUH 4N90E 4B7IA 1YNLH 4Z18A 1B88A 1HXYA 2MPAL 1RZJH 1A6ZA 5FYKD 5JORA 3SBWA 4KV5F 5TGBA 1FVDA 2CLRA 4KV5E 4LHUD 3V5HB 4LHQB 1KIQB 1N5AA 4GBXA 4X98B 3P40A 4S1RL 1PX4A 1HQRB 4ZPVA 5GGUB 1P84J 3TBWB 3U0PA 4GAJL 2Z91A 2OR9L 4JQIH 4Y4HA 1I9RH 1CTNA 1HYSC 3MX0A 2YKLL 1OGAB 4QEGA 2G9HB 4LQFL 5C0AB 1J0KA 2FIRT 3HMWL 4KI5D 1JTTA 1FSKB 4KHXH 3A67L 2M8XA 1MAKA 5JOPD 3O3BB 2W9DH 3HPJA 2VN7A 5T1KA 5I1CL 3EYUL 5FA3A 1NFDF 4GW5A 5BMFL 1U41A 3CPLB 4P9MH 1NFDE 3LS5H 1CICA 5DSCA 2NY6D 3E0GA 3S88L 4TVPD 4JG0H 4P5TC 4EXPX 2PTTA 2CO7B 1QRNB 1TFHA 6FABH 2WNGA 1MELA 1HWHB 1MREL 1GC1C 4X7TA 4UTAL 1ITCA 4MDJB 2Q76B 5IB1A 4WO4D 1OWRM 3KLSA 4HT1H 4Z0XA 2AXFA 1J11A 1HHKB 3AU1A 2Q86A 2FGWH 2NY2D 2C4FT 3F8UB 3SJVB 2IAMA 1R5IB 1BAFL 4UB0H 4G43A 3I02A 4PJDB 4Y4FD 1A7RH 4WU5B 2YD8A 3QEHA 4R8WL 4YX2H 1OGAE 3IT8D 3AUVA 3OJDA 2IPTL 3DETD 1H5BB 3QHTC 1JRHI 4AZ8A 3GI9L 4NQXA 3M8OL 5CJQL 5EU7E 2FH6A 4OQTL 2D0FA 4KTDL 2X4SB 5A2KH 2NCMA 3S8WA 4NKMA 2FJFB 1Y6NR 1YYLH 1Z9MA 4HUWB 4JFYA 4CJ1A 5C9JB 3IU3A 3VGGA 3QAZC 2CRMA 4KUZL 1UADC 4YAQB 5TF1H 1MCOH 5FECB 4IEFB 1QRNE 4X6EA 1X5FA 2BNUB 4DKFL 5E8OA 1I1AA 4UUJA 3FB6B 4L8CA 5C0JA 3P9MA 3SKJL 3KPOB 4YK4C 1X4XA 1ZTXH 5SWSD 1JPFA 5MEQA 4R7NA 1HEZB 3FHAA 4H26B 1HHJA 1M05B 4RMRA 3DX9B 4LK4A 1QYGH 3SDAA 1AD0A 1U8PA 1M7XA 3UJTH 3SJVE 4G9FE 1CFTA 1HH9B 3QXAB 4OIIH 4PJDF 1T7ZA 1AIFA 1OSPL 3GSNH 4PJDE 1K6QL 1TTFA 3MZTA 4AH2A 4LSQH 2XTJB 1BFTA 1BQSA 4B41A 4M62H 4F33B 2HVKB 4YQXH 4ODTH 3S3SA 1DSFH 5FCUL 1Z9LA 2W9EH 5MERB 3WHXB 3O8XA 3N1PC 3WNLA 4I13B 5B8CC 1BZ9B 1OTSD 4KJYB 4NKDB 5FB8B 5IFAH 1ORQB 2Y1VA 3WS3A 5J57B 3BWUC 1BJ1H 4F9LA 1I3VA 1QBLH 1U58B 4WTWA 3R4DA 3RNKA 5IKCA 1KG0B 2HLAA 5LGJB 4IRSC 3UJTL 2B39A 3QJFB 3MUGA 1N59B 5LJYH 3AREA 4MJ6A 4PB0H 5AEAA 3WUWA 1FL5B 2YZ8A 4HKJA 2FEEL 3NFPB 1H3VA 3MV9B 2BX5A 2XFXA 4LSQL 3BKYL 2QADC 3WIHA 5HDQL 4PGDA 3ZT7A 1AHWA 5GJSH 2IPUG 1A1OB 4X7FC 4MWFA 4P2QD 3GUTB 1JI2A 1KJ2H 1NANI 5AZ2L 4M02A 4MA8L 1QBLL 2PO6D 1H3TA 4N68A 1QLRA 4LDLB 5AUMB 2Z31B 2AV1A 3OKOB 1A47A 3X3FH 3IDXL 1NGWA 4KKBC 3F7VA 2APVA 5FUZL 5I1LB 4GKOA 4P2RE 4LAQH 1L4IA 3C5ZA 1MHHA 2SEBB 2BXZA 2H32B 3T0EA 5GS2H 1JRHL 3RY5A 3DROA 4OF5A 5F7WC 1N7ML 1ORSA 1QVOB 3ARRA 5FGBC 1JI1A 2X4OA 1HXYB 1KJ2L 1H0DA 5JORB 3LSOB 3TN0B 5C6WH 2R69L 1FVDB 2CLRB 3MV9E 5TGBB 2IWGA 2MNUA 3RKDD 1JPST 4GUPA 1S7XA 5ID0A 1ZS8A 2RFXB 4NRZA 4GBXB 4KKAC 4PJIA 4PJFA 4PREA 2BJMH 3J8F7 3DSNA 5JO5A 3ISWA 3X3FL 4NO5B 3CVHA 4EEEA 4APQB 1NAMB 4P5KA 3BDYL 4ZPTA 3BFOA 3RY6C 4MJ5B 4LRNH 1RUAH 5DJ0B 5EU3A 4IIQC 1QG3A 4AENA 4ZTOH 1ZAGA 2DWDB 5HHOD 3NCBB 3U79A 1DBAL 4PGCA 1V3JA 5DHXB 3HPJB 2ORBL 5T1KB 3RI5F 2IANB 1J12A 3ZKND 4UAOC 1UWGL 1X5IA 5HYSA 5IMKB 3QDMA 1MNUH 1IGCL 2EDEA 5IMLA 1KELH 2R2CA 4KH2A 1DDHB 2ZNWA 3JWDH 3R06B 1IFHL 2PTTB 1FRGL 4HKZB 4M3JA 5GGQH 2YMXL 4U49A 1YMHB 1S7WA 4LCYB 3V6OA 4BQ6A 3N0PB 3VMPA 3VDBA 4X9HA 1CLZL 4P59L 2EKSA 4X4XA 4X7TB 1NANH 2V5YA 3I84A 4Z0XB 2AXFB 1EZVY 3O2VL 4R96B 1Q0XH 2ZUVA 3AU1B 3H0TA 3MRBB 2Q86B 3CIQA 2YD1A 3QQNA 1DBMH 4JPIA 2IAMB 2DWEA 2OTUA 1QNZL 5AYUL 3V95A 1A4JA 4L8DA 3KXFA 3I02B 3MRRB 4MXVF 1JGLL 4MXVE 3C2AH 4HV8A 3ZTNH 4K3HA 3TEUA 1X6NA 1MCFA 2QSCH 4KK9C 1Z6JT 5GGQL 5MP6L 1MY7A 3QEUA 2GJ6D 4JKMA 4OCYL 1IMHC 1FNSH 4NQXB 5TJWK 1X5GA 4I0PB 4M00A 4HEME 5FDYA 2IANE 1YYML 3OXRA 3VFGL 4Y7MA 4XVJH 5DJAA 1HOCB 3HE6A 2Y36H 3AM8A 1NEZA 2AJUL 3KAAA 5IOPB 5F96H 3EOAA 1SYVA 4ZTPH 4UUJB 1G7PA 2V2XB 5C0JB 1CK0L 1MRCH 4ORGB 3SGEH 3FO9B 3NZHH 2JK5A 2LAAA 1DR9A 5MEQB 4R7NB 4HDIA 5F21B 3U83A 4QHLA 5LQBL 3QFJB 2MWCA 3LRSB 4MZ3A 1FNSL 3EO0A 4PY8J 1CFTB 2BHUA 3AXLA 3PGCB 2P8LB 3X13B 5GSVA 4HK0A 1GGIH 2EO9A 1EVTC 1J0IA 4PBXA 2R1YA 3PL6B 5JPMB 5K9QG 2XRAL 4M61A 1CIUA 2EDNA 3OB0H 4BM7A 4LGSB 4X8JB 4L4VB 2NW2A 3ARQA 4CU8A 3PWJB 2DMBA 3QUML 1OP5H 3KS0J 3H9SD 4XMPL 1CU4L 43CAA 2PXYA 4RISH 4JFEE 2ENYA 3B5GA 4HHAA 3IFLL 2VLLA 4DZBA 5FHAH 3WS3B 5DEFB 5I19H 3E3QC 1MI5B 5BS0D 3MRMA 2DJUA 5C0DA 5IKCB 1NLDL 2HLAB 4J3VA 1R3HB 4DQOL 3MODH 4X7CC 2HH0H 3IDJA 4MJ6B 4AEEA 3EZ8A 4HKJB 1MRDH 4QHKJ 5CP3H 3SE4C 5LG1A 3T2OA 2XFXB 4JQVC 3LPWA 1NEUA 3GKZA 4TUOA 5JA9A 2Q7YB 4JLRA 1MHPH 3QFJE 2AK4B 1UA6L 4K7FA 1AC0A 1OSZB 3K46A 1GGYA 3SOBH 1CVSC 1GGUA 1XGTB 3GHEH 4KRPB 3MRQA 4Z7UA 1FYTE 3QA3A 5C07D 4KQ4H 1QLRB 1WWBX 1Q72L 2AV1B 4L4VE 3EO9L 5BXFA 2XWJA 1XCTB 1M7IB 3WJJC 5KS9A 4PTTA 3MR9A 5B22A 2WQRA 1KNOA 1MRDL 5D5MA 2VSCA 3CDGA 1MI5E 3PWNA 5IEHB 1GIGL 1G9ML 2DQUL 1CDBA 3DIFA 5ALCL 2ZZUT 5HI3D 2KQMA 1JZ6A 4MSWA 4HIIA 1WBXA 1XCQA 1H0DB 3B9KC 3UO1H 1U8IA 1YQVH 3A0OA 3PXHA 4GUPB 1S7XB 3HRPA 3QG6B 1ZS8B 5DMJB 4YO0B 3U9PL 4PJIB 4S2SA 5TDNA 2AK4E 5JO5B 3ZDZE 2VZOA 4PD4K 3VXQB 5T33L 1OVZA 4P5KB 3GSRA 5HVHC 3ULUH 5CD3B 4P46D 5A2FA 1CI5A 4XBPA 3BZFA 1RUML 4UINH 5EU3B 4D0CB 2ZUTA 4AENB 4MA7H 4XP9L 3VXRD 3EDDA 1SJEA 3H42L 1KIPB 1SEQH 2HLFC 4MMXC 5HYSB 2CO6B 3IDYC 3QDMB 2R4RH 1U2CA 4QKXB 3MCLL 3EO1A 4JZOA 2NY3B 4NO3A 4XI5C 3W39A 2R2BA 2BOCB 4OFVA 5E1AA 1J05B 1FFNB 2FECI 2IBZX 1U93B 1P5VA 4L5FL 3GIZH 4GW4A 4X4XB 3RIFF 5JW5A 1DQDL 1AJ7L 5C2BH 1KFAH 4M6NL 3BEWB 5EBLB 4PJIF 3GSOA 4KDTA 2DM2A 3CH1B 4PJIE 4JPIB 5JXEA 4R26H 4LIQE 2OTUB 4X6DA 1PKQA 4G6FB 1YEJH 1RIVH 3IF1A 1VEOA 2FX8H 2O5XH 3OPZH 3OZ9L 4HV8B 3WHE1 1RZKL 2R4RL 1YEGL 2UUDH 3SCMA 3RHWK 4FQCH 3U4BL 3UJJL 3QEUB 5H94A 4HMEA 4AQOA 4YWGH 4Y2DD 3S3PA 1EMTL 3VWJA 1MJJB 3D85D 4FOMA 5DO2D 1NLBH 2YPLE 2YEZB 3OKLB 4Q0XL 5DJAB 4WEUD 4PLJC 3HE6B 3GJFA 1NCBL 5M95B 4Z0BH 5GISH 2JKXA 2OCFD 3QQ9C 1KFAL 4QYOA 2X41A 3MLYL 5EOCH 3EOAB 4Y5XC 4YFLF 5E6IB 5EZJA 1YEJL 1N26A 4NGHL 1CD8A 1JBJA 1G6RA 1U42A 2O61B 2O5XL 4NO2B 3LKNA 4PS4H 4KJWC 4LMQI 4HDIB 3MO1B 3UROR 3LS4L 1B6UA 3TA3D 4IM8A 4OGYL 5EN2A 2GTWA 3AXLB 5GSVB 4HK0B 5D1ZA 1NLBL 5E8PB 1AXTL 5DJDA 5L0QC 1P4IL 4URTB 3DOSA 1I9JL 3ULVE 1L9NA 2EYTA 4M61B 1WWWX 2JIXA 3ILQC 3NACL 3VFSA 5C0RH 1H3PL 1HCFX 1NGZB 2NXYB 4Z78A 4LPUA 1WFOA 4RAUA 5HSFA 1U8JA 4MLSA 2PXYB 4BA8A 5D93B 3IFOB 3X3GL 3VH8A 4HHAB 5CCKH 4YPGB 2WV3A 3NFSH 4YE4H 2GITA 5C0DB 5JR1H 4MD4A 3F7YB 1W8OA 2DJSA 4D9LH 2Q8BH 3BZEA 1A8JH 2XA8L 1HKLL 5K59F 3RVTD 4GSDH 3VW3L 5K59E 3U30B 1L7IH 2Z8WC 5EFIB 2CXGA 5FFLA 3P4MA 1GGBL 2YRZA 5A40E 2LTQC 4WO4A 5SX4H 4XNYH 5TDOB 4WHCA 2X70A 4JLRB 2W0FA 4FN0A 4U1LA 2OI9B 4M1GH 2DQFA 2FECL 4K7FB 1D5BA 1KGCD 2XWTB 4BZYA 5E5MA 1PQZA 4XCEA 1E6OH 2LFGA 4Z7UB 4Y4FA 1HI6A 3L3KB 3STBA 4D9RE 4FQ2L 1F02I 1YEDA 3L1OH 2X9XA 3BEVB 1D5ZA 3FONB 2R8SL 1FLTX 1R5WA 4JFPA 4YXKH 4GSDL 4PTTB 3MR9B 1BFSA 5DTFB 1NCAH 3BIBX 3ZTJG 5EBWA 3H7BA 3A6BL 4XPBH 1VKXA 4W81A 1MCEA 1JTOA 3PWNB 5BW7A 4AEIH 1I9IL 4YXLL 4RCAA 3HNTH 3GBNH 2GKIA 5IW3A 4MSWB 5HGBA 4LLWA 1WBXB 1XCQB 4XMLH 1AY1L 2OR8A 3U6RB 5TFSH 4MDIA 1JF5A 32C2B 5D7LD 3NABH 1B4JH 3HNSL 3V6ZA 1S7UA 4XTRC 5SWSA 3L1OL 2HFGL 1K2DA 4GRMA 4S2SB 5IMOA 3U7AA 2OLDA 1T4KA 1MIMH 1D6EA 1U3JA 1A14L 4FRWA 3GSRB 1I1YB 1RZGA 2DQEL 3L3GB 1S9WB 4LFHG 4R7DA 4GG6A 1U3HD 5INDB 4Z7UF 4Q9RH 4ODVL 4XBPB 5EC2A 4Z7UE 3BZFB 4N8VB 1U6AL 4RMWA 2QSQA 1YY9C 4MAYC 3F58L 2F15A 1MEXH 4P23B 5I30L 1SJEB 2D4FA 1IKNC 2FX7L 2RCSH 2GJJA 1FG2A 4I3SH 5F93C 3VFPA 5DMYA 4XBGA 3TFKC 4CADB 2B1HL 2R2BB 5D4QA 1X44A 3UTQA 3OKNA 3DUUA 3QO1B 1QLEL 1AXIB 1FNHA 2Q7NA 5HDBF 1FVEA 4L9LA 2R29L 1MIML 5HDBE 4GW4B 3G6JA 4HW6A 5JW5B 2BNRB 5CZXD 3AB0B 3C09C 4NBZB 1FJ1A 1V3LA 4YHKL 4EUPH 3LQAC 5I1AA 5FF6B 3MLUL 4OQTA 4X5LA 2CIKA 3A6CH 1ERNA 1MEXL 3GSOB 1JZ5A 3GRWL 3WO4B 4X6DB 1PKQB 5FKPB 3UDWC 1KB9J 5I8EA 5FO9A 1C5DB 4OCRL 2D0HA 4TPRH 1FE8H 3BD4A 4XP6L 3SCMB 1MPAH 2QQNL 5T1MA 3ZKMD 3LHPL 2P43B 1DCLA 4KTEL 3RWGA 3IXTB 1KTKE 3FQWA 3RWHA 2EIEA 2VXSH 4OD3H 2EDHA 4XNQA 3GJFB 1NGXA 5KSAC 4Y5VA 3MUZ1 1SM3L 2DQJH 3B8SA 1T83A 2VDOH 2YD2A 3T65B 4J3TA 2BC4A 3NGBB 5E2TH 3P11L 5GGVY 2VLJA 4M7LH 4X6FA 2BVPA 1IGYA 1G6RB 3TIEA 5B3NA 2BNRE 3LKNB 2IH1A 2PYFA 1E6JL 5J12B 3TC9A 2NY7H 4ZUUA 4LHUB 2Y7QA 3S37L 1ZV5A 5EN2B 2P5WA 3DSFH 4X6DF 3GM8A 4MX7A 5JIKA 1PKQE 3OAUH 1EAJA 5E2VH 1B4RA 1IBGH 2KZ1B 3P4OA 3CDYA 3ZE1F 4U1MB 3ZE1E 1WFUA 1FHGA 1FLRH 5AD0A 4F7PA 1C16A 3B5HA 5DRNB 3RVVC 1ES0B 3LKOB 4UOJA 3ARFD 4F2MB 3PWPA 4NZRL 4P3WA 2NY1C 4HAFA 3GSNA 2C1OA 3IKCA 1JZ3A 1FNEA 3SKOB 2PR4L 3TYGL 5E2TL 3Q5TA 5CJBA 3VH8B 3BN9C 3VJ6B 1GGCH 5TE4H 1EX0A 1GZPA 4MD0A 2GITB 4MD4B 5DWUL 2NY7L 3D3VD 3RWCB 2VDMH 3RBSA 2XA3A 4L8BA 4X80H 1GOFA 4K23L 3FN3A 5I1IH 4IRJD 3SBWC 4R4ND 3CMOH 5CIPB 4WO4B 4N9GA 4Y16D 5FYKE 2X70B 2WK2A 4M8QB 4U1LB 1ZANH 3IDUA 4W4NA 2DQFB 1D5BB 4Y4HC 2NY2B 1A7NH 4N8PA 5KSVA 2PW1B 1QRKA 1PQZB 4HCRL 3ULSA 3MA7A 4JKWA 1GAFL 3PE9A 3T4AA 2EYRA 4Z7QF 4Y4FB 1HI6B 1N6VA 5BZDA 4Z7QE 1EO7A 3KPSD 5TE4L 2ZUQB 1YEDB 3UPAA 4QRPE 4KI5F 1D5ZB 1VERA 5TH2B 1KJ2A 2H2PD 2GY5A 2GJ6A 4X80L 5TPWH 1F11B 1MJUL 5T3XL 3K8KA 5I1IL 1CICC 5JOPE 4JHWH 4NBYB 2VQ1A 1I7RA 3PNWA 5EBWB 2F54E 1ADQH 4O58L 4RDQG 1BQHG 1OAZL 4M6OL 4U6HA 4RWHA 3X11A 4LCUB 1DQML 3RDTC 5D7JD 5GGSY 2X09A 1ZANL 2L7JA 3RGHA 4TVPE 3D5OF 2R0ZH 5CGTA 1S78D 5C6TL 5IBUB 1IAIH 1E4XI 1UZ6F 4MDIB 1A6PA 3S98A 1UZ6E 3V4UH 5K9KA 3L7FB 1YDPA 4XNXH 3V6ZB 3ARDD 1S7UB 4NZDA 1DUYA 5SWSB 1G7MB 3SDXA 1EFQA 2O5YL 1UVQB 2OMNA 3MLRH 4GRMB 5IMOB 3SGKC 4HS6A 1T4KB 1NGQH 3QNZB 1RIHH 4JB9L 4G5ZH 2ENSA 4LLYA 2A1WH 1RZGB 2VDKH 4W6WB 3CUPB 3QISA 5EC2B 5A2IH 1WVZA 4QTHA 1PSKH 2NY5L 4WGVB 2UVEA 5DD3L 1IM9D 4OLWH 1OWWA 5IB3A 1UENA 4OFDA 43C9B 3CC5A 1KCUH 4OKVA 3OTTA 2VDRH 3ZKXB 2NX5D 3MRKB 4TQEH 4HD9A 1FG2B 4DGVL 1WIUA 4YUEH 3E8UL 4K07A 5LKNA 4XBGB 1PJ9A 3F12A 2DQDH 2KL6A 1KOAA 3DUUB 5DHYB 3DXAA 2AQ3A 2OQJA 2EDFA 3CVIH 3GBML 3W0WD 1I1AC 4F80A 4L9LB 2RJMA 5GSRB 3EYVB 4IJ3C 4ZQKA 3G6JB 2FLBT 4NWTH 1FAIL 5HYJD 4NM8H 1FJ1B 5T3XD 3PWVB 4GT7A 3SDAC 4OD2A 4RNRA 4ZOCA 3MRJA 4ZO6A 1JFQH 3GK8L 4RWYL 4O5LH 1K8DA 3QZWG 3TIDA 5I8EB 3IKKA 6CGTA 1OAQH 5SX5K 4GG6F 4PB9H 3MRNA 3EHBD 4P2QB 2YBRB 3RWEA 3G6AB 3OG6B 4WTZG 5T1MB 4WHYH 4U0RC 3O8XC 1QSEA 5I71C 2WIIA 2X05A 4Y1AA 2PO6B 3WSQL 4Z5RB 1V7NL 1JYVA 2F5AH 3G5VB 3RWGB 5JZ7C 3NCEB 3CXHJ 4LLDB 1YY8A 3FQWB 1E4XH 2BVQA 2XACC 3RWHB 2X1XR 4NWTL 4F9LC 3DO7A 1FGNH 1JPSL 2OYPA 5FDWA 3LCYA 4XNQB 2AK1H 1XGPA 4ONGL 1NSNH 5BRZD 4N5EC 4ERSH 4Y5VB 2AI0H 2ZG1A 4BZ2H 3C9NA 3WXWL 3AREC 3RU8H 4DUXA 1CYGA 1PG7L 2XKUA 3O81A 3NAAL 1ZGLA 3G6JF 1JVKA 1UWXH 3DYMA 4X6FB 2BVPB 1OAQL 3G6JE 4OGAC 5CS7A 5TE6H 2IH1B 4LSUH 1AHWC 1S9XA 1LEIB 1MFEL 5ICZA 3FO0H 1B2WL 4H0GA 1Y18A 3K2UL 3W9EA 2Y7QB 5ACLA 2P5WB 4ALAH 4RGNC 4GRLC 4OCWL 1E4XL 4PJEA 3P4OB 4GO6B 3T8XA 4TNVK 4U2ZA 1CFSA 3EOBA 1IKFL 4P2QE 3GFUA 4LVHC 2ZCLH 5AD0B 1C16B 3QWRD 4P46A 5C08A 3SE8L 4ERSL 2OK0H 3UJIH 5E0QA 3EYSH 3HNVL 3MLVH 2V17H 4DN4H 2ADIA 2LE9A 3IKCB 3VXRA 5HHOB 1FNEB 3QEQD 4GKNB 5HI5D 1EEYA 1T7YA 5IVXA 5KJRH 3C5ZC 3KWWA 1VHPA 3CFJA 3T0EC 2FSEB 4OI8A 3CMGA 3OL2A 4HQQL 5CUSH 3QP3A 4L8BB 1UZ8B 1OAKH 4HJ0D 4MJ4A 4M8VA 4HBCL 1G1CA 1RFDH 3DUSA 3V4VH 3GDBA 5HGAB 1A02N 4N9GB 2A6KB 1G1YA 4P2OD 1DBKH 4RA3A 4Y5YA 2BCKB 4K3DL 4Z7NF 2OK0L 1RHHA 3BMWA 2XQYK 4Z7NE 1WT5A 4FQJH 3HAEG 4MA1C 2QHLA 4QRSA 1R6VA 5CP3A 4CDHA 4F57H 3BRGC 5EU5A 5KSVB 5IG7A 3P9WB 4GS7C 3VDCA 1Z0MA 4Q6IC 3T4AB 2EYRB 2J88L 5BZDB 4LPCA 2NNAA 4RMUA 1UYWH 3R8BB 2I60H 4BH7B 1KJ2B 2GJ6B 5C0GA 1R24A 1IGJB 4K8RL 5I15L 2AABL 5HHOE 5CD5C 2C3XA 5L9DH 4Y2DA 4ZD3L 3PP3K 3CX5K 5ITFA 3GNMH 2VQ1B 1I7RB 3PNWB 4BELD 3REVA 1VFUA 4I2XA 1T0MA 3ZHLA 4K7PL 1O5DT 3V6OC 4F58L 1UACH 2XN9D 1IL1A 5IGXL 1X5AA 1BBDH 5JIIA 2FHBA 3B2UD 1XIWC 2UV3A 1KPRA 2VXTL 1YECL 4GRWB 5F7KC 4GAGL 4HS6B 3BGFB 3OKKA 4LVNC 4M93C 1EJ6A 2H2SD 4LSVL 1ZHNA 1WQVT 4LLYB 3TA3A 4XP5H 4JDTH 1TVHA 4BQ8A 4OD1H 1FZJA 1JHTA 3P4NA 4QTHB 3S3JA 1NMBH 1QFWM 3FB5A 1OD7A 5LWYH 2G75B 1DVFD 2ZWLT 4ISVB 3O2DH 5IB3B 5DA0B 1TQBC 1RMFL 2GJ6E 3UXFA 3P0VH 5CFHA 1N5YL 3JWOH 1BBDL 1U8LA 3H9SB 5L2JA 2J8UE 4KC3B 2MTPA 1MCRA 1ONQA 3I6LD 4K3JH 1MCWW 3DXAB 2OQJB 3CFKB 5ITBH 1CDHA 5BS0B 4YC2C 1HSBA 1MCQA 2YA2A 3UTOA 4HUXA 1A6AA 4U6XA 5C0IB 1QKZL 3VMNA 4PJHA 2UY7A 4ZQKB 1CGUA 4JDTL 2HRPL 1IEHA 1KB5L 3FQRB 4R3SA 1CF8L 4K8RD 4U1NA 1OTTC 3WLBA 3H9YA 2ICWI 2F74A 3DMMD 4GRWF 3BYTA 4OD2B 4GRWE 4RNRB 5LGKA 3MRJB 4OZ4B 3WUWG 2HKHH 1K8DB 4XWOD 1RZIA 4OV6F 3TIDB 4U7MA 3WNMA 2VITA 3TT3H 1F4XL 1T0PB 1QZ1A 1NMCB 4NKIH 2OL3H 4I5BA 3RWEB 5K9QI 4NN5B 4PR5B 4YH6A 3TPKA 1I8IB 2HN7A 5ITBL 5C07B 4MCYB 4HC1L 4KZDL 3T2NH 5GS1B 5I18L 1IAOA 5HBBA 1WSST 4LLQA 1GC1L 5CGMA 4U6VH 4ZS7H 3H9SE 1ZT1A 2A9ML 2VDLH 1WEJH 3QCTH 1TTGA 1FGVH 2R56L 4EVNA 2EE6A 5BS0E 3HCVA 4LPVA 4MXWL 1HHHA 1KIRB 4TOYL 1ZGLB 4RFNB 1FFPA 4HFUL 4QHMA 4LGRB 1LO2H 3RRQA 1YC8A 3U46B 4EQ3A 3EFDH 1S9XB 5KSUA 3QUMB 5D7LA 2W0KA 4CJ0A 5ICZB 3NCYS 1Y18B 3FOMA 1HHIA 4U2YA 3W9EB 3FFDA 3SKUD 3JUZA 1BOGB 1ETZA 4KMTH 4K94C 4PJEB 3CFIC 5IHUH 3T8XB 3BMVA 3EOBB 2GAZB 1WEJL 2ZUSA 4IDJH 5C08B 2NZIA 4P46B 1IGFH 1U3HA 4N8CL 1HYSD 3V2AR 1B9ZA 4JZNA 2A83A 4NHCH 3VCLA 2ADIB 4YDVA 5C07E 3VXRB 1N8ZA 4J6RH 1OCWL 2UYLB 5C1MB 3RGVA 1SEBA 3KPMA 2XKNB 4R90L 2N4IA 3VXTA 3CFJB 15C8H 5EZOH 2YSSB 5DJ2A 2XNAA 2GSIA 3WD5H 1K5NA 3L6FA 4P5TD 4OSUH 4KMTL 4NNYA 1FO0H 1GJIA 3DUSB 2EIZB 1AFVL 5ENWA 3EOTL 1IGFL 2JB6B 3OHXA 1G6VK 3VFNA 3L3JB 4ZUSA 3ZYZA 1RHHB 1QA9A 1T2QH 5KANI 1S5IL 1WWCA 5MI0B 2AQ1A 4PRPA 5EU5B 4YPJA 3I75B 4PJEF 4BQ9A 5IG7B 4LCCC 1LE9A 4OCXH 1L0QA 1EJOH 4NQCD 4JKLA 3ZSSA 1HK6A 4ONOA 1ZLWK 1CL7I 2HWZL 4TSCH 4DVRH 4YHNA 3O3EA 4HS3B 5J56B 2G60H 5C0GB 1R24B 3MJ9L 2BY2A 4Y2DB 1YEHH 1CGTA 3D85B 4FQHA 3MYJA 3REVB 5IW1A 4UILL 3MJ8A 1A2YA 4UI2A 2X4TA 3VGBA 5JHDD 3PDGA 1T0MB 4OF0A 1CDIA 5IBTH 4CVWA 3STZA 4BUHA 1NEZG 5DLML 1KLFA 4Z8FH 3O4OB 4RZCA 2IG2L 5IESH 3ILPB 4LLVA 4KDTC 1J1XH 1U92A 2J8OA 2D03H 1MQ8A 5ADOH 3OKKB 4YHML 1UEYA 3V7AE 1QTYT 3TNMB 4HWBH 4NC1C 1ZHNB 3TA3B 5LCVL 4KROC 1ZVHA 2DQIH 4FQQB 2F5BH 4S0SD 2D9CA 3FB5B 1YJDH 3BWAA 2R2EA 3V5KA 4H8WH 3QUYC 4NDMA 3VWJC 1KBGL 1IGIH 4AIZA 3ARFA 4NNPL 3T3MF 4OLUL 3T3ME 1EGJH 4O9HH 3MLXL 1O0VA 5EZLB 4CN6A 4HF5L 1IC5H 3Q5OA 1P1ZA 3QBTB 5HDLA 3CLEH 1OQOA 3MV8D 1V5JA 2BMKA 3MREA 3VWKA 1YZZA 3D3VA 4HUXB 4U6XB 1A5FH 1EBPA 2VXUH 2I9LA 2VRAA 1A7OL 5ID1A 5CINH 1FVCB 4IRJA 5ANMA 2NY0C 4IRSD 4R3SB 2VR9A 5EORH 4HFWA 2F74B 2OMBA 1CL7H 2ARJA 1WC7A 1KC5L 2IBBA 1O7SA 1LO5A 2QADD 3G04A 3PJSA 4Y8AA 4MCZA 5D1ZC 4EUPA 2B2XH 1A7BA 1WCBA 3HZMA 3KPPA 1ZVYA 5F7MC 1P9MC 4MYWB 1DQJA 2FLRT 4YDIH 2GQHA 4R0LA 4NZJA 2WP3O 2HN7B 1Q94A 3GIVA 1KCSH 1LDPH 1RZFL 4WU7A 4B53A 4HG4K 1UCBH 4LLQB 2AVGA 1TDQA 1UH2A 1JZ4A 1EUTA 3IJHA 3VFVB 4KKBD 4J4PA 1J5OL 5C92A 1Y0LB 2VZVA 4LOUD 4TYUA 2LABA 1CZ8H 1CL7L 1DN0A 4LKCA 3D6GA 3HCVB 5D7JA 3MLZL 5IROA 1HHHB 3NPZB 1FFPB 4XBEL 1G7HA 2DBLH 4JPVL 2Z93A 1D6VH 5KSUB 2OJEA 5D7LB 2ARJQ 2C4XA 5J1AB 3SKNA 1QHOA 4H25B 1HHIB 4KWUA 2ATPA 3ARDA 2VUYA 5BV7H 5C3TA 4NP4H 4NYLA 4UT9H 1LWRA 1UCBL 3MMEA 3QXVA 1KGCE 4KKAD 5GZNC 1BZ7A 1ZA6A 2DQCL 1N0XL 4P2CG 2IPKA 4O2FB 1U3HB 5FYLH 1XGYL 4J1UA 3D0VB 3SE9L 5ESVB 1IGTB 5FOBA 1CZ8L 1HNGA 4JZNB 1QLFB 4C54A 3VCLB 4PTUA 4YDVB 1N8ZB 4UDUA 3TO2A 4YR6A 4X0KA 1CWVA 2F53D 3VXTB 1QPPA 1T1YA 5JQ6L 3TPUA 3TH2T 1BJ1J 3V79C 2QSVA 1EH9A 4FTVD 2IADA 4HCRA 2XNAB 1MAMH 4GW1B 5EULV 1K4CB 2GSIB 3B2VH 4PJAA 1K5NB 4LDOB 1I3UA 4ZFOA 4NNYB 4H1LA 1BHGA 4OFYD 4ZYKB 5ENWB 3OHXB 3SE3A 3VFNB 5F8QC 4ZUSB 1P6AB 2D9QB 1RZJC 4U1HB 2WINA 3WIIL 2BSTA 3MRHA 1NC2A 3BPLC 5FO8A 3JV4A 5H35A 3QXWA 1LE9B 3KHOA 1TZHA 1T3FA 5FXCH 4IMLA 3MNVA 4G8IB 5DC0A 2VLRD 1FZMA 3NMEA 2NLJA 5D2NC 4YHNB 1HDMA 3TNNA 5GRUH 5I6XC 5FYJH 2Q3AA 3CFBB 4R2GC 4V2BA 1DEDA 3V4PL 4Q9QH 1OQXA 1QPXA 4FQHB 3V6FA 3MYJB 5IW1B 2V5RA 3VG0H 2GUOA 2RQ8A 1JNLH 3MJ8B 4UV4H 1A2YB 2A38A 4PJ7E 4C83A 2M1KA 2ADJB 1FIGL 4IHOB 5BRZA 5I2IA 4N0YH 4OF3A 3STZB 1CLCA 3Q3GB 5E6ZA 3TWCH 5I16A 1W0YT 4ZS6C 2YXFA 5DVKA 4RZCB 3S6CA 1P6FA 2Q87A 2FDBP 1IAMA 2VXVL 4LLVB 2PW2B 2E8YA 3O0RL 4Y88A 3V0WH 4P49A 5JHLL 4J3WA 1BWMA 3ARVA 1W2KT 4QHNB 1FNGB 3S5LG 2E7LC 2W60A 1QHPA 1E4KA 5DRZA 3KPLA 1EPFA 2EXWC 4PRIA 1QQDB 1EEZB 4KAQL 1FCCA 2AJSL 5IQ9A 4OTXL 4LU5H 3S36H 3V5KB 4HLZH 1F97A 3KJ6L 3QWRA 4KHTH 3MLPA 2EE2A 4OCSL 1P7QA 4O02L 4AIZB 3K2MC 3ARFB 4IRZL 3MA9H 4OM1H 5DC4B 5D70L 1F4YH 3FQTA 3QEQA 2A73B 3HPLA 5CWSA 1QP1A 4M7ZC 5J6HB 1P1ZB 3AAZA 3CSPA 3GMOB 5FM4A 5A16B 1IEAA 1L7TH 3MREB 3NA4A 3VWKB 2K3TA 3EJYC 3GMPA 3D3VB 1RJYB 4RAHA 2N56A 2I9LB 5ID1B 2CIIA 1F6FB 2CQVA 2E3VA 3MOAL 5J13B 4IRJB 4X5WA 3V9FA 3MCKB 1IC7L 5E8NA 2ESVA 4U1GC 1NDMA 3EJZC 5K9JH 1HE7A 5IK3B 5GGVH 5JW4Q 1CD9B 1NMAL 4Y16B 4P2OA 1INQA 1LO5B 1LK3H 4MLIA 1ZGLM 3PJSB 4XPGL 1WCBB 4YXHH 3HZMB 3ABZA 4OM1L 3KPPB 3C8KB 4AYFA 3CZFA 1TVDA 1I7TA 1NC4D 1LE5B 3VRJA 4R0LB 4E9LA 2D7OA 1J1PH 4XP1H 4NZUH 2ZCKH 1Q94B 4LSSL 1DQTA 3R8QA 4FQIL 2PF6A 1OAYH 1BPVA 2EDRA 2VR4A 1OB1A 2C3WA 5JIHA 4XHQA 2Z8RA 3BO8B 4OFIA 4WW2A 3FL7A 1QBMH 3T4YB 3K8LA 1VGKA 2HAZA 5K9JL 4KK8C 4XXDA 4LKCB 1E27B 4MAUL 2FEDC 4K7PX 3ZDXF 3Q1SH 2XQBL 4NZTH 5D7JB 1G0XA 3D3VE 3ZDXE 5DUMH 5I8CA 4LNVA 4KZEL 1U95A 2Z93B 1KEGH 5IMMB 2OTWA 4XB7A 2J7LA 5KVDL 5B38B 2WW8A 2IQ9L 2GFBA 3B9KD 4KGLA 3SKNB 3WBDA 3ARDB 3TT1H 25C8L 5DD6A 3KYMA 4NYLB 1LO0L 1F8TH 3Q6GH 4LLUA 1ZA6B 3FT4A 1HILA 4ZO8A 2IPKB 3D1MC 1Z3GL 2ZCHL 4J1UB 1ACYL 1Z0NA 3KG5A 5TDPB 4HBQA 4DCQA 4BSWB 2XY1A 3KPSE 4U3XA 1DVFA 1CG9A 1IM9B 4UDUB 3Q1SL 4PJ9C 1QACA 1NCWH 3MBXH 5DUML 1I3GH 4JO1H 1CXKA 3IDMB 1A9EA 2MHAB 4GQPH 5SWZD 1ZXQA 3FQUA 1KEGL 4D8PA 3TPUB 5BQ7B 1WGOA 2HLFD 1WWAX 3ZE2F 4DEPB 1CE1L 3ZE2E 4QTIL 1T1ZB 2IADB 2R1XA 1OF2A 4P9HC 4PJAB 3FJTA 1R3IL 4XI5D 3WFHB 4DW2L 5E5UB 4H1LB 4I18B 1HSAA 2GYSA 3SY0A 2LU4A 1YMMD 3VFWA 2XZCH 2OJZH 4JFZL 3DMMA 4LFHD 4DN3H 3TVMC 5ACZA 3QEGL 1J8HD 1ROWA 4Z7VB 3JV4B 5AAMA 4XH2A 5I1HH 3BD5A 2X89D 3MNVB 4CW1B 3RPIB 4XPFH 5D96C 2NLJB 1R3JA 3MRPA 3WXVH 3FFCD 4C59B 3VE0A 1DN2A 1JF1A 4LPXA 3QNYA 2PCPB 2NX5E 1AGCA 2JELL 2C3VB 1RK1A 1K8IB 2XZCL 4U6YA 5BRZB 5I2IB 5KTEL 4PLJD 4PJAF 1YEIL 5CMAB 3W0WE 3JWDC 3QHZL 3QQ9D 4GAYA 4P3DA 4CMMA 5I74C 4BQBA 5I16B 2G5BA 1RVFL 4LSTL 4F7MA 1RUKH 1S8DA 5HYJE 4S10A 4HULB 2FYYA 3U1SL 5T3XE 3MXWH 1AXSA 1Q1JL 4PRBA 4KJWD 1CLOH 5F72S 1BZQK 4LF3B 2ICEB 2AJZA 3BVNA 4GXUN 3H3KA 1CGYA 5LXGH 4Z7VE 3VXOB 4JY5H 2E7BA 5IQ9B 1RU9H 1W72L 3ZZ1A 2FIKA 4R4BA 3IFPA 3S7GA 2Y23A 4OB5H 1OM3L 1KB5A 1PZ5A 3ILQD 1JGUH 3VXMA 4QWWC 4OLVH 3QEQB 5KVGL 3UYOD 3D9AL 2YR3A 3WFZA 1ZEAH 4U31A 3AAZB 2Y25A 1AO7A 1IEAB 1ZHKA 5BRZE 2VABB 5F3BA 1KT2B 5E08H 5JA8B 2V6HA 1CLOL 4E41D 5JMRA 2ZOKA 4F3FA 5F1OB 1F3DH 3FQXB 4P5TA 3DV6B 4U1SA 4HMCA 3LQAH 5E8NB 2EH8H 2M26A 5DI8B 5DVNA 2WIMA 2DLFH 3HC4L 4MA3B 4P2OB 1SBSL 5IHBA 1CS6A 5D1XC 2DS4A 2P5EA 1ZLWH 2HT3C 4L3ED 1A6TB 4RFOL 1KXTB 2ITDA 3CZFB 4M5YL 1I7TB 4JR9L 3I6GA 4X6CA 3QCUL 1TJIL 2UZIH 4NQCA 3RPKA 1T80A 1C12B 4NUJB 5HXMA 2VL5A 2IC2A 4JGMA 5CILL 1CDGA 5GRVL 3DBXA 2IFFL 1MWAL 3OQ3B 1RIUH 4XVTL 1ZLSH 1IT9H 1OB1B 3QEQE 1T6WA 1LQSR 3DX8A 4F9PA 3DRTB 3LQAL 4PG9A 4QXUL 1SVCP 1WBYA 2ADGB 3FN0H 4G6ML 4X83A 4XXDB 2BSRB 4Y19D 4HKBA 5TQ0H 5JHDA 5GHWL 5EOCJ 4J2XA 5I8CB 2ZJSH 2XN9B 1UQSA 5DJ6B 2VNCA 5EWIH 5F7UA 3UEZA 3BP5A 5IFJA 3KJ4C 3FO1A 3OR6B 4Y5YC 2VJXA 4LEXH 2OTWB 4YZFF 4JREB 5I66A 1OAXL 1WT5C 4YZFE 2ZSVB 4Z7OF 4NJAL 1ND0B 2MKWA 2MQCA 3EW3B 1NCDH 3MRIA 1AE6L 3KYMB 4XTRD 4PPTA 4R97B 1FC2D 4RGMB 3CXDH 1UKQA 3BKCL 4X9IA 4RGOH 3FT4B 1ZLSL 5FYJU 3S97C 4FZ8L 5IBLC 4BYHA 3RKPA 1FPTH 1MRFL 1NBYB 3GSUA 3LD8C 4X6BA 5ISZA 5DVLA 2GSGA 3O6FC 1UWEH 1MJ7L 3ARBC 4OGXL 4W6XB 1DVFB 1CG9B 2R4SH 1YY9D 4MAYD 2CGRH 4FHBD 4WHTB 4UNTA 1A9EB 1RUQL 4LEOA 5DK0A 5EWIL 5GRJH 1YN7A 3FQUB 3VFUA 3BPOB 4D8PB 4UIMB 4XCFL 3WIFB 2NY4C 5DD1H 4OBSA 2G5RA 1NL0H 3CSYB 3X12B 5I1EL 2R1XB 1WICA 1YNKL 1OF2B 5E6YA 3TFKD 2XZAH 5F1SA 2YN5A 3MRGA 4YHOL 3NIGF 4JVPA 3HTLX 5C09D 3NIGE 2XN9E 2UWEB 2ICWA 5J3HC 1C5CH 1AGFA 5I9QC 1HSAB 1FPTL 4GKSB 4N0CC 2K1MA 2PN5A 3SY0B 4IRSA 1G7LA 1OGTA 1UWEL 1MFCL 3AS0A 5CZVL 3VFWB 3EYQC 3DMMB 4BUGA 5FHBL 5ACZB 1FO0A 4QY8B 1LNUA 3BT2H 4IMKA 1VENA 1SYSB 4XH2B 3D87B 4ZAKA 4U6TA 3FT3A 3ZHDA 4MNGE 1PZUB 5L2KA 4JY6B 4KKLC 4X4YB 4XWGH 1R3JB 1NL0L 3ULUC 3NZ8A 5HHME 1BM3H 1UB5A 3JTSA 2QHRL 3O41A 4MNQA 3CFCH 1JF1B 5J11B 3CLFL 3QNYB 3GMNB 4HIXH 1LP9A 1R5VA 3L7EB 1I8MA 5CP7A 1HXMA 2EEAA 2R0KL 2DDQL 2XWBB 3BGMB 3UZQA 5HYEA 1JK8A 4K3EL 4U6YB 4JRYD 1EO8H 1VACA 3D18A 4MJ2A 1CGSL 5B4MC 4P3DB 4GAYB 4CMMB 1UJ3C 5KSAD 4BSJA 5IVOA 2C5DC 2UWEF 2G5BB 1DFBH 3O3AA 3BUYB 2UWEE 4Y4KA 1S8DB 1TJHH 3ARZA 2FYYB 5FK9B 2Y5TB 1K85A 5FGBA 3RA7H 2IH3A 4RRPG 3LIZH 3ESVF 1JWMA 1T1WB 1XAUA 3BI9X 2HT2D 2Y06H 4XAWH 3RZWA 4F7TA 2V2TA 2P8PA 4BZ1H 2FIKB 3DI2B 1T7XA 3IFPB 3S4SA 1KB5B 3RY6A 1PZ5B 3OX8A 2E9BA 3RVVD 2WBJA 4KY1H 3GI8H 4HS8L 1MF2H 3CJJA 2NY1D 2EDDA 4PJXE 4Z6AT 3VRIA 1BQUA 2F53A 3FAXA 3LDBC 4TVSa 2X4PB 3C60A 4HAGA 5BZWA 1ZHKB 1EGJA 1F58H 3BN9D 1S7SA 1LO3H 3H6JA 4FTVA 5D7SL 2CLZA 3NH7L 4NQED 4LSPL 4TNWK 4TULL 5IHZA 4P5TB 2Z35A 2QLVB 1WZLA 3FHQA 5B3JF 3L5JA 1I8LA 1MFBL 4WDIA 4UZGA 4JHAL 1PLGL 4GBXD 4LNRA 1DLFL 2APFA 2FL5B 5EU4A 5JLZB 2ITDB 4Y4HD 2ATKA 4BKLA 3ZT5A 3W9DA 3I6GB 4JM4L 4NQCB 1D5IL 4WUUA 2CH8A 2BFVH 2VL5B 5E4EC 3DBXB 3M1BA 5EOTB 3RGVC 1CCZA 3KYAA 5CJOL 2X40A 1MCLA 5JW4N 4KVNH 4ONFH 2CDEA 5GRWA 1CICD 1WBYB 3QPQC 4JFOA 4LQ1A 1PAMA 2XZQH 5JHDB 3MLWL 3OKDA 1DQQA 3F5WA 3T0XA 2H9GB 2DMCA 3QAZB 3RDTD 2EICA 2RAMA 1UQSB 5IFJB 3LRHA 3FO1B 5DQDH 2FD6L 2D3VA 3HFMH 1X5HA 4NQSA 4ODUA 4AG4L 4YBQC 5HI4C 3VGDA 1FZKA 1E28A 3MRIB 4UTBL 4YK4B 4Z7WA 5L8LB 3PDOA 4QXTA 2J5LC 4HPYL 5D71L 5T3ZL 3MFGB 4IS6A 3OR7A 4X6BB 4PGZA 4M7KL 2HVJB 4NQCE 1OP3K 2FX9H 4DFIA 2AJYH 3QHFL 5I8OL 3VU2A 3WNOA 5F70A 5DA4A 1YN7B 3VFUB 2FWOB 3V8OA 4OM0H 4UT7H 5ADPH 2OXHA 4ELMB 4ZXBA 4LGPB 4AEHH 5B8CB 3ULVC 3MACH 5JHDE 4YBHA 4TSAH 5IFHL 3MLTA 3MV8B 4FQXA 4GXVH 5DQ9A 4G7YL 1L0YA 2ZPKL 1I1AD 4UT6H 2NTFB 1AGFB 5E2WL 1RK0A 3N1FC 3Q5YA 5EH1A 1TITA 4IRSB 1OGTB 4O4YL 4WUKL 3GMLB 3OG4B 1XEDA 2JLLA 5HYQB 2FGZA 5I8KL 1F2XK 1LNUB 3SDAD 3SE4A 2P49B 3PHQA 2QADB 1U0QA 3I2CL 3KR3L 4YJZL 4U1IB 4OI7A 1A0QL 5JW3H 3I6KB 3NCFB 3VG9C 1F4AA 2VL4A 2Q1EA 1V7ML 3CFEA 4G8GE 4UT7L 1NC4A 1QBBA 5DRWA 5ECJE 35C8L 3MRLA 5IT2H 1BFOB 3MNWA 3C5SA 4PRHE 2XG5A 4GXVL 3O8XD 3QI9A 1OD9A 3VD9A 1NBQA 1WAAA 3NIFF 4ELKA 1MHEA 1LP9B 3MGTA 3K81A 5JZ7D 5CP7B 4LCWD 4WFHD 4ELMF 2GJZA 4ELME 1B6DA 1JK8B 5T3ZD 1CD1A 1TJGH 3CVHL 2EO1A 3D18B 5KVFL 2Z8VC 5F9AC 4CUCA 3MV8E 1FL6A 4N5ED 1X7QA 4WEMB 1EDQA 3UBXI 3O3AB 3ARED 1B0GA 4GMSL 3WKNA 1RUPL 5AWNH 1UM5L 1H15A 2VWEC 1LO4L 4OGAD 3IJSA 2WUCH 2IH3B 3C08L 1JWMB 1WZ1L 1U8MA 3QB7C 1RURL 3BIAX 3G9AB 3OKEA 2AGJL 4FXLA 3RX7A 1F6AB 5DRXA 3QULA 3TJEL 2V2TB 2EE9A 2JJUA 2VZUA 1NFKA 2G2RA 4RGND 2P8PB 4GRLD 2VDQL 4N9OB 5C0FB 2WM0A 4I3RL 2E9WA 2VOTA 4NUGL 1J88A 3OX8B 1BFVH 4XNUL 3PV6A 2PYED 4IIQB 3RZCC 4CVZA 4J4PC 1LP9F 3N06B 1YN6A 5SWZA 3CK0L 3VRIB 2F53B 1M71B 2FO4A 1A6VH 1JE6A 1JTPA 5BZWB 4GLRH 5IROC 3C5ZD 1DE4B 1S7SB 4UAOB 4L9DA 4O2CA 1DL7L 4FZEH 3T0ED 4FTVB 2CLZB 4X99A 1KN2L 4WWKA 3QO0A 5DJZA 5DR5H 1I7UA 2VC2H 5HGGS 5CBAA 1A3LH 4L3AA 1MFAL 2FATH 3BDBA 2E7MA 3H3PH 3L5IA 4XPAL 1PEWA 2MFNA 2YPVL 4OT1L 5F7FA 3PQYA 4QRTA 4WDIB 1JMXA 1UXSB 3Q48A 2D7TH 2YD3A 3RWFB 3VFRA 3TBYA 4EOWH 2DQGL 4Q2ZB 2Q8AL 3TBSA 3U36B 3L3OA 1J8HA 4ZNCD 5I1GL 3SDDA 1XH3A 5J8OA 4BKLB 3W9DB 1FNAA 1V3MA 5DUBB 2WAHA 4OZIA 2VLRB 3QG7H 3HI1A 2BOBA 1TNNA 4JFXA 1TENA 3FRUA 1C1EL 4UV7H 3NBNA 3FFCA 5CEZL 2AAVA 2CDEB 1GXEA 5CD5D 5J9PA 3VMOA 2F53E 4JFOB 1AQKH 2EC8A 4ODXA 5HPMA 3BRDA 4XMKH 3V0VA 4OLXL 4YDKL 3NA9H 2D7TL 1DQQB 4PJBB 3F5WB 3UZVB 2DN7A 5DHVH 4JO3H 1T2XA 2KUTA 1VADA 2HJKA 1CE6A 4ZDHA 5AZEH 4X7SH 5E8DH 1VESA 5A3IC 4KTYA 5T5NG 3SE3C 3TLRA 4Y5XA 1JGDA 3I50H 4N0UA 4NQSB 4KFZC 4PD4J 1VGEH 5HVGB 3RX8A 1XIWD 4M6AA 4HXAH 1E28B 1RJLA 5E8EB 7FABL 3PDOB 4QXTB 5D72L 3U4AA 1PDKA 1TETL 1XT5A 4M6MH 2YPKB 2AW2A 4K94H 5EU6A 1H8NA 4FNLH 4IS6B 3KXFD 2EH7L 3OR7B 5D8JL 3DVNA 2HA1A 2VLRE 1J18A 4GH7B 5JDJA 2ED9A 2FCBA 1C5BH 1G9NH 2GK0B 3DLQR 4U4BA 2CKNA 5E8DL 1UJTA 3QJHA 4NQDD 4RQQA 3STLB 1DQLH 1S3KH 1JYWA 3TBVA 1UH4A 4AL8H 3ROOA 3SN6N 3KNBB 4AY0A 4PJBE 4XPHH 3MLTB 5DQ9B 3LB6C 2DYPA 3MRCB 1UM4H 4K94L 4EI6A 5IB4A 4FMFA 4XGZA 3UTZB 1MCIA 3QDGA 4G8EA 5JUEL 4LARH 5CEZD 5GGRY 1A7QH 1OTTD 5GGSA 4Z7WF 1E4KC 2VQUA 3O4LA 3I9GL 3RI5K 3PHQB 4MZ2A 5INCA 4PBWD 4QO1A 4X4ME 2Y5EA 3F62A 4LRIA 5FM5O 2XOTA 4L3EA 2I07B 5KVEL 2ED7A 1NC4B 4EUPG 3L3DB 5EUOA 1WITA 4XPHL 4PP2A 3NCCB 3P30H 3SKMB 1A1NA 3MOBL 4ELKB 3THML 3MGTB 2Y72A 1HZHL 1KPVA 4N1CA 3G6DH 4JDZB 1II4E 2GJZB 5KAQG 1WUNT 4LVEA 1MJ8L 2VAAA 2CDFA 4Y19A 2VKWA 1NAKH 1FL6B 3U9UB 1X7QB 4L4TE 1FBIH 5HJ3B 3PWUA 4OLYL 1JWSA 3E3QE 1W72A 12E8H 5MEND 1G7IA 2BNQA 1FL3A 4P5MA 1WK0A 3V52L 1BEYL 1FC1A 4ETYA 4HGKC 2W07A 1QOKA 1CLYL 3B9KB 1QBAA 1A1MB 4PJCA 1U8MB 2VR5A 2ERJC 2NR6C 3OXSB 4PRNA 2NY6C 5MHSD 4OJFL 3UTTD 2YZ1A 5HGDA 4EIZC 5L88H 3QULB 4NPYB 3O2WL 3VFOA 1ODAA 4D0DB 2AEPH 4P4KC 4FFZL 1HWGB 2D7PA 1TCRB 3FT2A 3NCJL 1PFCA 2AJXH 5HVHB 3QQ4A 4NO0A 4G3YL 4M48L 4F7EB 1DP0A 4CVZB 4EXKA 3H7LA 2VZTA 2AEQL 4FP8H 1BQHA 4WW1A 4WW2C 2R2HA 3HUJA 3KPRD 5SWZB 1QFWL 4QT5A 2F58H 1EXUA 5FUOL 4I4WA 4JFFA 4OF7A 3IDYB 1MVUA 4X99B 3L5HA 2Z92A 5DJZB 4WNQA 3BP4B 3OV6A 1OL0A 3P77A 5DFVC 3VXNA 3U2SB 3GKWH 3RWIA 1FN4A 4ZNEA 5J6GB 5E99H 4JG1H 1XGRB 5DQJA 5F1KC 1T03L 2DKSA 4QRTB 2X4UB 4P4RA 5DEGA 1MCBA 4JO4L 5HHVH 2ADFH 1J7VR 5E2UH 2B1AH 2P46B 2QR0A 1KCRH 3L3OB 2J12B 1J8HB 3WKML 1XH3B 4XCCH 1VFMA 4QF1A 2JCCB 4DGYL 1NCCH 4M1CD 3W2DH 2IBGA 3PIQB 1YEKH 2BVTA 3DX7A 2BOBB 4K2UH 4JFXB 1VFBA 2X1PA 1DUZB 2H1PH 5ESQA 1MCSA 3FFCB 4HLJA 4WVRA 3PXJA 4JO2H 3MZGB 4I77H 3RNQA 1RV6X 3BIKA 3VXSA 1T1XA