5IJBC

The ligand-free structure of the mouse tlr4/md-2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
136
structure length
136
Chain Sequence
QWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B chimera
publication title TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ijbC00
3WEAA 2E56A 3ULAB 2HKAA 1XWVA 3MTXA 1A9VA 5IJDC 2Z65C 5IJBC 2F08A 1AHMA 3B2DC 2Z64C 3RG1C 3VQ1C 3T6QC 1WRFA 2E59A 3VQ2C 1NEPA 4G8AC 5KWYC 3WEBA 3FXIC 5IJCC 1KTJA 3MU3A 3M7OA 1AHKA
chains in the Genus database with same CATH superfamily
4JQIL 4Y4FC 2GBUA 4J3OD 3LIZL 4LAQL 1ZSDB 2E56A 3FONA 1EEZB 5GRYA 1CDBA 1S7RB 2XV6B 3RPKA 2PO6B 1T4KB 1D6VH 3VMPA 3AM8A 5BS0B 2CHDA 5FYJH 5BZWA 1FZMB 3GSRB 4K3EL 5AYQA 1A3QA 3D39D 1IAMA 2H8PA 3W3BA 4JCMA 2WXRA 3FU7A 3TJHD 4I5BB 2OMWB 3E8UH 3GJFK 3KPMA 5C0NC 2DDQH 2WWKT 4Z7VF 1FVCB 2DWSA 3IM1A 4ONHB 5DJ8A 4E5XG 3ATEA 4UNTA 1MCOL 2FHCA 1F86A 4DPRA 4X8JB 2VUKA 4PLKC 1FV1A 1QZ1A 2BS9A 2VISA 4HJJH 4GKZB 3TYFA 5DD1L 1NCHA 2ATPB 4XNMB 4NC0B 2YQ2A 3QUYA 4KK6C 5D8JH 1LDPH 1DBBH 1R24A 1B4LA 2UX6A 5TFSL 4X4YB 2ZXDA 2I24N 1QD0A 4IEFA 2E5EA 1JYNA 1HL4A 5GGRB 4R7NA 4RAVA 4PB0H 1A4BA 1LP9E 2XX0A 3M8OH 2BH0A 5DMKA 3IFOA 4XC1L 1KFAL 4WW2A 1A6ZA 3X3FH 3BSZL 2L7JA 4MJID 4ZUUB 3P0YH 3OGOE 5D1XE 3RBGA 1P7KA 4FFYL 4LRNH 2XBZA 1JFQH 1IQDB 3M1CA 2JK5A 4YX2L 3GHEL 2AQRA 4ALAC 1TTCA 4L4TB 5IHBA 1GJIA 2FQEA 3ARYA 4LLYA 3N41F 2R0LL 5FK9B 2I9TB 1KYUA 4DN3L 2X2YA 4ZK8A 4K15A 4YHYB 4P9MH 3DRQB 1U2CA 2HWZH 1N8OE 5EV7A 3DARA 3TJEH 3ATBA 4A7VA 2WYIA 2DWEA 3RIAK 1BXVA 3KD4A 3KNBA 1KGCD 4PBWD 3WV0A 1OXYA 1UOKA 2FEDC 3CX5K 4GOSA 4UQ2B 5E2UL 4PJ7A 1T1XA 2Y7MA 1RJYA 5HI4D 4LASH 1JN6B 3D0LB 3V0HA 3QFJB 1IILE 3PJNA 4B3VA 2IWKA 2A74B 3VWJA 2J8OA 4WWKA 1EGJL 3I6SA 4N20A 4AVHA 4EF3A 2KL6A 3U4EA 4GKOA 5CLXA 4NPJA 2Q6WA 3BP5A 1MCSA 2P24A 3T3PF 5F7FA 3BYYA 1A25A 4OR1A 3F6LA 3E9UA 2WTRA 3UTSD 2DIBA 1BQHG 1S7QB 3EBAA 1ZANL 3H42H 4P2QB 1Q1JH 2YD4A 3IKCA 4HYTB 2DZEA 4O51A 4U3CA 5DDHA 4UIKH 2ZT9C 3B9KB 4Y1AE 5JW4M 2JXMB 1NM9A 1I1FB 2HVJB 4HAKA 4UV4H 4BK5A 3ULUF 3B9EA 3H2PA 4WU7A 3W39B 2ZOWA 4LEXH 4M1GH 4MXWL 3U0PA 4EI6B 2XTJE 5H94B 2GSGB 2ADGA 1KACB 2FRGP 1P5UB 2ICWA 2WN2A 4CMHB 3QXWA 4QF1A 5MEPA 3BGMA 1QPKA 4UQIM 2JTYA 2XIDA 2CG9X 2NY1B 5CZKA 1BD2E 1UHVA 3U0TB 3DRTA 1XIWB 2AQ1A 1TZIA 1U30A 3VTMA 2BX5A 1CTNA 1DQJA 1YEGH 1NCGA 4OM1L 3RVTD 4A2LA 4NQEE 1CC3A 1N68A 3Q1SL 1NZRA 1D6EA 1M1XA 1SFHA 3L3JA 4JRLA 5AAWC 1U8MB 4FI8A 3T1WA 5EOCJ 1VFUA 1LO3L 3QQ4B 4XR8C 4OFYD 1YDPA 4PG2C 3UCQA 1G7QA 2PPCA 4A7TA 4JFFB 5T1LA 3MLVL 5E4EB 1MAMH 3DIVA 3LSOB 4R3SA 4NZUL 4Y4KD 1K85A 4X0KA 1J05B 1LO0L 1CBVL 4P06A 4ABVA 1J86A 1M7DA 3IF1B 1PY0A 4J7RA 1ZK9A 3LD8C 4U7SA 5JUEL 4TQEH 5EOTB 2NMSA 1RHHA 3LKNA 4O2CA 4QOKB 2OL3H 4OUOA 4AV0A 2Y23A 4F92B 4FP8H 4YIQA 2DQGH 3VGBA 1DJXA 3UAJC 1G7MB 2WQXA 1JUFA 5DJCA 5FUZL 1IC5H 3NPSC 1RIHH 3OQ3B 4KK9C 5IHLB 3K8LA 5FW6A 1T4WA 4WUUD 3L3DA 3ZR5A 1I3VA 1OARH 2AW2A 2IIJA 4J1UA 3D2UA 2BNRB 4ZRGA 3EO0B 2NLJA 3KWWB 3UH8A 1RK0A 1S5IH 2WKGA 5T1MB 5MEOB 1QRND 4BKLB 5EC1A 3VUAA 4FMKA 3MLSH 2ZXAA 5T1DH 3FUEA 4XMKH 4J3UA 4JM2F 1RHFA 1YYCA 1ORQA 2WXKA 2ID5A 1TXKA 2A83B 3OKDA 2K0RA 1MFAH 2NDGA 1HHKA 2A77H 4HWNA 3QR2A 5B3JE 1Y6NR 3HFFA 3MODH 3MV01 4MJ4A 1UCBL 4N1CA 1CL7I 3QFDB 3D6GA 3I9GL 3L4CA 1YEFL 4AM0A 4LCWE 3RVXD 5D2LF 2D4FA 2HG0A 4XXWC 1RZKL 5D7KE 5EEWA 4G5AA 4NPYB 1NGZB 4L8SB 4M56A 5CAYB 1H6EA 2J6EH 4L1DA 2AI0H 5TGBB 3LVTA 3IBOA 3TNMB 4KITB 3PHSA 3G9VA 2HZHA 2P80A 4M1CC 2RR3A 4LPCA 2BSRA 4NEHB 4I8DA 1CI3M 2WUCL 3VXOA 5FM5M 5C07B 1X9RA 3F7KA 4M1DL 4JPVH 4D0DA 1UKTA 1IJ9A 1SJHB 4JM0A 3UYPA 5L2KE 3IDIB 3S48A 4MWFB 3T4YA 4AKPA 4NQVB 1I7ZA 3OKLB 3TV3L 1XXFC 5E1GA 5JLZB 4Q89A 2FJGA 3J27A 2IGTA 4NNPH 4XB3A 5IG7A 1FZKB 2GC7C 4P59H 2FD6L 3QJHB 3GPSA 3DETC 5I1EL 5JQHC 2OP4H 5FO9A 3ARFC 4I1RA 4NENB 3AQYA 5FA4A 1M7XA 5JPMA 2VH5H 3S5LG 4LKXB 4D9RE 2H32H 3MRQB 4MJHA 1J9RA 3SGKA 4G83A 2K78A 4Y19A 5CR8A 3ETBJ 1NCJA 3MNZA 2AQPA 4G1EA 1P69B 2F7RA 4J4PA 5DSCA 3P4OA 3SPVB 2VJ8A 3EBHA 4C83B 4ZZFA 1PL3A 3RKDC 1E4WL 4XE5B 4ERSH 4F3FB 3VFMB 1K3ZA 5JXAL 1PZ5A 2XFGB 4B27A 4PW9A 4GG8B 4QHNB 3L9RB 4E5XB 3PAYA 1Q9KA 1QPXA 5DFWH 3SE9H 4FKEA 3P73B 3B34A 3QRFM 4M4RA 4LXFA 3GMOB 3BUDA 1RZIB 2NUPA 4S1SL 3D69B 1OTSC 1OW0C 2MOQA 3LRSA 1P0SE 1F8TH 2ORBH 1HH6B 5BV7L 3BZ5A 2XWTB 3CWGA 3DOSA 1SOXA 1NGYA 3B1TA 3QXDA 4I0KA 4R5TA 1CURA 3QQ3A 5E4AA 5AW7B 4BHUI 5DURD 4PREA 4AYGA 5DO2C 3IMRA 4H8WH 2X6BA 2IV9A 4KVNL 1JXFA 1ZIAA 4ZODA 4I18C 4ZMQA 3BPNB 4H1LB 1U95A 2C9UA 2DQ6A 4WFGD 3GMNB 2XTSA 3H85A 2F53A 3NIFE 3QPXL 2P7TB 4X5XB 2YD5A 1CDYA 4JFDD 4N8VB 3TZVA 4ZPTB 3L5XL 4Y16A 3N42B 2B3IA 1LNUA 1NQBA 3OGCA 2BP8A 2Q2LA 4LSPL 4N8PA 4V2BA 1E30A 2ARJQ 1G7HB 2AGJH 3FMGL 4G8EA 2M26A 3QJXA 2QVMA 4WWNA 4BWUA 4BA8A 5F1OB 4W81A 2UWEF 1NBZA 2CALA 3O41B 2G3MA 4WTQA 2AQTA 5KAQF 2H47C 5EG6C 3FAWA 2W60B 1OAKH 2K45A 2ADFL 3HBPA 3PWNB 3ZO0A 2VYRE 3LQAC 3WN5B 2XA8H 3F64A 2FK9A 1NCUA 4TXVB 4ANXA 4Y4FB 1YN7A 2R0WL 3FT3B 5D6CB 2CK0L 3S3PA 5GGTA 3VFTB 3VW3L 4JANA 1XGPB 1K5NB 3IJHB 4TV3A 2ZKMX 2PWHA 5I15L 5AW4B 1PFOA 5I28A 3D30A 2GK0A 5GGRY 1P4LA 3Q8FA 1FNFA 5AB9A 4FADA 3MKKA 4X7FC 2JKJA 4GUPA 5JZ7D 3UJIL 4I13B 2EKJA 2XYBA 4PY8I 4L8CB 3FTVA 5F3BA 4XPGL 2ZUTA 1U93A 1KJ2A 5E08H 2QSCL 1IB5A 4MA8L 1CGTA 3MRNB 2W59A 3GMPB 4OKVA 1JNJA 3O2DL 1ZDSA 4CSPA 5H2BA 4OGYL 2BSTB 4P46D 2Y36L 4JPKH 3RVWC 4UANA 1WVZA 2CO4A 1QFWM 9CGTA 3NGBC 1X4YA 4JE4B 1GW6A 4UUJB 1CICC 3AUVA 3MREB 4KQ4H 4MB1A 2Y2WA 1J8HD 3KR3L 4HHGA 5AB0A 3KPOB 1AD9B 1T7ZA 3OXSB 4DW2H 4TVPH 1RXLA 2ERJB 4FQHB 4M61A 1ZHLB 4LLDB 4KMQA 3L7FB 5LDUA 1UJ3C 2SODB 1U8LA 5E70A 4Z7NB 3R4DA 3ISYA 4G9FD 5FO7B 1M57B 4JG1H 5EU4B 3O4OB 3P2TA 3R1GL 3CMOL 3PXJA 3QWQB 2NZ9D 2CDFA 2Z92A 2YQ3A 4XO5A 2V9QA 3FO2A 4LBEA 4MKMA 4MNQA 3HS0B 5L88H 3QAQA 1BQLL 4PTUB 1CD8A 2BFVL 1MFBL 4YHIB 2O6CA 4OUUA 1PD0A 3BI9X 5CUSL 4PR5A 3IGLA 4KY1H 3TYGL 4GXFA 3L6FA 5CINH 3PPEA 1DHKA 3ZYJA 1SQ2N 2HT3D 3L2NA 2ADIA 3ATFA 4A39A 4CDGC 2E9BA 1QR4A 2XC8A 4FJYA 3K6IA 1GY1A 1TYJA 1Q9OA 2N7SA 5C0CB 4AW4A 2QELA 3VCLB 5BUGA 2BIOA 1BFVL 5KJ7E 4H44C 1JGLH 4AQAA 1T0NA 4M8RA 1EHKB 3SDAC 5HP5A 3OZKA 1G5AA 1G1KA 1NSNH 3MV9D 2J2ZB 3GEFA 2BERA 4GAJH 1DQQA 1B0WA 5DHMC 1KCLA 1MRFL 2ITFA 3D25A 5EBLA 4J3VA 2EH7L 2VXSL 4AIZA 1W8OA 4UM8B 2DYPB 5CP7A 5AVXB 1UOVA 1FO0A 3QXVA 3V4VH 1E9OA 4H8UA 1LK2B 5IVXE 4AYSA 1TZGH 4IOFC 1W15A 4PJFE 3LB6D 1BEYH 5CMAA 2E7LA 1VZIA 3GWJA 1E4KA 2DWDA 1A6PA 5LO7A 1SYVA 1FFOB 1UD5A 1JNLH 3NCJL 4MA1B 3MR9A 3N1GC 4KUZL 4MXVF 4X6CE 4C4KO 5L6YH 3AGVA 3ZE2B 5IY5B 5JHLH 4FLQA 5GIRB 5HHME 1CGWA 3L5HA 1BM3H 3ETSA 3N1FC 1OSEA 1AR1C 4KRPC 4PS7A 5E94B 1ANUA 3IMWA 3ULVC 1NAMA 1TG8A 1NFDF 1X5XA 4HKBA 4K3GA 2IFGA 3NA9L 4XH2A 2K3HA 1C5BL 4V1DA 1AKJD 5ANMA 4G72B 4QNPE 2P49B 3L1OL 2J1XA 4E41B 1JHTA 2RIKA 4PJ9D 1DN0B 1IC7L 3TGXA 1IL1B 2MHAA 3FUDA 3K71B 2ZX6A 1PTZA 2VLRA 4HZAA 1DQVA 1M9SA 1AFVH 1E27A 3OSKA 1SY6L 4Z7WE 5FAAA 3ZL1A 2D03H 1N10A 1OGAE 3B5GA 3EDDA 3MJ7A 4P2RE 2QQKH 4WW1A 4YFDB 3UG4A 1NMBL 5IB1A 4LU5L 4OCSL 3PP4L 1AQHA 1N0XL 1E9PB 2GTWB 1J12A 5ID0B 2QV4A 3QJFA 2DTML 1ED3A 1WICA 3L4ZA 3WELA 4H8QA 2VCOA 5LQBL 2FH8A 3EO1B 4P5KB 1JGDB 4NT6B 2HLEB 1HCYA 1MW2A 1YQVH 2HJKB 3JV6A 5B8CC 3PFUA 3MO1A 5J9PB 3WEOA 4PJBA 1XF5A 3RIFF 4GO9A 1WZ1L 4PJEF 2JCCA 3INOA 1RV6X 2X2IA 3E2HB 3DNKA 2PYEA 1ULVA 4ZOAA 2G0LA 1GSKA 1CDIA 4HK3N 4Q2ZA 5E9NA 3QNXA 3T0WA 1IGTB 2X7LB 1BX2A 4I87A 4NQCD 1CGVA 4PVLA 2CA3A 4H26B 5JO5A 3MNWB 3O6ML 3BXNB 4LCIH 2EICA 2G5BA 3CC5A 1PX3A 4G6ML 1I8LA 3SYOA 2LU3A 2WB1A 3HZ3A 3OWRA 4CSSA 4OGXH 3RZCC 2AVGA 4PGEB 4Y9CA 1WA2X 4KHTL 5CKGA 4PAZA 1MCPL 1HWWA 2B9AA 4NKIL 2NT0A 1OCCB 2B9BA 1JE6A 3U79A 1VACB 3OG6B 2ZE0A 2ZTBA 1RP8A 1JRHI 3DWTA 1ZLVH 1PLAA 2B39A 3RWCA 5H37G 1A47A 5HDOA 2NXZD 3GBNL 1OE3A 1V3MA 1LM8V 1TETH 1U8HB 5I1CH 3Q6GH 4M4PA 1R5VB 1T21A 1WWAX 1Z32X 3EHBB 2FX9H 3F83A 3MNVB 1CQYA 5IM7B 3V52H 3ZHNA 5CF3A 1JZHA 1OAYL 5ISZA 3AMLA 4YQXL 3S37H 4N6RA 4HSQA 4YFLI 5J3HD 2P5EA 1FHNA 4UAOC 3UPRB 1HQRB 1S78D 2WSKA 2CRMA 3PLYA 1XAUA 5ETUA 3L3IB 1CI5A 2MQ3A 4P4KB 4KJQC 3C60A 1HHGA 2C34A 2C8NA 2YPVH 3GUTA 4LFHG 2A4EA 1NM4A 4ZYKA 4G5ZH 1IM9B 1PZDA 5DZPA 3IJ8A 5AVQB 3IK2A 5C0AA 3WNOA 3VG9B 5T1KA 2AXFA 2YZ1A 1HC1A 3T2NH 2WANA 5M7QA 3TM6A 2ADJB 4IHOB 2QBWA 4A7UA 3AWFA 4QRAA 2VC2H 1DN2A 3NZ8B 4U05A 5D1XD 1SJEA 2ZOUA 2DQTL 2H2PD 3EOTL 3MFFA 4FFZA 3L9BA 1PDKB 4PWGA 5HHOB 4WFEE 5C0JB 4OZGB 43C9A 2V2XB 2BW4A 3OM3B 1AQMA 2E27H 4RESB 4IBWA 2IDSA 2JSFA 5D7IA 3O6FA 4PJGF 1AXTH 3BQUA 5HYJE 5EOQH 4MVBC 1B3IA 2HFFB 1A7OL 4NB7A 3MJ8A 3V0IA 4AVJA 1ZLSH 4OI8A 4WWOA 3MV7B 2EZ0D 4L3CB 3DV4A 1KCKA 4XC3L 2QTEA 3FFCA 4KROB 3MLWL 4M48H 1NBYA 3OKYA 3UERA 4WO0A 1CLZL 1ZT4A 4JFVA 1JTOA 3NJKA 4NYLA 1WAAE 5F72S 3BN9C 1E3ZA 4RH4A 4ALAL 3T2QA 1HHHB 4MMXB 2Q5BA 2DLTA 1A22B 3KVPA 4OGAD 1DVFB 2E0PA 1P7QA 2BOCB 4HIPA 4XBPB 4XPHL 5EOCL 3SDCB 3IU4H 1NANI 2DLFL 1U3HB 4U31A 1A1NA 4OCMC 4PRPA 3T04D 2G75B 5DO8A 2DQDH 2R7EA 4FQQB 1AIFB 3P77B 4P23B 1CFMA 2ZQKA 3C08H 1DQLL 1BGXL 4ONFL 2F08A 4Y1AD 3WEXB 5DJ0B 1RZPA 1KXVC 3O8XC 4ZT1A 4LLUA 2X1XR 1FH2A 4EI5C 4W9LC 4OJFH 4OSUL 2OTUA 3V0FA 2G3ZA 3SJVB 3LKSA 4NQQA 4YXLH 3VVWA 1SOKA 2GIMA 2F58H 5IV2B 3D7PA 3VI4F 3X14B 1JP5A 1J11A 2K9FB 4KGLA 1T7VA 3QZBA 5C0GB 3QPQC 2EUZA 5DWUH 1BD2D 4F37K 5DJYB 4I0PB 1DUYA 4EN2A 2CIKB 1VJSA 2EKSA 3RUGE 4Q0XH 1WLHA 5I19L 4NQED 4KKCD 3G9AB 2BC4A 3T3MF 1ACYL 2AQ3A 5E99L 2ZPKH 1Z2KA 1BZ9B 1GYVA 3IWVA 4QRQB 3U6XS 1MF2L 1LILA 4YL4A 4H13C 2YEQA 2K9UA 1X4ZA 4G8IB 4QGTA 4YO0B 1BFSA 4QHUA 4BZ2H 4RDBA 4X6DE 1INQA 4HKZB 2HRLA 1WE5A 3W38A 4AYFA 3EFOB 1M7UA 3OPZH 4I85A 4UMGA 1NUNB 2HJLA 1K9TA 5ENWB 5I74C 1MRDH 4K71C 5BZDA 3K4AA 4W9GC 5EEYA 1Z3RA 2XZQH 2VXQA 3TX4A 4HWZA 1BYOA 4WGVB 1KB5A 1LJMA 1IBFA 4XHQA 4YGVA 3TA3C 3IKKA 1ZT7B 5LG1A 2VN5A 1P53A 3Q2VA 2X41A 3V4PH 4QGYA 1FDLH 3CN3A 1HT6A 2DAVA 2EIZB 3ZYIA 5CCJA 3TFKC 3E38A 2CO7A 1PGRB 1A3RL 4LOUD 2XHNA 4NQXB 5IB3B 4Y4HA 3NIDE 5ACZA 1MCWW 4XB8A 4TUKH 4Q52A 3AW5A 3PP3K 4BGLA 1CT8A 3IDXH 3VQLA 4YDJB 5KSAC 5ADOH 1N64H 3M8OL 1GKEA 3FH8A 3C5SA 1U8KB 3NZSA 2DI8A 4U1JB 5IBUG 1MJ7H 4QRBA 3HC3H 3EF4A 3MJGX 2BP5M 3WJMA 1P7HL 4J39A 3O2VL 2Q87A 3BUQA 2F61A 3H9SB 2VDQB 4IW4C 4OZHE 4QRRB 1OCWH 3WHXA 1WC7B 2ZOOA 4KDTA 1UJ3B 2QVKA 2Y5TA 4IBYA 4W93A 5IHZB 1NGWA 3ULUH 3I75B 5E2TL 3S98A 1BYPA 3RJOA 3NVQA 3FU8A 4Q7DA 3TO4D 4J2XA 2F19L 2IFFH 2GB2A 4JPWL 3RFZA 4LCWD 1B88A 1ZVYA 2FSEA 2B15A 4N0RA 5AB2A 1R5WB 3WTTA 3IE4A 5D7KD 1EHNA 4PJXE 1JMZA 2WO3B 3VWKA 5JW5B 4HUXA 2OJZH 4AIXA 2X4OB 1MG2C 4HEME 5HY9B 1C8PA 4LSUL 1RZJH 3MBEA 3WGUB 1DBAH 3RWDB 4JFYB 3VGGA 5CJQL 2CO6B 4Z95H 4L4VE 1T80A 1U58A 4BUQA 4JRXE 2DWYA 1RUKH 4DJMA 4L3FA 2O72A 5L2KD 2VQ4A 2LQRA 1G6RH 3PIQB 5GISL 3JSSA 2BNQB 1LEKA 4YSEA 1A6TA 1KBGH 2QV2A 2N4IA 2NYKA 4X4MA 2XRAH 4XMVA 5FYKU 2ZWSA 4KMTH 4OU3A 2K6YA 5CLZA 4ZS7L 5I66B 3QIBD 1CLYH 3H0TA 2X1PA 2X4QA 1MFNA 3VI3F 4H2CA 1JERA 1NJ9A 4AQ8A 1NIAA 3HNVL 2Y7QA 4D9RD 1YEHH 4M1GL 4MJ2A 4H2AA 3S37X 1XSKA 1R3KB 1XH1A 3TFBA 4B9KC 2EUXA 2PCFB 4HJ0D 2ZOLB 2F15A 4LCCB 4IMKC 2WJ7A 3ZQ9A 3EYSH 4DF9A 3NP4A 4Z7VE 3TVMA 3VD1A 3G6JB 2R8SH 1F42A 3EYQC 1AD0B 1G0DA 4UQ3B 1FZOB 1ZT1B 1AXIB 3SY0A 3HN3A 3HZYA 4FABH 1RAMA 1UXWA 3EDFA 5EPMA 4PJHF 1EO8H 1I9RL 2IH3B 1RERA 3MLUH 1NCIA 4NQDA 3N85L 4AH2B 4QXUH 3K6SB 2BZCA 3IDNB 4G6KL 5DFVD 3VFNA 3DHPA 4ZX6A 4BRJA 3V7AG 3UZVA 1FSKC 2CWRA 4RCAA 2WXHA 3MCKB 2XPYA 1H3WM 4KKPA 4MDJB 1KIQB 5ACMA 2DLGA 4ZO8A 4RGMB 5E6IC 5CZVL 1YY9D 1CK0H 5HPMB 3D85D 4EBQL 1XD0A 1T22B 3JT0A 4M7ZB 1VSCA 3S5ZA 3P1VA 2AZAA 3KBHE 4HHWA 5EZJA 4NCC2 2EYSA 1R5IB 5DMJB 3TO2B 1BLNA 3SBWC 1JPSH 2J1KA 1IC1A 2W65A 4GI9A 3EGDB 4GQ9H 5MENB 2V7HA 3D4ZA 1QLFA 1IC5L 2MNJB 4BDVB 3IDGB 3RU8H 3JTSB 4X5QA 2WVUA 4H25B 2KZWA 2ZCKL 2XZAH 1II4E 4HH9B 4G80A 5IMOB 2IOMA 4YHZH 2WMPB 1BVLA 5EO1B 1A9EA 2N56A 1DJIA 3FUMA 4P2AA 2GJ6A 4TOYL 1M6UA 4DGIH 4I77H 2JQAA 3QS2A 2DYSB 3AGWA 4N86A 3LZPA 1GSMA 4QWWD 1E8YA 2NUTB 5FXCH 8FABB 3EFFA 3FF7A 4FTVB 3EGXA 2ZSWB 4HGKC 2X3CA 3AU0A 3CSYB 3T3PE 1PU0A 4JM4H 4UQ9A 2PPEA 3QH3A 4F5CE 3TCLA 1U8JA 1CPUA 3OC5A 4OV6F 4QD2E 2DBLH 4Y2DB 7FABL 1TLKA 2C3WA 1WA0X 4WLCA 3O3DB 4UAOB 1XEDA 1X7TA 3RB7A 1BZEA 1EEYA 4PJAE 1TDQA 1RJZB 4JPVL 1BVZA 3QIWA 3ULUE 5EEXA 1W0VA 2C4FU 2XG5A 5E8DL 3ZJAA 4JFXB 3JWDH 2BSDA 4BWTA 1HQ4A 1XB8A 2YXMA 1IGIL 2FWLB 3D18B 3HE7C 4PGDA 3S34H 3T8XB 4M5ZL 3FW6A 4XMPL 4MD4B 8PAZA 4MAYD 1QO3B 1CYGA 1ZXKA 2MQCA 3BIBX 4F15C 4Z78B 5KYXB 1IIIA 1JPST 2FEEL 2ARJB 3FU9A 3RX8A 3P30H 5D2NB 3WIFA 3U2SB 4Q97A 1XGTB 3SZKC 4JDEB 3S8GB 2HJFA 4JZJC 3U4BH 3H4FA 4ODTH 4XE0A 1E2VA 1WZKA 2NXYD 3MRIB 3VGDA 4BUHA 1RJLA 3OV6A 3FCTA 1NCOA 1PYWB 2DJMA 4L5FH 1FE8H 2EAEA 1ZHKB 3UJTH 4G8FA 1MNUL 5B38A 1MLCA 3F5WA 4P2CG 5JIMA 1S7VA 5EMYA 2V4LA 2VDQL 3BIKA 4OH2A 5I1GH 4BKSC 3I3BA 3HE6A 1PCSA 1NUFA 3SZ6A 4L8BB 3WNNA 5DMYA 3HTLX 1N5AB 4GAYA 1DP0A 3HKZA 4IK7A 4XNYH 4EN3D 1EMTH 1FCGA 3LKOB 4J8RB 2HT4D 4Z3HA 2YEZB 4K3JL 1EVTC 3IPFA 4Y88A 1WEJH 2I7SA 4Z76A 4JFQA 3MRHB 2UY7A 4JVWA 2OMZA 2CHZA 4J6IA 2OMUB 1RULL 1F8TL 5JPNB 3AREC 3BWAA 4OQTH 3KPPA 3RDTD 2HLAB 5CU5A 2EUVA 3D34A 1QSVA 3C8KA 4Z7QF 2LLLA 4YBHA 1TQUA 3RG1C 5I1AB 1P1VA 1JHLL 3TC9A 5JQ6H 1A2YA 1U8OA 4OD1L 4PVBA 3F84A 1V54B 2IBZY 5L8LB 3GFUA 2H0JA 4P2QE 3A67L 3KPLB 4GG6B 1QHPA 2A9BA 3DSFL 4EI5B 3ZQXA 1JK8B 1Z66A 4G6FB 4UB0L 2AANA 2HLFC 5HHMD 3VFSB 1I1YA 3C6LC 4XVOA 3NJLA 5CP3H 5D1QE 1KCUH 2HPOA 3F3HA 3H3PL 4K8RH 1HEZB 3QI9A 4AV4A 5D1ZC 4PYHA 4CADB 3EG9A 5IQMA 3X3GH 2IALA 4IIQA 3VFOA 4ODXB 4DN4H 5I6MA 2XA8L 4UTAA 2YHGA 3VAEA 3B2UD 3FHAA 1EAPB 3WAJA 1B9KA 5CEZH 2IGFH 4W6XB 2OXHB 2YPKB 4JPIB 2KS0A 3SGEH 1S3RA 1WCBA 1UT1A 2AEIT 3W82A 5DHVB 3FU6A 1SDYA 3WIHH 1OGAD 3B3BA 3QDGB 4P2RD 2WBJD 4BEIA 2Z8VC 4DZBB 5FDYA 4DOHB 4HIHB 3RGVC 1DEDA 3QUZB 4M6OL 1J5OH 4N2IA 2AXGB 2DM3A 3F2LA 1QSEA 3ULVL 4GMTL 1HVXA 4LSVH 3TNNA 1LE5B 3WFDL 5DJAB 1PNCA 1YA5A 1UB6A 4HS3B 1A7QH 1R3JA 2P8PB 4Z7UA 3ULSA 2DQFB 1MCNA 3OKEA 1NC4A 3KLAA 1C7SA 3DX4A 2TRHA 4LHUD 4K71B 3UZQB 4K94H 5KSUB 3DVGA 3GSUB 2APBA 2CBTA 5BRZB 4DO5A 2AJUL 3DSNB 3MOQA 5KJRH 2OI9C 2WAQA 3TA3B 3ZL4H 1HHIA 3NJHA 4QOKE 5AVWB 4URKA 5E4OA 2R2HA 5EZOH 5GS1C 5EUKB 2YMXL 1A9BB 2BVQB 4YBLB 3WUWA 1MVFA 3I02A 2M2DA 32C2A 3NFNA 3ARBD 1REIA 5KOVC 1MQKL 1EA9C 4MRCA 3ATDA 2A9NH 4UINL 4KUCD 1NMCB 5GS0D 3PDOB 3KL5A 3M1OA 4NKOA 2L4OA 2BNRE 4HEPG 1MI5B 4UT6H 4OLZH 3BRDA 1T6BX 4GW5B 5G4OA 1LEIB 2NTFA 4AEIH 4OY9A 3QZLA 4DP2X 4EIUA 4LEOB 1U8NB 4XCEB 3FT2B 3QUMH 3HMXL 2JB6B 3AG2B 2E7HA 1A5FL 4X6EA 2H3KA 5BNXD 2HH0L 4KY1L 2D7MA 5DMGD 2Z35A 2AXJA 3VXRE 3VFPB 5HHNB 5T33L 2A0LC 4AC4A 4NLHA 5BXFB 3DUSA 3VRIB 5K9OB 2ZUQB 4GIOA 3LPWA 4HJIA 3MQIA 3UTTB 5J5EA 4ZXBC 1KJ3L 4H0HB 3NEXA 3WHE0 4R8WL 1Q4NX 5DK3A 1GOHA 4AM0Q 4BZ1A 4HCFA 4HCRL 4KI1A 3V9CA 4ISVB 4DTGL 4QXGH 3RWJA 1I9JL 2GJRA 3ARDB 3HLAB 3JWOH 5GJSL 3VYOA 5C8JA 3MTXA 2AJVH 2Y6SC 4L5FE 2HX7A 5BVJB 5CGTA 2AJXL 4L29A 2WNXA 4BH7B 1CYXA 2VRKA 3BP7A 4FQJH 3HRZB 3UFIA 1E5UI 3LXUX 3I2CL 1S6NA 4HUWA 3V6ZA 4LPWA 1HSBA 3TF4A 1M6OA 1MFVA 4I9XA 2VRQA 2VR8A 1HILB 4WFED 1D7BA 1IKFL 3JYCA 2J20A 4NIYE 3SGDH 3SKJL 2WUBH 3EUDA 3M46A 3WFBL 4PBDA 1X5YA 2EDJA 4RMRA 5HYJD 3WY2A 3GQFA 5L4IA 4M7KH 5KN5A 4YL9A 1BM3L 2JJTC 3FHQA 4PJIB 3DTDA 2GUYA 4L1TA 4GLRH 1XZWA 1KLUA 1I1AD 2J56A 3N41B 4XOEA 4QXTA 3LYRA 2VXVH 1J5HA 1QNZH 4MNGA 4J6RL 4Y5XA 3PNWB 5AAMC 2I60H 3ZRSA 4AUJA 4CW1A 1IAOB 2WVVA 4JL1A 3O2WH 3S96A 4N25A 1C5CH 4IOSA 2CBMA 2ROXA 1I3GH 1TZ8A 4FULA 2VJ0A 3S88H 3AM8C 3QQDB 5AZEH 1T3FA 1CGSL 4Z7AA 5ITBH 3HBGA 3MROB 1OM9A 5J7CC 2KLRA 3HRPA 1KXQE 1NCDL 1Z9SA 3MUGB 3R18A 1URZA 1KN2H 4NRYB 2AJ3B 1NAKH 1S9YA 3P9MA 4LLMB 1WS8A 3DURA 4OVVA 5E5MA 4DAGH 1R3LB 4B95C 3VQ1C 4PJ5B 5K9KB 4M7JL 5I0WA 4CILA 4XNXL 2VQ1A 1R0AL 4DQAA 1DEEA 5AL0A 4GP4B 5K69A 4LAJH 3NFSL 5E6IB 3QUYC 3FDWA 4BFOA 2FR4B 3ROLB 2O5YH 1PEZA 2F2HA 4ADIA 3MBWA 4GAGH 3EOBB 3WI9A 5I8KH 4JDVA 5EO9A 3HG0A 5AUMB 1RMFL 4UT7L 1JNHB 1MZZA 2OPCA 1P4IH 5TH2A 4WEBH 2X40A 4N3TA 3SQBB 2R2BB 1YMMA 4KXZH 3E3QE 3UGXA 1YPZF 1W9XA 1XGQB 4MBRA 1CXIA 4YZFE 3NSDA 3VXMB 5IT2H 2NQ3A 1RI8A 2WXOA 4FFWD 4WW2C 1WZAA 5K1NA 5E6UB 1IUZA 5F9JB 4FQIH 5IWLC 1E90A 2QQLH 1XR8B 2E46A 2IQ9L 3WKQA 3IU3A 1DSYA 4CC0A 1PZ2A 4HH8A 3LXCA 4MJ6B 3RP1A 1V27A 3CDFA 2R0KH 2PTTB 4YXHH 4F2MB 3N04A 3KLDA 4WI0B 4AGQA 1JZ2A 4FXTA 3U0WH 3NCEB 2EDEA 2RFXB 4ILDA 4A7GA 2Z91A 1U92B 4RMWA 1OQXA 1U8PB 3NESA 4HJGA 1NBQA 4IKIA 3VH8G 3V52L 2XQBL 2FX9L 1PF3A 3KXFA 3A21A 4UM9A 2HFGH 3C6SB 3ILPA 5CN3A 5FCSH 4K2UH 1G6RB 4DPBX 1HJCA 1SEBA 1EHLL 5DTFA 4IK6A 4APQB 5HDQH 3ZKQD 4JG9A 3RGHA 2AK1H 3LZNA 4X6FB 4ZAKC 1NCAL 4NN5B 5DGQA 3T0DA 1IZKA 4WY7H 5EZPA 1DVQA 1EZVY 1KGIA 3VFWB 2YPVL 3A22A 4WWKC 4PRBA 3VWJC 4OI7A 1GRWA 1PVHA 3LQZB 2YGQA 4EOWL 3ZDWA 5KVFL 2XIBA 4G6AD 2FHFA 2VAAA 5F7UA 1UXLA 1WZLA 9PCYA 4JFOA 2FWUA 3P4MB 5F3FA 4AK2A 4K07A 4A2HA 1ZLEA 3D3VB 1R19A 3GYRA 5HYQA 2BXZA 1NKGA 5HGGS 1CXHA 5JORB 3HE7B 4M7LL 4N85A 3HPLA 5G5DB 3DVIA 1T03H 5CXPA 1KTJA 4PRID 4EIGB 1AQDB 2BO0A 5IW1B 5B39A 1DCEA 4BK5C 2ZNWA 3CFQA 4K5LA 2FYVA 1IM3A 1UUNA 2WB7A 4ICWA 2NY7H 3QPKA 4ZTOH 3ZHFA 2VLKB 4XOBA 1AXTL 1GZQA 4JFZH 1KDIA 4MFHA 4X7SL 4JZJB 3DMMC 3HUJB 2Y07L 3JUYA 2GG1A 2XN9E 3UMNA 1XF2B 4DFHA 5K59F 4CAGA 4J3OG 3B2VH 3GSWB 4LLVA 3I50H 4NOFA 5D5MA 1FFRA 3TN0D 2KERA 1ZIBA 3QORD 1CD1B 1KJMA 1M05A 1ASPA 4OZFA 3EBGA 3VB8A 1JXKA 5D2LB 4B9IA 5JW4R 2X4TA 4XMXA 5LDSA 3BKYH 3BZFA 1NICA 3C5ZB 1JFHA 2LV4A 4QRPA 2IWEA 2Q86A 2YUZA 4LNRB 4L4VD 2DIJA 4OCNC 4HZLA 1QEWA 4JRXD 4AKQA 5C97A 5IFHH 4LP8A 3IU4L 4FNTA 5H4ZA 4NJ9L 2EXYD 1JI1A 5KS9F 3CFJB 3FTXA 5ERWB 3QUKB 1QFUL 3RWGA 1DLHA 4KTYA 1BIIB 1L9PA 2E59A 5HDBB 3V2AR 4QHLB 5LWYH 4OD2A 8CGTA 3V0EA 5A3ID 5K5YA 5A7BA 2G0KA 5I1DA 1JYVA 2CHWA 2V7NA 3SKMB 5DJXA 3VG0H 3O3BA 2B1HL 5DR5H 3REWB 1SRDA 1MVYA 4W9CC 4POUB 5ECGA 4J3BA 4B0MB 2QVIA 5DS8B 1JTTA 1Q9WB 3LJ3A 3HIZA 4CC4A 2XPZA 1LE9B 5I5MA 3KLHD 3V9FA 2X70A 4LLQB 5CEYB 2NW3A 2ZD0A 4HJ1A 4OFPA 3X1GA 5KSVA 5DZAA 2CH8A 3MXVL 2XN1A 1EGJA 2H2SC 4NWUL 4FFVC 4P9HC 5F1NB 5D1ZB 1T0MB 2HFTA 5IQNA 4OCXL 4WO4B 2FUQA 2VDKB 1FH5L 2QPSA 2OMYA 1U33A 2E9JA 3Q6FA 4KFZC 3TEUA 2ALWA 1K8DB 4F1SA 4JNXA 3R8BB 1O6SB 4LSTL 4XPAH 1KSRA 2NY0D 2HSIA 5AOJA 3FT9A 5EIQA 1T5WA 3SOBH 3CVIL 1IC0A 3W5NA 3CBRA 2P5WB 4AEHH 3A5VA 4NAQA 1XCTA 2GBVA 1IGYB 3MLTB 5DFTA 4DKFL 1SQMA 4OJEH 2YXFA 4PV9B 1WGVA 4S1DD 3TBVA 4JRYD 3GZQA 1RIVL 1NDGB 2YA2A 5JMRA 4LL9A 2FJHB 4FQXD 4A66A 1RUMH 3DVNB 1TJHH 1UD6A 2PF6A 3ESVF 4NBYB 2OI9B 4PJGE 4F2FA 4XNDA 1BWMA 3QUXA 1TQSA 2YKLH 3IJ9A 3FQ1A 2OMBA 2AQ2A 3IDXL 4ZX5A 4BE6A 4M00A 4Z77A 2CNYA 2BDNH 2ED8A 4OM0H 2EE3A 1SZNA 2D8KA 4BXVA 5DD5H 4B9GA 5JPMC 2UWEB 3CHPA 1DBMH 4WUUA 5CU9A 5T5NG 4JFUA 4D7BA 1OCWL 3UBXI 2I32A 2YJQA 2ESVE 3KHQA 4PSPA 4KZEL 2AEQL 2UVFA 4YHOH 4F7CA 3HZVA 4OB5H 2CKBA 3FZUD 1B4JH 4Q9QL 2IFFL 1KCVH 3CVHL 3QQ9D 5EORH 2XX1A 4L37A 3TASA 3MRBB 3AROA 3ZE0B 2VMEA 5GRVL 3IWUA 1CE1H 3R06A 5L2JA 4P5RA 4PIBA 1CR9H 2WN3A 5FOJA 3SYCA 5KYWB 5A7EA 4L05A 3MRKB 4ZDHB 4JKMA 3X13B 4R9HA 1EFXB 2B5IC 2NY3C 4U1NB 3CZGA 3ZZSA 1SEQH 1DANU 4XMZA 3NDYE 4U1HA 3PQYA 3WN6A 3ULUD 2IDQA 3AXHA 5JXED 1VZGA 3C2SA 4ZSOB 2JI1A 5KTEH 1UD2A 3LRGA 1AZBA 1JDCA 2PUQT 5F21B 4GXUM 3ZKMD 1OB0A 1QEXA 2DYRB 2L7QA 4PH8A 4L3EB 3PAUA 1MWOA 2OMXA 4NNXA 2MCPH 5IP4A 3STLB 2C3VB 2Z31C 1JF1A 4PLJC 5C0BE 3B8SA 1TJIL 3TZVC 2X2UA 3H6JA 1ZSDA 1AYRA 4WJG3 4Y16C 1BBJB 4YC2B 1EEZA 1YEHL 5DHYB 3IT8D 3NYKA 3T3ME 1TF4A 1QSFA 3BDYL 3QO1B 1ZS8B 2D0FA 2FLRT 2PO6A 4MMZB 2HKHH 1BJ1J 2QADC 5BS0A 3LZRA 5HHOE 3MNMA 4JLRB 2GSIB 1E3FA 2TAAA 2V3EA 4I5BA 2OMWA 4OJCA 3GLEA 5IEKB 1KTKE 1CTMA 1FVCA 4ONHA 1KEGL 5AL8A 1HTYA 1TJGH 4MLIA 4NJAL 5HVHB 1UGKA 4OJAA 2OK0L 3IMBA 3EJJX 5DUPH 3BVXA 4QLRA 5FGCB 2QGBA 3Q9QA 4Q6KA 2WZ0A 1I7UA 4XNMA 5I18L 1LMKA 5INDA 4ZW3A 3F65A 1E6OH 5B7FA 5EF0A 4MS6A 1NINA 2IBBA 1N5YH 2H8PB 2YQBA 1CU4H 3L4VA 3TT3L 4OW6A 1KWGA 1IFHL 5I1KL 2QSQA 4X4YA 1Q72L 2DPKA 4IGBB 1SHSA 5DRZB 4R7LA 1Z5YD 4LDEB 4TYUA 5DJ8B 5HXMA 1CK0L 1K4DB 3KYMB 1P4BH 1JGVL 4I3RL 3MJ9L 3TYFB 2CXKA 4P2QD 3NOIA 4OIFA 1ADQL 3RPBA 4OLWL 2NZIA 1B4RA 4ZUUA 1JPSL 4PWFA 3AITA 3QUYB 2R29L 3B9KD 4JFPB 4LSSL 1IQDA 2E9WA 1XGZA 4M93B 4GBXA 1H5BA 4KFMA 1TU2A 7PCYA 4YSRA 5D1QD 2ZAGA 3SJVE 1DQML 4CN4A 5FV1L 2WWNA 2D7OA 3DRQA 1F18A 2OX5A 3K7UA 5TE4H 2A5UA 4R2GC 4CSTA 4RAVB 3KVDD 4NRZB 1X9LA 4KO7A 1IBGH 1H19A 4H40A 5GRXG 3D8MA 4FQPA 2F8VA 1XIWD 3T2PA 1P7KB 2FNWA 1MFCH 1A0QL 4I77L 5DVKA 2GSMB 4KZDH 5DK0A 2YRZA 1ASQA 2IDFA 3CFEA 3CQQA 4LLYB 3BPCA 3W5MA 2A74A 4WGKA 3BLPX 2F7OA 1L7IH 1I3RB 2EQDA 4QEGA 4BHUA 5C0FB 4DP1X 1SJMA 4NM4L 2ZONA 3EDKA 4YHNA 3DYMA 2VDKL 5ID1B 5AOIA 2NNRA 1VENA 3KJ4C 3DLQR 1S7QA 1NC2B 1RURH 5JW4Q 1TQBC 2NX5A 2V5RA 1G5GA 4YWGH 1VGEL 4AIEA 3B7UX 2JXMA 1T1XB 1RJYB 3ZTCC 4CUCA 1M42A 2YMTA 2ZUVA 4L8DA 2HVJA 2BRRH 2P42B 3S6CA 3VI3E 5LKNA 3O6KH 4XI5C 4TUJB 4QOKD 3T0BA 4LPVA 3WHE1 2P45B 5A6MA 3VWJB 4WWKB 3ZE1F 4AG4L 5JTWA 4PJEB 1D7FA 3RNQA 3U4EB 5H94A 3LS4H 1UWXK 1YEKH 3BP5B 2Q6WB 2P24B 4W9DC 3NA4A 3ZDXB 2E4TA 4GKNB 3IJYB 3TL5A 4AXWB 2EDLA 2EEBA 1YJDC 2ZWNA 3ZTJH 3FTZA 4ZMTA 3U0TA 5DDHB 1T20B 5KSBF 2BNRD 3O6LH 4M5YL 4UDTB 1COBA 3BDXA 1E4KC 3PGFH 4JFEA 3UOAB 3U4BL 3GSNL 3MGTB 4KH2A 1AKPA 3SDXF 4WU7B 2VWEC 3HI1A 3HCVB 4XWOC 4K9JA 5LAXA 4C56B 2ADGB 2VDRH 1CFNA 1OTTD 1T0OA 1WBYA 4JKNA 1P1ZB 3VGAB 2H6OA 3LEYH 2IBZX 1FA4A 5AVSB 1DSFH 1TZIB 3CBJB 4J3OF 5AENA 3IFLL 3IF1A 1DQJB 2FBJL 3ZPDA 1OM3H 3JV5A 2X4NA 4E0RB 1A6VL 1F3DJ 1F1GA 3KYAA 2XU9A 1D6EB 1M1XB 2NW2A 3L3JB 3QDJB 3OAZK 4FNUA 5GJTL 2CR6A 1YDPB 4N4YB 4WGWB 1G7MA 1G7QB 5D7JD 4OT1L 4XGZA 4W9ZA 1XFPA 2YBRA 5KVGH 5T1LB 3QCVH 4R3SB 4Z3EA 5FHAH 4AJWA 3OHXA 2COQA 4NO2A 1W0WB 4WTXA 4X0KB 4IM8A 1N3NA 1INDL 4ZMVA 3MV9A 4HWBH 2BNQE 3EO0A 5CZXC 4DHLA 1M7DB 4IRSD 4MTMA 3MRCB 5DVOA 1YNLL 2BVYA 3OZ9L 4EUPH 4WCYL 1RHHB 2NYYD 3OXRA 5FECA 1A8JH 3IMTA 2X89D 2B0SL 4PGZA 4P3CH 3VRLE 2A83A 5C0RH 3T0EA 5F7MC 3QDHA 3ZZ1A 1JUFB 4MZIA 2XN0A 2ZAIA 1GC1H 1EBAA 4KHXH 4R5XA 3QFDA 4LARH 4YH6A 4MA7L 2DICA 4U7KA 1I8LC 1X4XA 1NEZA 3L3DB 1K72A 1PD1A 1RFDL 3OB0K 3A6BL 4P07A 1KCSH 1WT5A 3D5OF 1FIEA 1DFBH 1FAKT 3PXLA 2VR9A 1LWHA 1IEAA 1RK0B 2HVKA 1NGZA 4L8SA 2ITEA 4NPYA 1NWPA 4CVXB 5EC1B 1BG9A 3MACH 5CEZL 3TT1H 2O1AA 3A47A 2XWJB 2XICA 3LH2L 5DK2A 4PWHA 1ZEAH 4TSBL 3ULVE 5ICYB 3BEWB 1SUHA 1ORQB 5HGBA 3OKDB 5GZOA 4FXKA 1HHKB 3L45A 3ARRA 5C07A 1J5OL 1NCNA 4XN5A 2BY1A 2MSPA 4LSVL 3SODB 4AM0B 5A2AA 4DWHA 1AS7A 4MWFA 1PKQA 1KELH 4NQVA 5E6SB 2KLTA 1IGMH 4B9YA 5JLZA 4WI9A 3O45A 4ZFGH 5DQJA 6PAZA 4K9EC 3DYPA 1XO8A 3L5WA 4K94L 3KYNB 3W2DH 3LZQA 5TQ0L 2GVYA 2BSRB 1H9DA 1A7RL 3U9PL 4MHHG 2WJ5A 2CBOA 2YRBA 3SDYH 3VXOB 1OP3K 3NP3A 4UBDC 5DQDL 2H5UA 4FI7A 2QT6A 5MENE 5CHNA 3MBXH 3RTQC 3UYPB 4C83A 3S8WA 2EXWD 4YNYA 4F3FA 1I7ZB 2YAOA 3LNIA 2VN6A 2FJGB 1BHGA 3B9DA 4S0TD 5IG7B 3VU2A 4OZIE 1ACXA 5LCVA 2Q2EB 4GG8A 1QR1A 4QHNA 5FOBB 4KBPA 5JPMB 2NXZC 4BRVA 3BQUC 3KBEA 4Y4FD 3CLEH 4EDWH 4OLUL 4U7MA 1WIUA 3D69A 2ZX9A 5ALCH 4Y19B 3FSZA 3MNZB 5DSCB 4AL8H 5B1JC 2WQSA 2XWTA 4JN1H 3L5IA 1UUSA 2NY4B 4KKBC 4OF6A 1PZ5B 1NDTA 3BGFC 3N9GH 5DD0H 3STZA 5C0ND 4HPYH 3HZMA 3PWPE 4LBAA 4N2AA 2PPAA 3U1PA 3UAFA 1Q9KB 2R2EB 2B5IB 4H1LA 2YD1A 4U6XA 1AE6L 2NY3B 5TPWH 1J1PL 1JTPA 3CSPA 3LH9A 4M4RB 2WZPD 2P7TA 4P05A 2IMNA 5EU3B 4N8VA 5CILL 2UY6B 2NUPB 1DDTA 1GIGL 1P6FA 1UG9A 4E9RA 5CBEB 2UYLA 1R4XA 1AJ7H 1P84K 1G7HA 1T89A 3DOSB 1ADWA 1NGYB 3QXDB 4KK6D 3O4LE 3QQ3B 2P48B 4PREB 2VM9A 1FYTB 2RHEA 3GI8H 1MVUA 3INUH 3ARGC 5F93C 3ZIYA 4N0YH 4L4JA 4OLXH 1YECH 1TVBA 1EJOL 1LO2H 2F53B 3T8MA 2A9ML 5KJ4A 3FT3A 5D1XA 1TYEB 5D6CA 3TZVB 3VFTA 3ZE1E 2WP3T 5C9JA 1LNUB 1K5NA 1R6VA 2YKKA 3ELAT 2XN9D 1OAJA 5EN3A 3OR7A 1M7IB 3JV4A 1A14L 4G8EB 2QADB 3GS7A 1GGIH 1OIOA 1ZTXH 2YC1A 1F0LA 3N1PC 3IVKB 4KNQA 1ONQB 2PTUA 3IS1X 3SCMB 4L8CA 1VFBB 4ONGL 4ABWA 4NAJA 4YDIH 1OAXL 3DO3A 3GMPA 1KTDB 4QCIA 4JANB 3BRGC 3T6QC 1NTDA 4GSUA 3HG4A 3PU7A 2WVSA 1MFUA 3NSCA 2FEDD 2APTA 4XAKE 1P4LB 4JY5L 1M56B 3B2MA 1PG7W 1VESA 3MREA 4KTGA 1HESA 3VGEA 1KGJA 3QEQA 2YAHA 2X0VA 2H26B 1E6JH 5AAPA 5F3BB 4XTRC 1FNLA 3WNIA 1U93B 3GSQB 2ZG3A 4FQHA 1ZHLA 3CFMA 3L7FA 1AO7B 3WKMH 5D4HA 1QLRB 3OHMB 1RVFH 4OKVB 4LVEA 3B56A 5H2BB 4ACPA 2YRPA 3KGRA 2J4WL 4Y4HC 4GG6E 2WGXA 3UO1L 2DN7A 1B0IA 4TLSA 4N28A 1FORL 2LOEA 3T8VA 4YHIA 1KTCA 3J7HA 4HXAH 5LXGH 4DVRH 2CGRH 4R2GB 2A6KA 4U1LA 4KDTC 5FM4A 3FSOA 1UVQB 3QCTH 4ZUVA 4QYOA 5I26A 4E41D 5C0CA 5IBTH 5C2UB 2NYZA 3WKPA 3RFZC 1GGUA 5GSRA 5IF0B 1SM3H 2Q10A 3FO2B 1FYHB 4GAFB 4LBEB 4MNQB 2VDLB 2Z6FA 1PSKL 4KJYA 4UT9H 2W80C 2EACA 2IO5A 1L7TH 1G7PA 1PD6A 1W72A 3QDGE 1CFTB 2J2ZA 4P57B 2BWIA 4MQXC 4XBEL 1HSAB 5T3XL 6FABH 5MEQA 4K73A 2DLHA 5FHBH 2DYPA 3WIIH 1LO4L 4G82A 5KVFE 2VO8A 2XZCH 3Q5TA 4OQ1A 3Q01A 3K8KA 2V2WB 1Q9OB 4NKQB 1W8EA 2E47A 1B6DA 3LN4A 2B1AH 1LHZA 4DP0X 1Z9MA 1FIGH 2JTDA 3T5WA 1SBSH 2QL1A 1FFOA 15C8H 1DJHA 4NAMA 1NGPH 4X7TA 3MPCA 4CGUB 2ENQA 3DGCR 3ZRCC 5BRZE 2Y2TA 4YK4B 5GIRA 1Q0YH 3TEWA 2DWTA 5FA3A 1MFDH 3AY4A 3UTQA 3UAJD 2ALAA 5GRVK 2UZIH 2WO4A 2FTAA 4N2GA 1QFHA 3P3RA 3V4UH 4KK9D 5CP7B 4AQ8C 1XZ0A 2ESVD 1FO0B 1HINH 4ENEC 3ZRFC 4KKZA 3TO4C 2ZUYA 1DN0A 5CMAB 2XT1B 4NGHL 1SYVB 4WV1A 1MI5E 1J10A 1GYCA 4UU9A 1EXHA 1V7MH 5T3ZE 3B2VL 1S5HA 1DQTA 5IQ9A 5TE7H 3H53A 1KB3A 3SPHA 1PQZB 3OMIB 3F04A 4HKBB 4K23L 3SE8L 5ID0A 5TQ2H 5J13B 3WTVA 4LCWA 4XH2B 3EO1A 1M4KA 4V1DB 3KPQA 3PV6A 2MPAH 3Q8CA 3V7AE 1JHTB 2WXPA 2KT6A 3SPJA 3QDMB 4UF7C 2IV8A 5BQ7A 3RPIA 3DBSA 3FTYA 4P4KD 3ATAA 3BISA 3MJ7B 4WW1B 3MV8B 4KK8C 5IB1B 4M1CD 5C7XH 1W6WA 1KIRA 1IM9D 5EUOA 1CJYA 2A7BA 3QJFB 2C9RA 4G7SB 4H26A 4UZGA 3BXNA 1ED3B 4YLCA 1IFGA 4N2DA 4S2SA 5C0BD 4ZPVA 3ARSA 3JV6B 4NHCL 3AG4B 2QZQA 3TPUA 3H3BC 1TIUA 2YOAA 3EAKA 3NSFA 4PJBB 3RY5A 4PGEA 4N87A 5F3HA 3CZEA 1VACA 3DETD 5HHOD 3IRPX 2I25N 2D31B 5IVZA 3WFEH 2ZXQA 3ARFD 4ZW6A 4F33A 1GAFL 4GMSH 3BZ4A 2Q7NA 3FUHA 3B8YA 3QNXB 4G8GB 4H8HA 3LRMA 4GSDH 1U8HA 4AQZA 3PE9A 4WAFA 1R5VA 4M29A 1JZ3A 5IM7A 4MA3A 4PJIE 2G5BB 3CC5B 4JK0D 1EXUB 2IG2H 1J5CA 4FQCH 3OLGA 4GEJA 4HS8H 2YD7A 4IDJH 1K2DA 3EH4B 3UPRA 3HOGA 2CJUL 1E8XA 1FBIH 1ICTA 2XIIA 2WNGA 4QTFA 2V5TA 2G60L 1IBZA 1L3WA 1MIMH 3DO7A 1FGNH 1NA8A 3EW3B 3RWCB 2KQNA 2FGWH 2XNAB 1A3LH 5FYKE 5CBAB 3AACA 3NIGF 4TNVF 5I6NA 2BCMA 4AEHL 1OTSD 1MCEA 2WXQA 5DRWA 3ALXA 5ISZB 4D8OA 2CRZA 4YHMH 5GGTL 1GGCL 2ADJA 2VSKB 4N6RB 4TRPL 1XH0A 4JZOB 1FZJB 2P5EB 3KWXA 4PJ5E 3LTVA 2AKRB 5DO2D 5L9DL 5ETUB 3D85A 1WIOA 1PY4A 4R7VA 3QIWC 5C0JA 3C60B 4OZGA 1RUML 2V2XA 4PD4J 1CFSB 2FX8H 3GK8L 3GJEA 4OCWL 2J71A 1KJVA 3GXDA 3KJ6H 2FB4L 3SJVD 2E3VA 4ZYKB 5E1IA 3TBYA 1EAOA 3WD5H 3FTSA 2Z7ZA 1KJ2L 2XQYA 4P49A 5C0AB 2J8UA 4UYPA 2AXFB 4JY6B 2HMIC 3IMSA 1IAIL 1BPLB 3MV7A 3R0MA 5FW8A 3TWYA 3DYOA 3DXAB 3AB0C 4L3CA 4PS4H 2FEEI 5DD5L 5IOKA 1SJEB 1FRGH 1N6QL 3MFFB 1C16A 1PZ3A 4U6VH 2V9UA 2CMRH 2WZ5A 5E03A 4BJLA 1MJUL 5SWSE 4NZJA 1G7LB 5JYMA 2X1OA 4X8XA 5I5IA 4MMXA 3D05A 1DVFA 4XP4H 2BOCA 4XBPA 3O6FB 5D7IB 4FA8A 2H0PA 3ECUA 3BQUB 2OL3A 3SDCA 1D5IL 3WY3A 2W81C 1U3HA 3WCYA 4MQTB 3MJ8B 3LEVL 5C0DA 3THMH 1QNIA 4HU8A 4EI0A 1FPTH 1S7TB 2DQCL 4RWYH 3GRBA 1AIFA 2OULB 4P23A 4JO2H 2WKOF 1BA9A 1QHOA 1ZT4B 2H7WA 3CMGA 4NYLB 3BGFB 3BKML 5DJ0A 1WTGT 3QYNA 2VDLL 1MCBA 3EJTA 1BFTA 1X44A 5D96C 1QLEB 1S9KC 4JHAH 5AWNL 4MNHB 1P7QB 1R33A 3PFQA 2J88H 1OSPL 2BZ7A 4GB9A 3GXTA 3V55A 5IQOA 35C8L 4N2HA 5LGJA 3CZFB 1QFPA 1X5GA 4XCFH 4Z5RA 3VDAA 4XN9A 3LAFA 3RVWD 1FLTX 1UZ8A 2VDMH 3N50A 2PLTA 4O4YH 4LLUB 3P0VL 1X6NA 1RU9H 2DY2A 3APNA 5DJ6A 5EDXA 1WTLA 2CSPA 4XCCL 5KG9B 4TSAH 1DO6A 2HKHL 2J6EA 3ZKXC 3OLEA 1KBVA 1LXMA 2VLKE 4G8IA 4ZUSA 3V5KA 3U2IA 5SX5K 4HKZA 1FO0L 2O26U 3QIUB 5I71C 1WSST 4IIQC 1DUYB 5E2VH 2GTQA 1DQDH 4HDIA 3EFOA 5TJWK 3VNZA 5DUPL 4MKTA 2Z4TA 4QHKI 4HS6B 4PRHE 3TBWA 2BC4B 1CO1A 3WFHB 2MJWA 1ZT7A 4EN3A 1XF3A 1M9WA 5B38G 2DLEA 1UCTA 1NAML 3LCYA 2EIZA 1U8CA 1JGUH 4QHUB 3K2UH 4QT5B 4NQXA 5IB3A 1FN4B 1A6UL 1INQB 2H32A 1DL7H 1AH1A 3QR1A 5F9WC 4F8TA 3OR6B 4AYFB 2BNQD 3RIKA 2HN7A 4YDJA 5GRUL 4GW1A 2HJLB 2PN5A 3RDTA 5BZDB 2J25A 3SDAD 1CGYA 1QUNA 3AXIA 3QJSB 2VMDA 4HWZB 4PV8A 1MAKA 3MDJA 4YGVB 1MG3C 3ERXA 1N4XL 4JG0L 1ID5I 1WC7A 4ZMOA 1UT2A 4XVTH 3KHOA 4X98A 4FCHA 3N43F 4XP1H 1RLBA 1JBJA 4RISH 1BMZA 1FL3A 1HAUA 4OTXL 1MIEH 2FECL 4HBCL 3FK3A 5C9KA 4IOFD 3TBSB 4Y4HB 3ZXAC 1BVKB 5ACZB 2IH8A 4FXGA 4NWTH 1CT8B 3ZTNL 3CZNA 1LP9F 3DTXA 5I1HL 5I24A 3PRZA 1E3XA 3P4NB 2F54E 3C5SB 3JWNC 4NQSA 5D7HA 3P2DA 1LEGA 5IMMA 2EDNA 3WJMB 1OHZA 1AR1D 2KQMA 2X4OA 4KRPD 3S35L 4B0MM 3ULVD 3RWDA 4JFYA 3UPCA 3WHXB 2CNZA 4LVOB 5E24E 4L48A 5DS2A 2Y5TB 4P2YA 2EH8H 2XWCA 3H1ZA 5K9JH 4R0LA 1QA9B 4CBPA 4U1IA 1XHHA 5HVFB 4RMSA 3CLFL 2FSEB 1U9KA 3S4SA 3QGVA 3CU1A 3BWUC 2X9YA 3FQWA 1XGUA 3CX2A 1U41A 1XWVA 3NCBB 4LFHD 3HB3C 3VWKB 5DC9B 4HUXB 5CLTA 1BBDL 4YSPA 1HK6A 4J3OH 4Q6IC 3KPSE 1OCOB 3MBEB 4W70A 2J1YA 3ZT6A 1P6AB 3SBRA 1MRCH 4ODVH 3O6KL 4O9HH 3QHZL 1JI2A 4G70B 5AD0B 1V3JA 4PGJA 3U9WA 2CKNA 3P3TA 3QDAA 5MEND 1TSHA 3IGFA 1RPQA 4H88H 5F1SA 5J1AA 1A4JA 2WQUA 5DLML 4DK3A 1LEKB 1EH9A 2PCFA 5C70A 2EIDA 4WTWA 1J48A 4LCCA 3NABL 3I74A 1IFRA 2I07B 4PP1C 3ZN6A 4URTB 2I5YH 3G6JA 1RUAH 2J5LB 3A3YB 4UQ3A 1ZVSB 5J12C 3H0TB 1FZOA 1MHCA 2X4QB 3M6DA 5F7AA 5HHMB 4DZ8A 1NJ9B 3UCRA 1MHHA 2BOBB 2Y7QB 1UH4A 3BH8B 2JJSA 3IDNA 5E8OB 1I1RA 3RZCD 3WUWG 1G9HA 3AABA 2F9BT 5L4FA 1W0YT 4CKVX 3V0WH 1KLFA 3NH7H 4LNVA 3LMJH 3QWNA 2QMKA 3BVDB 2ZXGA 5ALBL 3SOTA 5I8OH 4FFZL 4OV5A 1V5JA 5EWIL 1IEBA 2AJZB 3ZE0E 1KBKA 3LPFA 3TVMB 1JPTL 3PWPD 5AW6B 5A2LH 5HPMA 2OAAA 3UAAA 1OM3L 3PL6C 4QKTA 4PJ8C 4U0RB 3SY0B 3HZYB 1OAQH 3HI6H 5EPMB 4HWUA 2A99A 4OVUA 3Q3GA 5HGAA 3VFRB 3DUUA 4NQDB 2ENYA 1UZ6E 2P9RA 4XHJC 3Q13A 2YS4A 5KVGL 1BPVA 3RVVC 4BDVA 5ICXA 4D8PA 4YJZL 4KJQD 3IDGA 5FHAL 2NY5C 5FUCC 3UZVB 4HQQL 3Q1EA 5IB2B 4IRJC 1DBKL 3JZ7A 4H25A 2GABA 4GINA 4LHUG 4ZSOE 2M83A 2GJZA 1A9VA 4L0ZA 4YZWA 2NSMA 4HH9A 4IBLT 3GBDA 4ZQTA 2WMPA 1QLEL 1DBJL 2EYSB 5D6DA 1ZVNA 4PY7A 3EZ8A 5HVGB 4APXB 1BLNB 5F0LB 3BZDA 1F02I 5MP6H 1KCRH 5C0RL 2W65B 1S3KH 3VXUB 2VDOB 4DP6X 2ODIA 1GC1L 4IBVA 1QLFB 5CCKH 5BQDA 4X50A 2QZ5A 1WFMA 4BYHA 5ADPL 5KEZA 4MGXA 1C9SA 3L2MA 4PJDA 5F6IC 2MNWA 4M43H 2CZNA 4FI6A 3CVBA 1EUUA 4TLTA 5CD5C 4WDIB 4OF5A 2PYFA 3C5XA 5LAPA 4MVBD 1BVLB 1E4XL 2XJKA 4G42A 2Z93B 4UWQB 1AR2A 3HBQA 1CIDA 2P3YA 4RQQB 3TT1L 2BVEA 5HGDB 3ZGHA 4YHLL 2LU4A 4LF3A 1YYMH 3ARZA 5I6OA 4AYBA 1XR9A 1ZV5A 4Y1TA 1RP9A 4NLAA 3RA7L 3O3DA 5FYLL 5FGCE 3DK2A 3GI9H 3MU3A 3V4VA 4XAKD 3SPIA 1TPXC 4NKDB 3BN9D 1RJZA 3RWFA 4R5VA 4CDHA 4Z7OB 5CJXA 3DHJA 5EH1A 3UC2A 5EIIA 4ELMF 4N2CA 3IFNL 5KS9B 2A6IA 3EGXB 3S36L 3E1F1 3B5HA 3BW9A 5JHLA 3II3A 3MRGA 5FGBA 3T8XA 4N2BA 1OF2A 3TJPA 2CJ3A 3ZDZF 3ZR6A 1QO3A 3QH3B 3EYUH 4NZTH 2Y06L 2AQNA 3T6XA 3TCLB 3HS8A 4I3SH 5D2NA 5KSBE 4TPRH 3U2SA 2D2CC 1XGTA 3DGDA 3B7TA 2X0WA 2YPLB 4HU2A 4JDEA 1EEYB 3B6SA 2ZXBA 3RIAF 4AUYA 1R9FA 2I85A 1NIEA 3MRIA 2IAMB 4EI5D 1L9QA 1W0VB 2R69H 3MBXL 4XPBH 5C09E 1C5DA 1ZHKA 1L6XA 3MJ6A 1HQ4B 3U7AA 4DSYA 4O5LH 2EP6A 1R3HB 2VXQL 3MN8A 2EIBA 2PKDA 4PGDB 5E2WL 1KB5L 4B7LA 4G71B 5LGYA 1XGYL 2UVEA 3EYOA 1PG7X 4FLRA 1DUZB 3UO8B 5C2BH 2VDNH 3QPQD 4JN2A 2YK1H 3KS0H 3CFBB 2QHRH 1E65A 1NCBH 2ZF9A 3L08A 3UJJL 2IADA 5BUAA 1RJLB 4AZ8A 4FCAA 5GHWL 3WOVA 1MREL 1K6QL 3E6FA 1TTUA 2DLIA 3QDGD 2VXUH 4G8FB 5F1IA 3UTZA 4JN1L 1RIUL 3D39E 4AK1A 3ZMRA 5F7LB 1BQUA 1HOEA 1XD1A 2MNUA 4XOAA 3WTXA 4WRLA 4PEEA 4FNLH 2YR3A 5FX3A 3HE6B 5I1AA 2N1TE 3L3KA 4GAYB 3D9AH 3ML9A 1S9XA 3ZX1A 3T0XA 3B1UA 4QY8B 4RIRB 5I2IB 1HAWA 4Z76B 4JFQB 2UY7B 3C5JB 2OMZB 3GPEA 3KCPA 2NY2B 2QLYA 4PJ7E 2CBQA 3WXWH 5BRZD 4CL7A 1VPOH 1SVCP 3BWAB 4DKAA 3CLWA 3TA3D 2VR4A 3MRFB 3VJ6A 1JZ6A 3ABKB 5HYFA 4H7VA 3C8KB 1NL0H 3RHWF 3P11L 4PJCA 3TFKD 5KANG 1O7VA 4AMKH 2X4UB 2ATAA 1VEPA 1H8OA 1U8OB 3ZDXE 1JNNL 1WBXA 3FYIB 1JZIA 2DQJL 2Z34A 3NTCL 4D9LH 4U2ZA 5KSAD 2WXMA 5KVEL 3D4CA 4OCRH 2OXHA 4FHKA 2EJ1A 2XBDA 2BY0A 5AYUH 2JV6A 2A73B 1MI5D 1XV8A 4M3KB 3VSUA 3OKKA 4UILH 1ET8A 5T3ZD 2PW2A 4DEPC 4WK0B 2VERN 4IRZH 3ZKXB 1I1YB 2GJJA 3CDYA 4HIHA 2AFNA 3QUZA 1NLBH 3AS2A 4NO0B 1ILUA 3ROOA 3K6FA 3GHBL 1CLOH 4I0CC 3GLDA 4BFRA 3FO0H 2O6DA 3QI9B 3ZZQA 5B39G 5DJAA 1RZGA 4W9KC 1P4UA 2IALB 1EVUA 3VFOB 3CG8A 4JO1L 3L5JA 2DQFA 4QLWA 1WWCA 4AQ1A 4BUGA 2WWMC 1V10A 1KUMA 1WCBB 5KSUA 2WLNA 1WRFA 5C0EA 1YEDA 3EKCA 3DSNA 3OJMB 1OT1A 1D9KB 2GFBA 3MCLL 2XY2A 2DQHH 4KQ0A 1QSEB 4L9LA 5EUKA 1P9MA 2TSBA 4OZFG 1Z5HA 3QVAA 3TNNB 4XNQB 1E6JL 3CHXA 2DBJA 3FU5A 1KNOA 1UB6B 2APWA 1GGBL 3N91A 1EERB 4FHBD 3WKML 1NC4B 3KLAB 1RVFL 3FXIC 5AW8B 2MOVA 3LZFH 4U1GB 2EO1A 2F6AA 3MOBL 4LVNC 1LEIA 3B7SA 3DI3B 1BJ8A 1F2XK 4LEOA 3QUXC 1CXEA 1U8NA 2WLYA 3COOA 3FT2A 4TM9A 5E8EA 3F58H 2R2HB 1NFAA 3CXDH 2UX7A 5HI3C 3WUWB 4KAQL 32C2B 3VFPA 3CSGA 5HHNA 2JE8A 2C3GA 2IDTA 3VSQA 2CGRL 3VRIA 5F7HA 4UYQA 4Z7VA 3UTTA 3UP6A 2VDOL 4NUPA 2RMNA 3NCMA 4XP5H 3CFCH 4XMTA 2BP3A 1WIPA 2A4ZA 4OCYH 3EYQD 2NTFB 1O5PA 5ILTL 4TSCH 2D7QA 4OI9A 3BKJH 3R7QA 5T3XE 1G7JA 3ARDA 1SXCA 3HLAA 5FYKD 5GGVH 1L7TL 1EJ8A 4E68A 1F97A 2Y1ZA 1QW8A 4X6EB 4ZD3L 2EE0A 4XVJH 1BREA 1GMEA 4GP8B 1DTUA 4B50A 3DUSB 4XNUH 4EMZA 3ZUNC 4PJ5D 3ZIMA 4RA3A 1TCMA 4E2OA 5E6ID 2FATH 3QA3A 3EF7A 2VDMB 4K55A 2O6EA 1AS8A 4A68A 3RWJB 3CK0L 4ZO6A 1N70A 5C8JB 2H1LM 4ODHH 5HHXH 4P48A 1MPAL 2G9KA 1MFDL 3VD3A 2HP4A 3BLBA 1G94A 4HPOL 4WHYH 2GKIA 2QTVA 4OLVH 4L29B 3KG5A 3VX1A 1FNSL 5TF1H 1HE8A 3PNWA 4JKKA 1BLIA 3MKGA 4BZ2A 4HUWB 1IKNC 3DX2A 1IAOA 1M6OB 3KS0J 1G9NH 2UXFA 1MFEH 1XGRA 3QHFL 5IVXF 5SWSD 2PO6C 3F6IA 4PJFF 2DMKA 1Z3GH 1JOIA 1XDTT 3QQDA 3BPOB 3VTTA 4BKTC 5I73C 4X6CF 2FL5B 4FZEH 5PAZA 2AF2A 4EVNB 1JJUA 3MUGA 1AS6A 3D87B 3V4PA 1KLUB 1ETZB 1PNDA 2C9AA 1V55B 4QXTB 4LLMA 4YPJA 4MNGB 4Y19E 2Z7UA 1D5BB 4Y5XB 1R3LA 2AITA 3IXAA 4CW1B 5K9KA 2WVVB 1ZE3H 4HF5H 4QNPF 5B3NA 3K74B 1B0GA 3DHUA 1YUHA 2Y7SA 1I31A 1PJWA 2BLFA 3D33A 2FR4A 1YJDH 5E7FA 2XBTA 2EVHA 3V4LA 3BVUA 3EOBA 3C87A 1CF8L 2DJSA 1RZ7H 1JNHA 4Z7WF 3WS3A 4J2QA 4DPAX 3DX7B 2YSTA 3UL4A 1DFXA 1Z9SB 2W9LA 2VLJA 2QPEB 2BHUA 5DJZA 3POHA 1ZA6B 1KENL 2K8QA 1H6TA 2OZ4H 1HZHH 1S9YB 1QFWL 1XGQA 3I3DA 3P9MB 5HJ3A 1CCZA 5JHDB 4XWGL 5JXEA 25C8L 3DURB 5E5MB 2F1AA 4GO8A 3VXMA 4U33A 2JJWA 4NCDA 5AW3B 3RWIB 4BFIA 1D3CA 4MQ7B 2AV7A 1TTBA 1A64A 1YUKB 1J8RA 2VQ1B 5F8QC 3SGJA 5F9JA 3UBXA 3BWUF 5LGHL 1BAFL 4R97C 4UTBH 3HE7D 3MBWB 1EDYA 2L0DA 1URIA 4F2MA 2K1MA 3NZUA 4FZ8L 5DYOA 3IRZA 3LNDA 4N1HB 5CWSA 2XWBB 4P2OA 2RFXA 1BJMA 1L4IA 1YMMB 2F53E 2VLKD 2WXIA 3EJCA 3VXPB 1U92A 4YHYC 3SDXB 1U8PA 3QJTB 4IS6A 1T0PB 1BZDA 4Z8FL 1OPGL 3K2IA 2YMOA 1NDMA 1UYWH 3MRLB 4OAWB 4RRPM 4B96A 4BXSV 5EU6A 5F6IB 1G6RA 2DF3A 4G3YH 4PRHD 1MNNA 4APQA 3IU3B 3GNML 3CE1A 2VLME 3BVNA 4HULB 2A74C 4QR7A 5GZND 2GITA 3MLXL 2Z91B 2VZVA 4I3GA 5E4IA 5D1ZI 2I27N 2LVEA 3ZMNA 3F7VA 3NAAH 3KXFB 1I8UA 4N2LA 3V0AC 4UM9B 4UTAL 1U8IA 2WQ8A 3ILPB 2VL5A 4F58L 2XVGA 1BSIA 1NLDL 1SEBB 3D3VA 3ARED 2Y2YA 5DTFB 5JORA 3N0AA 4POZC 5G5DA 2WVTA 1B2WH 5MI0B 3GM0A 4PRDA 2R27A 1ITCA 4N68A 2XLLA 4PRBB 3KJ6L 3BCDA 1IGFL 5BZZA 4CMHC 4JM2A 5FCUL 3KM1A 4JFOB 1XF2A 4NNYA 5C3IA 2NY1C 3GSWA 5D1QA 2F54D 2BK8A 2HLFD 3NJMA 4CVWA 5HYQB 5C0IA 1NGQH 1QKZL 3TA4D 3U7YL 4HD5A 3C6LD 4E9YA 3WEBA 3BPLB 4GQPH 4YSQA 2DKMA 3MAWA 5D71H 1CB4A 5D2LA 2HRPH 5B39B 2VJXA 5F7EL 4YPGA 2CAKA 1IM3B 1KEML 4M62L 5D1ZD 1G0YR 3CHOA 3H9HB 4K9EH 4XMWA 4C8XA 4XNZB 4MJIB 1AOHA 1YNKL 3HNSH 3BMVA 4RZCA 5E4EC 3CFJA 4WI7A 1LO5A 5ERWA 3ESUF 4F9LA 4LLVB 1SLVA 3QUKA 5AKVA 4KPHL 4MNQE 3TTYA 1S7UA 4RFOH 2V9RA 4AYMC 4QHLA 3RGVD 4MASA 1AG6A 1YRKA 3KPSD 1KJMB 1WAAF 4OZFB 4AQOA 2X4TB 3RQ3A 1FFTB 1N59A 1QUPA 5TE6L 3WNMA 4F9PA 3UC0L 4QRPB 3GKWL 2B2XH 4HZLB 2J88L 4Y0GA 5C6TH 3KYOA 3IBEA 1HXYA 1X5IA 1MH5A 4NQUA 4JO4L 4FJ6A 1Q9WA 2MEJB 4XCFL 4ZS6C 4P0DA 1YEIH 1YYLH 3RWGB 4YHKL 1DLHB 2E76C 4JR9H 4O02A 1NOLA 2CJTA 4LGRB 1CD9B 5B22A 1D7DA 4BZ1L 2VDML 4M3JA 1OP5H 1EDHA 5I1DB 3GRWH 2AJYL 2V7NB 2YAPA 3BLKA 5DJXB 2BJMH 1GGTA 2Y7LA 3MNDA 1GHFH 1KN4H 3J07A 2VW4A 4WO4A 3UTSB 2XVBA 2O5ZH 3T0EC 1MLBA 1OKEA 1Z5LA 4I2XB 4OLYH 4RGOL 4G9FE 4PLNC 1K8DA 2J8HA 1F4XL 1O6SA 3MYJB 1SF5A 2CCWA 1B9ZA 5DGRA 4ZFOA 5IQ7H 4JO3H 5IGXL 1PCXA 1JK9A 1KYOK 1WT5C 3F7YB 5I0XA 3IDYC 4L8SC 3RUGF 2P5WA 4FS0A 2VWEE 1QAWA 3VXRA 1AQKH 3QUGA 3ABZA 1IGYA 2R4SH 5AG9A 1JRHH 4NQTA 5D55A 1OHQA 4JE0A 1WFJA 4Y2OA 5IOPA 3B37A 1OV8A 4GKSA 4PV9A 2A0LD 2OMYB 3ISRA 3I6KA 3GGWA 1NDGA 2CRYA 1BWWA 3Q6FB 5ANME 4IKNA 5E8PA 2WW8A 4KTDL 2WAHA 1Y1DA 2V17L 2W9EH 3M86A 5GGQH 3DVNA 4EIZC 2BIIA 4JL2A 4X6DF 2VLRE 4A67A 3N06B 2ZYRA 2DL2A 1I9EA 3L4XA 3D52A 3OF6D 1T66C 4UQAA 4HOWA 4X8CA 1MJ8H 4KOBA 4LKCA 1ZLWK 4C4BA 2Y6SD 3ZHLA 2B8OT 5IB4A 4GUCA 1VGKA 2UWEA 4Y4KB 3TBVB 4WHDA 4MCNA 3EFDH 1WG3A 2NR6A 4FA7B 1I3UA 4LT7A 5JW3L 3CZUB 4YLQT 5ESVB 4WK4B 3KYKL 1E7VA 3WJJA 2NY5L 2FT7A 2EC9T 3T4AB 4HMCA 1ZV9A 3NIDF 4CNIA 2DQEL 4ZMXA 3MRBA 5I30H 2JCCE 4FF9A 4NFDA 3CFIC 3DK0A 3FPXA 5F9OL 3VVVA 2PYEE 5DT1L 1U8QB 3V6OA 1QASA 2Q8BH 4Z77B 3WDHA 3LNEA 5LBGA 3S2AA 3OKMB 4OQTA 1M3IA 5J4MA 1IV8A 3MRKA 3UZEA 4WUUB 3FB6A 4OZHF 2W9DL 3S3CB 4PUBH 4F7CB 5ACLA 4Y2NA 3AQXA 2ZCHH 4YSSA 5K9JL 5DLLA 3DBXA 1ODUA 1CWVA 4L37B 3GMRB 1NEZG 4FQ1H 3IJSB 1KXQA 3UAEA 4UQEA 1TCRA 2X9WA 2YRLA 4ORGA 3R06B 5L2JB 4PJXF 5F8RC 2Q9OA 4X9BA 1OF0A 5BMFL 2JELL 1YEJH 4L3EA 5CP3A 3BPNC 3QWRA 3STLA 4IOIB 4UZUA 5B7MA 3SE3C 1F4AA 4EO5A 4N0UE 4F93B 5ISZE 4OZ4A 1NANH 5DEJA 1BBJA 2O5XH 2P5EE 4LB8A 1OAZL 4N9OB 4OIAA 1ZS8A 5FEBA 4MMZA 1T89C 3QUYD 5SV4A 2OMVA 1ZXQA 4YXKH 2E9GA 2LTQC 5I1JH 4Y5YB 2MFNA 2GSIA 2XOTA 3WIHA 4LSQL 5J57B 3BAIA 1QFOA 4H0LC 5F44A 5IHUH 5IEKA 4R4NC 1XBRA 3TCTA 4N8CL 2OMXB 1IRAY 2EDQA 5C0AE 5EO0A 2YUVA 1JF1B 3GJFH 3MA7B 3QG7H 4N0CC 3GIZL 2YD2A 5CN1A 1I7TA 1OANA 1T2QL 3V5DA 1QSFB 3U7WL 2PWEA 3PWJB 5T1JA 3VO0A 1LK3H 2W92A 4MD0A 4WZ9A 3VXQB 5JHBA 3MLYL 4M6NH 2HX8A 5JHAA 3LDBB 3NH7L 5I73B 1HYRC 3LMJL 4Z0BL 4DEUA 3B2PA 3WENA 1BEXA 2IBGA 5D7IE 3GBMH 4IGBA 5DRZA 2R15A 3TEYA 2Z1KA 5JIIA 1XH2A 1TQWA 3BD5A 2VN7A 1K4DA 3K72A 3KYMA 1GS8A 4Q9RL 2F7IA 5FS5A 3NRQA 12E8H 3W37A 5IFAL 4YE4L 1A6WH 2ZUSA 3FFCE 2FIKA 2XTLA 2ICWI 4F37F 6TAAA 1I7UB 3ZTEA 1NMAL 1PLGL 5INDB 4JFPA 4DCQB 1LD9B 1L0YA 3GEWB 4ZAKD 5HHVL 2B4CH 3TEXA 3CGTA 4NCC1 4UT6A 1C1EH 3HC4L 3MV11 4CMMB 3UABA 3HMWH 5JR1L 4MXQC 2BNUB 3VWJD 4WWKD 3IGAA 2XJLA 5HYEA 1IT9L 3QUMA 3EGSB 2ERJC 5FGRA 1EFQA 1QBMH 4H1LG 4PRPE 4NRZA 4JDTL 5DURB 2OR9H 5SWZE 1N7ML 4K7PL 1UKQA 4N8VG 3O4OC 1NFDA 4HALA 3HFMH 1KCRL 4R97B 2QPUA 3PABA 3QXTA 3B9VA 4JGMA 3HS0C 1HZLA 4GBXB 1UZGA 1VDGA 1H5BB 1TU2B 4KGJA 4DGYL 5I1IH 5JDJA 2DD8H 3NRPA 3IE9A 4M43L 2PWDA 5E2JA 1I3RA 1J5DA 5C0FA 3FOMA 4F80A 5L7XH 2W0LA 2OX5B 3MSPA 4GUQA 3DMMD 5ID1A 5FYLE 1AY1L 4GI8A 4QHMB 4M5TA 1TOXA 3MXWL 3TIEA 4PB9L 3VMOA 1NC2A 3P9WB 4A55A 4FL4B 1TZAA 3JV0A 5FYJU 3ZK0A 1F90L 4X0NA 3KL3A 5DK0B 3SYAA 3CFEB 3D12B 4TUJA 2XETA 3BPCB 4A2GA 5DRXB 3NK3A 4PJEA 1NCCH 2QDVA 1I85A 2X1WL 5H4YA 4XZ4A 2EEAA 1A21A 3TPKA 1RK7A 5T1LD 4GKNA 4YHNB 3IJYA 3JTTA 5D7SH 4AXWA 4Y8DC 4ZMNA 2YLKA 3EYUL 3LPOA 4NZTL 4P04A 3IYLW 1DO5A 2DMCA 3IMUA 1UD8A 4HLJA 2A2QT 1T20A 2NX5B 3FCUB 3OX8A 5GGUB 4UDTA 3ECBA 3QWOA 2ZOTA 2JB5L 1N8ZA 2X12A 2FT6A 3LN5A 4PJAF 1LWJA 1F13A 4MA1C 5E9AA 4L8DB 3O0RH 5E51A 3MGTA 1CDHA 2X05A 2PP9A 2DJ4A 3MRRB 3RNQB 3HCVA 1CZ8H 3RAJH 3K5RA 3V10A 4C56A 4WIQA 3PHQB 4P46B 3UIYA 4EZJA 1P1ZA 3S3JA 1Z7JA 3BJ91 3WMQA 5C2BL 3QXAA 3CDCA 3QQXA 3D2UD 1AXSA 1J8HB 4K7FB 2V5YA 4HSAC 3MUUA 3RL2B 1FGVH 4JFEB 4K7PY 2HRGA 4E0RA 2F5BL 2H2SD 5CIPH 3VD0A 3QDJA 4FFVD 2P5PA 5T3XD 1T2JA 4A2MA 3BAYA 3RHWK 3IDUA 4TTDC 4BWWA 3HI1B 1CMOA 4CSZA 1O7SA 1OB1A 5LAXB 1CFNB 2HVBA 1IGCL 1WBYB 4YN3A 3GT6A 4FNLL 4XP6L 3LN9A 1W0WA 4WTZA 2PCXA 1J1XL 2JKXA 3BP4B 2CKBL 4RSVA 1F58H 4HT1H 4S1QH 5DUBA 5F1KC 1SLXA 5I5JA 4FKHA 1LQSR 1VFOA 5IHHA 3EJZC 3F62A 3G04A 3MRCA 2X4NB 4HGWB 3STBA 3X1NA 2MMXA 3N55A 3E2HC 2NW2B 3QW9A 1RZFL 2P80D 3DKHA 4W4OA 2VXTH 2QQNL 3ARUA 4RFNB 3LNHA 4XGZB 2YBRB 4K3DH 1U4FA 1TQCB 4UIMB 3RFRA 4PLOB 3QT2A 3OHXB 4NO2B 5E1QA 5KVEE 1BG1A 2O30A 2KI6A 3MLZL 1N3NB 3MV9B 4X9IA 4NM8H 3DPBA 4MS8C 3V8OA 4F7MA 4CVXA 4X4ME 4LDLB 2ADYA 4DEWA 2XWJA 1ZPLA 3HJ0A 1J0JA 2OTWA 3OXRB 5AYUL 5FECB 1ILSA 1UACH 5ICYA 2ESVA 3BEWA 5ES4B 1DCLA 2DQIL 3QISA 3T0EB 4HUVA 1JZ4A 3CVDA 2VDPH 5EEUA 1WHOA 4KI5C 4KVCL 3EHBC 4B9ZA 4Y19D 2NY6C 4DO4A 1FAIH 4RNRA 3ZGIA 1KC5L 1NEZB 1BAGA 2Q7YA 4ELME 1SXNA 1FLRL 3VGFA 2ZYIA 3FN0L 3PHOB 5I6KA 2HVKB 3IDYB 1IEAB 4LCUB 4KXAA 3T2LA 4RWHA 1L5GB 3MOAH 3ZDZE 4P4KC 4H20H 1CL7L 4R4FH 5DK2B 5IROA 1A7BA 3KYNA 1I9IL 3LV3A 4ICXA 4O58H 5T5FH 3H6AA 4UDUA 5HGBB 2NY3D 3PF2A 4FXKB 3MLRL 3SY6A 2F18A 4E42B 4KKRA 2GCYA 4NQDE 3VG9C 3MA9H 3RWEA 1J0KA 5DRNB 4ABQA 1KFGA 5ELIA 4G7YH 3HEIB 3GTNA 4ABUA 3UBHA 5EA0H 2R1XB 1PKQB 4XZUA 3VI4A 2GIYA 3OAUH