5IJBC

The ligand-free structure of the mouse tlr4/md-2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
136
structure length
136
Chain Sequence
QWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B chimera
publication title TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ijbC00
1KTJA 2Z65C 5IJCC 5IJBC 3FXIC 4G8AC 5IJDC 3WEBA 3VQ2C 1WRFA 3M7OA 2E59A 3MU3A 3ULAB 3B2DC 3T6QC 1NEPA 1XWVA 5KWYC 1AHMA 1AHKA 2Z64C 1A9VA 3VQ1C 2F08A 3MTXA 3WEAA 3RG1C 2E56A 2HKAA
chains in the Genus database with same CATH superfamily
2B1OA 3EJQA 2XNAA 4RGNE 1C5BL 5C86A 4IMKC 3D12B 3D85B 4ABUA 5K39B 4ATTA 4XN2A 2P52A 1RZQA 1ZDSA 1G4RA 1MVUB 1I7RA 2VWEC 1XQ4A 1U36A 4G70B 4WU5A 5FUOH 5E8EA 3POHA 5IBUB 3QIWD 1QLEH 2FLMA 1A4CA 3GBMH 4NYLA 3SDAB 3OPUA 5IWLA 3RURA 9CGTA 3HB3B 2ADGA 2CMRL 2HAZA 4W4NA 3VRLE 5DFWH 4ATWA 3V4LA 1GCFA 1PLGL 3DVNA 4LEOB 2AHIA 4ZTOH 1D5MB 4MJIA 5KJRH 1R3JB 3HNVL 4KX9A 4YIQA 3G9AB 3KW8A 3REWB 4YFDB 4XOEA 3QWRD 5ECGA 1X5GA 3MYZA 4UQ3A 4G8AC 4PJXB 4YHNA 2H9GB 3P9LB 4LO9A 5ICXA 2ZT9C 4LOUD 5HGAA 3L7FB 1GAFL 4MNQD 1IB5A 5E6SB 3GSRB 3SQRA 1L0QA 5I1AB 5DQJB 4ZX4A 1FFPA 4I87A 5EOCH 4U1SA 1SUHA 2LLLA 4NHCL 4O2CB 3ULSB 2DN7A 1F4WH 4UNUA 3RWHA 3MTXA 4JFEE 1HHHA 1BHGA 3QXVA 4OZ4A 1NAML 1YNTA 1HOEA 3CFBB 4GS7C 4CILA 4CGTA 4RX4D 5I0XA 3HI5L 4XAWL 2ICWJ 2XJLA 3QDMB 3X12B 1W0VA 4JK0D 5FUZL 1BF2A 2A0LC 2BOLA 4G82A 3WIHL 4I5BA 4XC3H 3C5ZB 4RFEB 3QQNA 3C12A 5TFSL 1E9OB 2WM0A 1BIIB 1UB5B 3R0NA 3V6OA 1JXDA 4ORZC 1G9ML 1IGML 4J8RA 1KIRA 2PYEE 4NQCA 3NEOA 1RJCA 2ZX6A 4RAUA 4PVMA 4Y5VC 5T1LD 1MCKA 1FDLL 4FFWC 5HDBF 4AL8C 1VFOA 3EJPA 4XBEH 4QRAA 4X6DB 4PR5B 5G4MA 5C70A 5E9DA 4HAKA 4ERSH 2ZSVB 2CJSA 5TE7L 1EAPA 5AVSB 2EKSB 4G5ZL 4XE5B 2D7MA 3BHBA 5F9DC 3SE3A 4XPTL 1XR9A 4ZQKA 3E8VA 4X8JB 1OP5H 1BVOA 1A9EB 4U1NA 4I18C 2EYRA 2HJFA 2R1WB 2X4OB 3GI8H 4P5MA 2IF7A 4TSBH 4ANWA 4LVNC 1TU2B 4AVJA 1DUYA 5JMOC 4PI0A 3WEXB 3WFBH 2QADC 4D0DB 2BNRB 3OKEB 5F0PB 3RB5A 1T5WA 4WV1B 1XF4B 4BFOA 2OI9C 3DJ9A 1R46A 4DKAA 1YQVH 1EHAA 2AI0L 2G9HB 3MRMA 3MV9D 5JIKA 3KYNA 4PWGA 5FC9A 5I24A 3Q5TA 5DYOB 1LEIB 3B56A 1MZYA 5FWQA 8CGTA 3TA3A 3HRPA 4MZRA 1T0MA 3A6BL 1DBMH 1X7SA 2BVUA 2ZX5A 4NOBA 1HHJB 2BMKA 3WN5C 4YLCA 1MIEH 1NMBH 2AQ3A 5J11C 1G94A 1VGKA 4OI7A 2E76C 5TGBA 3D18B 2OMNA 1TJGL 3CHPA 1X6NA 4QOKE 5KS9A 4ZO8A 1WF5A 4OGYL 2VR8A 3MLVL 4AIZB 5B7FA 3ECQA 1DSFL 2JNZA 3OSKA 3Q9QA 4X42A 4ZX5A 4LPWA 5B1CA 5KSUB 4Z7VE 3CFMA 5DD3H 1GY1A 4BUHA 3WEBA 3WJJA 1AJ7H 4HJGB 5IQNA 1YYLH 1X44A 3HZYB 5K9QG 3H0TA 2HUHA 3V52L 4K94H 1VIWA 4XWOC 3H42H 1RAMA 3PXJA 4KWUA 3HBQA 2NUTB 3Q43A 4JFFA 3N0PB 2MOVA 2NZ1A 3S8WA 3UZVA 3IDXL 1HVXA 5FCUL 5CSZB 5T5NG 3RKDD 3GI9L 3P4NB 2F7RA 1KUMA 1TMQA 4L37A 1TMCB 4L3EB 5DEFA 2OR9L 1T7VA 2J1WA 3NCWA 3IGKA 3PWLB 3DUSB 2WCSA 2YSSA 5E4IA 1FVEB 1YN6A 4AYMC 4C4KT 2F54D 4UILL 3H55A 3Q9PA 3CN3A 4YPGA 2DLTA 2IANE 4Q2ZB 2E7LA 3TYFA 1MREL 2P44B 3BFQG 1YEIL 3FRUA 4FFZH 3I6KB 4BH7A 4XT1C 4Y9EA 3ZKXC 4BWWA 4P3CH 4BQCA 5FCSH 2F08A 1AZRA 1E27B 4UAOC 2PPFA 5F88B 5C0FA 2VO5A 2JQZA 3GKWL 4EI5B 2NW3A 2J8UB 2VDQL 4QTHB 3RHWK 3O9WC 4ZBJA 1YSOA 3VWKC 1VFAA 5DD5H 3QORC 3WNJA 3WU1A 5K69A 3UTSE 3MRRA 4F37F 3WXVL 1F4AA 3FB6A 2I60H 3QDJD 3L3IB 2VABB 5BXFB 2LT9A 5DD1H 3JWDH 32C2A 3L9RB 4JO1H 1N19A 1E9PA 3HNTL 4EZMA 3B34A 1SOQA 1Z3RA 2DIJA 4AT6A 5LVEA 2HSIA 1S7VB 1A7NH 1THCA 2LLGA 2O6FA 3HZ3A 5DRZA 1ZVHA 5T1MB 1F56A 2ARWA 1ET8A 5T5NF 4TUJA 4ZFZA 2EIZB 2AV7B 3DXAD 1X5AA 3CG8A 5CZXD 1BIHA 5DJAB 4KH9A 3C60A 5ANHA 2AEQH 1FG2A 2EUVA 3MACH 2VLRE 4EOWH 4W9FC 4F7TA 3EYVA 5CEZH 2WXPA 5D2NE 2ENPA 1ADQL 1A3LH 4JFZH 4XNXH 3T0EB 4BIKA 4HUMB 3FUHA 3KYMA 4NZJA 4R4BB 3ZZSA 2A74B 4R2GC 4QRRA 3EGDB 3SEPA 3P4MA 2V5TA 4BSVB 5HHNA 3ULVC 4QI3A 1JGUH 3QZWA 4GQQA 3OKYA 1EHLL 1CL7H 4FTVB 2WZPA 1ACZA 4KQ3H 1XZ0B 2HFEA 2QSCH 4LRIC 4UU9A 1KMGA 3GMRA 3IKCA 3NP4A 1AD9A 3H9SD 3O2VL 4ZNCD 1Z3GL 5AD0A 5IMMA 1CZ8L 1X5FA 4JJ5A 2DY2A 2WLZA 4WO4D 3BDYL 1W8OA 5E8PA 2JLLA 4UQDA 1GPOL 1T83A 1I4FB 3PF2A 1WFIA 4D0BB 3OKOB 3ULVF 3HJEA 3MBEB 4L3CA 3HMWL 2YD4A 5BRZE 4GP4B 4QPEA 1EFXB 2L8AA 2QHLA 4EN2A 5CJQL 1J9QA 5DO8A 3QAZB 4G42A 1VADA 1LO0H 3DVIA 3LZNA 2JMRA 5JNYA 2DV6A 5FYLE 3REVA 2APFA 5DUBB 3BZ4B 4FXTA 2ZAGA 4BQ6A 4P5TB 4PJ8B 3STZA 4WK4B 4BV1A 4L8SC 1WZ1H 5GRXG 1Z32X 1XWVA 2ATPA 5LG6A 3FCSA 2XTJD 3ULUE 4KRNA 1QNIA 3FTGB 1CDCA 2ODHA 3CVHL 4PGBB 1J5OL 3ARFA 3LEXB 1X4XA 4O00A 4J3UA 5CJXC 3WDHA 5CAYB 1JF1B 1E7VA 5AVUB 1YMHB 4OLUL 5I1CH 4OJFH 4Z8FH 2X28A 5SWZE 2X53A 1UG9A 5E70A 1KFAL 1BM3H 3QJXA 4LSQH 3MZTA 4U49A 1NPJA 3DPDA 4OZIA 1AP2B 2XKNB 3KPOA 3FT9A 4ZUUB 4E5XG 1A6VH 3ETBF 1NC2B 4QHPA 1MFEL 2Y06L 3RL1A 3VA6A 4ZFGH 4QTIH 2NY1C 3NCXA 5IVNA 1NGZA 1M05B 4O4YH 5LGYA 1AFVH 1IKFL 1BYPA 4I0PB 4DP8X 3P9MA 1RJLB 1YPZE 2YRZA 4LHUG 1L9MA 3NCYP 1I3UA 1X5MA 1PZ3A 1OM9A 1UT1A 4QRPA 3DO7A 4P5KA 2ERJB 4ZD3L 2EVJA 1UM5L 2NSMA 2W9EH 2R2BA 2QMJA 3MRLB 2AKRB 3GMLA 1MSPA 5C8JA 4FQJL 2BW5A 2IQAB 4X8CA 1UENA 1CBVH 1SF3A 4JUTA 4JW3A 4YVNA 1PBYA 4C47A 2FBJL 5I2IB 1CGYA 1DEEB 4ONFL 4XMXA 2DQ6A 3BN3B 1KDJA 1QA9B 2AGJL 1FVDA 3ZT6A 4L4TB 4WU7B 3QDGA 3DETD 4WTZG 2X70B 3V0EA 3BUYB 4NQTA 4P0DA 4JZOB 1RZ8B 4HJSA 1Z9MA 1EK3A 1INQB 1U3HD 3HG1D 3LZRA 1XB3A 3DVFA 4LLQA 4S10A 2DBJA 1U8HB 2VLKE 2OJZL 2E4TA 4PY7A 5EU5B 3RVVC 3MRKA 4F2FA 4XO9A 5T3ZE 4GXUN 1KB5L 1RJYA 4M5SA 1IAOA 4FA6A 5L8JB 1T4KA 2WHVA 4N5UA 1BEYL 5IFAH 3LIZL 4NP9A 4I18A 2F9BT 1T6WA 4POZD 1YEGL 2NW2A 1A1MA 2MPVA 2X6BA 5KYUA 3CZKA 3T71A 1DDHA 2Y23A 3EF4A 3UEQA 4ZMQA 4JKPH 2H26B 2BSSB 4LSRH 4YBLB 4ALAC 1IAIL 1XGRB 2XQBH 4L9DA 4PBXA 4BK8A 3TC9A 1I75A 2ADJB 3W9EA 1A65A 3D39D 2E27L 1NOFA 4X83A 3TONA 2X9YA 2RQ8A 5KVEL 5KVFH 5EEVA 2XZZA 1GZQA 1OSEA 2JQMA 3D50A 3KLQA 5DS1A 1IGTA 3PAUA 5DUML 3W2DH 1SXZA 3POCA 3AU1A 1XCWA 2PTUA 2JK5B 2R56L 4MCYA 3PABA 3CK0H 2GBUA 3SY0A 3WN5A 3CHXA 3VRJB 1DCLA 2DQHH 1OIOA 4LARH 4PYHA 1UFUA 3L9BA 2MCAA 3VVWA 5BVPL 3B2DC 1DL7L 5E00A 4IBZA 5I15L 3GMPB 1QUPA 1TTGA 1GY2A 3D1MC 5AENA 2WYTA 2EUZA 3ZHKA 2YQ3A 3U25A 2OMTB 2K4WA 5JQIB 4HOZA 1UZ6E 3QIUB 4Y7MA 4MJ5B 2YPKB 4UOQA 4UBDC 3ARGC 2JFCA 3UTZA 2VDOB 4AGMA 1BF8A 3SDDD 4KZCA 1G7JB 4LLMA 3QQDA 5DHEA 4WKXA 4PRDA 5DSCA 3IXAA 1J0YA 1A6WH 2VMCA 1MAML 2CO6A 4PHXA 3RYMA 1I7UB 5JDSB 2HTKD 1WFJA 2X41A 1FFNB 3QUZA 4CJ0A 4LU5L 3ALWA 2BP0B 4JFQA 4X7TB 3IE4A 3QEHA 1VFMA 1NFDE 4DGYL 4WY7L 1A6TA 1F1GA 2XU9A 4NFCA 4NWUL 1E4JA 1IILE 2XIIA 1FIGH 1J1PL 3BP7B 3SDXE 1RCYA 2KYIA 2OCJA 4AIOA 4X98A 4PY8I 3TH2T 3FOLA 3QGVA 2CIIA 2NZ9C 3CPLB 4F7KA 4DGUA 3JYBA 5IEKA 2ZXGA 1QRNB 4G7VH 2JLPA 4IK7A 2VR7A 1MJ8L 3EUDA 3MX0B 5GRUH 3S4SG 4U1JB 4P59H 3D4ZA 4YSAA 4ZUSB 3L3DA 4GW5B 4H8WH 4FMVA 3UCQA 4TV3A 4G43A 3U4EA 4RFNB 4PJHB 4PRPE 5FA4A 1LWRA 2R15A 2BSDA 3FO9A 2YPLE 1IM9B 4F8NA 4A2EA 2XV6B 1Z2KA 4MZ3A 5C07D 1IQDB 1G7HB 1TPXC 5EUOA 3WE6B 1M3IA 2FGWH 3CFUA 1F00I 3K2UL 3I3EA 4A6YH 4Q6IC 1M57B 1S7RA 2WSPA 5AW9B 4PREB 4GAYB 4MD5B 2D4FA 1WQVT 4CNIA 4JL1A 4X9FA 5J9PB 4YDMA 5D1QB 5I17B 1IT9L 1XH2A 2DF3A 4GXVH 5JXAH 3PXLA 3LN4B 4CL7A 4ZFFA 3OKLA 4JJOA 2B39A 2ZCZA 2GUOB 4WCYH 3QC6X 4HH9B 5LB1A 2W38A 3RB7A 1QSVA 1AI1H 3KPSE 4P2QA 4CC4A 3T8XB 5EEZA 4IBWA 5FPIA 1K2DB 3QFJE 2X4NB 3MDJA 3GZPA 1XIWC 4HETA 1BBDL 6TAAA 3T8MA 3L5XH 4OAWB 3VA2C 5DK2A 3B83A 4ODHH 4L4JA 1QFPA 4MX7B 3FQ4A 3U36B 2CJ3A 3QDMD 2J8HA 3IGAA 2I25N 3ARWA 1B3JA 3C8HA 2DICA 2P43B 2IALB 3VTAA 2VLJA 1RZGA 3LRKA 1DQDL 5E99H 3DPBA 1IBGL 4OD1L 4FTDA 4GI8A 1HT6A 3QG6B 3C5JB 2E7MA 3MRHA 1XXFC 25C8H 2WVVB 4OF7A 4LHJB 1O7SA 2R39A 3NA4A 5INDA 2VSDA 3MJ6A 1MJJA 5FGBA 3PS6A 5TDPB 3LS4H 4R4ND 5ESAA 5JLZB 1ES0A 43C9A 3L3JB 1OPGH 2F5BH 4A7TA 4DVRL 4OVUA 1Z1WA 2XICA 1CFQA 1KGWA 5FEBA 4WI0A 5AW3B 3MGOB 1YECH 3ZKMD 3TEUA 5IM7A 2VN4A 4EVNB 2VDNH 3MOQA 3V5KA 2ZJSH 4J1UB 4XMPH 4DQOL 3BWZA 3UACA 4P4KA 4XO3A 4JO4L 2VE6A 4HJIA 1HZKA 4PJGA 5D6CB 4IRSA 1FYTB 2OMVA 4G7RB 4A04A 1MIML 2IDQA 1E30A 3HPLB 5DHYB 3UDWA 2AQQA 3PLYA 4LOVA 2CJUL 2ZXDA 4LNRA 3T3PB 4MA1B 3HBGA 5KBLA 3ZMNA 3EJYD 5CP3H 1NFIA 4KQ0A 5ESQA 4GKNB 4JX0A 4HKZA 4IBUA 3ARUA 2ZOLA 1FLTX 2JIXA 3KPQA 4KDWA 4FQQA 4UOZA 5E2TL 3WMSA 4R3SA 1Z9LA 1WEJH 1Y1DA 1D5RA 3MV8D 4YSSA 1G43A 2WZ0A 4YDJA 4M7LL 5CILH 4JZJC 1H9VA 5DR5H 1MQKH 5BUAA 5AYQA 1SYVA 3IJYA 4G8EB 1J1OH 3C2SA 2F1BA 4DP1X 1GZHA 1QFUH 3P2BA 1NOLA 2Z8VC 3DDGA 4PRHE 5GIRA 3O4OC 4NJ9L 3OXSB 4HX1A 3QHTC 1I8LC 4BFGA 4AENB 1AE6H 1WWCA 2XY1A 3VE0A 3SJVE 4MFHA 4AH2A 3EDEA 3CLEH 4XPBH 1H8SA 3A4DA 1WISA 4F92B 3Q2LA 4QHLB 3TIEA 2WLJA 3LSOA 4HKBA 2MJWA 4AL8H 5FKPB 3CN1A 2XQ0A 3L95B 2FJGA 3PWPA 3I84A 4NZUL 5JOEA 1J5CA 1QVOA 3N50A 1UACL 2N7BA 1BVKB 1EZSA 3U7YL 1F45A 4PAZA 2CGZA 3RY5A 1YEDB 4ADGA 1GOGA 1QW9A 2PXYA 4U1MB 3DX7B 4BFBD 3WY2A 1FBIL 3MRNA 4K9EC 3VI3B 2W60A 4P9MH 3KGRA 4Y16C 3U4BH 4AYFB 4JNXA 5AW4B 4TTGA 1JYXA 1PG7H 4HMDA 5G55A 4XCNA 3BIAX 3FQ2A 1CGUA 1KG0B 1J8HA 5DFAA 2DD8L 4KROB 5EBLB 4J2XA 4QXGL 2K45A 1PFCA 1KELL 3KLSA 4EI5D 4OD3L 3K1DA 4RFOH 3LRSB 3R1GH 3S5LB 3TJPA 5L0QB 4MQXC 4EXKA 1CI3M 2DWEB 3L4UA 4X5RA 5HGBB 1ZT4B 2VIRA 3KE0A 3GO1H 1KXQE 5LHDA 1T89C 1AQKL 2ZAHA 3LNIA 3GLAA 5KANI 3U6XA 2IBGA 5DZLA 5K59E 5FGCB 1NKRA 1KGXA 4JPQA 1F8TL 3TV3H 3HLAA 4FYRA 2G9KA 5H94A 1DVQA 4NEHB 4ZS6C 2A3TA 1Y6NR 3FO0H 1R5IA 3H7LA 2D2CC 3ZO9A 3IWVA 1HAWA 1W80A 1CLZH 3NSXA 3OJDB 3NCJH 2EH8H 2C1PA 3KWXA 1M6UA 3PHOA 4NM4H 4HUKB 4G8FB 1P7BA 2WNXA 3GKZA 4UOJA 3F7YA 3JWNC 4TUKL 2EINB 3VRIA 4F7CB 4NO0B 5IB5A 4ZUTB 3I50L 2NR6C 1KB3A 5ANME 1TCMA 2LV4A 3HAEA 3VFGL 4K3DH 5HDRA 4HUNB 1EGJA 4EKXA 1JVKA 5BS0D 5I75C 3TCLA 1S7UA 3DI3B 1WHOA 3R06A 2YPVA 3STLB 3NH7L 4QMEA 3MLUL 1PNDA 1DCEA 4X5XA 3F04A 5KYXB 3WOVA 4XNMB 2OXGB 1C8QA 1GC1C 2R0KL 5AAWC 5CIPA 3AS1A 3QQ4A 2XFGB 5E1IA 4NWTH 4XMUA 4GKLA 3KL3A 2K70A 2WWKT 3HZKB 3NACL 5HGHA 1SEQL 5JDJA 5L4FA 1OGSA 1RU9L 4HLZG 1MRCH 1NCOA 3CX5J 5SWQB 5B38G 1L7IL 1EXUB 1CGXA 1WT5A 3G5YB 2EEXA 4HWEL 4KK8C 1G9NC 4AEEA 3VXOA 2P5EE 2C9UA 2TSAA 3H3BC 1OOWA 4KUZL 4Y4FB 1ZJBA 4IBQA 1ACCA 3ZE0B 4YX2H 5DD0L 3I2CH 4GUQA 2ZKHL 4J3XA 2OR7A 3PJSA 2VDPH 1ZLVK 3MYJA 5CU5A 1H6TA 2X4SA 1FC1A 3ILQC 5JW3L 5JZ7D 5DJ6A 4OM1H 2FD6L 2OZ4H 4Y2DA 3PG2A 3QDAA 4J3SA 4LK4A 3QUYB 4IDLA 5J6GB 4JHAL 4MCZB 2YD5A 6FABH 1QTSA 2H5UA 5DZNA 5ILTL 3LN9A 3ZE1B 1DBBH 2CCLA 2VZVA 3GXTA 4PJ9B 1NGQL 3B37A 4APQD 1ZANL 1MRDL 3AQZA 4HHGA 2ZKXA 2OJ1A 3LEVL 3C8DA 5HVWA 3ARBB 1FZJA 3PGCB 2H0EA 4Y19B 3GGWA 4AXWB 5E08H 3PDOA 3FAWA 2V6HA 3DYMA 3NJIA 3V4PL 2WUBH 3VFUA 2XG5A 4Y2NA 4JDVB 1JZ2A 2B20A 2A83B 4XPAL 5F1IB 5I0DA 3CBJB 3B8SA 3ELAT 3GZQA 4JGUA 1I8KA 3LS5L 1QLFB 1TTRA 4MYPA 2B2XH 2HJKA 1B0RB 2A1WL 3DX6B 3D34A 1WAAE 1YY8B 1RK1A 1KCVL 2BIHA 5KUMA 1FG9C 2W9DH 3VD9A 4JM2D 5CN3A 4S1QH 3TBYB 1IGJA 2F15A 1BVLA 1L3WA 1S9YA 5LGJA 3MOAH 5CZXC 1EO8L 5EU6E 1L9OA 5EOTB 1TQBB 3ULVH 2ENSA 4K71C 3IMUA 2APTA 3APNA 5JOPD 1DJYA 4EUPA 4YAQB 5J06A 5HYJE 4QUOA 3BKML 5LBSA 3PYCA 1G6RA 1ID2A 1RZJC 5FA3A 1I1AB 4AJYV 1P7QA 2JCCA 3VFVB 1BXAA 3H1ZA 1S3KL 4YHIB 4D7PA 4N90E 4L8DB 1PSKH 2AJ3A 2OAAA 2V5YA 1OW0A 4QRSB 3Q1EA 4JO2L 1CURA 3PAVA 1FFTB 2J88H 4HISA 3SKNA 2WXJA 4JRYB 1XF1A 1G0XA 1Y0LA 3CFDA 3MLXL 3W0WD 2SEBA 1FJ1B 1AS8A 3MSPA 3QG7L 3IGLA 1G5GA 1QTYT 3S3JA 1H6EA 3BW9A 2A6JA 3DIDA 3IAQA 4S1DC 4X9YA 3QPKA 5KSAA 4OD2B 5BZWA 4LPXA 5IK3A 4ZMPA 1IEAA 2JVUA 4UNTA 4PTTB 1JPEA 1CTMA 2BZ7A 3QXAA 4IHOA 4ZW3A 3S88H 3ILPB 4GLRI 4LEBA 1YC7A 1D5IH 2NX5D 4DP7X 4UZUA 4WO4C 2VDMH 2Q6WA 2DQTH 2WKOF 5HYFA 1F4XL 5ACMA 1CDHA 2P48B 2OMZA 4KI5E 4KQ4L 1N64H 4AMXA 5FO8A 5D70H 5HGDA 5T3XH 8FABB 4Z7OE 5DVMA 3BD5A 4LZKA 4HBCH 1AG6A 2JTYA 3B6SB 5TE6L 4QF1A 5EORH 4K8RH 1K5NA 1QKZH 4HOMA 3Q06A 2FX8H 5DZOA 2DWDA 2BS71 1AACA 3IBOA 3P3SA 5FAAA 4KXAA 4G6JH 1QRKA 4G80A 4YLQT 1JERA 4MAYB 2XTJC 3KYOA 4U1GB 3EYFB 2JKXA 2J7LA 5JUEL 3ZBMA 2N56A 3NVQA 1BZ9A 2E56A 4FEIA 2XWRA 5CUSL 3UTTE 4Y9CA 3QIWA 1WITA 1UJ3B 3FHAA 3QRBA 4P9HL 2UXGA 2X6AA 5TF1L 3K7UA 4XNAA 5MERB 1U8CA 5HHMD 4YEEA 2C9AA 3L2NA 5FF6B 3PAZA 1OAQH 1YCSA 1J0HA 4TQEH 2GC4C 2VW6A 3GRWA 4JZJA 4UMSA 1HSAB 5INCA 1WA0X 4KHXL 4Y5XC 3X3FH 1EJFA 1UZGA 1NCAL 2A4CA 3B2PA 3QWRA 4MNHA 1U8OB 3ECVA 4LIQH 3MUUA 4GNKB 1DYZA 3B7YA 2AMUA 2WLIA 2ZG1A 4GKSA 3BUTA 3RZCC 1I8LA 1KDIA 2X1WL 3QIUD 4MNQA 4UM8B 1HZHL 2V2TA 1MZZA 3N43B 4KKCC 1FYHB 3ESNA 5IZ7A 1DN0A 4HS8L 3FTVA 3D0VB 3P11H 4U3XA 1HOCB 2HVJA 2XXFA 3ZZQA 1U3YA 4FAAB 4GG6B 5EOQH 4ELMF 2NQ3A 4RX4A 2HT3D 1ZT1A 2XBZA 1I3RA 2CUMA 4JRXB 2BSED 4HU8A 4JFDE 3UBGA 2EYTA 2UYLB 3J27A 3T9WA 3RAJL 2ZWLT 1KCLA 4MDRA 3BAYA 3GXIA 3RWCA 3VG9B 2AW2A 3SGEI 1JPTH 1XT5A 5HDQL 3MLTB 4K73A 5GGQL 1NM9A 4MXQD 5DVOA 1R5WB 2X6UA 2NY5L 1M2VA 2X9XA 3DI2B 1FO0H 3QRGL 1U3HC 4FZEH 5ICYA 4NXSA 5T1LA 4YSDA 5CGBA 5HY9B 2VERA 4TSAL 4U6YA 2YKLH 3I6GA 2FX9H 1A0QL 2FYYA 4HJ0C 4F27A 4X5WB 1QABA 4XMLH 4R7LA 5AVYB 1QRND 5I6KA 4XX5A 2J71A 2R29L 4N2NA 4GEJA 3CAFA 1AMXA 4QCIA 3RUGF 4JKWA 2VOTA 3NN8B 2BY0A 3AT9A 3BMWA 3UX9B 3FB7A 1L0YA 1FIEA 2EE6A 3ZQXA 4NT6B 1UWGL 3QJQB 1NPUA 2A73B 5HJ3B 4BZ1L 1YMMD 3LH2L 5JPNA 1QR4A 3MMEB 1B90A 1JYVA 2BIIA 4R7NA 2NY6D 1PDKA 2KS0A 1EUUA 3CFEB 5C08B 3E0GA 3MV9A 5KVDL 1FHNA 4TNWF 4GSUA 3AB0C 3UAFA 4YSUA 1N5AB 4HWUA 1QHQA 3SCMC 3DSFH 1MFCH 5LCVL 4C56D 1B4RA 4NO3A 1JXKA 3SGDI 2GT9B 3P3YA 4EDXA 1DR9A 2BRRL 3RWDA 2HPOA 5DWPA 3VJ6B 4TOYH 3NIGF 2VDRH 3BPCA 4PJDA 3BEVA 2MHAB 4RESB 3L4ZA 5EUKA 1P4IH 3FUFA 4MXWL 5DRXA 3EYOB 4N0UE 3KBPA 4EBQL 3ZHFA 3FFCD 5C3LD 2YAQA 4PJ5B 2AVFA 5AVQB 3O3BA 3WN6A 2ZOKA 4GYBA 2CJTA 3HEIB 4BWUA 1OM3L 1O9VA 1TETL 3VQMA 1HU8A 5E4EB 3D0AA 3QNZB 5D5MB 3KPMB 5CCKL 3MR9B 2E86A 5B3JF 5I6NA 2Z31D 2BFVH 1NGPL 1T3FA 4I88A 2WBJD 4DOHB 5DRWA 4AX3A 2E9BA 3SBWA 1E40A 2HTKC 4OKVB 4QRQA 5KSVA 1F18A 1U8KB 2CKBL 2HPTA 3C5SA 3W11C 1R3HB 1ZCRA 2NTFA 3T65B 2ZUUA 2OK0L 4NIYE 5JW5A 3BKYL 5GJSL 1WUNT 5IBUG 1PLGH 2HN7A 3PP3H 2YRBA 3QUKA 4Q9CA 3G5VA 3HE7C 4JO8A 4MD0A 3L3OA 3E6FA 4NC1C 4LLDB 1MHCB 2F54A 2A9CA 5JW4R 3HNVH 3KYAA 5KJ4A 2G0KA 1WPCA 3T0WA 3VU1A 3QJOA 3VXNA 3CZUB 4F8TA 2IH8A 4G6KL 3E1F1 1T21A 2J5LB 3EFOB 5GS1B 4Y2OB 1J18A 3EIFA 4M5ZH 4M9OA 3ZHDA 2NT0A 5SWSE 1AIFB 5ERWA 2ADFH 2IXQA 2R4SH 4BDVB 1FYTD 4HUCA 2LVEA 2I07A 4NX0A 1KLGA 1HYSD 2H6OA 4LF3B 1GAFH 1D6EB 4B95C 3EOBA 5DZPA 3GPSA 3P2DA 1QI3A 3SDAC 5F44A 3QDJA 3WMQA 4U1LB 1RUMH 3CXFA 1MJ7L 3HB3C 3Q13A 4JMXA 1COBA 3QS2A 3AAZB 3U9PL 4XAWH 5ITBH 4MASA 4MNGA 5D93B 5GS2H 1OQOA 2X4UB 1VA9A 4M56A 2A9BA 3QO1B 2UWEB 4BGLA 4GINA 1EZLA 5FOJA 1MCCA 2KPNA 4PJBE 3V5DA 1QATA 2VDKH 2WB1A 3BT0A 3N1MC 3O8XB 4JE4B 4K7PL 1QI4A 5TFSH 1N8ZA 4AITA 5DRNB 3SE8L 3DXAA 2B0SH 5ICUA 3Q2VA 3ISWA 1JMZA 1MOEA 2JELL 1A9VA 1OAUH 4JFOA 3PQYD 3EO1A 1CDBA 2X9WA 3QHZH 3AY4A 5JIIA 4BUGA 2WIMA 3UGUA 1MCNA 5AAMC 4G8GB 5IB4A 4AI7A 4P4RB 1HI6A 4QY8A 3L4VA 3NCCB 2CK2A 1ZAGA 5L2JB 1T1YB 3LHPL 4PGDA 2WKOA 2YMXL 4XNBA 5D2LE 4E9RA 2WP3O 4AK2A 2VL5A 2DJSA 1PKQB 5KAQG 3TVMD 1WLHA 5IMOA 5IV2A 3C5ZC 5JIMA 1SDDB 5C9JB 2CRIA 3RIAK 1S7TB 5HDWA 5IB1B 2DLGA 4UIKH 3V0IA 4DAGH 3UERA 4JDEA 4YR6B 1MCOL 4JM0A 1SOXA 1NGWB 5BQDA 3NFPA 3V10A 3V6FB 3VI4A 3DJSA 5AW2B 3LB6D 2AI0H 4Z6AT 5DK0A 1TSHA 3H9SA 4LLUA 5CP7B 4X8XA 2NXZB 3LKSA 3QCUH 4WO4A 4F8QA 3RX8A 1T1ZA 1K6QL 1RK0A 3C75A 2VM3A 4AV0A 7PAZA 2BSTB 4KROD 4JPIB 5IF0A 1X5JA 4L23A 2PABA 2VLMD 4O2FB 3QRLA 1LHZA 3BISA 4ABWA 2G2PA 3VW3H 3LX9A 3ZKMC 4M62L 2WWOA 1MNUL 3OZKA 4QXUL 2LLNA 2DQDH 5DLML 5I8CA 1QASA 1BLIA 5C2BL 1TJGH 4YHKL 3IFNH 3TBWB 3EJZD 3MUGA 4HCFA 3RWEB 5JXED 2AK4B 3G5ZA 5MEOB 2C7UB 4NO5B 1JGEB 4X6DF 4WV1C 2FO4B 2NUPA 5IROC 4ZMNA 3W39A 4GKZA 1NEPA 1PX4A 1P9MA 3OLDA 2CBMA 1BX2B 2YS4A 4YZFF 3OLIA 1R3LB 5CZRA 4CUCA 4EQ3A 4PQXA 1E90A 3GJFH 4TYUA 3U4AA 5KAQF 3RPIB 5HVFB 1IEHA 4JG1H 1XH0A 4OCMC 1PCSA 1KTJA 4KJYB 3GI9H 2CRZA 3MUY1 4X6CA 3KJ4B 3ZL4L 4BKTC 4LSVH 3WO4B 1JFQL 1A1NB 2A6IA 4O2EA 4PG2A 4NNPL 1N9PA 3FYIB 2ARJA 2OR9H 4OZHA 4XBGA 4Y5YA 4NM8L 3QQ9C 4IU3A 5D8JL 3HC0B 1EEZA 3BYTA 2VUKA 3PFQA 1NICA 3L5WA 5E2UH 1XCTB 1P4BL 2YBRA 3LPOA 3GSOA 2F5AH 3O2WL 5IG7A 2GCYB 2GFBB 2QTEA 1MREH 4LCCA 3U83A 2BVOA 3DX9B 4MMXB 4Q0XH 3RVTC 2I7OA 1YEIH 1IZJA 4O02A 1JNHA 2AV1A 2KZWA 2FJFB 2PR9A 2D31B 4Z7WE 1KY7A 4K9EH 4PJFB 4ZDHA 1NCHA 5KVGH 1R24A 4RAVA 3DX0A 2QGCA 5AZ2L 4YVUA 1S46A 4MA7L 3NZHH 3VXTB 3UJJH 3IJEB 5IEHB 1ROWA 3TM6A 4NQXA 4Z3HA 3VDAA 1IJNA 1X5HA 4AM0B 3WXVH 5KZCB 4I48A 1A7PH 2VXTL 3T6WA 1G6VK 3SPCA 1FNEB 2F53D 2P5WB 1F1DA 3BSZL 3TH3T 4PPTA 3MCKA 1U3HA 2ZWNA 3HG1A 4PP2B 3CMOL 4EZKA 1HH6B 5J3HD 2CM5A 2XACC 3Q1SL 4XN7A 2ROYA 4Y1AB 2Y2TA 2JKLA 4CRPA 2PCYA 1T20A 3B7UX 1NKGA 4EI5C 4JDZA 3OSVA 2VAAA 2Y5TB 2IAMB 3U82B 3PWNA 5L2KD 3ARBD 4N20A 4Y19D 2Z7YA 4H0GA 3WY1A 1ESOA 3QUMH 4N0YL 3MRCA 2HKAA 4MS8D 1ZVYA 2A7BA 2XG4A 3BI9X 4B0MM 1YN7A 3D3VB 2V33A 3BLBA 3D39A 3EDJA 3FB5A 5KVFE 4AYGA 4CADB 2XQYA 1ZA3B 3ML8A 3D52A 5D1XD 1NANH 2J8UF 5MEQB 5DJZA 1E4XL 2P8MB 5E5MB 1Q94A 3F7VB 1DUZB 1EJOL 4I1PA 1PG7X 3ESOA 2Q0ZX 2H6PB 4ZUWB 2DWTA 4NRZB 5BVJB 4KZDL 3CFCH 3P73B 2WQ8A 1Z3GH 1JRHL 1CZ8H 3SKMA 3O45B 4C83A 5DJXB 3VWJB 3RG1C 1ZLWH 3NZ8A 4KVCL 2QBWA 1GPOH 3L8QA 4OZFB 1PZ5B 4ZFOA 1SDYA 5FO7A 2X4RA 4PRID 3T0EC 1B4TA 3HMWH 1XSIA 4I9WD 3THML 1W6LA 3QEQB 4G9DB 3OVUB 2R7EA 2A74C 2PW2A 2GSGB 3BUDA 5EULV 4RIRA 1D5BA 2Q1EA 1QOKA 1MCIA 5IOPA 3GIZL 5J4MA 2OSLA 2O5ZH 2H3NA 3SDDA 5I1HL 3BESR 1KPVA 4FABH 5GGVL 1S4IA 3LQAL 4DKEH 5IVXB 2XXCB 4WJ5B 1J5OH 1I7ZB 2JCWA 1E6JH 1DLFH 3T77A 4N2MA 4OLUH 1IC1A 2ENYA 3RFRA 3O4LE 1QO3B 5A2KH 5I73B 2F1EA 1CTOA 4DUXA 3MNWA 2AJYL 3IB4A 3MBEC 2D3JA 4LCYB 4NGHH 3MODH 5I19L 3CMGA 3GSXA 5F3FA 3QAZC 2VO8A 3N5AA 1WH0A 2F74A 5E4AA 1MW3A 4HCRH 5FYLL 3E3QE 2Y06H 1E2ZA 2PYFA 4APQC 4P5TC 4PJ8C 4J8QA 4FULA 4EN3D 2ZE0A 3WLWD 4JB9L 1T0NA 5IQ7H 1IKFH 4KDTA 3ULUL 4NHUA 4LMQE 1ZMYA 2K3HA 2AJSL 2XKSA 3L54A 4UTCA 4D8PB 4FCAA 3T09A 1QSFD 4ZD3H 5TQ0H 3K72B 5BOZG 5HHPA 3PWVB 4P2RB 5IW1B 3B5TA 2VNCA 1NM4A 2IOOA 1Z5LA 2ILLA 2IPUK 1D5MA 1AGEA 3NABL 1INDL 4IRZH 1HQ4A 4MHHI 4HW6A 3O6FB 4M61B 4I2XE 4Q89A 5C07A 3UYPA 1A8JH 3H9ZA 1T2QL 1ED3A 1QQDA 2H1PL 4IU2B 4ES9A 35C8L 2YN3A 1IIIA 4L4VB 3OHXC 4TN9A 2R0WH 4NQED 3VXMD 4PSRA 3V4VH 1HE7A 1E50A 2VKXA 4PJXA 4QHUB 2GEQA 4M48H 5ABAA 5CWSA 3U0PB 3ZDYB 5K9JL 3UXFA 1SFHA 2FE0A 3DMMB 3I3DA 5EU7C 2RACA 4NQVB 4DJMA 5I30H 3DX2A 1D5XA 1B2WL 3IDGA 5DQJA 2G30A 2ERJC 4AKQA 1ZSHA 1LDPH 3O11B 1OAYH 1KB5H 5GGRB 5KBMA 4WHTA 2DQIL 2IG2L 5I66B 1P53A 1QFWM 4XPGL 4NPYA 2Q76B 2VR3A 5ADOH 3QDMA 4RWYH 2X7LA 1FFQA 4TM9A 3TV8A 2JKNA 4UCFA 5HPMB 3QQ3B 4DP5X 3DJZA 3FH7A 1WFUA 3K4ZA 4J28A 3VXRD 4KK5D 4G6FB 1RZ7L 4QGTA 1XZWA 1I8IA 5ISZD 3WG7B 2OQJB 1W72L 1IAIH 4K4KA 1HHKB 2GY7B 2WIIB 4RDBA 1KENL 1ITBB 3QI9D 3NPSB 3RHWF 2R2EA 4FNLH 5DI8A 1YEHL 4BFKA 4DNLA 4JO5A 1CS6A 3WAJA 4H25A 4E9YA 5CEXB 3CFKB 5T8IA 1LQSR 2E9IA 2VWEE 2XZCL 4XP1L 5T3ZL 4BE5A 1HK6A 2NXYB 4ZMLA 3C6SB 5DUMH 2EKSA 3SOTA 4QHNB 1RFDL 4KMQA 4XVTH 4GSQA 4WUUE 2BP8B 1VCBC 2Y07H 5CCJA 5L88H 4X8JA 3LKNA 4GEIA 1DQLH 1WK0A 2YQBA 1MWAH 1LEKA 5JW4Q 3RWIB 1CPUA 3EOYG 4N8VA 5I1KL 1DL7H 3BZEA 1J1XH 2OW7A 4P49A 2P26A 3KPRE 1MELA 1NMAH 3OKEA 4YBLC 1QBML 2ZCKL 1LD9A 3GS7A 3EG9A 1B0GA 2R23B 4MB4A 5EO1B 3MGAA 1RUPH 3DVGB 4Y8AA 3S0PA 3GUFA 4JPWL 4FERA 3OB0H 5D7JD 5GXBB 4FI8A 2GW5A 1A4KB 4XP4L 5CMAB 4UT9L 4Z3EA 1ZGLP 1N18A 4IM8A 4LCWB 3HIZA 3MV8A 1MAMH 2YEZA 3IMSA 3X13A 3GF8A 5EB9A 5HDBE 3CFJB 1ZS2A 4NENA 4ELKA 2ZKWA 1GIGL 2AEPL 1RZKL 1RHHB 5DA0B 3IPBA 4DGYH 4R4FL 4WY7H 2C8NA 4WHCA 4UT6A 4PJ5D 3TZVB 3GM8A 2IOMA 3KYKH 3QIUC 4M8RA 3BZFA 2XHNA 1MHEA 1CXFA 3BLPX 1M3JA 2OCFD 4AEHH 3DV6B 3HA0A 3RTQD 4ANKA 4AYEC 3N04A 4HF5L 4N8PA 5IIEA 4AYDC 5EZLA 4P23B 5FK9B 3IYLW 1MJ8H 3VO0A 3OKNB 1IC4L 1Z7JA 5CSZA 4ZO6A 5FDYA 3WFCL 2EIEA 5C0CB 4A7UA 2V0AA 2WQVA 4J3TA 3C8KA 3EYSL 2FSDA 4YWGL 4CU6A 1NLBH 1PFOA 1Q0XH 3PWLA 1GW6A 1Z0NA 5F7DA 5AVTB 3WFZA 4MXQC 4OB5L 1FVEA 4DN4H 1MAKA 3CU1A 4FL4B 5JIDA 2DOCA 3K2UH 1KOAA 2AQ2A 3WFDL 2PWHA 1KPUB 4P46D 2R2HA 2W88A 1RV6X 4NNYA 2BIOA 3IAPA 4I3RH 1AO7B 1P5UB 3VXUB 1S9VA 1SLWA 4G9FB 4JY5H 3FT4A 1QSEE 3H3KA 4NAJA 4HEME 2D3LA 3QPQD 4TNEA 2VXQL 5KBNC 1IBBA 4EI5A 1CFTB 2FRGP 3DYPA 2CK0H 4OW6A 1HEHC 4JVPA 2Z93A 1F5WA 1K4DB 3OL2A 2PWDA 1N26A 2V5RA 1O6SB 3GHBL 5KBDA 3KLAA 3L3IA 4RFNC 1GGUA 4V1DB 3L9RA 2EIBA 4QAWA 3IDMB 5B8CA 2X4PA 2B5IB 1ORQA 3V4UH 4ISVB 1OQXA 1EZUA 2NTSP 2NY6C 1BV8A 1S7VA 1DN2A 2O72A 2K1MA 2FX7H 1OT2A 1TZAA 3PAYA 3O8XD 3EGXB 4OD1H 3Q44A 4JRWA 5AW6B 4GO8A 1JK8B 2AV7A 2XZAL 4ZOAA 5D1QC 1HILA 1RJZA 5DQ9A 3UAJD 5DMGD 3T8VA 4XNZB 3F85A 4PJAA 4G7YH 5J0BA 5BS0A 3RDTD 1NAKL 5L9DL 3FSZA 2XJKA 3CN4A 4YBQD 5J1AB 2KLTA 4DESA 5JOFB 1FH5L 4UQCA 1KGYE 1CQKA 5JIPA 2GJRA 5BJTB 4R4BA 1HCVA 2E9GA 3GHEL 1U8QA 4OV6F 1TOXA 3ZTNL 2XNAB 4LSPL 5I1EL 4MB1A 4A7VA 5DHVH 1A7RH 3D9AH 4KK6C 2VZUA 1RULH 2ZXQA 4NUJA 4UTBA 1I7RB 4N0FA 1PD0A 3RJQB 5GZND 4WU5B 4KRPD 5E8EB 4NYLB 2FQDA 3LZQA 2ADGB 4QRFA 4MAZA 1TQCB 3DVNB 2Y36L 2NCMA 3DDFA 4IJ3B 4IRJB 5JHLA 4MJIB 3IWUA 4MGXA 4YIQB 4D0BA 3WCYA 4CU8A 2CAKA 4JDTH 2G0LA 2GY5A 2JJTC 3HNSH 1YG9A 1PLCA 5DURB 3MREA 2PUQT 1KSRA 3WHE0 2X40A 4UQ3B 3ZDXB 4YHNB 3BH9A 3MUZ1 2EIKB 4APQA 3PIQA 2FATL 5HGAB 4HVBA 4PM1A 3QZLA 5SX5K 4YLBA 1FFPB 4OCRH 1C5CL 4U1SB 5FHBH 4FQHB 3FTZA 2MTPA 3CSFA 1OGTA 2G75A 2Z1PA 3EH2A 3RWHB 3HOGA 1KGCE 3NA9H 1HHHB 4OZ4B 4MA1C 1YNTB 1MN4A 2FWOA 1KJ3L 1DBAL 4BQ8A 3ZXAC 4F8LA 4CJ1A 1OK0A 5GRWA 3SE6A 1M7IA 1EO7A 1UOVA 4XVUC 4I5BB 3L1FA 1OAZH 5F1NA 4Z7UA 1O0VA 5T1DH 4M3HA 3OHXA 4J8RB 2HFGH 2J4WL 4JM2A 4ODTH 4RAUB 3SDYL 3ULVE 2HA1A 1IM3D 4NNXA 4P2OD 2A9MH 3E8UL 3SE9H 3T3PF 3KGSA 5CNHA 5E9DB 5F9JA 3DA0A 2YAEA 4HUWA 3U6RA 1EAPB 2F18A 4XN5A 1H15A 4X4KA 3R7RA 2VM9A 4PYGA 3BHBB 4M4RA 3FBKA 4L1BA 4X9GA 4ZQKB 1XR9B 3NDYE 4LBAA 2VSCA 4NQDD 5MP6H 4U1NB 2UV3A 5T5FA 1PMYA 4QXGH 1JHLL 2C4FT 2HJFB 4MSWA 1KELH 4P5MB 5BPPA 5C0RH 2IQAA 1DUYB 3SOBH 3KPPA 3W0WA 3S5LG 1MWOA 4OV5A 3QPXL 3MRMB 4BKSC 3KYNB 3Q3GA 4O58L 1F8TH 3IDJA 5J1SC 1RZ8A 1VZIA 5AW5B 1ETZA 3OAZK 2FWSA 1H3PL 3PE9A 1HEJC 5AWNH 5H37G 2NX5A 1T0MB 5MEPA 3LOWA 5GJTL 5T3XE 2X3AA 4U1IA 2BMKB 4JN2A 3LQMA 1DANT 3F5WB 1OTTC 4KROC 4PJEB 4JRLA 4OCXL 4GXFA 3K46A 1SNRA 1B6UA 1VGKB 2F19L 3I50H 4CSPA 3BVNB 5TGBB 3IETA 4LL1A 1I9IH 4MS6A 1U6AL 5EFIA 5KS9B 4I77H 1DQIA 1M7DA 4AWJC 3WKPA 4B50A 1YUHA 1LP9E 2EDWA 3NH7H 3F7RA 2ZUWA 2E8ZA 3TFKD 4XN9A 3VI3F 4R5XA 2QKIC 2EE9A 4YZWA 2OMXB 3VXQA 3H0TB 4ODWA 4C55A 3D3VD 2J73A 2FLBT 2AS5M 2PW1A 4JFFB 2A2QT 3K74B 2YKKA 1SEQH 3UZVB 1QG3A 1RU9H 4OCNC 4X6EB 2NY2D 4FFYH 3LXUX 3GLEA 4L37B 3BCFA 4HWEH 2Y6SD 4G7QB 1H8NA 4Q8BA 1TZ8A 4HFWA 2JK5A 5DEFB 4TTDC 5TDOA 1ZVSA 4OLZL 4LIQE 2AJVL 3MOBL 4NAMA 3J7HA 4KUZH 1X7QA 4A37A 1R47A 4OU3A 1OZTG 1YN6B 5DD0H 4YPGB 1KYOK 2OSYA 3GEWB 7TAAA 2YQGA 1U92A 3TYFB 5EWIH 3NCYS 2OYMA 2B1HH 3CLFL 4ZW7A 3FRUB 4BH7B 2D7PA 3ZX1A 2B16A 1UXWA 3AWEA 3QIUA 4JHAH 4MJ5A 3VGAB 2BCKA 2YPKA 3BT2H 4N2OA 4C8XA 5LGKA 3GXDA 5C0FB 3BD4A 3T3MB 5ILTH 1LQBC 4Z7NE 2DQEL 2CO4A 2NW3B 4NLAA 5E2VL 3KWUA 2FSEA 1NGQH 3MV01 1ZANH 1A7QL 5HXMA 1JPGA 3TESA 1VFAB 2OX5A 1EEYA 3HJ0A 3TWYA 3WTYA 2D03H 3FB6B 3II2A 2BSEA 4K7PY 3DGCR 2AEWA 4YDNA 3M7OA 3PGFL 1I7UA 1TSRA 4ODSL 3RWGA 2GC7C 2OL3L 32C2B 4FNSA 4FYSA 1AR1D 1E9PB 1W15A 4JPKH 2BVPA 3EH3B 4N25A 3V4PH 4AT6B 1F58L 4YXKL 5IJKC 3OG6B 3AXHA 5I0VA 1KZQA 5DRZB 1BREA 4XPAH 1HX0A 1A14H 3VGFA 1NCNA 3LS5H 3EGSA 4ZFZB 3OR7A 3NJKA 3QUYC 2Q8BH 3FUNA 4L2LA 1BD2E 2ZWYA 1MW2A 4N6QA 3C60B 1PYWA 4M8QA 3X1FA 2QGDA 1FG2B 2XN0A 3G5XA 3E80A 2BDNL 4F7TB 3K6IA 1EO8H 3EYVB 4XOBA 4KK9D 1QRNA 4J7RA 2FJHA 3ZE0F 2A77L 3DECA 4TQPA 5GRVK 3KS0J 3ARBC 5AB9A 5J7CC 3L4YA 4HT1H 3KYMB 4QRRB 4POYA 1BYNA 1RZPA 4NUMA 3QXWA 5HHNB 4X7DC 4DP6X 1R0AH 4PJHA 3B2XA 4RRPA 5GSRB 1B4LA 3UTPE 1YMMA 2IBZY 2Y5QA 3QZWB 3IEAA 4RRPM 4IBTA 2OA9A 3ZE1F 5DTFB 3MLXH 4OCYH 4WUKL 1QW8A 4LDOB 4N5EC 4NKIL 1TJHL 1ZK9A 3RL2A 1U3JA 2HFEB 4PREA 3RX5A 2HX7A 3GXFA 4GAYA 2W9LA 3L13A 1INEL 4C56A 4R7VA 3GMRB 3IKCB 5D1XC 3ZKSD 1AD9B 2F8VA 2YXFA 3OAUL 3A24A 4UINL 4YQXL 5AD0B 5IMMB 1WO2A 4JJ5B 1CE1L 3QR0A 4HAFA 3EOTH 5E8PB 3W38A 4PS8A 4ONGH 3LN4A 3LMJL 4ZW6A 1UWFA 2XBDA 4L3CB 4OM0H 7FABH 4HH9A 4KKBD 3CVIL 1X6LA 2FZ3A 1SQ2N 2B59A 3TPKA 1F4XH 1I1AC 1IFHH 1I8MA 4PJCB 5E9AA 1LE5A 1GXEA 4G42B 4KKLC 1VADB 3FFCA 3K4DA 1A6PA 5B1JA 3REVB 4EO5A 2QQLH 2FIRT 1P5VA 5IFHL 2DWYA 5C92A 1KYAA 5GHWL 3STZB 4DO5A 3DRTA 5FGRA 1MRFH 3ASNB 3HKZA 1S5IL 4W9JC 2O30A 1SJVA 3FCSB 3HI6L 2YD6A 2HG5A 3SPVA 2AZAA 4Q9QL 2PCFA 4IK6A 4TKWA 5FIEA 1U9KA 2DAVA 2JB5H 2Z64C 3ARFB 3BVVA 3BIBX 3C5JA 4M7LT 1AS6A 1JNLH 4GSRA 2Z31A 3UADA 1G7QB 4V33A 2WBJA 2QSVA 1B4JL 1R5VA 2WVVA 3RIFK 5JUEH 3ECUA 3UYRL 3ABZA 4L1SA 3UGEA 5TDPA 4P9HH 4OZIB 2Z92A 4HGMA 5AW0B 1X5YA 1IARB 3ZZLA 4AG4L 2FEEI 3KPOB 1PD6A 3UJIH 4E41E 1JYWA 1DJHA 2MQ0A 1KV3A 2H8PA 4RMUA 5FM8A 3RL1B 4KHXH 5EZJB 4EVNA 1ZEAH 1L7TH 1MFAH 5J12B 1NGZB 3PNWA 1NCAH 3OTTA 4I3SH 3KD4A 4YPJA 3P9MB 4OGZA 3WJLC 5SWZB 3MCG1 2ZPKH 2W59A 4QRPB 2K7QA 1YDPA 2M1KA 4OTXL 2OTWA 1IGCH 3WLWC 5FUOL 1FYTA 4MAYC 3GBML 4U1GC 5DVKA 2R2BB 1NUFA 1UCBH 3K6NA 1E4HA 3GMLB 1BCIA 2EDBA 2P7TB 5C8JB 4ZTOL 4U1KA 3WNMA 4EMZA 4H88L 3HFFA 1UJ3C 2YBGA 4FHBD 1GGIL 2QQNH 4XZ4A 4XPHH 2BJMH 1PJWA 4PLNC 1E5YA 1FVDB 3WIFB 5DFVC 1G9EA 1ZPLA 3MJ9H 1ODUA 1CDIA 4ZFQA 1HJBC 4RMRA 3RAJH 3KVDD 2GSMB 5B3SB 1KN4L 1FNAA 4LB8A 4N8CH 3ABGA 4LLQB 4FQXD 1NAMA 3VQ2C 3ZUNC 2EIMB 1MF2L 4PY7B 3OXSA 5EOCL 3FN3A 1WTLA 4PHZA 3PQYA 4YGAB 4J3OD 5I28A 1F4WL 4TSAH 1IBYA 1RJYB 3WIHA 4E2OA 3FO1A 2VQ1A 1IAOB 4X0KA 3D2TA 4CSZA 4UQEA 2NW2B 1A1MB 3BE1L 1YJDL 5KYUB 4XC3L 2QVMA 5C09D 3ZIMA 1DDHB 1BZ8A 2DDQH 3HE6D 5D7LD 3M46A 2WOYA 4KKAC 3OKKA 3IRZA 2GITA 3TVMA 4MMZA 2WJ5A 4U6VH 4AC2A 4JUSA 3VG9C 3W9EB 1KZYA 1YEDA 5E56A 5I76A 3ZYJA 1QLRA 4HIJB 4IQHA 4BZ1H 3GBLA 3LH2H 2YD9A 3MLZL 4A7QA 2ZX8A 4XBEL 3N43F 2VERN 4B9YA 1AZZC 4H8PA 4ERSL 4EKJA 3QI9C 3EJUA 2CGYA 4A2HA 4ODVH 4GG6F 1ZLUK 3AU1B 1I53A 2BS9A 4N85A 5LCVH 1N3NA 4MCYB 4MTMA 4PWIA 3PABB 2MCMA 3T1FA 1OSZA 3SY0B 1KG0A 1AO7D 2A9DA 2C4FU 3AM8C 2BRRH 2E47A 1I85A 5J5EA 4AQ8C 2IJ0C 3AUVA 4TSBL 2JKWA 3GI8L 3Q5YA 3V0AC 3OM3B 2OMBA 2G60L 4YN3A 4F58H 5E00B 3LRSA 4K55A 4UIMA 4TQHA 2PO6D 3VD2A 1MNNA 2Q7YA 3WFBL 3CVBA 2ZNXA 2DRUA 5HD8C 4HC1A 3H9YA 4X8GA 4WHYG 1O5DT 2B3IA 2H2SD 1XB8A 5AVXB 1IBZA 2QKIA 1YQVL 2EIJB 5JXEA 1FFOA 4JQXA 1R3IL 2N59A 3VFOA 2Z35A 3HC4H 5ALBL 3L81A 4F5CA 1OM3H 3CBRA 1OGAB 1AKPA 1NBVH 2V8LA 3BUIA 3QQDB 4B3EA 4PRDB 5DSCB 3IXAB 5C0JA 2CO6B 1DBML 1MCWM 2WN2A 2YGOA 1DANU 3Q48A 4BZ2H 3MXVL 3QUZB 3KEHA 5CCKH 1QPXA 4JFQB 4ZPVA 2H0PA 1MIEL 1NMBL 4QHKI 5I9QB 5FS5A 5BRPA 3QEHB 4PJ7A 5ABZA 5D96C 4RZKA 4DWHA 1A6TB 3CDGA 2BLFA 3RWFA 3U6XS 3TT3L 5DQDH 2A4EA 2K6WA 2HJLA 4XMTA 4IYKA 2VDOH 1FORH 3L16A 5FKAA 2OK0H 4KJPD 3AZUA 3BKYH 5GJSH 2Y2WA 5B1BB 2LW3A 1N6QH 1NIDA 1ET7A 5DD3L 2FDBP 4X98B 4YAQA 3FOLB 3LNHA 3O0LA 2CIIB 1GCYA 3JWOL 3ZKXB 3WNKA 4N2FA 4UM9D 4G6KH 3G3LA 1X5LA 3CIQA 3L1OL 3O3DA 3WJMA 5IEKB 3M1OA 5KVGE 5FECA 2R8SH 1Q0YL 2Y7SA 1KB9K 1P1ZA 1FLRL 4M5YH 2BSRA 4NBZB 1BZ7A 1W8NA 4I7ZC 3L3DB 5SWQA 1JZGA 3QR1A 1OWRM 3RY6C 4G43B 3KM2A 5FA4B 3W9DA 3CVDA 1IC7H 3FO9B 1Y07A 1GYUA 4IRJD 2GTQA 3LVEA 5IJKA 5EUOB 3WNIA 2BWQA 4XO5A 4RGND 4AW7A 3N1FC 1GSKA 1WIPA 4DEPB 3NPZB 2F53A 1S7RB 1KXVC 1ZKAA 4FFZL 2IV9A 4PWKA 4TF4A 5DURD 3GSNL 4C58B 4KNSA 3W37A 4CNIB 2NY4B 1ZIAA 2WO3B 5D5MF 4F2EA 2WZ6A 2AJUH 4EZLA 4K7PH 1RIHH 2L7JA 1H5BA 3VGBA 1WJ3A 4ZFFB 4GRWB 3OKLB 2A6DA 4XCYB 5GS1C 2B4CC 4HIXH 3S3DB 1GGCH 2JELH 3FB8A 3IMTA 3L1EA 5DD5L 4P2QB 3QPQC 3WXWL 3L3GA 3NG5A 4DP0X 5L2KA 3ARBA 4Y1SA 5DD1L 1H8OA 3EO9H 4Y19A 4D94A 3ZIYA 1NGYB 5DK2B 3Q05A 4R2GB 1CUOA 1OARH 2Y22A 1T0OA 4KTGA 3IGAB 4JDVA 3M6DA 5F8RC 1A7NL 4OZGA 1NCCH 2BVQA 4JY6A 2VLJB 1RZGB 4M00A 2P42B 3DPBB 2KPWA 3VD4A 1LK2B 4UTAA 1YY8A 4KTEH 1ADQA 3MZGB 3GPEA 3O8XC 4MJJA 3FNKA 5D1XA 5CN2A 4Z76A 5INDB 1B9ZA 3VD1A 1QZNA 2AEQL 2VMJA 1GYWA 3MACL 1MJJB 1KC5L 2CPUA 2K4AA 1JZ4A 5ESAB 2PNDA 1ES0B 2D0FA 43C9B 4GT7A 4XNXL 1VB9A 3RE0A 1M1XA 4UNIA 4N1HB 4LASH 2CLZA 4W9DC 1K3ZA 1WP6A 1MPAL 4PD4K 4H1LA 4WW2A 1CFQB 1WD9A 4QTFA 4WI0B 4JFYA 1CGWA 1O9ZA 4PRIA 5IM7B 4DVBA 3UPAA 2GIXA 3N91A 1H6FA 1JGUL 2UWEF 3V5KB 4QRSA 3BQUD 3WUZA 2PYED 5EG6C 1KTBA 4XOAA 2B14A 3MKGA 4P4KB 1CFNA 5JHDE 2VE6B 1EIBA 4PJGB 1CIUA 5C2BH 4IRSB 5I5RA 3X1EA 2EDOA 3BCDA 4MCNA 3IFLL 5FYKH 5K5YA 4LNRB 1KYDA 1OE2A 2ZNWA 4NC0B 3VFNA 1W9XA 2XTLA 5CU9A 2MNWA 3R8BB 1KCWA 1BZEA 1NFIB 3KVPA 4HP5A 4PTTA 5ESQB 1A6UH 1UHVA 4FF9A 1OB1A 1T1XA 3A47A 4HKZB 2ZOLB 5C1MB 5FHAL 2JIXB 3KPQB 4RAHA 2VT0A 4FQQB 1TDQA 2NXZC 1JXGA 1M9SA 3B2VH 3LVTA 5JPMC 2NNAA 1ULVA 2RFXB 2MQCA 2WK2A 4RETB 4PLKD 5AB0A 2F58L 5D7IA 5ECJE 4EZJA 4PIBA 1FL5A 4HK0A 1IBHA 1LO0L 4V2BA 4BFIA 1SYVB 3IJYB 3NCEB 3O2DH 2I27N 1WFNA 1DSYA 3CVHA 1SM3H 3PREA 2V3DA 4YE4L 3ZL4H 1U8MA 1JFQH 1WZ1L 4FX5A 1QX1A 1IL1A 1MI5E 3GRGA 4LPCA 2CDGA 2HTLD 3DIFA 4HX1B 3S2CA 5D8JH 3SZKC 4D3CH 1MFDH 2J72A 1F1AA 1K3IA 4UZGA 4H44C 3KXFE 4EN3A 4ACTA 3VE0B 4DETA 1ZXKA 4QXTA 4OJFL 3SGDH 4KI1A 2EH7H 1QSFA 3LSOB 4PLOB 1GZPA 1BAFL 2ALAA 2Z8SA 4LSQL 5A3IC 4HKBB 3E6HA 4S0SD 2G2NA 3C08L 3OAYK 2FJGB 3PWPB 4QKTA 4QOKD 3WTVA 4MKMA 5MERA 1G7MA 1AQHA 1HHGA 2DZEA 2WXOA 4G8IA 4MA7H 4XPFL 1AXSA 4PRNA 2PXYB 4N4YB 1MCSA 4ZFGL 3WO4C 4QTIL 2E8YA 3MRNB 2DEXX 4NQEA 3T0VA 2GTZA 1GW0A 3VXMA 1AFVL 2W60B 3JVGC 3SQBA 4M93C 1K4CA 1GYCA 1A8ZA 2FWUA 4XCNB 1ROCA 3EW3B 3SPHA 4WO0A 3BIKA 2W9EL 1J8HB 4MXVF 4MMXC 3BZ5A 4PN6A 5CLTA 4JCLA 1BQHA 2H47C 3MRQA 3Q1SH 3OLEA 4F15B 4H2CA 1CBVL 1JZ3A 1V3KA 4YFLF 2VIRB 1TO4A 4WNSA 2IAND 1H9DA 4PV8A 4M29A 3TEWA 3N1QC 5GGTH 7CGTA 2FJUB 3UEZA 1RPKA 3BVXA 3P69A 3HLAB 4MJ6A 5H94B 3VXRA 2VH5H 1YNLH 1ZRUA 1R5IB 5I0YA 3DX3A 3EADA 5ISZA 1KB5A 3HMXL 3UGXA 3CN0A 1KCUL 4GO6B 3K6SA 5DVLA 3ZO0A 2C1PB 3PHOB 3LIZA 1PQZA 3QI9A 4J6IA 5C0AE 3F7YB 5HY9A 2R1XA 3WSQH 4JZNA 3VRIB 3X2QB 1L0XA 4D2NA 3UTSD 4PJFF 5B7EA 2PP9A 3HAEB 3AM8A 1E4XH 1I1FA 4ETYA 5IFAL 2VSMB 4AQ8A 3TCLB 4WI4A 1JGDA 3I6SA 1S7UB 1O6TA 2V2XA 5H37H 3R06B 3RGVD 3CDYA 1E67A 1FPTL 1IAIM 1TZIA 2WINB 2I32A 3L6FA 2IAMC 1JRHH 3PFUA 4Z0BL 5ADPL 2GJZA 3I75A 4LSRL 4X5XB 4AM0Q 3T2PA 4E9VA 4KVCH 4XCFH 4JFWA 2XQBL 3B9DA 1QFOA 4PJIA 5DUPL 1CD8A 4ELME 5CGMA 5CIPB 5AL8A 3QQ4B 3THMH 2P8PA 2RJMA 5HGHB 1WE5A 1WZAA 5KVFL 2IGTA 2VLRD 4HV8A 4ZSOA 1LO3H 3EBAA 3ARDD 5D7JA 1CU4H 3VG0L 3W2DL 4LFHG 1BP3B 1N5AA 2ATAA 3M8OH 1OE3A 3CK0L 3VXOB 1NIAA 3WEMA 4GB9A 3H7BB 2DQHL 2N7AA 5KSBA 4WAFA 1ICTA 3PJSB 2Z9TA 3MYJB 2XWBA 5T33L 2X4SB 5F9WB 1EJ6A 1UADC 4WI3A 3M1CA 1YLBB 3NYKA 3I74A 2LAGB 1U2HA 1DJGA 2BNQE 4Y2DB 3VWJC 1GKEA 4NCC1 3RIAF 3UG5A 4DFIA 2AJYH 5LG1A 4QD2E 4O5LH 1OANA 3ASWA 4DGWC 1CXEA 4PJ5A 2KT6A 5C0IA 3RUGE 3JYCA 1RUAH 4AYSA 2EP6A 3B9VA 4GW4A 1BQUA 5FYLH 4Y9FA 1A6WL 1UKQA 2L7QA 3A6CH 3NFSL 3QNZA 2WAHA 4NDMA 1FZJB 3KPMA 4B3VA 5HYEA 3LAFA 3ARQA 5LN4A 3GGWB 4W6WB 5BRZD 1ZHKA 3RTQA 3PDOB 3ZYOA 3RY6A 3VFUB 1B3IA 4MD4A 4F8PA 2AJSH 2XG5B 2Y7OA 3MU3A 1TEGA 1XL4A 4GMSH 3CQFA 3NIFB 4NFDA 4XP6H 1H3VA 5GS0D 2WBKA 2Y3AA 1GTNA 3ES6A 3HG3A 5FYLD 1I8KB 5IESH 4Z5RB 1J5HA 1HYRC 2X4TA 2HJKB 4FQPA 3QA3A 2Q2LA 1HCYA 3ZMRA 5I73C 3NIGE 4KUCD 1FVCA 1KXVA 5MENE 2DMCA 3G6JA 3ULUD 2EO9A 1X5XA 2YGPA 4LLDA 3IM1A 1IJ9A 4FC3E 3SYCA 5EEXA 1SOKA 1IGJB 3BKJL 2BHYA 4IKKA 4ZI8A 1IGIH 5E24E 2DW5A 1BVLB 1GTFA 4FQ1H 3UZEA 1S9YB 5LGJB 1CLCA 4P46A 3LV3A 1Q9WA 5IVXF 5GS1A 5SWZD 1SN5A 1SY6A 1EX0A 3KJ6L 4H26A 4EUPB 4B9IA 1OHQA 4P59L 4KTYA 1G6RB 2E6JA 5FA3B 4X4YA 1P7QB 2JCCB 3GC3A 2FECL 4H8WL 1PIFA 2YWZA 3SKOB 3QK0A 3KR3L 2Z7ZA 5SX4I 1B2WH 5EIVA 2AJ3B 3NIDB 2OYKA 2ADIB 2ZP0T 2IBBA 4G6AD 4G6MH 4N2AA 3SKNB 2D73A 5B3JE 1Y0LB 2DLFH 2DQIH 3CFDB 2IG2H 2FGWL 2SEBB 4OSUL 5HHQA 3AAZA 4XPGH 5F9AC 2X87A 2ZTBA 1IE5A 3BW9B 1CFVH 2A6JB 2X4UA 3O6FC 5KVMC 5KSAB 4FS0A 1HXYA 4NPKA 5BZWB 1OP5K 4PTUA 3RLSA 4Z7AA 5IK3B 1NUDA 4GXVL 3F84A 1IEAB 1R1CA 4XHJC 5F6HI 3O8XA 3QXAB 1RZ7H 4IHOB 1HL4A 4ELDA 3MNVA 4JFXA 1S7SA 3TO2A 5DUJA 3GJEA 1FAKT 5C0BE 5I1GL 3W5MA 5KOVC 4GIOA 4PLJC 2QGEA 1AI1L 2Q6WB 3UAJA 4FADA 5E8DH 3DMMC 2GK0A 2OMZB 3ZT5A 3RDTA 3L5XL 4IOIA 4QAMB 5E6IB 5FO8B 4ODHL 4OI9A 2XZCH 1SRDA 2Y7MA 4TVPL 2BS8A 3HI1A 3ZY7A 2EDEA 1I31A 2QLYA 3L2MA 4QF1B 5EF2A 1K5NB 4OR1A 5E99L 2DWDB 1BJ1H 1JAEA 3GMOA 4NC1E 4G80B 2VLKD 4RMTA 4K3JL 5HYSA 2OTUA 3BP6A 2ZWZA 4FQLH 3ZDYF 3QUGA 2PPDA 2ESVE 5T3ZD 5I1KH 3DBXA 1S7TA 2YUVA 1AHWB 1EAJA 3WUWA 5GZNA 2ZCKH 4KY1H 3QIWB 4IGBD 4X99A 5LAXA 3UO8B 1F11A 3LS4L 4HBQA 3U1QA 3NPSC 2GIYA 1U8CB 1YEJH 1OPGL 2IH1A 1BQ5A 3TJEL 1DBKH 2EUWA 3OC5A 2EDHA 4XP4H 2XRAH 1OSYA 1TLMA 2EUXA 1YECL 4QWWC 2NXYC 5INCB 5TH2A 5I6LA 1MVYA 1BEXA 4I1RA 4MNHB 3DKHA 2YD8A 4XMPL 2AEPH 2R69H 1RZKH 3GMMA 2WLIB 4WF7A 3FT2B 4GKSB 2YFOA 1AS7A 2H3XC 4HJJL 1WC7A 4MNQB 4OF8A 3TO4D 2V2TB 4N2KA 5EU4A 3RWEA 2OSWA 1DN0B 4GQRA 1KBBA 2C7UA 1JGEA 1ZLVH 2HVJB 1OGAD 3OR6A 4PVBA 4FNPA 1L6XA 3RNKB 2O6PA 1ZT1B 1I3RB 4N24A 1CFMA 1UEMA 2EYTB 4B7IA 4QJ3B 1DFBL 5I1DA 2N7SA 3RPIA 1BYOA 5FYJH 1UT2A 5DR5L 1MQKL 2W8CA 3RWCB 4A2GA 5DWUL 6PAZA 1J1OL 1IC4H 2P8LA 2FBRA 4L0PB 2K9FB 2VZ1A 5ICYB 3QDME 4A66A 5T1LB 5ES4B 1IM3A 1VACA 4XXCC 3S48A 1JPFB 1UUNA 4P2OA 5L8KB 4U6YB 1AE6L 3I6GB 4OB5H 4PBDA 1SLVA 2FYYB 4M6AA 1A3QA 2EVIA 2QGBA 4ICWA 4MBOA 3TZVC 1NCGA 3ATBA 4J3OC 4QJ4B 4LP4A 2NMSA 4IBSA 1QI5A 3N2JA 5KYWA 1XCXA 3IGFA 4NQDA 2D31A 4AL8L 1JVOA 4QCIB 4S2SB 3N40P 4RVBA 4KTDH 4X6DE 4H8HA 3FB7B 2FAUA 1OTSD 2VDLB 2MFNA 2CZNA 2KZ1B 4P23C 5F71A 1DQMH 1NDTA 2BY2A 5JPNB 4Q97A 3EYQD 4YSRA 2X10A 5DU7A 5A2LH 1SXAA 4R7NB 4MJ4A 5BZDA 2X88A 3FJTA 1NIFA 1PDKB 1QD0A 5ID0A 2X6VA 3MV9B 4P9ML 3L7EA 4U7KA 2V8MA 3U1SH 5FFGA 3U4BL 4PGJA 3PRZA 3OXRA 3MNZA 2WWMC 4A7GF 4HDIA 1MQ8A 4FL4C 4NO3B 1WTGT 4MRBA 1KN2L 2BNRE 4EDXB 3K8MA 3RWDB 1IUZA 3MLWH 1JIBA 1EHNA 2K7PA 3IE9A 3E2HB 3BPCB 3AQDA 4PJDB 4UUJA 3BEVB 1EEQA 1TG8A 4PRPD 1LWJA 4AEIL 1J87A 2XZAH 2Q3ZA 2YPLD 5EHFA 1P5UC 3O6KH 5DRXB 4NO2B 4BHUA 3ZL2A 4PP1D 4RMSA 2B1AL 2OV0A 2DTSA 4P8QA 3MI6A 2YK1L 3OQRA 3E1ZA 3CXDH 1EHXA 3QXDA 3TV3L 3O3BB 2ZOKB 1PEWA 3MJ8B 4JFSA 3LH8A 1FH5H 1KCSL 3FO0L 3MCLH 2H2SC 2LOEA 4WFFE 2N0MA 3MROA 3RFZA 4LPYA 1CYGA 4YHOL 2EH8L 3GHEH 3ZTNH 2B5IC 4HK3N 3D3VA 4NM4L 4LSPH 3PHAA 4WHYH 3HRZA 4W9ZA 1DO6A 1DQJA 3KPSD 1PW3A 1T3FB 1X7TA 2YZ8A 3Q8EA 4I0KA 5KSVB 4QRQB 4KJQC 4K3DL 4FJYA 3C5SB 1KTKE 2NTFB 3D8MA 3MA9H 5HHOB 3DRQA 5IHZA 4PU2A 4BEIA 5JW5B 4XNZC 2HN7B 3QUKB 4G1MA 4PS4H 3G5VB 4M6MH 4MD0B 4B27A 3L3OB 3E6FB 3R8QA 1S7WA 2F54B 4OZFA 3CQPA 1JSYA 3TJHD 2WP3T 3VXNB 4OLEA 5IJCC 2APWA 2NQDA 4EF3A 1T5XA 4L3EE 2H4EA 3ZGHA 2P45B 2Y2YA 2YHGA 4HKJB 5FR3A 1JNNL 2GSGA 3RJDA 5FB8A 2ZUSA 3FU3A 1MRCL 5ERWB 2IXQB 3ZSTA 1IKNA 1KLGB 2FATH 1PLBA 4HQQL 3B5GA 3EOBB 2VGLM 3C5XA 5ID1A 3QDJB 3I2CL 5IWLC 2OFQA 4ZPTA 1G9HA 1TQCC 1Y18A 3EHBD 3H3PH 5KN5A 4IRJC 4IJ3C 1KJ3H 4MNGB 4KVNL 2J8UE 3Q8AA 2OZ4L 4GRLD 4GOSA 1BBJA 3LNGA 1DJZA 4U6XA 3RGBA 4J3BA 6FABL 2JJSC 5CD3A 1N8ZB 2W95A 1IGFH 3DXAB 1EAOA 3B1UA 1NBQA 1NEZA 3BVWA 3IS0X 2X05A 4CMMA 2Y0SA 2J4WH 3GSQA 3VCLA 2EVHA 3SDYH 4JFOB 4K71B 1E5ZA 2FT8A 2D7NA 4EIUA 2IO5A 3VSVA 2F2HA 3KCPA 2HT2C 1OSPH 5E08L 4IKLA 3BLKA 4HLEA 2WUBL 4B9CA 5FLUA 1HI6B 4JHWH 4QY8B 3GSUA 5GGRY 5A6IA 5KYYA 3VD5A 3KWVA 4PGDB 2R9HC 2B2XL 3VXSA 3FT0A 2VL5B 3SIKA 3A6OA 4PRHD 2TRHA 4D0CA 5JORB 3ZDXF 5IMOB 5D1ZD 2J12B 2W9DL 4QHUA 5IV2B 2GHWB 4JFUA 4M61A 4KKRA 1EANA 3T0EE 1UATA 3WGVB 3P3UA 3V6OC 1WWAX 4JDEB 2GJPA 3GBNL 4URTB 3MOAL 3QPXH 1FP5A 1E65A 3VI4B 1JZDC 2H41A 2RB8A 3ULVL 3ZTDC 1EWHA 5DK0B 5IHWA 4RWHA 3H9SB 1S9XA 4LLUB 4WO4B 3QZMA 4K7PX 3GB7A 3VGEA 1YNTF 2Z91A 4FTVE 1NCTA 2V9UA 1RK0B 1H3PH 1UD2A 5IF0B 5KUKA 1PSKL 4GSDH 5IREA 4FMFA 5GJTH 3R19A 1XGZA 2WANA 3B1TA 3SE3C 3FTXA 2IWKA 2J88L 4FLRA 1VKXB 2EC8A 5I8CB 4OCXH 4HPYH 4KC3B 1F6LL 2OR8A 3ILDA 1G84A 3ABKB 3MJ7B 3D2UD 1FWXA 3MUGB 2XTJB 1FUNA 1J7VR 3G5ZB 3QO0A 9PCYA 4N8UA 2NUPB 3S88L 2FIKA 3W39B 1U8NB 4AE0A 1TEFA 2WIIA 3VSTA 1D5IL 3T2NL 2VDML 3DOSA 4OFDA 2DQTL 1V10A 2Y25A 1D7BA 1ANUA 2I26N 3TXAA 1DJXA 1HH9A 2DPKA 1N64L 2IDCA 5T3XL 4X6CB 4JGMA 3ZN6A 4HBCL 2A6IB 4O2EB 2ARJB 2TRYA 4OZHB 4XBGB 4Y5YB 5J13C 4K8RL 1QKZL 2K9UA 3PPSA 4IU3B 1EEZB 1NDGA 2FX8L 1SBSH 4DEWA 3MOBH 3L5WB 2PCPA 4G6JL 1ITCA 2EO1A 2YBRB 3GSOB 5IG7B 3RWIA 2HTLC 1E3ZA 1I9JL 4IOFC 3HN8A 2FQEA 4LCCB 2BVOB 2O5XL 3LPGA 4D9QE 3HHRB 3AS2A 1I9EA 4O02B 1JNHB 2X1XR 1A47A 2R23A 1A4JA 2ODIA 1K85A 4Z23A 4ZDHB 4CVWA 2FH8A 1R24B 1BECA 4RAVB 4PJEF 1I3GH 5EU7E 4AKOA 4EXPX 1OAQL 1RKRA 5JOPE 4BYHA 4TQEL 4NQXB 1PTZA 3KCWA 5EIIB 3NJHA 1NWOA 4XXWA 1KJ2L 4MA3A 3X3FL 4AZ8A 5KS9F 1NWPA 3PGFH 2VC2L 4ODSH 4PWJA 4X4ZA 1ACYH 3QISA 4LIQL 4TNVF 5E23A 2ZYRA 4X4MA 2BOBA 3MCKB 1U3HB 3HG1B 4YXKH 1KPRA 4Z7WB 3EXJA 4XXCA 3WY3A 1L9NA 2L7EA 4ODXB 2E7LC 4FQXA 4Q58C 1EVUA 1EXGA 4RA0C 4XO8A 3SD5A 3MNMA 2YAHA 2VUOA 1ZA6A 4UF7C 2OLDA 3P11L 2P5ED 2X38A 4L4TE 1UM6L 1L9RA 1QHPA 2WXNA 4YO0A 5F0LB 3VGAC 5IUSA 2F68X 3MV7B 2BERA 5EOQL 1FQ9C 4DKFL 4LLYA 2D7OA 5HPOA 4JDZB 2VAAB 4UV4H 5ACZA 3DV6A 1HZLA 4I8DA 5C09A 1UWEH 2UVFA 3IFPA 4WI2A 1JPTL 3HE6A 3VM7A 5D7LA 3B3IB 1SHXA 3VGDA 3MRCB 4B0MB 2WTRA 2XG4B 3BAKA 1EQWA 1YN7B 3FB5B 3D39B 4FZEL 3AB0B 3DGGA 3HUJA 1A5FH 4JLRA 3CHQA 4N6RA 2FX9L 1NA8A 2B9AA 2R29A 2XWCA 4GQPH 3T3MF 4ZMWA 1YEEH 3FN0L 3QZWG 2WO2B 5BV7B 1KLUA 2GHZA 4XMLL 5DJZB 4ALAL 1TJHH 2X2IA 1Q94B 4PB0H 1OOAA 2XKUA 1INEH 1K5WA 1VFBA 3C60C 3CFQA 3OAUH 1AO7A 2KBGA 2N1TE 1P5UA 3SKMB 4AUJA 3EXLA 4C83B 2DQJH 3BGAA 1HEZA 2Y72A 3LMJH 4ZFOB 5FO7B 2X4RB 2D0GA 2PO6A 3L1GA 3DO4A 1MEXH 1NCUA 4GP5B 3CC5A 5AZEL 4YGVA 5I71B 1KFGA 2CQVA 3DURB 2R7EB 2PW2B 2D7QA 2R4RL 1FN4A 2CALA 4GBXD 1R34A 4FJ6A 4BINA 1D5BB 3NJMA 5EU6D 1RVFH 2D8KA 1VRSA 5IFHH 2J6EA 5IOPB 2OSLB 2YPVL 3DSFL 4WWPA 2XY2A 2H3NB 4ZMVA 3SDDB 5IHBA 2LVCA 4JY4B 2ZXAA 5A2CA 1KPVB 3CXHJ 4M1GH 4YL4A 5HYJD 5M7QA 1H3TA 1TVDA 3FU0A 4UMGA 2ZOOA 5D2NC 2VDRL 4F57H 1NTDA 3F65A 4N90D 1JK8A 1ZV9A 2DYPB 4F2MA 5HI5D 3ZL1A 4GQ9L 3T77B 1P4IL 3OKMA 1B4JH 4HFUH 4S1RH 4OGAD 4AMKH 3L48A 3W57A 1MHHA 2UZXA 3TX4A 3OB8A 4QRBA 3MNWB 3ECBA 3AT8A 5DO2C 5BQ7A 3QJVB 4KHTH 5E6ID 1NBCA 1ONQA 3GSXB 3TPUA 1UXSA 4ORGA 4A7SA 4FFVC 2F74B 3UBXB 1M2OA 3GFUA 3N3EA 2CXGA 2QPDB 3GZOA 2VJXA 4Z1PA 2EDMA 2PYFB 5DT1H 4PV9A 1D2OA 2X1QA 4HG4J 4UM9A 4W9LC 2CKBA 4W9HC 5IQ9A 5CGYC 1T0NB 3S5ZA 4NHUB 4DK3A 1UZ8A 2BFVL 3NOIA 1UGNA 3WENA 4OTXH 3ARFC 5AOZA 1BXXA 4HWBA 5HHPB 5LXGL 2ITCA 3DSNB 5B4MC 1J5IA 4U7SA 1HL8A 4ZAKB 2EABA 5GS0C 1Z5LB 2OW6A 4IRJA 4PJCF 1AGEB 1PZCA 2LU7A 2YD3A 1HQ4B 3QEUB 4H88H 5C07B 3UYPB 5LLIC 43CAA 2NRDA 1ED3B 1QQDB 3HW7A 1GGIH 5DA4A 4HPOH 2JJSA 2ZUTA 4XN1A 3VFMB 4IKIA 1KTRL 1UQSA 1AXIB 4IBVA 4N0CD 5MHSE 4M5ZL 1DHKA 2PCXA 2DLIA 1KN4H 5CWSB 3BXNA 1URIA 5J12C 4J3WA 2ADFL 2XXGA 2BNUA 2R4SL 2FEDD 2I5YL 3GSWA 3WGUB 3CJJA 3TEYA 4L0ZA 3AACA 5GGSA 4A55A 1D5XB 1HL9A 3IDGB 4A6YB 4QJ5B 1MF2H 3VMNA 1QYGH 4IEFA 1SF5A 1BOGB 2P3YA 3MLSH 4FQHA 4DK5A 4OZIF 2GSIB 1MY7A 4OF5A 1HTYA 1FRGL 1L0PA 1RUML 4WHTB 5D1QE 3AITA 3WYRA 4ZMTA 5J57B 2EXWD 4G6AC 5B39A 4NPYB 5ITBL 4FD0A 1UJTA 2QMKA 2X7LB 4B41A 4BRJA 1CG9A 3FF7A 3BE1H 1YJDH 2DLHA 3EAKA 3C87A 2VDKL 2X2HA 4J5VA 3BPOB 1T6VN 3ME0A 1I8IB 4BSWA 4JO3H 4X4XA 4CC1A 1SJHA 2B0SL 1RP9A 4B60A 4NCDA 2CA4A 4MZIA 3TF4A 1OAUL 1F6AB 1WS7A 3INUL 4JL2A 2WZ5A 1TYEB 4JQIH 1J88A 2R2EB 5DI8B 3KWTA 3WKML 1P6AB 3MLZH 4E9WA 3QHZL 3FCBA 4H25B 2RH0A 3LPFA 5EDSA 5J1TC 2ADYA 1OTUD 3VFSA 4ZXBD 4LL4A 4YXHL 1C12A 2X9ZA 4KOCA 5CHNB 4K7FA 2GTWA 3LKNB 3MO1A 4AOFA 3BAEL 3HVNA 4XAKE 1KYOJ 1LEKB 2ZKMX 3DOHA 1MDTA 3CFNA 1PL3A 1M56B 2G60H 2PYEA 3BQUA 4N8VB 3BZEB 4MDIA 1A6AA 5FYKE 4ZW5A 2R27A 4YDKL 4WEBL 4UIKL 4DAGL 1EDYA 1LD9B 4XGZA 3EG9B 1B0GB 3VQ1C 2VR6A 4NS0A 2QT6A 4UNVA 2VDNB 1KTDA 4GRMB 1R3IH 2JI3A 2V3EA 3QCUL 5ALBH 2ZXBA 4YL9A 1M6OA 2QPFA 3VVVA 3QJHA 2MPAL 2YEVB 4EAEA 5LGHL 4P48A 1FYTE 3MV8B 2YEZB 3X13B 1ETA1 3MXVH 4NENB 5I74B 3T3PE 3VW3L 4ELKB 2JXMA 5LNGA 1ZE3C 3F5WA 5EN3A 2DQDL 4PJEA 5I6XB 2NYKA 1A4BA 4F37K 1JGLL 5F3HA 3BVNA 4LCUA 4RISH 3TT3H 3IFNL 2ZOUA 2IPTL 5CINL 5HYQB 4EJ1C 2EXYC 4PG9A 4BM7A 4A2LA 1ASQA 1SEBA 3V95A 3BZFB 4LCVA 1MHEB 1OP4A 3JWOH 2OMXA 2XTSA 3WDIA 3U2SA 3CSPA 4V11A 3L1OH 3KLHD 5L4MA 4H13C 1Q0YH 4R96A 5EZLB 4ZX3A 4JG1L 3S5YA 3MA7A 1FLRH 3MRIA 4X6EA 4QOKA 4LLWA 3QUZC 3LNFA 4LSVL 3OGCA 2ITFA 1JPSH 2BO0A 3C8KB 3GS4A 5FX3A 5HHOD 5I9QC 1JI2A 1N0XL 4Z7VA 3OD3A 5F7DB 5FO2A 4Y1TA 5E2UL 5F7HA 4BE6A 1CL7I 4PGZA 5SV3A 3DIVA 3KH4A 2ALWA 2F5AL 4GQZA 1BQRA 3N1PC 1UA3A 3N9GL 5AW7B 3T2OA 3AQYA 4Q0XL 2C9PA 1RUQH 1JV2B 3FZUC 2R2HB 3TWCL 3GSNH 4NNYB 2K6ZA 4DIXA 2QL1A 3AGVA 1II4E 1ZIBA 1XAKA 2DKSA 1O6VA 1QPKA 1S9VB 1OL0A 3CZLA 3FT4B 4OLWL 4U31A 2CPCA 4F9LA 5GZOD 4X9IA 4K9EL 1D3CA 4CGUB 3SE4A 5JHMA 5KVGL 3VI3E 1LEGB 1IZKA 3NZHL 3UJJL 2Z93B 1A25A 3BSZA 3EH4B 3VFPA 3I6LE 3NSYA 3WXWH 2IANA 5DJYA 3KLAB 3D08A 5EA0H 1EXHA 1A7PL 1AVAA 5HI4D 3WKQA 5C6WH 2JKIS 5B8CB 3EYQC 2X4PB 5AALA 1ORQB 1Q9LA 3W56A 3P77A 2VMDA 3UIYA 5SWSD 4R84A 2KZBA 4BKLA