3EOAB

Crystal structure the fab fragment of efalizumab in complex with lfa-1 i domain, form i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
215
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Efalizumab Fab fragment, light chain
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell adhesion
total genus 37
structure length 215
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoaB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoaB01
1ZT1B 4LAQL 2L4OA 3TBYA 2WINB 3DARA 4HUMB 1FV1B 3U7YL 4XPTL 1Q9OB 4DFIA 1M71A 2Y6SC 2MCPH 4TNVF 4XNUH 5GGQH 4L4VD 5HI5C 5JHDD 4MA3A 1F97A 4RWYH 4E9LA 5I1JH 1I8LA 4MNGB 4HG4J 3V52L 1T1WA 4H8WL 1IAOA 3HB3C 5DMYA 2EDFA 1XGRA 1YECL 2R0KH 4HQQL 3RWCB 1HILA 3LKQA 1AXSB 4OD3L 1EEZA 3O2DH 5KSVA 3FONB 2F5AH 3KXFE 1YY8B 4Q9RL 1J9CT 1GZPB 1U93A 2AGJH 3TNMB 4R0LB 3QWRA 1EHXA 4DKAA 4NDMA 3MLSL 5MHSD 5FYLH 3ULUL 3BUYA 5K59E 1C16B 3QUMH 3EDKA 3HZVA 4G8IB 5D93B 1OAXL 3EYVB 2Q7NA 2IANE 3ARFD 2OBGA 5CJ5A 2JB5L 4PP1D 4EUPH 5C8JB 3WYRA 4N0CD 4NIKB 3LEVH 5F96L 1JBJA 2Q8BL 4JM4H 1IILE 4I18A 3G6JB 1ZA6A 3IJHB 1HZHL 3KPSD 3IXTB 5DJ8A 4MQXD 5ICYB 2VIRA 1ZMYA 5JPMB 2DQJH 2CK0L 4IIQB 4FS0A 3QA3A 5FHAH 5K9QI 2AJVL 4PJDA 1Y0LB 1J1XL 3ROOA 5KVGH 4C59B 1T7VA 4QXUL 1JGLH 1A6TA 4LMQE 2VXQH 2I60H 5J6HA 3FFCD 1YJDL 2Q20A 3WFEH 1AGBA 2CIKB 4K55A 4WJ5B 2CLRA 3MRGB 4FFZL 3G5ZB 5I2IB 1UCBL 1NMAH 15C8H 1EERB 5I71B 4XXDA 2R23A 3BEVA 3HR6A 3REVA 1JPTH 5JOFA 1BF8A 1AO7E 2ZUQB 3S36L 1U8NB 4XPFH 4CADB 4H25A 4JFPA 3WIFA 4GFTB 1UQSA 3PWPE 4F33B 4KHTL 2HAZA 1RU9H 3RVTC 4D9QE 4KWUA 2AJYL 1NC2D 1F2QA 4UILH 1FDLL 3HFML 4I77L 4FQQB 4YH6A 3BRFA 1S7XA 2HN7A 4ONGL 5EZLA 5LXGL 5TE4H 2HT2D 2AJUL 4LAJH 3JWOH 4HKXA 4I5BB 3AY4C 5E8EA 4P23C 5CCKH 4NT6B 5DMGC 1NGZB 2EDBA 3L6FB 1JZ7A 1ND0A 4NQEE 4UINH 5A2LH 5DD3L 5SWSE 5IMOA 3T0ED 3LN5A 4N0UA 1ES0A 1NGPH 4DQOL 2JJUA 4RFNB 1I1YA 1RZJH 4NWUL 4P2QD 3H6JA 1MCOH 2IALA 4U1NB 4YDVA 3BIKA 1O5DT 5HHVH 4HUNB 4LF3B 1IEHA 2GJJA 3P9LA 1ZS8B 5IHUH 1A7PL 3PHQA 1ZGLB 4QRQB 2EIDA 4MXWH 4B41A 2JELL 5EG6C 1IEAB 3LCYA 4XHJD 3MSPA 2NY4B 3QHZL 5D7JD 2BNUB 4JVWA 3H9SE 2X4RB 1JUFA 1Q38A 1JTTA 4JM2A 1V7NH 3U6RA 2X7LB 2CO7B 2FECL 2GIYA 5CS7A 2VSDA 1JWMB 3H8NA 1KIQB 2VDNH 4OCWH 3GSWB 4HUWB 1KCVL 3O6LL 3QIBD 5DVOA 5HYJD 3G5XA 5F7EH 4JR9L 5D5MF 5F9DC 3S34L 3MV7D 1FFPA 3RZCB 1G9MC 3CUPA 1HI6B 2R4SH 1FNGB 4XPGL 3ZMRA 3DV4A 4OM1H 5GSRA 4M6MH 4QHUB 5D7SL 1X5FA 4PFEA 1C1EH 4OLZL 2JCCE 4NKDA 4ODUB 1F2XK 1DQLH 3TT1H 4OCYH 1NC4D 1PW3A 1N8ZA 2CRZA 2AK1H 2JE8A 4EI5B 2MKLC 4ODWA 3P11H 4PRPB 2GJ6B 5ESVA 1KB5L 2EKSA 3DRTA 1IQDA 4JFEA 4MX7B 3WXVL 4POYA 5HHMB 4K07A 5C0JB 3EFDH 4JKKA 2WANA 3MCKB 1H3UA 3ZT5A 1P4IL 4MGXA 1ZK9A 2ZOLB 1YZZA 5I1AB 3TBSA 4TVPL 3EO1B 1CLYL 1QFWM 3T3PF 2VC2H 1CE1L 5J11C 3DO3A 4M7LT 2D2OA 2VE6B 5F6IB 4KRPB 3WUWB 3S4SB 2Z31A 4ONHA 3O81A 3UAJC 2PXYB 4I3GA 3TN0D 2FCBA 5BRZA 3VFOB 3V4VH 4LGPB 4OV6F 3RWDB 4WCYL 3WIIL 3O3BB 3BH9B 3N9GH 4O5LL 1CT8B 4YDKH 5TF1H 4J6RL 3W2DH 5KS9E 5I74B 3NTCL 4WHTB 4OZIF 3B2VH 5IG7A 1OGAB 4YXHL 2YXMA 4YK4C 1K8DB 1T7WA 3OKKB 1CWVA 3EJYD 5ITFA 1EZVX 2OTPA 3U46B 3KPSB 1S8DA 3AS0A 1CDYA 3SO3B 1VPOL 2W92A 5JMOC 2G2RA 2FATH 3BP7B 4EIZC 4PJIA 1CFTA 3LIZH 1IZKA 4N8VA 4CU8A 5GS0L 4ZFFB 1J1PH 4PG2A 4D8PA 1FJ1B 2R56L 4ENEC 1N6VA 1TVHB 5I9QB 3O6FB 4G6FD 4FXKA 1TDQA 3GSVB 3WKNA 3VWKA 1B90A 3B8SA 3QB7C 4OFYA 1BWMA 4HPOL 4M93C 2Y72A 2G60L 5ANME 4ODVL 4WIQA 4JO1H 1AGCB 3NCBB 1DVFB 1LO5B 1J8KA 2WLZA 5IV2B 8FABA 5C3TA 5IF0A 1MLCB 5KVEH 4OSUH 1CYGA 5E5UB 1N4XL 1NCBH 3V4PL 2Z8VC 4PTUB 4U1IA 5LGJB 3WO4B 4DFHA 4HKZB 3QWOA 4P2OA 5LJYH 1KB9K 2ZSVB 4N1EA 1VACB 2YSSB 3MLWL 4UT9L 4YHPB 3TO4C 4WI4A 3V9FA 5F7KC 2WBJD 1A4JA 4UT7H 3ZKNC 2FR4A 2PYFA 1C5DA 4X5XA 2F9BT 1NBYB 1R5VB 3HI1A 3O8XD 1F42A 5D2LE 1T20A 2I5YH 5JW4Q 2BNRB 4NHCH 1OY3B 43CAA 4I8DA 3QG6B 1MEXL 3BW9A 4PJGB 1WCBB 5D70H 3ZO0A 4HS3B 4LNRA 4NCC1 1T2QL 5JIHA 3Q6GH 4P4RB 3LQMA 1NGWB 5IB2A 2QTEA 5C0FB 3SGEH 4M8VA 4OT1L 1ZAGA 5GJSL 1FYTE 3T0EB 4ALAH 3C2AL 1T0NB 5F89B 4KTDH 2DWDA 4PRNB 4OZGA 2R29L 3GMOB 3U1SL 1D6VH 3HG1E 2DQEL 5BXFA 1MH5A 3C9NA 1F4AA 2EIZB 3O11A 5F7DA 2P24B 1AY1H 3QEQA 4EOWL 1S7RB 3C5ZA 2A9MH 5F1OB 4WUUD 3MRIA 4JO2L 2J7LA 2ITDA 4WI2A 2CKBL 1JTPA 4OD2B 1S78C 4RIRB 4X8JB 3N1PC 3OR6A 3WJLC 1N6UA 1MWAL 4EIGB 5CJXC 1FIGL 5CJOL 2AABH 4ZOCA 2V7HB 3LVEA 5JNYA 2AEQL 4XBPB 4F8QA 4U1HB 1KCRL 2KQMA 3RUGA 3OKEB 4PJ8A 3FB8A 5JXEC 2VH5L 5EU6E 3F65A 3GMNA 1LDPH 5C0AA 4L4TB 1N5YL 3L3DA 3K1DA 5IW3A 1U8PB 4GW5A 1T1ZA 5GISH 5HHPB 4ZD3H 1T66C 5EZOH 4XP1H 3BMVA 3LS5L 5F8QC 2AS5M 4Z8FL 2J8UA 3MR9A 4XVUC 2KH2B 4N0UE 4QF1A 2OL3L 3FN0H 3QDJA 1JF5A 4JJ5B 4XX1G 1LE9B 3VFGL 4YHYC 3O9WC 4LLQB 1WSST 3LEYH 4DN3L 5DUPH 5IM7B 1U58B 4Q9QL 2Q86A 5ILTL 3RWIA 4K94C 1CZ8H 1A9BA 1FL5B 1QO3A 4QRUA 4Y7MA 4MD5A 2YPKB 4RBPK 5D9SA 3UYRL 3LS4H 5E6IC 5C0CE 4U1LA 3PWLB 3WDJA 5F3BA 5JQ6L 1XIWA 4X7TA 5HGHA 1INDH 1CICB 3RRQA 1CBVL 3CLEH 1CDHA 5AWNL 4Q2ZB 1WWBX 3Q0HA 5DFTA 3IU3B 4J3SA 1G7HB 1OP3H 2BSSB 1MJJB 1R3KA 4Z78A 3SKOA 1PKQB 4QTIL 2A38A 5B8CC 5HYEA 5CD5D 1JWSB 1F6FB 5D8JL 2VDRH 4XC3L 4Z7VA 1UWGL 4RNRB 5T33L 1F90L 1ZLUH 2P8LB 4XX1E 3DSFL 5MEQB 4S1SL 4XMLL 3AVEA 2PNDA 1QFHA 2Z4QA 3IDJA 3NCMA 5DT1H 2PETA 3ILQD 5CGTA 5E2UL 1EFXB 3FO1B 2PO6D 1CXLA 3BKJH 1VEMA 5HJ3A 4DN4L 4KU1A 4B50A 4JFEE 5I30H 5EOCJ 2V7NB 1J10A 1NCWH 3T77B 3BGAA 5ISZD 4HBCH 1LE5A 5DVLA 1FFQA 1B3JA 1NCDL 4Y4FC 2K3TA 1A5FL 4HIJA 2JK5B 2AEWA 4G6FB 3KJ4C 3QO0A 5DHVH 2PW2B 2F15A 5T1MA 4PJ5B 1OLZA 4G6ML 4HMEA 2UY7A 5E1AB 4XWOC 3DGGB 1BMGA 5AZEL 1NFIA 1F4YL 3OHXB 1CL7L 4PRAB 1DLHB 3WXWL 1RJLB 3NACL 5MEND 4FFVD 3DYMA 1BOYA 3CK0L 4WWKC 5T3XH 2B2XH 2NY1D 1OPGL 3NOIA 2VLJD 3ARXA 2WIIB 5ALBL 2H26A 4G6KL 3DROA 3BH8A 4YGVA 3CC5B 4OJFL 1HKLL 2R9HC 3L3OA 4FQJL 4XAKE 1Z9LA 4LDEB 3ARTA 2VAAA 3O8XB 3OAUH 3HPJA 1ZHKA 3GRWA 2EZ0C 4JPIB 1HYSD 4OZFG 4I0PA 2B1HH 1L7TH 5D72H 4DCQB 1CK0L 1CQYA 1U92A 3MJ9L 5MEPA 1T03L 2A73B 1RZKL 4HUKB 4OGYL 1ZLWK 4XCFH 4JB9H 1K4DB 4JPKH 4KROC 5C2UB 2DBLL 1NLDH 4PLKC 4EXPX 5FF6A 4NO2A 1KIUA 12E8H 4PJ9A 4TN9A 4YHIB 3FB7A 4NO5A 3HMXH 3GKWH 2FL5A 2AV7B 4P4KD 4LLVA 2VABB 4GAYB 1UWEH 3SE8L 1NGYB 2PYEA 5EBWB 5BZDA 5L7XH 2GK2A 4Y5XA 3VFMB 3FFDA 4R4FH 4KKLD 1FVDB 2NXYB 2W0KA 4G8EA 4LLWA 3LPFA 3QZWB 5CSZA 5JLZA 1S7VA 4Y2DA 4AEEA 1PX4A 4TSBH 4QXTB 5HGBA 2Q3AA 3B6SB 3H7BB 5GGTA 3ZKXC 4M1GH 4K2UH 2VQ1B 1LO3H 4HV8B 5E8DH 3HAEH 4JFFE 1VDGA 4GRWE 3LQZA 5DEGA 3VXUB 4FQXA 1QLEH 4NQSA 1CTNA 1YNTA 5C08D 3W11C 3U4BL 3VFWA 3HE7B 1U6AL 4K94H 5HVGB 2VDPH 1GPOH 1JGEB 5IMLA 4E5XA 5HHOA 3P40A 3ZL4L 5I66A 1Q0XH 2OXHA 2J12B 2J2ZA 4MD0A 3FMGL 1MJ8H 2ARJB 4F15C 2R2CA 3O6KL 1F3DH 5GS2D 3UJTL 2BMKA 3B2UC 1OW0C 2F53E 5MERA 3QCTH 2CH8A 2G75B 2NXZC 4J8RB 4X99A 4PRHE 5DEFA 2BHZA 3QISA 5T3ZE 1UM6L 3B9DA 3MRDB 3UZEA 4L9DA 4LHUB 4P5KB 3ARGD 1FPTL 5T5FL 5FK9A 3T3ME 4DZBB 5TGBB 3SDXE 4F80A 5B38A 3G04A 4XP4L 3QI9A 3LRSB 1G0DA 1VENA 4UIMA 5I8EB 3PWNB 3NA9L 1AR1D 2J8UE 1IAIL 1R3IL 1RZIA 4OV5A 4GXVH 4TOYH 1BIHA 3QDJE 1YPZB 4HJ0D 4ZXBB 4DKFH 1N26A 3RVUD 3PNWA 3BWAA 3G6JF 4I0CC 4K8RD 3MGOB 1A7NL 2FSEB 3W0WA 4J4PA 5E8OA 4OF0A 4OCNC 5JO5A 2A6IB 1CGYA 4PRDA 4LCIL 4WENB 1M05A 1MCLA 1A6WH 5IVXB 4FQCH 1OM3L 5EOTB 4K3EL 1YNKL 2EXWC 1QNZL 1V5JA 2H1PL 2P5EE 4NQDE 3B9KD 4DEPC 3MV9D 1HNGA 3ZYOA 5GQBA 3MRJA 2ZCKL 3WS6A 5HDQL 5D7KD 1ZVSB 2EO1A 1H0DA 2XTJE 4KY1H 3CFEB 1KEML 4F2MB 4LQ1A 4GKNB 2DD8H 5GJTH 1ONQA 1SVZA 1XGYH 3KYKH 3LOWA 4YJZL 2HRLA 4XNYL 4RBPH 1ZLVH 2R15A 5B21A 4FZ8L 1UXSB 4TPRL 5E24E 2NNAA 4ODBD 1JWUA 5GZND 5DJ2A 1YEJL 3CVHH 5EU3A 3SE9L 4EBQH 3FB6B 4UOW0 1F6AB 3U30C 5ICXB 2GSGB 5KANI 1XT5A 4NZUH 3UTTA 4G42B 2DB8A 1S7SA 5SX4I 4BQCA 3NZHH 2VQUA 2AXFB 5C07D 5GS1A 5IB1B 2R2HB 1HQ4A 1RIHL 3T2NH 1NLBH 5E9DB 1ZHNA 4GW1A 5IEKA 3JXAA 4Z7WA 4FMFA 1E4XL 4JDZB 4AEIH 4UOJA 3WNNA 3IFOB 4JY5L 2R0LH 3EZJB 3CSYA 2VDQH 4PYGA 1FFNB 1MQKH 2W9EH 3RX8A 2HT3C 5GRVL 1UA6L 1I75A 1HKFA 2A83B 3QDHA 2BOBB 4YBQD 1QVOA 1XF3B 4IBLT 2DJ4A 5D1QA 2JLLA 3IRZA 3ARDB 4W6YB 2NY2C 1QD0A 1O7SA 3L5WB 3N1GC 4OKVA 4N9OB 3DMMC 4HHAB 2WZPD 4FTVD 4QWWC 1QSFD 2BNQE 4GQPH 1A6AA 1NBVH 3TEUA 1JZ6A 1KUMA 5AUMA 5INDB 1W72B 4C55A 3MLRL 1WC7B 5FUOL 3MOAH 3LEXB 4J3OC 1I7UA 5IUSA 4UTAL 2VZOA 4QHLA 2K7PA 5DJ0B 2WQ8A 4K3DL 2F8OA 2YPLB 1GGYA 2NY3C 4UBDD 3MLUH 2CPCA 4MZ3A 1CXIA 3EYFB 5F7YC 3WNPA 2XFXA 2DM7A 1R0AH 1RUKH 4JQIL 2DDQL 1QQDB 1LEIB 3GGWB 1ZT7A 3A6CL 2F54A 3K2UH 3HLAA 4XPAL 5C08B 4FABL 3EYSL 4MXQD 5EU7C 3UDWC 1KJVA 3GB7B 1H15A 4K23L 2R69L 5T5NG 4J7RA 2XOTA 1ZWIB 2DQUH 3BP6B 1WT5A 3D39E 4M7LH 1CG9A 5BVPH 5ESQB 2QSTA 2GTWA 4LQFH 3FOLB 1IM9A 4N0FB 3FAXA 3RWFB 4PJCB 4R9HA 2GJZB 1RFDH 1VFBA 1ZA3B 3U83A 3JV4A 1S9XA 3LH2H 2CJUH 2MJWA 5CBAA 1BWWA 5FYKE 3T65B 4M61B 1JGVL 4TVPD 5LBSL 1PLGH 2IH1A 4AMKL 3BEWA 3Q6FB 5HY9A 4DGVH 5E70A 2D03L 1ZLWH 3V7MA 2ATPB 5CEZL 3U7WL 3TPUB 3ARFC 5I75C 4GMTH 1RUML 1KIPA 4N0CC 4NJ9H 3SE4A 1C7TA 3ALPA 1PZ5A 3V5DB 3VGGA 1DUYA 2NCMA 4D9RE 4YAQA 4PJEA 4WFED 4RRPA 4OTXL 4JKWA 2OSLA 2D7NA 5DTFB 3W9EB 1JNNH 4MQXC 5HHOE 1Q9WB 4AM0B 1JNLH 1WEJL 2L0DA 3L5JA 1ORSB 1ZVHA 2QSVA 1YEEL 3TBYB 3T2QA 4M5ZH 1OARH 3TH2T 1A6UL 1T2XA 2VJXA 3G5VA 1DQQA 2X40A 5CHNA 3MROA 4MA3B 4N0YL 1UACL 1JGDB 3IDNA 1T1WB 2E9IA 4YFLI 5GS0D 4NCDA 2R8SH 5D4QA 1ZANL 3EYQD 4YUEH 2XQYK 5HTSA 2NY0D 3TNNA 3VXMA 1D5IH 2XG5A 1XAUA 1XGTA 5JR1L 1HILB 2FO1A 3LKQB 1EEZB 3NIFE 3QDMA 3RL1A 5KSVB 1DQMH 3B9KB 9CGTA 5JOPE 5IQ9B 2QSCL 3AB0C 1KYOJ 1GC1L 1FVEB 1X4ZA 5ETUB 4NDMB 1P5UA 2NLJA 5DFWH 4BFIB 3BUYB 4G7VH 2ED9A 3F58H 4Z7NF 3O2DA 5DA4A 2AXGB 3GMQB 1DQDL 43C9B 1SYSA 3ORJA 1BVLB 4ZTOL 4Z0XA 3BGFC 2O5ZH 1Y6NR 2HT2C 4FQLL 2CUHA 5DRZA 4Q7DA 3O4OC 5DK3A 1RURL 4D9LH 3P30H 3ZTJG 1NEZB 2R0ZL 1ZA6B 2ESVA 1KBGL 5DJ8B 4LEXH 4ODTH 3FT4A 4YBLC 4ZPTA 3OJMB 3QUMA 2X1WL 4V2BA 4PJAF 1QYGL 2OZ4L 3KJ6L 4ZPVB 4PJDB 2VLRD 3WHE0 5KSBF 3CIQA 3ROOB 4BYHA 1E27A 4EUPA 1A6TB 5I8KH 4PTTA 1JP5A 4KI5D 3NCEB 1XGUA 1MHHA 1UG9A 2APFA 1UYWL 5KSAB 4AZ8A 1U2HA 1NMBH 4NNYA 2MCPL 2CLRB 5GGQL 1BD2A 3QIWC 4ZAKA 5DJ6A 5I1JL 4KHXH 1TXKA 1I85A 4Y19A 1A9EB 4C56E 2FRGP 4XHJC 1YYMH 5M7QA 3I9GH 4ETQB 5D7JC 1KN4L 2R23B 2RIKA 3BEVB 3I50H 3REVB 3K81A 1JMXA 3K8MA 2IJ0C 4J3WA 1FN4A 3O2DL 4LOUD 2AJ3B 4H25B 4U33A 4JFPB 3WIFB 1UQSB 3HCVA 4OAWA 3PV6A 1MCWW 4OGXL 1NDGA 3G6DL 1U91B 2AGJL 4JHBA 4UOW1 2DIAA 5EUOA 2ZUXA 4PUBL 3QIBC 4L3ED 2NY6B 1P7QB 2PTTA 1YC7A 4HAGA 2XXMB 1S7XB 5EZLB 4M43L 5JPNA 4AY0A 1AH1A 4JRWA 1BQUA 3QFJD 5DGQA 1IGFH 1JF6A 2CDFA 4Z7WE 5I15H 4QNPE 4KXZI 3LEVL 4PJ7E 4MNQE 3L3IB 5E8EB 2MSPA 1P7HL 1KCUL 4JM4L 1ND0B 1N0XH 3QPXH 1JPST 1YA5A 1P84J 2DQJL 4L8BA 5IMOB 1JNHB 5FHAL 5AZ2H 1ES0B 4Y0GA 3GHBH 3KPQA 1I1YB 3LN9A 4DVBB 5KVGL 3X11A 3VXNA 2IALB 1U0QA 3PXHA 4I2XA 4TNWK 3BIKB 1YN6B 2YRLA 1NBZA 4MAYD 1T22A 4HGWB 1BEYL 2QSQA 3PHQB 2I60L 4WFGD 5HPMA 1BPVA 3WFEL 1KB5B 4UU9A 3OB8A 4X6DE 3RAJH 5B39A 1T80A 1XGPA 4I9WE 3IGAA 4E0RA 3TN0C 1NMAL 1QBLH 3VWJD 2E7MA 15C8L 4IRJC 5CD3A 3U6RB 3AMLA 4QRPA 5EWIL 1JPTL 8CGTA 3TH3T 3ARED 1I3VA 4XPFL 1NFDA 2V9QA 3FCTB 3FQWA 5EZJA 3IS0X 4XBEH 4L1HA 3RWEA 3G5XB 4WFHE 1RU9L 2F54E 2MCG1 3A6BL 1KJ3H 3JWNC 3EJYC 4UILL 1XCTA 5DDHA 1FFPB 1DLFL 3FQNB 2Q3ZA 2FJGA 3CUPB 4RRPG 3MYZA 3DV4B 4PJBE 3KLHD 3QH3A 2EIEA 2HTKC 1M7DA 1IAKB 1WGOA 5DRNB 3PF2A 5TE4L 2BSRA 1IAIM 3ARBD 1MFBL 5IROC 4GS7C 2VXVH 2IAMC 3JWOL 4NKDB 4PR5A 3WNKA 2QQNL 1ZXQA 1NCAH 3GSQB 5CCKL 3ZE0E 1TZIA 4ODWB 2EIBA 2EDLA 2EDYA 5ESVB 2EKSB 4KKNA 1O7VA 4UINL 3UTSE 1MJ7H 4G8FA 3IFNH 2D7QA 4LCUA 2Y5EA 1NGPL 4R26H 1LO4H 3TBSB 2NY0B 1RZJL 2XXCB 1ROWA 4HJGA 1X4XA 3T0BA 1MCOL 3AXLA 1G7LB 4WHYG 2IF7A 4Y4KD 1VKXA 4ZS6D 4CDHA 1SY6L 3QR2A 5IHUL 2WUBH 4ODXA 2Z31B 4ONHB 1QRKA 4RAUA 1JHKH 3EGSB 4CJ1A 2A0LD 3UPRA 5BRZB 2Z35B 4PLNC 2YZ1A 1CDIA 2EDKA 4YBHA 2X42A 4Y16D 4LKCA 1WUNT 4U49A 4XMPH 1CGWA 1ZLSH 4PB9H 3UYPA 1QRND 2AK4D 3WLWC 2WWKT 3BQUD 3RDTD 1IAMA 5IG7B 5L2KA 1VFUA 4M8QA 4MHHI 4U2YA 6FABL 4D94A 2VDNL 4OCWL 3QFDB 5HYSG 4P46D 3ZDYE 1BJ8A 4WFFD 5E95B 5ITFB 3STZB 1KTLA 4KGLA 4LDLB 5F7EL 2Q8AL 1S8DB 3VFNA 4D0BB 1WWCA 4NO0D 2G2RB 1VGEH 5MP6L 3SKNA 2R4SL 4PJIB 1CFTB 4E41A 3C5JB 4N8VB 1QBBA 5LQBH 3VA6A 3DUUA 5JTWA 1CGVA 2H9GA 4YC2C 5DJZB 4FXKB 5KANG 2YWZA 3VWKB 2OJEA 4KVCH 1DQLL 5I17B 4OCYL 2AK1L 4L9LC 4M9OA 1KXVC 4A2LA 2ENYA 1V8HA 4QGTA 3TA3D 8FABB 2EDOA 3MFFB 5IF0B 4TRPH 3BJ91 2KDGA 4HXBH 4HIHA 4FXGA 2HFEA 1HK6A 4F37F 4W4NA 4U1IB 5CBEA 1YEHL 3QWOB 3VFRB 4P2OB 2Y07L 4N0RA 2H41A 2YA0A 3KVQA 1R3LA 2XN9A 3SDCA 2Z8SA 3RNQB 3ROLB 1TQCB 4K3GA 4GAFB 3DVNB 3I02A 3BHBA 3QXUA 4PV8B 3V4VL 1C5DB 4X5XB 4BH8A 1I1FA 1CLCA 3N9GL 1MWAB 3HI1B 1IL1A 4K71B 3WHE1 1T20B 1F4WH 2X1XR 3BE1H 4F3FA 3B2VL 1UXWA 5CJ8A 2ERJB 4POUB 3BW9B 3ES6A 5IWLC 2I07B 1ACZA 4LNRB 1TQBB 3QUZA 1IRAY 4G8GB 1ZVYA 2NYYC 2FWOA 2NW3A 2X4UA 1KTDA 5IB2B 4DTGL 1CU4H 4N5ED 4P23A 4M1CC 4IOSD 2CLVA 3BWUC 4HCRH 2FATL 4H26A 3LDBC 2DWDB 2OL3B 4C54A 4OZGB 1J1PL 5SWQA 1MH5B 3P2TA 2E27L 3C9NB 2DN7A 3O11B 5F7DB 5T1LA 3T0XA 3QEQB 5GRZA 1WITA 2FBOJ 4AL8L 3V5HA 3P9MA 1QR1A 2DQHH 3C5ZB 4JHWL 4DUXA 1A2YA 3MRIB 2ITDB 2D7TH 1BGXH 4MB3A 4P9MH 2IC2A 1CXEA 5EUOE 4ZUSA 1P4BH 5B39G 5CD5C 2KZWA 5KVEL 4LSSL 4KJWC 1HHGA 4GRLD 5F71A 3OR6B 4X6CF 3MNZA 1IC7H 3PXJA 3O0RH 4Q58C 4IRSD 3TYGL 3RUGB 4PJ8B 4QKXB 3DHMA 4GMSL 3FB8B 5D5MA 1JGUH 1DBKH 3P0YL 2CSPA 3NIDF 3GMNB 3H9HA 3L3DB 1T1ZB 3JV6A 4X6EA 5C70A 1RUAH 4PJXF 2PO6C 1VFAA 1MFDH 1J1OH 3VD4A 4QF1B 2DKSA 1JMZA 4DVRH 4NHCL 5HI4D 3MYJA 4MDIB 4QHKI 3HNVH 4I2XE 3QHFH 4HS8H 2YD2A 3FQTA 5DWUL 1XF5B 3Q6GL 2Q86B 3RWIB 1K5NA 1F00I 1QKZH 5TDPA 1QO3B 2V9RA 1V7MH 4QRUB 4MD5B 2RR3A 5D9SB 1QHPA 3W9DA 1KULA 4HIXL 4U1LB 2IQ9L 4S2SA 4JHZA 2KBGA 5SV4A 2VSCA 4KTDL 2FX7L 1XIWB 4X7TB 5HGHB 3ZHLA 2H2SD 3U9UA 1K3IA 4X4YA 4PBVC 3ZYJA 4PREA 3QDGB 3TBTA 4B5EA 4FFVC 2BVYA 1AY1L 1NFDE 4JZJA 5B3JF 2BP3A 4NBYB 2NY1C 4QRRE 3CZFA 4MJID 4O4YL 4Q6IA 1HHHB 4NFDA 1OB1A 1PG7L 4OBSA 3VG9C 1G7IB 4Z7VB 4RWHA 4KGJA 5F7FA 3SDAD 1LMKA 4FG6C 4UZGA 5JORA 1Q94B 3MOBH 2CDEA 4YDJA 3T4AA 1OHQA 4NCC2 1G9ML 5DK0A 1CVRA 2YRPA 1HOCA 1RUQH 4DOHE 2Z4QB 1QEWA 3IDJB 3LD8B 4KK6D 2R2BB 1FSKB 5FGCE 1EO7A 3RU8H 1HYSC 4GG8A 4PB0L 1LDPL 1HH6A 5HJ3B 3RIFK 4RX4A 1AIFB 1GAFH 4EN3D 1NUFA 4GSDL 5EZOL 4XP1L 1WIPA 5HD8C 4YEFA 5GSVA 3OXRB 5AD0B 2CGRH 3F7PC 1MVUA 4LIQL 5ENWA 4WTZG 2NZIA 4WI6A 4GBXB 4HIJB 4FP8H 1F5WA 3QO0B 1MAMH 1I1RA 3LEYL 3Q5TA 3REWA 5T1MB 1EDQA 1K9TA 2ZUTA 3I6LD 4FQHB 1P6FA 2EEDA 4LK4A 4MWFB 4X0KB 1CZ8L 3NCCB 4P4KC 1KB9J 3SGJC 3TCXA 1INQA 3VCLA 5JW4N 3TWCH 3RI5K 2GY7B 4KKLC 3IKCA 1P2CB 2VO5A 3HE6C 5DHVA 4ZFGH 1J0ZA 3GUTA 3CLEL 4OQTL 3V6ZA 3V0WH 2P5WB 3R8QA 2H26B 1MY7A 1F3DJ 3BH8B 4JAMA 1MFAL 2BOCA 3BT2L 4HGKC 3QJFA 5DQ9B 2VDRL 3L3OB 3P4OA 3HZYA 1CF8L 3MRBB 2VAAB 1YUHA 1ZHKB 4ZODA 1IMHC 1HXYA 5C0EB 1Y18B 2EE3A 3MNWA 3D1MC 1D5MA 3BGMA 5SWZD 3GI8L 4Z7QE 4WW2C 5DT1L 2IPKA 1U92B 1XF2B 3OF6A 5ABDE 2AQ2A 5MEPB 3D25A 3OKNB 2BXYA 3TH4T 4XP9L 5GZOD 3BKJL 3KPPA 4Z76A 1EGJH 1RIVH 4X80L 1HH9A 1NCWL 4WW2F 5EBLB 3X3FH 1EK3A 5EC2B 5FF6B 3QDAA 4NO2B 1TNMA 3PQYB 2HKFL 2YC1B 4PJ9B 2ICWI 4H0IA 3C87A 1HE7A 3MRLA 5IJKA 5CP7B 4NO5B 4RGMC 1A7QH 2EH8L 3VI3E 1MFEH 3PWUB 4LLVB 4TUJA 5DD1H 3KXFD 5E7FA 2PYEB 1JI1A 4LSVL 1IVLA 4Y5XB 3V8CA 3FFDB 3EYUH 3ARGC 4OCSH 1S7UA 3GO1H 1I3GH 1MNUH 4G8EB 4AT6A 3NIGF 1U8OA 5CSZB 5JLZB 4NC0B 1JVKA 1S7VB 4Y2DB 3DRQA 2IAND 3HMXA 5HGBB 3ZKQD 3WJLA 1OF2A 4L1DA 1DL7H 1FZOA 4HJ0C 5DZNA 5KOVC 3RJDA 3RVUC 4PP2A 3DXAE 5DEGB 2P42B 4FQXB 4K8RC 5JXEA 4NQSB 1YNTB 3FN3A 4P5TD 5GGSA 2V5YA 1Q1JH 2RFXA 4P99A 2ZSWA 5FIEA 5BS0E 5I16A 2WLYA 4PGCB 4E5XB 2XZQH 3B43A 5ECJE 3QNZB 5E8NB 2HJLA 1MRDH 2DJSA 2BRQA 2UUDH 4JFOB 4ZOBA 1UADC 4KKAD 3IDIA 4L8SC 2ENSA 3FRPA 4RMQA 3TBWA 1JE6A 2B1HL 1OD9A 2WW8A 5D72L 3HAEA 2WV3A 4XGZA 3WFDH 2BMKB 4I0KA 3O9WA 4PY8J 4IMKC 3RI5F 1PGRB 2F19H 3VRJA 3OAYH 4IDJH 4MQ7B 3GK8H 1BQLH 5MERB 1PQZA 3IDYB 1I1AA 2X89D 4V1DA 1OT1A 4TULH 3VW3H 3QQ9D 1OSZB 3SE3C 1TPXC 4X99B 4XCFL 1V3MA 1NJ9A 5CSBA 1G9EA 3F7YA 3OKMB 4JPKL 4PBWD 1J05A 4CL7A 5FHBH 2CXKA 1NLDL 4LSTL 2FGWH 1KCSH 1AO7D 2HFGH 2XT1B 4XXCC 4LLUA 1U8JA 4L29A 5FK9B 2QADD 1KJMA 3PWPD 2I26N 2EEBA 3FHQA 4D9QD 5GZNC 5B8CA 3STBA 1A0QH 5B38B 25C8L 3G04B 3KLAA 3QI9B 1HHKA 4UIMB 1MCBA 3GBMH 4HFWA 3QXAA 2WWKO 4OV5B 4M00A 1MIEL 3BOVA 5HGDB 2M2DA 3UZVB 1LO2L 3BWAB 4K2UL 1ETZA 5HVHC 1TJGH 3W0WB 3O3AA 5E8DL 4Y5VC 5E8OB 1LK3H 2E7LC 4M4RA 3BZEA 1QLEL 4NKIH 5E00A 4TTDD 4M02A 4NQED 4ERSH 3RJQB 4HX1A 5JW4M 4K94L 5SWSD 2VDPL 1GPOL 5IB4A 2DQGH 1QPPA 1Q0XL 4KKBD 4HLZH 3S96A 4FQ2H 4YNYA 4X4XA 3SCMC 4QLRA 4YBQC 2VDLL 4GG6B 4OQ1A 4MJ4A 1TJIL 4Y4FA 1H3VA 3GMRB 3E2HC 5ITBL 2A6KB 3RX7A 2H3NA 3JTTB 3FL7A 3OG4B 1E6OH 3N1FC 3B9AA 4RGOH 1SM3H 2FEDD 5FO8A 1ONQB 1AC0A 3H9SD 3DVIA 3DPBA 1OGTA 3EDEA 1IC5H 5H35A 1H3PH 3RIAK 4KJPC 1JWUB 5DJ2B 1CGUA 3E6FB 5EU3B 4MJ5A 1JPSH 4XVSH 3CFKA 1WBYA 2IPTH 1X6LA 4M7JH 2A74A 4R90H 2IBBA 4LAQH 3IDMA 3UTTB 1KGCE 4U0RB 3BDXA 1L4IA 5GS2H 3D0LA 4MXQC 4QXGL 5GS1B 2NQCA 3OPZL 4TOYL 4X7SL 1ZHNB 4GW1B 5J12C 4DKFL 4XVTH 1IQWL 4H8WH 3CVHA 4P2RE 4HIEB 1BIIB 3CSYB 1OVZA 2UWEA 4OD3H 1SJHA 1A3LH 3BD3A 4PRBA 1EBPA 2DKMA 3FZUD 1QVOB 4J3TA 2Z91A 5D1QB 5TF0A 3NABH 2H8PA 3NAAL 3MLSH 4OKVB 4ISVB 3ULUH 5DUML 3D3VD 2VNCA 1LP9B 2DWEB 5KZCB 5TDNA 1MRFH 3KXFB 1J87A 2UYLA 5AUMB 4PGBA 2JB5H 4NGHH 4KY1L 1OAQL 1HINH 3KYKL 4ZUUA 5T1KA 4QHLB 1CR9H 1N64L 4K8RH 4JFYA 3DETD 5L8JB 2YD8A 4O58H 2XFXB 2DRUA 1A8JH 4HD9A 1DTUA 4NQCA 1SEQL 2FO4B 2X4SA 4NUGL 2B1AH 3CVHL 1OWRM 3VFTA 3HLAB 4YO0B 3BDYL 3GJEB 1JCKA 1KJVB 2FIKA 1H15B 1KELL 1YJDH 4MA8L 2WINA 2QBWA 3NZHL 1QACA 3CH1A 3P3YA 3QYCA 4MJ2A 1B0RB 1CG9B 3E6HA 4FFZH 3O4LE 2GTWB 3EYQC 4LCWB 3AFLA 4WI3A 1I7TA 3BP4A 4HWBL 2DL9A 1G7QA 2B4CC 3MOQA 5I71C 1VFBB 2R0LL 2AI0L 1S9XB 3JV4B 2W9EL 3RWCA 2ZUQC 3S36H 3CXDL 5CBAB 1ZE3C 2NX5D 4HF5L 1OSPH 4ODHH 3RIAF 2F58L 2IH1B 3ZDXF 2HTLC 4KHTH 4G9FE 2AJYH 2GT9A 4RMUA 2YKLL 1QSVA 2F74A 5C7XH 5E99H 1SBSH 3GSXB 1QSEE 1FGVH 4ONGH 3EYVA 3S97C 1KIPB 2QADB 4RMRA 5TQ2L 1H9VA 1PZ5B 1QFOA 1DUYB 4YAQB 1O0VA 4NN6B 4PJEB 4F7MA 1OD7A 2OSLB 2ATKB 4WI8A 1EMTL 2WP3O 1GGBH 3G6JA 3MLUL 3QHTC 3IJHA 1A21A 2AJSL 2C1PA 1RUKL 3V0VA 5IKCB 5E1HB 5FA3A 2AQ3A 3KS0H 4NNXA 1KG0A 2OXGA 1Y0LA 4DQOH 3IXAA 1M7IA 4NWUH 2DL2A 1R6VA 2W60B 4H1LG 3G5VB 5L88L 3K2UL 3MROB 4KI5C 5BZWA 3AUVA 3MV8A 5E4EB 2Y6SD 4N90E 3QEUA 3IDNB 1FYTD 4OCRH 3V6FA 2QHRL 3LRHA 1KXQE 1OQOA 3TNNB 1IGML 1JPFB 3L5XH 3VXMB 5DSCA 4M7LL 3MO1A 3HB3D 4KI5F 2MHAB 4W68A 5BVPL 4Y1AE 5DD5H 3HG1D 3QHZH 3QDMB 4Y5YC 5DZLA 3GBNH 1UEYA 3RA7H 4NBXB 3NPZB 1U8MA 2V5TA 4LOUC 3LH2L 4ELMF 4OZHB 3EO9H 4FNLL 3VD7A 1KCVH 4XPBL 1PLGL 1X5KA 4G6JH 3DX8A 3EDFA 4PGZA 2IBGA 2Z0BA 4JQXC 1Z9MA 3S34H 3DURB 1SYSB 4Z0XB 4FQQA 2EECA 1BREA 4GMTL 1KPVB 4K7PH 1QBAA 3C60D 5D7SH 5EU6D 4NJ9L 2ESVB 4KQ4H 3K46A 4LLDA 1TMCB 4XB7A 1Z9OA 1BJMA 5JIPA 1AXIB 4LSQL 4NPYA 5BOPA 4KV5E 4HWZA 5CAYB 1JNNL 1NGZA 3ARRA 1H3TA 4F7PB 1KB5H 1EXUB 4EUPB 3WXVH 4JG1H 1I9IL 1IC4H 4PTTB 3SDDC 3O3DB 4XNZB 4R4BB 1MHHB 4M5ZL 4TVPH 3HUJF 5C0BA 1EV2E 4KJYB 4ZQKA 4MAYC 1BD2B 1CE1H 3DGCR 5FCUH 3OAZH 4ZAKB 5DJ6B 1RVFH 3CD4A 1ZS8A 4YR6A 4Y19B 2D9CA 5C0CD 5IBLD 2VZ1A 2R8SL 1ZGLA 4QRQA 2HRPL 4YUEL 1CI5A 1T1XA 2D7MA 1MQ8A 4O02H 4JRYE 5MI0C 3UJIL 3VWJC 2C3HA 1FN4B 1IKFH 3D3VB 2X4RA 1ZKAA 1DQML 4O5LH 3RGVC 3HCVB 4OAWB 3PV6B 1MHEB 1NDGB 4JGMA 1V05A 1FC2D 3RKDC 5D7IF 5D1XD 4HULB 2PTTB 1M1SA 5L0QC 4RGNE 4G7VL 3BZDA 5TQ0H 3KHQA 2IBZY 5JPNB 3H9ZA 3DX6B 3IJSA 1VPOH 4ZOAA 3KLHC 3DJ9A 5DFVD 1X5AA 2CDFB 1HI6A 2RGSA 3ARBC 4P0DA 5GS0H 4QOKA 4D9LL 2R56H 2D31A 4ODTL 2UWEE 1W0VB 5DMGD 3MXVH 2BSED 1OP5K 4JFED 2B4CH 4LPVA 4ODUA 4YXKL 1J5OH 2VZVA 4UT6H 3UDWA 2DQIL 1I3RA 4HPOH 3X11B 4L4VA 5I8KL 5DZOA 5JHDA 2GK0A 1NBZB 1YNLL 4FA8A 1FAIH 1UWXK 5HPMB 3GMMA 1A64A 1N4XH 2IH3A 2ZOLA 4UU9B 4Y4KC 3HHRB 3V4PH 1SVCP 1NMBL 4ZS6C 1XGPB 2NY7H 3IGAB 5H94B 4O51A 3ARPA 4E0RB 3B3IA 3EOAA 2NX5B 4MYWB 4U1GC 3WUWA 1YEFL 4YPJA 3NCYS 4UT9H 1YYML 4N8PA 3WSQH 3MJ8A 3I50L 4QRPB 3R4DA 2JKXA 1FQ9C 2QJDA 3FQWB 5EZJB 3BQUC 3RDTC 1CT8A 3JUZA 3OJVC 2LABA 4K7PY 4ZUTA 3ARFA 4UAOC 1AR2A 5JOEA 4P46C 2G5BA 1XCTB 1YN7A 2WK2A 4XAKD 2OK0H 1K8DA 2FJGB 4FZEL 3X12A 1H5BC 1NCTA 3QH3B 4X6BA 3WJJC 2BSRB 3KPSA 4OT1H 4APQC 5GJSH 1CXFA 3C2AH 2AXHA 4PR5B 2CRIA 1WV7T 4MNGE 1I9RH 1II4E 3RGHA 5AYUL 2R29H 4JGJA 5IW6A 3U1SH 1TZIB 1PKOA 1W2KT 4ZFFA 1FJ1A 4JDVB 2VZUA 3PG2A 4G8FB 2G5RA 3GSVA 1GH7A 1RZKC 4LCUB 3F7VA 3FFCA 2A77L 4EOWH 5AZ2L 2V2TA 2R1WA 2QKIA 1UJ3C 3TA3C 3AXLB 2CKBH 1VKXB 4MDJA 5EPMB 1MLCA 1J0IA 4ODXB 1J0YA 1I7RA 2DYPD 3PJSB 1MWAH 35C8L 4PTUA 3RAJL 1FIGH 3UAJD 3UPRB 5CGYC 4LVEA 1XMWA 2FGZA 2HJKA 2ZSVA 4LKCB 1NL0L 3JBG7 1VACA 2ZJSH 2VH5H 4YHPA 5F7UA 3MLPA 1N5YH 1NC2A 3G6JE 3BZ4A 5L2KB 2KKQA 4GQ9H 4KK8D 4M8QB 4ZNEA 2D7OA 2GKIA 2XKNA 3O2WH 1Q9KA 4NJAH 4Z8FH 1R5VA 4RSVA 4XBEL 2DBJA 5A1AA 1I8KB 4QY8B 3TIEA 1J8HD 1KTLB 4PJAA 4JFFD 1MCQA 5FCSH 3VFNB 1KOAA 3QG6A 5KSBA 3MLZL 4DN3H 1JTOA 4Q9QH 5CZXD 2XQBL 3SKNB 5ILTH 4P4RA 4E41B 4GO6B 1ZTXH 3NGBC 4BK5A 4F7EB 4HWEL 5C0FA 1HXMA 3UYRH 2H9GB 3T0EA 2DTSA 5F9JB 1T0NA 3D6GA 5GGUA 2OJEB 4K3HA 3MX0A 3LY6A 3AS3A 2OR8A 1NCAL 2R4RL 4P2QA 3LRGA 2OM5A 2F53D 4KMTH 1QOKA 3ILPA 2XA8L 1MJ7L 2EIZA 1FL3A 1Z0MA 3IFNL 2P24A 1CDGA 2H2PD 3NCFB 2CRMA 3ZE2E 3QP3A 4HIHB 4PRHD 1GGIL 2HFEB 3PUCA 5CBEB 2VAJA 5T3ZD 5D8JH 4HBQA 4XC3H 4AJ0A 3X14A 4GRLC 3RY4A 5D7JA 2P4AB 3PE9A 4OD2A 3DLQR 1B4JL 3DSFH 1R3LB 3ETBF 4IRSC 2FD6H 2XN9B 4S1SH 4EI6A 4XMLH 3F62A 3CFDA 3DX9A 4LCCC 3V4UH 4BH8B 1WZ1L 3RTQC 1I1FB 3OKEA 1ADQL 2YRZA 5GRVK 1Q9LB 5K9JH 5F7LB 3QIBA 1IL1B 4MA1C 2DS4A 5HYJA 5GS3A 5HVFB 4F3FB 4YDLC 1UXWB 1R24B 3QDJD 3ES6B 2B5IC 3MV7A 1WISA 5HI4C 1TCRB 3VRLF 2FWOB 2NW3B 3OTTA 2X4UB 4MD4A 1NCDH 2VISA 2VKWA 1KTDB 1A5FH 3G6AA 1AE6H 1GL4B 4P23B 3BD4A 1VGEL 4H26B 5J7CC 1AKJD 4Z7UB 4KUCD 1NC4A 2MFNA 5KBNC 4YHKL 4JZOA 3W5NA 2A9NH 1XCQA 3QUXD 4R7NA 2LQRA 4DGYL 2YEZA 1F4YH 5T1LB 2H2SC 3RY5A 1JZ8A 2P5ED 4KVCL 4NKOA 4NQDD 3V5HB 3NACH 3P9MB 1QR1B 4AEHL 1A2YB 3WDIA 1OPGH 4HCRA 2XTJD 2X4OA 4ZUSB 5F1IB 5ALBH 1G7HA 4JFHE 1MJJA 4TRPL 1HHGB 1PEZA 4HXBL 4OJFH 3WUWG 2J5LC 3S4SG 5FM5M 1URLA 3MNZB 1JWSA 1FNSH 3T8XA 2VL5A 4KK5D 3SDAC 4KZEL 4RNRA 1P4LB 3UXFA 2BHYA 5I1EL 5D5MB 3UPAA 3ZE1E 2P8LA 3K2MC 5MEQA 3H9HB 4KK6C 4XI5D 3JV6B 2D0GA 1VFAB 1CK0H 4RFOH 2X1PA 2VITB 3FO1A 3MJ9H 5IW1A 4EN3C 1X5ZA 3OKOA 5FOBA 5EU4B 3BE1L 1PSKL 4PRPE 2GJ6E 1BBDL 3MYJB 1RZKH 4OIBA 4WUKL 2V7NA 5HHME 1M7XA 5CP3H 3AMKA 2Z8WC 5IROA 1J7VR 4WHDA 1K5NB 5TDPB 3L1OL 1CU4L 1BQHA 3QXWA 3W9DB 3M17A 2PW2A 4LP5A 4S2SB 4PJ5A 3ZDZF 4Q0XH 2HFTA 1K2DA 3BN3B 2R0WL 5E6ID 2HG5A 4QRSB 3SE8H 1OP5H 3U9UB 4X4YB 4Q9BA 1JHTB 3CMOH 4G7YH 2LE9A 2K1MA 1HWGB 1P9MC 1U36A 3OHXA 4A6YL 3E3QC 2BNQD 3O6ML 4XRCA 5J11B 1E6JL 3CZFB 3X13A 3BRGC 3W5MA 1CIDA 4DGIL 1JNJA 1OB1B 4P9ML 4OZIB 5DD6B 3OJDA 1OGAE 3QRFM 2J3SA 2WIIA 5E5MA 5JMRA 5JORB 3BVNA 4UNUA 2WBJA 4HDIA 4YDJB 3T4AB 1CFNB 3UZQA 1IC7L 1TIUA 5DK0B 3KPSE 4WU7A 3VE0A 1QEWB 1U6AH 3WFBH 4JPWL 3G9VA 3O8XA 1JGUL 1DBKL 4GG8B 4KTEL 1K85A 5EIQA 1J8HB 1B2WH 4HS6A 4YK4B 3FB5A 3SPVA 2WQRA 3P4NB 5DVKA 1RMFL 3O6KH 1U41A 4RISH 1BJ1J 4WRLA 5FOJA 4ZFOL 1MFDL 3F8UB 4OLUL 5GZOC 3G5YA 5GSVB 3IAGC 2FDBP 1MVUB 5ENWB 4PJFF 3D39D 4DVRL 3UMTA 1FBIH 3REWB 3BI9X 3QHFL 4HS8L 3W39A 4WWID 5F97E 1VB9A 1V7ML 1UM6H 3R06B 2OLDA 2FH6A 4L9LA 4M93B 1DFBH 5HBBA 4D0DA 4U4BA 2AV7A 4IRZL 1FPTH 2VABA 4DK6A 3VMOA 3DSNA 2QQQA 3IKCB 4WUUA 5EBWA 3DI2B 5DHVB 3RWJA 3GUTB 3VFMA 4KDWA 1FVDA 4WWKD 4FRWA 3ZLQC 4KRLB 3JV0A 1EUTA 4FFYL 4X9GA 5DGRA 1R3IH 4JAMB 2BOCB 1WFNA 3QJFB 2BNRE 5K59F 3TO4B 3P4OB 3HMWL 3HZYB 4PJGE 1A7NH 1CS6A 5CUSH 3QXDA 1CIUA 4P5TC 5I6XC 3WIHL 2GCYA 1YUHB 4LCIH 1HXYB 1RUQL 1D5MB 3BGMB 3KGRA 1OM3H 3T0EE 4K3EH 2XQYG 2IPKB 4FXLA 5IWLA 2GAZA 4CRPA 3SQBA 4YHML 3LKNA 2DTML 1VHPA 2ARJA 5CJBA 3I2CH 1HH9B 2H1PH 1F58H 4ELKB 1AHWC 1AKJB 3QQ9C 4JKLA 4DWHA 1ACYL 3MPCA 4KROD 1EO5A 2ARWA 4FP8L 3MRLB 1ZGLM 2DI9A 1DE4A 4J8RA 4PYHA 4LFHG 4DKEL 5LWYL 4XNYH 4NQDB 3VXRD 5A43C 5JOPD 3MJ6A 1EGJA 4FZ8H 1Q72L 4TPRH 1T2JA 4L3CA 4WEBL 1GC1C 1W0YT 1I4FA 2QLVB 3QUKB 1QPXA 3QAZC 2YA1A 1T83C 4LHUA 4AT6B 3TWCL 3B5GA 1YEJH 2VXSH 3SE9H 2X70A 1DUZB 3DRQB 4ZFGL 4L4TE 3V0WL 2BCKB 1DDHB 2ITCB 1FZOB 2LTQC 3LRSA 4X9FA 1G9NC 4PJXA 1NMCC 1RIHH 1IFHL 2UZIL 1X6NA 3HZMA 1C7SA 1S7WA 2EYSB 2RFXB 3D9AL 5I16B 2FSEA 2PO6A 5FO9A 4TTDC 5F7WC 2HJLB 1BZ7B 5DJCB 4DKDC 3V79C 3IDIB 3TBWB 2AJXH 2BZDA 4KKBC 2JJWA 5ISZA 3HAEB 4XGZB 5EOTA 4JHAL 1T89C 3O9WB 4YHYB 3Q3GA 3ECBB 4UNVA 3LZFH 1KXTB 3GSOA 1PQZB 3EOBA 1I1AB 4V1DB 4Y8AA 3LKSA 4P5MA 1EGJL 5JQHC 4L5FL 4OCLC 2VYRE 2NXZD 3F7YB 1J05B 3SY0B 4C56D 3TJEH 2FEDC 2Z9TA 1B9ZA 2JF1A 1EEQA 2XV6B 1LEKB 1PKQE 3MLRH 1E4JA 2UVFA 5D1ZD 3CFEA 4F2MA 4GKNA 3HRPA 4UTAH 1A7QL 3I6KA 2WUCH 4LLUB 1I7ZA 4GAJH 1MFEL 4U31A 5KN5A 3PHOA 4L29B 3RNKA 5MENA 1RAMA 1KJMB 1CFSA 3O45B 2EE9A 5C92A 3QNYA 2XICA 2GFBA 1UZ6E 2PTVA 5HDLA 2DDQH 2VLJA 3EYUL 5B8CB 5DXWA 1Z2KA 3GO1L 2IWGA 7FABH 1HHKB 1MNUL 4HFWB 5A2FA 1CDCA 3QXAB 4LCYB 3FB6A 3D5OF 1HCFX 4XPAH 4FABH 3QBTB 2GSGA 1FE8H 4IOFD 3MRKB 4G42A 1R5WB 4K23H 1ETZB 2R69H 4BKLA 1SMOA 3BFOA 1KJ2L 1OTTD 1JYXA 1A7OL 4MNQD 1FL6B 4U1MB 1BFVL 3BZEB 5E9DA 3TZVC 5E00B 3BKCH 1Q1JL 4JY4B 3TP4A 4HX1B 5IB4B 3RVVD 2XZQL 3D18A 4PJ5E 2X4PB 3S96B 1MRDL 4Q97A 1FFNA 4LEOA 4X4XB 2JCCF 2O61A 3FZUC 4KUZL 3MA9H 2A83A 4NRYA 4Y4FB 2BOBA 5LBSH 4MAUH 2H3NB 4AMKH 3KJ4B 4JN1L 2F19L 4IDJL 5L8LB 5JXAL 3DUHA 4I13B 4DUVA 5F7HA 4WO4D 1QLRA 3MRHA 5L8KB 4TNVK 1FORL 3BSZL 4HMDA 5FGBA 1TTFA 3KPLB 4I9WD 3VW3L 4HHAA 3U7WH 4CKVX 3EHBD 5FO8B 4P4KA 1R3HB 3SGJA 5INDA 5BW7A 1CFVH 3VDAA 3VMPA 2OTWB 5DURB 1QSZA 3HC4L 1OGTB 2HFGL 3L3HB 4WWKB 3WO3B 3DETC 4GKZB 3O2VL 4TSAH 1AGEA 1WEJH 3CFKB 1WBYB 1I9JH 3MRRA 3EYFA 3QZWG 2CRYA 4WFHD 4XC1L 4EZMA 5IFAH 3IDMB 1A0QL 5KS9F 1YEEH 2V2XA 3D2UD 4DAGH 3D0LB 3GGWA 5E7BA 1A6UH 3QCVH 5C0ND 1FGNL 5C08A 3N50A 4N0YH 1YEGL 4ODSL 1UACH 3KYAA 3GB7A 5JW4R 3CVHB 3LN4A 1ZANH 1NBQA 1V3KA 3BP6A 4WDIB 1LK3L 1FG9C 5DA0B 5JR1H 5F3HB 5GGRY 5ESQA 1SJHB 4HEPG 1DBML 3UTSD 4ERSL 5F9WC 1P84K 2HT3D 3RWFA 1WFUA 2Z91B 4XPHL 1ZA3A 1GC1H 2X4QA 1UJTA 4HXAH 4FQ2L 2H8PB 4MSWB 3WL9B 4KROB 1IGYA 1LWRA 4BSVA 3T65A 3S5LB 4LASH 1JRHH 3IT8D 3PABA 4U3CA 1AP2A 3VD3A 3VXRB 1GZQA 3DMMD 5TDNB 4JFDD 5DJDB 4M62L 1FNHA 3RPIA 1IJ9A 2ATPA 4NHUA 4RGOL 3L95A 3TPUA 1G9NH 4ZTOH 3FRUB 4LHQB 4P3CH 4FQLH 3ARGA 4B7LA 2EEAA 1RURH 4I18C 2R0ZH 3V5DA 4LHUG 3VXUE 5EFIA 1ITCA 5C9KA 3HNSH 2NY3D 2P8PA 2CD0A 3NFSH 1IC5L 5DTFA 1QYGH 2OZ4H 4J23A 4NQCB 2X4SB 3KJ6H 2FB4H 3W9EA 2VQTA 1H3PL 5C0DB 3ZKXB 1Q9WA 5DS8B 4AM0A 1JPSL 4ZUVA 3VFTB 2IPTL 4R90L 5D2LF 3VMNA 2FIKB 2DLIA 3BIAX 1UYWH 5DVMA 3U7AA 3CH1B 5AG9A 2K7QA 3HRZB 3VGAC 5IQ7L 3E6HB 2X4NA 2HJFB 3WMSA 3PGFL 4P9HC 1JGDA 4XVTL 1I7TB 3BP4B 3PDDA 1G7QB 2R39A 4F15B 1KN4H 5FAAA 4IMKA 2W0PA 3N1QC 4UV7L 3KPOA 1OWWA 1A3LL 3B9KA 2LAAA 3MV9A 5IQ9A 2NXZB 4OGXH 3G6DH 1FVEA 5CLWA 4IM8A 5FV1L 1WAAF 3NABL 5ETUA 3CVIH 5C0IA 4KFZC 4PUBH 2GT9B 4BSJA 2F74B 3MXWL 4BFIA 4BUGA 5SX5H 3S36X 2V2WA 1OTUD 1MRFL 2YN3A 4M43H 3T2OA 4XXCA 2AXGA 1F4HA 3WFHB 3GMQA 1H8SA 3R1GL 4NGHL 4F7MB 1YPZE 43C9A 1V3LA 1PVHA 3ULVE 1HINL 1BVLA 3C60C 1CR9L 4NQVB 1KCUH 3BXNA 3F7QA 4K8RL 3S9DB 5I8CA 2BY1A 1NEZA 4HW6A 4O58L 2C1PB 2FBJH 3MV01 2X1QA 2Y25A 3CH8A 5EZIH 1EFQA 3V0VB 5FA3B 4NNXB 1KG0B 2C3GA 5IVXE 4ZPVA 3D85B 3IXAB 2GEEA 1M7IB 5C07A 2B1AL 1DEEA 4IHOA 1E28B 5BZWB 1CLZH 4U3HA 2DM3A 4Y5VA 3MV8B 4Z5RA 1BEYH 1T21A 3QEUB 3V6FB 1YMMB 2HP4A 3MBXH 3NFPA 5KSAA 4Y4HD 2DICA 3VH8A 5DSCB 3MO1B 5DI8B 3B5HA 3OV6A 5IBLC 4OF5A 1EA9C 4QHNB 5CILL 2NR6D 1TCMA 5EOQL 5C6WH 4H20H 1A9EA 4OCMC 4YHLL 4JM2C 3RL2A 4ETQA 1U8MB 5EWIH 4DEPB 3IFPB 1IEBA 1OSPL 4ODHL 4FTVA 5IGXH 2AJ3A 5JIIA 1KACB 1I8IB 1FO0L 5D1XC 3DX8B 4D2NA 1U91A 1RPQA 3A6BH 4HLZG 4CMHC 3VJ6B 2NTFB 1DLFH 5C7XL 1P7QA 5E99L 4QT5A 1SBSL 1FGVL 2ORBL 4BH7A 3DO7B 3ABZA 5DFVC 3QIUD 4LLDB 1MFBH 5E9DE 3FO2A 4NPYB 3WS3A 4HWZB 2RQ8A 4W4OC 3S3SA 3SKJH 2QQNH 5DO2C 3L3IA 4OLVL 1GGBL 1CTOA 2IMMA 4KAQH 5EO0A 2ICES 4K7PX 4YZFE 1EAJA 1JNHA 5LAXB 3AROA 1HN1A 4JFQB 4DVBA 4YDIL 5C0BB 1UZ8A 4ZQKB 5IFHL 1OP3K 1D9KD 4Z7UF 1YN6A 5EORL 3DV6B 4WW1A 4HGWA 1SY6H 3KLDA 4RA3A 4YR6B 3QIWD 4OCRL 1DBBH 3GDBA 1KB5A 1DBAL 2DIJA 4R2GD 1T1XB 1A6VH 3L5XL 1ZLUK 5DD5L 1JK8A 4ZO6A 2NY2B 4JFXB 5CJQH 3GBNL 3DMMB 3RA7L 2YPLE 4JFDB 4OFIA 4QRRD 5TDOA 5H37H 3VXTA 1MELA 3EJZD 3EO9L 1MHCA 3T1FA 2H32B 6FABH 4NN7C 1XR8A 3ZKSD 2XY2A 3QT2A 3FCTA 3SGDH 3ISWA 4KC3B 5BOZG 3MMEA 4G6JL 3VI4E 3V2AR 2Q8AH 1AD0A 1IGJA 3IJSB 3L9RB 1F13A 2NY3B 5C08E 4F57L 1KN2H 2VDOH 3FQNA 4NZDA 3OL2A 5MP6H 4EKXA 4QOKB 4K7PL 2W65A 1IAKA 5DRNA 3GBLA 4KQ4L 1RQ5A 1H3GA 4P9HH 2D31B 1JV5A 2VB5A 1HCVA 3AS1A 3BN9D 3GSQA 2DLEA 4PJCE 1I3RB 2A6DA 5ACMA 4L4VB 2FHBA 2BRRL 1XH3A 5JHDB 4JG1L 2GK0B 2MMXA 1KPUA 3ARZA 1IC4L 1NDMB 1VGKA 3IKKA 1UC6A 3GMMB 2IH3B 1R3JA 3SGKC 4WV1C 4ZO9A 3KHOA 1G7LA 1YEHH 4O51B 1KLGB 3UBXA 2HFFA 5FCUL 3B3IB 3EOAB 1FG2A 5DJYA 1RVFL 2Y07H 3U4AA 1A3RL 2Q6WA 4NP4L 3DOSA 3C6LD 1CL7I 4FMKA 5J1SC 1M6OB 3EGSA 3MJ8B 4HWUA 5IB3B 2Z35A 4IRJD 4O02L 3ULUE 1OAYL 1IKFL 1BX2B 2VXTL 2YUXA 5BV7C 1WIUA 4KK8C 1CD0A 4K7FA 2O5XH 4ZUTB 2H6PB 3ARFB 5I75B 4WI9A 3QJHA 2G5BB 1YN7B 1MCFA 3QFDA 3AU1A 1FH5H 3X12B 2DQCH 3STZA 3T09A 1BAFL 4X6BB 5I1HL 5TQ0L 4DTGH 3MBED 5IT2H 2ED8A 4FHBD 5CZXC 4NRZA 4JCLA 4D0BA 2HTKD 1DQTA 3HC0B 1NEZG 1D5ZB 2VLRA 5EBGA 3ME0A 3C5JA 4P48A 5IW6B 2IAMD 4YE4H 1JYVA 1JI2A 1GIGL 1T6VN 2E27H 2X9XA 5DJZA 3MXVL 4OLXH 2B4CL 3F7VB 3FFCB 1J5OL 4OFDA 5I17A 2V2TB 2R1WB 4UT6L 4AL8H 4TUKL 5TH2A 2QKIB 3MCLL 5H2BA 2ZZUT 4JHWH 2VKXA 4CN1A 5IIEB 3V8OA 2H2PC 4ETYA 4MDJB 3MFFA 1FAIL 1KTRL 4ELMA 4LSSH 1MLBB 4LLYB 4AIOA 3GNML 4GLRH 4IJ3C 1I7RB 2R1YA 4Y5YA 2NY7L 1WFTA 2XWJA 1Q8MA 3KPNA 5IEHB 3VFRA 3AB0B 3TYGH 2HJKB 3FTGB 4GMSH 2NY5C 2JIXD 3K8KA 3P0YH 3WSQL 2CKBA 2V17H 3RNQA 1P1ZB 3ROLA 2VWEE 4S1DD 4NZRL 1YMHA 3DVNA 1NC2B 4PV8A 3BZ4B 3GIZH 4L3EA 3WLWD 2XKNB 1Q9KB 3HI5L 1UKQA 4JQXA 3T3MF 1MWAA 4PJDE 3RVWD 3FQUB 1F4XH 3QUZD 4K9EL 3TIEB 3BGFB 4PJAB 4QRTA 3SDXF 3DXAD 3OBAA 4JLRA 2VZTA 2N7AA 5KSBB 3O4OB 3QFJA 2I07A 3NCJH 2J8UF 5DWUH 2OK0L 4G8GA 5ACLA 1ORQB 4LPYA 4M3JA 4YBLB 5BS0D 4JDTL 3WN5C 1KF9B 1HXMB 1X5YA 3HUJA 1GOHA 3B9VA 4HIXH 2IQ9H 5GGUB 2OL3A 1I9RL 3S37L 2FX7H 3QUXC 2EKJA 5D7LD 4P2QB 4U2ZA 4I48A 3ILPB 2FZ3A 4KUCF 2VTFA 4POZC 4RDQG 1FL3B 4MAYA 1A02N 3QIWB 3CSPA 1KEGH 2XTJC 4G3YL 1UH2A 4O4YH 4LVHC 3HTLX 5HHNA 1T4KA 1PG7H 1MI5D 1K6QH 5CKGA 3X14B 3JUYA 5D7JB 3S88H 2XACC 3STLA 4OD1L 1E4WH 4ZOEA 1KFAH 2BC4A 5D7IA 4OKDA 4KK5C 4EI6B 3CFDB 3DX9B 1G9MH 3AREA 3EOTH 4HPYL 5FKPA 1YEIH 4YXLL 2ZJSL 3BKMH 4XI5C 4KZDL 3MLTB 3QIBB 4PB0H 4EDWH 5HYJB 2CQVA 2XZZA 2DLHA 1IAII 1RULL 3WKML 4WU5B 3TVMD 2I9TA 4GQ9L 2EDNA 4GSDH 3O2WL 4X4MA 3MV7B 3PL6D 4NJAL 4GOSA 4CMMA 3GJFK 3HN3A 4GUPA 4MD4B 5I1DA 4LIQH 2VISB 3HR5B 3P4MA 3ARBA 3G6AB 4MDIA 2NYYD 1AJ7H 1H3XA 3UTPE 1XF5A 4M1CD 1NC4B 2Y7QB 4ZUWA 5D2NA 1ZTXL 3EW3B 4CVZA 2DMBA 4JZOB 1XCQB 4R7NB 1NANI 1ZLVK 2YEZB 5DF0A 4XB8A 4NKOB 4KMTL 4OQTH 4Y4KA 2X4OB 3QDGA 5BV7H 4OZFH 2Q87A 3IDGB 1IARB 1CFBA 1OLLA 5JDJA 1B6DA 2X41A 3KYOA 2AQ1A 1MFAH 1J18A 1LGVA 3TN0B 1AQDA 3BT2H 4JREC 1J0HA 1HHHA 4KJWD 3T8XB 4A6YB 4IRJB 2VL5B 1G7IA 4R4ND 1CF8H 3CCHA 4Y16A 2HMID 7CGTA 1QRNA 1Q94A 2AK4A 2FD6L 3BQUA 4NFCA 5IMMB 3RDTA 5HDBE 4JVUA 4I0PC 2X10A 3V4UL 1CXKA 4Z6AT 3GI8H 2IPUK 2R2BA 4LHJB 5K9JL 1KGCD 1YYLH 1W0WA 1YQ2A 3BIBX 5IW1B 2A1WL 5FOBB 3OKOB 4XP9H 3N1MC 3N85L 1PG7W 1ZHBA 1H5BA 2Z93B 4X80H 1AIFA 2YHGA 2WSKA 2GITB 4NO0A 1B4RA 5EA0H 1E4XI 4EDXB 2XPGB 4GS7B 3OXRA 5AD0A 4HJJL 1MSPA 2IAMB 5K9OB 1MCCA 4P2RD 5C09D 5GRWA 4GBXA 4ZFOB 2HKFH 4KPHL 1U3HD 4WTXA 1AE6L 3KDMA 5A16B 1BQHB 4X83A 2UV3A 4N8VG 4PY7A 5T3ZH 3M17B 3FKUS 1NAMH 2EH8H 3MJ9A 4FQHA 3JWDC 4F9PA 4MWFA 5IBUB 1K2DB 4X0KA 4E42A 2HG5B 4HMCA 4LSVH 2OI9C 2A9NL 1QHOA 5CP3A 1UJ3A 5BRZE 1P53A 3TA3A 3Q5YA 3E1F1 4XRCB 4WY7L 4AENA 3D0VA 1P2CA 3X13B 3PGCA 4DZ8A 1NFKA 5F6HI 4EVNA 1LEGA 3OJDB 4AQ1B 2P5WA 4KVNL 2OR9L 5E5MB 2YD7A 4HUVA 2YMXL 3U4EA 3BVNB 4F58H 3FQRA 2WBJB 4HDIB 1UVQA 5DQ9A 1FNSL 4FG6D 4LLAA 5K33A 4WU7B 3VE0B 3UTQA 3MRBA 3GSNL 3BD5A 3EO0A 4PJIE 4HS6B 3SPVB 3FB5B 5T5NF 3V6OA 2ZWLT 5C0EA 1Y18A 5EUKB 4WI7A 1MCHA 3G5YB 4RFOL 1XF2A 5FXCH 4NSKA 4M6NL 1ED3A 4V2CB 4WEUD 3OKNA 5JW5B 5HD8D 5T1DH 1QZ1A 2AJZA 5KVMC 3O4LD 5EBLA 3W39B 4YC2B 4WGWB 4LSRL 5EC2A 5D7LB 1S9YB 4LSTH 3PQYA 2YC1A 4L9LB 3LKOA 5CP7A 5FM4A 1HSAA 2AAVA 5HGAA 4D0DB 4Q0XL 2ID5A 3PWUA 2C1OB 2BY0A 4WUUB 3HNTL 4QGYA 3NIFF 4G9FD 3RWJB 1P69B 2LU7A 4PLJD 5JW3H 1MI5B 2PUQT 3CMOL 4G7YL 25C8H 3HE6D 4U1SA 1PY4A 1WFOA 3H42H 4TYUA 2PCPB 4UV4L 1MFCH 4GRLA 5E08L 3QQ4A 1UB6A 1QSED 4HK0B 2VERN 1MIEH 2P45B 4IRSA 1X3DA 4MJ6A 5F44A 1LO2H 1QBMH 4PPTA 3HKFA 4N8CH 4LCCA 3QXDB 4G8GE 4NM8H 3QUYD 2GCYB 4P3DB 2BVEA 1TETL 5JZ7D 1ZHLA 5F6HJ 3LKRA 3QRGH 3PIQA 3WFBL 5J13C 4PGCA 3OQ3B 3QNZA 3R0MA 5E8NA 2GAZB 3IFLH 4OZGE 4H5SB 3LKNB 4JFOA 1B2WL 4HUUA 2VDLH 4RFEB 1TJIH 4RISL 5ITBH 4Z7OE 4N90D 4PIRF 4LSPH 2EO9A 1T3FA 3QEQE 4MQ7A 3BPNC 3LDBB 1NSNH 5L9DL 2XA3A 3FO0H 4Z18A 1FBIL 4Y1AD 1OSZA 1DE4B 1RHFA 2NPLX 3OKMA 5JUEL 3C6SB 5D1ZC 3ARUA 3VFVB 2EDJA 4W6XB 5BCAA 4L3CB 3JZ7A 1I4FB 1DFBL 1BP3B 4X6CB 3RUGE 5TE7H 4Z95H 3MACH 1DZBA 2X70B 4MJIA 3MZGB 5C0AE 4LGSB 5DD0H 4M7KL 4QXGH 3SDAA 4PJXB 1NCCH 4YX2H 3AC0A 3OPZH 4IOFC 1UM5L 3OKLA 4X7SH 3HZMB 3W81A 1S7WB 5HGDA 1OTTC 4JEGB 1SJXA 1IQWH 2QQLH 5IHZA 5CUSL 2D3VA 2PO6B 5FO9B 1KLUA 3SQOH 1EX0A 4GRMA 4ZSOA 3RVVC 4EN3A 4UUJA 3JWDH 1VA9A 4PJ7F 4MQSB 5ISZB 2DLTA 3TV3H 5HI3D 3Q3GB 1GVIA 3OB0K 4PJHB 3GSOB 5C09B 2AEPL 3EOBB 3NAAH 3LKSB 4P5MB 3GJFH 1MRCL 4GG6A 1L6ZA 2OP4H 3I2CL 5DUMH 1F58L 3QDGE 3GMRA 4WO4C 1A1MB 2A6KA 3JTTA 1HDMA 4MCYA 1S5HA 3EHBC 3MNVA 4YPGB 3L3JB 1B0WA 1XGQA 5I1CH 1OAQH 4JRYD 4Z7VE 2AXJA 3I6KB 4NKMB 1OCWL 4X6DF 1N64H 3JTSA 1I7ZB 3IJYB 5KN5B 3PHOB 5GGRA 3RNKB 5MENB 5FYJE 1CFSB 3TT3H 4OLWH 1SQ2N 3QNYB 2GFBB 2NW2A 2NY1B 3TJHD 1MCNA 2VLJB 1SEQH 4NUGH 5I76A 3VG9B 4AIXA 3E6FA 2VXSL 4RGND 1UH4A 4PGEA 3HZKA 3BDYH 4HZLB 3QG7L 2HVJA 1KELH 5C0NC 4MA8H 4BKLB 4X9HA 4XCNA 1DCLA 1WT5C 3KWWA 1YDPB 5DUBA 1JZ3A 1X4YA 3ZHKA 4M7ZC 4PJFA 5FV2A 5SWZA 1HHIB 4PJBF 3BKYH 4C57C 4HWBH 1ODAA 3D18B 3I75B 4HIEA 1BIIA 2AI0H 4LEOB 5C3LD 5E03A 5B22A 4P3WA 2O61B 3CXDH 4HF5H 2IFFL 2AJXL 4NRYB 2F58H 3SCMD 3ZE0F 3IYLW 1MUJA 2XG4A 1RZGA 4LSUL 3RVXD 5HHXH 1FNEB 3LZFL 3TGXA 1BOGA 1QLRB 3MRHB 4LPWA 1EJOL 2YKLH 5J9PB 3BO8A 3Q1SH 4ISVA 1X5IA 4UB0L 5KG9A 2P5WE 2W1NA 1LP9A 2DWEA 4P4KB 2CXGA 4RMWA 5E2TL 5T1KD 3KXFA 1L9NA 3SE4C 3TJEL 5TQ2H 4L8CA 4GH7B 3MUGB 1ZSDB 1EMTH 1QFUH 2WUCL 2XZAH 1PAMA 4GAJL 1GRWA 1AGEB 1JIBA 3MRRB 2AJSH 4KJPD 1F3JA 2IANA 3AGVA 4MXVE 2FO4A 2V2XB 5BO1L 2QR0B 5I73C 7FABL 2VZ3A 1RJZA 5ESAA 5L88H 1MCKA 2DQTL 4P5TA 4YO0A 1WJ3A 3VXQA 3GJEA 1FE8L 2FJHA 3ZDYF 4H0HB 2QHRH 3LN4B 2IFGA 3PV7A 1IGMH 1B0RA 4WW2B 1QFWL 3LKPA 5E5RB 3PQYE 3BKCL 4LCWA 2ZKHH 4Q6YA 4C4KO 1MHPL 2IADA 3WBDA 2CMRL 2DQFB 1B88A 2UZYB 2X4TB 1MREL 1NCUA 2X4QB 4F9LA 2XWTA 3ZTJH 1AHWA 2P48B 2X89A 2PYEE 1IGYB 4BSVB 5IFJB 5IBTL 4FNLH 3ELAT 2XI9A 3MA9L 4CGTA 3MRPA 1DANU 3PABB 2YS4A 4XPBH 1AP2B 2XKSA 4MAUL 1TJHL 1GZQB 5C9JA 2W0FA 4NUJA 4RGMB 1F8TL 3RPIB 1WBZA 4NHUB 2AW2A 1OTUC 3FOMB 1AO7A 3L95B 3U0WH 4X98A 3CZJA 3GSXA 3ARGB 3ZZ1A 3ULVL 4UDTB 2FX9L 3C08L 1T83A 3PWPA 5ADOH 1CFVL 5EFIB 2P47B 4LSQH 2P8PB 1F11A 2ATKA 3T0AA 3KPMA 2FHFA 4TSAL 1JHLL 5BQ7A 5B38G 5KAQG 4N1CA 4ZUVB 5ELIA 1FFRA 1I9JL 2YBRA 1EPFA 3C8DA 1I9IH 5CZVH 4ONFH 5IFAL 5IKCA 4XNZC 2NMSA 2LU4A 2EC9U 3K74B 1A6ZA 1AD9B 1M4KA 2VDKH 3D87B 5F93C 3T0WA 5GGVY 4DAGL 2YD1A 2W60A 3TYFA 3QCVL 3VRIB 4XNXL 4RA0C 4LVOC 3WDHA 2X4NB 4LKXA 2OZ4A 2MOVA 4NQEA 4ZMAT 1I85C 4U7MA 3IVKB 4Y4HC 5SWSA 4L8SB 3S35H 2HRPH 2FLBT 2NR6C 1JPFA 3QXTA 1T89A 2MHAA 3UJIH 2ZG1A 3KPOB 4GW4B 1LO0L 3MV9B 2VN4A 4HT1H 2YUVA 4LRIC 5IHLB 4HXAL 4OZHA 3E0GA 5C0IB 2HTLD 3OZ9H 5DMIH 4LASL 1JRHL 2V2WB 1K4CA 3LPGA 5EUOF 1U2CA 3DURA 4LVNC 2G9HA 1G9NL 1GJIA 1FO0B 3QIUC 4P3CL 2CDGA 1XF1A 1KPVA 3BXNB 3W0WE 5I8CB 2B7DT 1OT2A 1WWAX 3HNSL 3SKMB 3MREB 3NFSL 4YXKH 4AYFA 1VADA 2FB4L 3TPKA 2W59A 2DQIH 5C07B 1DEEB 4IHOB 4F7PA 1EXUA 4KK9C 5HVHB 5GHWH 2Y5TA 4Y5VB 4Z5RB 4HIIA 1YNLH 3DYPA 1IBGH 1T21B 4GG6E 3O3DA 2JCCA 4R4BA 1D9KC 3NFPB 4KJYA 5IESL 3VH8B 2C4FU 3VXSD 4R97C 3ARYA 1N7MH 1IZJA 1MAJA 4JKMA 4UNTA 4R2GC 1YEFH 2H32H 3SCMB 2NY4D 3U36A 1QR4A 3RL2B 1EEYA 3UTZB 2GSIA 3E2HB 1IEBB 4U6VL 2ICWB 4BQ8A 3AM8C 1X7QA 4FTVB 3OB0H 1QSFB 3D3VA 3K3QA 1U8LA 4PLOB 1AXTL 2FEEL 3EJZC 1MHEA 4JFHD 1RZ7L 4LARL 4IEFB 4JFZL 3CVIL 1NFDF 3VFPA 4TSCL 2E8YA 1NKRA 2A6JB 3BESR 2Y36H 4PGDA 4FZEH 3UTTE 4QT5B 5F21B 4B53A 3RZCD 4BH7B 1C5CL 5KS9A 1BVKA 2P8MA 3DX6A 5JDSB 3MFGB 4YHNB 3FO2B 3WS3B 3CPLA 5AYUH 2E9JA 4O2EB 4AG4L 3BN9C 4EI5D 1X5XA 2FBJL 5EO0B 1W0VA 4PRPD 4OIAA 2GJ6D 2P7TA 4U1JB 5EZIL 5HHMD 2A77H 5J12B 3MV11 3SDDD 2DQDH 1UZ8B 1IM3B 5IOPA 4PG9B 3UTOA 2J8OA 4W6WB 1CLZL 3SGEI 3OXSB 4WW1B 1L6XA 3GMPB 4C58B 2FJFA 1RZ8B 4X6FA 5J0BA 1LP9E 3MBXL 4KRPD 3UYOD 35C8H 3GZKA 5IVOA 4YFLF 4MS8D 5H94A 3D48R 2PXYD 2NX5A 5ANMA 3C6LC 1JK8B 2AV1A 1NL0H 4JO4H 4H20L 4PS4L 4P2CG 2YUWA 5J1AA 5D96C 3VGBA 3SBWC 3RGVD 5BVJB 4ZFZA 5TDOB 3WFCH 5CEZE 3VXTB 1SY6A 1MHCB 2V9TA 4M1DH 3T1FB 3F5WB 1XR8B 3NPSC 5IGXL 3VA2C 1OGAD 4XH2B 3RKDD 5SX4H 3MMEB 1CFQA 4TTGA 1AD0B 4OB5L 4F37K 3MLZH 5C2BH 1IGJB 1KSRA 4H88L 3MBEC 1C8PA 2XQBH 4ZDHA 1OAKH 3SJVD 4ZTPL 1UGNA 1I8MA 5D2LA 4HWEH 2W65B 1KV3A 5DJAB 2BY3A 3L7FB 2ZUYA 1JV5B 2I25N 4LCWE 3O6FD 3SKJL 2UY6A 2R4RH 3CU7A 2A6DB 5GIRA 1Y6MR 3CDCA 4JDVA 3KR3L 4KAQL 1XH3B 2XA8H 4Z7QF 4G9DA 1KPUB 4YHZL 1VGKB 1GSMA 3IB4A 2PR4H 1FYTA 1DVFD 1D6EA 3IU4L 1R3JB 5MEOA 1GGIH 1K8IB 3ULSA 3UBXB 2HFFB 3HG1A 3UP1A 1FG2B 5DJYB 1NGXA 5EPMA 1WAAA 3K80A 3OX8B 2Q6WB 1B4JH 3CX5K 1DBBL 3SDCC 4KI1A 3PJSA 2YXFA 1A6VL 4KDTC 4U6HA 3SKUD 4XP6L 4PJEE 1WZ1H 3VI3F 1ADQH 5SV3A 4S1DC 5CJQL 1KNOA 4K7FB 1OAUL 1MJUL 3HA0A 2ADJA 3QJHB 4RAHA 2BNRD 3RVWC 2EYTA 1MCPL 4UTBL 3QUZC 4R3SB 3AU1B 4I3RL 4U6XA 1I8KA 4QY8A 4JRXD 4I1NB 1D5BA 3C60A 5EU6A 1CE6B 3TFKC 4YWGH 5H8DA 5DC0A 4NRZB 3UO1H 1AC6A 2AKRA 1KN2L 3MGAA 2VDOL 4APQD 2VLRB 4N9GA 4YHKH 3L7EA 4F7EA 5C6TH 3ARQA 5HYQB 2BVTA 1CD9B 3VXME 3X17A 4P9HL 3PWJA 5FUCE 3MODL 4DGYH 5A40E 5C6PB 5F9JA 4EUPG 3QDME 3TO2B 4GXUN 5TH2B 5H2BB 4AEHH 4DUWA 3VXSB 4OZHE 3PGDA 2Y9RT 4ELMB 5C0CA 4PV9A 1L7IH 1SBBA 2R1YB 2H45A 4Y5YB 4L8DB 2XWJB 3KPNB 3I3EA 4KZEH 1U8QB 3WE6A 4NN5C 3QEGH 4CNIA 5I1EH 5CGYD 4R6UA 1C5BH 3MRFA 4OUOA 2CKBB 1YMHB 5FYLE 2I27N 4QCIA 5DJXA 2ESVE 3MLVH 2W0LA 4L3EB 4L4TD 5D1XA 2UUDK 1Q9LA 2BK8A 3TVMC 1C12A 4OBRA 5HSFA 4MVBC 1CCZA 4IOIA 2O5XL 1PSKH 3PL6C 4QRTB 2HLFD 1BBDH 3OAYK 4JLRB 1R24A 2APXA 4WUKH 3QFJB 3FN9A 5IK3A 2CR3A 4O2FA 1NCNA 1FH5L 1TCRA 2DQCL 3AY4A 4W4OA 2MQ3A 5BMFL 5K9KA 3L1OH 1JYNA 1IC1A 5IT2L 3RWHA 4PRID 1BD2E 3HUJB 4LFHD 4N1HB 2EDTA 3CLFH 4Z7UA 3FQXA 4Y19E 2R0WH 3SDDB 3O41B 3UX9B 3VD9A 4YE4L 4I48B 1HIMH 2FZ3B 3VGHA 5I19L 1CICD 1A7RH 4MAYB 4A6YH 4JZJC 4OLXL 2B0SH 3D3VE 3O6MH 3Q2CA 1E6JH 3K7UA 4Q6IC 5HHNB 4DGIH 1T4KB 3BPCB 5F1IA 3STLB 2BC4B 3BUTA 5MI0B 3VWJB 5D7IB 2DM2A 4R4NC 5CEXA 2QEJA 4L4JA 4Y88A 1U8HA 3RGVB 2HKHH 3M07A 2HMIC 1MCSA 3AREB 4JY6B 5FKPB 1P4LA 1NH6A 4JPWH 4YFDB 4PD4K 5GRYA 1PG7X 4ZYKA 1VSCA 4M48L 4KTEH 3RTQD 2V17L 4UQ3A 2ADFL 1SEBA 1EFXD 5GRXG 5L0QB 4GKSA 2I9TB 2GUOB 2JJVA 1RMFH 3GIZL 3MTRA 2HLAA 4OLUH 3CSGA 4CMMB 5J56B 4GUPB 2VITA 3SJVB 3UROR 5I1DB 1F4XL 3P4MB 5EU4A 1RIUH 1WZLA 3ARBB 1SYVB 4HKBA 3PDOA 5H37G 5KVFH 3NCJL 5CMAA 5E0QA 3GFUA 4KKCD 5AG8A 4F7TA 1U3HC 2PTUA 4ZUWB 5D2NB 1INEH 1D3CA 4PJ5D 4CVZB 2VLME 1TNNA 3KPRD 3DECA 4ZNCD 2NX5E 4PJHF 5DMJB 5IP4A 4IRZH 3AS2A 3VGEA 2C3VA 4JZNB 5LGHH 4QRSA 3JV5A 4MNHB 3BPOC 3U79A 1T7YA 1JHTA 4QRPE 3SGKA 2OCFD 4Y4KB 4WV1A 3UJJH 1S9KC 4FN0A 5FKAA 4FFYH 1KEGL 4U1GB 3KYOB 2DYPA 3V5KB 4AH2B 1AQDB 2W07A 1T7XA 3D69B 4S1QH 1K6QL 3HMWH 5DR5H 5DD6A 3NBNA 4OZIA 3S88L 3CCHB 4Y16B 1N59A 3EIFA 1IT9L 1E4WL 1KFAL 2O5YL 2WP3T 1QRNB 4KXZH 2AK4B 3WIHH 3NFNB 2VLKD 1XFPA 3BQUB 4OQTA 3RDTB 1CFNA 4OZFA 4BSWA 5FEBA 4GAGL 4LSDA 3EOTL 4JQVC 4XWGH 2E5EA 4UAOB 1YEIL 3BKML 4R8WH 4X5WA 4GXUM 4P46B 1W0WB 4JRXB 4YHMH 4EDWL 2DTMH 1J8HA 1N3NB 4JFFA 1VEOA 5I18L 1ZHBB 3I6GA 1H5BB 2MNUA 3P4NA 2ZCHL 4NO0B 3ZYZA 3GSNB 3FT3B 5LCVL 3BPLC 4APQB 1ACYH 4JG0L 1UH3A 5KW9H 2CKNA 1UCTA 1P6AB 3KDMB 5IJKC 1AJ7L 4PY7B 4DKEH 5LWYH 1WAAE 5DLMH 1GGCH 4BELD 4E42B 4LBEA 1Q72H 2F53A 3R06A 1G1CA 3MRCA 1XZ0B 4WEBH 1N5AA 1UJ3B 3HS0A 3TA3B 3GI9H 1DN0A 1E4KC 1YEDA 1ZGLP 3KYNA 1MFNA 4PLJC 2NXYD 4AENB 4PRHA 3D0VB 5M94B 3PGCB 3KPTA 3U82B 4DZ8B 1NAMA 4XVJL 2X44D 4EVNB 1LEGB 5L2KE 1HEZB 5BV7L 5EC1A 2KZ1B 3A67L 4XMKL 4HUVB 3U4EB 3FQRB 4BM7A 2R2EA 1NAKH 3FT2A 1IFHH 2UZIH 1UVQB 1DQJA 3TO4A 4KJQD 3WNMA 3VXUD 3D9AH 3QUYC 4WHCA 4PY8I 3SDXA 3UTQB 3QXVA 5JZ7C 3HE7D 4U0QB 3EO0B 2OTUB 4E41E 5DHXB 2E9WA 1FFOB 4J3XA 4I4WB 1WICA