3EOAB

Crystal structure the fab fragment of efalizumab in complex with lfa-1 i domain, form i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
220
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGMIHPSDSETRYNQKFKDRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARGIYFYGTTYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Efalizumab Fab fragment, light chain
publication title Efalizumab binding to the LFA-1 alphaL I domain blocks ICAM-1 binding via steric hindrance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cell adhesion
total genus 37
structure length 215
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoaB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eoaB01
2ICWA 4Y5VC 1INDL 4D9LL 4HGWB 4MHHG 4WCYL 3G5VB 5EZOL 4X8JA 4J8RA 1N0XH 4YDVB 2XRAH 5JOFB 3QUKB 4JZJC 4W4NA 5EDXA 2H1PH 1CQYA 2VISB 4JDZB 1XGYL 5IT2H 4LSTL 4OCXL 2BHZA 3F5WA 1BVLB 1NGYA 4TNWK 1NAMA 1IKNA 2V5SA 3ZHLA 2F15A 4G9FE 4GW4A 5B4MC 5IEKB 3WJJA 2DQUL 1UM4L 4U1KA 3MOQA 3IDXH 5JORA 3MX0A 5KSAC 5DD0L 4CNIA 4RBPK 3K7UA 4YX2L 2QQNH 1MWAA 5E2WL 3RWCB 5FYJL 1I8LA 1JHKL 4JGUA 4DEPB 1BF2A 3KDMA 4ZS7H 1U8OB 3K81A 4MDJB 1RK1A 1HYRC 1T80A 3FCTB 5ACLA 3RWGA 5I9QB 3JTTB 3H42L 3PUCA 1IL1B 1DDHB 2H32B 1FSKB 1X5ZA 2YC1B 3FO1B 5IM7A 4P9HL 1DVFD 4UAOC 4MQ7A 1A4JB 3B2VH 4DFIA 1NCAH 4FN0A 3LH2H 3U4BH 2MWCA 4AEIH 2DL2A 5HI4D 4IDLA 3T2NH 3FQWA 3ARGC 3X13B 5F6IB 5EWIL 3DVGA 3P73A 2VDOL 3D2UB 3Q5YA 4ZXBA 5JHDA 4H0GA 3OKMB 4XMPL 5IMMA 3RTQD 5F9OL 4BQ9A 3MGTB 1JZ2A 1RZFL 2O5YH 4ELMF 3ZKSD 3SDXA 1PG7W 4JVWA 1UXSA 2NTFB 1K4DB 1WCBB 2ESVD 4MXWH 3GNML 3GSOB 3HKFA 3MSPA 4RMSA 4MWFA 3BH8A 1QLEH 1MCFA 1NQBA 2AJ3B 5E00B 4F7EB 3NVQA 1U8HB 1DANT 3IS1X 3L6FA 4M7JL 4HKZA 4N90E 5EA0L 3L3GA 1T03L 3QXTA 4K7FB 4X99B 1XF2B 4JANB 1JV5A 3RVUC 3TT3L 5T3ZD 4LLVA 3NIFE 1IGCL 1NBYA 1JHTA 4CMMA 1FH5H 4DOHB 4FXKB 4JKWA 2EDRA 4G8EB 2HVJB 2PW2B 1HYSC 5IVXF 2BJML 1JPGB 1ORSA 2YPLD 1KUMA 5BW7C 1FZOB 4QRUA 3LRHA 1ZTXL 4XCFL 3QNXB 2XN9E 1K2DA 1EX0A 2BOCA 1RJZB 1UEMA 3SDAB 5F7DA 5SX5K 5DJYA 4GAJL 5CZXD 3I9GL 3CDGA 1J8HE 2XG5A 1AKJD 1ZLWH 5E2TH 3LS5L 1P4BH 3ZKNC 2AV1B 3OKNA 3WKNA 1IGTA 3IJSB 2X1PA 1SYSB 1HHIA 4XH2A 2V2TA 3V0AC 3BPNC 3IRZA 3O0RH 1YPZB 2P7TA 4L8SC 1YNLH 2DQDH 2MHAB 3MLRL 3UZVB 4HUUA 4JRYE 4ONGL 4P4KD 1MFCH 4L4TB 5I16A 3TBWB 3HNSL 3W11D 1GL4B 3ROOB 2IPUG 4UDUA 2BRRL 3NFPB 4GXVH 1F4YL 1MJ8H 4R4FL 1ZXQA 2EDOA 3MNVA 4LCWD 5KVDL 1MIEH 4BH8B 3BGAA 5CINH 3SKOA 4F9LA 4X5XA 4Q6IC 5ACMA 4ZODA 4JRWA 2WLYA 3NACH 5HHVL 1GZPB 3VXPA 2QSVA 1JZ6A 3BQUD 4M3KB 4M7KH 1RMFH 3E1F1 2OMNA 3ARSA 4N0UA 3OXSB 1CE6A 2Q86B 1S7SB 4UTBL 2Y6SD 2CRIA 4IS6B 1YUHA 5KVEL 3ZL4L 2ZJSL 2VB5A 3BHBB 3OF6D 5T1MB 2AJUL 3TJEH 1FAKT 4XX1E 3VRIB 3HRZA 4KDTA 3UTQA 4YHML 2B1HH 5DFVC 5FYLH 3DPBA 2X4OA 2PNDA 3PWLB 2WUCL 2IH1B 3CVHA 2BOBA 3HCVB 4LLUB 3FQNA 5IWLA 2EE2A 2ZCHH 1V3MA 3QULB 4OZHE 3RPIA 1NC2A 2WWMC 4WVRA 4CU6A 3UTPE 1O7SA 5DYOB 1BIIB 5DJAA 5DURD 4O4YH 1MHCA 5DK0B 4NKDB 2YD6A 4W68A 5E4EB 1MCWW 3TEUA 4CVZB 5JW4Q 1I1YA 5C7XL 1EHNA 3STBA 4MD4A 4APQA 2PF6A 1BX2A 2W9DH 2BMKB 5C0AE 5HPMA 1W0VA 1KB5H 4YDLB 3PGCB 1E0OB 4KRPC 3DI2B 5ANME 5T3ZH 3TN0D 4HZLB 4QXTA 4YHKH 3C5ZD 3IDJB 3C9NA 1MJUH 4GRLC 3H3BC 4LIQE 5HHOB 5FCUL 3WFEH 3ILPB 5IVZA 1KLFA 2VLKD 3O3DA 4NKMA 3G08A 4OLWH 4XNYL 1Z3GL 3MLVL 4ZFOA 1T5WB 4H88L 3VRJA 5HHPB 4Y4FD 2HFEB 4L5FH 3UJIL 1NMBL 4XNXL 5HGDB 5DI8B 4QGTA 4NNPH 2GTWA 1Y0LA 2ZP0T 4NRZB 1Q9LB 1T04A 1NUFA 3QDME 1GIGH 3KPTA 3CPLA 2YHGA 4RDQG 2CPCA 4NUGH 3K2UH 3RWIA 5I2IB 2Q6WB 4NO5A 1DFBH 3QUMB 4NSKB 3ZKQD 2NXZD 3ALXA 5GHWH 1A3RL 1JYVA 3MPCA 4JVUA 1CXLA 4PJAA 5IBUG 4LSQL 5ISZB 2COQA 2X4QB 4YPJA 1MCSA 2NLJA 4XNMA 5B8CA 5EUKA 4Z0XB 2BNQD 1J7VR 1RIVL 3PWJA 1JF1B 3WFZA 2FECI 1HKLH 3DTXA 3UDWC 1MEXH 3T09A 3UZQA 1JK8A 1NAKL 5A2IH 5CGMA 2NMSA 4WW2F 4JHWL 3C6SA 5DSCA 1ZAGA 5FHBL 2FWOA 4S1QL 4KH2A 4OCRH 1ZANL 3SE9H 4MB5A 5FUCC 2EKSA 3QA3B 4PYGA 3P77B 2JJUA 5I19H 3RWJB 1A6PA 1IZKA 4G9FA 1WWCA 1Q72L 2XRAL 1EA9C 4HW6A 5ENWB 5E6YA 3VDAA 2QHLA 4ODXA 2H1PL 1IGFH 4XWOC 4NKIH 5IT2L 1FGNH 4PB9H 4Q2ZB 4CJ0A 3LKNB 4NJ9H 1MCDA 1FL6A 2H26B 1SVCP 3MRNA 1J87A 4I18A 5HGHB 2D7PA 5GGSA 3SJVE 2Q3AA 4R7DB 3WN5C 2XNAA 3IDXL 4NM8H 2PYEB 5FYKE 4QRTA 25C8H 2GAZB 2R0ZL 5KSBF 3MJGX 1CFTB 1HOCA 4NO0D 4KC3B 3VCLB 5HYSB 4ZNEE 3DMMC 4ZS7L 1T7WA 2ITDB 2IH3A 4HC1H 5EC2A 1R3HA 5EC1A 3BH9B 4PGCA 2IJ0C 3QT2A 4NP4H 3CSYB 5DVMA 3R0NA 5E8EA 1CD1B 1K85A 3B2VL 3ULSB 2HJLA 3K2MC 1NCAL 4NPYA 3LH2L 2CLVB 4PRHB 1CDIA 2DD8H 3U4BL 1KENH 3EDKA 3S8WA 3T2NL 1OF2B 1SHMA 3BO8B 4E41B 1RK0B 3WLBA 2FYYA 3RL2A 4P5MB 3LKQB 3ARGB 2MNUA 1OAKH 5IV2B 4LBEA 4ODBD 1EH9A 1AGCA 4XP4L 4HV8A 2B1AH 3EOBB 3FMGH 5F71A 5FO9B 4R4NC 1AI1H 1JWUA 1R5WB 1YNTB 1GOGA 2HRLA 2F9BT 1L9MA 2KQMA 2O5YL 3BIKB 4LCCA 4UV7H 5F7YC 3HI1A 4MXWL 1BJ1H 5DD6A 5ITBH 3GBLA 1QLEL 4J23A 1AHWC 3QIBB 4U0RB 2E7LA 1MRFH 5DUBA 4NCC1 2BSRB 1TCMA 2XN9A 2VKXA 1QLFB 5KN5B 4FZ8H 4WWKA 4KHXH 1T2QH 2HG5A 3FB6A 4OKVB 3QUXD 1FH5L 3L5WA 4XPHL 3BESR 5AEAA 3JBG7 1CGVA 1Q8MA 3WLWC 5JDSA 3VA2C 4JGMA 4OFVA 1VFUA 4M48L 4ODUA 4DKEH 3KLAA 2AK4E 5KSBE 2W60B 4YHOL 4AENB 3F6IA 3B9DA 2OZ4A 3T0WA 2CO7B 3N85H 4JRYA 2EDBA 5MERB 2D7TH 4FA8A 2R9HD 4ZUSB 3L7EB 4G42A 5E2TL 3LQAC 1P4BL 1TQCC 1ND0A 1F6FB 1U8LA 4X7CC 4ZOAA 4L1HA 1O5DT 4AQOA 2DM3A 1HXMB 5FYLE 3DYMA 3O0RL 2YRPA 3GM0A 1ZT4B 3WCYA 3PJSA 1YNLL 2XTJB 2DQDL 1BZ7A 1MFCL 2YD8A 4U49A 4L8SB 3RI5K 3DRTA 4HK0B 1UB6B 3HPLA 4GXVL 1MJ8L 3WIFB 3FRPA 3TVMB 3QIWD 4NKOB 4A6YA 1KCRH 3QJHA 2X4RA 1VFBB 1MIEL 3QQ4B 3W0WD 3SDCC 5CINL 2MSPA 2ZOLA 1SYVB 2C7UA 2X40A 3KXFD 4YIQB 3H0TB 5DMKB 1E4KC 2P8LA 2BSSA 3U82B 2Z35A 1U91A 3HI5H 4OQTH 3SKNA 2ITCB 4M7KL 3SGDH 5C0DB 1RMFL 2IANE 1YEGH 3HI6H 4Y19B 5FO7A 3I85A 2DOCA 3SO5A 3IU3A 5J8OA 1G1YA 1WBXA 2FX7L 4OZHA 3BN9D 4JY6B 4RGND 3TJEL 4F15C 5GSRA 4F7TB 5FB8B 1CQKA 2B1HL 3O2DH 4YHPB 5FYLL 2XWTA 1T4KA 2XKNA 1JPTH 1WLHA 3S37X 4BZYA 3NAAH 1QBAA 4J1UB 5EH1A 1NBQA 3IXAB 3PP3K 2ZCHL 1CIDA 5F93C 5C0AA 3MFFB 5I1KH 4Y5YC 1HHJA 2A6JA 5ANMA 3RA7H 1X5FA 3UX9B 2BK8A 4PJFF 4R4BB 2CKBA 1MVFA 4O4YL 2ICWI 5CSZB 3OKOA 2BCKB 4OTXH 4JO2H 4HD9A 3DXAE 2H2SC 3IDNA 2E9IA 4G9DB 4H8WH 5E6ID 4Z7VB 5T1LD 1IBGH 4CAGA 2W9DL 1VA9A 4DKAA 3T4YA 2JIXB 5I1LB 1KB5L 2ZG3A 4PLJC 5IW1B 3D85B 1U8IB 2JLLA 2Z8SA 1KIRA 5T3ZL 2ZUUA 4LNRB 4Z8FH 4YHKL 4LHQB 1EFXB 4KRPB 1MJUL 2XZZA 4JJ5B 5T5NG 1G7QB 2GCYB 3QDMA 3WFEL 3LN5A 4GRLB 4IM8A 3QUZD 4CVWA 5FKPB 3QNYA 4F2MA 3VD9A 3X14A 1G9NH 4WRLA 5EULV 2FDBP 3PDGA 4OLWL 4YGVA 3FKUS 1F3DJ 1KJMA 1NCBH 2YMXH 2OK0H 1YDPB 2AEIT 2EDEA 4WUKH 3MROA 3QI9A 4L5FL 1G7HB 4BYHA 3MV8E 1YMMB 1PQZB 1A6ZB 2ATPA 3KPOA 4NNPL 2WLZA 4LKCB 4ZMAT 3TBTB 1UB5A 3FQXB 5BS0B 3R06B 1GIGL 3AS3A 2LE9A 5DEGA 1Q0XH 4Y16C 1WFOA 3GSUA 2AJYH 4NUGL 3K2UL 5D7JA 1CDJA 3UTTD 1DFBL 3TNNB 4JE4B 3DUSA 5CBAA 1D3CA 5I73C 4KI5C 5GHWL 2AJSH 4XBGA 2YXMA 5D1XC 3JSSA 4U6YB 2XG4A 1QR4A 2GJZB 4FQXA 4I4WB 4E0RB 3IFPB 1RQ5A 3MBED 3CC5B 3PIQA 1U6AH 1HKLL 1YJDH 4UQ2A 3VGDA 1MEXL 4PGBA 3MCLH 2R1XA 4OM0H 2JJWA 5KZCB 5T33H 4OCRL 4BFBD 1OT1A 3KPLB 4P2QE 4XNQA 3SE9L 3LRGA 3MA7A 4NO2A 1GOFA 2DKMA 5JW5B 4GXUN 5I19L 5EZLB 1NUGA 4XVJH 2E9JA 3IDIB 4L9DA 2KL6A 3SJVA 3I50H 4F7PA 3QDJD 2AXGA 1PSKH 4MD5B 1IGFL 5CFHA 4NKIL 2WQRA 2YSSB 2P45B 1FGNL 3QNZB 3OX8A 4HGMA 3B2UD 4KKBC 4EI6B 4Q97A 5IGXH 1OLLA 4ZNEA 4ONOA 3VXNB 2X9XA 4YAQA 2O61B 1DUZA 1IAOA 4Z0BH 3WIIH 4GMTH 2HN7A 4P46C 2YUXA 4H1LG 5CJOH 1BQUA 3PHOA 3ARFB 5EO9B 2CR3A 4NM8L 5AZ2H 1X4XA 1EGJA 4OD1H 3NN8A 2VITA 2ZSWB 5BMFH 2VZSA 1AD9A 4GAYA 4M61A 3VXUA 4KJWC 1JGUH 4J4PA 2JB6A 5K9OB 1U3YA 3NFNA 3DMMB 5LCVH 4HC1L 2WP3O 4GOSA 2LU7A 2ID5A 5DQ9B 4NP4L 4NQEB 1EXUA 1P2CA 4UIMA 1XMWA 4PRNB 3QQ3A 1HNFA 4JFXA 1DLHA 3CDCA 3EUUA 3OKEA 5B39G 4N68A 3WNPA 1WBYA 4RQQB 3TPUA 1K3IA 2DD8L 3JWDH 1KENL 1U95B 5MI0C 3HC0B 3OJ2C 4FZEL 3D2UD 3RWHB 3OV6A 3GSXB 1OAKL 3RVXD 2B1AL 3MZTA 1J0YA 3ARDA 3FMGL 3DUUB 3UEZA 2BNUB 4NCDA 1YN7A 2Z8WC 1ZHLA 4OD3H 3U4AA 3EO9H 4BZ2H 3IDMA 4UV7L 2VQ1A 4P2YA 4OFYA 5JPNA 4L29A 4U1JB 5ITBL 2IPUK 1VPOH 5C70A 4WEMB 4KGJA 5EU4B 1EZVX 4TRPH 2XQYG 2CDFA 5IHBA 1MRFL 1PY9A 2FNBA 4GAGH 3RGVD 3QZWG 1U93A 3G5YA 2VQUA 1MCOH 5F9AC 4FZ8L 1XF5A 4KHXL 1T2QL 3B3IA 1NFDA 5GZOD 1D9KC 4WO4D 1VHPA 2WMPA 3C6LC 1CDBA 1I7TB 3DRQB 4WIQA 2Q7YB 4BK5A 1LO2H 4OLEA 5INCB 4FTVE 4P2RE 1AIFB 3MV7B 3SDAD 3VFNB 3D5OF 4DKEL 3D39E 3P4MA 1T7YA 3G5ZA 1EMTH 2JB5H 4UNUA 3DX9A 2UVEA 5KSUA 4MZ3A 2Y4SA 4XMLH 4H20H 2D3VA 2X89A 3T1FB 1FZKB 1F58H 4PV9B 2OMBA 2OL3B 1KIPB 1LGVA 4KJYA 4S1DD 3KWWB 3IT8D 3O2WH 4NHUB 3OGCB 5DGQA 2DQCH 1I9IH 1FNGA 3KPPA 3MJ7B 3V9FA 4JO3H 1DUYB 5DS8B 4L9LC 4X6DA 4L4TD 2IPKB 3VGAB 1YECL 3FT3B 3BD5A 3BIAX 1KULA 1JHLL 3KJ6L 3FRUA 4ZUWB 4FQ2H 4P57A 1BQHA 1MCKA 1OW0A 2BFVH 3HAEB 2IANA 4N5ED 4Y5XA 1CFNA 3FTGB 2GEEA 1KCRL 1JI1A 5I74B 4H0HB 2I25N 1CD9B 2P5EB 4I48B 4G80A 3I02A 5CJBA 1OTUC 1IAIH 2DB8A 5IROA 4AEFA 1U42A 1FP5A 3SCMB 1S78D 1BD2B 3HI5L 4OQTL 1IE5A 2E9WA 2X10A 5JMRA 4MJ5A 1KCLA 1YEGL 3HI6L 2AEPH 1QBLH 1LEIB 4EQ2A 4YHYC 2Y23A 5BV7C 2WP3T 3RDTD 1FL5B 2DTSA 3CX2A 2AQ2A 4NC2B 3ULVD 1KTKE 4OM1H 4JKPH 1T7ZA 2FBJL 3O2DL 3RWFA 1JPTL 3HUJE 3DXAA 1EEYB 3NAAL 3LD8C 4OFDA 3JWOC 2ADIA 4XVTH 1I9EA 4GG8B 3KYNB 5DT1H 3OXRA 5E9DD 3BX7C 3BD3A 4Z5RA 5I1KL 5A2KH 1LDPH 3RA7L 2EEDA 4ZUUA 4X7EC 4O2EA 4Z6AT 5JR1H 4NM4H 4QRPB 1EZVY 2GUOB 4F33A 4GUPB 4LP5A 1BVKB 4E42A 3MRHB 3TO4C 4H8WL 5E8OA 2EDLA 4QGYA 1IBGL 5BRZD 2HTLC 1A4KB 5CBEB 4NQCE 2V2WA 4LSUH 1LWRA 3JTSA 3DOSA 4L3EB 5E7FA 4UNTA 1B88A 1P9MC 5HHOD 2DWDB 1NC4A 3MV8A 4Z8FL 4R6UA 2A38A 2OR8A 4NC1E 4MSWB 5IFJB 2BZDA 1DANU 1IAIM 3RVVD 2CDEA 4RMQA 15C8H 3HTLX 5IOPB 1NFIA 2WBJC 4OZGF 4GW1A 1G9NL 3VDCA 3X11B 2CKNA 3MRPA 4PJ8C 4ZOBA 2OK0L 1F13A 2EO9A 4HPYL 3FQTB 4MX7A 3GUTB 4WUKL 4QRRA 3LSOB 4N0RA 1LE9B 2VIRB 4KJQD 2B5IC 4PJEB 1MHEB 5GSVB 2QR0A 5IMKB 1QLRB 4LHUB 1LO5A 3BZDA 3RVTD 4WY7H 1QSFD 1Q0XL 1KTLA 5E24E 2AJYL 3G6DH 1T2JA 3STZA 4U7KA 4BH7A 2FR4A 1XZ0B 3MCG1 3MMEA 3N1GC 4PJ5E 4QRQA 3OJDB 3HNVH 2AJSL 5DJ2B 2H9GB 2CLRA 1LEGA 1MIMH 2YEZB 3HZKA 4P2QA 3D69A 2QJDA 5K93A 2B2XH 1LILA 2FO4B 5J1AA 2QSCH 4PRPE 1YEKH 2BVQA 4LLDB 1U6AL 1YJDL 5E94B 3VG9B 2HKFH 4FQQA 5DR5H 1AGDA 1I1AA 1JGEB 1OT2A 2D9CA 3MCLL 3QJFB 4OM0L 3WEXA 5D70L 2UYLA 2YUZA 2E6QA 4JHZA 4I2XE 3V0VA 5F9DC 4ONHB 5HVFB 3MUZ1 4HS8H 4JRXB 1I8LC 3RAJH 5IFAH 1BZQK 4J6RH 1T21B 5GZNC 1FV1A 4NBZB 2X4SB 3LQZB 1LP9F 4KTYA 4RAHA 3STLA 4JREC 5KANI 4XVJL 3E6FB 2PCPA 3V7AG 4P5TC 3ZT5A 4ZQKB 1FFPB 3B9AA 3I50L 1MSPA 5AD0A 6CGTA 1N8ZB 1PSKL 3UMTA 3JV6A 4NRXB 4WI2A 2EYSA 2NZ9C 1KCUH 2K7QA 3UPRB 5D7SL 3QEGH 4MNQB 2L7UA 1U8KA 5F1SA 3VFRA 3ULVH 5IGXL 5IMLA 1C1EH 2VXQH 1BP3B 5I76B 3MRKA 1LNUB 1OB1B 3RX5A 4XP1H 3U0WH 1KPUA 3WIIL 4JG1H 5B4MD 4ZXBC 4GMTL 4W6YB 2BY0A 4JO4H 3U6RB 1GGBH 5CJOL 5KSAD 5AZ2L 4WFFD 4WFEE 5TGBB 4OD1L 4PRDB 4RAUA 5BMFL 5FHAH 1ZT7B 1F6AA 3ZDXF 1JGUL 3FFDB 3L3HB 1Z9OA 3T4AB 1Q9KB 3GSVA 5LCVL 4FHBD 5E5MA 2VDKH 5FGBA 3GMMB 5D6CB 5HI5C 4ZPTA 4KKCC 1GGIL 1JGDB 1SJEB 1UH3A 2D31A 4E41D 5EOCJ 3W5NA 4GW5A 3PQYE 3S96A 3ARGD 4PG2A 3MRLA 2PXYA 3R8QA 1QSZA 2EC9T 5EUOA 1FZMA 1AGFA 2Y5TB 3WHE1 1R5IB 1YQVH 1F11B 3JUYA 3PV6A 5SX4H 3PV7A 1S5HB 4I77L 4H5SA 3S3JA 3PGDB 1BFOA 1CG9A 3FHQA 1XR8A 3I2CL 4OD3L 4BZ2L 3CCHA 3OKDB 1YA5A 2ARWA 4JPIA 1H3GA 1R0AH 4N8VG 1YNKH 3HZVB 5CEZD 1VPOL 4FTVA 3IGAB 1IJ9A 2APXA 2X4TA 2V9RA 2J8HA 2R4RH 3D39A 4GAGL 4ZPVA 35C8H 4BSVA 1KPVB 3RVUD 1SVZA 5FOBB 1WQVT 4MHHI 3HB3C 1J05B 2X7LA 3ZKMC 2V7NA 4NN5C 1QSEB 3VXMD 2A6DA 4PP2A 5C0BE 4EUPB 5CJQH 4U6TA 1D9KB 1LO2L 1HYSD 1EHAA 2DLTA 1HHGA 4JZNB 3BJLA 3Q6GH 2A9NH 3G6JB 3NCYP 1OAUH 1Y18B 5IIEB 1XFPA 4PGDB 3QEQE 3MRGB 1RZIB 5CUSH 4F9LC 1EMTL 2JB5L 4U6XA 3RNKB 5MHSD 3ZDXE 2R2HA 3VWKB 4XMLL 4DZBA 3WFCH 4C58B 4H20L 3NPSC 1OCWH 3BKYH 1F58L 2G2RB 4NHCH 3ZKND 4FFVC 2Y1VA 5FV1L 2W0PA 4JAMB 3O2WL 4X6CB 1MUJA 4WJ5A 2DQCL 1HXYB 2R8SH 4JO3L 3TNMB 1J1XH 4L8CB 4HXAH 5EG6C 3RQ3A 4HUXA 5GS0C 1UZ8B 2FSEA 2EXYC 5HDOA 4OZIF 4L9LB 3FQUB 3U30B 4DK6A 4KDTC 4PGEB 4U31A 5L2JB 4FQ2L 1G6VK 5DEFB 4ZAKA 1R3JA 4HIIB 4IIQB 4MCZB 3CU7A 4QTHB 2WW8A 4KGLA 3RZCC 2YRLA 4C56E 5ERWB 1Q94B 3CXHJ 1AFVH 1B0RA 4LCUA 3BW9B 4JN2B 2RIKA 3N1QC 5ELIA 2YKLH 4Y19D 5D2NC 1A0QH 4K8RC 3MZGB 1P4IL 4FQHA 3WHE0 3IETA 3F6LA 3D18A 1MJJB 1MLBB 3HUJA 3IVKB 1XGUB 2AEPL 2BP3A 4APQC 3T3ME 1QBLL 4N1HB 1I7RB 4L3AA 4JFYB 3GMRA 2C1PA 2ZCKL 3RP1A 4AMKL 5INDA 1JN6A 3VFTA 4PJXF 3ULVF 1XGPB 1ZHNA 4OM1L 5DFVD 4LSDA 4JKPL 1DN0A 5F9JA 4XP6H 1UYWL 2A83B 3MRMB 1WT5A 1FYTE 1UJ3B 4XNUH 4OAWB 3I3BA 3Q5TA 4RAVA 1QBBA 3ZZ1A 4XVTL 4MA7H 5DT1L 4NQCA 1P84K 2WWMD 3X3FH 5DEZA 1CICA 4UQ3B 2YD5A 1LDPL 4CBPA 4NQSA 2Z31C 3V7AE 1DBKH 4H1LA 5JR1L 4NM4L 1FNHA 4WUUD 3PHQB 5CEZH 3OPZH 2R23B 3H9SE 2JIXD 5LXGH 3D85D 4I1NB 3TO4B 3TYFB 3WNOA 5I8CB 1YZZA 3CX5K 5TF1H 4KRPD 4F7MB 1MHHB 4U1HB 3MRJB 2NNAB 4GRLD 1RZKH 4CVUA 3RL1A 3ZYZA 2F54D 5ESVB 2ZCLH 4U6HA 15C8L 1YEDB 4KK9C 5B39A 1X5IA 4PJ5A 4LLWA 1YMMD 4I8DA 4POZC 2VABB 5D1ZC 5IR1B 1CS6A 4XXCA 5FDWA 1C8PA 1U92B 3QFDA 1X5GA 2UWEB 4HWZB 1X5XA 1OGTA 5I75B 1R3IH 2GFBB 1JMZA 2ICWB 4WY7L 5HHNA 3BE1L 1CGUA 3G6DL 4LNVA 3NGBB 4R8WH 3HZMA 4PJXE 3KPQB 5EORH 3S5LG 1HH6A 1CK0H 4GT7A 3SGJA 3FO2A 1A7BA 3FOMA 4TOYH 5LGKA 1ONQB 4O2FA 1I8MA 3INUH 3QQ9C 5C9JB 1A5FH 3VFVB 4OCLC 2HAZA 2B2XL 3QZWA 4I18C 2QSCL 4JFFB 4MB4A 4NQTA 5F1NA 2QKIB 1YEKL 4NRYA 3BKCH 3WD5H 2HKFL 3M1BB 5DR5L 1ED3B 2VUOA 4R2GB 5C0GB 2R15A 5JLZA 1NDMA 3ROLB 3Q2CA 2FIKA 5I71C 3O6LH 5GQBA 4OV5B 2AXFA 4HS8L 3RAJL 3KPSB 4J6RL 1H3VA 2NX5E 2P4AB 1A7PH 1SEBA 4RNRA 2VZVA 3TH2T 1GAFH 5DD3H 3DIFA 2A74A 2NY0C 1FFNB 3VJ6B 4P5TB 1TVBA 4OCWL 4AY0A 4X6FA 1KCUL 4XWOD 1RJLB 1UWXH 3QEGL 2ATKA 4GLRH 4MQ7B 1KJ2B 3ZTNH 1L7IH 1ZA6B 4UT6H 3ULVL 3BP4B 1C1EL 2VXQL 3V6ZA 5I8EB 3C2SA 4HQQH 3I75A 1B0WA 4XP1L 3U0WL 1PJ9A 1S9XA 2IFFH 2OP4H 4NT6B 5JOEA 4JG1L 3UBXG 2ZG2A 4AEEA 2DYPD 4JO4L 3DVGB 4PP1C 3VXRB 3WNKA 3P73B 1GGBL 2XQYK 4WV1B 1W72H 4Y4KB 5DWUH 1T66C 1AY1H 1CYGA 3VFSB 4X4YB 1FC1A 2F8XC 5EOTA 1R3LA 5MENE 4LCCC 1GVIA 1XT5A 4D9QE 3VI4F 2HT4C 2LFGA 5HJ3A 5KS9E 2CDGA 4ZD3H 3DMMD 1IC5H 3PQYA 1NBZA 4G8GB 3T0DA 5FK9B 4MAYA 5C0CE 1WAAF 2ZKHH 3F7YA 5GRWA 3GK8H 2VDKL 2O93L 3VRLF 5GJTH 4U1NB 3ZSTA 2I9LA 3AROA 2F8VA 5FM5M 4WWKC 5K9KB 1CFSB 1JV5B 1LO4H 4HJGB 4CMMB 1SY6H 5AAMA 4PJGB 1A6VH 3PWVB 1UACH 1RHHB 2CUMA 1NFKA 2JJTA 1U8JA 1Z9MA 5BZWA 1HCVA 2KQNA 4D9RD 4D8PB 4BQ8A 2AABH 2QSTA 4R4ND 1ES0B 4NBYB 1LHZA 5DVNA 5F3HB 2W91A 2BY2A 1R0AL 3CDGB 3MGAA 5C0BA 3RBGA 4RFEB 3GSQB 1YNKL 1S9WA 1CE1L 4JG0H 2GT9A 1HQRA 1L9NA 2ZUVA 2NY5C 1BHGA 3L3IA 1W0WA 4PREB 2R4RL 3QEQA 5ESQA 1II4E 3TIDB 2FJFB 2WM0A 35C8L 3IXTB 2EYRB 4WFHE 3GSNH 2Y9RT 4PRIE 1SJHB 5CJQL 1FZJB 2ILLA 5EZJB 1W2KT 3I3DA 2Q8BH 1N3NA 5ADPH 4HUNB 3WLWD 3QRGH 1WTLA 1SQ2N 2A9NL 1OAUL 1U58B 5DJXA 2JKXA 1F2QA 3M8OH 4NN7C 4J3UA 5DC4B 1KTDB 3VI4E 2B39A 5CUSL 1F3DH 5GRZA 4MJIB 1WF5A 1RAMA 1BJMA 3WFCL 4IRJC 4ZFFA 1OCWL 3BKYL 3F7QA 1WAAE 4NHCL 4PJCF 1MHPH 3HPJA 3VRLE 3NPSB 3OB0H 4E5XA 1ITCA 3FFCE 4N0UB 2WUBH 5A2FA 2R8SL 1J1XL 4HXAL 4R97C 1A7OH 2DBLH 2FGWL 4ETYA 5FF6B 1K4CA 3TLRA 5ALCH 4G43A 5IBLC 2GJ6E 4I0KA 5C09E 5SWSD 3VFOB 3ILQC 5DGRA 2NQCA 2P8MA 4LQFH 4WI5A 1MCJA 3GBMH 4S1SH 5F7FA 3SDCD 1AFVL 1D5MA 3RZCB 4K07A 1MREH 1OP3H 2CR6A 1WJ3A 3C60A 1KLUA 5ACZB 4AK1A 4QOKE 4F37K 5MEQB 2YKLL 1A0QL 4XPFL 3MLYH 3KPMB 4Z7WB 1I8IA 1MHCB 2PYFA 3BISA 4YC2C 5D2NB 2FJHA 3O41B 1XCQA 1X7QA 3LS4H 1TMCB 2Q20A 2R0WH 1FYTA 2KDGA 3VXTA 5KOVC 4PJIF 1QRNA 1I9JH 2FZ3A 5GGRY 2BVPA 5MEPB 3VWJA 1CLZH 3LV3A 5HPMB 3MV9B 1W0VB 3U7YH 4D3CH 1IGYB 1NCDH 2YD2A 1PG7X 5HDQH 2D0HA 4OGXH 4LCYB 4QXTB 5F44A 3H3PL 2HJKA 4KFZC 1Z5LA 1AXSB 4DN3H 2XZAH 1CXIA 3H9SA 4FNLH 1U8MA 4XNUL 5IVZB 5T1DH 5DJ8B 3D48R 4MA7L 3LEXA 4QYOA 5DJDA 1EIBA 2VLRE 3QI9C 3X3FL 1DL7L 3HR5A 3AU1A 1QO3A 2DJSA 4QRPD 1GH7A 5DVOA 1ADQA 2HWZH 5C2UB 1DBKL 5DMJB 1DE4A 3B9VA 2BNRA 3WV0A 2Z31B 4H0IA 4YK4B 2H2SD 3FB8B 5B3JE 5CEZL 3OPZL 5D7JC 2R4SH 4NNYA 5LXGL 3L7FB 3AREB 4PLJD 5HVWA 3LY6A 5TF1L 4WNQA 5GGVH 1G7LA 3UTSE 4MNHA 4FQXC 1RZKL 4M1DH 2ZCLL 4HDIB 4FFZL 1UA6H 4DUXA 1OGAB 3G04A 2FEDC 4KMLB 5HI3C 1S7VA 1HILA 4PJXA 3K8MA 3MRDB 4N9GA 3TZVB 2WIIB 5HYJE 3CIQA 3CFEB 3PDOA 1D5ZA 3C6SB 5DSCB 4NYLB 1JTPA 4K71B 3MRCA 2EDQA 2FWOB 2RBLA 4LHUD 4GS7B 4KXZI 3K80A 5D1ZB 1JBJA 2HRPH 3CFDB 3U9UB 5KJRH 5JW3H 5C3TA 3LEVH 5DRWA 2DLGA 2WNGA 4Y16D 3LKRA 3LEYH 5LAXA 4EDWH 4ZTOH 4R8WL 4N8VA 4KI5D 1CK0L 1T5XB 1IQDB 5D1XD 4TOYL 4BQBA 3CAFA 1A5FL 5D7LA 5FAAA 3LKSB 5ID0B 4AIXA 4Q9BA 4PJHE 2X05A 5CEYA 4B41A 5JOPD 2NX5A 2B20A 4HK3J 1S7WB 2W0FB 5CHNA 3D1MC 3GIVA 3CH1B 5DHYA 3P11H 2OTWB 3ZKXB 4OBRA 5BVJB 3FT4B 3P9LB 1XGQA 4OZ4A 1OLZA 5MP6H 4Z77B 3S36X 2YUWA 2HVKA 4KY1H 4I13B 5C6WH 5T1KD 1P7KA 3O6LL 3WIHH 3V0WH 2YK1H 4ETQB 2OXGA 3B9KB 4WHDA 1A1NA 3PL6A 5GS2D 4J4PC 1UCTA 3U4EA 4HH9A 2A0LC 1JJUA 1ZEAH 2VZ3A 1A7PL 4WW2C 3DV6A 4MJ2A 1BFTA 4GG6F 5D1QA 1CF8H 1GAFL 2FATH 5DD3L 2DLFL 3KNBA 4XGZA 5EC2B 1JWMB 4KDVA 4MNQD 3EOAB 4I0PA 1A6AB 4PY7B 2NY0B 5GGVY 5MENA 3ZTNL 3N50A 1R5VA 4EDXB 1EBAA 4UT6L 4KKBD 5EPMA 5KS9A 1QG3A 1ULVA 1TZHB 3HG1E 3BKJH 1F4HA 4HQQL 1YY8A 4P5KB 2XXCB 3DVFA 3BEWA 3GRWA 3CDFA 3VFGH 2OP4L 2IFFL 2A73B 3RGHA 1I1FA 4NGHL 2F53A 4PJDE 3ARDC 1W72L 5DWUL 2HFGH 1AY1L 1J18A 2P48B 5FUZL 4YXHH 2LV4A 2OJEB 3U0TA 1VENA 5ID1A 4Y1AA 4PJ9A 1QPXA 1UJTA 4ZD3L 4KJWD 2E27H 5DD6B 5F7MC 1IC5L 2G5BA 1E6OL 2C3XA 1I8KB 4C83A 2ZKHL 3BP7B 1AXTH 2GI7A 4MA3A 1LK2B 4U7MA 2ENSA 5GJTL 1EO7A 4BK4A 2X1XR 3VGGA 2ZWLT 3IJYA 5E7BA 3CFBA 5EIIA 1MI5B 2Q76B 2X44D 3V4VH 4IRSC 4S0SD 5DHXB 2X41A 3W9EA 1J8HB 1NJ9A 3FB6B 3MC0A 1SY6L 2D4DA 1A6VL 1UACL 3QEUB 4NQDB 3C2AH 1WICA 3BGMA 1EEQA 8FABA 3O3UN 2AXJA 4Y2DA 1YMHB 2AABL 3QFJD 4P2OB 3VFUB 1DEEA 1HEZA 4WEBH 4K7PH 3LKOA 4NZUH 4XRCB 4JRYB 2IF7A 4M02A 2MCG1 1TVHA 4BQ6A 4UDTA 1T1XA 4PRIA 3AAZB 4GG6E 4JG0L 1ND0B 1P1ZA 4EVNB 4PJBE 4I3RH 2W0LA 1MVUA 3PGFH 4GAFB 4ELMB 1JMXA 4JN1H 4O02H 2VMFA 3DBXB 3LKPA 4MZ2A 1D9KD 3GSNL 3C6LD 4F7CB 3JV4B 1XH3A 1KLGB 2AS5M 4K3EH 1K5NA 3LPGA 3MRIA 4MAUH 1OW0C 1WAAA 2Q8BL 5ADPL 3QRGL 1OTTC 4TVPH 3I6LD 4Y5XC 3FFCA 1ZLVH 4WTZG 2HT2C 4EBQH 1D5IH 3DGGA 1L6XA 4JFHE 1V8HA 2OS7A 4Z78B 5GIRA 1D6VH 5IROC 5EFIB 3SN6N 1UVQA 3GB7B 5D96C 1S7UB 4X8XA 5IVXB 2P8LB 4GRWH 2E5EA 1MHPL 4MS8C 4IRJB 1H9VA 3MNWA 2YZ8A 5DD1H 2DQFA 4P23A 3CUPA 1G0YR 3PWPD 2WUBL 4EN3A 5DRNA 2PO6B 3V6OA 5C08E 1A7OL 2XZCH 2DBLL 3DLQR 4U1LB 4O2CA 3OHXB 3W39A 1WTGT 4P49A 3VDBA 3MO1B 4JFZH 3RWEA 5GSRB 5ALCL 4QOKA 2VDNL 3NOIA 5J6HA 1T4KB 2H6PB 3S5LA 5B38B 5FO8B 2EKJA 1WV7T 4L4VE 3UCRA 3VD7A 3QAZC 4YHIB 5TFSH 3VXOA 3P9MA 1HE7A 3GBML 4S1SL 5IBTL 3THMH 1PKQE 1QZ1A 4M3JA 2DRUA 2QQLH 4K7PY 4X6EB 1MREL 1OTUD 5C0AB 4NUJB 1E4XH 3TH3T 3O8XA 4U1GB 1CGSH 4HIJA 3VH8G 1OTSC 4DTGL 2NXYC 3VFMA 3MLWH 1UGNA 2VC2H 5DJCB 5ANMB 1C16A 5CP3H 5EU6D 1EUTA 4M6NH 3MLYL 1U2HA 5E4IA 3DV4A 1JPFB 1RI8A 3LS4L 3H9HB 5CGTA 2DL9A 2R0WL 3IDNB 4OIBA 1AP2B 1UQSA 4QRSA 3T8XA 1JL8A 4LSSH 1I9JL 3ESVF 3PXJA 2VLRA 1CLZL 3L3KA 3T4YB 4D3CL 1B3JA 1NCDL 2KH2B 3BGFC 2H8PA 1P7QA 4YH6A 5HHMB 5HDQL 4OGXL 1NCNA 2ESVA 1WFTA 5CIPH 4LVNC 3ZTJG 1HHKA 1KCVH 3BPOC 2XZQH 2DQJH 4KAQH 1HN1A 2J6EH 2XZAL 4FNLL 4G6MH 2I5YH 3QEHB 3QNYB 5T1DL 1ZK9A 2Z0BA 3BMWA 3WS3B 1NCCL 1ZWIB 1KG0A 3PNWA 1KJMB 5C07E 1CGXA 4FXGB 3UBXA 3UTSA 2FD6H 2HWZL 1T7VA 4XZUB 4NFCA 2P49B 1E27A 2ATPB 2P5WB 2EC9U 3AMLA 5D2LE 1MFDH 3TO4D 3V5HA 2R4SL 2HTLD 5D5MA 3ES6A 5D7JB 2V6HA 3S88L 4HBQA 3RWDB 3RIAF 5D93C 3SPVA 2J1KA 4CDHA 5CEXA 5GGVL 1A6WH 5DHVA 4V1DE 4M00A 3SDDC 1XF4B 5EOCH 4PV8A 4M1DL 1I3RA 4JEGB 3VXSB 4FQXB 5I1EH 1UA6L 2WBJD 4NN6B 4JQVA 4WDIB 4AIOA 2G75A 4NCC2 2GSGA 2BSTB 1I1AC 5A43C 2XA8H 4JLRA 4PJ8D 1YEJH 5FA4B 5JDJA 3B6SA 2WQ8A 1ZLUK 3QDGE 4PGBB 2I07A 1A14H 4P4KA 1FO0H 2FLBT 2FH6A 1UXWB 3LIZL 2GY5A 4NQVA 2HRPL 5HTSA 4PJHA 2CSPA 2JJSA 5KJRL 3LQAL 2NY1C 4NO2B 5JW3L 3LEVL 1LD9A 5JXEA 4LCWA 3L3JA 3LEYL 1FC2D 4EDWL 4ZTOL 1MY5A 5IQ9B 5IVOA 3SE8H 1CLYH 4QHMB 4I5BB 3F8UB 3WHXB 4OCSH 3D87B 5C0FB 4M62H 4J2XA 1IEBA 4UV4H 4YXKH 4YAQB 1DUZB 1LE5A 2NY4C 5BQ7B 5DZNA 1JWSB 3P11L 2MOVA 3FAXA 5IB4A 2XFXA 3EO1A 3V95A 4KUCD 3KPSD 4D0BA 4KY1L 1G6RH 3WIHL 3V0WL 2YK1L 2DIJA 1FL3B 4OCYH 5GZND 3HG1A 1S8DB 3OJMB 2GJJA 3PWUB 4ODHH 4P48A 1QACA 3QPXH 1IAII 3ARVA 4P5TD 1NEZG 3MNZB 1CF8L 4PJDA 2ED8A 4WW2B 4LK4A 4OGYH 1XIWA 5DD5H 5BV7H 2IMNA 3D0VA 2NZ9D 5BZDB 5I1AA 4XAKD 3H7LA 3S4SB 1JP5A 1X5JA 4GBXB 1IEAB 4JFXB 3GJFA 3CVIH 1F8TH 4PG2C 1WBYB 5F7EH 3TPUB 3BKJL 2PXYC 1QOKA 4JDTH 3VFGL 1RUKH 5GGRA 4ZXBD 5JHDD 3H3KA 4ORGB 2VERN 3JWOH 2HFGL 4YXHL 3DHMA 5L8KB 1X5YA 5J56B 1T0PB 2V7HB 4AL8H 4JY4B 1WITA 5H37H 2AJZB 1F42A 4JFEE 1CT8A 3O4LE 1AGEA 4M5YH 3U2SA 1KNOB 5JPNB 1U3ZA 2M1KA 3N06B 3OR7B 1AXTL 3CLEH 3D25A 4CN4A 1ETZA 2E7CA 5HI5D 3GMOA 2AK4B 5KSBB 4X4XB 2FH8A 1T1WA 4KKCD 4Y4FA 3P4NA 1N5YH 1HK6A 1XF5B 2GITB 2C26A 3V4VL 3MR9A 4IHOA 3GMNB 4GG6A 4IRSB 3FN9A 4WW1B 4RBPH 3C2AL 5J7CC 2W65A 4MNGE 5EBMB 4PJBA 3ARYA 2L7JA 1MCRA 3GJFK 2VN4A 4X7FC 3HMXA 2VLLA 1RHFA 2F19H 4WEBL 4K7PL 4NZUL 5KSUB 2VTFA 2DQHH 1S9VB 4PB0H 1VSCA 2WINB 2HFTA 3F7RA 1S7RB 1K6QH 3QXWA 4OFIA 2EEBA 3LDBC 4J12A 1HHHA 1RIHL 2V17H 1PYWA 4U7SA 3G5XA 3RTQB 4I3RL 3BRFA 3PGFL 3U0PA 4UU9A 2OSLA 5ITFB 4JN1L 4O02L 2YD3A 3HB3D 3ZKMD 5IB3B 2Q7NA 4W6XB 5IW6B 4H8WC 5HGBA 4K3EL 4MAUL 4Y4HA 3EZJB 2RB8A 1PKOA 1NAMH 3T0EE 3GMLB 1A9EA 4TVPL 1EAJA 4PG9A 3SO3B 4CJ1A 1QUNA 1SM3H 1KB5B 2AVGA 4Y5XB 4EBQL 1D5IL 2EIZA 3BVNB 1H8OA 2LU3A 1KXQE 3JVGA 4X5LA 1TJIH 5DRZA 1D6VL 2GK0B 1NUDA 3I02B 4DK3A 1FG9C 2UZYB 5AYUH 4LOUC 1MWAH 1G9NC 3T0BA 3P0YH 2YPLB 3MJ8A 4FFVD 4ZSOB 2GKIA 3WUZA 4M1CC 5D96B 4X9HA 2AEWA 3QO0B 1Q1JH 3NCYS 5DD1L 1BBJA 4MJ5B 4QNPF 2IAMB 4HLZH 2QADC 3TCLA 1T20B 4JHBA 4L4VA 4HFWA 1I4FA 3MBXH 1X44A 3W9DA 1A6TA 5GS0D 1TTUA 2EXYD 1CLOH 5D71H 5J6GA 1SBSH 1AKJB 3SY0A 3EDDA 4AT6B 3TCXA 3EIFA 4D0CB 1G7IA 4YHLH 1G7MB 2DQTH 4JFZL 4Q9RH 2W9EH 1FIGH 1IAMA 5SWQA 4M8QA 5FA3A 5SX5H 2NW3B 5A16B 3SKMA 4MQXC 5J3HC 4WTXA 3RY6C 3RZCD 3QCUH 3VMNA 1EERB 3HHRB 1A3LH 5TFSL 2FECL 3E8UH 4OT1H 1GXEA 3O45A 3WKMH 3DARA 1M4KA 3QAZB 2CQVA 2QQLL 1CICC 1E4XL 4YWGH 1OHQA 1CGSL 1CFQB 4N0FA 4NC1C 3MLWL 2VC2L 3BZEA 4K8RD 4M6NL 4ZUUB 1F4AA 2NXYB 1CL7I 4APQD 6FABH 3E3QE 2N1KA 3N1PC 3VG0H 5IHZB 5HD8C 1Z6JT 3MV9D 2A6KA 1SJVA 4LSSL 4KJPC 1ORQA 3MV11 2LQRA 5C07A 4ZO8A 1A1OB 2QQKH 3BQUB 3EFFA 2X5PA 5DMYA 1KCVL 2ZUTA 2XZQL 2DQJL 5D2LA 4KAQL 3UAJC 4LVNB 1A8JH 3MRFA 3ZHDA 3WFHB 3BPOB 4G6ML 2F74A 5H35B 2A6IA 3OR6A 4RIRB 2DQIH 1YN6A 4XXCC 4MX7B 1BFVH 4JM2F 2Z31D 3R4DA 2PUQT 3QUXA 4QNPE 5SWZE 1JCKA 3RFZC 1QEWA 1MFDL 4TNWF 1I3UA 2CJUH 1MFBL 3D6GA 3STZB 2W1NA 2XWJB 4IMLA 4PJFB 2HMIC 3ARRA 1QFWM 5D93B 1E4JA 3CJJA 5EOCL 2OQJA 4RGMB 1AO7E 3SEPA 1JNHA 3SDDB 5J1AB 5I1EL 4KK9D 2ZOKB 4GKSB 4QT5A 5I18H 4U1MB 5I1DA 4UB0H 1GHFH 3JWDC 1YEJL 2AQ3A 1TCRB 1B0GB 2Y72A 5C0JA 1AGDB 1I1AB 3GZKA 4POZD 5DJZA 4P2CG 3TN0B 1X6NA 5EU5B 4DCQA 1A14L 5D1ZD 3C5ZB 4LRNH 1FO0L 2C4XA 4EI5A 3EJZC 1FVEA 4HKJA 1J9CT 2VLKB 4G9FD 5HYSG 1YPZE 2YA2A 3J7HA 5CD3A 4P0DA 2BVTA 2NY1B 1Y6MR 3QIWA 4HKBA 3GI8H 3O4OC 5C0EA 3OAUH 3SE8L 1PZ5A 1CLYL 4CU7A 2RFXA 4IDJH 1RULH 4RMVA 2DLHA 3QQ9D 4OCSL 4M62L 5EBLB 4UV4L 3TT1H 4YXKL 3KPNA 1BREA 3IDGB 3CVHH 4GKNB 4JFDE 4ODWA 5AAWA 1IM3B 4EIGB 2YRZA 1HSAA 4OBSA 4OCYL 1H3UA 2BNQB 3CFKB 4OCMC 4ODHL 1PGRB 4LLYA 5BJTA 3VFPA 3QPXL 2HH0H 1ZKAA 3KHOA 1MH5A 5D7IF 3O3AA 3V79C 4LF3B 2DWEA 2NY0D 1BZ9A 4AEHH 4A2LA 1U8PA 4OGYL 1GC1H 5DD5L 3S3PA 5BV7L 4YNYA 3G9AB 2SEBB 4M93C 1IILE 4JFEA 3ZSSA 3O4LA 4YE4L 4MJ6B 1CD8A 3CVIL 1F8TL 1J0HA 2JJTC 4X0KB 2D31B 5F7EL 1D5XB 2VH5L 3D3VE 3BP5A 1JTOA 1T22A 4OFKA 4QHNA 4YQXH 1TVDA 1SJXA 2VXVH 1CDHA 1RUKL 4N90D 1ZT1A 4H25B 5E6IA 4PP1D 1I3VA 3OB8A 1AGFB 1T66D 2B7DT 4AYFA 3JWOL 2CRYA 4AL8L 5HVHC 3WE6A 1EO5A 3QO1B 5I0ZA 4RZCA 2HT4D 1CG9B 4JJHA 3G6AB 3CCHB 4YBQC 5FYKU 4M5YL 3IJHB 5D7KE 5T3XH 3IDYC 5GRYA 5EO1B 5JPMB 1E4WH 5KG9B 3FO0H 3O6MH 4HKXB 4ZS6C 5DJ0A 4MNGA 5DDHA 3TIEA 3CLEL 3VH8A 4P2RB 1HCFX 2XN9D 4R90H 4HG4J 1MI5D 4MB3A 4DZ8A 1X5AA 4WWKD 3ZDYF 3GSWB 4Z9KB 1J8HD 2CD0A 4MCYB 2R2CA 1N5YL 1F5WA 4M6MH 4U1IA 5CD5C 4JO1H 5E95B 1W0YT 3WDJA 3ZE0F 5CJ5A 4M5ZH 1VFOA 3BRDA 4G7YL 3DO7B 1N7MH 5L8LB 1TETH 3CZFA 1RV6X 2VDQL 4JRYD 5TH2A 2EDNA 2F19L 5J9PB 5L2KE 1TQBB 2F5BH 4PB0L 3TM6A 5L7XH 4HAGA 5D7IE 2V5TA 1K6QL 2F58H 2VSCA 3CX5J 1F45A 3T0EA 1S7XA 1ZS8A 4URTB 2V17L 2VE6B 1F4WH 1QVOB 2Y06H 4OUUA 5E56A 4WJ5B 3P4OB 3EO0B 2XIDA 4XCNA 3KR3L 2IADA 3VGHA 1AC6A 5ISZE 2FSEB 1DQQA 5CSGA 1WWBX 5CJXA 3OQ3B 3FONB 4LMQE 4HGWA 3SOBH 2VDLH 1NAML 2D7MA 3G5VA 3UPAA 1V05A 4P3CH 3AB0B 4YDVA 4OLZL 5JOFA 1FNFA 1SM3L 1BGXH 3QUKA 5F96H 2VZTA 4KQ4H 5J12B 4ZDHB 2ICCA 2AP2A 1CXHA 1TJIL 4JDZA 3C60C 4IRJD 1BVLA 4NKQB 5AYUL 4EKXA 2J6EA 5E1HB 1MWAL 4NZJA 1X5KA 2XICA 2YD1A 1P6FA 3P0YL 1MELA 4WI7A 3KYMB 5IEKA 4XP9H 4WWID 4AH2B 3MBXL 2A2QT 3VWJC 2QADB 1IGJB 1CLOL 5D71L 1SBSL 3UTPD 4B7IA 4PJ7B 5INDB 3RWCA 1A21A 1IKFH 2CK0H 4YHLL 2DQTL 5IBLD 1ZHNB 4Q9RL 1FIGL 1U8OA 3ZE0E 4MDJA 5F9JB 3FCTA 3NZ8B 4L3CB 2OTUB 3JTTA 1IL1A 1DDHA 2H32A 4GLRI 4MXVF 1J0JA 3ILQD 2YC1A 3TBYB 1CDGA 4U3HA 2PYEE 3QCUL 5KBNC 5C0AD 1VCAA 1A3LL 3E8UL 4OT1L 2R2EB 3WKML 2J5LB 1A4JA 3C8HA 3I6KB 2IALB 4R7NA 4JFPB 5HXMA 3DX8B 2ZSVA 3EOYG 1CICB 1NGWA 3X13A 1CDUA 4NFBA 1BEYH 4RCAA 5DLMH 3D2UA 6FABL 3OKMA 3VG0L 2Y7QB 5E2UH 3MGTA 1CFBA 3W0WB 2P8PB 3BP6B 3AUVA 3O3BA 1Y6NR 1I9RH 2NTFA 3KXFB 1K4DA 2VDPH 4JFQA 4XC1H 2CUIA 4PRHE 3GSOA 1GZQB 3VFWA 5I8KH 2QQKL 2R2BA 1NMCC 1NEZA 1JYWA 4F7EA 5E00A 4E41E 3QDMD 4K23L 1U8HA 3QWOB 5SWZA 5GXBB 3HNTL 1T2XA 1M71B 3M07A 1UH2A 3U48A 4K7FA 4OLYH 5GGSY 4R0LC 5GGQH 4JANA 3WO4C 5JZ7C 5C0RH 4RGNB 3QI9D 2OZ4H 4KDWA 1FVDA 1K3ZA 2DQIL 5M94B 4FXKA 4G8EA 2HVJA 1BFVL 2PW2A 2EC8A 3FN0H 4WTWA 1JPGA 1NLDH 4LVHC 1FZOA 5IKCB 3HMWH 4I3GA 5D7JD 4PRPB 5TE4L 3QNXA 3SDAA 1G6RA 1RJZA 2DTML 4J3OC 2NY5H 2IBZY 3HZMB 4U2ZA 4WU5B 5IK3B 4PJAF 3LMJH 5F88A 4I2XB 2AV1A 4MXVE 3V4PH 5CWSB 4FQXD 1SYSA 5CCKH 1H3WM 3RBSA 5T1LB 1YPZA 2G9HB 2FEDD 5HI3D 4A6YH 5I18L 4UB0L 1GHFL 3I3EA 2MHAA 1F3JB 2ARJB 2E7MA 1O7VA 2E3VA 4L4TA 4U6VH 1H15B 1NDMB 2VLJE 3ROOA 5KW9L 5DUPH 1WIUA 3DVIA 4LRNL 3PL6C 1AGBB 1J86A 2AXFB 1A64A 3QUZB 1A9BB 3EHBC 3RKDC 1HQ4B 3NZHH 4OZGB 5D1QC 5FM5O 2H2PC 3SJVD 4BH8A 3C09B 2XTJE 4YUEH 4F80A 1UT9A 5FYKD 3B83A 3DIFB 4I0PC 3OAUL 5DTFB 4JM2A 1IRAY 1ZHKB 3O4OB 1ZGLB 3Q0HA 1GZPA 1TVBB 2VZOA 5D72H 5DK2B 1DCLA 4IDJL 1RULL 4YPGB 4BSWB 4X80H 5E8DL 4NQXB 2Z4QB 1P69B 4XMKH 4MLSA 2OM5A 2J3SA 2LTQB 2Q86A 1S7SA 3TT1L 4QF1B 3OKKA 4IS6A 3WNLA 3P0VH 1WISA 3UTTB 3CVHL 5T1MA 1H3XA 3OTTA 3K4ZA 3VRIA 1TJGH 3VW3H 5EOTB 5EBGA 3REWB 4Y8DC 1QHOA 2CKBH 4J4PD 3PWLA 4EOWH 4JPKL 3RVWC 2X4NB 3DX7A 2A0LD 2IH1A 3MBEB 4LIQH 3HCVA 3D3VA 4K8RL 4K9EH 4N0CC 3EGSA 2J2ZA 1KOAA 3QULA 4AEHL 4YBLC 3LRSA 1GC1L 2RR3A 4XVUC 1VGKB 3ISWA 4HSQA 5DYOA 1BIIA 3EYFA 3CXHK 5DK0A 1TDQA 3EYSH 4M43H 4NKDA 5C0IB 2DM2A 4CVZA 1LP9B 1HI6B 4CGTA 4TN9A 2VXVL 3ZYIA 4JB9H 2BMKA 2J12B 3QDJB 2D7QA 3ARDD 2Y5EA 5ETUB 3GHBH 3WDHA 3PGCA 1FG2A 4IEFB 3NIFF 4ZFOL 4HZLA 5TDNB 3RHWF 3ULUH 4H26B 3IDJA 2N4IA 5T5FH 1G7PB 5GS1A 3CK0H 5HHOA 3TYGH 5HVHB 5DFWH 3TBVB 5KTEH 1VKXA 3I6GB 5T3XL 3MJ9H 4Z7VE 3RI5F 1E4WL 3O6ML 3FO0L 3GMPA 2VRAA 2EH7H 2GT9B 3V52H 2AK4D 5L6YH 1JNLH 5KVMC 3QXAB 4DVBB 1T5WA 4R90L 1XGTB 5HHPA 1F97A 2HFEA 4RFNC 3QEQB 4U4BA 3S9DB 1ZHBB 5HGDA 3QYCA 5L2KA 5DI8A 5TE7H 4M6ML 4IRSD 4NRZA 1Q9LA 3ET9F 3BWAB 3WDIA 5D7IA 1MAMH 2VYRE 4JO1L 5I2IA 2Q6WA 4M5ZL 1F6LL 3QUMA 4NSKA 3UP1A 4QTIH 2X70B 5FYLD 2FCBA 1N7ML 3LCYA 3TV3H 4KWUA 1TETL 1WBZB 1BMGA 1UWEH 3IFLH 4LVEA 2AERT 2IEPA 2X89D 5ISZA 2F5BL 3C8KB 2X4QA 2ARJQ 5TE6H 5BS0E 4WENB 5I30H 2AXHA 5L7XL 4ZFFB 4Z0XA 2F58L 1JF1A 2DDQH 3F12A 4P23C 3EDJA 5DC0A 4EN3C 2BERA 1F4WL 4E5XB 3GDBA 4LFHG 4OGAC 4C56B 3IFNH 5FYKH 3QA3A 3P77A 1HWHB 3RWJA 4XXDB 3LN4B 2IAND 3PWNB 3SOBL 2VDLL 1OTTD 4P3CL 1WSST 4OD2B 1L0XA 2HT2D 4KUZH 1BGXL 5ENWA 3RGVB 3UXFA 4XAWH 1WWAX 4RMRA 4KQ4L 1EAPB 4X98B 3PP4H 3TWCH 1RZKC 2NW2B 1FPTH 3N1FC 5CMAB 1EGJH 3O8XC 4WO4B 5F72S 5FKAB 4Q2ZA 3LKNA 2P44B 3LAFA 4PRAB 2H26A 4RWYH 4X9BA 1N2RB 4MS8D 4LRIA 2BC4B 2IAMD 4L8DB 5HGHA 3B5TA 3BUYB 1AE6L 4GRMB 4R7DA 3GGWA 4XP9L 2PYEA 1MPAH 4OZHF 5I6XC 4HXBH 1H5BB 1RZGB 3HS0B 1FLTX 1OSPH 1ITBB 5F3BB 3VWJB 1D7FA 5HYSA 1IKFL 4WU7A 3DXAD 1BM3H 4MA1C 2BVOB 1WZ1L 1J88A 2YXFA 1Z5LB 3SBWA 1BFSA 3CSYA 1PD6A 1H8SA 4Q9QH 4OZIB 4KPHH 1NL0H 1CD1A 3GMQA 5TPWH 2CLVA 4PRHA 1OTSD 2NXYD 1JZ8A 5DO2C 3Q48A 3ZYJA 4W81A 1OF2A 3BO8A 5FIEA 4E41A 5ESAB 1FFRA 1RK0A 4O58H 4P5MA 1BEYL 2KKQA 3LKQA 5DLML 5IV2A 4DUWA 4G6FB 5LQBL 3EOBA 5E2UL 4DAGH 4NQEE 5FO9A 3MUY1 1S3KH 4NNYB 3QHTC 1R5WA 1I9RL 4G8FA 1KV3A 3BIKA 1U8QB 2VDPL 4OI8A 4XC1L 4GKZB 1VEMA 3MV8D 1VFAB 3MJ6A 5FM4A 5I8KL 2XV6B 3AM8A 5HDLA 3NA9H 1BOGB 4MNHB 3QIBA 2QTEA 5IEHB 5J13C 3KAAA 4JQVC 1C5DB 1D6EB 4LEOB 2MPAH 4OLYL 3RDTB 1SEQH 4JM4H 5GGQL 3ULUF 1QLFA 5KN5A 1GPOH 4R0LB 5C0RL 4EJ1C 2YN5A 2OZ4L 3WO4B 1JNNH 4N9GB 4OKVA 3VD3A 5EO0B 3FN0L 4F3FB 5IQ7H 2JJSC 2FHBA 1P5VA 5JXEC 3HMWL 1KXTB 2EIEA 2W60A 4AENA 4FQ1H 5E9DB 3LKRB 4PY8I 2NY5L 1YYLH 1D5BB 4ODTH 5F1KC 3L7EA 4P2QD 3LMJL 2VLJA 2YD7A 4Z7UB 2M26A 3BI9X 3SDDD 1RVFH 2VR9A 4MXQC 3MV7E 2CIKB 1Z9LA 1HXMA 2OI9C 5GGTA 5BRZB 5CKAA 3B8SA 1ZT4A 1I1AD 2H41A 4A6YL 3QG6B 1UH4A 3AXLB 4QXGH 5DC9B 4U6VL 1VADB 5J11C 5AG8A 4HK0A 1A1MA 5DUPL 1RZ7H 2HVKB 3IYLW 1UB6A 1ZA3A 4LGSB 3WIFA 1E28B 2CIIB 3TVMA 2NY1D 4NKOA 3NZHL 2C5DC 1VFBA 3QQ4A 2DI7A 3RJDA 4KV5F 3K1KC 5CP7B 3HE6C 2WK2A 3FO9B 4YUEL 1SYVA 1XIWC 5I66B 3QQNA 5DMKA 4OF5A 3CZJA 4BUHA 4RGOH 2D7NA 2ITCA 4XMKL 3EZ8A 1BQHG 3L5XL 1T1ZB 2BDNH 3QIUC 4HWNA 5HYEA 1QSFB 3ULUE 3P0VL 5IB1A 5C0CB 2NY4D 3BEWB 2P5EE 3A6BH 2BXZA 1T6VN 4Z7NE 3V5DA 3O11B 4JY6A 1AD0B 1TJGL 4F7TA 5FB8A 2CO6B 4YHPA 4N1CA 1BD2E 3VW3L 3QCTH 4ZO9A 2CKBL 4EOWL 2WZPD 2XQBL 4LIQL 1E4XI 2CGRH 2G5BB 1NGPL 4K9EL 5K59F 4MA3B 3V2AR 1KN2L 3QH3B 5D9SA 1TZGH 4R4BA 5TDPB 3S35X 3ZHKA 4WFGE 2EDWA 3EYSL 5CSZA 4LASH 4Y5VB 1N0XL 3REVB 2PXYD 3W9EB 1LQSR 1NJ9B 4G9DA 4Z7VA 3O9WC 4QLRA 4EUPG 3HZYB 3L3OB 4JB9L 2J8UB 4JZJB 5JIKA 2O26U 2JIXA 1KELH 3GHBL 3D85A 4JY5H 5IW1A 5GRXG 4HS6B 3HR6A 1U8IA 2FL5B 2QSQA 3ULUL 1G7JB 4LNRA 2EYTB 1EFXA 4NDMB 4JJ5A 3CK0L 1G7QA 3TYGL 3NH7H 5GRUH 5KTEL 1VEOA 2PETA 4GRLA 1OQOA 4FTVD 4CU8A 5K9JH 5FKPA 4UDTB 4KV5E 4P2RD 2CXGA 2W59A 2EH7L 2PTTB 4OSUH 3V52L 4CL7A 1JNLL 1P1ZB 3D39D 5KSAB 3FB7B 2IG2H 1CGWA 1YDPA 2QQNL 1KGCE 1M7DB 1AQDB 4L3EE 1G7HA 4XHQA 1NFDF 3NIGE 4K94C 1EEZA 4F9PC 4IOIA 4RFNB 5TE7L 2FO1A 4Y4HC 4LKCA 3ALWA 3FQXA 5BS0A 3R06A 1K5NB 5F89A 3S3SA 1MAML 2V5RA 4YZFF 5LJYH 3NCMA 1OWWA 1BWMA 3TNNA 4QTIL 4UAOB 1UWGH 4KK6C 3IU4H 5IMOB 3TV3L 3JVGC 1UWEL 3VXUE 3IFLL 4AEIL 4U6YA 2GJZA 4KU1A 2I9TB 4YXLH 4FFYH 5I30L 4I4WA 4E0RA 5DVKA 5K59E 3CC5A 2GJ6B 4QHUB 1DQMH 1Q9WB 2E6JA 3C5SB 5C09B 4LPVA 3OKYA 5J57B 4KQ3H 2D03H 4X6DF 3CD4A 3UDWA 1S9YB 2XOTA 4ODSH 2JK5B 2BY3A 4EXKA 5FCSH 3IFNL 5FYKL 3KPLA 4RDQF 4QCIB 4XCYB 1JTTA 1FORH 1DP0A 5JW5A 4HWBA 5EZLA 3GSRB 4D0DA 3DROB 4RFOH 3BZ4B 4PTUB 5LBSH 5E2VH 2VLME 4KUZL 3QDAA 4MD5A 4XAWL 4ELKB 3TWCL 1FPTL 3P9MB 1KB9J 1EGJL 4JRXE 1IMHC 3VXMB 5F8QC 4EI6A 3FN3A 2Z93A 4CADA 1HH9B 4LOUD 2MCPH 3VXNA 3MGOA 2GTZB 4RWYL 3VD4A 3VFMB 4M1CD 3K46A 5L0QC 5HGAB 1QNZH 2MKWA 4KXZH 1RUQH 3DV4B 2QADD 5EO9A 3ARFA 3BMVA 1NFDE 3T77B 1OWRM 4ZUTB 1MPAL 4QRSB 4HXBL 4J3XA 3T8XB 1OSPL 1FVCB 2ZSWA 1VACB 5I6XB 3L3KB 4PLOB 4ERSH 3MLUH 1UZ6F 4LVOC 4PJCB 4PD4J 4YZFE 1KSRA 5K9OA 1P7QB 2A77H 1JF5A 3RHWK 1IT9H 2R1WB 1OAQH 5FXCH 3DMMA 5B22A 3BDYH 1BM3L 4BSJA 3BPNB 4M9OA 4MQXD 5J3HD 4F8TA 2AV7B 1G0XA 5DQ9A 4ODVH 2VDMH 4NQCD 4NQEA 3K4AA 4R26H 4Q9QL 2H3NB 1NL0L 4KPHL 1TTFA 1CICD 5TPWL 3MRBB 3MTRA 4X6BA 1JE6A 4RQQA 4F8QA 5ICZB 4HCRA 1N4XH 1U95A 1JYNA 3HC0A 5EU7E 1CDYA 3RWHA 4X6DE 3GSXA 4DKDC 5K9QG 4O58L 2UV3A 3CMOH 1BECA 2UVFA 3KYKH 5HD8D 1CTOA 4TUJB 3DUUA 4ORZC 3NACL 4Q6IB 1S3KL 2BNUA 4KJPD 4NZRH 2NY6C 5DQJB 4IJ3C 3MOBH 1JPST 5I15H 4Z95H 5HYJB 3A0OA 5DQDH 2F8OA 3QRFM 4U1JA 3NA9L 5EU4A 1T89A 2D4FA 2MPAL 1NGZA 4UT7H 1FQ9C 3AFLA 4PJIB 1KIQA 4S0TD 1SEQL 4JM4L 5KVFH 4PJ5D 5FGRA 2WANA 1GPOL 4JCMA 2VAAB 2OR7A 1KBGH 1JNNL 1I7TA 3DRQA 3RY4A 2Q7YA 5E8NB 4EI5C 5DJ6B 5INCA 1PEZA 4NFDA 4N5UA 3RUGB 4F58H 1NPUA 2ZPKH 5IQ7L 4PRPD 1AIFA 3MV7A 3V5KB 3UYPA 3VFNA 5BXFB 1G84A 1W72B 5SV4A 4FQ1L 1LD9B 4PR5B 1WVZA 3BSZH 3ELAT 3BPLC 1YYLL 3KVQA 2ICEB 4ODTL 1UZ6E 4UBDC 1QSEE 1F00I 4LDOB 2YPKB 1FZKA 3T1FA 4PV9A 4PPTA 2OL3A 1KIPA 3ARBA 2HMID 4WEUD 2FB4H 4GKOA 1QFUH 1T6WA 3KWWA 1RVFL 2EO1A 4WUUB 3X12B 4NHUA 1IEBB 4XCCH 4G6JH 3MJ7A 5B3NA 1DUYA 4TQEH 5DS8A 2IPKA 4XB8A 1LE5B 3H7BB 5LGJB 2OI9B 3F58H 4QXGL 4TYUA 2HJFA 3FT3A 2AKRB 4LLMB 4IOFC 4HIEB 4ZUWA 2XFXB 5I1GH 2CRMA 3S37H 2DQEH 1RZ7L 1MOEA 3EJZD 2F54B 3AC0A 1RFDH 3HAEA 4LLQB 3OG6B 4JHAH 2PW1B 3FTGA 4BFEA 3HG1B 1A47A 2P5EA 4AIZB 1GOHA 1ODAA 3Q5OA 3DYOA 4WFED 3MJ9A 1N59B 3HE6B 4TTDC 3ARQA 3SCMA 1BD2A 1BJ1J 1C12B 4RGOL 4OI7A 1TZIB 1E4KA 3UTOA 2BDNL 5E5RB 2FJGB 1LEIA 2JE8A 3QIUB 4QRRE 2K9UA 3HA0A 1INQB 1FL5A 3A6BL 3GSNB 3U7AA 5I0DA 43CAB 4JKLA 1BF8A 4LMQI 1IARB 5FGCB 1SMAA 3PQYD 3QCTL 2X4PB 3FHAA 1QFWI 4H1LH 1EEYA 4NNXB 2CGRL 3U2SB 4GG8A 3FQRB 3C5JB 1ETZB 1KFAH 1L7TH 1TZGL 3T0XA 2EDHA 4QRPA 2GUOA 1T1YB 4LASL 4GUPA 1QQDB 5IW3A 3TBSA 1BVKA 5F8RC 3MRHA 1XCTB 1V3KA 5EUOF 3ECBB 4GG6B 3BRGC 1A4KA 1EDQA 5CBEA 3O9WB 4PLKC 1KELL 4JY5L 4K55A 4PB9L 1V7MH 1WC7B 4L3EA 1NDGB 4DVRH 4NJ9L 2VJXA 2DWDA 4MD0A 1EJOH 4FMKA 1UCBH 1NLBH 5C0BD 4MSWA 5IFJA 1PX3A 4YBQD 5GRUL 5K9JL 3T0EC 5IOPA 1PW3A 4LARH 3JWNC 4ZS6D 2DYPB 3X11A 5JIPA 1HSBB 4OSUL 25C8L 3WN5B 3QEQD 1WZKA 3IS0X 2P47B 1PYWB 2IG2L 3GUTA 1CR9H 3FQTA 3LSOA 1XEDA 1LE9A 2VIRA 2OSLB 4OJFH 3GJEB 4PJEA 5GSVA 1MHEA 5CJXC 1T3FB 5IMKA 4NIKB 4UI2A 3LVEA 3BPCB 1QLRA 5CD5D 2C3GA 3MFGB 4QHLB 4Y4HB 4X5WB 2GYSA 4D9LH 3V6FB 4QY8B 2DLEA 3F7VB 1XZ0A 4HGKC 3TA3C 5C92A 1S7QA 1UWGL 5DMGC 5T5NF 2H9GA 5C08B 1BLNB 4QHKJ 3A67H 3U46B 1ZE3C 2UWEE 3L9RA 2FO4A 4YXLL 4FFYL 4LAQH 4TUKH 5IG7B 4LLDA 5E94A 1DQML 4NO3B 1EUUA 2R56H 1Q9OA 1AI1L 4BZ1H 4C56D 4KQ3L 1JVKA 1JGEA 2D03L 1BBJB 3QJFA 2E8ZA 4ODSL 4XPTH 2DJUA 1FN4B 1A6TB 4YHZH 1XGRB 4ONHA 4JRXA 1PKQB 3MREB 4YX2H 2M8XA 1T21A 5EUOE 3KS0J 1FORL 5FYJH 2X4SA 3LQZA 1G7IB 4JFFE 5I9QC 1AHWB 1AJ7H 1FSKC 4RFOL 4LDLB 5FA3B 3E3QC 3DX6A 5LBSL 3H42H 5E2VL 4ZTPH 5HHQB 5LG1A 3NFSH 4NRXA 3UPRA 3JZ7A 4MNQA 3C60D 3SDYH 1KC5H 3CFJB 3PG2A 5I76A 1MNUH 5EN2B 1OB1A 1ROWA 3HUJF 3ARTA 3MQIA 1QNZL 5I1IH 4KK5C 4U33A 3O6FA 1FYTD 1RUQL 3N85L 3U6RA 5CGYC 3WS6A 4J3TA 4XMPH 4NZDA 3MLSH 5DK3A 2D7TL 32C2B 3VWJD 4J7RA 1K8DB 5TGBA 2V9TA 4KHTH 3BXNB 1ZT7A 4M6OH 2HFFB 3O2VH 3MLUL 2VL5B 1ZV5A 1TQCB 4LKXB 4G8IA 1UFUA 3L3HA 2A77L 3T4AA 1Q9KA 1OAQL 3FB5B 4NOFA 2JELH 2H45A 1F90H 3H9SD 1A7QH 3GMMA 3VXRE 4HUWB 5JW4R 1A22B 5H2BA 3D0LB 4HJJH 1WIOA 4G6KH 4ODVL 3T65B 2VDML 3FZUC 3FOLB 3SKJH 2APVA 1JGDA 1SJEA 2WSKA 1N4XL 4G8GE 5SWSB 1FDLH 5KOMC 4G6FD 4V1DB 3CMOL 4M7LH 3DETC 1BWWA 1R5IA 1F11A 3KYKL 1S5HA 1QEWB 3SDCB 3PGDA 2BHYA 1RZ8B 4NZRL 5E1AA 3OKDA 3MOBL 5ICYB 5I15L 1IAKB 3DVNB 3QDGB 4Z95L 2C3VB 2NY6B 3ZE2F 4PJGE 1J8KA 3HZVA 3P30H 5DQDL 4IJ3B 4P3DB 3DI3B 2YN3A 2YOCA 3IGAA 2I27N 4ZUVB 3BEVB 4YDJB 4UT7L 4FMFA 2ZZUT 4LPTA 5AUMB 1V7NH 1KPVA 5JZ7D 1QTYT 4LSVH 5GGUB 5FOBA 3VE0B 2UUDH 1J05A 1VDGA 5I1DB 4BKLA 4QO1A 5F6HI 4F15B 1QSEA 2VSDA 2AK1H 1KBGL 4EUPA 3IAQA 3N0PB 4POYA 3BWUC 1D9KA 2BRRH 2CH8A 4JZNA 1SBBA 4EI5B 4F58L 2ZPKL 4I3SH 1F4YH 4R4FH 1Y18A 5IIEA 4PGDA 1EO8H 1WZMA 1RZIA 4KMTH 3BSZL 5CD3B 4LPWA 4HZAA 4JM2C 3RNKA 4PY8J 4Y5YB 3MUGB 3VWKA 3P0GB 4OTXL 3CFIC 3FAWA 4JO2L 2G2RA 5GISH 4YO0A 2F5AH 2FB4L 1QFUL 1S7TB 4JAMA 2NX5D 3SE4C 2VWEE 4XCCL 5DUMH 2GSIB 1HXYA 4L8CA 3TNMA 1N5AB 3TO2B 4LLAA 1UZ8A 1DSFH 4U1SA 1KT2B 3F58L 4MJIE 4L9LA 3FQUA 4PGEA 3DURB 1OVZA 5L2JA 5I1GL 4LGPB 1V3LA 3S37L 5GRJH 1FAIH 2DQEL 4P59H 3PL6D 1IZJA 5DEFA 1KACB 1RFDL 4HIIA 4IIQA 1IM9B 4MCZA 1KXVC 4JHAL 4QTHA 3BJ91 3EHBD 3RKDD 4OGZA 2EIDA 1NCBL 2YMXL 3WNNA 5D1QD 2H2PD 5ERWA 3WL9B 2HLAB 1Q94A 5FEBA 1MH5B 3BW9A 1OQXA 4JN2A 4I0PD 3ZE2E 5E8PA 4BA8A 2NTSP 4YDIH 5MEND 3MYJB 4D9QD 4WI3A 3ZDZE 4YR6B 5GS3A 1R3KB 5E99H 1M7IB 4Y2OA 1MJJA 5C0CD 2C1OB 5CAYB 4Y16B 1QR1A 3LB6C 1C08B 2Z92A 1T22B 3MLZH 1I7RA 4KROC 4JFYA 2KZWA 5I73B 2CLZB 5D1XB 1IKNC 3M17B 1XGPA 4X7SH 4OZFG 5GS1C 3MXVH 2Z8VC 3WE6B 2VQTA 3MRMA 1VGEH 2A83A 2XPGB 1FNSH 3WJJC 1ADQH 1G1CA 5JO5B 3RVWD 3AS2A 1U41A 1OSZB 3EYOB 1UJ3A 5F7KC 4XHJC 4OAWA 4N0CD 5T33L 5DJ0B 4X7TA 5EU3B 3TIEB 2MQCA 2FEEL 1TNMA 3VH8B 4LSPH 4UQ3A 4XVUD 5T1KB 1L7TL 3B4NA 4GRWB 4HS3B 4M03A 4O51B 4Y8AA 4DGVH 4PFEA 1YEFH 3HC4H 1NGXB 3PHQA 5IJVB 4R96B 2R23A 4L8BA 4YLQT 3IAPA 4JZOA 4UZGA 3TO4A 3TYFA 5JNYA 1IC4H 5I8CA 3VXQB 4WFHD 1V7ML 4DVRL 4BFIB 4F7MA 1MHHA 4AZ8A 2VOTA 3IKCB 1JUFB 4U1HA 3MRJA 1EJOL 2HP4A 2NNAA 1UCBL 1NLBL 1P9MA 4Z0BL 4PRID 4Z76B 4JPWH 5ESVA 1YEDA 4NC0B 1OP5H 4LARL 5C8JA 5KVGH 4P46B 1CL7H 1NAKH 1LO0H 1KJVB 5F1OB 4OUUB 5FYJE 1CR9L 2VABA 4JDVB 1FFOB 2EICA 5TF0A 1L0YA 4OJFL 5IR1A 2DMCA 4BQCA 3QWRD 1U92A 1U8NB 2UWEA 2YWYA 4HWZA 1OGAE 4HX1B 3FFCD 3IFOB 4F37F 4MDIB 4Z18A 4Z7OF 1A2YA 3KPQA 1Q72H 1N6QH 3L95A 5B38G 2ZUSA 3HLAB 3TA3B 1ONQA 3JWDL 1U0QA 2ADGB 5CIPB 5C9JA 4TVSa 3A67L 1DR9A 5L9DH 3VFVA 3B5GA 3L3DB 2GJ6D 5MI0B 5C09D 3T1WA 4LRIC 4LAQL 4JFFA 4TUKL 2QKIA 4OIAA 4P23D 5SV3A 4EN3D 4YHNB 3M1BA 2R56L 1URLA 4BZ1L 1ED3A 5C0GA 3EO9L 3QFJB 4OGAD 3ROLA 4KTEH 3EAKA 4XPTL 5A1AA 4YHZL 2R0ZH 4OV5A 3KPSA 3DSFH 4QOKD 2EZ0C 4TRPL 1QYGH 3GFUA 3PABA 1AJ7L 3KYOB 1YEIH 1EBPA 2OX5A 3T3MF 4V2CB 3GRWH 3SBWC 1MCOL 3RRQA 1FFNA 3VJ6A 4ZTPL 4P5TA 3NFSL 3BZFA 1RJLA 3O8XD 1KJ2A 4KI1A 3C6LB 1ZA6A 4HUMB 12E8H 3SDYL 1KC5L 3BP4A 4R7NB 5E08H 5I8EA 4FQIH 1MNUL 3QUYA 2QLVB 2ZSVB 3Q3GB 3KJ4C 5HY9B 1DTUA 1NGWB 3CH8A 5JA9A 4NT6A 3MLPA 5I1IL 4ZOEA 3KPRE 1KPRB 4HK3N 3VXRA 1ZVYA 4HHAB 4WV1A 4X4YA 2J88H 4Y4KA 3VFSA 4XP4H 3EYVB 3MLSL 1B6DA 2VLRD 1FO0B 2XWBB 3O3BB 4KHTL 3HE7A 4X7DC 4TUOB 1J12A 1P7QD 4M6OL 4JFQB 2R1YA 3O2VL 4PLNC 2QHRH 3AM8C 4G8GA 5FK9A 1I9IL 3VFWB 4Z7OE 5HBBA 3QIBC 4U0RC 2R2BB 1INEH 1NEZB 3OAYK 2BVUA 3PWPB 2JELL 1T0MB 1F90L 1A7QL 5SWZB 4U1NA 3WXVH 4HJJL 4XPAH 4G6KL 4B7LA 4OF7A 1ZSDB 3BAEH 5K9KA 3IAGC 3TFKC 1I85A 1CFSA 3SKJL 4P4RB 1T7XA 3E2HC 2LU4A 4HJGA 2BFVL 3UTSD 1FVDB 3BT2H 5DO2D 4PJGA 5IWLC 4S2SB 3PWVA 1RHHA 4XPHH 1FDLL 4PUBH 4W4OA 3RNQB 4X9IA 5ICXB 4M7LL 5AWNH 4M48H 1AO7B 4D8PA 1L0QA 4YHOH 1IAIL 1TPXC 1ES0A 3CFCH 1G6RB 5IB5B 1CVRA 1MI5E 5HYJD 5F3HA 2QQQA 5AZEH 1P5UA 5EU6B 4AM0B 4RFEA 3GSQA 2RCSH 3P30L 5F88B 1YC7A 4NQDE 5KSVB 2E9BA 5GJSH 1GC1C 3B43A 4NOBA 4ALAH 4HBCH 1F2XK 4WI4A 4YHYB 4PREA 3TIDA 5BV7B 4DQOH 5J0BA 2XTJC 2FJFA 1I7ZB 1R24A 1V7NL 3IXTA 2EYRA 4LSVL 2IC2A 5F7LB 3UC0H 3T0VA 1QA9B 2AK1L 5IF0A 2P24B 4HG4K 2EDKA 4OB5H 3IF1B 1SJHA 5I17A 1FZJA 5EZJA 5ADOH 1NSNH 1PX4A 3TVMC 2X09A 4I3SL 3SE3A 1U58A 1QRNE 4LGRB 4XBPB 3LD8B 5JXED 1EO8L 1KTDA 1FBIH 5DZLA 5F1IB 4ELME 3OWEA 4KMTL 4CW1B 3ZYOA 4MJIA 1RUPH 1J1OH 1Q38A 4JFDB 3EYQC 4JM2B 1ZVSA 2XA3A 5GISL 2F5AL 2DMBA 5E2JA 4MXQD 4QWWC 3S4SG 43C9B 4DWHA 4J3WA 1WWWX 5DUML 4LSUL 1UEYA 2L4OA 4UUJA 3OKKB 1DSFL 1DBMH 2ADJB 1VB9A 2V2XB 2FX7H 1XR9B 3K3QA 5JQHC 4HF5H 2BNRE 5B8CC 1FNAA 5FF6A 5IVXE 5GRJL 1FAIL 4P59L 3HG1D 4ESKA 3VFOA 2VNCA 2WBJB 1LEKB 1M05B 3DX7B 1GRWA 4CVXB 3D3VB 4PJ8B 1AR2A 3HE6D 4ISVB 3EGSB 5H94B 1XIWD 3RZCA 5FECB 4YDIL 4ZFZB 5ACZA 2IQAB 3LRSB 2B5IB 2X4UB 5MEQA 5KS9F 1OD9A 4CDGC 3EYFB 3KPMA 5F9WC 5E99L 4Z7WA 2E7HA 5D2NA 3O41A 3QIUD 1ZLUH 2NY3C 4X8JB 4J8RB 2MTPA 1YQ2A 2DIBA 1MLCA 3MLZL 2E8YA 3HNVL 5C86A 4EXPX 3RY5A 1MIML 5MEPA 3MV9A 1IGYA 4KROB 3CLFH 4U2YA 3F5WB 1FG2B 4X7SL 1NGYB 2CXKA 4LCYA 1NAMB 3MXVL 5JUEH 1VGEL 1FNSL 1ADQL 5GS1B 5A3IC 4GW4B 1AXSA 1W8OA 1VKXB 3UO1H 4U1KB 5HGGS 5DJ8A 5JORB 1KEMH 3GMPB 2YR3A 4CNIB 2GY7B 5C1MB 2VR5A 4QXUH 3DJ9A 5D7LE 4LSPL 5IFAL 1MWAB 3K4DA 1FFQA 5HHME 1CXFA 3BKMH 4DGVL 1YEFL 3HC4L 4HWUA 3KDMB 5L2KB 1RK1B 5DHVH 2Z31A 3NPZB 4GQ9H 3FB8A 3RWGB 3SKUD 4JREB 3O9WD 2JCCF 2X42A 3OZ9H 5D7IB 3MCKA 2V5YA 5IM7B 3L7FA 1HNGA 3U7WH 2LVEA 3BDXA 3AREA 3RIFK 1IC4L 1J10A 2W0KA 4M9PA 4PRBA 2ZNWA 4A2MA 4FOMA 2VN7A 4WGVB 3FQWB 2P5WE 4JPWL 4Q0XH 4HDIA 5F7UA 5KVGL 1OGAA 4ZXBB 1C5CH 5JHDB 5IMMB 3BYTA 3TGXA 3F12B 3VGFA 1CL7L 3MRDA 3WUWG 1B90A 1LO0L 2Q3ZA 4JFHD 2WIIA 5HDBF 3SDXB 3TZVA 1UXSB 2X1WL 5FHAL 1CU4H 3CFEA 4NYLA 5MEOA 5EB9A 5D1ZA 4MWFB 4Y4HD 3BH8B 5EBWA 2E7LC 3CFDA 1JGVH 3U9UA 3VXSE 2GQHA 1U36A 2F53E 4Y89A 3L6FB 5KAQG 4HKZB 2EDYA 3L3GB 4P99A 5C08D 4Y1AE 4KK6D 4LLVB 4YBHA 3IKKA 1N6QL 2XKUA 1T5XA 2ENYA 3VGEA 5M95B 1IQDA 1NBYB 1B4JH 1JHTB 1JZ4A 1JZ7A 1YC8A 5L9DL 1ORSB 3LKSA 5ID0A 4V2BA 2KPNA 4QRUB 1S7WA 2W0FA 1YQVL 3RU8H 2DI8A 5C2BH 2FHCA 3UZEA 5E6ZA 3CH1A 3ARFC 4L4VD 1K2DB 2BOCB 2OTWA 5BVJA 3FT4A 3P9LA 3QHFH 5F7DB 2FBOJ 5DJYB 4Z77A 3GGWB 4KTEL 3B5HA 4ETQA 3B9KA 1JYXA 3DSFL 4WHCA 3OKNB 2JCCE 1IGTB 3HN3A 1CWVA 3ETBF 1U3JA 1U3HA 1QYGL 4LL9A 1P7HL 1HHIB 4XH2B 4XTRC 3GJFH 4WU7B 1XF1A 2V2TB 1YEIL 4I9WE 3KPRA 1QBMH 3GRWL 2P7TB 1JWMA 3EOAA 5CLWA 4HUUB 5I16B 1A6AA 4PY7A 4K3JH 4NN5B 4EDXA 4UDUB 3GMQB 12E8L 1JFQH 3Q6GL 1TZHA 4LSRH 4DFHA 5E08L 4FQIL