1H5BC

T cell receptor valpha11 (av11s5) domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
GDQVEQSPSALSLHEGTDSALRCNFTTTMRSVQWFRQNSRGSLISLFYLASGTKENGRLKSAFDSKERRYSTLHIRDAQLEDSGTYFCAAEASSGSWQLIFGSGTQLTVMPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags T cell receptor
molecule keywords MURINE T CELL RECEPTOR (TCR) VALPHA DOMAIN
publication title Crystal Structure of a T Cell Receptor Valpha11 (Av11S5) Domain: New Canonical Forms for the First and Second Complementarity Determining Regions
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2001-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h5bC00
1BECA 1K4CB 4ONOA 2CKBL 2A9MH 4M1DL 3RWJB 1EERB 5AG8A 3MGTA 1A22B 5HHMB 4NPYB 4U1NB 1Q1JL 4JFDE 4POZD 5B8CB 5L9DL 4EQ2A 3GSWB 1MF2H 1CLZL 1IEAA 2AEWA 4U1SB 1FZOB 2WM0A 3KJ6L 3IRZA 5JQ6L 3VXSE 1ZAGA 4UIKL 3TP4A 1QQDA 1RZ8A 1CFSB 4H26B 5FYJU 2NTFA 2EDBA 4M3KB 3DIFA 3VRLF 1EHLH 4HUXA 4XWGH 4FXKA 2X4NA 3GJFB 1WZMA 4YXHH 1J1OL 1VERA 2R39A 4XNUH 25C8H 2ZCLL 4IMLB 1AGDB 3D2UA 3K2UL 3GKWL 4OCYH 1ZLSH 3FQWB 1PZ5A 2HAZA 5A3ID 1MH5B 1WWCA 1CIDA 2Q86B 4BK4A 5HHOB 3BWAA 3UYRH 4KKBD 5LGHH 1QFOA 1F11B 3QI9A 3FQTA 4TQEH 3QEQA 2ZPKL 1LK3H 1NQBA 3A67L 3UJTL 5ID1B 4BKLB 2QHLA 1JK8B 1T66D 2HT4C 3SKJH 2I07B 3V52L 4M6ML 3KPOA 1EEQA 1UG9A 2PYFA 3FT4A 3OGCA 3PWPD 1MFEL 2FJHA 1DQTA 5IMOB 3PHOA 1RZIA 1I7RB 3F5WA 4X4ZA 3T3PF 2MSPA 1GPOH 5EUOE 3BE1H 3O8XD 1XFPA 5KVDL 1JHKL 5ITFB 3KWWA 3UTZA 3RDTA 4RSVA 4E9LA 2CJUL 4PB0H 5SX4H 2WINB 1EO8L 4ZFZA 3FMGL 2DKUA 2VR5A 3DV4B 1NAMH 1RJYA 3NZHL 1KELH 3AS3A 1OTTC 4U1JA 1DQML 4KKCC 1PYWB 4HWZA 3PHQA 2OJEB 2I9LA 4R7DB 4AL8L 1INDH 3V7AE 3C5ZA 1WF5A 1HH6A 2AJ3B 4P9HC 4E41B 4JZNA 2YD6A 4UTAH 5IT2L 2CRYA 2WIIB 4ISVB 5I1JH 4M9PA 4WNQB 1EXUA 3LDBB 3WFDL 5ABDE 3NCYS 3HRZB 3SDXB 1NCTA 2EDJA 3QZWG 2NY7L 4C83A 4YNYB 4UV7L 4LHUD 1C7TA 1TVBB 4NM4H 1VCAA 2DBLH 4WEBH 2VLJE 4J2XA 1NCWL 1O0VA 4XPBL 5CS7A 5FDWB 5JMRA 1T3FB 1F4YL 2WSKA 3MGOA 4R26L 5KSAD 4EUPA 3CFCL 1MJ8L 3HI6L 3OJDA 4N0UA 5GHWL 1R5WA 1T5XB 4QCIA 3MTRA 5TQ2H 3RWHB 1EAPA 4N5EC 2Q8BH 3U30B 4X4ME 3OAYH 5CP7A 1I3RA 4G3YL 4X5WB 4P3DB 1J8HD 1QYGH 1FNGA 4X5XB 3VXME 5FIEA 4XNXL 3LS4H 4J3UA 3QFJB 1G9NL 3WDHA 3QAZC 4LCWA 1IGTA 1A21A 2ZUXA 4XP1L 1U3YA 3EO0A 3FRPG 3QJFA 1FYTB 4N8PA 2NR6C 1E4KC 1MCOH 2EEAA 3E8UL 2X7LA 3QQ9D 4XC3H 1FN4B 3FB7B 3RA7L 5GGTA 2MCPL 1FBIH 2E27H 1W0VB 2IBZY 1F02I 4HJ0C 2N7BA 3GJEA 4NJ9L 4AT6A 4DOHE 1F97A 5HYJE 1JTOA 5IBTH 3GMNB 3WXVH 2DYPA 3C8HA 3MBEC 1S7UB 2Y07H 2EDNA 4XPGH 2IEPA 2JLLA 2NTSP 1WSST 3T0EE 1IKNC 3NABH 4KMQA 3QIBB 4GXVL 5ERWA 1SEBA 1QRKA 3C6LB 1U8LB 3U4EB 2B1AH 4NQCA 2ARJB 4PRPD 3O6ML 1AP2B 1N6UA 1CLOH 4TVPL 1TQBC 4XPHH 3CUPB 1YJDH 1VSCA 1BFTA 2QKIA 4R2GB 2N1KA 4FQQB 1F00I 1LO2H 5EOTA 5IMLA 4PD4K 4YK4B 4FOMA 1MJ7L 1R3IL 5T3XE 4Z18A 1JPSL 3IDJA 1SBBA 3REVB 3JV0A 1YQVH 4KKNA 1J0JA 1C5DB 4LU5H 3KPMB 3MV9B 1CBVL 5TDPB 1BEYL 5C7XL 1LP9B 4JY6A 4YC2B 1JHLL 5AUMA 4MNQA 2HA1A 5H35A 4AY0A 3TYFB 4MHHI 1GAFH 4LDLB 4K94C 2NYYC 1SJHA 3MODH 5C6WH 4I3SH 4PLKC 4Y16B 5E6IC 3RFZC 5DRWB 3STLB 5CJBA 5GGQL 3E6FA 3P0YH 2JE8A 4KJWC 4U6TA 3VXUE 4M7KL 5M7QA 4JFED 4JANB 1JGLL 1KCRL 4P4RA 1HHHB 1FH5L 4PR5B 3MRCA 3ULVE 5DDHB 1NJ9A 1T0PB 1UENA 4FTVA 5INDB 1RZGB 4L4VE 3CVIL 1Z9OA 4NQDE 5FK9A 5EA0L 4G9FA 4MXVE 4OIIL 4CMMB 5KJRL 1ZOXA 2XY2A 3EOBA 3HUJF 5I1LA 3BVNB 2H8PA 5IB1B 5IW3A 4K3EL 4DW2H 2I60L 4PJFA 4Y89A 5C9JB 5E8NB 4MJ2A 1U9KA 4MGXA 4L9LA 4HUUB 3G5YB 2ATKB 2VKWA 3C09B 5JPNA 3QWRA 4EI5D 4JPWL 3MCKB 1KUMA 4GBXD 3MNVA 4D0CA 4X99B 4F7TB 1AE6L 3U7YL 1A1OB 5I1GH 1UZ6F 1NFIA 1KLFA 1NGZA 4XRCB 1I9JL 4UV4H 5FHBL 3SJVD 4MAUH 4PJHA 4XVSH 3X14A 1CICC 2R0ZL 1MCCA 5JW5B 3QDGD 4DTGH 1BBJB 4NGHH 1EGJA 3MBEA 2Z4QB 3K8LA 2PYED 1MUJB 2AI0H 4MNGB 3ZE2F 5IFAH 1B4JH 4I3RL 2QHRL 3WFCH 5LXGL 1J11A 5ITBH 1IKNA 2R2EA 4PBVC 2O5YL 4TTGA 1D5XB 1F5WA 1NGXA 2KUTA 3RI5F 3FZUC 3V0VB 1EVTC 5CEZH 2CLRB 4P48A 3UMTA 1F3DH 4WW1B 4F15C 5CJXC 4O2FA 1G7MA 1JYWA 2HKHH 1FNSL 2P8MB 4NC2B 1IT9L 4JFDA 3NIDE 3QULB 3IAPA 3VXRA 5KN5A 5BV7H 1T80A 2QLVB 1NSNL 3VXTA 4GFTB 1OB1B 3JV5A 4MAYD 4RMVA 5L2JA 3TPKA 1ADQA 1FRGL 4PRID 4JFZL 3UTSD 3H42H 3BRGC 3ZKSD 5C0RH 1MY5A 2J12B 2XN9A 3BSZL 1U8MB 2X40A 4IBLT 4N1CA 1BFVL 1ES0B 4GAGL 1LE9A 1AKJA 4OF6A 3FFDB 4OCMC 2XKNB 5T1LD 2P48B 1KULA 3MOAH 4AZ8A 2P5EB 4OLZH 5EOQH 4LSPH 2J1KA 3B8SA 3TFKD 1E0OB 2DQTL 5E6IA 4HIHB 3ETBF 2XI9A 4U6VH 4L3CA 2A6KA 2LU7A 2OZ4H 4MQXD 4HX1B 2RIKA 4NWTL 3Q3GB 2R0LH 3BIKA 2FJFB 2MQ3A 5KVFL 4KZEH 3QA3B 4OSUL 4WIQA 1CU4H 2XZCH 1A9EB 5DRZA 5BXFA 3RBSA 4XMLL 3U46A 1S8DB 4P2OB 3R8BB 3PGFL 1N7ML 1S7XB 1UACH 3EZJB 1EZVY 2HLAA 1T03L 5I1HH 2YWZA 2D7OA 3BT2L 5IW1B 3B9EA 4KHTH 5CCKH 2O5XL 5HPOA 1A2YB 3IETB 3ZSTA 5SWQA 1FAKT 3IFPA 4DN4L 5E9DE 5EU3A 3RNKA 5T5FH 1C8PA 5EUOA 4FQXB 4LKCB 4NRXB 5EULV 5FO9B 4Z76B 1KV3A 3DI2B 3TZVA 3HZKA 3QT2A 2BNRE 4PV8A 4X6CF 1N6QL 4V2BA 3GSNB 3IDXH 3SE8L 3HMXH 1AIFB 1R5VA 4NO5B 3RL2A 2YUVA 5DMJB 4JG0L 3QIWA 4RAVA 3SE9H 2P44B 2VIRA 1KCVH 3BUTA 1JPTL 2A9NH 2UZXB 2HJLB 2KH2B 3LZFH 4WEUD 3HC3L 4UT7H 1UWXK 4JPIB 4X9FA 2VN7A 4WV1C 3ALXA 5KSBF 4J3TA 4IOIB 1ND0A 4LDOB 3V6FA 3FB5A 4QRUA 1HNGA 1CICA 4YIQA 3Q5OA 3GSUB 4OFYA 1A3LL 4RRPA 1QLFA 1B6DA 1S9WA 4NZUH 3U0PB 2VXVL 2VLJA 2EYSA 1CLYL 4NQEE 1AI1L 5ALBL 1B9ZA 2EZ0C 3TT3L 1UH3A 5GGVL 2ERJC 3ZZ1A 1A7OL 1H8SA 3KYKH 2DLFH 4L5FH 3P73A 4HPOH 3ARRA 5CJXA 3QDHA 3UJIL 4Z7VB 4UTBL 3LKNB 1XCTB 5GRZA 5B3JE 2EYRA 5AZ2L 3D39D 4JDTH 4NT6A 4ZXBB 5GJSH 3OB8A 5IB4B 4GSDL 3DMMB 4XCYA 4Y2DB 3PIQA 3VWJC 4Y5VB 3DNKA 3MRNB 3QUXB 3MO1B 2AVGA 3MUGB 3HCVA 4OKVA 4OT1L 1P1ZA 3QDMA 5D2NB 2DM4A 3W11D 2FIKB 1B6UA 3HI5H 4ZS7L 3BN9D 3IKCB 3VXMA 3C87A 3K2MC 3BPLB 4NM8H 4PY8I 5HDQH 3QRGH 2FZ3B 4RGOL 4G8EB 1ZWIA 1CGTA 1EVUA 4HMCA 2NY0D 4DCQA 2LAAA 4K71C 5E2VL 1MFDH 1LO5B 4NUJB 5ETUB 2YKLH 3DHJA 1RZFL 1T2QH 1WBXB 4YDKL 5HYJA 5I30H 3RP1A 4F37F 2OL3A 1XGYL 4OZHF 4JG1L 2DB8A 1ZGLA 3OAUH 3MA7A 4ETQB 2Y4SA 2BVOB 4QRRA 3T0EA 1SHMA 3BQUB 1I7ZA 2IQ9L 1FZKA 4U1GC 4JM4L 1D5BB 1QSFE 2D2OA 4G43A 4OZGE 3KLHD 4M61B 4ODSL 4YFEA 2AS5M 2BOCB 1TVHA 3FO2B 2VO5A 1NAMB 5KS9B 2CDGA 2VWEE 4PJIE 5H94B 4P5TD 2NW3B 3OPZH 2FEEL 5JA8B 3T08A 4Y1AE 1IM9A 3ZT5A 4N90E 1RULH 1GL4B 2VYRE 3PL6D 5T1MA 3VD5A 4NHUB 1EO7A 3VGAB 2B20A 1VFBB 5L0QB 4XX1G 5J6GB 1X6NA 4TSBH 1G6RA 3CIQA 1ZMYA 2EC9T 4HAGA 4HIXL 4Q9BA 5D2LB 3SDAD 5IBUG 4TRPL 4XWOC 4I77H 3DX8A 3MV7B 5ID0B 4JFFB 4HGWA 1LMKA 1EH9A 3S96B 2BY2A 1CLCA 2DQDL 1RURH 4N8VB 4WV1A 1TXKA 2JB6B 2NY2B 1NAKH 5GZNC 1BD2B 1MCJA 1MHCB 1WWAX 4MB5A 3WCYA 4QWWC 2PO6C 2W0KA 4EDXA 4ZFGL 4JY4B 1FL6A 3U4BH 3H9SB 1JUFB 3ZKND 2QSCH 4LLAA 3KPLA 2UUDH 5KVEL 4N9GB 1LO0H 2WQ8A 4O2CB 5ESQA 2C4XA 3QEHB 2JTDA 1P7HL 3TN0B 4PRHE 1VGEH 5CJQH 1HYSD 4PJGF 1KENL 5IR1B 2WWKO 4H1LH 5ACLA 1N5YL 3PJSB 1KIRB 3VFGH 2GI7A 4WW2B 1C5CH 3L3IB 1XR9A 3FQXB 3VWJA 3G08B 1T1XA 5D93B 2YPLE 4Z7UB 2APFA 1JRHI 5E2UL 3STZA 3HN3A 3FO0L 5D8JH 1CE1H 2X44D 1BJ1H 1OGTB 4YO0B 5HVGB 1FSKB 5DR5H 4XC1L 4OZFG 2EXWD 5IF0A 5AWNL 1KIPB 4ODXA 2D7TL 1HXYB 1FV1B 2BHYA 2XT1B 1EAJA 2YUXA 3I6KA 3MJ7B 4YDJA 5BVPL 3PHSA 4XXDB 1OAQH 1INEH 2NZ9C 2V7NB 3BPNC 3ESUF 5EU5A 1IGML 2R1XA 1KCSH 4ODHH 3U9PL 5IFHH 4XVUC 3WO4B 2BVPA 3LKSB 3GSOB 4P57A 2BRRH 4GW1A 1C5BL 4LEXL 4XAWL 2OQJB 3L3GA 3KYNB 3ME0A 5HBBA 5DRNA 1U95A 5EN2B 1JZ2A 3M1BA 1MREH 1R24B 2O5ZH 2VE6A 1QKZL 5DK0A 4TVPE 4NCC2 3TO2A 4D0BA 5EU6D 2ZP0T 1XR8A 5FB8B 3DURB 3INUH 2J6EA 4BH8B 3TBVA 4HKJA 4DUWA 3O9WB 1NFDB 1M6OB 1JGEA 2MKWA 1NBYA 4MA7L 4Q74A 1I1YB 1MHHB 4TSAH 4YXLL 3DX6B 2PW2B 3OAZH 4R7NB 1MFNA 2ICEB 4YDVA 3VFOB 4YGVB 2AV7A 4PRBB 4JR9L 4A2MA 5TF0A 4JN1L 5HGHB 2DTML 1NC4A 5ENWA 4UT6L 4G7VH 2XQBH 1RZJH 3MJ8B 2IANB 4HJGB 4PJ5E 1SBSL 3EOAA 1WTGT 2VDNL 3PUCA 4G7YH 2X4OB 3L1OH 4N0CD 4Y4KD 3D25A 4WGVB 5DUPL 2FIRT 4NC1C 3EJZC 1XGQB 4HXAL 3DLQR 2WBJB 3KPRD 4JN2B 3V5KA 1JF1A 1L7IL 1T20B 1KT2B 4FXGB 4XBGA 4NJAH 2A83B 4JPVH 2ID5A 1QSVA 5FM5M 1Q9KA 4U1HB 3T0VA 4Z77A 1MRCL 1NC2A 2PO6A 3GSNL 5D6DA 3DHMA 1PFCA 1CD0A 5D7LD 3KAAA 3IDIA 3W39A 4K3DL 5LGJA 5H37G 3BP5A 4ZAKB 1E4XH 4AIZA 3IF1B 2VWEC 3FQRA 3LSOB 3O3DB 1T22B 2X5PA 1TJHL 4MX7B 4GMTL 4ODVH 2C1OB 1AH1A 3VJ6A 1DUZA 3EYFB 2A0LD 4K7FA 3QUYD 1GJIA 3F7VA 3TV3H 2MOVA 3LEVH 4X6EA 1KPVB 1ZLWH 3RWEB 1V3JA 2GEEA 2BNRA 5IEKA 4D3CL 1GIGH 1SM3H 1JGUH 4NRYA 4JRWA 2QQKL 2R0WH 5I71C 1NBZB 1JGVH 1JWMB 4RGNB 2VL4A 2D0GA 3RWIA 2RAMA 2NY6D 4MNHB 4L3EA 3BKMH 5GQBA 1OM3L 4WENB 1ZEAL 3IGAB 5F1IA 5JIPA 2J8UF 5B39A 4F33A 3NIFE 4YXHL 2DOCA 4AEIH 3TO4B 1LEGB 3ARFA 5JW3H 3BDYL 5GGUA 4LVHC 1IVLA 4IRJC 1I1FA 4OUUB 4DN3H 2QQLH 5BV7B 2FATL 4I2XA 1ZLSL 4BZ1H 2YXFA 2EIEA 5D7KE 1YMMB 2C3XA 3BO8A 4UQ2B 4PJ9B 1CGYA 4GJTB 3UYRL 3TYGH 5LGHL 2SEBA 3RGVD 5BS0E 4JVPA 1HEZA 5ICXA 4TQEL 3BAEH 3C60D 2CKBA 4ZPVB 4X8JB 1DEDA 1HSBA 3CLEH 5F96H 3QHZH 2XG5A 3EYVA 1YN7B 5D6CA 2DQJH 1HXMB 3WIIH 3FT2B 4MXQC 4WJ5B 5HHOE 5IQ7H 3ZDXF 2IJ0C 4DGYH 3LQMA 4F7PB 1OPGH 1JE6A 3CZJA 4OQTH 4GW5B 5IFJA 1QO3B 1ZLUH 2J8HA 1PAMA 1UVQB 3GM0A 3LEXA 3LPGA 5D1ZB 1MHPL 4N8CH 3LAFA 1GPOL 1KTLA 3BE1L 3B9DA 2EDQA 1D9KD 1CGWA 4Y19E 1BFOA 1QEWB 2Q76A 3E0GA 4PB0L 4X7CC 5DI8A 4L3AA 1Q9OB 4WHTB 1I9IH 1J88A 1QFHA 3VD3A 5DSCB 4L29B 4LRNL 1NAML 5CGYC 4PIRF 2F54D 1J1PH 2L4OA 4O51A 3RWFA 4M7ZB 2VQUA 3C2AH 1X4ZA 5SWSA 4YHIA 2A73B 4HHAB 3MSPA 1G0DA 3X13A 4F57H 3GFUA 4HXBL 3DX9A 5C09B 1PKOA 4HEPG 2GSGB 2Z92B 3ARQA 3NZ8B 4JRXB 1OVZA 3RTQD 4XMPL 3RZCD 4P3WA 3TH3T 5ACZB 1QSFA 4RA0C 3ARDB 4OZGA 1UCBH 3MRRB 5F7DA 5HY9B 1AGEB 1P84J 1MAMH 1T0NB 4JM2B 3BD3A 5FKAB 3BW9B 4NM4L 4C55A 2OR8A 3V0AC 5EIVA 3HMWH 3KDMB 1PGRB 2R1YA 3S36H 1UZ6E 5HGBB 4BFIB 3AY4C 3IU3B 1I9RH 4OAWB 3PQYB 4HG4J 1RZKC 2KZ1B 3EHBD 4U3CA 3VFWB 3MV8D 4GKNB 1DFBH 2E8YA 4GAYB 2R69H 4HCRL 4QOKA 3MRIB 3SDXE 2P24B 5J6HA 5D1QB 3QCVL 1F3JA 3HE7B 1MRDH 4OLUL 5HI4C 2A6IB 4PLJD 1YNTA 4QHNA 3RVTD 2WUBH 1YUHA 1KB9K 1KEMH 4KRPC 3A6BH 4LLYB 2D0HA 1IAKB 3Q6FA 4NO3B 3ARGD 1JWUA 4KMTH 4PTTA 1FO0H 2Q87A 3SDCB 5F7YC 2PUQT 3LS4L 3TEUA 4OV5B 2ADJB 1J18A 4L8BA 43CAB 3LKRA 4RMUA 3UDWC 5FCUL 1HILA 4NO2B 1MCOL 3RWGA 1VHPA 4HKBA 4IRJA 4XCCH 4Z7NE 1M7IB 2FECL 2NLJB 3ROLB 4K7PH 3REWB 3CH8A 1TFHA 4KWUA 4YAQB 3UPRB 3JXAA 1QFWI 3WXVL 1Q38A 1MQKL 3QFJE 3MXWL 1Q0XH 1RUQH 3MJ9L 1Z5LB 4YR6B 5BJTB 4NYLB 2X41A 3PV7A 5E6ZA 4MA1B 2GSIB 1NBVH 1EHAA 3WS6C 2WW8A 2DL2A 2DQIL 1CLOL 3IDYC 1U42A 3U2SA 1YJDL 3DETD 2YPLA 3L3DA 5DVLA 2VXSH 3QXAA 1YMHA 3O3UN 4HUWB 4R96B 4ZUVB 5MERB 2VDMH 5MHSE 4Q6IC 4QHLA 3CK0L 2O61A 1YQVL 4J4PA 1CDIA 1QA9A 4LU5L 5L2KD 3MRMB 3I3EA 1PSKH 1VADA 1VEPA 4LAJH 5B8CC 1YYMH 4YHZH 3DXAA 5BOPA 1OT2A 1LILA 2YN5A 3O3BA 1YEHL 5C0AD 2BCKA 3LY6A 2A77H 1KNOA 3HC0B 3U36B 1V3LA 4OZIB 2YPVH 1B0RB 1DL7H 4XB7A 4QF1A 2NX5E 1OCWH 2X4SA 3O3AB 1A4JB 4LBEB 3P0YL 1FFOB 4OUOA 1TNNA 3HR6A 3B9KC 1V3KA 3QJHA 3D69B 2I5YH 2IPTL 32C2A 1N5AB 1P2CB 1WAAE 1VFUA 1I1AC 3OXRA 1KN2H 1UH2A 4BA8A 1J0ZA 2JELH 4HH8A 2BVTA 4WCYH 4OZ4A 4LCIL 3JWOH 2F5BH 4O02H 4OFKA 1FGVH 3AY4A 1CF8H 4OM1L 4X6DF 3MOBH 5KAQG 4DVBB 1N59B 1ZKAA 1ACZA 2EIDA 3QNZB 2BERA 3ULSB 2YS4A 5H8DA 1PKQE 1XZ0A 3CFBB 1PX3A 3BISA 5GGVY 1KTKE 5E00A 2GY7B 1KACB 3HUJB 4W4OC 2IAMD 1D7FA 1IM3B 1BF2A 5FAAA 5SWZA 5C70A 2AKRB 4KK6C 5D70L 5ICZB 1CK0H 2R2CA 5BRZD 2OSLB 4QNPF 3MROA 5JW4N 2GQHA 4M6AA 4DW2L 4G6ML 4W81A 1CXLA 1B88A 4I9WE 4XCNB 3BP6B 2V9TA 4PUBL 4FABL 4ZOAA 1UA6L 4GW4B 5IVXA 3DTXB 4NNPH 5BCAA 3B2UD 1P4IH 3UDWA 1MLCB 3I3DA 4PGDB 1MCWM 3P30H 2ZZUT 2P8PA 1X6LA 4YHNA 4JVUA 5GRWA 4NQXB 4BQBA 4E42A 4H1LB 1CDJA 2HT2C 4NCC1 1D3CA 4UV4L 3TA3A 4MAUL 1MCPH 2VLRD 5I1AA 1DBMH 1I85C 1WICA 4XVSL 1N64H 4X6BA 3F6IA 4LHUB 3BI9X 4P46D 2C7UA 4DTGL 1RD6A 4RBPK 4NGHL 3WUZA 4CU7A 4P5MA 5IK3B 1QSED 5ITBL 1ITCA 5KSAB 1NCBH 3Q5YA 3VFTB 5F9JB 5LJYH 3WS6A 5GS2D 4KZDH 3D6GA 3I6GA 5CJOL 3O0RH 1MCBA 2VQ1A 3P4NB 4U1MB 2DQGH 1ODAA 4QGYA 3LDBC 3P0GB 5IJKC 1X5AA 3B5TA 3CPLB 1M05A 2HKHL 2GITB 4G42B 4JO3H 5FOJA 5E5RB 4U05A 5F1NB 4YZFF 5J1TC 4OTXL 4MNGE 1CFQB 4O00A 5GS1B 4WHYG 3RWCB 4Q6IA 1J8HB 3S5LG 1KPRA 3T1FA 4OGYL 1T1WB 2UY6A 2W0PA 1F90H 3ELAT 3X17A 5GZOC 4M7LH 4IJ3C 5E94B 2HVJB 1K4CA 1MWAH 5CMAB 3RWJA 4TVSa 4NPYA 4U1NA 2AK4B 5B8CA 4C54A 3CMOH 3KPSE 3RVWD 3GSWA 1OTSC 3OR6B 1H3UA 4Q58C 4U1SA 4EN3D 1JMXA 3U30C 1FZOA 4LSPL 2OBGA 4EQ3A 5IMMB 3WNKA 1HQRB 5AYQA 5I74B 4C57C 5TE4L 1CFSA 1WV7T 4JFXB 4WO4D 4H26A 1NUNB 3L95B 3B9KA 1JFQL 1G84A 2R0LL 3GJFA 4WWID 4AMKH 4DKEH 5JUEH 4FQIH 5CGMA 1CU4L 1IQDB 2XZCL 2PTUA 1DQLL 4PRPB 4IMLA 3EUUA 5EPMB 1AGDA 4JFHE 4LGPB 3IDGB 4JGMA 3LS5H 3FQWA 4WY7H 1NDGB 1H3VA 3QUZD 1MH5A 2Q86A 4KHTL 5HHOA 4KTDH 1BFSA 2DI9A 3PWLB 1R3JB 4MJID 4LGSB 1F11A 5JDJA 1X7QB 4NDMA 1UCTA 5ID1A 3FONB 4BKLA 4DWHA 3QIBC 1MHEB 3QUKB 1JK8A 1TZHB 1ZSDB 5F21B 3EO9L 3MACH 4FFZH 2I07A 5DMGC 2QQNL 2FX7H 1XIWD 5DD5L 3HMXL 2LFGA 4X80H 1GZQB 3W0WD 4OFPA 3S35X 4NQVB 1HDMB 2DWDB 5IMOA 3SE9L 4CKVX 1S7QB 1KCVL 1I7RA 2A9NL 3H8NA 3RX8A 2IPKB 2OXHA 4ZOCA 1W0WB 3DGGB 1U8NB 4UT7L 3P11H 5ITFA 3BP4B 1GH7A 4X7EC 5KSBB 1AO7D 1U58B 4JFEB 4HAFA 4NN7B 4YC2C 2WINA 5DZOA 1I85A 4NZTL 3UBXI 1OGAB 5IVNA 2AJSL 3DV4A 3MQIA 1PYWA 3MJGX 3SKNB 2OJEA 2BDNL 2FRGP 3B4NA 4R7DA 4Y16C 3R0MA 2EEDA 4NZUL 1QFPA 2AJ3A 2VDQH 3VU2A 4CMHB 4F58L 1K8DB 4E41A 3HKFA 3MYJB 4EXPX 4ISVA 2WIIA 4D9LH 4K9EH 3AAZB 4L5FL 1FORH 4HPOL 4F3FB 3S98A 1DEEB 4K2UL 3ALPA 5IJKA 1OHQA 3LQAL 3TBWB 3HRZA 1YDPB 3SDXA 2VERN 5GJSL 2JCCF 4YNYA 3MRPB 1A6WH 1TVBA 1AJ7H 4HS6B 4O58L 3HNSH 4NSKB 1Q72H 3JV4B 1CGSH 1KJ2H 1QZ1A 4KXZH 3D3VD 4F2MB 4XP6H 5FDWA 2BOBB 1T3FA 3MUHL 3EBAA 3VXQB 3O6FC 4EI5B 3JWDL 5C0IB 3PP3K 1PW3A 1H3PH 4Z7VE 4O4YH 4GBXB 3QRGL 5HDQL 1TENA 1QBLL 5D96B 1GC1C 1T5XA 1RFDL 2GJ6E 1EA9C 5ILTL 4HV8B 2H1PL 1Z9SA 3RWHA 4D94A 3QIUC 5IHBA 3QDGB 1T2QL 5D2NE 4X5WA 4P3DA 2EDTA 1IQWL 1F2XK 1LDSA 2PYEB 4X5XA 3PXHA 4ALAH 2D03L 3WLWD 3SO5A 3C09C 4OZHB 3TVMD 3BESR 4X83A 1WEJH 5IUSA 1F6FB 1FYTA 4LLQB 1FPTH 2Y23A 1FN4A 3FB7A 3R1GH 5EC2B 1R3KB 2QSVA 3GO1H 1OD9A 1W0VA 2CK0H 4OGAD 1DBBH 2E7CA 2WBKA 3GMNA 3RU8H 2F19L 4ZQKB 4KGJA 3ZE0E 5J11B 3CCHB 1EBAA 1S7UA 3NBNA 5JXED 4MAYB 4KROB 2NY1B 5GS0D 4M62H 3LPWA 2AJUH 3UTSB 3QIBA 1RULL 4Z7OE 4UBDD 1W8NA 3C6LA 1U8LA 3E6HB 4XP5L 3U4EA 5F1SA 3PV6B 1N6VA 2ARJA 3BHBB 2CIIB 1AP2A 1URLA 3CUPA 3CXDL 3GI9H 4MA8H 5KS9E 1TTFA 4XNZC 1X5GA 4FQQA 5C0JB 2E9BA 4KI5C 3J7HA 1RURL 3REVA 2EO9A 1H3TA 4PP1C 1C5DA 2ZNXA 3KPMA 3MV9A 1I75A 1JZ3A 4M5ZH 5TDPA 3VXPB 3WDJA 1S7WB 1LP9A 2DS4A 3T2OA 2PXYD 1NAKL 3K0WA 1OSPH 5D2LE 2DQUH 3TYFA 5HGAB 4XPAH 4OM0L 1A9BB 1ZLVK 3ZTNH 1QBAA 1OAYH 5CILH 3NIGE 3WKML 1B3JA 4Y16A 5C0DB 4F9PC 5DRWA 3STLA 2OR7A 3C2SA 4OQ1A 5FUCC 2UZYB 1FO0B 5FDYA 4RX4A 4H0HB 4AH2B 2XKUA 1TCMA 1JNLH 4XBEH 4ELMF 1CGVA 3D2UD 4JANA 2V5MA 1VGEL 4ONGL 2W07A 5GRVL 4PR5A 5HVFB 5DDHA 4P2OC 1H8OA 5C07D 3VFGL 5K59E 1OP5K 5INDA 1RZGA 1UB6B 4APQC 1LQSR 3QEQD 4WVRA 4PB9L 1WFUA 3MA9H 3O6FA 4ODWB 5LCVH 1IC4L 4CMMA 4PJBE 3QYCA 1CE1L 2R4SH 1QVOB 1MCIA 1G1CA 3QUML 5DR5L 5HJ3B 4FQXC 4JHAL 1JPST 1KJVB 2W60B 3BVNA 1HKFA 3CGTA 3OKMB 1MAKA 4XHJD 2B8OT 1KJMB 5IB1A 5A2FA 5L8LB 4Z7UE 1W2KT 1INEL 1ZHNB 2FWOB 2LTQB 3NCBB 3VDAA 5C8JB 5C9JA 3GHEH 1MCWW 3WNNA 5E8NA 4EZMA 1KCSL 4DAGH 4NIKB 1J1XH 4HUUA 3FN3A 3G5YA 1UT9A 1EIBA 2ATKA 2BRRL 2YR3A 2F8XC 5C0ND 3TBYB 3PHQB 4QY8B 4X99A 2ZUQB 3UTQB 4PG2C 4F7TA 1AQKH 1MREL 5J1AB 5KVMC 1EMTH 1U0QA 3IDUA 2O5ZL 1A1OA 2NY4B 4XRCA 4PJ7F 4WUKL 2FGWH 4NWUH 1ZA6B 1NGWB 2ARWA 5D7IF 5JW5A 1OAUH 1BBJA 1TJIH 2Z4QA 3SKOA 1UM6H 2WWKT 3IDNB 3INUL 5IB5B 1MUJA 5FV2A 3LB6D 5C2BH 4MNGA 4S2SB 2DD8H 4N9OB 3TWCH 1XGUB 3DI3B 3ARUA 5JZ7C 4Q9RH 2WP3O 3ULUL 1F6AB 4OD3H 5D5MF 1RIHH 4DUVA 1T0MB 1D5XA 5JOPD 3V0VA 2CLRA 2NY0B 4WW1A 5GJTH 3ARBB 1NGPH 4YFLI 4WFFD 1ZANH 3SQOL 4ODTH 2P8MA 5DD1L 2HTLD 3ARTA 4G7VL 2ARJQ 1RZJL 2CRIA 3QULA 2JF1A 3DMMC 4N0UB 2H45A 4BSVB 3L1OL 1NFDE 2EDXA 1WIUA 1OB1A 3QUXC 1KTDB 1G0XA 3O4LD 2AGJL 3BP7B 4X7TB 1UGNA 1RAMA 1KGCD 3BPLC 4U7MA 1U8MA 5EORL 4NJAL 4YX2H 1BX2B 1ES0A 3I9GH 4DK3A 2XQYK 3MRJB 4H20L 1A6ZB 4LF3B 2IANE 3FFDA 1OP3K 2XKNA 4TOYH 3BD5A 3S9DB 2P5EA 5I16B 3HC4H 4PY7B 4F9PA 5D1XC 2VDLH 4HIHA 3QG6B 5HI5C 1U8OB 5DJ8B 1E4XL 4HX1A 3K7UA 3Q3GA 3K8KA 2VKXA 1LD9B 2FJFA 1PJ9A 1Y6MR 4NO0B 3PL6B 3CVHH 1IKFL 5GXBB 3QA3A 3VE0B 3WHXB 1A9EA 4G9DB 3LEVL 2VQTA 2DYPD 1S8DA 4P2OA 3GGWB 4P59H 3SO3C 2FO1A 4FQPA 2Y5EA 1S7XA 3SDAB 2E8ZA 3CX5J 4YHKL 3TH4T 5IW1A 2V5YA 2XRAL 3MR9A 2G5RA 3O3EB 5ISZB 1A2YA 1ZS8B 3IETA 5LWYH 4GXUN 1G7IB 2CKNA 4J23A 5IMLB 4FQXA 35C8H 3H3PH 4LKCA 4NRXA 3DYOA 5FO9A 4Z76A 2OK0L 2RCSL 2P5WD 4S1DC 3GZKA 5B38B 3BKML 5L0QC 3GSNA 3DWTA 4PRNB 5DWUH 4NO5A 3J8F7 4AEIL 1FIEA 2ED9A 3OF6D 4GG6B 1JCKA 4RGMC 3T04D 2A1WH 2QQLL 2HJLA 1A14L 1FCGA 4RGNE 1IC7L 5BO1L 1HWGB 3TJHD 1JYXA 1PLGH 4JPIA 4N8VG 4MNQD 4PG2A 2UVEA 4RFOH 4KRNA 1M7XA 1JPGB 2AJZB 3HNVH 4KKCD 2G9HB 4IOIA 3RPKA 1T2XA 2BNQE 2NY2C 4FA8A 3S37H 5DRXB 1MWAB 3NAAH 4Z8FH 4X9GA 5GRXG 3NCJH 5F7NC 2P43B 3GSUA 4OLYL 3CLEL 5F96L 3HPJB 3QHZL 1A7RH 3H9YA 2RB8A 1OWRM 1UM5L 3WNMA 3HI1B 3CFKB 1K3ZA 2DQJL 5DQJB 1V7MH 2Q7YB 3U0PA 5DVOA 3QZWB 1GGYA 2MPAL 3O6KH 1OPGL 2HJKB 1MQ8A 1UWXH 4Z7VA 4FTVD 3C8DA 3LKNA 1XCTA 5TH2B 5A16B 3TN0C 2KQMA 4YGAB 4ZXBA 3C6SB 5IB4A 3DMMA 1TVDA 1U8PB 2VXQH 1EK3A 3DO3A 5IEHB 4WW2C 1K8IB 3O2WL 4Y2DA 1WC7B 2IBZX 4JGJA 1I9IL 4GO6B 4M8VA 3MRNA 3MLVL 3QUXA 5D93C 2EDEA 3MO1A 3MUGA 1I8KB 4JGUA 5D2NA 4RQQB 1XF4B 2FIKA 5JHDD 3IKCA 2LVEA 2FZ3A 4G8EA 1FVDB 1FSKC 3K81A 4F8TA 5J9PB 5KTEH 4KDTC 4QXGH 3QEUB 1LO5A 4NUJA 4LLVA 5ETUA 5DXWA 4BJLA 2YOCA 1WBXA 1UCBL 5EU6B 3S35L 1JVKA 2EICA 1YJDC 3GNML 3WO4C 3GBML 4QRSB 3BKCL 1AXSB 2HN7B 4IMKC 1BVLB 5JDSA 3S36L 3WV0A 4ETQA 1HK6A 2BVOA 2F8OA 1U6AH 1MVFA 4WI3A 4O5LL 5CHNB 1UWGH 3K80A 4PJDF 4OZFH 5K9OB 1WLHA 1D5BA 2R4RH 4UILL 5HYEA 4M61A 2R69L 3C08H 2BOCA 3FO2A 4FNLH 1NAMA 5KS9A 5H94A 1HZHH 5HDBF 2NW3A 2WUBL 4AM0B 4OF3A 1KEML 5TDNB 1CR9L 3KPRB 3MCG1 3O9WC 3PQYE 4KMTL 3S3JA 3FRUB 1YPZE 1DBAH 2EH7H 2IMMA 4FFVC 4U6YB 4JFDD 4DQOH 1VFBA 3ES6B 5L2JB 1FG9C 1CDGA 2D4DA 3P4OB 4RISH 5J6GA 4MVBC 2IF7A 1O5DT 4JHWH 4S1QH 5D2LA 3CFJB 1YC8A 3VXSD 5D7LB 1AKJB 4XCCL 2YD8A 2YK1H 2HKFH 3MV7A 5T3ZL 1OAKH 4JFFA 5ID0A 4W4NA 4K7PL 4PD4J 2W9EH 3S96A 1KJ2B 4ZSOE 2WBJC 4N8VA 2XA8H 4KQ3L 2HFEB 1Q0XL 5C86A 2JB6A 4LSSH 5I73C 3GMMB 4P23D 4PLKD 2DQEH 1BD2A 1MHCA 3HS0B 3EYUL 5FOBB 1FFQA 1X5JA 2V2WB 1AXIB 2ZCKH 4JY4A 2DM7A 3H7BB 3H9SA 3KPPB 5DYOB 1JUFA 1RVFL 3ARZA 2XTJE 4MCYB 4LNRB 5TE6H 3BX7C 4N9GA 4ZAKC 2VXSL 4O2CA 3F7QA 1SJXA 3MJ6A 3QEHA 5H2BB 3ZYZA 3TN0A 1U91B 1KF9B 2NY6B 4NZRH 1A7BA 5IR1A 2QL1A 3AROA 4N5UA 2NY3D 4ZUTB 5AZEL 5I18H 1LO4H 3PJSA 4KTEL 4R8WL 1KIRA 1QSZA 1FC1A 5I15L 4YPJA 4WW2A 1A6AB 3L3IA 3MXVH 3FQXA 3T1WA 1X5IA 1WQVT 4LCYB 3G08A 1F4XH 1YEFH 4Z7UA 1YYML 5DEGB 4Z0BH 3LRHA 3AUVA 1OAZH 5A2IH 3GIVB 2LVCA 3WKNA 5I2IB 3TZVD 2C4FU 3LV3B 5EBWB 2VDPH 1OGTA 4YO0A 5I1DB 3O6LL 2AJVL 1DL7L 1FYHB 2UVFA 1OCWL 4N68A 1KIPA 1VA9A 3RGVB 1HXYA 1FV1A 4KDTA 1KBGH 3VD7A 3QIWD 3C60B 3MJ7A 1Q0YH 1KN4L 2AERT 3QO1B 4XXDA 3CU7A 2X9YA 2V7NA 2OTUB 5M94B 3Q5TA 3SDYH 4YE4H 3P4MB 4PJEB 2YPKB 3LKSA 3GSOA 4XI5C 3PDGA 5C08D 4O02L 4OZIE 3K8MA 5BV7C 1FGVL 2OQJA 3KYNA 2I9TB 1FNHA 4Z7QF 4PJXB 5EN2A 1MJUL 1R24A 1D6EB 4PJ9C 4OFYD 1UWEH 3PE9A 4V1DE 4D9QE 5BOZG 2B4CH 2M2DA 1F4HA 2XA3A 2KDGA 3VW3L 1WFNA 2CGRL 2UWEB 2VLJD 4IOFC 5EWIL 1WZ1H 5LG1A 1NMAH 1CS6A 4P3CH 1FGNL 1CK0L 4PRAB 4TPRH 5FB8A 3DURA 4L4JA 4BH8A 3VD4A 3GMRB 3O9WA 1M6OA 4OIBA 2WIMA 1FLTX 1I1YA 1MHHA 5GS0H 3DX6A 2PW2A 3I50H 4R7NA 1A47A 2AK1L 2ICEA 3CFDB 4NZJA 3VFOA 4YGVA 4NNPL 1MPAH 4PRBA 4DZBB 1P4IL 4ONFH 1I3UA 4PJFF 3P30L 5HGHA 3MRDB 4MCZB 2FB4H 2YBRB 3VI3E 3RTQB 3SDDB 3RZCB 3MJ8A 4KK5C 2IANA 3ZYIA 2FEEI 4HJGA 3VMPA 4KKAC 5E5MB 3WIFB 3VXMD 2X4OA 1MCPL 1DBML 5FFLA 4UZGA 3ZE1E 4LPXA 5ELIA 1N64L 4GMSL 4S10A 1EZVX 1XGQA 3RUGE 2YSSB 2WBJA 1LGVA 1P84K 4M7ZC 1NPUA 1MFBL 4JN2A 4PJHF 1T20A 5D71L 1HOCB 3GSQB 1KT2A 4FXGA 4FS0A 4WTZG 2A83A 5DJZB 5F3BB 4U1HA 3MV8B 4LSVH 5GRJH 3C5SB 4CDGC 4XAKD 3TNMB 2W59A 1IBGL 1NANH 4ONHB 3ARDC 4L8DB 1MELA 3PABB 4JO3L 3OKOB 2AJXH 3QHFH 1DQQB 4ZAKA 3T0ED 4JM2C 3IF1A 1OARH 3LSOA 1JWSB 3O3DA 4MX7A 5I8OL 4J8RA 5ANMB 2C1OA 2ORBH 3ARGB 1KJ3L 2H2SD 5AYUH 3EYFA 4WTXA 5HI3C 2QQQA 4ELKB 1BPVA 4YEEA 1OT1A 4OCLC 3TNNB 4P9HL 1JTPA 4AQOA 1EBPA 1MNUL 2BNUB 1GHFL 1QRNE 1KPVA 3B5HA 4M7LL 4MDJB 4MSWB 3RWEA 3WFBL 5CD3B 1KG0B 2V9QA 3MLWH 1XF5B 1NMBH 1NLDH 1GZPB 1MWAL 5HHPB 5J57B 2CUMA 5D1QC 3CSPA 2BHZA 3CMOL 4G8IB 4WDIB 3OR7B 5T3XD 2EYTB 1CXKA 3W81A 1NBZA 1RUKH 3BRFA 1J8HE 4LSDA 1JWMA 2EO1A 3ARVA 3SDCC 4LSRL 2IG2H 1YNKH 3MV11 1UM4L 3IGAA 2AK4E 4YHYB 4YUEL 4DKEL 4GRLD 1LEGA 1UXWB 1CL7H 4OUUA 3TESA 1S9YB 2GAZB 2NZIA 3LS5L 4ZOEA 1YMMA 1RJZB 4QTIH 2ZCHL 3VXUD 3ULUE 4UQ2A 4PJ9A 4KTDL 5FA4B 1BP3B 2AV1B 4CW1B 3ULVD 4ZPVA 5DMYA 2F58H 4X8JA 3L7EB 5DJYB 5L2KB 4L4VD 1YN7A 3MACL 2FGZA 1U8KB 4FFZL 4B0MM 1EJOL 4NQDD 3UTTB 2WWMC 1HXMA 4HEME 4POZC 3BZEB 3FT2A 4WJ5A 5DK3A 2PR4L 1MFAH 3VI4E 4X80L 5EUOF 2XYCA 5I17B 2E9IA 5C0AB 4F7PA 4CN1A 2GTWB 5JHLH 4GW5A 2OZ4A 1QO3A 1OY3B 3QXTA 1A7PL 3RVUD 1UVQA 3FOMB 4XP9L 4QGTA 5D1ZA 2PTTB 4X98B 4EDWH 5E7FA 5I1CH 3CVHB 5F9OH 3P11L 3QNXB 1MLBB 3D9AH 1QEWA 1GGUA 2X42A 5D9SB 3KXFE 3MLUH 4P2QB 5D7JB 4PREA 1Q9OA 4WHTA 2CMRL 5DSCA 3S4SB 2W91A 4L29A 1DUYB 2YRPA 4IEFB 3Q0HA 2A73A 4HHAA 4QEGA 5A3IC 5C09A 2CLZB 4WTZA 5E7BA 2GSGA 4KKBC 3G6AB 1NDMB 3OBAA 4P2RE 4JFEE 2Z92A 3NZ8A 4ORGB 4JRXA 4D9LL 1ADQL 4M1CD 1OGAE 2A38A 2IAMB 5EOCJ 5ACZA 1T66C 3ARDA 3F7YB 5HTSA 3HMXA 4PBWD 3MRRA 5HY9A 1AGEA 1T0NA 3PF2A 1JRHH 2JCCB 4JM2A 3C8KB 5FKAA 3BW9A 4XNYH 4JY5H 1RIVL 3HNSL 3OZ9H 1QFWM 4K94L 1Q72L 2WLZA 3KDMA 1CGSL 1KJ2L 4KC3B 3MBXH 2AXFB 4BFIA 4XP6L 1YECL 4TNWF 5HGBA 3IU3A 3S88H 4OAWA 3PQYA 5HHVL 2BFVH 3VFWA 5HYSB 3HZYB 2A6JB 3K1KC 4GKNA 5DUMH 4GAYA 4WEMB 3O8XC 3MRIA 2P24A 3DYMA 5D1QA 4GAFB 2V2XB 4HKXB 2GFBB 5TPWH 3HE7A 5B4MC 1GCFA 2FX8H 2A6IA 5EU4B 3F58L 1A6VH 5HHNB 1FFNB 5FECB 3WD5L 4RMTA 4LLYA 4P46B 1CT8B 1IAKA 5IBUB 3JWNC 2FLRT 1BQLL 4JZJB 4H8WH 3MCLH 3SDCA 1NC4D 1AC6A 1RQ5A 4HS8H 3RWDB 4OV5A 2ADJA 3SGDH 2WMPA 43CAA 3GRWH 1JL8A 4MJ6B 4NO2A 4OCWH 4OB5H 1ACYH 5LBSH 5EUKB 4H1LG 4DUXA 3OJMB 5DJ6B 4DFHA 3R1GL 2ZSWB 1IAOB 1TTUA 1M7IA 3SE4A 5DHYB 3VRIB 1MCHA 2NLJA 3L9RB 3ROLA 1H3GA 3REWA 1BVZA 4M43H 4YAQA 2EH8L 4LHUG 3UPRA 1EEYB 3MFFB 4LKXB 1JV5B 5GZND 3PGDB 4P9ML 4HK3J 4UINL 3W39B 4GQPH 5C0FB 1EFXB 1S78D 2PO6D 1Z5LA 4YR6A 4M62L 5IB3B 3CSBA 2Y7QB 3IFNH 1PG7X 4WU5B 2AJUL 1F45A 3C9NB 5BJTA 5KSAC 4NYLA 4WI8A 1T6VN 4HQQH 5FUOL 2CD0A 3ISWA 2GSIA 1C1EH 4R4BB 4FMKA 4HS3B 5KZCD 3ZKMD 2X4QB 2XWBB 3BFOA 3GI9L 5E9DD 4DEPC 2JJTC 1KC5H 4EN3B 2DAVA 2VTFA 4HUWA 4R96A 4ZUVA 1VGKB 2K9UA 5GS1C 5MERA 3UTSE 2BNRD 1BLNB 4NFCA 3X3GL 1S7VB 3MRMA 1IL1B 4M5ZL 2ZG2A 4OZFB 3H6JA 2B1HH 1BQSA 3QQ9C 4G8GB 2M8XA 4GKZB 2PKDA 12E8L 1OAYL 5CILL 3NCEB 4G6JL 4XVJL 5FYKH 3HC0A 4C4KO 3QUZB 3U36A 4OZIA 2V5RA 4MXWH 5I74C 1B0RA 3SGEH 4F37K 2WQRA 4XZUB 3RX7A 3O3AA 4WHYH 1XH3B 1A4JA 1G9MH 4LBEA 3ARFD 5SX4I 1CGXA 1FFOA 4LASL 3B2VL 4X7SH 4XVUD 5FGSA 4WU7B 4Y4FD 5I19H 3D69A 1N5AA 1P2CA 4DKDC 3QDJB 5MENB 1T4KB 1XCQB 4Y2OA 1VEMA 1Q9WB 4TTDD 3ZT6A 1RZJC 5HGDB 4NQED 4MXVF 2R0KL 1BQUA 1LO3H 3W0WB 3BH8B 4PJCB 5HHXL 4PJ8B 5HYQB 4GLRH 5IIEB 1IFHH 4M6OL 3MA9L 4DVBA 1N59A 1JTTA 4ZO7A 3ULSA 5FM5O 2R4SL 3CFBA 4L8SC 2CR3A 2G60H 3HUJA 3T2PA 3LEXB 1IM3A 4GG8B 1A5FH 2AKRA 4OI9A 2XWTB 3NA4A 4Q2ZB 2MFNA 5ICZA 3Q1SH 2YEZB 3UXFA 4EI6B 5T3ZE 1F42A 2OSLA 4RDQF 2ESVB 3B3IB 3FB6B 2B0SL 1FE8H 4XCNA 3GHEL 4TUKH 5IM7B 3K4ZA 4K3JH 3BP6A 4KPHL 1KXQE 4UI2A 1IAIM 4GW4A 5JO5B 3DTXA 1QACA 1MLCA 4PGDA 4NQXA 3EDJA 1AQKL 3IB4A 3LD8B 2ICWB 4H1LA 2D9CA 4JFPB 1FLRL 1A3QA 4NN7C 2Z8SA 3EYQD 2MCG1 7FABH 1MCDA 5SX5K 2YRZA 3L7FB 4NWUL 3W9EB 4LHUA 3DROB 2VDRH 4UDUB 2V9RA 4ZODA 3V5HB 1IEHA 3T2NL 4PY8J 5TF1L 3D3VB 5C2BL 1LEKB 5ADPH 5IK3A 4CMHC 5DF0A 3TWCL 1QSFD 2VL5B 2J7LA 5KSAA 3AU1B 4OD3L 5D5MB 2FECI 1RIHL 3NIDF 3VFTA 3MLRH 5F9JA 3VCLB 2B7DT 4RAHA 4KJQD 1KLGB 3UC0L 3P4NA 4U1MA 1Q8MA 1FG2B 2FEDC 4PJAB 3CPLA 1BBDL 4ODTL 2GITA 2JJTA 4G42A 4JB9H 4KV5E 4Y1AD 2RFXB 4NUGL 5F1NA 1GOGA 4N90D 3UYOD 1CFQA 5GS1A 2AQ2A 4PS4H 3RWCA 5ESAB 1J8HA 3RL1B 4RBPH 4ZPTB 1T1WA 4EI5C 3DVIA 5E94A 5EZLB 1DTUA 2HVJA 1X4YA 5HVHB 1JWUB 5FUZH 4GBXC 5CMAA 1YEGH 4LSTH 5D96C 1LK2B 2EC9U 5DD6B 2AK4A 5K93A 3SGKA 1L7TL 4N0UE 3OR6A 2DIJA 4ERSH 2G75A 2X4RB 5IMMA 1J86A 3O81A 1U3HB 5E2TH 1HQRA 1NCDL 2PETA 2J88H 2B2XL 1IEBB 4JFXA 3LOWA 4K7PY 4Y5XB 1S9VB 2H6PB 2VZ3A 3L95A 2HT3D 4IRJD 2J4WH 1VFAB 5D7SH 1UJ3C 3WEXB 3O4OB 1G7HB 5ADOL 1J0KA 4LCWE 1MRFH 1Z9LA 1IQDA 4OBSA 4EOWH 4KK8C 4PRPA 2WP3T 4JO2L 5EPMA 4JVWA 1I7UB 2IPUK 3IDGA 4TN9A 1NDGA 4CVXB 3L5XL 1VEOA 1PQZB 3PWLA 3RIAK 4PRHD 5J11C 5LWYL 4MZ3A 1P7QD 4MAYC 4Y4HD 3KNBB 3FONA 3H7LA 3V4UH 43C9B 35C8L 1MHEA 3H3PL 3QUKA 4RZCB 1U8QB 1TZHA 5DGRA 1ZSDA 2YPLD 2PXYB 2VABB 4JHZA 4YHLH 1P9MC 4FRWA 3VXOB 4NQCE 3B5GA 1GZQA 5DWUL 2NXYD 4NQVA 1HDMA 3LMJH 6FABH 5ISZE 2DWDA 5LQBH 3WJJA 3TFKC 1S7QA 1QFWH 1CIUA 2GK0B 5KANG 4J4PD 1JYNA 4BQ8A 2IPKA 2JIXD 1GGTA 1W0WA 3DGGA 5JMOC 1U8NA 2DWEB 3ZDYE 4MQXC 4O9HL 1UYWH 3BP4A 2QADD 4U7SA 1QHOA 2OJZH 5CGYD 5KSBA 4QT5B 1U58A 4JFEA 4S11A 2XZQH 4CVWA 4FQLH 3MC0A 5FYKU 1OGAA 1WWWX 3NAAL 4DKFL 3NCJL 5EZIH 1CXHA 1WK0A 5C07B 4ZUWB 3SKNA 4G80B 1OD7A 4OI7A 4OCXH 3PNWB 2BX5A 1KFAH 1U36A 1QLRB 1K8DA 5B3JF 4WFGE 3FO1B 4ZNEE 4TVPD 4HZLB 3WJLC 3MYJA 1H0DB 1YN6B 4UT9H 1EPFA 1I4FB 3TJEH 1TITA 1R3HB 1ZT7B 3AAZA 2ADFL 4R90L 4L4TB 3JUYA 4F3FA 1RK0B 1DEEA 1CWVA 4JO4H 3TBWA 1YDPA 1J10A 2OL3H 4K3HA 1T6WA 2DTSA 5E5UB 1XZ0B 4FQJH 3MRPA 4QKXB 4J1UB 4NSKA 3AB0B 3JV4A 2XIDA 1RPQA 3THMH 4F2MA 2JB5L 2C3HA 3TH2T 2BOBA 3GK8L 5F7KC 3VXQA 5KVGH 4GUPB 4WHCA 3WL9B 4EI5A 5C0IA 8CGTA 2LE9A 3OV6A 4GBXA 4AIOA 1X44A 4G9FE 4PJ5D 3QEGH 1HINH 2VLME 3OJVC 2BC4B 4LIQL 5M95B 4HV8A 4G5ZL 4O2EB 1OQOA 1TQCB 2NY5H 1JI1A 1LDPH 1JZ8A 4XPTH 5DZLA 2I25N 3QDGA 3KR3L 1RUAH 2Y36H 3NVQA 2PYEA 4LVNB 4HJJH 5JW4R 4LQ1A 5E2WL 3GI8L 4XT1C 4OQTA 3NA9L 3I02B 4OZHA 2AQ1A 1G6RH 4H88L 4OZGF 3TA3D 1K3IA 4LLQA 3WFEH 4B7LA 2ZUQC 5JIIA 5JORB 5E03A 4PJIF 1RZ7H 5EC2A 1R3KA 4PJDB 4C56B 4NP4H 3A6OA 4WGWB 3SKMB 4PJHE 1IGYB 4NBXB 1VPOH 3MLYH 1A0QH 3PDOB 1WIOA 4N0YH 1A4KB 4ZQKA 2XWJB 3IDYB 1AGFB 2NW2B 3CCHA 2DQHL 2RJMA 5A1AA 4MAYA 5DC0A 2V7HB 4FQCH 4YBHA 3CJJA 3W11C 5C6TH 1V7NH 3UTSA 3O4LB 1H9VA 3BN9C 1DBAL 4KVCL 2KKQA 3E6HA 3ULVH 1MFCH 3PV6A 2F53B 3BHBA 3G04B 3KPTA 2NY0C 2AEPL 2CIIA 3ARBC 4ACPA 1DSFH 5F7MC 5CUSL 1UH4A 4BFGA 3OX8B 2ZOKA 1R5IB 3QHTC 3L3JB 4C58B 5C0JA 3OG4B 1IC5L 1Q94B 5EU7C 5A2KH 3JWOC 1LNUB 3VXRE 1NH6A 2APBA 5IMKB 4YFDB 2FD6H 4AK1A 2MQ0A 2XA8L 1CD1B 4W6WB 1AXTH 4HBCH 5IW6B 3VXPA 1Z0MA 2EE6A 1S7WA 2XN9E 2HMID 3UO1L 4YWGL 5HGAA 3V9FA 3B9KB 2HTKC 1A9BA 4ZFFB 2VH5L 3KLHC 2EIBA 5D7KD 3DSFH 1R6VA 1I1AB 4HGMA 5C0DA 3LPFA 1FZJB 3JTSB 3HA0A 2J5LB 1ZVHA 5BS0D 1DBJH 3CX5K 4U1IB 4P5TC 1IAIH 2Z31D 3WJLA 1FO0A 1JN6B 1QBMH 3WNPA 4AH2A 3NCCB 4L1DA 3PL6C 1DBKL 2P5WB 4NZRL 4BSWB 2H2PD 5I18L 4NDMB 3MV01 2VZVA 3KYMB 1XF2B 1L9NA 3LIZH 1BGXH 4HFUL 3MXVL 1UB6A 3SDAC 2HFGH 1ZLVH 5HDOA 3WE6B 1YEFL 1K4DB 4LARH 4FZEH 4Z0BL 1E4WH 1OAZL 3KYOB 3R4DA 4FG6D 4ODWA 4KK6D 3E1F1 1BIHA 2N4IA 3NFNB 1QVOA 4OGXL 2H3NB 4YQXH 4Y19D 4JQVC 1PG7L 5HJ3A 3U0WH 4LSUL 1KJVA 3GDBA 3VFMB 5B38G 2W60A 4JO1L 3BGFB 3MX0A 3OKMA 4R4ND 1KJMA 2FWOA 1ZHNA 5C8JA 4CN6A 3IFLL 1OP5H 1WWBX 1SEQH 1YEJH 4P4KB 2DLEA 5IESH 1GGBH 3NTCH 4NN6B 4OF7A 5DO2C 3ZKNC 2HT2D 4I0KA 3EYSH 1ZVSB 3TBYA 1IILE 1JF6A 4QY8A 3WSQH 3L6FB 3UTQA 3MLXL 3AXLB 3HTLX 5T1KB 5J1AA 1U2HA 5I0ZA 3S3SA 1XGTB 1TTGA 1HYSC 2CK2A 5HPMB 1ZA6A 2YMXH 1NGWA 3BEWB 5BMFH 1T1YB 4PJEE 1NMAL 5DUBB 4B7IA 4OKDA 3IDNA 5DVKA 5IB5A 4U2ZA 4S2SA 5EO0B 2PCPB 4PJXE 1XGUA 3ZTJG 3X3FH 4U1KB 5J3HD 3IAGC 1F6AA 1CZ8H 3F12B 5HHQB 1T0MA 3QH3B 5K9QG 3S5LB 3MRLB 3LHPL 3ARBA 4ONFL 2UWEE 4M1GL 4IJ3B 5FO7B 2IBGA 1D5MB 2YA0A 1KLUB 2P7TB 3UAJC 3N85L 4IHOB 3WS3B 1NCAH 2Y5TB 5IVXF 4BSVA 2Q6WB 2A2QT 3HZVB 1ZE3C 4JJ5B 1TETH 2R2BB 3P4LA 1KTDA 3VG9B 3V4PL 3U0TB 3BP7A 3QDME 4X7TA 1BX2A 3QCTH 3FN0H 2EDHA 3MRJA 3S34H 3KPQB 1A6ZA 4LF3A 4K8RD 3MRQB 3S8WA 2BVQB 5GRJL 2QEJA 1DLFL 5I16A 1Z3GH 1W72H 2VDOL 4PY7A 3QFJD 3I75B 5LGKA 3IU4H 5EIIB 3ZMRA 3A6CL 4R9HA 3QG6A 3QHFL 4LOUD 1U8OA 5DJ8A 1N3NB 1OARL 2HLFD 4OLWH 1U8IB 4XNMB 2FR4B 1LD9A 5C0CB 3MRBB 5AYUL 1IGIL 3L5HA 4NO0A 3PL6A 1YNLH 1M4KA 1R3LB 4ZTOH 3VWKD 1X4XA 3VE0A 3WHXA 3IDMB 4G9DA 1KCUL 1WFTA 5KW9L 3HLAB 1NGQH 4HWEH 4QRRE 3GGWA 4WTWA 5I9QC 3MLWL 1NLDL 1OP3H 2P47B 3SDAA 1QBBA 3VXSB 1G7JB 1CN4A 5MHSD 2JJSC 1T21B 3RQ3A 3O3EA 4WI2A 1ZS8A 5ISZA 3QIBD 4XVTL 3VDBA 3RVXD 4N0CC 3GIZL 5ANME 3C6LD 1AD0B 5F7FA 4CADB 4M1DH 1G7IA 4R3SB 1FVEB 4JQVA 1Q1JH 1QP1A 4UOW0 5L9DH 3NIFF 1N0LA 1W8OA 4R2GD 1CLZH 3U7WL 5F9WB 1YNKL 2YUWA 4P23B 3KJ6H 1C08B 2OLDA 5B38A 1NCCL 3RHWK 5JQ6H 1RZKL 4K9EC 4PRNA 4PV9B 4JDVB 4QYOB 3GBNL 1MEXH 3GMQB 2DBJA 5EFIB 1QNZL 4TNVK 2ZJSL 4GG6A 1CL7L 1ETZB 1VFMA 2NX5D 5T1DH 5FCSH 2YD4A 4J7RA 3G6DL 2CIKB 4QRPB 3VA6A 1J1OH 3L3HB 4V2CB 2DMBA 2ZCLH 5DHVH 2VLKD 1ED3B 1JPGA 4ZNEA 5HSFA 2AJZA 3VH8B 2G9HA 2A0LC 3GKWH 2AXJA 5DRXA 1M7DB 1MWAA 2F58L 5F3HB 3HPJA 1N8ZB 3R06B 4BUGA 1KIUA 3HI1A 4RX4D 3CFKA 2Q7YA 5DQJA 3A67H 4KJYB 3UJTH 5E2JA 1MFAL 3QZWA 5LKNA 2FX9H 1NMCB 3G6JB 4OFIA 2HJKA 1RIUH 4M6MH 2YD5A 3O6FB 3QNYB 1EX0A 5TH2A 5JIHA 5A16A 4EDWL 1MFEH 2NY6C 3QQ4B 5L2KE 4QHKI 1X5XA 3C6SA 4I9WD 4NBZB 2BSTB 2APWA 1U8PA 3UTTE 1YA5A 3D9AL 1DJSA 1MCEA 1K8IA 5IEHA 1P4LB 1SMAA 1E6OL 1WC7A 4GRWH 4B41A 1I8KA 4RQQA 5F89A 3T0WA 1XF4A 3QIUB 4ZS6D 3WMSA 4I4WB 5C08B 1SVZA 2CJUH 3BDXA 3EDFA 3DRQB 4QHUB 1FVDA 3OGOE 4XXCC 5J9PA 2IBBA 1J5OH 3RGVC 1AR1C 4OCSH 4KJPC 1FZMB 3C60C 4P2QE 4XB8A 3QEUA 4AL8H 1E4KA 4MA3B 3FRPA 1OLLA 1VDGA 1U41A 3UTPE 5EU6A 3EFFB 5IT2H 3MUY1 4HKZB 5GISH 1G0YR 4QRSA 4XNYL 5F6HI 1IAMA 1AXSA 2HN7A 1BVLA 3OZ9L 3RVVC 1ZT1B 4WWKD 1WZKA 4LP5A 3SDXF 3SKOB 4KHXL 3S88L 4LPYA 4UV7H 5CHNA 2BFVL 5DTFB 3A0OA 4PG9B 2IH3B 5K9OA 1B90A 2OCFD 2V17H 3JV6B 4XPBH 3SEPA 3KHOA 3BGAA 1E4XI 1D9KC 2R9HD 3F62A 1F4YH 3P0VH 4S1SL 1P7KB 2FX8L 3LCYA 4HUMB 4R26H 3CFCH 1A6VL 4KTYA 3RY4A 4AM0A 3RGHA 4XNZB 3TIDB 2CSPA 1UXSB 5TDNA 3DX7B 5GHWH 1BWWA 3KPRA 5F71A 4JFOB 3MCLL 3FRUA 2RBLA 4HS8L 4U6YA 4WFHE 3MOQA 3QP3A 2UY7A 3PWVB 2MHAB 2Y6SD 3ES6A 3KPSD 4Z7NF 4G3YH 3P4OA 1Y18B 1HE7A 3Q2CA 5E99L 4DOHB 4JAMB 3FFCB 4JEGB 4FQ2H 3CFJA 4XX1E 3RTQC 3SDDC 3RZCC 4XNXH 5D7LA 3IAQA 1NUDA 4NFBA 5JOFB 1FCCA 5TFSH 5JXAL 3E3QC 1KJ2A 4HWUA 3E8UH 4JZOB 3RA7H 2AABL 4EVNB 2HFEA 2C3GA 4RWHA 5IOPB 4YHML 3GMMA 1KXVC 2C1PB 3TBTB 4JFHD 1UKTA 3EHBC 3LN5B 1WBZB 3HS0A 4ZD3H 5FOBA 4Z9KB 3H3BC 4HQQL 4NKOB 2V2WA 3RJQB 1DR9A 4RAUB 1F4AA 3H7BA 3KPPA 1HHGB 5DYOA 2HWZL 4PLJC 4MCYA 4Z95L 5JLZB 4LNRA 1KC5L 4APQB 3DV6B 4Y7MA 4WI6A 5H2BA 3O6MH 3MR9B 4P2OD 4TVPH 3ARGC 2M1KA 3K4AA 4PPTA 4CJ0A 5F6IB 2YXMA 1U91A 1I3GL 4LIQE 4ZUTA 3V7MA 5MI0B 2DICA 1A6AA 1N0XH 4GRLB 1MJ7H 1UKSA 2H32H 4LCYA 1I1RA 1R3IH 1JPSH 5DEGA 5CLWA 2BVUA 3KLSA 5FM4A 3GIVA 4FQXD 2BP3A 1QOKA 3I3BA 5I2IA 1CBVH 3WIHH 5AG9A 1JHLH 2VXUL 5FYKL 3LV3A 5EBWA 3VXUB 5I1DA 2NXZD 1SY6H 4XXCA 3LH2L 1MI5B 1WAAF 5DURB 3RGVA 5CZXD 1P4BL 2Z35B 4X7SL 1BVKB 3C60A 2VNCA 4G8GE 1HIMH 3QO1A 6CGTA 4L3EE 3ROOB 2VUYA 4YHYC 3T3ME 1J0YA 2OTUA 5GGQH 4L4VB 2VAJA 4NQDB 2Z9TA 3P4MA 4PJEA 2YPKA 4RNRB 5CZVH 4M7KH 1LO3L 4G6FD 3DETC 4YBQC 1HHIA 1KCRH 2I9TA 4D0DB 4PGBB 4PJXA 2X05A 4DVRL 4I2XE 1FH5H 2C26A 1D6EA 2X1XR 4R97B 2Q8AL 2HH0L 2MMXA 4S1RH 5TE7L 3U1SH 4D2NA 3QDJE 4NQUA 5MENE 3CVIH 2UWEA 1GVIA 5B22A 3TIEB 4ENEC 4Y8AA 5EA0H 4OIIH 1JZ7A 2NMSA 5KJRH 1P69B 3QPXH 4CNIB 4PJCE 3Q1SL 4PRAA 2BZDA 1FNLA 4PYHA 4XGZB 5DT1H 3GMRA 3M17B 2BXYA 4TUKL 1HQ4B 4ZXBD 2EE3A 2GJ6D 1QLEH 3CFDA 2ICCA 2I60H 3LKQB 4DZBA 5HYIA 4LPVA 1K5NB 4Y2DD 3MRDA 4MCZA 2YBRA 4OD1H 4YPGB 4C4KT 3RTQA 3SDDA 3RZCA 4U49A 5MP6H 5F93C 2V5SA 3PP4L 2GIYA 5E5MA 4JPWH 3WIFA 2ESVE 3OAZK 5D7JC 2EIZB 2VDKL 3S4SG 1FL3B 2DLIA 3SCMD 1RV6X 2YSSA 1AE6H 2AXGB 4LLVB 3VG0H 4NC1E 5D1XB 3O41B 5J7CC 1I9JH 5FHBH 4ZYKB 1HOCA 3GSQA 1HNFA 3G5ZB 5SWSE 1I8MB 5CSZB 5DJZA 2V5TA 2R0ZH 4Z7WB 3HG1D 15C8L 5F3BA 1HHKB 1NL0H 1CFTB 3MV8A 5I8KL 3HHRB 5JDSB 3FO9B 4JRYD 3BJ91 1TJGL 1ULVA 3C5SA 2LV4A 3TNMA 2IAMC 2QHRH 4KK9D 4ONHA 3I6LE 4L8DA 2YD2A 3PABA 1I3VA 3SO3B 2O5YH 4JB9L 3OKOA 4Y5YB 1DQQA 3N1PC 3BQUD 1VB9A 4Y0GA 3KJ4B 1JWSA 5ANMA 3ARGA 2ZUWA 4ELKA 5CSGA 1FNSH 3UTOA 2FO4B 3TNNA 5HYSG 1T7VA 3QCUH 2BNUA 3DPBA 4MSWA 4I8DA 4MDJA 1N2RB 1F58H 3B2UC 5CD3A 3CC5B 1BAFH 1RY7B 1KG0A 1XF5A 4PJAE 1GZPA 5HHPA 1YEGL 1EJ6A 4LSTL 5I66B 1FRGH 4G8IA 4QOKE 3K4DA 4WDIA 3OR7A 3BSZH 4MD0B 2J8OA 2EYTA 4ERSL 4S1DD 1BFVH 2Y25A 5D72L 5FYJL 4P46C 4HT1L 2J88L 4OGZA 4RGMB 3CU1A 4JZJC 3QXWA 2O26U 1SYVB 1DQDH 2J4WL 1CFBA 2E9WA 4YJZL 2VAAB 4S0TD 3LKOB 5D7SL 4U2YA 5T5NF 3V6OC 3MNWB 5CBAB 1MRFL 1S7SB 1R0AH 1UXWA 1GC1L 4MHHG 1MIEH 3WN5B 3VFSB 4NWTH 3MLZL 5KZCB 1Z0NA 1S9YA 2GAZA 5E9DB 2I24N 4OSUH 1RJZA 2W0LA 1T7XA 3JTTB 3CSYB 4XMLH 1QTYT 5FA4A 4M6NH 2FHFA 4UUJB 4GQ9L 2RQ8A 1T03H 4FFYL 2AV1A 3BYYA 3S3PA 4CW1A 4JREB 1CD8A 4WUUB 1P5VA 3VFPB 3L7EA 5DJYA 3V4UL 1G7LB 1ORSB 5L2KA 1QHPA 1MIML 4DN4H 3VGHA 5AAWA 4M7LT 1U8KA 4JQIL 1ZT4B 3WDIA 5GPRA 3UTTA 1W72B 5CEYB 3BZEA 1BIIB 5E70A 1JNHB 3RVWC 3GMLB 5I17A 3CZFB 6FABL 3GUTB 5C0AA 4EN3C 5I8CB 2Y72A 2GTWA 1T83C 1CFVL 2BJML 3FOMA 5TQ0L 5KOMC 2PTTA 2HYMA 5E4EB 4X98A 4WO4C 3CVHA 3QNXA 1UYWL 4BQCA 1MLBA 3NFSH 2OJZL 2X1WL 4Y4FB 4CGTA 1JPTH 2VITB 2V2TB 4DKAA 2CO7B 5D9SA 1ZK9A 1ZLUK 5D7JA 4P2QA 4FQLL 4KQ4H 1CXIA 5TDOB 3S4SA 1C16B 4NQEB 1DUYA 4HBQA 4KUZL 3P40A 3DXAE 3PGCB 5F88B 1YEKH 2W92A 3N9GH 3QUZC 2UZIL 1GGCH 2CLZA 3OKEB 1N4XL 5DFVD 3G6AA 1NDMA 1A3LH 4ORGA 4MB4A 3TJEL 4I48B 4K8RH 2IAMA 3D85B 4U33A 3E2HC 5IVOA 5FYLL 3F7YA 2WNGA 2ZSVB 3TT3H 5GGVH 1XIWC 2JCCA 2M26A 3C8KA 5A43C 1K6QH 4Z7VF 3FCTB 4PJ8C 2AXFA 5L7XH 3Q6GH 3RIAF 1H5BB 4GSDH 4LK4A 5KVGL 5DHVB 5IB2B 4DGIH 3ILQD 5HYSA 3HZYA 4L4TE 2A6JA 5I1KH 4CAGA 3AC0A 1TCRB 1HINL 3FOLB 4HH9B 2FYYB 2V2XA 3IS0X 2GFBA 4HKXA 2ADIB 1OTUD 2X70B 3O9WD 5EU4A 2WLYA 5SWZE 2VLRA 3D48R 1UADC 5HHNA 1FFNA 3O45B 4FFVD 5FECA 2NY5L 2X6MA 4RGOH 4XPTL 4P46A 1CT8A 3NGBB 4JZJA 4X0KB 4HJJL 5E2VH 4W6YB 2ZOLB 4BELD 3DO7B 3RWDA 2IAND 1RZFH 2OMNA 5FGCE 4NCDA 4MJ6A 5IVXE 2EDOA 5FHAL 4F7CB 3V6OA 1NEZG 5EUKA 5I73B 3LD8C 5DJ6A 4PJIB 2ZSWA 3ZE0F 1IAOA 2R56L 3X12B 1MCNA 5DHYA 3VRIA 4NP4L 3L9RA 5FO8B 3TCXA 2D7MA 2X1PA 3S7GA 4Y1AB 1EEYA 3MLYL 4GRWB 2RHEA 3MFFA 4LKXA 1JV5A 2HVKB 4Z7OF 3PGDA 1DQJB 4PGEB 5C0FA 1EFXA 1O7SA 3NN8B 4ODSH 4JFYB 2XZZA 1FAIH 4FQCL 5IB3A 2Y7QA 4WU5A 3C9NA 3TF7C 5KS9F 5INCB 4J8RB 3IXAB 4ZTPL 4C56E 2EKJA 4ZAKD 4R4BA 4HS3A 2X4QA 2XWBA 4HLZG 4EN3A 2A9ML 3QBTB 1JHTB 1T83A 3T0AA 1VGKA 1MF2L 4JKMA 1BLNA 5D2LF 5CINH 1KGCE 4NHCH 3WLWC 4KKLD 3MMEB 2F53E 1S7VA 3DUSB 2FLBT 1AXTL 3NIGF 1IL1A 5HVHC 4OZFA 2B4CC 2AW2A 5AEAA 4YEFA 1SJVA 1T1ZB 4G8GA 2EXYD 5C0BB 2DQDH 4GKZA 4RGND 5HHME 1EHLL 4XWGL 3DSFL 4OGAC 1U3HC 3QUZA 25C8L 4XNUL 4YBLC 2L7UA 3BZFB 4PRHB 2BNQD 4XZUA 4ZMAT 4MJIA 1XH3A 4XTRD 3TO4D 4Y5XC 5JXEC 1P7QB 4OCYL 2XACC 1QBML 5GS0C 4ZFGH 1T7YA 1V8HA 4WU7A 3AGVA 3VXNB 2YWYA 5K59F 3O4OC 4CL7A 4UBDC 1NBQA 4KY1H 3QDJA 5MENA 1T4KA 1XCQA 5KVEH 1Q9WA 1LK3L 5HGDA 3LIZL 1BGXL 4PJBF 3K3QA 3W0WA 1I7TB 3BH8A 4PJCA 2NXYB 5F8RC 4PJ8A 5HYQA 2HFGL 2FSEB 5IIEA 1KENH 3SKJL 5CIPH 2BXZA 4LARL 1FDLH 3VFVB 4FZEL 1N5YH 4DZ8B 1E4WL 1OF2B 1FNAA 2JIXB 1LVEA 4HIIB 1ZGLP 3OWEA 1IC1A 2XKSA 3AFLA 4Z7UF 3GSRB 4GG8A 3U0WL 1CI5A 4HFWB 2XWTA 4Q2ZA 2PXYC 4G6AC 4KXZI 2YEZA 4EI6A 1F8TH 1BREA 2ESVA 2QTEA 5D1ZD 3B3IA 3FB6A 4XC1H 4AIXA 2D7TH 5IM7A 1YEJL 2C3VB 4PREB 4QXUH 5TJWK 5E1HB 5IESL 3C5JB 5BVPH 1GGBL 4R6UA 5JO5A 1KELL 3EYSL 4L9DA 5C2UB 1Y6KR 1S3KH 3N0PB 1IGMH 3U9PH 1BJ8A 1INDL 2ICWA 4X5LA 4JFPA 1C5BH 4LEXH 4UTAL 2ILLA 3KS0J 3L7FA 2H32B 3W9EA 5I1JL 2R2HB 2YMXL 3DROA 4UDUA 1S9KC 2X09A 4LPWA 3V5HA 3MREB 2DM2A 1RJLB 3D3VA 5IBLD 4XH2B 1LEKA 3TT1H 2GJZB 4OFVA 3X3FL 2VL5A 2DBLL 4WEBL 3AU1A 1CZ8L 5D5MA 4HWBH 4E41E 3VCLA 4PJ5B 3DBXB 1KSRA 1KLGA 5CP3H 3V95A 1FG2A 4B50A 4PJAA 1NFDF 3MGAA 3CD4A 4ZNCD 4ETYA 2RFXA 4OCNC 4XHJC 1NCAL 3T4YB 5SX5H 5FYKE 1S5IH 3AB0C 4YHOH 1U93B 5TQ2L 5ESAA 2DTMH 3F65A 3RL1A 1TETL 3BEVB 5KG9B 5L8JB 4ZPTA 4UT6H 2Q8BL 3T65B 2XICA 2WBWB 3HE7D 1SBSH 5EZLA 2VDNH 3AVEA 1QYGL 5DUPH 3F7PC 1J05B 1KB5H 1LK2A 4HXAH 5DD6A 1IJ9A 2CO6B 5A2LH 4HIJB 1P53A 4JJHA 3L3OB 4LHJB 1TQCC 1ZTXH 2X4RA 1U3HA 3IVKB 4RWYH 4XC3L 5F44A 3IU4L 4MYWB 1MVUB 1FBIL 2E27L 3AMKA 1IEBA 4TYUA 1X3DA 4LVNC 1MOEA 5AAMA 2PN5A 4Y5XA 5JXEA 3LB6C 1S9VA 2H6PA 5CSBA 4WHDA 4BZYA 1VFAA 2CDEB 5IBTL 1CXFA 3WEXA 2XY1A 1G7HA 3CSGA 4ZUUB 2RGSA 2Y07L 4ZOBA 5E8EB 4XPGL 1FYTE 1NGQL 1SYSB 2XTJD 4QRTB 1TJHH 3NABL 1I7UA 4GMTH 3CDFA 4JLRB 2DJSA 4M03A 2HTLC 3P9LB 1A7NH 4CVXA 2B1AL 3KGRA 3CNKA 3DRTB 4EUPG 4I0PD 5DS8B 1PQZA 2VR9A 4XPHL 5L88H 2HG5B 5C0CE 4D3CH 3KNBA 1LO2L 2WWMD 4HDIB 1EUUA 4GKSB 43C9A 1UKQA 4RZCA 1I8IB 2DN7A 2QQKH 4MS8D 1U8QA 3V79C 1ORQB 2PXYA 1I8LC 2VABA 3VXOA 4X6FB 3WUWB 2ZUYA 1MEXL 4U6XB 5MEOB 4K55A 5J8OA 2NNAB 5DJ0B 1OM3H 1VFOA 1ZEAH 2GK0A 3KLDA 5T1DL 2CH8A 5BS0B 1GAFL 2HRPH 1E6JH 5EZJB 3MODL 2Z31B 3KLAB 4YHPB 2DWEA 3EAKA 3BDYH 4I3SL 4QT5A 3SN6N 8FABB 2FATH 4X7DC 1RJCA 4MD4B 3MV9E 4JKKA 1LP9E 2DQCH 4KU1A 1DLHB 5C07A 5GGSB 3MFGB 4U6HB 4ZUWA 4G80A 2EDYA 1A64A 4QRPE 3KHQA 2J5LC 4OLXH 3ZYOA 3ARED 3PNWA 4FFWD 4V1DD 4D9QD 1QLRA 1FJ1B 2FX9L 4JFQB 3FO1A 4H8WC 3PWPB 1KIQB 4HZLA 1RMFH 1H0DA 1YN6A 3P9WB 1I4FA 2PW1B 3SBWC 1RIUL 4Y19B 1R3HA 1ZT7A 2BY0A 2MNUA 4L4TA 4NQSB 2XZAH 1RK0A 4F9LC 2VXTH 4Z78A 4FQHB 4UDTB 3EDEA 3O8XB 2Z0BA 1XMWA 4UOW1 1G7QB 1MHPH 2C4FT 4J1UA 5FYJE 2CLVB 2BMKB 4J6RH 3G6JE 4YXKH 1A3RH 2KZWA 4AEEA 4LLUB 5EBLB 2P42B 2FBJH 4GUPA 5B4MD 1XF1A 3WL9A 2P46B 2Q1EA 4LLMB 1IARB 3VDCA 3TJHC 4A2LA 5JOEA 3IXTB 4HUVB 3UZVB 1PY4A 4LRNH 2BC4A 4Z0XB 1J5OL 4OCSL 3RHWF 3BGFC 1CTNA 4O2EA 4HXBH 3PG2A 4NNYB 2DIBA 4PP2B 5J1SC 3IFOB 5DQ9B 1TMCB 3UROR 1ONQB 5I1GL 4TNVF 1PEZA 5C08E 4P4KC 5GISL 1FP5A 4XMPH 1RU9H 4NN6C 3I02A 1OOAA 4EBQH 5J4MA 1IRAY 5I1IH 1DVFD 3HE6D 2AI0L 4M4PA 5IFAL 1B4JL 4JM2F 5JORA 4XCEB 3WFCL 2APVA 4PJDA 4C56A 1TIUA 2V17L 4Z5RB 2IQAB 3SKMA 5BZDB 1IGYA 4HD9A 3VFRB 4QRQB 3PDOA 5CEZL 1MCLA 3P0VL 2XNAB 1A4KA 2OYPA 2XWJA 1II4E 1YPZF 3X11A 1AGFA 2NW2A 5ALCH 4I13B 1TDQA 4DEPB 4HCRH 3VGBA 1QRND 2V7HA 1BM3H 3QCVH 3O4LA 5FGRA 5BV7L 4OLUH 2ITCB 3N1QC 4PRDB 2R1WB 1G9MC 1I8LA 1NFKA 2F53A 3G04A 5CD5D 2X1QA 1GGIH 4HK3N 3H42L 5C0RL 4NNXB 1AD9B 3OX8A 4FQ2L 1R5IA 3BH9B 3L3JA 2IMNA 4L9LC 1YY9D 5DJCB 5CKGA 5FCUH 1Q94A 3SPVB 1LNUA 2WUCH 3MOAL 5TFSL 4OLZL 5EOQL 5I8EB 5IMKA 3VG9C 3G5VB 2G75B 4KI5E 2AK4D 1LWRA 4P2YA 3T8XB 2L7JA 1CD1A 3ZTJH 4U6VL 4IDLA 5IW6A 1G6VK 1PEWA 2OZ4L 4XMKH 2ITDB 3FFCE 3VWKB 2OP4H 5FYLE 4U1LB 3VD9A 4XAKE 2KPNA 1MQKH 4ZD3L 3MXWH 4ZFFA 4ODUB 1U8HB 3ULUD 1I1AA 3ET9F 3MJ9H 5AD0B 4GS7B 4KZEL 1A6UH 2P5EE 1FZJA 3JTSA 4BFEA 4U1IA 4BH7B 1UACL 1ZVYA 1JN6A 2WAHA 5I1HL 1Y0LB 3SBWA 5FUCE 1XF3B 2DQIH 4TNWK 3BPOC 5CCKL 4IDJH 4F9LA 4I0CC 2P5WA 3GRWA 4BSWA 1JMZA 2BSSB 1T2JA 4M5YH 3BXNB 4L8SB 1FNFA 1M1SA 3RKDC 3KYMA 4W4OA 4ZFOB 5T5FL 1XF2A 2UYLB 1N0XL 3VMOA 5FF6B 2ZUUA 3OF6A 3WE6A 3EJYD 4X6CB 1K4DA 3H9HB 3CK0H 2NX5B 2VC2H 4IOSD 1DANU 3KYOA 4A6YH 3IDXL 3BIAX 1OW0C 3BN3B 4LPCA 1F2QA 4Y88A 3WIHL 2HJFB 3NFNA 4P99A 2H3NA 1OSZB 1SY6L 2VLKB 1YYLH 4U7KA 1CDBA 3KXFD 1H15B 3LZFL 1YEHH 5F9WC 3VFMA 3S36X 4P23C 3T4AB 1E28A 4ZDHB 1HIML 4OZIF 5IQ9B 1BJMA 4BYHA 4F7EB 1PVHA 4F8QA 5IWLC 1JI2A 4P4KA 2NPLX 4Q0XH 5HYFA 4R4FH 5GSVB 5CZVL 4P2RD 3CDCA 2IPTH 4Q9QH 1ZVSA 1PKQB 2F9BT 1MI5E 1WBYB 1OGAD 3QWOB 3L6FA 3AXLA 1ZHLB 5T1KA 3VH8G 2A6DB 4LCIH 2B5IC 4S1RL 3U1SL 1XGTA 5F1OB 4OM1H 3MRFB 2NY3C 5HPMA 3KYKL 3BEWA 2DLFL 5I76B 1T1YA 5DUBA 2F5AH 3QPXL 3QXDB 3SY0B 2FL5A 1PZUB 1J0IA 1YEIH 1UEYA 1BQHB 4JDTL 5L6YH 5EO0A 1JJUA 2PCPA 3ZHKA 5JHDA 5DT1L 1QPXA 2FEDD 1NMCC 4U1KA 5D70H 3DECA 3DUHA 3VI3F 3F12A 3TZVC 5HHQA 4IIQB 4YH6A 4K7PX 3PXJA 3ZDZE 3QH3A 4Y8DC 5EO9B 3G9AB 1QLEL 3MRLA 3S5LA 4G6MH 3HI5L 3ZE1F 1HCVA 4OD1L 5FO7A 3RUGF 3QIWC 4NM8L 1D5MA 1KLUA 2P7TA 4PUBH 4FABH 5MP6L 4IHOA 3WS3A 1UA6H 2Y5TA 2WK2A 3WHE0 2Q6WA 3V7AG 3HZVA 4NRZB 3SJVB 4D9RE 4JJ5A 2R2BA 5LVEA 4ZO6A 2CR6A 1MFDL 3U0TA 5CIPB 4ODBD 1EV2E 3VG0L 2YKLL 5DK2B 2IALB 4WWKB 4UB0H 3KVQA 5I30L 2AJYH 1E27B 1BZ9B 3KPQA 3OHXB 4RRPG 1NL0L 2ED8A 3MRQA 2BVQA 1UJ3B 2N7AA 3OAUL 4NN5C 1ZA3B 2VISB 3I75A 1K9TA 5EIIA 5IP4A 5DEFB 3MLTB 1N3NA 4HZAA 1DE4B 3HR5A 4HK0B 1BF8A 5CJOH 4KK8D 1U8IA 4XNMA 4Z7WE 2FR4A 2DJ4A 5C0CA 3MRBA 3OMZA 3U83A 3OPZL 2P45B 1R3LA 3JZ7A 3IDMA 3KPSB 3QCUL 1V5JA 1MCSA 3HLAA 4OTXH 3SOBH 4PRIB 1F58L 1BAFL 3TLRA 1CD9B 3S6CA 4TUOB 3VXSA 1G7JA 4KROD 2NY1D 4OGYH 3V2AR 1LE5B 1T21A 5EZOH 3FQNB 1OW0A 4TSBL 5T1LB 2HRLA 1AD0A 4CADA 3OKKB 2ZOKB 4JKPH 4R3SA 3WO3B 3OKNB 2EC8A 1FVEA 4IRSD 2ICWI 3FT3B 4I77L 2ATPB 3LVEA 4QO1A 2FH8A 4XNQB 4M93B 4IM8A 1JZ6A 4P23A 1C08A 1S9XB 4N0FB 1DQDL 3FTGB 4WFED 3BKYH 4PV9A 4JDVA 4QYOA 2COQA 5TE4H 3GMQA 1IE5A 5EFIA 3ULUF 5IWLA 1R0AL 1MIEL 1ETZA 2DLGA 1JFQH 1F13A 5DMIH 2CIKA 2FH6A 4QRPA 2GT9B 3L3HA 3MV7E 4JFFE 3HPLB 3T0E