4CSZA

Structure of f306c mutant of nitrite reductase from achromobacter xylosoxidans with nitrite bound
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 92
structure length 335
sequence length 335
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cszA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cszA02
1L9TA 3IN2A 2IWFA 2ZONA 5PCYA 4UAHA 5I6LA 2AZUA 2I7OA 4TXVB 4E9TA 4YSSA 3GDCA 3PXLA 4DP5X 5I6PA 1BQRA 3NJJA 3S8FB 1PNCA 1WAEA 2FT7A 4MFHA 1PLAA 4CSZA 5F7BA 1ID2A 3NT0A 3CDZB 1AACA 3FQ2A 1SDDA 4DP0X 3WNJA 4YVNA 1AIZA 2UXGA 2BWIA 1JOIA 2Q9OA 4UF7C 4Q89A 5I6KA 3ABMB 4UANA 3TBCA 3DKHA 2CALA 4DPCX 3UAEA 3PAVA 3UACA 4DPBX 3OMIB 4YSCA 5FC9A 2XLLA 3CVCA 3ZBMA 4A2EA 4X4KA 1AQ8A 1CC3A 2AZAA 1GR7A 4ZK8A 3FQYA 3NP4A 3N2JA 2UX6A 4G71B 3PAUA 4KO9A 2PPAA 2RACA 3NJIA 4A2FA 3CVBA 4A2DA 4HCGA 1M56B 5I5JA 1M9WA 1KCWA 1PLCA 4AKPA 4G70B 1PAZA 4DP9X 2JXMA 1NIFA 1SF5A 2IDSA 1ZIAA 3ASOB 3T9WA 2YAPA 1A4AA 1JXFA 1BQ5A 3EH4B 2VM3A 1OE2A 2WO3B 3NSCA 4M4RB 4YVUA 5EHFA 5I6MA 4YSAA 4F2EA 4YSQA 1IC0A 3BQVA 3AG3B 2I85A 2X87A 1TKWA 5LDUA 2CCWA 1BXVA 1M57B 3RYMA 3DTUB 1JZFA 3T6ZA 2TSBA 1N70A 4YSOA 3NP3A 1RKRA 4KOCA 3WKPA 4BXVA 2QPEB 1T5KA 2FWLB 3CZUB 3QJUB 5AZUA 4CSPA 1KBVA 3NYKA 2J55A 3NJGA 2UXTA 2VN3A 1RZPA 3X1EA 4NERA 2IH8A 3FPXA 1ZV2A 2HX9A 1NICA 4F2FA 4YSEA 1J9QA 3FQ1A 3S3BB 3QPKA 1A3ZA 3AG1B 1AS8A 1JVLA 3MBWB 1AOZA 4PAZA 4NB7A 1E30A 3NSFA 1ASOA 2J57A 3UABA 5I28A 3FYIB 2EIJB 2BHFA 2BWDA 1X9RA 1AZRA 2FJSA 1BAWA 2BP0B 3OMAB 4A2HA 2VSKB 1AR1B 5B7MA 1DYZA 2OJ1A 1B3IA 1GS8A 4N8UA 4WTQA 2BZ7A 1SNRA 2W88A 1V54B 1AAJA 3UAAA 4HZ1A 3EH3B 3WNIA 2PLTA 2XV2A 1L9QA 1XB3A 2GI0A 1YLBB 3FSAA 4PCYA 3X1GA 4A67A 3WIAA 1XB8A 1OCOB 2PPDA 1L9OA 2IDUA 1RCYA 1XB6A 2YXVA 3FT0A 2YAEA 2PPFA 3IE9A 4DP7X 3KW7A 4DP2X 4YSTA 2EIMB 3AG4B 4A66A 4HCFA 2FQGA 3X2QB 2VM4A 4JKNA 2HX8A 3NSYA 2VSMB 3X1BA 2TSAA 4HCIA 2FQFA 4A68A 1R1CA 2NRDA 4G7RB 2J5WA 1NZRA 1ZPUA 1QHQA 1SF3A 2YAOA 1PMYA 1V55B 3OD3A 1RZQA 3PPSA 4F7KA 2H47C 2ZOOA 5D4HA 3H4HA 1MZZA 1NPNA 4GP8B 4DP4X 4AKQA 2PP9A 2Y1AA 1QLEB 2DWTA 2Y69B 2B08A 3FPYA 3QJVB 2HZHA 1E67A 1KDJA 1NPJA 1NDTA 1SFDA 2AANA 4JHUA 2CJ3A 5D4JA 5I6OA 2BP8A 7PAZA 4GXFA 9PCYA 2BW4A 4KOBA 3FS9A 1VLXA 4HHGA 1OE1A 3UADA 4EF3A 4W9ZA 1URIA 2DYSB 2IWEA 4BDVB 2JFCA 2HRHA 2OCCB 1DZ0A 4AX3A 4G7SB 1BEXA 3FU7A 3MX0B 2VW4A 8PAZA 1HAUA 1ZDSA 1NTDA 5B7EA 2HLEB 5D4IA 5TK4A 2XVBA 1PY0A 2X88A 3EF4A 1KDIA 1WA0X 1BYPA 2UXFA 4YL4A 1NIEA 4BWWA 1JXDA 4DPAX 3AG2B 5I6NA 1BQKA 1KBWA 2UXVA 3FSZA 3JTBA 4WKXA 2FQDA 2R7EA 2IDFA 2EILB 4A2GA 1NIAA 4E9QA 4KNTA 3CG8A 1ILUA 1CUOA 2BP8B 2XX0A 3NJHA 1SDDB 1ZIBA 3PAZA 1KCBA 3OQRA 1SJMA 1UATA 5IY5B 1PZAA 1IBZA 4FA7B 4RH4A 2P80A 1ASPA 4E9RA 4GYBA 1ET5A 3ABKB 1GSKA 5AFAA 2BZCA 1AS6A 4HAKA 2QT6A 2HXAA 4E9VA 1SFHA 3KW8A 1XMEB 4G72B 3NJMA 2WO2B 3L45A 3SBRA 1AZUA 1PNDA 1ILSA 2GC4C 3JT2A 2GHZA 1BYOA 3WKQA 1PLBA 2FT6A 2XYBA 1E65A 1W6LA 3G5WA 1E5YA 1MDAA 2XUWA 4QKTA 5I26A 2N0MA 3QJRB 3FSVA 4AZUA 3WI9A 2MTAA 7PCYA 1JVOA 3QJSB 1AS7A 1WS7A 3PCYA 1SHXA 1JZEA 4L0PB 1GY1A 1JXGA 2ZXWB 2DV6A 1IUZA 2MRYA 1OV8A 1A65A 2IDQA 1GW0A 1IBYA 1JZGA 2XV0A 3ERXA 3ZDWA 2VW7A 3QJTB 4DP1X 3S3DB 1AZNA 1F56A 1WS8A 2ZWNA 2XX1A 4E9YA 5B1KA 2IDTA 3X1NA 2YAQA 2W8CA 4KO6A 5ANHA 2IH9A 2BO0A 4KNUA 3T6XA 3SBQA 4HALA 4DP6X 2E86A 1PZBA 1TEFA 2CAKA 1CYXA 1ETJA 6PCYA 4Q8BA 2QDWA 5TK2A 1ET8A 4AI7A 3OMNB 1OOWA 2YXWA 1L9PA 1AZCA 3ZX1A 4BXSV 5I5IA 2AVFA 2XWZA 2IAAC 1WA1X 2YAMA 2A3TA 1JZHA 2EIKB 1AZBA 3NSDA 2B3IA 1TU2A 3QQXA 3T6WA 4N4YB 4P5SA 3SQRA 3V9EA 3IN0A 4HIPA 1NIDA 3GYRA 2AFNA 3IEAA 4DP8X 1HFUA 2PPEA 4GP4B 4E9SA 1FA4A 5A7EA 1EZLA 1J9SA 3N55A 2BP0A 3EHBB 1NWPA 4QLWA 5B3SB 2FTAA 3IBOA 2XXGA 1ET7A 2VMJA 4BK5C 2PCYA 2FT8A 2DYRB 1TEGA 4YSDA 5E9NA 4K9JA 2J56A 4E9XA 2I7SA 3NJLA 1GY2A 4YSUA 1AANA 3ZIYA 1ADWA 2HX7A 3CVDA 5B1JA 1NWOA 3EH5B 3T6VA 2HRGA 5B1AB 2DY2A 3FU9A 3OM3B 4HHWA 3FYEB 1SHWA 2FQEA 4YSRA 2P80D 5B7FA 2QDVA 2FNWA 3TASA 2XV3A 1JZJA 2YAHA 1NIBA 5B1JC 2BW5A 2CUAA 1GS6X 1GYCA 4P5RA 3UGEA 1WA2X 1W8EA 1CURA 1NINA 2PP7A 3TU6A 3X1FA 3AY2A 1KYAA 1L9SA 4BWUA 2CBPA 3NJKA 3AW5A 5B1BB 2VW6A 3GXUB 4KO5A 1HAWA 2YQBA 1A8ZA 3NJFA 1BXUA 2JKWA 1OCZB 1AG0A 1IKOP 3U25A 3ASNB 4BWTA 2Q5BA 2UX7A 3HEIB 5I5MA 2QPDB 1CYWA 3PLYA 2PPCA 1V10A 1W6WA 3ABLB 1PCSA 1FWXA 3AZUA 3WG7B 4AKOA 1L9RA 5PAZA 1JERA 1PF3A 2XU9A 3DIVA 3H4FA 3NJNA 1X9UA 2GBAA 1J9TA 1KGYE 2WSDA 4E9WA 3TA4D 1ZDQA 4JHVA 4YSPA 5AKRA 2DWSA 3D12B 4BDVA 1KV7A 3QJQB 1PZCA 3FU8A 1J9RA 1MG3C 3H56A 3TBBA 1JZIA 1GS7A 2IWKA 6PAZA 1A4CA 2GC7C 3S3CB 3T71A 1E5ZA 2GIMA 3FSWA 2PCFA 1I53A 2EINB 4NAJA 1FFTB 4ENZA 1QNIA 1MG2C 4KNSA 3HB3B 1A4BA 2PP8A 1BXAA 1N68A 1OCCB 2R7EB 4GY4A 4KO7A 1AG6A 1ASQA 4G7QB 3CDZA 2OV0A 1OF0A 1J5DA 2H3XC 1J5CA 4M3HA 2GSMB 2YAFA 3V9CA 2H5UA 2LLNA 2YARA 4W1TA 1OE3A 3ABGA 3BVDB 3FU7B 1EHKB 5F7AA 2XXFA 4GP5B 4FAAB 3C75A 2GB2A 3S8GB 1OCRB 1MZYA 3SBPA
chains in the Genus database with same CATH superfamily
1UH2A 3FQRA 4UQBA 4CN1A 2NUPA 3FC8A 5TTRA 2OQJA 2VRQA 2A73A 1NKOA 1BQRA 4OSUH 3MRMA 2C4FT 4RX4A 5E9DA 1ETZA 3HG1D 4AOFA 4CSZA 5HI5D 1U2HA 3CZFA 3NT0A 5ALCL 5FHAL 4NI6A 3ZY7A 1ZVNA 1R3IL 2HKHL 2V8MA 4BBWA 1QYGH 2WM0A 4BH8B 5JW4Q 3CVHH 2YFOA 1V7ML 4XH2B 4DK5A 5MHSE 5E4OA 3ULUH 2SEBA 3LSOB 3F65A 4PJXB 3A22A 4NP4H 1HQRB 4Z7WE 3HFFA 3ZDXB 1I1FA 2EYSB 4O2CB 1TZHA 3VO0A 2E9IA 2B5IC 3KBHE 3PAVA 4WI8A 2MQ0A 3MZGB 1JYVA 4R7DA 2G4EA 1F1AA 2JCCE 4O9HH 5MENB 4NAMA 2BFVH 3MLRL 4WLCA 2P28B 1KTLA 3BVNA 3COOA 3T2NL 5DS8A 1CXEA 1MJUH 2B9BA 3BE1H 5IIEA 2VSDA 2VITA 4NN6B 4X5PA 5LQBH 4OAWB 5AVTB 3WY2A 2XBDA 3PWPE 3P77B 4G8GD 2F8OA 4JO2H 5HGGS 3ZDZF 1BMWA 4PY8I 1J5IA 5FYLD 3EO1B 1FPTH 2H0FA 3KNBA 3R4DA 6FABH 4OM1L 3MRRA 4M4RB 4YVUA 3MYZA 3N91A 2ZWYA 1JPST 3Q6FA 5CZRA 1S7QB 3P9MB 2BVYA 1IL1B 2QVKA 1HSBB 4MYPA 5C0FB 2P48B 3TIDA 2ZP8A 1TNNA 2WSPA 1F6AB 3E1ZA 3MJ9A 2EUVA 3NCEB 1OP5K 1DFBH 4OW6A 4NZ8A 1QBML 3MRGA 4JPKL 4MDIB 3MV8D 4D0BB 4WFFE 1WWBX 1UXWB 4DVBA 2EUZA 2X3CA 5DR5L 4P2QB 1IGCH 2E47A 1GZHC 3Q5TA 5TFSL 1IZJA 4Y0GA 1FHGA 1RZPA 2VLMD 5E8NA 4N90E 4W9DC 4CN4A 3K4DA 4LCCB 2ZKXA 2HX9A 1I8AA 1SVCP 4WHYG 3QHZL 3CSYB 4OF8A 1P1ZA 1SUJA 1S9VA 1S4IA 2Y0SA 4HWZB 1JZ4A 1K8IB 1OK8A 1KN4L 1ZSDB 3MNVB 1H19A 4RSYA 3Q06A 3NSFA 3G6JE 3D48R 4MJ6A 2HT2C 4LFHD 1NCCL 2A1WH 2R69L 3QFJA 2Y07H 1NDMA 1BV8A 2BWDA 4RGNB 4UTCA 4LBEB 4PJ7A 3RHWK 3WIIH 3C08L 2IMMA 5IK3A 1OPOA 4BELD 1DYZA 3MRLA 5MHSD 5JLZA 1U93A 5DLML 1KYOJ 5A2AA 1R5WA 2G2RA 2BK8A 2QKIA 3MRKB 1ID5I 2ZYIA 4IRSA 2Y25A 5KYNA 2XV2A 2XG5A 3CPLA 4KTEH 4ZFGL 4GW4B 5AVXB 5HHOE 5KANI 1DJWA 5D2LB 4FQLH 4OZIE 2B59A 5IFHL 3TPUA 1YN7B 4PRAA 1W8NA 1C5CL 1WBYA 3UC2A 1FGNH 1EXGA 1HXYA 2VE6A 3I02B 2CO7A 3IJYA 4G8GA 2OXHB 3E8VA 5DC0A 4I87A 4JZOB 4JQIA 4Y16B 3DBSA 4ELDA 5IFJA 3B2MA 1MCWM 1USQA 3NSYA 4XPAL 2W95A 3MUHL 2DH3A 3RY4A 2B3RA 4LLWA 4CVZB 3PDOB 4YXHL 1BZ9A 2FQFA 4A68A 3BD5A 3T08A 4RGND 5MI0B 5K9KA 2CO4A 4CNIB 5A3ID 2VLKD 3MFFB 1C7TA 1LQSR 4WGKA 4YXKH 1NMAH 1UA6L 1V55B 2CLZB 2GVYA 3P3RA 5E8DL 1CI5A 4H1LH 4XVUD 2X89A 4PRIA 2ED8A 4X7SH 4P59H 2H47C 3I3DA 4NZTH 4ZTEA 3H7BA 4DGVL 4TOYH 2MOVA 2WXNA 4TNVK 3MV8A 1S9KC 1J8SA 3P40A 3MLSL 1F4XL 3U0TB 4HUVB 4R3SA 2OMXB 5DJ8A 5E00B 5FO2A 1JK8A 1JTPA 1OHQA 4LSSH 4OZGE 4QEGA 1BREA 5ETUB 4N6RA 1FFRA 3CD4A 1C16A 1E67A 1NPJA 2HZHA 1NDTA 4M8VA 4HJEA 1I85C 3MA9L 5BW7C 5JDJA 5HSFA 2BW4A 2O26U 2P8MB 2YPVH 2FECI 4WV1C 3TJHC 3DK0A 3FTUA 1M4KA 4PJ8D 1EAQA 3NPSB 1U30A 3ALWA 4TVUA 3LHAA 4NQDA 3DX8A 5H2BA 3VFRA 1Q0XL 4G5ZH 3VD2A 4U4BA 4AYFB 2NY1B 1BX2B 4PS4H 1O0VA 2WN3A 2J1KA 3GBMH 4JN2A 1JNLH 1RL1A 4X4ZA 3WIFB 2GITB 1C5DA 3QAQA 5TGBA 2UXFA 4KJQD 4M7JL 2M8XA 2GK0B 5DRWB 5FCUH 5GJSL 2AXFB 3L5XL 5JIPA 3C5ZB 2Q1EA 2X2IA 2ZPKH 4N8VB 1EEYA 3O6FB 1A14L 4X7FC 2XX0A 3L16A 4Q6IA 2IANA 2XNAB 4MLSA 3B56A 3D0AA 4NO0D 1ITCA 2BFGA 5C0RH 4RETB 5EDXA 4ZSOA 15C8H 2WMPA 3SQBB 3UGUA 1AGFB 1KPRA 3OKEB 2IXQB 2YBGA 1F6FB 2AQ1A 2Q10A 4P5KA 4KPHH 4R7XA 3QIUD 1UASA 3QUXD 1BFTA 3BZFB 4Q4IA 4NQVA 4UWQB 5GS2D 3H42H 3HI6L 1O6SB 3KE0A 3MOBH 2R23A 5BRZB 1NFDF 4OD1H 1IGMH 1JPTH 2PWDA 3GK8H 2NQCA 2OQJB 2DJSA 5AENA 4IU2A 4KGLA 4LFHG 3UYOD 3JTSA 4PRDA 5C0JB 3V79C 1YEKL 2DQHL 2AW2A 3QR2A 4K3EH 4KX8A 4YR6A 1W8OA 2CUIA 2NCMA 3NA9H 4H7VA 4M5ZL 5FFLA 4PSPA 1T1XB 1P6AB 2R0ZL 1T1YB 1MCCA 2E27L 3GJFH 5DQDL 2YMOA 2GTZB 2X28A 1N6UA 2ZXWB 3KGSA 1TJGL 4KUCD 4KKZA 2DV6A 3SDXF 4XI5D 5D6CB 4YAQB 4MQ7A 3JTTA 4UILL 1FNAA 3ZDWA 3QQ4A 4YZFE 2YD3A 2DBLL 3VSVA 3MGAA 2VLRA 5DGQA 5JQIB 2OXGA 1J0IA 3RTLA 1L0XA 1JBJA 4C47A 1XGUB 4S0TD 1KEGH 1KG0B 4KKPA 2PYEA 4OLWH 4Y4HB 5L0QB 3RX7A 4UQDA 4E9YA 4N87A 4KNQA 5KN5B 4KFZC 4LCWA 4X7TB 4PJDF 5D4QA 4NNPH 2CAKA 1Z0NA 1ETJA 1SEBA 3CBJB 4FG6C 3OMNB 1OOWA 2Y7LA 5E95B 5C09D 3CFQA 2DQTH 5E1AA 4R90H 2WB1A 4APXB 4JB9L 4GO8A 1G7IB 4HJ0D 1J1OH 2APWA 3LRKA 2WJ5A 2F74A 3ESVF 3NSDA 2R29H 1FFNB 3T6WA 1PY4A 1OAYH 2ICES 3IU4L 1H3TA 1JMXA 3PDDA 1DJYA 3IJHB 3JWOC 1YPZF 3BH8B 4HK3N 1QX1A 1WCBA 4DP8X 1KB5L 4UV7H 1IGTA 4JRYE 1WUZA 3SJVD 1DN2A 4ZMAT 4BK4A 1E7UA 5HVFB 4HFUL 3S5LB 1SBSH 2MNUA 1XR8B 2IQ9L 3LQZB 5DC9B 5DHXB 4HS8H 2W91A 1LDPH 3N41B 1CICB 3V4VB 2FT8A 3QEUA 4JFFB 3RFZB 2XQYK 3B3IB 3EFOB 1XF5B 1GY2A 3GHPA 2R1WB 1AHKA 3D33A 1KGJA 2KZKA 4J1UA 3UTZA 1EXHA 1A6WH 2CDGB 5TQ2H 3OHXB 4GQ9H 3MBWA 3K74B 3WENA 1J0KA 3P73B 4CBZA 2WO4A 5B7FA 4UNIA 4P05A 2YS4A 3U30B 4PJ7B 1GAFH 4CMHB 2CNZA 3L3GB 5K69A 3UCRA 4GPVA 3WL9B 4ZFOA 1YEIH 1J8RA 2W9DL 5ACZB 1IGJB 1L9SA 4GKLA 4XMKH 4F37F 3CHSA 3MJ7A 4KQ3H 5DQ9A 3V4VL 1MW3A 1KJ3H 3MLYH 4WGVB 3W0WA 1HCVA 1R3LB 4PVNA 3TJPA 4OZHB 2DH2A 1AG0A 5CZKA 3GMLB 4OCYL 1DJSA 4FQHA 5I6XB 1P4LA 2F54A 2GUOB 3V4PB 1XF4B 4WVRA 2XQBH 2VUYA 2I5YH 1SQ2N 5CSZB 5D72H 4XXDB 3MUJA 3T4AA 1CGSH 1DVYA 3CZKA 3DXAB 1LO5B 3AZUA 1JGEB 4FNLH 4ISVA 1HXYB 4U3HA 2CO7B 3IJYB 1L3NA 3AY4C 3FOMB 1QFWL 2ICWI 4GT7A 4XXCC 3P4MA 2Z31B 5HHOB 3QQNA 2N1KA 2YD1A 4P5MB 3MFFA 3EOBB 3NMEA 5EUOE 4Y9CA 2NNCA 4EN2A 3EF7A 1CFQB 1RUQL 1ADQA 4B95C 1BQHA 1JZIA 5KSVB 3QDMB 2P3YA 4ONFL 4XXCA 1A4CA 1NDGB 3H0TB 3T0EA 1OWRM 4LCYB 4FFTA 1S5HB 1PJWA 3HB3B 3P3UA 1L0YA 3Q43A 2XDHA 2EIZA 4OCMC 1AQDA 2R1XB 3LVEA 3GRWH 5LJYH 1T5WA 5T33L 2CHNA 1X7SA 4JFOB 4Y2LA 2A4EA 1WYJA 4ONHB 1T4WA 3T0XA 5CSGA 1SHMA 2VDKL 3UOAB 4TUOA 1G9NC 4TVSa 3HBPA 3LX9A 3F7VA 1KC5L 1MDTA 1EHKB 2GBVA 5D5MB 1P9MC 2PW1B 2R2CA 1XGZA 4D9QE 4G9FE 4JFVA 2VOTA 4ZUWB 4AYFA 4PRNA 2EC8A 5KVFL 2XT1B 5DVOA 3BP6A 3VYOA 2B2XL 4TULL 1QRNE 4YSSA 3QXUA 4IHOB 3OPUA 4YHIB 4ZD3H 5CF3A 2NTFB 4HXBL 3I9PA 3MREA 2AK4B 1NFAA 4G3YL 3O6FA 4XPTL 4UNVA 1BPVA 1IGIL 4PV9B 1M1SA 3D3VA 1EGJL 3S37X 3UIYA 5GRVL 3E6FB 1A1MA 3OL2A 4LGSB 3KYOA 4UF7C 4FG6D 1DEEA 1F3DH 2AQ2A 4GRLA 1Z9MA 1KPRB 1MUJA 3O6KL 3NCFB 3O6FC 4EO5A 2IPTL 5IZ7A 4M6NH 1E2VA 4MDRA 4Y1AA 2JWYA 3RTQC 4XZUB 3CDGA 1W0VB 1KB9K 2ITEA 1NSNL 4UIKL 1GPOL 1DSWA 1BMZA 3KBFA 5FK9A 1GTNA 3O2DH 4K3DL 5E4EC 3NJIA 3V6BR 2LOEA 2Q3AA 5IW3A 4XNAA 4NBXB 4YHMH 4HCGA 3RPKA 1UUSA 4WWKA 5C0GA 4A2DA 2PABA 5IVXF 2E8YA 1U3HA 3ARRA 2VIRB 5C08E 3K5SA 4JL2A 2P46B 4PCTA 2NY5L 3QUGA 4JRXD 1SJVA 1NIFA 3BKMH 4X80H 4XVUC 3T4YB 4JFEB 4KU1A 3FT3A 1X3DA 2YAPA 3QQDA 5CCHE 3MBXL 4Z76A 5J1AA 3BEWA 5IHUH 3IDYC 3SDXB 5KAQF 3QQ4B 1R5IA 2XVGA 4PLJD 1L0PA 2Y7MA 3VH8B 3WJLC 1BJ1H 4R96B 1U92A 1EJ8A 2X87A 5IBTH 2CIIA 1ZLEA 1H5BC 3MC0A 1OB1A 1G43A 3AAZB 4OI9A 4XMLL 1AD0B 1W91A 3DV6A 1Z3GH 2QPSA 5C2BL 3P0YL 1MWAA 4L2LA 4AGLA 4OCRL 1KLGB 1RKRA 3AC0A 1A7QL 1L9NA 2YA1A 4FXGB 4KKCC 2PWFA 4IW4C 3T3MB 3PABB 4P46A 3T8MA 4P57A 1KBVA 3MUY1 3QWRA 2APVA 2AEOA 2ICEA 5EWIL 1BD2D 2IOOA 3C2SA 3BHBB 3CU1A 4JZJA 4NERA 1QRNA 1A3RH 1OCWH 5K9OB 1EZSA 3UPRA 2F8XC 3TTYA 2D3NA 4PJ8A 4JFFD 3FQ1A 2ODHA 1U8QB 3DYMA 4G80B 3M1BB 2AJSH 3MGTA 5E2TH 4MB1A 3VG0L 1A7PH 2C8NA 5JW4M 2AJ3A 4KXBA 1E9OA 2CM6A 1E30A 4TNEA 1COBA 5IF0A 2J57A 1J0YA 2UV3A 4LARH 3UABA 4FZEH 1KB5B 4PLKC 3RVTD 4D8PA 5FB8B 2YUXA 1DBBL 4XCYA 2EE0A 3AB0B 5B3JF 1AR1B 4H0HB 2F53B 3UTTD 1B3IA 4ODUB 5I17B 1JPFA 1OGTA 2VR5A 5SV3A 2X4OA 5KSBB 4L0ZA 4LHQB 4HULB 4HZ1A 2AJUL 2XPZA 3BKJL 4KI5F 3FKUS 1L4IA 1XIWD 1TLKA 3GXPA 3MRJB 3QGVA 2XZQL 4WFFD 5LCVH 3WNIA 4F5CE 2GAZA 1G4RA 1OD7A 2VC2B 2ZICA 4OGXL 3EFDH 4NO0A 4ZTOL 5ECGA 2B4CC 2V2XB 4A67A 2Z3FA 3GSXA 5DSCB 1BWWA 1A7RH 3ECUA 1Q9WB 1Z9NA 4K7PL 1M7DB 1SN5A 5H35A 1M1XB 4QRPD 2QVMA 1C5BL 3WFCH 4YSTA 2X4SB 4R0LA 4KI5C 1OTTD 2IADA 2NY6B 3L3JA 5CWSB 3K6SB 2B5IB 3SO5A 3OB0H 4TTGA 1AZVA 1MN4A 3R0NA 5C6TH 3L2LA 5FHAH 4Q0XL 1XBRA 1O6TA 2BRRH 2XWBA 4LDCA 4B7LA 3CQFA 3D0VA 1L6ZA 1RIHL 5J6GA 2A83A 3UTPE 2DMBA 1V7MH 2EDKA 2WV3A 3ULUL 3HG1B 2VL5A 4J6RL 2QJDA 4JDVB 3F8UB 2VT0A 3KL3A 3BFOA 2ZOLB 3W81A 2OX5B 1NPNA 2YD5A 1H8NA 3V4LA 1GZHA 4H0IA 1YRKA 4KMTH 2W9EL 5DD1L 4YC2B 2YA0A 1IT9L 2X2HA 1NCJA 3BI9X 3GJFK 5AW8B 1A2YB 4W6XB 4BFIA 5GGTA 3B2UC 4APQB 4XOCA 2L3BA 5FAAA 1T7WA 3TA3B 5LQBL 5HGAA 4EF3A 4WI2A 4U1KB 4GAJL 1NEPA 1DVQA 2JF1A 2NSQA 5EA0L 3TNNA 2RCSL 4PN6A 2HRHA 2I24N 3IDIA 4N28A 4GINA 1JHTA 1RZIA 2O5ZL 3BQUC 5F6HJ 4OM1H 4KDVA 4NN5B 1T4KA 4CC1A 4JNXA 2QQLL 1JK9B 1RERA 1UCTA 2V7HB 3QDMA 5EOCH 4BSVA 5MEQB 1CXHA 4W70A 4S11A 4CSSA 3KLDA 4AQEA 5L6YL 5DMJB 4ZXBB 4H8PA 2VUOA 1BZDA 5C0NC 3D4YA 3H0TA 3H9YA 2ATPB 4JPKH 5IOPA 5HGBB 3ZKQD 1GC1C 1OSPH 2CIKB 1XIWA 3DLQR 3LPOA 1F41A 1U8PA 1WHPA 4NFBA 5B38G 1IGCL 3GBDA 4NS0A 1Z32X 1E28A 2PTTA 5F7LB 1XCTB 1P4BL 4OJFL 1NCBL 2C34A 1PLGL 1DVZA 5DUJA 3MNWB 2Q2EB 4GMSL 2HT3C 5ESQA 3ZHLA 3PE9A 1CFVH 3D18A 3VFWB 1CVSC 2HFEA 5C9JA 3EFFB 4ZW8A 3BSHA 2WXMA 5EEXA 3RGVD 2PXYD 3CFEA 1XMEB 5T5FA 2WO2B 5EEYA 3CFKA 4TUKH 3MRNB 1HOCA 2ENYA 2J1ZA 3K72B 5I0VA 2C1PB 3WY3A 3DV4B 4CW1A 4EBQH 4F3FA 4Z3EA 3DYPA 4N5EC 1JWMA 4KTDL 1SM3H 5DLMH 4E41D 3GUTA 2F1AA 2J5LC 5HHMB 4WHTB 4JE0A 3MOQA 4PY8J 4U0RB 2I25N 3Q2CA 3ML8A 1MJJA 4HAGA 1D5ZA 4I3SL 2BSTB 3H9SB 4FFZA 4RRPM 2I60H 3HKFA 4GBXB 5HTSA 5LG6A 3GLAA 1FO0H 3WCYA 4Y1AB 2XTJB 2KZBA 5E6ZA 4KZEL 4HETA 1QAWA 4UBDD 3VXPB 1YEFL 4W9GC 4ECNA 5AOMA 1CG9B 4KVCL 4F8OA 3VGBA 3PRZA 4U1JB 4JPVL 5FK9B 1TQCC 4IMLB 3RVTC 4R97B 3GTTA 2WTOA 3RGVB 3H54A 5BZWB 1WRFA 5L4IA 3VCLA 4D0CB 4U6VH 7FABH 2D7PA 3D39A 1AZCA 1CK0L 3BUYA 3G6JF 3JUZA 1SLVA 1EHLL 2B77A 3TCTA 4HS3B 4ODBD 1PU0A 5KBPA 3EDKA 2IAAC 1I7RB 1F2XK 2YAMA 3LIZA 5DDHB 4AK1A 5HHPA 2NSMA 4HC1A 3GSNH 4JFDA 2BS71 4FEIA 1R5IB 1ZHKB 3MRFA 1J8HD 1A7OL 4R96A 1D6VL 4A7GF 3MLSH 1ACZA 3PNWA 4WI6A 1TETL 1TZGH 3NPSC 1UH4A 3AU1A 3CZLA 2X4RA 5BS0B 1O7SA 3P54A 3MA9H 1ETA1 2DLGA 1ZCRA 2YFNA 2B7DT 1SPDA 4YPJA 1NBZB 2XXGA 5AW3B 2VMJA 4D3CH 4G2AA 1CMOA 3HNSH 5K33A 2F18A 1MNNA 1CDIA 2ISDA 4YSDA 2GHWB 4B0MB 1ZTXL 2DM7A 4L9LC 3DI2B 4YHOH 2EEDA 1U8QA 4WO0A 4X6CF 1OGSA 3AWEA 3WNMA 1JNLL 3U36B 2FK9A 2X38A 1SHWA 3M8OH 3NABH 4FG4A 5JOPD 3RWFB 2XZCH 2CBOA 5E7FA 4HIEA 3VFGH 4WEUD 2QQKH 3LKPA 5IF0B 1D5XB 5T1MA 2HVJB 5IMKB 3MCKB 5J56B 5KTEL 5L9DL 4RAUB 5CJOH 2YK1H 1NBYA 3TBVA 3N3EA 1GYCA 3RIAK 4CUCA 2XOTA 1G87A 2PCXA 2PP7A 3FQNB 5DHVH 3V9FA 1RZFH 4LIQH 1D6EA 3RU8L 2JELH 4OZFB 1CBVL 4GSUA 2CR0A 1VSCA 2VW6A 4QRTA 4ZOEA 3P4LA 3IJSA 15C8L 4L8BA 1G7MB 1K3IA 2EKJA 2HKFH 3O6FD 4XP6H 5F1KC 1A8ZA 3NJFA 5F1IB 1IIIA 4ZBJA 2EUXA 1IKOP 4KPHL 5GQBA 1KFGA 4NO0B 2UX7A 2KUTA 2WQRA 2ZXEB 4X8CA 1KWKA 3HI6H 4WJ5A 4EXKA 4LSRL 5KVMC 1M7DA 3OX8B 4Y7OC 2Y22A 5KS9B 5LHDA 3UG5A 1M1XA 4YHZL 4G8AC 4WK0B 4AKOA 3L81A 5KVEH 2XIBA 5GRUH 1BQUA 2XU9A 4KI1A 5E94A 3ZRCC 1DR9A 2NY2D 4WUUE 1JV5A 2XWBB 1AKJB 5KSAD 3VGGA 4JEGB 2B20A 3K7UA 1HQ4B 4LCUA 5D1ZI 1KPVA 4OH2A 3B6SA 4P9HL 3LPFA 3NBNA 1N18A 1UZGA 4UB0L 5J7CC 3IFOA 2XA3A 5HDWA 3WN5A 3S2AA 2J88H 1PKQA 5AZEH 1QWNA 2EINB 3FB7B 1KEGL 2V9RA 3A6BL 4RRPA 2QTVA 4P4KA 3MRMB 3I6LD 1DQIA 3ARED 2R7EB 5AOJA 1DHKA 1UD5A 4XNZC 4MCMA 5FGRA 5TPWL 3Q3GA 1DQJB 3NIDF 4NNPL 2BIOA 4AGOA 1IGFH 1E4KA 1MHHB 3MOAL 1J5DA 1EEZA 3C6EA 4NIYE 4RSVA 1E40A 1MAMH 2O1AA 4M3HA 1J48A 3RA7H 2SEBB 1QSED 2DW5A 5HHQA 4TUJB 2H3NA 5CU5A 4JGUA 1XF2B 3NEOA 3BVWA 3RWDA 4MD5A 3V0WH 3DURA 1ZGLM 3DETC 1S7VB 1DJIA 1EHAA 1UOWA 4DN3L 5HVWA 2A6JB 2DQEH 1EO7A 5MEQA 1OCRB 5I71B 5C09B 4H5SA 1KYDA 2XXMB 3GEWB 4X6EB 3NJXA 4LBAA 3EJYD 3A0OA 2ZONA 5GSRB 4PY7A 3RFZC 5EO1B 3VI4B 4E9TA 1FLRH 2OR8A 2CO6A 1GHFL 5DS8B 1H8SA 3KCPB 5IOPB 1JWUB 1A22B 1MPAH 1YYML 5FM4A 4QHLA 3GSQA 1SBSL 4OZIB 4OFQA 2IQ9H 3JYBA 2FBJL 1VHPA 2HP4A 5GRXG 4OFYD 3UTOA 5K9QI 4LCVA 5IKCA 1MCRA 2X4TB 2VZOA 2OMYB 4K2UH 3BKCL 1I1AC 2NNRA 4QXVA 4UTBA 3MRRB 4LSTL 3FRUA 2VTFA 3TBWA 1DE4B 5A40E 4NRYA 2C9QA 4ODSH 1BBJB 1KCVH 3RB7A 4DPCX 4Y5YC 2YC1B 1EO8H 3S35H 4M6ML 1Z6JT 1B4TA 1QACA 1UXSA 3QNXA 3ZL4H 1OSZB 1QSEB 2ZP9A 4DVRH 1KIPA 1F6AA 4QRUB 1L7IL 1Z9SB 2VKXA 4M6OL 3EH2A 1CQYA 1K5NA 2OR7A 1I3VA 4MA7L 3BWAA 3UJTL 3VXSA 1UXWA 3QXAB 3OZ9H 1L6PA 3Q0HA 4DERA 3D7PA 3SDCD 2X9XA 2XWTB 2W9DH 4GG8B 2ESVE 2KBGA 5IREA 5I5JA 2QSTA 5DEGA 3VXNB 3ULUD 2VQ1B 4HCRH 3HC0B 1Z7JA 5FUCC 3UBXI 3V0VA 1HIML 1KUMA 4XP5H 2VN5A 4TRPH 4DP9X 4TL4A 4KJPD 1LNUA 2GY5A 4J2XA 2XPYA 3BWZA 3HNTL 4EOWH 4APQC 2AC0A 1MREL 4HWZA 5C86A 5GGTL 2J44A 4GBXA 3F04A 3U4BH 3D09A 4FEMA 2I85A 1YYLH 1RIVL 4ABUA 4YGVB 3VD1A 3RDTC 1JFQL 2OMUA 3PWUB 3MLUH 4B9FA 2CCWA 4HLZH 4JL1A 3BP5B 2YZ8A 1W9XA 4BZ2H 3S5YA 5A2FA 3O41B 2DQJH 1P9MA 2R39A 2RFXB 4PJIE 4RQQA 5A6IA 4NO2A 1N5YH 2NY1C 1VADA 2EVFA 2NY0D 4GBXC 4M5TA 1Y1DA 3ULVH 1CLZH 3PHAA 1JV2B 5KUMA 2VDMB 4D0CA 5J12C 3WFEL 1ZS2A 4UDUB 5A2KH 4IIQA 4XX1E 1FZJB 5IQMA 1XL6A 4PGDA 5F96H 5KBLA 4GKOA 4FLSA 4HPHA 1EX0A 3O9WC 3DX6B 3T3ME 1G7LB 3TNMA 2XYCA 2BVPA 1E2WA 1A3ZA 3DOSA 4L5FH 3RHWF 1CE6A 4ONFH 4L9DA 4WJG3 4PJHB 3IBEA 1JWSA 3IFLL 4P23A 2Z91B 5DZVA 4H8VA 4IIQC 4QXTA 2FWOA 4GXVL 2OR9H 5T1DH 3RIFK 5HHXL 4DKDC 3BPCB 4FFYA 3T1FB 1SYSB 2F58H 2YOAA 4LQFL 4PW3A 3R4RA 4R26H 5EMYA 3GRWL 4AIEA 1RP8A 3DUUB 3BRFA 3NFNA 4YIQA 3KXFA 2GJZB 3BDXA 5DFTA 1ZHLA 5EU5A 1VDGA 5JXED 1TLMA 4ZOAA 2RB8A 3V7MA 3EH3B 1WZ1H 1RZJC 1UQSA 3KJ6L 5D7SH 2CJTA 2DQFB 3HS8A 1MHEB 2HLFD 4PJEA 1DVTA 1L6XA 2IAMD 5BVJA 2P5EA 2Q76A 3ZE1B 4XVSH 1R0AH 4BFJA 4G6JL 1W16A 4LK4A 1S8DB 1JZ3A 4M5YH 5J57B 5FO7A 4EDWH 1C8QA 1I1YB 2PPFA 4LSUH 4TULH 1VKXA 3MCKA 4ZD3L 1C08A 4JKNA 1MY5A 4TNWF 5BPPA 2VSMB 2ICWJ 2HTLC 1UOVA 1FE8H 4EUPH 5H2BB 2Z7YA 1R1CA 4NRZB 3FHEA 5AWNL 2YUWA 4RMQA 1PMYA 4N68A 2FEEL 3FAWA 4E41A 8FABA 3QWOA 1INQA 4TQEH 4U3XA 1I9RL 1C12A 3VFVA 4WJ5B 5E99L 1NPUA 1U8CA 1YO4A 2ICEC 4M1DL 3WS6C 4JZJC 1J9CT 2BOBA 2UUDH 3IAQA 1LE9A 5IJCC 2W0KA 2CKBH 1EFXB 1GH7A 1L7TL 1E5BA 1GCFA 1VLXA 2H0PA 3QT2A 2BWQA 2CUHA 1AGCA 1WGVA 4ZSOB 1MVYA 2VB5A 3QR1A 1AJ7L 1S2EA 5DHEA 3IRZA 1KIQB 3RB5A 5B39B 2OCCB 3ABZA 2IBZY 3VQ2C 4F58L 2YEZA 4OGYH 3RFRA 1DSFH 3SGJA 1JNHB 3KPRB 1YC7A 5FUOL 3UJIL 4ILDA 1RUPH 3FNKA 4BEIA 5TDNB 3GMQA 1WEJL 4P2YA 5FYJH 2D03L 3F5WA 5IBTL 4F57H 4H2AA 1THAA 2QLVB 3DHUA 1NKRA 4JFDD 5CCGE 1Z3GL 1CLOH 3PQYE 4MDJB 2WN2A 4KITB 4XNQA 2B1AL 2ZAIA 5B8CB 3X3GH 2A73B 1VCAA 2CR3A 2P24B 2R7EA 1TOXA 3QJHB 1RZ8B 1PD0A 5JOEA 3QFJD 1BVZA 3LH9A 2YXFA 5SWZE 3TVMA 4YHLH 4M8UA 4KVNL 4UQ3B 1A5FL 4XN7A 2P5ED 2X2YA 5C8JA 3SPJA 2G3ZA 1NLBL 3N41F 3ZTJH 1UATA 5KVDH 3EZJB 4NX0A 1TYJA 3OKMA 3KS0H 4R0LC 3TTSA 4JFSA 2EKSB 5C92A 4N9GB 2VLRB 4I18A 4J4PC 5BUAA 4OD2B 1CD8A 2AJSL 3PWPB 4KXCA 4X4MA 1XD1A 2CGRL 2BZCA 1F90L 3BLBA 5SWZA 2BOLA 3FQTB 1OLZA 4U1LB 5GSVB 5L88H 5GSRA 5BMFL 4PJXE 3VRLF 3R1GL 1UJ3B 3IPBA 3KPRD 4JN1H 4NKMA 5DVMA 3V0GA 4I2XB 4OF0A 2BNQA 1TJIH 4FA8A 1MDAA 4I18C 1Q1JL 3N43B 4J4PA 3T2OA 3U9UB 3PUUA 4MKTA 2HA1A 3WI9A 1KTDB 2IH1B 5F7WC 5IG7A 3DUHA 4HK0B 1JZEA 5DWUH 3SDCB 4APXA 2AJUH 3B7UX 3ZMEA 4N2HA 3FH7A 4WTZA 1UYWH 5LCVL 2F74B 3TEUA 3TBWB 2BP5M 1E4XL 2OSLB 3VG9C 5IVZB 2VLKA 4ZYKB 1MCEA 5IHLB 4ODVH 3NCBB 3L3DA 1U8IB 1ZE3H 2K78A 3BPLB 4QTIL 3MRIA 3W57A 5EOTB 1Q9OB 4RMRA 5EORH 2I07A 2G3XA 2C26A 3DVFA 3ILQD 4W9KC 4ZAKC 1MCJA 4BQ9A 5B1KA 4MDIA 5INCB 4OI7A 3N44B 3QBTB 4YDKH 2CA3A 2VMFA 1T0NA 2XWTA 4KNUA 4Y5YB 3D50A 4MJ5B 3MRDB 1SOKA 3U1PA 3VXNA 1KXTA 5C6TL 2ZJSL 3SYOA 1CYXA 4P2QA 4NCC2 3OJ2C 3SKOA 4AL8H 2B8OT 2NY6D 5E8NB 4DO4A 1NEUA 1CFSA 1KGCE 5EU6B 4Z7UB 3DNKA 5ITBH 2W94A 2HFFA 3OKKB 3SDAB 3UBXA 2IG2H 1F58L 1QFUH 1K8IA 1OM3L 3UPCA 2XWXA 3IEAA 1H6UA 1HFUA 3T8XA 4WO4C 1WFUA 3PV7A 2W9EH 4L4TA 3CFJB 4YBLB 1C9SA 2Y1YA 1J9SA 4LBEA 4RAHA 3ZU8A 4MD0A 4DK3A 2EO9A 4U1NA 4JQVA 3MRLB 1VADB 4QLWA 3KWVA 2BVEA 5J3HC 4P2OC 4CU7A 1EHNA 1ET7A 3IU3B 3QCUH 2PCYA 1JF1B 3G5VB 4GRWH 2O6EA 3AREA 5IB4A 3RWCB 4KAQL 3AADB 5HYJE 2R4RH 4FFVC 4M62H 4XCCL 3TO4A 5I1JH 1NCDH 4Z0XB 4LEXH 2O5ZH 4FNRA 4J3WA 3MJ8B 5LNEA 4KTGA 5DHVB 3RBGA 2H26A 1P4LB 3EYQC 4L0YA 5IVXE 2QQLH 4NQTA 1WZLA 4KHTL 1D5RA 1M7UA 3QDGA 2F61A 3EHBC 4NQSA 4ZMXA 2FZ3B 4FE9A 4NRXB 1AXTL 1JWSB 5LBGA 5F93C 4U1IA 2Z91A 1E6OH 1V8HA 3QI9A 2EO7A 5IB5A 3ZUNC 3SPCA 3IDNA 3TO2B 5DO8A 5AOLA 1DVFC 5D70L 3HI5L 1SYSA 1SY6H 3AS1A 2CJSA 4G8GB 5E5MB 5J06A 2AV7B 2Y2YA 4B9ZA 2DDQH 4NZRH 4G7YL 1W8EA 4F92B 5EF1A 2PNDA 3X1FA 3AY2A 2ENQA 3ISYA 2Z31A 1Q9LA 2FO4B 4KZ0A 1YQVH 3PDOA 4PW9A 5IQ9A 1HS6A 5B1BB 3X3FL 5F44A 3B2XA 5DJ2A 1RY7B 2NQDA 1NMBH 1MOEA 3VXMA 3GQFA 4GMSH 1U2CA 1I3RA 1FRGH 4UQ9A 1N12A 4R4BA 2Z7ZA 1KGIA 3ML9A 4AE1A 4RA3A 5D96C 1DTUA 3ES6A 2YXMA 5GGRA 1DVXA 3NCJH 4X6DE 2FX8H 4XPBH 3WJMA 4G8IA 2Q8AL 2EXWD 5I1EL 1I1YA 2J43A 1OGAE 3GMPB 2UWEE 1IC4H 4N6RB 4GS7B 2DLEA 5G4NA 4Z7UE 1MSPA 2FX7H 2HN7A 4HGKC 4W9JC 1N6QH 5LDSA 4Y19B 2Y2WA 5DYOA 4QWWC 3CCHA 1A3LL 5L8JB 1XZWA 5T1KA 2YN5A 4HH9B 5DS2A 2WSDA 1DQKA 2JE8A 3STZB 5FWQA 1M71A 3IVKA 1AI1L 2GG1A 1X5IA 3D12B 3EYVB 5DMIL 3VXSD 4D8OA 4Y1AE 5KYXB 2DI9A 4RAVA 5AVZB 5JPNA 2W5PA 4V1DB 3I74A 5DD0H 2ZX5A 3VGHA 4FLHA 5D1QC 3RKDD 5DURB 4OJEH 3MA7B 6PAZA 1AYOA 1EJ6A 4KXDA 4Z7QF 3IDMB 1OZUA 4IU3A 1B88A 3OHMB 2YA2A 4MXWH 2ODIA 5ID0B 2OMNA 4IOIB 2GEEA 4JPVH 5GRZA 4UM8B 2DOCA 1EFXA 1AFVL 1XDTT 4QHNA 4OCSL 3R8BB 1TJMA 1JHKH 1MIEH 1AGCB 2XNAA 3E3QE 4P0DA 5EUOF 1CLYH 4LDLB 2LLNA 2QVTA 2YARA 4JM2C 2AXGA 4RZKA 4G6KH 3SE8H 1AGFA 2VDQL 3LOWA 4H8UA 5FYKU 2CXGA 2IXQA 4IOFC 2L7EA 4C4UA 1T20A 1MLBB 2ZG3A 1SVBA 3BZDA 5H37A 3L7EB 2KC0A 3VE0B 1ZHBB 1UWGL 1D9KA 1K4CB 3WNOA 3HN5A 1MH5B 1SXCA 5JR1H 2I7OA 1HESA 5CSBA 3PWPD 4ZPTB 3WUWA 3RIFF 3IFNL 1UM5H 2JI1A 3LN5A 1JTTA 1AKPA 4Q9BA 2P24A 1WPCA 3FTGB 1BF8A 1GYAA 2EDWA 3WTXA 2VISB 2WCPA 2CO2A 1QUNB 3KPRE 4QD2E 1G9MC 3DHJA 4B53A 1RHHB 1MVUB 4PBDA 4ZFZA 2YPLB 1MCHA 4QXUL 4MZ3A 4HG4J 5HYJD 1FUNA 1GCYA 2BWIA 3MMEA 2Q7NA 2Q7YB 1NGQL 1BF2A 2ID5A 2WLKA 3KH3A 1FYTE 2IGTA 1N8OE 3UAEA 5I74C 5IFAL 3LKRA 3I75B 1CYGA 4DT2A 2HPOA 3CVCA 4L3FA 5SWZB 32C2A 1GGBH 3V6ZA 1FZMA 2QQKL 2P5EE 4ZK8A 5JHDA 1CIDA 4PLJC 4ZMVA 5L9DH 3RWJB 1KTJA 3CZEA 4HKXB 2V5RA 2DQUL 3QIBA 4DH2A 4P46B 3VMPA 4X7TA 2WZ6A 4NWTH 4WGWB 1DDHA 5E9DB 2ICEB 1MFUA 4F20A 2IH1A 2Z64C 4L8CB 3UPRB 5GPRA 3QK0A 4P4KC 3BP7B 1YA5A 4XP6L 3TYGH 2JJSA 1V05A 3BSZL 3O11A 2DWXA 3QIBC 1K6QH 3M1BA 1I4FA 2EDEA 2VM3A 3MGTB 1EEUA 2FNBA 3CLFL 1HN1A 3PG2A 4Q6KA 4LSRH 3A5VA 3BH8A 2X1QA 4LSDA 3ZZ1A 4JUTA 1M05B 1PZDA 3P30H 1RZJH 1FYTB 2JJSC 3HRZA 5EZLA 4Z7AA 5KVEL 3U7YH 1HEJC 2C3XA 1C1EH 1F3JB 4YH6A 3KGTA 1MAKA 3VXRE 2Z1KA 3H3KA 2NXZC 2IV8A 4OV5B 2X4OB 1XEDA 5AZUA 4AEEA 3JV5A 2VITB 5FHBL 4G8EB 4ZMYA 3RFZA 3TC9A 3B3IA 3EFOA 2GAZB 3A6CL 3D34A 4QPEA 3FCGA 4YNYA 3U30C 1BLNB 5EO9A 4N8CL 5I1IH 4J1UB 4IBUA 5I19H 4YL9A 3SDAA 1V3KA 1NC2A 4MMXC 4P06A 1V3JA 1Q90A 2ZOTA 3UC0H 5ISZD 2WVSA 3WIHL 4LCWE 1ZVHA 2GW5A 2WXIA 4U1MA 2B1OA 4XNMA 5IQNA 1HSBA 1WAAF 2DMCA 1IIKA 5CEYA 1IAKA 1HKFA 4OT1H 4KJWC 5TPWH 4FQIL 4UYPA 5D1ZA 8CGTA 1LO0L 3SDAC 5L4MA 3PJLA 3QEQA 4N8UA 2HAZA 1OAKH 5F2FA 2D8KA 2W88A 3DMMB 4WFGE 4S0SD 1WLHA 3O6LH 4UNUA 3KWWB 1ROWA 4RMWA 4NKDA 4PJ7E 1E4HA 4RISH 2ZOLA 1T2QH 3F6JA 4JDZA 1AMYA 5LXVA 3TLRA 1QZNA 2GI0A 3FO2A 3SCMB 3CTTA 5DMKB 1OKEA 2DQEL 4AVKA 3QDGB 3AQDA 1TUPA 2COVD 3W9EB 3SKMA 1XB8A 1ZE3C 3RKDC 1RPUA 4NEHB 4BCXA 1A7NL 2AF2A 5IB5B 1H3VA 1LO5A 1LWRA 2YAEA 2WZPA 5E8OB 2FATH 3VU1A 3ZE1E 4OVUA 3KLQA 4AYEC 3QDME 2G9HB 2SODB 4APQA 3DRTB 1NFKA 2HX8A 3DSNB 3IT8D 4POYA 1BAGA 3RDTA 5GGVY 3H2QA 4FI7A 4U7SA 2J5WA 3CVHL 3RVUC 1MELA 2DZEA 3BKCH 3HUJB 3LNHA 4LSTH 1EV2E 2Y7QB 4XP9L 4DFHA 1CFQA 3LNFA 3C8DA 2IC2A 3F84A 1FVEA 3VXSE 1X6LA 5T3ZH 3C6LB 3FB6A 4WCYL 3S35L 3U9PL 3HLKA 4Y4KA 5HP5A 1ZT1A 4OCNC 2VO5A 1NDGA 1T0MB 1RAMA 4PG9A 1L5GB 5JIDA 4M6OH 3ZMRA 4TUUA 3TCLB 3T0EB 1JE6A 2KKQA 1MFVA 3IDJB 1HE7A 3BJ91 4U4IA 3NFSL 4HJTA 4RDBA 3UBFA 3NIDE 2BDNL 4JY6A 1J0ZA 1QO3B 3BCDA 4U6YA 2WGNB 3KH4A 5EU3B 2MCG1 3T2NH 4JJHA 1OAXH 3BZ4A 1OTUD 4JZOA 3DRQB 1A6UH 3HI1B 3I2CL 4PCSA 4GW5B 2A9NH 2WWKO 3HZYA 4PJEF 1HL9A 4OZFG 3ARBA 5AUMA 4HS6B 4EQ2A 1BZ9B 4X2UA 3D18B 1WIOA 5DK0A 2L7JA 3EFFA 2JCWA 2G5UA 4ZUWA 1F45A 1P7KA 1RIVH 1JFQH 1BQHG 1G7QA 3EF4A 4UMGA 4WW2A 5D1ZD 3V7AE 2GT9B 1O9VA 4K71B 2X6MA 3FH8A 2J5LB 1DFBL 2WQ8A 4FFZH 4HYTB 1U8KB 2LU7A 5E6IB 4DF9A 1OWWA 2DL9A 4ETQB 1KGWA 3ULVL 2YUVA 1P6FA 1YEJH 4GEJA 2X70B 4HIXL 1HHIA 3L3KA 3GXDA 1I7ZB 4X5WA 5IV2A 5D6DA 5CEZL 1NJ9A 3A67H 4WW2C 2KLSA 2K4WA 4OFIA 2MFNA 5LN4A 3E6FA 1QPPA 4ACPA 3QG7H 3TP4A 2PKDA 4PPTA 1UFGA 3LH8A 1EMTL 4O4YH 3APFA 4U2YA 1DANU 4NSKB 2DJMA 1NOLA 4IRSD 1MWOA 2IDCA 3CDGB 4XWOC 1LTXA 3GSRA 3IFPB 1AC6A 4DK6A 5DJAA 1ERNA 1J5OH 3UTSE 1NKGA 4R7LA 4NQED 4ONOA 4QOKB 4B9KC 3T65B 2YKLL 2FT6A 2WVVB 3HHSA 4RIRA 3KPMB 3WTUA 3E6HA 3VWJA 4WF7A 3D39B 7PCYA 5I9QC 3QJSB 3SJVE 5AAWA 4JO1H 1MVUA 1KBPA 3ARFA 3N5AA 2NY2B 3WS6A 1KFAL 25C8L 1JXGA 5DF0A 3SGEI 3FQWA 1FVDA 1WCQA 4WUUB 2YWYA 4Z8FH 3FAXA 2Y6TE 5AZ2H 4G6JH 1NAMH 4JX0A 3TBTA 4Y2NA 5SV4A 3KYKL 2AJYH 3LEYL 4PRID 4I77L 3ZKND 1KB9J 4LSUL 1UEMA 2VDRL 4UOW1 1S9XA 1MWAH 1BVLA 1RSFA 1E50A 3CXHJ 3SGJC 4RMTA 4Z7NB 2ENPA 2W8CA 5ANHA 3N06B 3SD5A 3BGMB 2BO0A 3CLEL 3EBIA 4HUXB 4X99B 4XPAH 1WWAX 5D93B 1X5XA 1WBZA 1ZXKA 4AC2A 3ZX1A 5I5IA 4P5TD 5HGHA 5MEOB 4XMXA 3NK4A 3PY9A 4QAMB 4I88A 4QO1B 3ARGB 5D7LA 1N3NA 2WKLA 5ESAA 4Y4HC 3JWNE 5EIIG 3WV0A 2APSA 4LHUB 4UV4H 2QHRH 1DJGA 2HSIA 4NQCA 1TTRA 4NIKB 4TOYL 4DGVH 4TQEL 3JTTB 1P7BA 4KXZI 1FV1A 3BO8B 4BK5A 1TKWB 2I9TB 5DEJA 2NR6A 2AJXL 2E7DA 2RQ8A 4A7UA 4WUUD 2CCLA 4JHAH 2NW3A 1PW3A 4X98B 4YDNA 5L4FA 1VPOL 3EO0A 1PZ5B 5EIVA 1W72L 2WOYA 4OZFA 2GTWA 3PPEA 1OGTB 4K8RH 4IQHA 2NR6C 2OW6A 4UU9B 1HI6B 4G9DB 4F8QA 1ZVSB 4N9OB 4F58H 4Z7NE 1T3FA 4HMEA 4F27A 1OARH 1YY9C 1BLNA 5DMGC 1NGYB 2DY2A 3B9KB 3AQZA 3FT2B 3VFPA 1EDHA 4DKFL 3MPCA 2DD8L 2N7SA 5FYJL 3NVQA 3HE7A 4WRLA 5C0BB 3GXNA 1FBIL 1H3PL 5KOVC 3QHFL 5J6HB 5E94B 1PQZB 5B1JC 1TITA 1AGBA 4H2CA 4JFDE 5GGSY 1WA2X 4TS6A 3BESR 1BZOA 3VMNA 4KVNH 3TBSB 3ZOAA 5I1HH 4PP2B 2BNRA 5E1GA 3ISWA 1ZOXA 4LCUB 4EVNA 2LTQC 3IMUA 4ZAKA 3EHBD 1CICA 3V4VA 4M7LT 3MBEC 1ZK9A 4JDVA 2CQVA 3IFOB 3FUNA 1YPZA 3F7KA 1YEWA 5I5MA 3GBNL 5DVPA 1XR9A 2CGRH 5LAXB 1UGNA 3H42L 2VR3A 3AJ7A 3VTMA 2HJLA 2H3KA 3MO1A 4PI2A 4FLOA 2A2QT 1PTZA 3FU3A 5AB2A 3OAZH 4X6DB 4B3VA 4K3GA 4JRWA 5DZOA 2R2EA 5TD4A 3DSNA 5IR1A 5IJBC 1DLHB 1OGAB 4HDIA 4U7KA 1MCIA 1MCWW 2R0ZH 3B2PA 4OIAA 1NFDE 2KDGA 4NQXB 5H4ZA 4Z7OB 3M7OA 2DTMH 3IWVA 1BD2E 1J9RA 1MG3C 3OZKA 4L18A 3NIFE 1JK9A 4OCWL 1WFTA 1Y1UA 4PFEA 3GSWA 1MRDH 3TO4C 3VDAA 2GSIB 2P8LB 3EGSA 3T6QC 5HGDB 4LCCC 3QZPA 2OYPA 4NZUL 4GY4A 3N9GL 3BXNA 4G7QB 3SODB 5B22A 2CIKA 3ULVC 5DT1L 1YEDB 5C0BE 2EDFA 4LL1A 1J5CA 3GXFA 5ACMA 1WISA 5E9AA 5C09E 4EN3D 3IMTA 3R06A 5AKVA 3DBXA 5DK2B 5JZ7C 1NC2D 3V4UH 1GW6A 4PRPE 1MFAL 2MKWA 2G2NA 3ZR6A 4OF3A 4TNGA 4B60A 2QR0B 4FAAB 2GB2A 4MNQD 3SGDH 2BCMA 1IC5L 2PCPB 1OM3H 1LJMA 1A9BB 1CF1A 3SZ6A 2VERN 1H0DB 4UAHA 4UV7L 1URZA 4L4JA 3MRNA 4IRJC 2BC4A 1HOCB 5HJDA 3OAUL 2BPBA 2VWEC 1L9MA 4AQZA 1T0OA 3I9GH 3LZFL 1XO8A 4XCNB 2IPKB 4IRZL 4EZMA 2UUDK 2XWDA 1PLAA 1XH3B 2NNAA 3B3BA 3JWOH 1AACA 1BHGA 1QSFB 2X70A 4OM0H 3QCUL 5ERWB 2FDBP 4X5WB 4LAQL 3MODH 2R4RL 4M62L 5I1JL 4N8PA 5E8EB 4IRJA 4O51B 4PJFE 4UIMB 4GIOA 5EEVA 4XMPL 4UANA 1UFUA 5FYKL 4JFZL 1MI5E 5ICXA 1HHJB 5TQ2L 4XP4H 1M7IA 4S0HA 1KN2L 2J1XA 3OMIB 3L3HA 3HZVA 2WZPD 2JQMA 4N0YL 5DJXA 1G9ML 3U7WL 3RNQA 3VXPA 4OUUA 1UKQA 5J12B 5BV7B 4DGWC 3KCWA 3D8MA 4KO9A 2RACA 4UZSA 1U41A 2DDQL 2D31B 1MW1A 4W4OC 3V6OC 2MEJB 3MREB 1A6AA 1LEKA 5HXMA 3E1F1 1HYRC 1WT5C 3X13B 1ECYA 4EJ1C 1CZ8H 4G70B 4ANXA 3BCFA 4D9QD 2WUCL 2NDFA 1UKTA 2W0FB 5ABDE 4JKPL 1G6RH 3B34A 3D69B 1FRGL 2Y7SA 3EH4B 5AQ0A 4WV1B 1QSFE 4P23B 1RMFL 4OQTL 3BQVA 4OGZA 2KYIA 3EO9L 2XCMC 3O6MH 3TV8A 2Q8AH 1CGSL 3D39E 1GZPA 1M57B 3PYCA 3DYOA 1FZOB 4JM2A 1IC4L 1CI3M 2F08A 3JV0A 3PGDB 4FNLL 1OK0A 4PD4K 4PRPB 5DJ0A 4KX9A 2DYPB 5IQOA 5EOQH 3ZHFA 3WKPA 2DWEA 2V7NA 5E70A 3ARWA 4P4KD 35C8L 2JQAA 3DGGA 5AAPA 1CFNA 4FQ2H 1TZIA 1D9KC 3RZWA 2PYED 3MKKA 2WIIA 1PX8A 3D85B 2MPAH 3VXRB 5E6IC 3ARGA 1JIBA 5D7LB 3CDFA 1RUQH 3BGFB 3ARDD 4N20A 4YSEA 3FT3B 4NQCB 5KBKA 1OT1A 3AG1B 2K45A 5FLVA 3KDPB 3ZQWA 4HJGA 4P04A 1LK3L 2M83A 4B96A 2BVUA 3U6RA 3IJEB 1DBKL 4RAUA 3UTQA 2D0HA 3S36X 1ZEAH 1BAWA 3HG1E 4RRPG 5DFVD 2A0LC 4X4YA 2AQTA 4DNLA 3PAYA 3NZSA 4WI0B 5IJVB 4JM4H 3DJTA 4LSPH 2VLKE 4UU9A 3DIDA 2VDKH 3SPGA 3KG5A 1HI6A 4G9DA 2O6CA 3NN8B 2HT4C 1KC5H 5JUEL 3EJUA 5GZOA 1XTMA 2GI7A 2V3DA 4OFVA 2QADC 5D1QD 1S9YB 5HI4D 2PPDA 4RGMB 4GRWB 5IW6B 2X4QB 3VRIB 2YXVA 4AT6A 3IFNH 4LLQA 5GZOC 2AI0L 2EDBA 4AK2A 1RK1B 3ARFD 4W9HC 3QZWB 4XPTH 4PTTB 2Y5TB 4K8RC 1TR7A 4EDXA 4QHMA 5EFIB 4IBVA 3GO1L 4KZCA 1T04A 4ZUVA 3ZE1F 4JO5A 1SQMA 3DO4A 4JFYB 4ZMLA 1SF3A 3H9HB 2YAOA 3JQOB 5FA4A 5C2UB 3S9DB 2KL6A 3ULSA 3GMQB 4N2NA 2J25A 1VAHA 4AW7A 1UWEL 3CSPA 3N40F 1I8LA 1NMCB 5F7UA 2RAMA 3ATFA 3FULA 1QLEB 4A6YB 3FBQA 2HJLB 4UIKH 4BINA 1CLVA 1IM3B 1JD7A 3VSQA 5D4JA 1RUAL 1BD2A 2HWZL 3JZYA 3SE3A 4N2FA 1I8LC 4NWTL 1MHHA 4LCIL 2IQAB 2UYLB 1URIA 5LO7A 4PLNC 3A21A 2DI8A 2Z4QB 2MMXA 1AGDB 3MRBB 3MLVL 3QDMD 4N9GA 5IQLA 4G7SB 1J1PH 3BSZH 4I18B 2CRZA 3FU7A 3DURB 4FYRA 4MGXA 1YNTF 4PJBA 4M43L 3OJVC 5DEFA 4XBGA 4HAFA 3T2QA 3MV7B 4M7KH 5LBSL 3S37L 1TZOA 3VXQB 5F7YC 3OB0K 3O4LD 2HT3D 4BWWA 4PY7B 1VF5C 2GSIA 2P8LA 1T6WA 3EGSB 2B16A 3P30L 3VI4A 5C2BH 4R8WH 1TVHB 4Z7QE 4L3CB 1DO5A 4TLUA 1A6ZB 4NM4L 2X7LB 1NCGA 4QHLB 4HMDA 3QDHA 5BRQA 3PQYA 3Q6GL 2BP8B 5TQ0L 1MI5A 1JZ8A 3FCUB 1Y0LA 4B97A 4FFWD 5EWIH 2F5BL 4S10A 5I76A 1SOQA 4L2YA 3EUUA 3DVNA 4ZXBC 1XGQB 3D0LB 4FXKC 1TSRA 1O6VA 3JUYA 1R3KB 4ODHL 5D1XB 1QWHA 3J2PA 2FEJA 5ISZE 3QYCA 4UQEA 1WWCA 3ZTEA 5F3BB 3VG0H 3L1GA 5AFAA 5EOTA 3WUZA 1A9BA 2QT6A 2WBJC 3KW8A 4E9VA 3SDYL 1NCWH 2CWRA 3OAZK 2MH4A 4AQEB 1NLDL 4LPUA 1IX2A 5LGHH 3NCCB 4J3TA 4GI9A 4PJCF 2R0LH 3QXAA 3VVVA 4O00A 4J3SA 4QKTA 4FQIH 2MPVA 1IEBB 3QJRB 4QRPA 4XN2A 1XH3A 5EUOA 4X6BB 1DVFD 4DEPB 4LAJH 4AM0B 2JTYA 5IEHB 5CGTA 3O3EB 3ZVVA 4U0QB 5CP7B 3X14B 2ZUWA 3VDCA 2XZQH 3EGXB 2R8SH 4KRMB 5I18L 2BIPA 4JFHE 3MNWA 3SJVB 1OQXA 4LRNL 4ZTOH 1UM6H 3GI8H 4ZDHA 3HZVB 4H0GA 4JQXC 3DOIA 3KWUA 5DRNB 3S3DB 1KXQA 1S7TA 3FQ4A 5A6LA 4X6CA 4JKLA 3CJJA 3B2UD 4KDWA 3ARBC 3ULUE 1F1DA 3WFCL 2ZYHA 3ULVE 3QIWA 5HYIA 5AB9A 3TX4A 4AQ1B 3JWNG 4PSRA 2P45B 4N5UA 4Q0XH 3MJ6A 5IMMB 4GFXA 5DO2C 5C07B 1RIHH 4O2EA 4BXSV 4KQ4L 1FZJA 1AGEA 3C5XA 2WXJA 3QORA 4NQUA 4XP9H 4JRYA 1NGWB 2B9AA 3D69A 3QJOA 4NQSB 3S96B 1G1OA 1X4YA 3U9PH 1YEGL 1MJJB 5A7BA 4Y2DD 2BSTA 3H9SA 3RWGB 2XVLA 2EE3A 3DTDA 1E6JL 3GLEA 3J8F7 3I6KA 4KJYB 1ZLSH 2BVQB 5E51A 4ALAH 2V2WA 2D7OA 4QY8A 4QTHA 2AV7A 3QORC 3HS9A 1E5AA 2HUHA 3NZ8B 1IJNA 1JUFA 3P0VH 2VUKA 3RGBA 4XRCB 2V5SA 1ED3A 5F88A 5FV2A 3I2CH 3JV6B 1IILE 5IROA 3QYMA 1H9VA 4Y4HD 3DXAE 5EA0H 3VCLB 4HEME 1QYGL 2YBRA 2Y7NA 1K4DA 2QV4A 3NJLA 4R4BB 4DIXA 3GPEA 2PXYA 1F2QA 4S1SL 4ATTA 4ZFOL 1VRSA 1S9WA 5GGRB 3CFBB 2FYYB 1B6DA 5KVFE 2H1PH 1DJHA 2BSSA 2OMZB 1P4IL 4Y5XA 1WZMA 2YUZA 5TDPA 5C7ZA 2OYKA 4PUBH 5DZNA 4H26B 4G1EA 3ZDXE 1JZJA 4XPHL 3RUGA 3MLRH 2AS5M 2VXTL 1WTLA 4GT0A 3BGFC 5HI5C 1ZLUH 1OZTG 1SLXA 4HIXH 3NIFF 1YY8B 3RE0A 3VFSB 2EC9U 2CBPA 5FA3B 4CDGC 3A67L 4I3RL 4KO5A 1HTYA 2P7TB 1UD2A 4PGEA 5I66A 4GIPD 2ZT9C 1JRHI 3QCVH 4IKIA 4X4XB 1MFMA 1EMTH 5K9JH 1AO7E 2J8UE 3FFCA 4MAYD 4O02H 4ZUSB 3HOGA 4AH2A 4YZWA 2D7TH 4P2AA 4D9RD 3P3SA 5E5LA 1H15A 3BAEH 3ABLB 1WE5A 3EGDB 4UQ2A 4NOFA 3P2DA 3IAGC 2BOBB 2OS7A 5E6UB 5HYFA 4IHBA 4FQXB 2ITDB 4PCKA 3H4FA 3CHXA 1O5DT 1H6TA 2KQNA 2VKWA 5EU4B 5IMKA 3ZT6A 4YEEA 3RBSA 4BUHA 2GBAA 3UAJC 1HL4A 4EEEA 4QHMB 3FQNA 1ZDQA 4TLKA 1QASA 1SN0A 5IUSA 4G82A 5EOCJ 4L8SA 2AGJL 4X9YA 4Y2DA 4JFYA 1F4YH 1OAQH 4UT6A 3HMWH 5FA4B 4WWKD 4XB8A 1HZKA 1KBGH 1G7MA 4ZW7A 3VI4E 4Z8FL 2G2PA 5DXWA 5F1IA 1MCNA 2J1WA 1T6BX 3JVFC 3LRSB 3ROOB 3LKNB 5GRVK 1MY7A 1FO0L 2Q6WB 2AEWA 1FNLA 3QH3A 2NY5C 4FTVD 4KZEH 1WFNA 4Y2DC 4J39A 2LQRA 4ZS7L 2LW3A 5IMLB 1NCCH 1F86A 4JFXB 1MWAL 3KVDD 4X8JB 2C9PA 2ZKWA 2VL4A 5I8CB 3EYSH 3C08H 4JHZA 3RL1B 4UOZA 1J1XL 3CLEH 1BQLH 1ZWIA 3KPSD 3WLWC 2Z35B 4ZFZB 2AEQH 3NTCH 2VC2H 5GISH 4BH8A 2X2UA 2HJKA 2XPGB 3CWGA 1NEZG 2RR3A 2YAFA 4WFGD 2VH5L 3BUPA 5TDOB 1AGDA 3MRBA 4L4VB 4Z6AT 1OE3A 1TZHB 3S4SB 2APFA 1HYSD 4MXVE 1PEZA 3VGAB 3T1WA 4UV4L 1XCXA 4LVEA 1I7UA 3H1ZA 4G8GE 3B37A 4KTEL 4ZFGH 1SXNA 4P5TB 1A7OH 2LVEA 3FTWA 3OC5A 4DGYL 3VTTA 1UA7A 3MBEA 1E8XA 4E5XB 4I2XA 1TVHA 2J8UB 1NCNA 3VD0A 3HA0A 5INDB 2DEXX 2X9WA 4QRBA 4N2KA 5KVGL 1BA9A 5F7BA 4BJLA 4P3DA 2B39A 4K8RL 5FKAA 1FVCA 3ETBF 3G6JB 4XXWC 3AMKA 4AG4L 1LD9B 3AUVA 3M46A 4H8HA 5CCKH 1VFBB 4NENB 1NMAL 1OARL 1UA6H 2J3SA 2EYTA 1M7XA 5E8DH 5HDRA 4EMZA 4EUPG 2EDXA 2VDQB 4JJ5B 3QPXL 4D9LL 4ZYKA 2G0KA 4HJ0C 3OKYA 3ORJA 3AXLB 3TIDB 5K39B 1U8IA 4HEMA 2Z0BA 4L4VD 5T5NG 1G84A 1F4XH 3KJ4C 3HRZB 1H3PH 1XHHA 3CN2A 3EIFA 3KLAB 1KGCD 3C5SB 3IWUA 3L1FA 4HPYL 4ESKA 3FQYA 1ZAGA 3VYNA 5HI4C 1RQ5A 3AQXA 3M17A 3NESA 1YUHA 3ECBA 4HUMB 5I1CL 5ICYB 1BVOA 2DIAA 1RZFL 1KCWA 4JGMA 1PLCA 3F2LA 2QGCA 3RU8H 1B3JA 3PF2A 1HL5A 2Y4SA 3LEXA 2NX5D 4PWKA 3APDA 2IDSA 3UP6A 2NY0C 4GBXD 5EO9B 1DSYA 4IM8A 4GG6B 4JHWH 4PJ5D 2PW2B 3ARZA 4B50A 2XN9A 2Q3XA 4G5ZL 3IJ9A 1CGVA 4K94L 5C08B 5I6MA 3U2SA 4F2EA 5KVDE 3NK3A 5IESL 5BQDA 5C1MB 3KDMB 5CEYB 4E41E 4NQEE 3IETB 4L4TB 1Z9SA 5GJSH 3T6ZA 2VXUL 5GRUL 2E9JA 1MXDA 3K8LA 2O6FA 1X5YA 4F5CA 5JLZB 3ZSTA 1XH2A 5D7IE 2G2RB 4CSPA 2X6AA 1KCRH 1Y07A 3K2UL 3HC0A 4NDMA 3P3TA 4R2GD 1IEHA 4XBEL 5IVNA 4Y16C 4OF7A 1P0SE 4YDMA 4QT5A 2XWRA 3QPKA 2W65B 2X09A 1FC2D 3LKSA 1JD9A 1JVLA 3DX7A 2FLRT 1MRDL 3H6AA 3HZMA 3EXJA 2BVQA 3A6BH 4QY8B 2DM2A 2OXHA 2OMUB 3PWUA 4OD1L 4WEBL 2V5MA 1MFDH 3LB6D 4L37A 4QNPE 4ZOCA 4TVPE 5KJ7E 5HDQH 1GS8A 3MOAH 4MJIA 1H3WM 4CVUA 3OBAA 3QW9A 2NYYC 3GTNA 2D73A 3BIBX 1II4E 3I50H 1JPSH 4M61A 4FX5A 2E27H 1TMCB 5DQDH 5AW4B 3ROLA 3FN0L 4UDUA 4GS7C 3V4UL 3E0GA 2ZXAA 4FLQA 4F7TB 1ZT1B 4DN3H 3FUMA 4MVBC 4YN3A 3TOPA 3V6OA 2B4CH 2VDMH 3SGKA 1XXDC 3HHRB 1X9LA 4G8IB 1CE6B 4NPKA 5IBLD 1BMGA 4PJHA 4CDHA 3DROA 5CBAA 4G1EB 3EDEA 3OLEA 4JY6B 2WQUA 4OVVA 4Z23A 2LE9A 4W9FC 2GCYA 2G9KA 1W80A 3LZFH 2FQGA 1MPAL 3X2QB 5EEUA 1CDJA 4S1DD 5T1KB 2FBJH 4F9LA 4FFVD 4NT6A 3TFKC 4F93B 4HS6A 2GIYA 5CJ8A 2VDLH 5HI3C 1KGUA 2ZNWA 5GS0C 1IMHC 1XQ4A 2P7TA 4RAVB 3IDGB 3OD3A 4JB9H 4Z95H 4PVLA 1PCXA 3ZGIA 5I2IA 4KBPA 4ZUSA 4MRCA 4CVXA 5FYLL 1HWHB 3O3DA 1KN2H 1OAYL 1S7SB 2K6ZA 3NFPA 2HTKC 3ZL4L 1MJ8L 4L3ED 4WW2B 4AQ8C 4N0YH 2XN1A 4Y9FA 1NQBA 1U8KA 5E6IA 2DIBA 4QKXB 3VFOA 4UM8A 1OAZH 4PJGB 2F0CA 2X6VA 1UXMA 1CGYA 2PO6D 2WXRA 1VKXB 2MQ3A 5HBBA 2FGWL 1IO4C 1MNUH 4ORGB 1GJWA 4FABH 2XBZA 3FS9A 5HVHB 4HCRL 3FQUB 1QEXA 5I15H 2GABA 3HCVA 4W9ZA 1BVKA 2RJMA 4H8WL 4TRPL 2IWEA 3TH4T 3U79A 4N85A 4FYTA 3U48A 2PR4H 3ETBJ 3HN8A 3ZDXF 4JKPH 4NUGH 3HPLA 5KS9E 8PAZA 1DBML 5E0QA 5GGTH 2FO1A 3LRSA 1A6WL 1JZDC 2X53A 3U4BL 3QWOB 1T83A 4BCZA 5JMRA 5BUGA 4GKSB 3O6ML 1PY0A 1D9KB 3ZE0B 2QTEA 1AHWC 3L4VA 3LXCA 1I9IL 2A9ML 1ZLUK 4QOKA 5E1HB 2Y5EA 4DPAX 3ARXA 4XN9A 4BZ2L 1ECZA 4XPGL 3W38A 3D2TA 4PRDB 2NY2C 3H55A 3BRDA 3OXSB 1QZ1A 4PJDA 1G9NL 1AVAA 4G8FA 4P8QA 5I8CA 1NIAA 2VZUA 4EAEA 1GC1H 3IDYB 1T83C 5E6RB 2VMCA 3D2UA 1PIFA 3FT4A 1AHWA 4EUPB 3ASWA 1E8ZA 2PYFB 5F96L 5TDOA 3MNMA 2NY4B 1KJ3L 3MLYL 3G5XB 3TM6A 2ZOKB 1TDQA 2AEIT 4K9EC 5DUBA 4DZBB 4UCFA 3QWNA 4OCYH 4FP8L 2P49B 4L5FL 3I75A 4FERA 1HILA 2I5YL 5BZZA 3FQXB 2R1YB 4OBRA 3OKDA 3FXIC 2ZSVB 43C9B 2TRYA 5KN5A 2VDOB 1YUKB 2FYVA 3EZ8A 3QIBB 5AALA 5CAYB 5I26A 2MQCA 5DD3L 1ETZB 2G3NA 2J12B 1QFWH 1U3JA 4YK4B 4PP1C 3AGWA 3OWRA 3PGCB 3MU3A 1G7PB 3PL6D 1FVCB 3G6JA 3MUZ1 3UH8A 4XMTA 2ZTBA 4B7IA 1SHXA 4L0PB 3LRMA 1KNOB 4TVPH 3TFKD 1IB5A 2YJLA 4QRSB 1H3GA 1QLRB 2XACC 2EYTB 4S1RH 5A16B 3CFMA 4K94C 4W9IC 5SX5H 2CPCA 3IPEA 1R0AL 1DQVA 1I9JL 1N64L 3CX5J 4JFED 1KT2A 3W11D 4PVBA 4GXUN 3O3BA 3U6XS 4FFYH 3ELQA 3K6FA 5HDBB 5C08D 1M05A 1NUNB 4EI5D 2VJXA 2WINA 3CUPB 2FGZA 2YD0A 2AI0H 1XR8A 3W37A 3OHXC 4HUKB 2AJZA 2HG0A 4NFDA 5ICYA 5J1SC 2AQPA 2P47B 4OAWA 5FDWA 4ZTPH 1FF5A 4H20H 3P69A 4XX5A 2EXSA 4JFQA 5IWLC 3C6LD 2F7RA 2ORBH 4HK0A 1GGCL 4JPSA 3SDCA 1VGKA 2JIXD 3IGAB 5DHMC 4UNTA 1GJIA 3OHXA 1HXKA 3L3IA 4KRPD 2DEWX 4AEIH 3QQXA 2NYZA 1RJLA 3VX1A 1S7QA 4HIPA 4Y5VB 1K8DB 3AT9A 1VERA 1YAIA 3GYRA 4FZ8L 5AG8A 1CVRA 2PPEA 2F6AA 4XNMB 1KEMH 3KXFE 2WBKA 4YDLC 1U33A 4ZFOB 1R75A 2YPLD 5ILTL 3SGEH 4XNYH 4Q6YA 2CDEB 2H6OA 3IS0X 5CZXD 2V37A 2BNRB 2JQZA 3PP4L 1CD1A 2FHFA 5M95B 3EAKA 3NACL 2A6DB 1E5UI 4MJ5A 1B0RB 1EGJH 1MVFA 4MAUL 4TLTA 4E9XA 4NKDB 1R3HB 4OUOA 3SKOB 3V55A 3EYFB 3ZYIA 4RGNC 4JDZB 4GKNA 3O6KH 3UJIH 3BW9A 2BIQA 1JHLL 2WW8A 4XXDA 4M7KL 2BNQD 4MS8C 3U2IA 1HEZB 3MNVA 5I8EB 3LPGA 5K5YA 4I4WB 4WI7A 5D7IA 1TNMA 3I6GA 1P4UA 1I1RA 1H8LA 2CUAA 1LK2B 4U6HB 2GY7B 4MHHG 3DHMA 1BIIA 1RD6A 1KYAA 2G3MA 1ETB1 5E08H 4HLJA 4PJHE 4LRIA 4M61B 1GGTA 5KVDL 1OT2A 2HFTA 3KEDA 4YDVA 1O9ZA 4XBMA 4PV8A 4LO9A 2XG5B 4ODHH 5IMOB 1WITA 3ASNB 1UACH 2MTPA 5DHVA 3DDGA 4HV8A 1CYWA 3WNPA 1NL0H 1T0MA 3MAWA 4ODXB 5D2LA 1L5GA 3QDJD 3SDYH 4YFEA 1WC7A 5BUPA 4XMLH 1CFTA 4ZFFA 2A74B 4PJ7F 3IDJA 5LGHL 4G83A 2G0LA 1JP5A 2J6EL 4X9HA 2VLJD 4NZDA 1PF3A 4GNKB 2YGNA 2K0RA 3Q2WA 1DDTA 1IFHL 3F7YB 1FL6B 4EIUA 1X4ZA 3TURA 2Y6SD 1RH8A 1F0LA 2PO6B 4PG2C 4G9FA 3EOTH 1CU4L 5LXGL 2XN9D 2WANA 1B0GB 1EWHA 3IMSA 4R4NC 3NIDB 4NWUL 2GJ6A 3D85D 4P4RA 5D1QE 3DUSB 1UM6L 3H7BB 5D71L 2A6KB 3NDYE 1HHKB 4HWEL 4QTIH 3LCYA 4MS6A 3GMNA 2BC4B 2C9UA 3H3BC 4IYKA 1NM9A 1IFRA 5ETUA 1WGOA 4NJ9H 3FUIA 1IFGA 1C16B 2AK4A 4M9PA 4PJGA 5ACLA 3GIZH 2C3HA 4BQ6A 1LWHA 3BSZA 2HTLD 4U7MA 3VD3A 3MROA 1AE6H 1I7ZA 1S7WA 5F0MB 2OZ4L 1DJZA 1FG9C 3KYOB 1NBCA 4N5ED 3V9CA 2ITCA 4CA4A 4DW2H 4PQXA 3BKJH 2JCCB 4DGUA 1HJBC 4FNPA 2ZF9A 4TQ8A 1Z5LB 5JPNB 2CSPA 4YQXH 3VGFA 4GP5B 4BKLB 4J3OG 1JN6A 2YRBA 5C0DA 2OJZH 5FYKE 3RNQB 1YNLH 5TE7L 1E6JH 1L9TA 2O6PA 4K7PH 3IN2A 1F00I 2RA1A 4XCEA 2DB8A 5DRWA 1EDYA 3T0VA 1TQWA 1S7RB 1XWVA 2VAAB 5D7JA 4LPXA 5FYJD 4NC1E 1PPIA 2WVVA 1SXSA 3TF4A 3HC3H 3VQLA 2FT7A 3NOIA 2LFEA 1KV3A 4RGMC 3RY6A 1BXXA 2BRRL 1A66A 4J3OC 1AHWB 2NTSP 1AYRA 4EUPA 2QFRA 4MBOA 5DRZB 1DUYA 4XCCH 5ENWB 1MIML 3G5XA 1I1CA 2UZXB 3WKYA 1FZKA 4S1SH 1KYOK 4J6RH 3FQWB 3SQBA 4QHUB 3DKHA 4QXGH 3UBXG 1TXKA 2H8PB 2BSRB 2WZAA 5AG9A 5CEXB 3UAJA 3QO0B 3PWVA 1J88A 1EANA 3RVWC 1N0LB 1JDAA 3ZBMA 4Q56A 2Y1ZA 2UZYA 3ZE0F 4YHNB 3HI5H 4MAZA 2VXTH 3MN8A 4ZX4A 4G9FD 1NFDB 3L3OC 5E4AA 3U82B 5JPMA 3W5NA 4I9XA 4EZKA 3H2PA 1CFNB 1T21A 2VR7A 4NZRL 1JAEA 4HUXA 3SZKC 4YR6B 1M56B 3F7LA 4R7VA 2BXZA 1NFIB 4FCHA 1T7ZA 1QEWA 2HH0L 2GTZA 1LM8V 4PJ8B 4WFEE 4GG6F 3HNVL 2YRLA 1IAOA 3L3OA 3LZQA 3UG3A 4XH2A 3CE1A 3SE4A 4R4ND 1EBPA 5E8PB 4AJWA 2X0UA 3SDDD 3AB0C 1FV1B 4XR8C 3BAEL 4KFMA 4POZC 1TKWA 2I9TA 1KB5A 5F3HB 4LF3B 3U1SL 4KUZH 4M9OA 4MAYB 3DTUB 2MCAA 4MRBA 2XQYG 5K1VA 1QATA 3RJDA 3OR6A 3EO0B 4PWJA 2GTWB 1W2KT 2ICWB 5BS0D 3TT3H 2VLLB 3NYKA 1DDHB 4G6MH 2VN3A 3LH2H 4Z5RB 4X8XA 1P4BH 2Z8RA 5E1AB 4JFQB 2ZCLH 1PLGH 1O7DC 1G0YR 2GFBB 2ZD0A 4QHKJ 3U4KA 1NCTA 4C56D 3LIZL 4H1LA 3B1UA 5B39G 3K6OA 3L3IB 3MUGA 5F72S 1VFAB 2OW7A 3M1OA 4ELKA 5E24E 1UZ6E 2RHEA 2B1HH 4NB7A 4JO8A 5GZND 2BVTA 2C9XA 5DRXB 5I28A 4ZOBA 2BHFA 4MCNA 5A2CA 2FJSA 3F3HA 1ZRUA 4LU5L 2Y5TA 5JQ6H 5ITFB 2CLVB 3B7SA 4Y89A 3QXVA 4I9WD 5JIMA 4OV5A 3RPIB 3HG1A 4YDLB 1INDL 5SX5K 4OFPA 3ULSB 3TVMD 3QUMB 3O8XD 5GGQL 3CVIH 4ABVA 4PM1A 3RZCA 5F1SA 1YPZB 4MJIE 3X1GA 4XE5B 2BHUA 2F2HA 3CBKB 2DPKA 3ATDA 3KVPA 2HJFA 3AWFA 2HVKA 1S3RA 3WFHB 1QA9B 4OLZL 5MP6L 1IM3A 5DD6A 5CN3A 5IM7A 4HMCA 3VI3F 1PL3A 4ONGL 4Z0BH 1NOFA 4D2NA 3CXDL 1FNGB 5EBLB 5C3LD 2R2EB 1FO0B 3HG0A 5IK3B 5CD5D 1A4KA 1XH1A 1FDLL 2UVEA 2ZXDA 1RZIB 3ALPA 3QZBA 4TMPA 1ZPUA 2N4IA 3GSVB 2IBGA 4NQXA 3FO0L 2AABL 4MA8L 3K81A 4YDZA 3WNNA 3G9AB 5AB0A 1XF4A 2JB6A 4AWJC 2XN2A 4HFWB 4XN1A 4GW4A 3QRBA 3W9EA 2ATPA 2G75B 3JWDH 3ZYZA 4UQIM 3DXAA 5L2JB 1TZGL 2A74A 3K6IA 5GGVL 1YN7A 2K6WA 2AANA 4PRAB 3TN0D 4N25A 5CMAA 2CCVA 4LQ1A 4C4KO 3HG5A 1ZMYA 4KX7A 4RGOL 3IXAB 2JJTA 1FL5B 4HHGA 3EJJX 1OE1A 1T6VN 3LEVL 3P4MB 5AYUL 3EYOA 2X5PA 1BVNT 1XGQA 2WLIB 2A74C 2X1XR 4N2CA 4MTMA 1CS6A 3WXWH 4HIIA 1EIBA 1SYVA 2UWEB 4MQTB 5EZPA 4YHOL 3O81A 2JJTC 4DETA 3CLFH 3WHXA 2R83A 3DIFA 3QEQE 4HKJA 4U6XB 5KSUB 3WS3A 1OB0A 1VGEL 2ZCKL 3VFGL 3D3VD 1RZJL 2E7CA 2YO3A