4CSZA

Structure of f306c mutant of nitrite reductase from achromobacter xylosoxidans with nitrite bound
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 92
structure length 335
sequence length 335
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cszA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cszA02
1F56A 4K9JA 1OCRB 2DWSA 5I28A 1ZIAA 2VW6A 3ZDWA 1KV7A 1OV8A 3FT0A 4F2EA 4HIPA 5I26A 4E9VA 4UANA 1DYZA 2YAEA 1J9RA 4QLWA 2YAMA 1EHKB 1XB6A 2HLEB 4JKNA 3UABA 3S3DB 2DYRB 2XV3A 3WI9A 5F7BA 4JHVA 4YSPA 2GIMA 3PAVA 1CYWA 1BXVA 1AG0A 3DIVA 3FSAA 4MFHA 2YAPA 4BWUA 3CG8A 1PF3A 3WKPA 1SDDB 3X1NA 2QDVA 2GC4C 3WG7B 3CVBA 4W9ZA 3FQ1A 1NPJA 4N8UA 1AOZA 2W88A 4BDVB 1M57B 5D4HA 3IE9A 2BZ7A 4KO9A 4DP5X 3NJFA 3FSZA 3DTUB 1L9OA 2IWKA 1GR7A 2XUWA 2J5WA 1XMEB 1SF3A 2ZWNA 3KW8A 1CURA 2VSMB 1PLCA 2VW4A 1CUOA 1J5DA 4HAKA 1AS6A 3NSFA 1PMYA 4A2DA 1PAZA 1OF0A 3UAEA 1R1CA 2N0MA 1NPNA 1T5KA 5PAZA 3D12B 5TK2A 4E9RA 5AKRA 4NERA 1L9PA 3IN2A 1GS8A 2B3IA 1NIEA 3QQXA 3PPSA 3PLYA 1IKOP 1EZLA 2FTAA 3HEIB 3ABGA 7PAZA 4BDVA 3OMNB 1BEXA 3OQRA 2P80D 3FS9A 5IY5B 1BQKA 2XLLA 2IDFA 2E86A 3NSCA 2PLTA 2YAFA 2R7EB 2H3XC 4KO7A 4YSEA 2UXGA 3FQ2A 1J9QA 2YAHA 1AZCA 4YVUA 3T71A 3UACA 4GP4B 4KO5A 1CC3A 3PXLA 1NIAA 1B3IA 5B7FA 5I5MA 3CVCA 2VM4A 6PAZA 2HX9A 2BP0B 1KBWA 1J9SA 2PPAA 1JVLA 4E9WA 1NINA 2DYSB 4BK5C 3QJUB 5F7AA 2Q9OA 2H47C 2OV0A 2EIMB 4HCIA 3N2JA 1L9QA 1PZAA 1ADWA 2LLNA 1MG3C 4AI7A 2I7SA 1M9WA 3QJSB 4DP0X 3CVDA 3FSWA 3G5WA 3TBBA 5I6KA 3OMIB 2R7EA 3C75A 4RH4A 5B1AB 1HAWA 4HHGA 5D4JA 3NJJA 1JXFA 1JZGA 4GYBA 2I7OA 2HX7A 4X4KA 1WA1X 2AANA 1HFUA 1ZIBA 4QKTA 4DP7X 1WS7A 2DV6A 3T6ZA 2BP0A 1WA2X 2PP8A 2UX7A 5I5IA 1NZRA 4A66A 3BVDB 2FQDA 3MX0B 3TU6A 1KCWA 2I85A 4AX3A 3EH4B 3NJGA 2ZONA 1V10A 2IDUA 2GSMB 2DWTA 1WS8A 1URIA 1W6LA 3SBPA 2FQFA 1ZPUA 2HRGA 1KDJA 2IH9A 3ASOB 3FYEB 2P80A 2QT6A 3T6VA 1NDTA 2HX8A 3DKHA 1PLAA 3ABLB 2GC7C 1OOWA 4YVNA 4P5RA 3CZUB 3PAUA 3NJMA 2B08A 3GYRA 4G72B 5I6LA 2OCCB 1WA0X 2PPEA 3N55A 1PZBA 2PPFA 1BXAA 1RCYA 2UXVA 5E9NA 4DP6X 1KBVA 2IDTA 4F2FA 1V55B 4E9TA 2MRYA 1X9UA 4E9XA 2XU9A 1MZZA 1SNRA 4GXFA 2YXVA 7PCYA 1SHXA 2Y1AA 4AKPA 4G70B 4AZUA 1SFHA 2AZAA 4EF3A 4BXVA 5B1JA 2JXMA 2H5UA 4HZ1A 1KYAA 1ZV2A 4W1TA 2HZHA 1W8EA 3AG1B 5D4IA 1KCBA 1ASQA 1JXGA 1AG6A 3HB3B 1AAJA 3UGEA 4DP4X 6PCYA 1SDDA 4AKQA 4M3HA 1IBYA 3QPKA 2PPCA 5I6OA 2GI0A 3AG3B 3H56A 2YAOA 4JHUA 2IH8A 5FC9A 2JFCA 2HRHA 1AZNA 4BWTA 2VN3A 4Q89A 2CJ3A 2W8CA 2VW7A 4KNTA 3TASA 2PP9A 3QJTB 1NIBA 1J9TA 2CALA 2IDQA 1OE3A 1L9TA 3NJKA 4F7KA 3IEAA 3AG4B 2VSKB 2IAAC 3H4FA 1RKRA 2HXAA 3T9WA 1A3ZA 4E9SA 5AFAA 3WKQA 1A4AA 3NJIA 1OCCB 3QJRB 4KNUA 3S8FB 1XB3A 3PAZA 5I6NA 1JZHA 4YSUA 1A4BA 1UATA 2WSDA 2AFNA 1TEFA 1A8ZA 4WTQA 4CSZA 1AANA 1MDAA 1NICA 1M56B 2YQBA 2EINB 4TXVB 3CDZB 3ZBMA 2QPDB 4GP5B 1KDIA 2XVBA 3X1BA 3AW5A 1AZRA 2YAQA 2FWLB 2FQEA 4YSQA 1AR1B 1ID2A 3NSDA 5ANHA 3S3BB 1NIDA 1BYOA 1TU2A 4NB7A 4GP8B 4DP1X 1E65A 2FT7A 1AS7A 4YSSA 3ASNB 3GDCA 1YLBB 2PPDA 2DY2A 1AZUA 3FSVA 1MG2C 2XWZA 1RZPA 3UAAA 4ZK8A 1E67A 1OE2A 4DPBX 4KOCA 1VLXA 1SFDA 4N4YB 1V54B 1NIFA 3SBQA 3NYKA 3ZX1A 3CDZA 4DPCX 2CBPA 5B3SB 4M4RB 2PCYA 2BZCA 4E9QA 3X1GA 3MBWB 2XX0A 1L9SA 5I5JA 2BWDA 2XV2A 4YL4A 3EF4A 2J57A 2WO3B 2VM3A 1W6WA 2TSBA 2FQGA 1PCSA 1X9RA 1PNCA 8PAZA 3JTBA 5B7EA 3AY2A 1OCOB 1ASOA 2TSAA 2BW4A 2UXFA 1JZEA 4BWWA 3TA4D 1OE1A 3FPXA 2QDWA 4KNSA 1E5ZA 2IDSA 4NAJA 4DP9X 4PAZA 1ILSA 5EHFA 2IWEA 4YSRA 1BAWA 2GB2A 1JZFA 1JZJA 1MZYA 9PCYA 2FNWA 2XX1A 4YSDA 2XXFA 1AACA 1QLEB 1IUZA 3NJNA 4HCGA 1ET8A 1GY1A 2YXWA 3T6XA 4A2FA 1ZDSA 1N70A 3OD3A 1DZ0A 3SBRA 2WO2B 3ZIYA 1SJMA 2RACA 3AZUA 2XYBA 1FWXA 1GY2A 3X1FA 1E5YA 1BQ5A 2CCWA 3UADA 3FU8A 3H4HA 5I6MA 4PCYA 3EH5B 4FAAB 2QPEB 4DPAX 4E9YA 2FT6A 3X2QB 2YARA 1JXDA 4G7RB 1N68A 2AVFA 2BW5A 3FU9A 1BYPA 1AQ8A 4YSAA 5TK4A 1GSKA 4KOBA 1AIZA 1ET7A 5B7MA 3S8GB 1NWOA 4YSTA 1NWPA 4DP2X 4KO6A 2VMJA 4WKXA 3SQRA 3QJVB 2UX6A 2CUAA 3FU7B 3OM3B 1FA4A 2PP7A 2JKWA 1GYCA 1BQRA 1NTDA 1PLBA 1XB8A 2A3TA 2FT8A 3EHBB 1HAUA 2J56A 3JT2A 2CAKA 4YSOA 1PNDA 3PCYA 3U25A 4P5SA 2BHFA 4A2EA 1ETJA 1ZDQA 2X87A 1AZBA 2Q5BA 2FJSA 1A4CA 2BP8B 2ZXWB 1QNIA 5LDUA 1FFTB 1JVOA 3ERXA 1SHWA 5PCYA 4CSPA 1IBZA 1JZIA 3KW7A 1TEGA 1PZCA 1JOIA 2EIKB 4GY4A 4A2GA 4HHWA 2X88A 3S3CB 5B1BB 4A68A 2PCFA 4FA7B 2BWIA 3WNJA 5AZUA 1ASPA 3NJHA 3RYMA 5B1JC 1E30A 4Q8BA 3IBOA 5A7EA 3EH3B 3NSYA 4G7QB 3NT0A 2MTAA 1GS6X 3BQVA 1JERA 4G71B 4G7SB 4DP8X 1KGYE 1J5CA 3X1EA 4AKOA 3NJLA 3ABKB 4HCFA 4A2HA 1I53A 1PY0A 3FPYA 2EILB 3FU7A 1GS7A 3TBCA 2AZUA 2NRDA 2IWFA 3IN0A 3WIAA 1L9RA 3V9EA 3QJQB 2BO0A 2Y69B 4UAHA 1RZQA 3FYIB 1ILUA 4L0PB 1ET5A 2BP8A 1A65A 4ENZA 1GW0A 3AG2B 4BXSV 1IC0A 2GBAA 1SF5A 2J55A 3NP4A 2XXGA 2ZOOA 3NP3A 4HALA 1OCZB 3FQYA 2XV0A 4UF7C 2GHZA 3OMAB 4YSCA 1CYXA 3L45A 4A67A 1AS8A 1TKWA 3V9CA 1BXUA 3T6WA 3WNIA 5I6PA 2EIJB 2UXTA 5B1KA 3ABMB 1WAEA 2OJ1A 3GXUB 1QHQA
chains in the Genus database with same CATH superfamily
4K9JA 1HU8A 2X44D 3MROA 2CJSA 5ANMB 5I28A 5HXMA 3CN2A 4C56B 2DOCA 2JKNA 2B20A 2X4PA 5C7XH 1T89A 3Q06A 1DYZA 3KHOA 4MDIB 4PJ5A 5K59E 2XIBA 5AKTA 3MSPA 1NDMA 1R5VA 3U6RB 2IH3B 2FO8A 3RWCA 1G7PB 3IJ8A 2VRAA 3UBGA 3CIQA 4J4PA 4YHNA 4W9EC 4XC3L 1WFIA 3E3QE 4YSPA 5DJDA 2FBJL 2DMKA 1Z9MA 3AQDA 5JNYB 2BNRD 3PHAA 5IVZB 5EIIA 3NAAL 4KROC 4M00A 1FNEB 1PF3A 3V4PB 3X1NA 2XZQL 5SWSB 1QSFD 2DQHH 3KG5A 1F45A 4IGBD 2EACA 2FBOJ 1ULVA 1A6ZB 3IDNA 4OAWA 4X83A 5T33L 1UM6L 3X13A 4WU5A 2Z4QA 1AXTL 1U0QA 4KO9A 4M1GH 3FSZA 4M8VA 2V17L 1GR7A 3GSXA 3L7FB 1JNNH 5JXEA 4UU9A 5I18L 3BUYB 2VSMB 1N6QH 1R75A 2BP5M 4HAKA 3SHSA 4N86A 4UAOB 5IV2A 2IOOA 4HHAA 2APXA 4HYTB 5J13C 2VJ8A 5C0RH 1NPNA 4TUOB 3QPXH 5BRZB 4RGMC 2H1XA 3OG6B 1LDPH 2FYVA 3FF7A 5F1KC 3ULVL 4P2CG 5DMGC 2WNXA 3I3BA 5HI3D 4XMXA 5IK3A 1YO4A 3FRPA 2WVUA 3C9NA 4QAWA 4G8IB 4UNUA 1HILA 3W39A 4Z5RB 1F4XH 5FFLA 1RVFL 1GGIH 2AXGA 1QTYT 1PQZB 1AIFB 3EDEA 5JIKA 1D5IH 1NAKH 4X6CB 1P2CA 2XXMB 3HG5A 2EDBA 3OKLB 3FULA 5I8EA 3WFBL 3PE9A 2IOIA 1LNUA 1TSRA 1JPSH 1A6AA 1A9EA 4K9EH 4PRHD 4WTZG 4ELMF 1ZA3A 4NCDA 3B2VH 4XO8A 4MNHB 3T1FA 4AZ8B 3I84A 3UTSB 2ZYSA 1UACH 1WK0A 2GBUA 2VXQA 8FABA 4K94H 3B56A 1FH5H 4JKPL 1F6AB 3RDTB 1TVBA 2MQGA 2NNAB 5F72S 4F92B 3JVGC 4AQ8C 5GGTL 5G5DA 2LABA 3T08A 2GEEA 5K9QG 3CVCA 4KKLC 2K4WA 3ARGB 4WHCA 1JV2A 6PAZA 3CX5K 2BP0B 2K6YA 1PG7H 1HL8A 3II1A 1JVLA 4L9DA 3B7UX 3K7UA 1WAAF 5F7AA 4R2GD 5JHAA 5DLML 4APXA 1PY4A 3OSVA 2X6MA 4KXZH 3BN9C 4NUJB 1MLBB 2N1KA 2NY0B 3N2JA 3PABA 4G1EB 5DRNB 4U7MA 3QZBA 4F8QA 3FOLA 2LLNA 3OGCB 1AFVH 2VZVA 2YPVA 2ZAIA 2BVPA 3ZE0B 1OIOA 3FO9A 4W68A 3P9LA 3QG7L 4AUYA 3IMUA 4DN3H 3GXTA 4WNJA 2UZYA 4QTHA 4Y4HA 4YQXH 7CGTA 1C12A 3N1PC 4OFYD 3F3HA 4I77H 5MEOA 4Z0XB 5BCAA 4K71B 2C9XA 1FJ1B 3FHAA 3TF4A 2EAEA 3HZKB 1N8OE 2B1AH 2O5YH 1A6PA 2B15A 4JFOB 3OBAA 4LSUL 5I2IB 5B4MD 1KZYA 4JVUA 2DQCH 3UERA 2BMKA 2R0LH 2DM7A 5BZWB 2ERJB 1YQ2A 1PYWA 5C0AB 2R39A 3VE0B 3BVNA 1EVUA 3II2A 5ICXA 2Q7YA 2XN9A 3MBXL 5LAXA 2XRAH 3KPMA 3BIKA 3ECVA 3VUAA 3UIZA 4KXCA 5IROA 2CM5A 3ZR6A 4PMFA 2Y5QA 4A66A 5FUOL 4P05A 2Y06H 4G5ZL 5DUBB 3MA9L 5TH2B 3V0VB 4ACTA 3WTYA 4URTB 5ENWA 2WLNA 3TM6A 1OK8A 4ZFGH 3W11C 2Z8SA 3GS7A 4OFIA 5E1AA 3GEFA 3I6GB 4KV5F 5E9DD 3KL0A 2D7QA 4IBQA 4ONGL 4B5EA 1BVNT 1IAMA 1WFUA 4Y2DA 5T1KA 2CHXA 4NQCA 3VFVA 1WBZB 4N3UA 2MCG1 5BMFL 3TS8A 3T2LA 4FULA 3NACH 2NUPB 3BPCB 2XPGB 1QRKA 4BELD 1T80A 1UXWB 1YNKH 1YPZE 1G9NC 2H45A 4G72B 1N2RB 3NCCB 3W81A 4NZTL 2J44A 3OKEB 4X6FB 3ZUCA 2K1MA 2PPFA 4WHTA 4Y7MA 1FFPB 1I4FB 1IM3B 3RDTC 3WFEH 2IH1B 1LL1A 3W9EA 3MJ9L 2IDTA 4F2FA 1O7VA 4Z77A 2D03L 4K7PY 2R51A 3ARGC 5DUPL 3GRBA 3ILEA 2NZ1A 1K3ZA 3QI9D 3Q3GA 2WINA 3N0PB 2P45B 3AC0A 3DTXA 1I3RA 1O5DT 3IJEB 3G6JB 3RWFA 1AGBA 1MCEA 3V4VH 3KPNA 2NY0C 2Q1EA 4LCUA 1D5MA 1USQA 1AAJA 1EFQA 1HWHB 2N3JA 3G08B 5I0VA 1UA7A 2PTVA 5DMIH 6PCYA 2JH2A 3GI8L 4HOZA 4KAQH 4M1DH 4WW1A 2NUTA 1RP8A 1PS3A 1CFTA 1G1KA 2ZX9A 4PCKA 1GOHA 4KDTC 2E4FA 1MFEH 5FC9A 1IEBA 3F5WA 4JO3L 1HE7A 4PJHB 5HGDA 1KC5L 3EGSB 3IFNL 5J6HB 2A9ML 3PWPD 4KNTA 1MAMH 4UTBL 2IBBA 4J3BA 4JB9L 1JGEB 5MEQA 3DI2B 3GMNA 4M93C 4AT6A 4P4RA 1YNTB 1QFWM 5TJWK 2ERJC 2DJSA 2DIEA 1E0OB 5AVTB 4JO2H 1RUQL 1YJDL 2WKOA 4E9SA 3UZEC 4PV8A 2WKGA 2WWMC 1UJ3B 3M7FB 4JFVA 1J5OL 3VFWA 2Z8VC 1RK0A 4TYUA 3H3PL 1PZ3A 3K2KA 1O0VA 3QYNA 1OP3K 4XCCL 3S96B 2EZ0C 2AJSL 5D1ZB 2FX9L 5F7KC 4NGHL 1A8ZA 1RH8A 4GMTH 5H37H 1OZTG 5JZ7D 2VERA 4NOFA 3MGOB 4JVPA 2JLPA 3IU3A 4PUBL 4YZWA 3MRLA 2QFPA 1KXQA 2QPDB 4J8RB 4BE5A 4F9LA 2VUYA 2ZF8A 2Z64C 1T0NB 4MNQA 2EE0A 3H6JA 4YFDB 4YSQA 1IGCL 1XXFC 3L4YA 3K3QA 1TU2A 5LBSL 4L1SA 2GSGA 3KH3A 4GP8B 2AMGA 4FRWA 4O58H 4GO6B 4JY5L 3LZPA 4HS8H 2JWYA 4NZRH 2O26U 3L1FA 4MA1B 4L8BA 4LLWB 4OCWH 3W82A 4BBWA 2ZAHA 5B38G 5IMOB 1A21A 1T4KA 4BFEA 5GS2H 4LDEB 2FEJA 1MCRA 4PS7A 5DEZA 4HK3N 4X6CF 4W9HC 1QA9B 2Z3FA 3OF6A 4AJWA 4BE6A 2QADC 3JVFC 2ZOLA 1FZJB 5BO1H 4OFPA 2CPUA 5D7KE 5TE4L 3V10A 5GRWA 3QIBA 4DW2H 4HEMA 5E6IA 2CBPA 2VITB 3EO1A 4X9GA 1S6NA 2YK1L 1YN6A 1I9JL 3CFEA 3GMMB 4DEPC 1ZRUA 4FQXA 4E9QA 1I1AB 1RSFA 1E28A 4FYSA 1M4KA 1A22B 3NIDB 3RA7L 3FH7A 4MMYB 1Z3RA 3HJ0A 4QWWD 2HN7B 3OVUB 1FLRL 1W6WA 3BC9A 2IADB 4ZS7L 3IRPX 3VNZA 4N0UA 4D9LH 1HWGB 2OMZB 5DHVA 3OLEA 3ZHLA 4XCNA 4XHQA 2ZPKH 3UDWC 4WWKA 3FFOA 3SY0B 4HUWB 3VWJA 3B6SA 3B7RL 4LBEA 1QD0A 4I87A 5FV1L 2W0FA 1KIQB 2WSPA 2FRGP 3PPEA 4HFWB 3D4CA 3MUY1 4R97B 5CJOL 1DVFA 2XX1A 5CP7A 2XXFA 1UJ3C 4PRAB 1FV1A 3CFBB 4AYDC 4YEEA 4L3EB 5C0BE 3ZE0F 1LK2B 3TYFB 1G0YR 3AS0A 3BXNA 1DHKA 3FCGA 5AW1B 1EPFA 2UYLA 4I0CC 4L18A 4BFFA 3HMXH 5DZOA 5HYIA 3IDMA 4ELDA 2Y6SC 4P2OA 2AJYH 2YD7A 2APWA 3DIFA 1BQHG 4YC2B 3SGDH 4BHUI 3QA3B 3H4HA 4PJFE 4AW4A 1JZ4A 2HKFH 3D0VB 3HC0A 5TGBA 5I1AB 4FG2A 2J1ZA 3E6HB 2MQCA 1BYPA 3GS0A 5I66A 1J1PL 3IVKA 3UPRA 1X5HA 2GTQA 1KFAL 4HFUL 3QFDA 3RLSA 4B0MM 3GSNH 3R06B 1RFDL 5D1QB 4K7FB 1J1XH 4OKVB 3VXSE 2QPUA 2R69A 1FVEA 1ZDQA 2YMXL 2EYRB 2X87A 3K91A 1HKLH 4MA1C 4Q7DA 1VDGA 3N6YA 5DCCA 1NJ9A 4IHOB 4EN3A 3FTVA 4I2XE 1Z32X 4Z3TA 3QWRD 4WSGA 1IGJB 1BJMA 4P23B 1EANA 3TN0C 3ARFA 5L2KB 2Q20A 4WO4B 5ID1B 2X88A 5B1BB 3J2PA 4PBDA 1BZ8A 5LNDA 3T4AA 2VLRA 1B4JL 5A6MA 4Z3FA 5MENB 4BV1A 3MLWH 3MV01 2FNBA 1UCBL 1IRAY 3BKYL 4NKIH 3RWJA 4KMTL 1A25A 1CFVH 1K72A 2EO9A 4ZS6C 5C6TL 2R23B 3RX8A 1LTXA 4X4YA 4IRJD 4N8VB 3EDDA 2CR6A 1I1AC 4B41A 5GRYA 4QF1B 1YC7A 5DJAB 3EYFB 5J1AB 1F90H 1TFHA 1JZ6A 2CGYA 5DHVH 1OQOA 2I60H 1KLFA 1ZTXH 1AQKH 2NRDA 2IWFA 4PGCB 4PJ9A 2DLTA 3G5XB 3KBPA 5D96C 3QJQB 3VGHA 4NO0A 4I85A 3E8UL 1RJYB 5KW9L 1NCDH 4EDWH 3OAWA 1CXLA 3Q2CA 1X5FA 3G6JF 3EFFA 1SF5A 2VLLB 3KNBB 3NP4A 4PJAA 4AXWA 2RHEA 4F2MB 1KGCE 3LS5H 3T0WA 3MJ6A 1P5UC 1U58B 3FNKA 5KJRH 1ORSA 3BRGC 4PJDA 2ISDA 3DETC 3EOAA 1AC0A 1UB5A 2X1XR 3PP3H 4GMSH 1OPGH 5L6YL 3UAFA 2P44B 4XODA 2XIIA 4PJHF 1F56A 3HB3C 1OCRB 4ODWB 4QRTA 1J0YA 4GAYB 1ZV9A 1DO5A 3LKPA 2VQ4A 4MTMA 3QUYC 4XBGB 1YNTF 2QSQA 1RHHB 1NC4D 4NUGH 1PSKL 3U1SH 3SCMB 4OV5B 4ZBJA 5EOCH 2C8NA 1NANH 3MO1B 5CD3B 4I89A 5ECGA 1MJ7L 1NCWL 1QKZL 1RPKA 2D3NA 2VNCA 3PGFH 4ZOAA 3RL2A 3MRKA 5SWQB 4FNTA 1R3HA 5I8CA 2H3NA 4U3XA 5GZNC 1A1OB 1AP2B 4NQSA 3KPRA 4ELME 4F3FB 3MACL 1KEGH 2W07A 2C5DC 4P23C 1MCIA 2XSKA 4NJAH 1SJXA 3UTQB 1TLKA 4J3OH 1OCWL 4M4RA 1XT5A 4W9DC 4EUPA 1H5BB 4W4OA 2NY3C 1UUNA 2ZWNA 2CO6B 3C09B 4BSJA 4JZOB 2V9QA 3BPNC 2X1WL 3R8BB 4UM8B 3JTTB 3UO1H 3BWSA 5K93A 3PUCA 5AZEH 1XH3A 1Y6MR 2HTKC 2YZ1A 2DYPB 2KZ1B 1DBBL 3HE6A 1N0XH 4KVCH 2I5YH 3HMWL 5GPRA 4MSWA 1B4TA 5CZRA 2BHYA 1HCZA 1NIEA 1TJIL 2YGQA 3EFOB 3LNIA 3OSKA 4OF8A 3H53A 5F88B 5FYJU 4RRPA 1JRHH 3F58H 1KB5A 3BESR 4IIQB 3RVUC 1DN0B 1J18A 2WBJD 1DLHB 4HV8A 4KI1A 5C92A 1IE4A 1BFVL 2GUOB 1FNLA 3LJ3A 4AV5A 4AQ1A 3C87A 4QO1A 3L4XA 3LRLA 4AVIA 3HZVB 1VHPA 4BH7A 3NIDF 1D5BA 1KY6A 4ZOBA 2YQGA 3BP7B 3NN8B 5D7KD 3RIFF 1QVOB 1VZHA 1KJ2A 3KJ4C 3DUSA 4PG9B 2L4OA 4Q2ZA 3UACA 4Q9CA 3VFTB 3VM7A 1GZPB 3AREB 2ZTBA 1VFMA 3UYPB 5MEPB 3D1MC 5I75B 3HFML 3NPSB 1KYDA 35C8L 3MR9A 4LDOB 4TVSa 3QFJB 1EAQA 4JFDA 3ARVA 3SDAB 3V5KB 3SCMC 3FRUB 4JRYA 3WDIA 4Y4FD 1X6LA 2F7QA 4KV5E 2H47C 3JUZA 1L5GA 5J0BA 1NAMA 1SN2A 3IGKA 1EWHA 3CBJB 1JV5B 3MVSA 4GXVL 1ZANH 5KVGE 1A4KB 2XN1A 1MG3C 4OV6F 2YJLA 3GJEB 3HRZA 4LIQL 1J10A 1ZHNB 4K5PA 2OMYB 3G5WA 3P3RA 43CAA 4S1DD 4OGZA 3X3FL 5C0BD 1S7TA 4GXUN 2ZWZA 1JF6A 4RFEB 3ZR5A 3SE3C 4A7VA 5DEFA 3CVIL 2GJ6A 3OB0H 3PGCB 5FKAB 4DP7X 3KYNB 2P8LA 2JKIS 5I30H 3OHXB 2Q7YB 1PX3A 1JF5A 2Y7QB 4QHMA 1XZWA 3C09C 4F5CE 1GCFA 1I9EA 2AF2A 4JE4B 4PJIA 3VFRA 3MUHL 4ADGA 3L3JA 4F8PA 4X7DC 3SE4C 1BF5A 5G4MA 3BVDB 3VVWA 1WZ1H 4YWGL 1INQA 4PI0A 1DQML 4P5TC 5DT1L 1V10A 1L0YA 1PDKA 2GSMB 5TDPA 3M1CA 2CIKA 1URIA 3RY6C 3V5DB 4HIEA 3QIUB 3DXAA 3RIKA 2ADFL 3VXSD 1QNZL 2A5UA 4NM4H 4Z7AA 4A6YL 3HI6H 4OTXL 4KJQD 5HDQH 3Q2LA 1XSOA 4YIQA 4C56E 1CFSA 4DQAA 5I1IL 3K8KA 4LLQB 3JWNE 4GPVA 5IKCA 4HDIB 2B2XH 5AB1A 2VLJB 3SN6N 3W37A 2R0ZH 3TA3D 1KJ2H 5DURD 5DS8B 1SBSH 1TMQA 4I88A 3K5SA 2G2PA 4JJOA 4GKZB 3CMOL 1REIA 4N24A 4PSRA 3RZCB 4M8UA 4ATTA 4OSUH 3NRFA 5T3XE 1EQWA 5JUEL 5DD3H 5AOJA 3L3IA 4P9HH 4QRSB 3AU0A 4JFTA 3DX8A 3L9EA 5E94A 5E9NA 2R9HC 5CLYA 1P6AB 1DANT 4ANKA 5D7LA 1MXDA 4D0CB 5KTEL 1CVRA 4XNDA 4ZTEA 5SWSE 2HFGH 1T66C 2UZXA 2XT1B 1XZ0B 1KLUB 1RJZB 3DJ9A 3OKOB 1NAMH 4IRSC 4HCRH 1CDBA 4HMEA 1ZV2A 3QSKB 5BXFA 1MIML 4C55A 3AFLA 1M05B 3QRGH 5B39A 2WVVB 4PBVC 1GGCL 1AG6A 2GSIA 2WLMA 3TZVC 1MNUH 2ZOKA 1VPOH 3FQRB 3P4NA 1XGUA 3TNNA 3HE7C 2F2HA 4U6TA 5CLTA 1KGCD 3H56A 1FNAA 3B7YA 3A67H 4LEXH 4NWTL 1GGBH 3SDDA 2EE6A 5BRZE 2Z1PA 3MRMA 1SZNA 3ZY7A 3NZ8A 4UQ3B 3MRHA 3WY3A 3C2SA 2R4SL 4WSJA 5J57B 2IALA 4O4YH 3HZMB 1L9TA 4Z7NB 5D7JD 2EUZA 2PWFA 5DJ6A 3DYPA 2VSKB 2BIQA 4L2LA 1J48A 1ORQB 4X6CE 2HXAA 2WQWA 4X4MA 3WN6A 4W93A 3T9WA 1P0SE 5DU7A 2BSTA 3NZHL 3O3BB 1P4IL 2X9ZA 4HAFA 5C0GB 4GIPD 3I74A 3F7VB 1KNOA 1ETZA 4X5LA 4ZW6A 3W57A 4EEEA 2J73A 4FQ1L 4FXKB 5E51A 2E9WA 2H32B 1HYRC 3P9MA 4FFYA 2Q86B 3BP4B 1TCRA 1QBBA 1HZHL 5I8OL 2XWBB 1MKFA 3H9SA 4JFFB 2PW1B 3QUHA 3CFKB 1DBAH 4R90L 3EOYG 2WUCL 3P0YL 2X12A 3D0LA 2VR7A 5EU5A 1U3ZA 2JKJA 4JGUA 2DB8A 1HJBC 2DQEH 5KSBF 1MF2H 4XHJC 3WS3B 5IQ7H 1U3HA 3BPOC 2F53A 1HQRA 1YDPA 3RZCC 4XPAH 4AUJA 1I8MB 4LSPH 3MI6A 5KYYA 5E5MB 4DZBA 4CSTA 3CLEH 4MDJB 1C5BL 3RPKA 2E46A 2P8PB 1FZOB 4HGWB 2F7IA 4R96B 3RWIA 2ADIA 3ZE0E 4B50A 1MG2C 3LNHA 1KG0A 3MLTA 4JNXA 1OP5H 3SPVA 2Z7WA 1OTTD 4OF6A 3QUXD 1BM3H 4HULB 3O8XB 5CFAA 2CLZA 5C0JB 1UZ8B 2HP4A 3VDCA 1X5JA 5E24E 3FZUC 2PXYD 3O45B 3W0WA 3NYKA 4UUJB 3UYRH 5DA4A 1S7QB 1T1ZA 1ZA6A 4OM1L 5C0AE 5F1NA 3W9DB 2ENPA 4CVZA 3FT3B 2MKWA 3LHPL 2YC1B 1P9MA 4OCNC 4P9ML 1J0KA 3HS0B 5I5JA 2LW3A 1EXUA 3TBTB 1S7VA 1EHLL 2WO3B 1HZKA 2Y36L 2VM3A 2TSBA 3NJXA 1F0LA 3VXTA 2W38A 1IL1A 3STZB 3OWEA 1N67A 5FO8B 5CBAB 2AJZA 1N6UA 3FUJA 4R26H 4TULH 2LE9A 3GBNL 4XNBA 4B7IA 3HNVL 1OLLA 4NAJA 4JG0H 4PAZA 4JM2A 4G8GB 3ILDA 4KROD 4JRXA 5HYJA 3CWGA 1G9EA 5EN2B 1VIWA 4FEIA 1T6VN 2BCKB 2BJMH 2YXWA 1HCFX 2IDCA 2X4SA 1S3KH 2WP3O 3G5VA 1TTUA 3ZIYA 3DX9B 4EI5B 1IAOA 2Z91B 2HJKA 4RGOL 3X1FA 2ZCKH 3WEMA 2PCFB 4WV1A 2YD0A 3VWKB 1JUFA 4DKDC 1M2VA 5I6MA 2PR4H 2QSCH 4HS3B 4POYA 2KC0A 4PLKD 3IE4A 2Z31C 1RU9H 4PJXA 4TNWK 4RIRA 1KTLA 2XG5A 2Q6WB 3NRQA 4AQZA 1FO0A 1KCVL 3S2AA 1CLCA 4TQEH 2B8OT 3G6JE 3QIWB 1QBAA 3TONA 2BFVH 4H5SA 3K6OA 4Q0XL 5F8RC 1MFCH 1R24B 2UZIL 2Y72A 5FDYA 4KQ4L 1A1NA 1M7DA 4U1JA 2WN2A 3BVXA 3Q9PA 4H40A 3BI9X 1ACZA 1YY9C 3G5YA 4FXGC 1BLNB 4G3YH 1PZCA 3DO3A 3FQXA 3LKSB 4GY4A 5HP5A 4PJHE 5JTWA 3WFHA 5AZUA 4FJZA 3GMRB 1T0PB 4PRBA 4NCC1 1TKWB 3MLSL 1FL3B 2OP4H 4OJFL 3ES6B 4B7LA 3O2WL 4C56D 2CA4A 3O2DH 5CJ5A 3U0WH 3LV3A 3NJLA 3VD4A 3HS0C 3MYJA 4NI3A 1PIGA 2LLLA 1XGPB 1YUKB 4PWHA 3WE6B 5E5RB 1AXSA 4C83B 2CLVA 2EDNA 3T8VA 3OR7A 4LPWA 4NZ8A 3KLHC 5KBDA 3P30H 5T3XD 2JK5B 3SKNA 1FH2A 2J55A 4W70A 4HLJA 3MRIB 3EYSH 3ZYOA 5EEXA 2FLMA 4NRXA 1MH5A 5C0ND 3CVHL 5SWSD 3KLAB 3R1GL 4AGQA 1ZSHA 3ZKND 2P5WB 4LCWA 1AS8A 3LPPA 2F1BA 4FQPA 4N8CL 1J1OL 4O2FA 2J21A 4FFTA 1IM9B 2QQNH 4FCHA 2UXTA 4H8WL 3BISA 3GLEA 3IAQA 4KXZI 1BHGA 1IKFH 4F33A 2O1AA 3P0VH 1MW3A 1PTZA 4RWHA 3GUFA 4JDTL 1MEXH 5T8IA 5A3IC 3FT0A 1LWRA 5JIMA 1K2DA 2ZSWA 3DVGA 4NHUA 5I15L 1KJMB 3QEHA 4JQXC 5EZOH 2F54B 3L16A 3C6EA 2XPZA 4XPTH 4Z7NF 5GIRA 4L2YA 1XB6A 4P2YA 1MI5B 4UQAA 5BRZD 4YS4A 3QQ9C 4OZGF 1A9BA 4XNMB 5HGAB 5DYFA 1IILE 2XV3A 1VFUA 3QPXL 2FVNA 4CSSA 4DIXA 1BBJA 3MZTA 4ODHL 4Q14A 5FA3A 5J6SA 3BCDA 1MCPH 2W0KA 4MFHA 3WFZA 1TQVA 2MOVA 4JG1H 4WFFE 1U8PA 3MLXL 4R4NC 2C7FA 3NIDE 5JHDA 3BW9A 3V6BR 1NAKL 4OB5H 1JFQH 2P7TA 4PGBB 1WCBA 1YEIL 3JV6A 1AKJB 1GKOA 4NQDB 2TRYA 3UL4A 4N0RA 4Y9CA 3WD5H 3OG4B 2QQQA 4P3DA 3RI5K 4PREA 3ZO0A 4OIIL 2NMSA 1NFIA 1OGTB 4MWFB 5JW4M 1RY7B 2DI9A 4G6AC 1CFNA 5F97E 3L9RA 2ZWSA 5ICYA 2FGWH 3ARGD 1DQTA 4F8TA 3VFMA 1AD0B 1IV8A 2B3IA 3PWVB 4AITA 2NY0D 3P2TA 4MQTB 5EBLB 4NN7B 2I32A 4QUOA 4KTGA 3ULVC 4DH2A 1S8DA 3CBRA 4GS7B 3GXFA 4QJ5B 2H3KA 2CHNA 3CZEA 4LQFL 4PTUB 4N0YL 3TWCL 1P6WA 1IKNA 5DMKA 4NZUL 4RSYA 4HH9B 2CBQA 4MX7B 1KULA 4DVBB 3DJSA 1Z9OA 4U6YB 2PYFB 2XLLA 4BZ2A 2B4CL 2P5PA 3EUUA 1IFGA 2PLTA 4N87A 2FL5B 5D1QE 5DHEA 3FO0H 3U36B 1IIIA 3ESVF 5AAMA 1OK0A 4BQCA 2VDOL 1NGYB 3D4ZA 2B1AL 1IFHH 5J9PA 5FHBL 3EW3B 5C0AD 4X80L 4Z7OB 5J56B 3CH8A 4GW5A 1CL7I 2WWMD 4U1LA 1IZJA 3LNGA 5IW6B 3QQDB 5JQ6L 3EADA 2VR8A 3I02B 2R29H 3P2BA 4BK5C 3BD3A 4RZCB 1F58L 4O9HH 3DI3B 2Y06L 5MENE 2F19L 4IMLA 3S5YA 1BF8A 4BZ1L 4TSCH 2VLKB 4DGIL 3FFDA 3LXAA 3PWLB 1IC4L 1VGEL 1CI3M 5DHDA 4PMEA 3HA0A 2WV3A 4X5QA 5FYLE 4YLCA 3MRFA 5IHLB 5IJBC 5ETUB 3QXAB 2E6JA 3GT6A 5CIPA 3RWHB 4AM0A 5C1MB 5EH1A 4AQAA 3N9GL 4IBSA 4HJJH 2A6IB 2QTVA 2WIIA 2VXQL 1JXFA 2OQJA 3MKKA 3TC9A 2ED9A 5IB2B 3QZNA 5KSAB 2ATPA 1IM3D 3L17A 4HWEL 4TVPE 2WGXA 4ZNCD 5L4IA 5KBLA 4WRLA 5E4EC 3KPQB 1CIUA 5K69A 2E7HA 1K3IA 4F2ME 4WI7A 1WYJA 1KCWA 2AQ2A 2I85A 1EFXB 5LXVA 4FJYA 5EC1B 2GAZA 4ONHB 3NJGA 5E2UH 5FYJE 4DO6A 5A2KH 2IQAA 4KY1H 1CFQB 1UOVA 2WZ6A 3Q5TA 3MV7A 4LAJH 4TSAH 2KZWA 5C0DA 4B9PA 2R2HB 2X9XA 2I9LA 3FN0H 5GGRA 4WJ5B 1RJLA 4ANVA 2YBRB 5JYMA 2YPVL 5HYQA 2D7OA 1CS6A 1UXSA 4R84A 1I1FA 1KGIA 1IAIH 4BZ2H 3VYNA 1RZIB 2FSEA 4Y16B 1PLAA 4Y4KD 4LLMA 3HHSA 1U8QB 2C1OB 1CL7L 5IVOA 2YRZA 1KIRA 4P5RA 2X7LB 1OAZH 2EDMA 2EEXA 4BQ9A 1NBYB 3GM8A 1SM3L 4UV7H 4WGWB 3CXFA 5D71L 1KXVA 1BXAA 1LHZA 1CGSL 3ZDYB 4ZUSB 5CD5C 1E9QB 1RCYA 3ALXA 1VCAA 4DO5A 5B21A 4IJ3B 1K9TA 1MIEH 3RBGA 5CEYB 4ZXBA 1I1CA 1HOCB 3WY1A 2DLFL 5TF1H 3AY4C 4Q97A 4ODVH 1MZZA 4JM4L 1S5HA 1VRSA 4JN1L 2D3VA 3KWWA 4MHHI 2DWDA 3RGBA 1ZLUH 3G3LA 2J25A 2IEPA 4OLXH 2YRPA 5I1GL 5DVPA 3MZGB 5D1ZD 1MPAH 5CZXD 3HPLA 2G3ZA 2Y6SD 2AJ3A 5CIPH 3OZ9L 5KSBE 4I5BA 3JT0A 3OKDB 4OLWL 1MCFA 3OR6A 4PS4L 4HZAA 3MPCA 1GIGH 1EDYA 3F64A 3GBLA 3CV5A 4QY8A 4X4XA 4Y5XB 1IT9H 5JDSB 3F12A 4XVTL 1RZ8A 1SLUA 2W8CA 1YQVL 4K5NA 5A2IH 1LJMA 4IKKA 1NFKA 2F58L 2PP9A 1OLZA 2EXSA 1VACB 2Z35B 3Q2WA 3QDAA 4CC4A 5LXGH 3S88H 1INDL 1RK1A 2I9TA 2J20A 4X0KB 2CRZA 2N1TE 4WK4B 5GGSB 4L3AA 2C3XA 5HVWA 2K3HA 3WJJC 3WEOA 3ME0A 4ZMAT 1RZJL 5E8OA 4F1SA 1ZHLB 2YEQA 1YJDC 2F8OA 3IJSA 3RFRA 2WKLA 2O72A 4FABL 4Q6YA 4LLYB 1D6VH 4NQEB 1C08A 1U36A 1MJJA 3O6FC 2RAMA 2W9EL 4L9LB 4RFOL 4WTQA 2R4RL 3PWJB 4MZRA 5IESH 1S9WB 1NICA 4WFFD 3CCHA 2CUIA 2J88L 2CDGB 2V8MA 3WGVB 2W95A 4JLRA 5CUSH 4AGOA 3QFJE 1KDIA 2XVBA 2ZKWA 3X1BA 2CDFA 2XWJB 2ZCLL 4AYSA 3OAZK 5ACZB 1KBBA 5DRXA 1HXMA 1KV3A 2CKBL 3EJJX 4YN3A 1FZMB 5C2BH 1UWXK 5F9DC 1I7ZB 5HYEA 4FQJH 5GISH 1JJUA 2Q8AL 4N2CA 5D5MA 3CN4A 3QH3A 5IT2L 4FQCL 5H2BA 2ZCHH 4IJ3C 3NMEA 5C70A 2X2UA 4L3CB 4R4FH 5AW3B 5L4FA 1K8IA 2EEDA 3DGDA 4P3CH 2CK2A 4O5LH 2YOCA 1N64H 3N0AA 4AC4A 1LGVA 1MQ8A 1S4IA 5JHLA 4FFZA 2BFGA 3ZSSA 1N5YL 5DFTA 1BOYA 3FT4A 5EV7A 4G9FE 4N4YB 4NO2B 3F7LA 4L8DB 3KL5A 3AAZB 3QRBA 1ETB1 3MRQB 3U79A 3CDGB 1B3JA 3Q01A 2CNYA 4H20L 1T22A 3MMEA 4EAEA 4NQXB 4V1DA 1LEGA 3JWDL 3RGVB 2ARJB 1A7QL 4GOSA 2D7NA 1ZLSH 4I0PB 5I82A 5F7YC 4AEIL 1N4XL 1SQMA 5IEKA 5IQOA 4NOBA 1HZLA 4K3JL 2UY6A 1OP4A 4XOEA 1MRCH 2ARJQ 3D25A 1X9RA 1OHQA 3MRNA 5J3HC 4AIEA 5I73B 1C8PA 1NGPH 1PNCA 2QR0A 2MPAL 2WZ5A 5DI8A 3GSVA 4HD9A 5D1QD 3K6IA 1AZVA 4ZAKB 3IJ7A 4BWWA 3S7GA 1OE1A 1A0QL 2OZ4A 3FPXA 5FO7B 5LGKA 4QXTA 2AMUA 1CD8A 4JPSA 5GZND 5BVJA 5LO7A 5ITFA 4M43H 4YHPA 3O3AB 3RNQB 5SX5H 4X8GA 5AQ0A 3QCUL 3QDGA 2Y2TA 2WANA 3CUPB 1VFAB 2VLJE 2HLAA 4KTDH 2YSSA 2FIRT 3FONB 1OVZA 1SXCA 3IBEA 4Q6IC 1TNNA 2R1YB 4WO4D 3R8QA 3X12B 1H6TA 3JVGA 4ETQA 3QPQD 5MEND 4HU8A 5FLVA 3CFDB 4G6JH 4X8JB 1GKEA 4L9LC 2J8HA 2YGOA 1AYRA 3DV4A 3K1KC 2KS0A 4FA8A 3SKOA 3FAXA 2FX7L 1Q1JL 3ZUNC 2F8IA 4HUUA 5FYLD 3ZLQC 4LCVA 1CFVL 5LAPA 1FFNB 2Z0UA 3SDYH 1IC7H 3PNWB 2ZP8A 3FF8A 5TE7H 3WFDH 2GJRA 2YD3A 4JMNA 1NWOA 3BEWB 1AMXA 3ZO9A 1HH6B 2DM4A 4YXLH 5KZCB 3E8VA 3MNVB 3TCLB 3QT2A 2QTEA 3MV11 4KI5C 2R0KL 1JN6A 1CIDA 5TQ0H 4TVPD 3WXWH 5JHLH 3TO4A 3D18A 1B4RA 4XMLH 2W9DL 2GTZB 2GI7A 5HDBB 5BOPA 2J4WH 1FFOB 1I7TB 3NGBB 4CSPA 4HG4J 3W5NA 4M62H 3WXVH 2X0VA 1FPTL 4ZTOH 5KVGH 3QB7C 2EIKB 4GAGH 1CTOA 4JHBA 1MSPA 2Y5TB 4HHWA 4X9BA 3ZK0A 4OCLC 5FYJD 4B9JA 1NBZB 1MELA 2YPLA 3ELQA 4HWNA 4OZ4B 5LG1A 1YYLH 3GJFA 1ZLEA 1DUYB 4MAUH 3GHEL 3O0RH 3U9UB 4ZTPL 4XI5D 1L7IH 4HMCA 2WQ8A 3HC3L 3IBOA 3DBSA 4NYLA 4Z7NE 1M2OA 4YDVA 1UOLA 1Z7JA 3Q1SH 3ISYA 3ULUF 2V2TB 1SPDA 1DO6A 4GUPB 3BEVB 4OZGE 2KQNA 3W2DL 5EZIH 4CN4A 1EAOA 2E9GA 2EILB 4HJTA 4AGPA 1C16A 2Y2YA 3SCMD 3APFA 5I73C 2OZ4H 2W91A 5CCGE 3WIAA 2OMVB 4NUGL 3RGHA 1T0MA 2QGDA 1WUZA 3I2CH 4JDVA 3RIAF 2R69L 1GW0A 5EFIA 1QLEL 2NW2B 1JWUA 4R7NB 4D3CL 4JFFE 3FCUB 4KJPC 2QHLA 4ZZKA 1OF2B 4KUZL 4U1NA 4LCCB 2C7UA 1OCZB 2C1PB 2CSPA 2FO4B 5KYWA 4F8NA 1H3PL 5DHXB 3HLKA 3M1OA 5FK9A 1MOEA 4G1MA 4FL4B 2XN0A 2MEJB 4JDEB 2J8UB 1B2WH 1RUPH 2V2XB 3H9HB 3WJLA 3KHQA 5EA0L 3SKMA 2BS8A 4XVSH 5F7LB 2CH8A 2DS4A 5HDOA 5KANG 3U2SA 4APQB 2DWSA 3P69A 4CDHA 3IFLL 4RGNB 5B3NA 1Q9WA 5I26A 2O6FA 1OSEA 3CXDH 5JR1H 1D5ZA 1UD5A 1NLDH 4QR7A 3BUTA 3OX8B 4AH2B 5JPMB 3GFUA 3LN9A 4H13C 5DRWA 2DYPD 2HJLB 4HD5A 2FIKA 1BAFH 3RFZB 4JGMA 3S5ZA 4LASH 3WJMA 3I6SA 1MFAL 2R2EB 4YDKL 3RBSA 1BXVA 1KIUB 3MU3A 2I5YL 4KDTA 4RMSA 3U6XA 5CKGA 2V3EA 1T0OA 1K4DA 4M5TA 2H8PB 2HYMA 1FG2A 3AXIA 4N9OB 1QSEB 5I1DA 3WG7B 1X7QA 5T3ZE 1D9KD 4G80A 1RIVH 2NY7L 4MD0B 2JIXB 1YEJH 3IE9A 2IANA 32C2B 2DIAA 4D9QE 1N19A 3FQTB 4LSVL 4X6BA 1GW6A 2L3BA 1UWGL 1L9OA 1I1YB 3UZEA 3KW8A 3KCWA 4F9PA 3ARED 4BIKA 1L3WA 1YG9A 1PMYA 2A2QT 2DMGA 4TRPH 3ARYA 3QXDB 1G0DA 3FC8A 1A02N 2VDNL 3QFJD 3ARBB 4F8OA 1UA6H 3SDAD 1KXHA 1MCWM 2X42A 3T2NH 3C8HA 2APSA 1E4KA 1F4YH 1GS8A 2Q2EB 3V0WL 4DGWC 2AABH 2XA8L 4ONFL 1JZ8A 3G6DH 3PLYA 1NH6A 4GG6A 3LDBC 1G9NH 1FRGH 4N3TA 2UWEA 5K39B 3HEIB 3HN3A 4XNQB 2CO7A 3QUKA 1S9YB 3I9GL 4JFQA 1ZLDA 2WBXA 5DUMH 5MP6L 3SGJC 4R8WH 2H0FA 4KX9A 4ORZC 3G04B 2EJ1A 4H8UA 1KELL 1WVZA 3GJFK 4G9FD 3VU1A 1WBYB 4MD5B 1I7UB 5SWZA 3BZ4A 4KKBC 3O6MH 3RKDC 4PGEA 2O61A 5KWYC 1MCWW 3FQ2A 3QAZB 4PI2A 4QDGA 3ZN6A 4APQC 2Y2WA 4GP4B 4NM8H 2WXFA 3AXLB 3SQOH 2BSSA 4G11A 5EU7C 4E5XB 1QZ1A 3IS1X 4S0HA 1O6SA 2HX9A 4D9RE 1J9SA 4KWUA 5LVEA 5D2LB 5HI5D 1IARB 2EUVA 4XB8A 5KN5A 2D7MA 4B9CA 1CK0H 4N2BA 3QIUD 3T0EB 1L9QA 4WDIB 4ZMNA 5GZOA 2WXQA 3N1FC 1TZHB 3LKRB 3INUH 1KB5L 3FUHA 1DBJH 1HHJB 1Z3GH 3HI6L 3MGAA 4PJCF 4BFOA 5IMKB 3FB5A 4B9ZA 5F3BB 2O61B 5HDQL 2VLJD 2P47B 5I6KA 4XHJD 4M6NH 2HH0L 2ZICA 5IB3A 3NEEA 2B2XL 2WXKA 3KAAA 2ZXAA 3S48A 3UDWA 5D1XB 4ZRGA 2G2NA 3IT8D 3RZCD 1TJGL 4KZEH 2P26A 1W0WB 5BQDA 5HGHB 2Y1YA 1J8SA 1KBPA 2O4EA 1ZIBA 3D48R 3FQNA 5HVHB 4OCYH 4R7VA 3DK2A 4HIIB 2DLEA 5INDA 2ZUQC 1XBRA 4F57H 3K71B 1A14L 2YMTA 1ZWIA 2OMWA 3IXAA 5IMLB 2OJEA 5FWQA 1UZ6F 4ETYA 5DTFA 2HFEB 4XOAA 4K23L 2VDRH 5HDBF 4FG0A 4M5ZH 4MJ5A 1DJHA 4GKSB 4UOW0 2R1WA 1NAML 4RSVA 4HSQA 5ALBH 1A6WH 4ALAL 1Q72L 3SBPA 3UGUA 4Y2LA 5IB1A 1HNGA 4S1QH 5EORL 1CDHA 2DMCA 4IRZL 4QYOA 1OANA 1RUMH 1NFDB 3Q0HA 4M61A 1JI2A 5IB4A 4WF7A 4ZW5A 1NCIA 3MCKB 2F54E 4LLUB 4QTIH 4XPHL 5GRUL 1OOWA 3HG2A 4NNPL 1MI5E 5FW8A 1DBMH 5CINH 1AY1L 1JGUH 3AM8A 4LLDA 5DRZA 2EXYC 5E1GA 1WA0X 3S0PA 3LH2L 2RFXB 2HT2C 4U6VH 4UQBA 3CDCA 1UTDA 1T1XA 3IDIA 5HHPA 4Q9QH 4UQ2A 1H8SA 3ZU8A 2ADJB 1V7NL 4MQ7B 1KBVA 3TN0A 4TUUA 2A6DA 4Y9BA 5D4QA 5JIIA 2X4NB 4LEOB 1FYHB 1GZQB 1ND0B 2A0LC 3LQZA 4OCRL 1I7RB 3T2PA 2WJ7A 2Y1AA 4KGJA 4G70B 1QRNA 2AZAA 3QJFA 4WU7A 1CTNA 4QHUA 4ZQKB 5AW7B 3P73B 1N26A 4NQDE 4P57A 1JD7A 3FCTA 1ASQA 2AQTA 4JFUA 3T0EC 1ZSDA 2A6KB 2D0GA 3QJHB 4W81A 3CSYB 1J88A 1LO2H 3GXDA 2J8UF 4TKWA 4JFFD 3V52L 3R0NA 1AHWC 5F9OL 5BZDB 1OTUC 3UJTL 4GINA 3PL6C 1NL0L 4OJEH 2IH8A 4YUEH 4N9GB 3DC0A 4DTGL 4HP5A 3TEXA 4BWTA 4G7VH 2Q76A 1WIPA 1B0RA 1Q0YH 1PPIA 2YOAA 5F9AC 1T7VA 2V7HA 1ZHBA 2FECI 1XGZA 1E9PA 2VDKL 3IFPA 5D1XC 3GTVA 3TASA 4C57C 2WJ5A 4RAVA 1DE4B 2G60H 3OKKA 5ISZB 3CN1A 4AYBA 2B0SL 3QHTC 2XWXA 3RTQC 4K3DL 3RVTD 1P5UA 2MCMA 1VADB 1T1WA 5DHYA 1DQQA 1F41A 2NLJA 3BIAX 4FXTA 1A4AA 3T6QC 3HUJA 4ABUA 1FZKA 1OT2A 2FUTA 2YWZA 1Z2KA 4J28A 3O8XD 2P24B 4YR6A 1QI4A 4CBZA 2XZAH 1BREA 3I75A 1DFBL 1DQJB 1WH0A 5BJTB 3QUYA 5ES4B 1YEFL 3EH1A 2LQRA 1T1YA 4PBWD 2D3JA 3EO9L 3PF2A 4GW1A 3FUKA 3N04A 4IGBA 5IHZA 4ORGA 1VB9A 2YS4A 4LVOB 4PQXA 5CN2A 2X2IA 4JHAL 3D85B 5T3ZD 1AO7B 4NP9A 5DQ9A 5C0EA 5JQHC 1AZRA 3KYOA 5JO5B 5IQ9B 1TMCB 5BUPA 1W2KT 3LQAL 3CH1B 4NCC2 4M8RA 1ID2A 3GMQB 5DJ2A 4D9QD 4ZPTA 1KJ3H 3ZL1A 1G7QA 3KYKL 3UZQB 1S9VA 1LO4H 2VLKE 2OSLA 3DO7A 2AVGA 2COVD 5DJCB 2VRKA 4YSSA 3ASNB 1USZA 2ROXA 5GJTL 2A74A 2J3SA 1AZUA 4MCZB 3NOIA 3HNTL 4N6RA 4P2RA 3DDGA 2YD2A 1NM4A 4KDVA 5B3JF 1XCTB 4XP4H 4CKVX 5C6WH 1W0VA 4GQPH 5AD0A 2HRPL 5HDLA 4BA0A 2D3LA 3BGAA 3MA7B 4FFYL 4OY9A 3SDCC 4N2FA 4EI5D 2FECL 4CU7A 1KWKA 2GTWB 4OIBA 1JGVH 3VWKD 4YNYB 1IGYA 2H1PH 4AG4H 3FXIC 2NTSP 2WYHA 5E2JA 5BV7L 3CXHK 3H7BB 3S37L 3LYRA 1I8IB 5C0CE 2PR4L 1LEKB 5CR8A 2FB4H 4PW3A 5EOTB 3S9DB 4JPVL 5CU5A 3TBWA 3OV6A 3QQ9D 2F5BH 1V3KA 4EJ1C 1R19A 2AJUL 2DF3A 2YD1A 4Z7UA 1BW8A 4HBCL 4ZFFB 1IBDA 1S9XA 2ZX8A 3AY2A 2OL3L 2FEEI 4YHKH 5IBUB 3QIWD 3WHXA 5L7XL 1N59B 3PP3K 1JHTB 4LLVB 3TVMB 3KLQA 4LU5L 4S10A 3S3PA 5D7SL 2CLRB 4QTFA 1MFCL 4KRLB 5CJQL 5AL0A 2FHCA 4H8VA 4X7EC 3L3HA 4HOWA 4D9RD 2V5YA 2AKRA 4MZIA 4PJ7F 3ZE1B 2OTPA 2CD0A 3VB8A 3IRCA 3REWA 1VFBA 3SBRA 3FUEA 3CVHB 2LT9A 1FWXA 1GY2A 2ZUUA 3QZPA 3ULUE 1CTMA 1QZNA 3MBWA 4F27A 2KUTA 1HYSD 1JWMA 1N3NA 2EVIA 2FHFA 4LSRH 4S0SD 1ZXQA 1XGQA 2BCMA 3C60C 3ESOA 3IF1B 4LHUB 4MS8D 3WN5B 4G6AD 3MXWL 4YHIB 5CCKL 2AJXL 1T5XA 3B2PA 4Y2NA 1R9FA 4MJ6A 4S0TD 3D2TA 3TBYA 4WUUB 5MERB 5HY9A 1F11A 4A63A 3QS3A 4KX7A 3WIHH 3QJVB 5FWRA 1HESA 3OM3B 3VI4A 2B9AA 3AQYA 5HHQA 4XN2A 1UWEL 4BFBD 5GGUB 3MNDA 4YSOA 2CAKA 3HJEA 4JFZL 4MB5A 2BHFA 3QDMA 1RZGA 2VXSH 3GSQB 3PWUA 4ZFZB 2A83B 4WKZA 2RB8A 4HKBB 1KPVB 2BP8B 1LE9A 5FECA 3QEQA 3RVXC 3CFCL 3EGXA 4K7PH 3C12A 3DROB 3IKCB 3DUUA 3SE3A 2HSIA 5GGVL 3V6OA 3NA9L 2WTRB 5IBTL 5HI4C 1NFDF 2P48B 2VJ0A 3DX6B 1IM9D 4J12A 5E9DA 1UYWH 2OMUA 2IBGA 3EYVA 2FEEL 4PIBA 4X5WA 3WIFA 3C5SA 1QR1A 3TNMB 3SE4A 3MLPA 2J2ZA 3DARA 5AVVB 4Z7WA 3MROB 4P5TA 1TQWA 1MFBH 1TENA 5HHNA 5I8KL 4HCFA 1MEXL 2XACC 2WXGA 3QWQB 2F54D 2DQIL 1WG3A 4TVPH 1A3QA 1D6EA 3FU7A 2X4PB 5FUCC 1FO0L 1MI5D 5DK3A 3TXAA 4PJ5B 1A3RL 2BS71 3HC4L 4M9PA 3D3VA 1RZQA 4NQEE 4MLIA 1NDMB 1R5VB 4HUCA 4JGNA 1MREH 3RWCB 2JCWA 3R7RA 3V8OA 4YBQD 2XETA 3CZGA 3TVMC 4BXSV 1JCVA 1RZFL 4DEUA 5DJDB 5T5NG 2EE3A 3FO1A 1PEZA 1HWWA 1F02I 4YSCA 1CYXA 4JY4B 5EIIB 4A04A 2IG2L 1OAUH 1G5GA 3RVWC 3JV5A 1E90A 3VD3A 4P4KC 2YLKA 5I6PA 4MZ3A 1AKJD 1YYMH 1DZBA 1TJMA 4KTEH 4NQDD 3TJPA 4XC1L 1OSYA 4X7CC 5CJ8A 3IDNB 1BECA 1QHQA 4EE2A 3X13B 1GTNA 4WU5B 1AD9A 2Z4QB 5J8OA 4N0CD 4ZUTA 3WN5C 5FYKE 4H8WC 5JORA 3GSXB 4OGYH 4IRSA 4KKCC 2P46B 4ZPVA 2VDOB 4UU9B 4NN6B 1QPKA 1J9RA 2FCBA 1MJUH 1I3UA 2Z7UA 4XP5H 1TIUA 5IV2B 3VX0A 2FZ3A 2V5TA 3TZVA 2G30A 2IPKA 2FH6A 1EJOH 2DYRB 1MVFA 5EU6A 2J6EH 3N44B 3HE7A 2FWUA 2GIMA 3ECQA 3U1QA 1FVCA 5IK3B 3FRPB 1DVZA 1HILB 3W39B 1P4UA 2AXGB 3U7YL 2RALA 1HEZA 1SJEA 4JHZA 4FLQA 4N5ED 3FQ1A 3BKML 5I8EB 2YKKA 1LNUB 2ARWA 1V8HA 3S4SG 1A6AB 1A9EB 1EERB 4U1MB 3T77B 3DTUB 2IWKA 1ZA3B 4G8AC 4AIOA 2Q10A 5JIDA 1XMEB 3T1FB 2JELH 1NGZB 1GSMA 8FABB 4JREC 1A7PH 3ZHFA 5JHMA 3DYMA 3ESMA 1T6BX 4MXQD 5IMMA 2JI1A 4CVXA 3RHWK 5CU9A 5G5DB 1M3IA 4KH9A 4MGXA 5A1AA 5KYNA 1KN4H 3EIFA 1DSFH 2YUXA 4MA7L 4MAYA 3I6KA 4OQTL 1T89C 2G0KA 2AV1A 4LSSH 1JV2B 2VXVH 1BBDL 2IO5A 3CN0A 4ODBD 2Y7SA 1G7HB 1QEWA 2YEZA 1XGYL 4L29A 5FHAH 4ERSH 4Q58C 3RPIA 4PJCE 5DFVD 4APXB 4O9HL 5E56A 2VLKD 4L23A 1MWOA 3EOTH 1IC5L 4FI6A 2FTAA 1C9SA 2Z6FA 4OVUA 4N2GA 4W6WB 4JFEA 4Z7QB 3FOLB 1JPST 2WOYA 4WI3A 3V4VB 2BVPB 1CFMA 3FO9B 3FS9A 4WHDA 3P9LB 2EYTA 2GBVA 3FL7A 4QTHB 4Y4HB 3LEVH 1C12B 3L1GA 4PB9L 3U46A 5MEOB 5E2TL 5KSAD 4PJGA 4FOMA 4WY7L 2B4CC 3L3DA 1OGAA 1UZ6E 4JM0A 2CU9A 2BRQA 3NSJA 2BMKB 1AZZC 4XMKL 5HDBE 1EJ8A 3B3BA 5JXEC 1PYWB 3DHJA 3OPZH 5C0CD 4MMZC 1KBWA 1P5VA 3BVNB 5ICXB 1QFWI 3KJ6H 2XN9B 3N1MC 5LAXB 3QEUA 3KPMB 1NQBA 4G8FA 1NBQA 1SN5A 2EUWA 1EFXD 3BIKB 3QJUB 1PKQB 4J6IA 2HWZL 3KPPA 2VDQH 2OV0A 3MRJA 4HCIA 1RUKH 4HC1H 3SJVA 3ZE1F 4M56A 2P9RA 5ENWB 2H6PA 1MUJA 3TGXA 2AI0L 1L3NA 4BQ6A 3F6LA 1KOAA 4KK8C 4KDWA 4WI9A 5E1AB 5EC2A 1R0AH 1KPUB 4UT7L 4Y16D 2AITA 2AW2A 5I1JL 3ATAA 3EZ8A 2JB5H 3IS0X 2E76C 1DDTA 5T1KB 4QRUA 4NQCB 3O2VH 3VFVB 3A4EA 3DLQR 4GQZA 3GRGA 3EJYC 5D4JA 2W60A 1M71A 1K6QL 1W0YT 3ULUD 2J1XA 1HFUA 4JBSA 5FB8A 3GPSA 3AABA 2AK4E 1FHGA 4RDBA 4FLSA 4OCSH 1QG3A 4XX5A 5HSFA 4WHTB 3WO4B 1YEKL 5JMRA 2NYKA 1NUFA 2G5RA 5SX4I 3T04D 3W9EB 1E6JH 3UTTA 2FQDA 1HIMH 4Z77B 3MOAH 5TF1L 5E5LA 2FJHA 5JQIB 2J8UE 3C5JA 4WEBL 3Q3GB 1D7FA 1F3DH 4XO4A 4NSKA 4RMBA 2O5ZL 3DTXB 4JO5A 3RWFB 1AGBB 1FNHA 2Z31A 3KPNB 4QRRA 4H0HB 1FIGL 4RGNE 4LCUB 5EBGA 1D5MB 5T1MA 5EU7E 3L54A 4X5RA 1P7HL 3ABLB 5DJXA 2BH0A 4NKQB 1NCBL 4WW1B 1UOWA 5FCUH 4OQ1A 1CFTB 2NNRA 3LZNA 2Y9RT 3CFMA 2ZOWA 2AEQH 1QFWL 4XN4A 4HIXH 4R4BA 1OP5K 1FGVH 1J05A 5I1EL 1IEBB 1THAA 3F5WB 4JRFA 3SGEH 1B4LA 4BM7A 5HGDB 3P4MA 1EEZA 4IRJA 3RILA 1M9SA 1PD6A 4O02A 5KVEL 2E75C 3BSZH 5MEQB 4FXGA 4DP6X 1U8KA 4CVWA 2AK1H 2EC9T 4AT6B 3Q7JA 2WBKA 4P4RB 4E9XA 3HZ3A 1QSEE 1HINH 1YPZA 3DRQA 4WW2A 5E2WH 5D72L 4KHTH 2F7PA 3ETSA 4FNLH 2B5IB 4PV8B 1T2QL 5AVXB 4JPWL 1JDAA 3N40F 2W59A 5IROC 4D7BA 4OZFG 4W1TA 5IFAL 3BAEL 2ALAA 4YDZA 3VFWB 4ZNEA 2XFGB 3UJJL 1RK0B 3CFQA 4L3FA 4NQED 4UINL 4Z9KB 4UTAL 3DUHA 3BP6A 3NFSH 4JJ5A 4QYAA 4AMKL 1OOAA 5IFHL 4RWYL 4GLRI 4PN6A 3WELA 1T04A 1V5JA 2BVQA 3ENEA 1TITA 4JPIA 5I6OA 2OW6A 3LZQA 3LMJH 4LKCA 2EH8L 3RWGA 2YAOA 3A21A 4LGSB 2QMJA 2NNXA 3IU3B 4NO5A 2JJWA 3TV3H 5CEZL 3MRLB 2HRHA 3ARPA 3W1ZA 4Y2DC 2Q8BH 3U4AA 5CJXA 1CWVA 5GGQH 1LE5B 2M83A 4F7PA 1OALA 3AACA 4MNQB 3WKMH 3LS4H 3SE8H 2DQDH 4XO9A 3OKMA 3GSWA 4HETA 1KEML 1FORL 1NC4A 4G83A 1TU2B 4PJBA 1BVKA 2GSGB 2NCEA 5FYKD 5B3JE 1SN0A 2QQLL 3BAWA 3N44F 1A3ZA 3GSNB 3MYZA 1XF4A 2ZCHL 5DR5L 3FBQA 4L8BB 3BVVA 4LT7A 4EIBA 1JDCA 3FUNA 4JEGB 2XWTA 2X2JA 1QLFB 4Y1TA 1A6TA 3P02A 4O5LL 2J6WA 1SOSA 4HT1H 4D0BA 1T4KB 1MCOL 1XH1A 4IW4C 4Y5YA 3MLUH 3B7SA 1A4BA 3WDHA 1RZJC 5ADOH 3U0PA 5I24A 5K1NA 1S7UB 1MDAA 4YDIL 2ZOLB 3ZL4H 4L37A 5FGRA 3RGVD 3MODH 3QIBB 1T03H 1KLGA 2ORBL 4I0PD 4KQ3L 5E6IB 4EDXB 2AP2A 5EF2A 4RAUA 4EOWH 1YN6B 3CFEB 4FQXB 3PDOA 3Q8AA 1E28B 4NHCH 5F71A 3L3OA 3ZKMD 3HR6A 4LOUC 4O02H 1AR1B 2Y07H 2VISA 3DTDA 5ANHA 4YDMA 5I19L 3KDMA 4NZJA 4YPGA 2D2CC 3FN3A 3T0EE 4ZAKD 5KVFE 4NFCA 1NEZA 1WWAX 2QEJA 1BD2A 4OLZH 5DHVB 3QCVL 4PJ7E 4XCNB 1T7ZA 4MNGA 4P46C 4PG2C 5ERWA 4HMDA 4QJ4B 4RFNB 4WWKB 4G6KL 3VWJB 4FJ6A 1RZPA 1UVQA 3B6SB 3KWUA 4LBEB 1SEQL 1CDUA 2W0FB 2MQ0A 1UGNA 5E6UB 3UGXA 4CJ0A 4WEEA 5CP7B 5IJVA 3S97C 3V6ZA 2EEBA 1FV1B 4FQLL 5F44A 1C5CH 1WDAA 4M7KL 3SBQA 1QR4A 1KCSH 4ESKA 2FJGA 3CDZA 3BXNB 2DTML 2UYLB 5GRJH 3CHOA 1CE1L 3S98A 4G6JL 3IDMB 4P2OB 4U4IA 4BD4A 3DIFB 5JDJA 1V05A 4OZIF 3WKYA 3E6FA 3K2MC 4DNLA 2O6EA 3JWDC 5EIVA 2OCJA 3HC0B 2FQGA 5FM4A 3ML8A 5TGBB 5I66B 4B3VA 8PAZA 4F9LC 1EZVY 5KZCD 1IBGH 1CF8L 3V4UH 5TE7L 1SLWA 3IVKB 3UPRB 1CDIA 1OM3L 4JAMB 3S3JA 2NY2B 3CHPA 3QFDB 2YPKA 2ILLA 4K3EL 3BHBA 5I1CL 1LO0H 4XCYA 3BVUA 3CIAA 1YYCA 1JZFA 3LNFA 1DCEA 1HCYA 1NFDE 1FVEB 2DN7A 4S11A 1RXLA 4Y4FA 4YSDA 5JHLL 1GA2A 1QLEB 1PLGL 2AC0A 4FFZL 1J12A 1NJ9B 2NT1A 5I1KL 4EN3B 2J4WL 4MBRA 1VFOA 1LO3L 3B5GA 2Z93A 3ARFB 3VJ6A 3SB3A 2C4FU 2BP3A 3QULA 1N8ZA 2E7BA 3ILPA 1VGKA 2G4GA 3T8XA 2CRMA 3T4AB 2VLRB 4I0KA 4ODSL 3SBWA 4FAAB 2VXUL 1D5XB 3QIBC 5C0BA 4PD4K 2Q3AA 4BK5A 5CGYD 4OI8A 3RWJB 5E6IC 1N68A 3Q1SL 3ZKXB 3DOSA 4FQXC 2UUDK 4X4YB 1HHKA 2IBZY 4XC3H 2FBJH 4WKXA 3SQRA 3VGDA 1AR1C 1KLFB 2JQAA 1NTDA 2E47A 4IKLA 1NGWA 2B1OA 2DAVA 3NAAH 4PJ9B 1H9VA 4QXVA 3NCXA 3VXRA 2AK4D 3BFQG 2XZQH 3ZTEA 4NO0B 2WQRA 2Q5BA 4YE0A 1A4CA 4R5TA 4RFNC 4WWKC 2DJUA 2PETA 3LSOA 5T33H 4PJAB 1UM6H 3EFFB 2O6CA 5E8PA 1GGTA 1QLRA 3PWNA 4JZJA 1AXTH 2Z92A 4AXWB 1DVFC 2V17H 4KHXL 1ASPA 1ORSB 2IMNA 5I18H 4PJDB 3K2UL 3EOAB 1UB5B 3L08A 2X5PA 4GSDL 2WYZA 4F1ZA 5ISZE 1MNNA 4W6XB 5EUKB 4QOKE 4BH8A 4GSQA 2MTAA 4FC3E 4RGND 5HHMB 1KMGA 1S7SB 1Q9LA 1KGYE 4QRTB 2CBTA 1UEMA 3ULVH 4FQHA 1EVTC 1LEIA 3LKPB 4N2MA 5IF0A 5ID0A 1A6UL 5L88H 2OTWA 1RVFH 5J7CC 2JNZA 1NDGA 4A7SA 4PRPA 1A65A 1W8OA 3LKQA 5C0IA 3WFBH 1WEJH 2WP3T 3BAKA 3RL2B 1BZEA 3MRKB 1KUMA 1R3HB 3TEZA 5B1CA 1LP9A 3GKZA 2H3NB 3ARXA 3GSUA 5I8CB 2VMCA 1QSED 2OTUA 4DERA 3GNML 4NQSB 5AW2B 3KPRB 2CPCA 4EN3C 2NY1D 2W07B 1QABA 4JKPH 3V4LA 4NJ9L 4OVVA 2Y7MA 5GGTH 2AXWA 4H26A 4Y19A 4JRWA 4LESA 3IGLA 1HNFA 3AY4A 5DO8A 3T4AC 4UDUA 3U6XS 4WHYG 4F2EA 5KUKA 4QI3A 3BYTA 2RMNA 3NEXA 3DJZA 5DLMH 5E5UB 1RZKL 3ARBD 2DQFA 2OMBA 3WLWD 12E8L 2X0UA 1XCWA 4L1HA 5TQ2L 3O4LA 2VYRE 4R3SA 3IMSA 1XH3B 3C6SA 5D7JA 3WENA 4JG5A 4U31A 1KYOK 1BPVA 5EG6C 4PLJD 5HDWA 3HE6B 4L4VA 4F37F 3QG7H 4MAZA 3H3BC 5KS9A 4MSWB 1ANUA 3FDWA 5F7MC 1HHGA 2NR6A 2CCLA 3FO2A 5TDNA 1MQKL 2A9NL 2F1EA 2IVFC 4LSUH 5FUCE 1KB5B 2VL5A 1G7IA 3DMMC 3OLDA 4HXBL 4HV8B 4WGKA 4ZMVA 2BZ7A 1OY3B 2H41A 1Z9SA 4AQ1B 2ZXCA 4QO1B 4DETA 1J7VR 3M07A 4LPYA 1H15A 5FXCH 3A4DA 3MBXH 5FKPA 2J5WA 1CXFA 1LD9B 2JCCA 4XRCA 3WJJA 1QBML 4BH7B 4ELMA 2WD0A 1D5BB 3ZL2A 5FUOH 5C71A 1KJ2B 3DUSB 4Q2ZB 1R1CA 2A0LD 3MA9H 4G5ZH 4BK8A 4EN2A 3IU4L 4UWQB 2VO5A 3DURA 3ZE1E 4E9RA 4YHOL 4TUKL 1DLFL 3O6FA 5AOMA 3MR9B 1U2HA 3D6GA 2F8XC 4FQQA 4JFDB 2FAUA 3ZDZB 4PY7A 1IGTA 1OW0C 4ONGH 3T0ED 1WAAA 4JRYB 4MJ2A 5FA4A 2FEDD 3VGAB 3MV8A 4DK5A 4N2KA 1E3ZA 1UCTA 1L5GB 2DJMA 4CDGC 1DVUA 1NAMB 3ABGA 2CRYA 5BMFH 2EDWA 2Z4TA 4K73A 5EZPA 5GSVA 2HG0A 5FGBC 5KJ4A 1UT9A 3INUL 1XSKA 3P77A 4IJTA 4WUUE 4NZTH 2PXYA 1BQKA 1WV7T 3HRZB 3QUMA 4AMWA 5IHHA 4WQOA 4WZ9A 2VMFA 1BEYL 4M6NL 1S7TB 1P4LB 2UXGA 3MJ9H 2D03H 3VB9A 4I4WA 3VI3A 1YZZA 4KO5A 5DUPH 1CC3A 2GJ6B 1SJHA 4W4OC 2P8LB 3PDGA 1EA9C 2WW8A 3K80A 3VW3H 4QHMB 2EEAA 4NT6A 3V7AG 4LNRA 5BW7A 2WXIA 1XF3A 4PJIB 3VFRB 1CR9L 1BFOA 3K8LA 3L3JB 3BLKA 4KFZC 1DUZA 3GI8H 1INQB 4MJJA 2E5EA 2L7EA 1ADWA 1PDKB 5FIEA 5TDPB 3U7WL 3SKUD 2CIKB 4HIEB 1A9VA 1A6WL 3DXAB 4AI7A 4JO3H 1KC5H 2IAMD 4GRMA 5F9WB 3AWGA 3IFNH 2DQTL 3GZOA 4UTBH 4YIQB 5AW6B 1CFSB 4JDZA 3VFNA 4JB9H 4M1CD 1IGML 5IKCB 4PJ5E 4J3OF 1JZ3A 4MJIE 2K8MA 2W9LA 4AQ1C 4XX1E 3TP4A 3NIGB 4QKTA 1RUQH 4DZ8A 1YJDH 3PHOA 4ABWA 1HEHC 5ABZA 1S7WA 2VDKB 3KXFE 3W56A 2IPTL 3FTXA 4U6VL 3F7RA 1J5OH 2NY6B 4Q6IA 2A1WL 3D8MA 1EV2E 3L3IB 3H3PH 4PP1C 5E94B 3A6CL 1M7XA 4XCCH 5D7LB 2BIPA 4GAFB 5DC4B 2X4TA 4NZDA 2FX9H 1BVNP 4FFWC 4NGHH 4U7KA 1EAPB 2UZXB 1DVQA 4PJAF 1OT4A 4PUBH 3TBSB 3V5HA 1NSNL 2B3RA 5EPMB 4ACPA 5MI0B 4WLCA 3D87B 5BXFB 2HT3C 3ZW3A 5B39B 4OLUL 3T6VA 2FLRT 2ZOKB 4ALAC 2JJTC 4LP5A 5IIEA 2VSCA 3P4NB 5DEGA 1XGUB 4M7LT 1IGCH 3TNNB 3CXHJ 2NYZA 2QV4A 4KMQA 5LBSH 3SDDB 4JY5H 3PYCA 2XQYA 3N55A 1Q0YL 1YA5A 4C56A 3MRMB 5ISZD 1TTAA 2Y1ZA 4UM9B 3NZ8B 3MRHB 1ZS8A 2HKHL 4QOKD 3UMNA 3ZZLA 4HPYL 2IALB 4E9TA 4FXLA 3VMPA 1X9UA 2LGNA 5E00A 3RY4A 4N68A 5DJ6B 1SHXA 4AL8L 1CQKA 1OKEA 2I25N 4OJCA 5TE4H 2BOCA 5T1JA 3V2AR 3AG1B 1AI1L 4YXHL 3S8WA 2YK1H 3C5ZD 1KNOB 1I9JH 1S7RA 2X38A 1RPUA 1I9IL 4J7RA 3RA7H 4AKQA 2QVKA 3P9MB 1FN4A 2PPCA 1TCRB 4QCIB 3D52A 1FLRH 4Y1AA 3ZJAA 4ADIA 1ECZA 1YHPA 4AENA 4DKTA 1CGXA 1XCXA 4ZS7H 3D0LB 3D85D 5EU5B 5LCVL 5BV7B 5JOPE 2R0WL 1R6VA 2VW7A 3TTSA 3UAJD 4C8XA 3K81A 4JQIL 2YHGA 2VKWA 1IJNA 1U3HB 2F53B 3BMVA 1HQRB 3V7AE 1YDPB 5CJOH 3FUFA 3MV9E 5DK0A 1LO4L 2NY6C 5KYYB 4TLKA 1NGXA 4DZBB 1BQLL 1C5DB 3B1TA 4D8OA 3QHZL 3L13A 4KNUA 5LGJA 2G5BA 3QNXA 3RWIB 4L1LA 2ADIB 3Q48A 2FD6L 3KWXA 5FX3A 4BKLA 2MNJB 1KG0B 4P5KB 4XT1C 3SPVB 2HTLC 2YN5A 2WLJA 1UATA 1WHPA 2AFNA 1AIFA 2CLZB 4UQIM 1S78D 1TEFA 3OKLA 1RQ5A 4OZIE 3IPBA 1CZ8L 3L2MA 4K8RL 3ZQ9A 4IU2B 2R59A 3W0WB 3HLAA 4IM8A 4KY2A 1M56B 2HMIC 1JGVL 1T1ZB 1ZA6B 3GSRA 5F1NB 2LAAA 1BQSA 1KFAH 1N9PA 2WZPD 1RFDH 2XN9E 3VD1A 1R5IA 1PKQE 3ZHDA 4XMUA 3SDDC 3BGMA 1S7VB 2YMXH 4XNUL 3P4LA 3N06B 2F5BL 2H2PC 3VXTB 1IL1B 4UDTA 2FT7A 5ESVA 3LQAC 1CJYA 2XWRA 1KTKE 2AJZB 1DBKL 5HJ3A 4ICWA 5CZVH 3ZDZF 2CBOA 2DY2A 1F86A 5E0QA 3ZT6A 4JM2B 3GMLB 3FQUA 4JRXB 1J87A 1T7XA 5HYJB 1EEQA 1B4JH 1GOGA 5E6ZA 3MCYA 2CWRA 1UCBH 4KMTH 3RWEA 1J5IA 5C6TH 2X4SB 3SIKA 3WLBA 3VQ2C 3ZE2B 2EDHA 3G5VB 3BLPX 4H0LC 5B3SB 1JK8A 1IAOB 2HJKB 3OJDA 4HUVA 2GPZA 4LHUD 2R56L 1KGJA 4JR9H 1VA9A 4WV1B 5J11B 1JUFB 1M2VB 1JGDA 3GIVB 4RNRA 4PJEA 4BQ8A 1PGRB 4WUUD 5BV7C 3E8UH 1Z9LA 2NDFA 2EO1A 2XY2A 3UYOD 4PJXB 5KW9H 4RDQG 2XQYK 4RIRB 1KTLB 2XG5B 1FO0B 4ATWA 4PJIF 1Y18A 1BM7A 5I9QB 3X14A 3IDJA 4WI6A 2CUHA 4H5SB 5IQNA 3K46A 2FNWA 2VGLM 1A1NB 1M7DB 4U1JB 3V0GA 4UZSA 5L6YH 2RD0A 3H54A 1O7SA 4KITB 4CBPA 5LDSA 1DZ0A 3G5YB 4U0RB 2WO2B 1KPRA 3D34A 1DQLL 3FQXB 4AEFA 3QHFL 4XN9A 2C3GA 3NABL 3WOVA 4ENEC 3BD5A 3WFHB 1TJXA 1BQ5A 1AVAA 2YMOA 3S4SA 1HXYA 4PRBB 4NP4L 3Q6FA 3IDUA 5ICZA 1ZT1A 3QZMA 1CDYA 1PSKH 3NIGF 4G7RB 4NX0A 2G3MA 3FMGL 3VA2C 1ADQL 3L5HA 5GGRY 1WIOA 5IM7A 1P9MC 1U2YA 4DQOL 1MFBL 1NCWH 3LV3B 3OKEA 4BZYA 1ICTA 4KO6A 4PJ5D 5KG9A 2BHUA 3MYJB 1INEL 2FJUB 4MJID 3N42B 4Y5VA 3MLYL 4GXUM 5DJZA 2C3HA 3EHBB 1JYWA 1AXSB 3HNSL 2CLVB 3BE1H 3DA0A 2WNKA 4P5SA 1BWWA 1ETJA 1ED3A 1JK9A 3MACH 3MJWA 3KXFD 3OR7B 4J4PD 4FKHA 1WD9A 3AU1B 2CNZA 1J5HA 1R3KA 4B9KC 3SKNB 4JM2C 1YCSA 4A2GA 1NCCL 1UKQA 5CLZA 1B90A 4NRXB 1MH5B 4UILL 4MJ4A 3HPJA 3L9BA 4LCWB 4MNQE 1Y6KR 3RVVD 3TH3T 1TZIB 2ZX7A 1AQHA 1YYML 4O2FB 4Y4KA 3GF8A 5A7EA 4RA0C 2R2BA 5F8QC 4F33B 1GS6X 1Q38A 3QORA 1XEDA 4A55A 3SOTA 4M7JL 1DBBH 1R3JA 1QMUA 4X5PA 4MYWB 1SVCP 4U6XA 3HMWH 4PGDA 1K2DB 2ZSWB 3DVGB 3I50L 4NHUB 4UBDC 4BK4A 3QEHB 3WKNA 4CGTA 4J3XA 3LXUX 2DQJL 1N6VA 4WFEE 5GIRB 3UPAA 3KGUA 2GW5A 4M7LL 5IHUL 3U30C 1A9BB 2YA0A 5DJ0A 3U48A 2QVTA 1BBJB 1BFVH 1M6OA 3Q6GL 4Y2OA 1ESOA 3GMPA 5FA3B 4CKQA 4HEME 4UF7C 2YGVA 3GIZL 2QELA 3DHMA 4MXWL 4TOYL 1U8PB 3BVWA 3SODB 2NXZB 2A4EA 4XVUC 5JHDB 3BW9B 2RGSA 4U0RC 4M3JA 2P7TB 1WCBB 3V95A 2VH5H 3JV6B 2CM6A 1XQ4A 1X5AA 3EO0B 1KBKA 4L05A 4U1KA 2LLGA 3MJGX 3HFMH 1HX0A 2AV7A 2CO2A 1W80A 35C8H 1ZTXE 1B0WA 1T0NA 4MBOA 4P3DB 4PREB 2CHWA 1G9MH 5EU3A 1NFIB 4Z3JA 4QLWA 5KVDL 2VN7A 1CFNB 1PAMA 5ICYB 5DGQA 1Q8MA 5JOPD 4G82A 1ROWA 4RMRA 4GXVH 2X6VA 4BFIA 4RLDA 1AHWA 1X4ZA 1IGIL 1AGCB 1QAWA 2JXMB 3PAVA 3EOBA 1PD0A 3PL6A 4RMWA 4XWOD 1G9HA 4LIQH 5FHAL 3WV0A 4ERSL 5CEXA 1WUNT 4N20A 3IPFA 3MV9D 3MAWA 5AAWC 3EOTL 2WNGA 5IFJA 1S8DB 5ESAB 5D2NC 3T0XA 3KBHE 3Q8CA 4NNXA 3N41F 5AW4B 1XCQA 3CVIH 1NPJA 5AALA 4I1NB 4EUPG 5DMKB 2YBGA 1Z5HA 3QYMA 3ORJA 1BP3B 4Y4HD 3RTQA 4TVUA 1IIKA 3KLKA 4BEIA 2FBRA 5F9JA 3C8KB 1PLCA 1O9ZA 1AS6A 4YWGH 1GH7A 5DJ8A 5C9KA 1DQMH 1GAFL 5DT1H 3UG5A 5J9PB 3CN3A 5F1SA 4LVHC 1IFRA 2XN9D 4H8QA 3CTTA 4GW5B 2AAAA 1E8ZA 2ADFH 4Z95L 4F7EA 3WEAA 1QNZH 4U1LB 4YL9A 1YN7A 3IN2A 4A6YH 4AEEA 4BGLA 4E41A 4NC2B 5IROD 4NQQA 5C07A 5FR3A 3SO3B 2GG1A 4OTXH 4OZFA 4RRPG 5I1IH 5F0LB 1DSYA 1WZAA 2VLRE 5C09E 2ZXGA 4IMLB 2VDLL 1U8HA 1EO8L 2C34A 4PM1A 1HL4A 3FFDB 1Q0XH 3CJJA 2XPYA 3D06A 3RB5A 3CMOH 2E6QA 2NNCA 1MWAA 2UZPA 3MRFB 1CE6B 5T1KD 1U3JA 3KVPA 5I71B 2ZUXA 5J6GB 1IVLA 5JUEH 5CIPB 4AM0B 4UOW1 2YAFA 2M8XA 3INOA 4AQAB 4C58B 2H3XC 4JKKA 4YSEA 4AW7A 1AZCA 3T71A 1MHCA 2WIIB 2D0HA 1TEYA 2ZG1A 2OQJB 4AM0Q 2EXWC 5KTEH 1W9XA 3CQFA 1ZV5A 2ATPB 4AOFA 5B7FA 2DMHA 5TE6L 3P40A 1G1CA 1E50A 3LX9A 3OWRA 4YHZL 1CYGA 4PJAE 4YBHA 3SDCA 1MIMH 3DX7A 4I18B 4OGAC 3D39A 4E9WA 5KJ7E 5HPMA 5JOFA 3G9VA 1UM5L 4WCYH 3S2CA 1MCLA 5I23A 1U92A 2GAZB 2GVYA 1DVSA 2ADGA 2IQAB 4JFHE 4JFXB 3TPUA 3MV7B 4HJ0C 5C0DB 2MWCA 3F7YA 4UT9L 5GS2D 2I9LB 5GGRB 4NWTH 5HHME 1RJLB 4YFEA 1ZHKA 5HYQB 4J27A 1UXSB 1JHKL 4ANWA 4I1PA 1I1FB 1JZ2A 1A8JH 1AGDA 4FHBD 3OMIB 3WL9A 2K78A 2KBGA 3CBKB 2FSEB 1TYJA 1IKNC 2R4SH 2RIKA 1VKXA 3KBFA 4LLMB 4U1GC 3HHSB 4LOUD 3NJJA 2ESVA 2DRUA 4ZODA 4FS0A 3VG0L 5GHWL 2GITA 4QF1A 6FABL 3BRFA 4OBSA 1FNGA 5KOMC 3NZHH 1P4IH 3O4OC 2OXGA 5K1VA 2X6BA 1NZRA 3M86A 4FQ1H 1H8OA 3LTVA 3U9PH 1WF5A 4YZFF 5LWYL 4GFTB 5G4OA