4AZ8A

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
230
structure length
185
Chain Sequence
b'SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPAGARNVSWRIINDQGGLDRLYSKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
total genus 34
structure length 185
sequence length 230
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A02
3TH3T 1A7RL 4Y88A 2IQAA 1YMMD 3HE6D 3VWJC 1UKSA 4PJEE 3R1GL 4MJ2A 5AYQA 3BE1L 4JRXA 1T20B 3RPIA 1XF2B 1JHTA 4WUKH 5C09A 2P5EE 5DYOA 1NSNH 3BPCA 2XKSA 4JPKH 4KRPC 1XCTA 3ES6A 4PYHA 3PWJB 3WDJA 4N0FB 4M1DH 4HFUH 1NPUA 2IWGA 3LPWA 4H8WC 1I9JH 1GCFA 4MJIA 4C56B 1VEMA 1AO7D 4D0CB 1CFNB 5C0CE 3DUSB 3QNXB 2GJZA 2J3SA 4QRQA 3RU8H 4NC1E 1SVCP 3WFBH 2MWCA 4PRBB 2CUMA 4HJJH 4P5MA 1UWEH 5E08L 4Z7VE 3C8KB 4OZHF 1WBYB 1PY4A 2D4DA 1F42A 4XP1L 1A2YA 4Y5XC 1G7LB 1MLBB 5DMIH 1XR8A 2D0HA 2V2XB 5AWNH 5GXBB 3CC5A 3QULB 1S78D 2FGWL 5GJSH 2BNQE 4D9LL 4ZNEA 4D0BA 4P2QB 4OGYL 3P73A 4LPVA 4NKDB 5HYEA 1KPRA 3C5SB 3RJQB 5F88A 3KLDA 3L9RA 4MYWB 5F6IB 3D6GA 4QRTA 1PX4A 1V05A 3ARDC 3GSRB 4NSKA 3ZDYE 2VIRB 1GJIA 4Y2DC 3A0OA 1G9EA 4PRHD 1XF5A 2FRGP 4KMTH 4LSDA 4N8CL 1DQTA 3Q5OA 1KFAH 3TWCH 4FQHA 1H3TA 2P47B 3MLVL 5HTSA 4XBGB 5E2WH 5IJVB 4OCNC 4JFDA 3QT2A 2R1WA 3KHOA 5L2KB 3HAEA 3EJZD 4G6AC 4EN3C 5K9JH 2CIKA 2HTLC 4V1DA 5BS0D 3NPZB 3R0NA 3IFNL 3DV4B 1MAML 1S8DB 1U91B 1BVZA 2VERN 5DI8B 3SE3A 4HF5L 4ZFFB 1MAJA 3JUYA 4PR5A 3HRZA 4HCRA 3K8LA 1OGTB 3MLYL 1RZKH 4NHCL 3VFTB 1MUJB 5IMKA 2PR4L 3ARFB 2JB5H 3BESR 3KYMB 4OZHA 5AZEH 3UAJD 3ZTJG 2VE6B 2F19L 2WIMA 2YPVL 1KNOB 1ADQA 1T3FB 1PG7L 5C2BL 1PGRB 2VB5A 4YAQB 2VXUL 3I6GB 2XWBA 3IU4H 4OIIL 5L6YL 2OK0L 2Y36H 1YEKL 4JGMA 4LGRB 1IGMH 4JY5H 4BQ6A 4Q97A 2DOCA 2GHWB 3U0WH 2D31B 2J4WH 3VE0B 4G9DB 4NJAL 4L3CB 4Y19B 4Z76A 2EYRA 2JELH 3UMTA 2WINA 3KYOB 4HMCA 5ELIA 4Q9BA 3MRRB 4RAUA 4K9EC 2IAMD 1JUFB 4MX7B 4GRLA 2HJKA 3L3DA 2ZJSH 3B9AA 4XP6L 3JV4B 2PW2B 4JZOB 2FH8A 3ZMRA 3C5ZC 3WFDL 3QQ9D 1WTGT 4U3HA 3VDCA 5J12B 1PSKL 3MLTA 5LAXA 3ZKNC 2WP3O 1MWAL 3DX6B 4KY1H 3U36B 4G5ZH 2P5ED 4YXLH 4MCYB 2NX5A 4DW2H 3PWVB 4XMPL 5EU3A 2DQJL 1FZKB 4XI5C 4KDTA 4XMKL 2L4OA 4M7JL 4YFLF 3PV6A 3CXHJ 3SOBL 2X9WA 2A74B 4AIZB 5ID0B 1MI5D 1S7UA 5K9KB 4PUBH 4K94H 5I30L 3R0MA 1A4KB 2QSCL 1A3LH 3UPRB 3F8UB 5D72L 4HIIA 4OFDA 3ZE1F 2EDYA 1X4ZA 4A6YA 5CMAA 5SV3A 3REVB 4RGNE 3EFFA 3TJHC 1IQDA 2R1XB 3RUGE 1A6AA 3RIFF 4ELME 3BFOA 5CEZE 5KSVB 5CZVH 4DCQA 2J2ZA 3SKOA 2YD7A 5K93A 3TN0D 5F1KC 4ZOEA 1JZ5A 2B39A 2BNQD 4MD0B 4P2OC 1P4BL 1WWAX 5MENE 3VXNB 1DBAL 4JFFA 5EOCJ 4FQCH 3FB7A 3HE7A 4HX1A 3T04D 5GGSB 5GRVL 4PJ9D 3GJEB 3FT2B 3CLEH 3O0RL 5IESH 3DUHA 5IB1A 1T66D 4JPWL 4J6RL 1LDSA 1QSFB 4RIRB 1OY3B 1MRCH 4NWTL 2V9QA 4DVBB 5D96C 4TUOA 3VI3E 1QPPA 4LLVB 5D7KE 3TPUB 1YEEL 1HKLL 2XFXA 2H1PH 3MLWH 4PD4K 2FJFB 3TA3C 3UDWA 3OKDB 1HHHA 5FYKL 2ADFH 5C0JA 1K2DB 4HKJB 4NO0D 3VWJB 3WO4C 2RFXA 1N8ZB 3Q2CA 2W92A 3W9EB 3TH4T 4EUPA 1F3DJ 3T2NL 1CDJA 3VFMA 5FKAA 4I5BA 1MCRA 1RK0B 3ILPA 2A2QT 4ODBD 4HG4K 4D3CH 1BQHB 4GRWE 4KRPB 1E4XI 1YYML 2OTWB 4HQQL 3OXRA 2ATKA 1MCHA 3ORJA 4GSDH 1UGNA 2BNRA 3TO2A 3C6LC 3DYPA 4P46C 2R4RH 1JRHI 3BZDA 4YXHL 1AXSB 2GJ6E 5FIEA 3L5WA 4DKFL 1MJUH 4H1LA 4J8RB 4YIQA 4K3EL 3S6CA 4OLXL 3UO1L 2DTML 5A40E 4RMSA 1U8QB 2DM7A 4AEHH 1LO4L 4LQFH 2KQNA 2XQYG 4JFQA 4P3CH 5HHVH 4G6ML 4QF1A 3TP4A 5IBUB 4YQXH 2W60A 4Y5XB 2Q7YA 4JFZL 3CVHB 4H0GA 4WWKD 4XP5H 5BO1L 4M6OL 5DHXB 2AEPL 5E2VL 1D7FA 3BRFA 2OR9L 4LVEA 2DIAA 3WNOA 4XAWL 7CGTA 3I3EA 2HRPH 3BUYB 1CE1L 5D8JL 1U3YA 1T2QL 2NR6C 4M03A 1L7TH 5GZNC 2SEBA 3ARDB 4TUKL 1B88A 3UBXG 4EOWH 4U0RC 1CICC 3SDDB 2X4RA 1NUNB 3QUZC 4Y2DB 4I0PD 4X4ZA 1C5BH 1MFEL 2YD8A 2VOTA 3UTQB 1FNSL 1I1CA 4JANB 3FT4B 4OCYL 4YBHA 4HUKB 1JNNH 4LLMA 4NKIL 4YX2L 4XMLL 3WFCH 2WUBH 2ATPB 3CX5K 1RUMH 4JQVA 2AKRB 4N0YL 4Q58C 4DN3H 3D2UA 4HK0B 5DD6B 5SX5H 3RVTD 4MNQE 1KIPA 4G80B 5IR1B 1VENA 4EN3B 5KVGH 1I3RA 5SX5K 5D5MA 5HGAA 4KTYA 3HR5B 5BV7H 3QQ3A 4NFCA 4O2EA 1XGTB 3GSXA 5KSAD 1YY8B 3LZFL 4HBQA 4YK4C 1YEHL 1HQRB 1QHPA 5HPMA 3ARGD 4RGND 5CILH 4AENA 3F62A 1FNGA 3ECBB 1WCBA 3W0WE 4RNRB 5HHOB 4OGAD 5DQJA 3QDGE 2BSRA 4ISVB 5L0QB 4X5XB 5CEZD 4U6HA 1YNLH 3CFCH 4KH2A 5DD1L 5CZXC 5MEPA 1DEDA 3CCHB 4YHZH 3QO0A 1HI6A 1UQSA 1A1OA 4RRPG 3VGGA 5DJ6A 2IALA 3QIWC 3BJLA 2RJMA 3MXVH 4JY4A 4YFLI 4ZFGL 2DQIL 2J5LB 5IBLD 2I9LA 5I0DA 1TZIB 2W9EL 1B0GA 1DEEA 3T0BA 4XT1C 2YD4A 5DS8B 4XP9H 1I8LA 3BAEL 2HFGH 2E27L 1FZJA 1QA9B 1U0QA 1VPOH 4XCNB 3AY4A 4ODHL 4TTDC 4OTXL 1YYLL 1N5AB 1DZBA 4PJ8C 2UWEF 1MRFH 3Q1SH 4FQLH 4NUJA 3T0EE 5GS0C 5HHMD 5SX4I 4I4WB 4KMLB 2QQNL 5I17A 4MB5A 2F5BH 1E6OL 3FRUA 4IHOA 1AY1L 3QWOA 4Q9RH 5BVPH 3GSQA 1U9KA 3O81A 2R0KL 5T5FL 1HNFA 2ZUXA 5E1AB 3WFEL 5BCAA 4BH8A 3QFDA 3C8HA 4WI5A 3RA7H 3C5ZB 5D6CA 2HP4A 4IRSA 4KQ4L 8FABB 3ZSTA 5E95B 3OAYK 2EXWD 1E6JL 3QXWA 1ZLUH 4G9FD 4LCUA 5I18L 2H8PA 3N0PB 1ZLUK 1OAQH 3MRKB 4QXTB 4XBEL 4JDZB 3RAJH 1VGEH 4F7PB 1RJLA 3BD4A 2Y6SC 3BP7A 3HZVA 3JWDH 1FNEA 2BSSA 1CZ8H 3CFDB 3RVXC 5HGDB 2F53B 2V5MA 2ZSVA 1KPUA 4AZ8A 2MKLC 5HDBF 3MRQB 3MRGB 4UT7H 2M8XA 5EO0A 4AMKH 1GC1C 4CNIA 3W81A 2CDFB 2VKWA 4KQ3H 5DRZA 4ZPVA 1MCOH 3W9DA 2V7HA 4QRPB 4DAGL 3V4PH 2YKLL 4X99A 2FL5B 3SCMA 5CJBA 4GRLC 4QHKJ 2HKHH 1MIEH 3S37X 3BH9A 1UZ8B 3D85A 4GQ9H 5D9SA 5EBWB 4PGCB 1WT5C 3QQ4A 4H5SB 4LLYA 1A9BB 3LPGA 4P2OB 3V5DB 35C8L 3VDAA 5IVXF 4QTIL 5CCKH 1AFVH 1QFWM 3K8MA 1BQLL 5SWZB 2ADIA 5E5RB 4BQ8A 2Y4SA 5AZ2L 3O4OB 3LIZH 5HHQA 3V6ZB 43C9A 2XN9B 2X05A 1JPST 3ARQA 3RWCB 2APFA 4PYGA 4QHLB 2CKBB 4KROC 5E8EA 2WUCH 1YNTA 5D96B 5SWSA 4O5LH 1QEWB 4L4VB 2VDPH 1P1ZA 5IHUL 3IKKA 4LIQH 4Y4FD 3U30B 3MRJB 2AGJL 5IT2L 3N06B 4NWUH 3MCKA 3B5TA 4QHUB 2DBLL 4ZO7A 3WO4B 5F3BB 3HNTH 1C8PA 2R39A 1KIUA 1S5HA 1XF3A 1ZT1A 3MJ7B 3U9PL 4HIHA 3C5JA 1LP9B 5F89B 1KLUB 3W0WD 5D1ZA 1EUTA 1B90A 3ZDYF 4K8RH 3ARPA 3PWUB 3OGCB 2JE8A 3T4YB 1S7XB 2QSQA 3VH8B 1CU4H 1A14H 4M7LT 5JQ6H 4KHXH 4PJEA 4FTVB 1EXUB 3UTSE 4P46B 2DWEB 2CXGA 3MGOA 1T0MB 4OLEA 5DJDB 2GYSA 4OZGE 5KG9A 3JUZA 2R1YA 2VLJE 4GXUN 1TJGH 1NEUA 3KLAA 4QLRA 3IGAA 3LKPB 3DVIA 4PJFE 5FKPB 3PE9A 5IVXA 1YPZF 2AQ3A 1WK0A 1DUYB 3T0ED 5EIIB 4BSVA 2FHBA 5C0CA 1C5DB 3FT3B 3GNML 5KTEL 4FZEH 3QDJE 2IQAB 2VABB 3V6OC 2XG5A 1IZJA 1H3VA 5CJXA 1FV1A 2A6KA 4BH7B 1N5YL 1TJIH 4M02A 4QHMA 4Y89A 3RWJB 1NGXA 5FF6A 1IQWL 4WI9A 2DIBA 1N0LA 1V7ML 4U0RB 1CICB 3IETA 1OWRM 3QUZB 4M7KH 1KB5B 4PRDA 4TRPH 2FCBA 2EH7H 4WWID 3HG1E 3TN0A 3VWKA 2GTWA 4L5FH 4HCRL 4GAGH 5JORA 4DTGL 1CDIA 4PGBA 3ZSSA 1FDLH 2CJUL 1KG0A 1IAKA 4UDTA 2AJ3B 3GM8A 1ADQL 4O2FA 5IKCA 4F7MB 4HGWA 4X4YA 2FYYA 2E7CA 1JHLL 2O5YH 3P4MA 1HIMH 1HHJB 2B1HH 1CDBA 1IGIL 5CJ5A 2C3HA 4IJ3C 3HC3L 1XGPB 2FWOA 4YK4B 4NNXA 4X8XA 4RDQF 2MQ0A 1YA5A 2K7PA 2IPTL 1E4XL 5IM7B 1GGTA 1G6RH 1YPZA 5I15L 3RIAF 3UP1A 5CFHA 1ZSDA 2AV7A 2EDNA 4NO0A 4Z6AT 5D2NC 3O8XD 5F8RC 2F9BT 1J1XL 2DLFL 4PRIE 3QO1B 3H7BA 3QIWB 4MNGA 1EO7A 2DD8L 2I24N 5CHNA 5EFIB 4JCLA 5FO7B 5IB5B 1B0WA 1KLGA 3WFHA 3WEXB 4OQTH 1DQLH 5J06A 4XB7A 1MCIA 5GGTH 1EAPA 1OGAE 3GSWB 2XA8L 2OYPA 3EFDL 4ODWA 2GTZA 3DIFB 4NNPH 2EDFA 3D69A 4LVOC 5IEKB 4K7PL 4HK3J 3RY6A 5DA0B 1BMGA 4PJ8B 4TQEH 1NGYB 2R0WH 2A6IA 2CLRA 3RWEA 1F6AB 4F3FB 1AP2B 5IMMA 4NJ9L 4ELKB 4MHHG 2V9RA 4JQVC 4G8GE 4H25A 4I2XE 1VA9A 4R4BB 1NCBL 1R5IB 4KJQD 4GRMB 4MAYC 1PJ9A 5H37H 3W5NA 4YDVA 2YD9A 3BVNA 4F7EA 1QBLL 1VFAA 3NFNA 3TM6A 3ARTA 4ZPTA 5D7LD 3VFRA 3S3SA 1PKQA 4KUCD 1HEZB 2X4TB 4OB5L 3OJ2C 5H8DA 2NCMA 4E41A 3LN5A 3X3FL 2IFGA 2H26A 2CSPA 5DHVH 1U8IB 1OP9A 5TDOA 4ZAKD 1T03L 2X4QA 4MVBD 3TVMC 5BVJB 3IF1B 3UTSD 5JHLL 3O6FA 5IW1A 5A16A 3BZ4B 5IG7A 1A7RH 3CDFA 3O6KL 4HW6A 1G7IB 5EOTB 4S2SB 2BVOA 3T8XB 1I8LC 3NFPA 4P0DA 2JCCF 4RMUA 3R1GH 1ZEAL 3VI3F 3WNNA 2XKNB 4JN2A 3AS3A 3STBA 2P8LB 2NW2A 5BRZE 4NFDA 3DVGA 5L8KB 1CFSA 1JN6A 4BELD 2BY3A 2CDEA 2HFFB 3MV8D 4IIQB 4JKWA 5E8OA 3WS3B 1IVLA 3N50A 4BFIB 4HS3A 2PTTA 4LSTL 2JB6A 4OLWL 5JLZA 4WJ5B 1WGOA 5LGJB 4Y2OA 3F6IA 2YC1A 4GRWF 4JFOB 1A8JH 1OP3H 3GSNA 4JFPA 4CMMB 4Q9QL 2D03L 5EN2B 1OP3K 4GW4B 4WUUA 3D25A 3S88L 4U2YA 4ELMA 2HRLA 2KBGA 1D5ZB 3HNVL 3HG1D 4XP1H 3MFFA 4NO5A 4PJBF 2HG5B 5MENA 4KZEH 1DLHA 4RAVA 3PWLB 4HUXA 4R7NB 5C0EA 2R69L 3N1GC 2BSED 2FGWH 4D9LH 2Z31C 4F37K 4OGYH 3A6CH 2DTSA 3VXSD 4L8SB 3BZEB 15C8L 1RZIA 5D7IB 4ODVL 1D9KA 4OUUB 4ZFOA 1N0XL 3H3BC 2YK1H 1ZT7B 2PKDA 4F33B 3EZ8A 2JCCA 4L8BA 3QH3B 4P2RB 1HWGB 5DEZA 1W0YT 4X9BA 1SVZA 4N8CH 2C9AA 2Z92A 4QY8A 3SGDH 3BEWB 4O02H 1HDMA 3MLVH 5JPNB 5DZOA 3HZMA 1Y0LB 3MYJB 1K8DA 4LSSL 4QCIA 4PRID 3QRFM 1KXTB 3VFNA 1A7PH 2I27N 1S9WB 2R23A 3MX0A 3IDYC 3EOAA 2RCSL 3O9WA 3L3OA 2BDNL 5MP6L 4L4JA 2WP3T 1OGAD 1NBYA 2DMBA 5ID1B 4YHNA 1AGEA 1DDHB 3IFNH 5FUOL 1MAMH 3T2PA 3IDIA 2XTJC 1FYHB 3D0LA 1BFOB 2O93L 5TGBB 3ELAT 2HLFD 3LS4L 5BJTA 1NDMB 4ESKA 4GUPA 2BVTA 4NHCH 3MLYH 3WDHA 4BZ1H 5LBSL 3KYNA 2PR4H 5C0GA 2GJ6A 1S9XA 5FECA 2A77L 3VI4F 4Z5RB 2YPVH 3BD3A 4UUJA 2BNUA 1MJ7L 3LCYA 4ZTPL 5CAYB 1PG7H 5C2BH 5TF0A 4PJBA 2NY0C 3A6OA 2VXUH 4OIIH 5L6YH 1U36A 2OJEA 2AQ2A 4NRXB 1YEKH 4UT9L 1Q94B 1BGXL 2VAAB 2XPGB 4CVXB 1T5XA 2Q87A 2VLRB 3MV9E 4NJAH 4UOJA 4FXGA 1P7HL 3D39A 4IDLA 2DIJA 2CK2A 1FJ1B 1EEZA 3HPJB 3B3IB 1D5MA 5EU6E 3KPNB 3T3PE 1RUKL 4XNQA 1JYWA 1M7DA 3R4DA 5C92A 1ETZB 5T1DL 1BBJB 4XP6H 3T65B 3QCVL 1LO2L 1MF2L 2VDOL 2VLME 3IYLW 4P48A 2A9NL 5KW9L 4P9ML 3WFDH 3VCLB 2ZP0T 2H9GA 3DX8B 1YDPB 1FZOB 3QG6B 4IJ3B 1PSKH 3D3VE 2HT2C 2OR8A 3KPSE 4R7DB 4RMTA 1MWAH 5BRZD 3LV3B 1CFBA 3IFPB 4NZUH 1QSEE 4PB0L 1R3HB 2VL4A 2GJJA 4XCEA 4XMPH 1IKFL 2DQJH 3VXUE 1UKQA 4MNQA 4XMKH 3WS6A 4C59B 4M7JH 1UWGL 1K4CA 4JM4L 3N1FC 3GSVB 3SOBH 5F1OB 1IKNA 3X11A 5D2NB 2VC2L 2IH3A 5B22A 4N0CC 4Y5YA 5D1XD 5KVEH 1MFCL 2OJZL 2QSCH 4OZIB 1ZWIA 2NZIA 1E28A 3QIBC 5F96L 3QDGA 3QFJB 1CYGA 4PTTB 2XY1A 1E4WL 4NO3B 4WO4D 5GSVB 1HXYB 2P43B 2NY1D 1WTLA 2EC9T 3DXAE 2NY3D 4EQ2A 2VDKL 1G7QA 5FB8B 1OARL 4HEME 3TO4D 3P4OA 1CR9L 5FDYA 4JQIL 1HNGA 3ZE2E 4U1LA 1EHXA 2Z8SA 3F58L 1P4BH 4MAYB 4NNYB 1T21B 1NGWB 2GI7A 5C6WH 4JJ5B 4FFZL 3RZCD 1QNZL 1DBAH 5DK3A 3U0PA 5HI3C 1FQ9C 2XYCA 5CIPA 5I2IB 2ESVA 2YZ1A 5JOEA 5ESQB 3RKPA 3S8WA 5C07A 4MQXD 3HHRB 4FQJL 3O0RH 3U48A 5GRVK 2EZ0C 1XIWC 4QYOB 1LEKB 5GGRB 1SEQL 4JPWH 4LCYA 4X5LA 4J6RH 2C3VA 4PY7B 4GW1B 3TVMB 1JWSB 3IDUA 1H5BA 3STZB 1WAAE 4NQCA 4Y1AB 5C0NC 1YEEH 1HKLH 2F8XC 5TDPB 4TNVF 2BCKA 3BH8A 3RVVD 1CDHA 1DEEB 4KI1A 3CVIL 3QUYD 4HUVB 5FYKH 1U3HC 4NOBA 3WE6B 4FNLL 2ZOLB 3QWRA 1S9VA 4NUGL 3ZE0E 3WHE1 4GAJL 3RY6C 1MELA 1NJ9A 3T2NH 3C6SA 5F1IB 4J3OC 1RV6X 5IK3A 1F2XK 3PHQA 2UY7A 1LE9B 1U8HA 2IADB 3OR6A 4HQQH 3ESUF 1YECL 3S96B 4G8FB 5A2LH 4YXHH 4FXLA 4ZOBA 4JO3L 3BZFB 3BGAA 2HYMA 1MVUA 1Q1JL 5TF1L 1GZPA 4DKFH 2GY7B 5ECJE 1IM3B 5LXGL 3LKNB 4S10A 2H6PB 4LEOA 1QO3A 1SHMA 3IDMA 2DTMH 3MV9D 1OB1A 4PP2A 1NAMA 1W8NA 1A1MB 5IMLA 5F93C 2BZDA 4G6MH 1M71B 3OKNB 3O8XA 3QIUD 3DI3B 3RHWK 3MJGX 1GH7A 4JFZH 4MDIA 1K8IA 4QOKE 2PO6D 3G5VA 5F70A 3MUY1 5BO1H 4M6OH 2VXVL 2AEPH 3PWNB 4L1HA 4EI6B 2CGRL 5E2VH 3R06B 2G75A 2VLMD 4LSUL 5EBMA 4XAWH 1F90H 4RFEA 3SDXB 5BZDB 1KC5L 1CE1H 2Z31B 3GBNL 5D8JH 1T2QH 3RWDB 1A4JB 1EVUA 1SJXA 2VXSL 1GSMA 1SBBA 4MXVF 3G04B 4H26A 4MQ7B 4JPIA 4I3SL 4TUKH 3D3VD 4ALAL 3KPSD 1L7IL 3AS1A 1JZ4A 4ZO6A 5LKNA 4KAQL 5E6IA 1AR1C 1QSED 3LKSB 1FC2D 1UG9A 1NBVL 1FNSH 3ARSA 1RUPL 4OCYH 3VXUD 5EO1B 1J0JA 3ZDZE 4NKIH 4YX2H 3ALWA 2UWEB 4ETYA 1AD0B 4XMLH 2GK0B 1NEZA 4JQXC 4XZUB 3U79A 5HBBA 5KOMC 4N0YH 4GJTB 3PABA 1YEIH 3OKYA 4HJ0C 3PUCA 1NGQL 2IGFL 3B9EA 3IDYB 1BX2A 4P2CG 3UTZA 4YFDB 4JDVA 1JNJA 2ITCB 5CEXA 3QP3A 3OPZL 3LZFH 3BHBA 4S11A 3AREA 4GXVL 3SBWC 1I85A 1J88A 2XTJB 5B4MC 4QWWD 4UAOB 1LQSR 2W65A 3DXAD 3FL7A 3U46A 1BVLA 5FOBA 1G1CA 3U6RB 1RK1B 5DD1H 5I8KL 4BSJA 5E9DA 2NNAB 4G43B 3WUWG 1LEGB 1CXKA 2VLJA 2VNCA 4UTAL 2NY0B 4Q2ZA 4ZFGH 2Q20A 3QEHA 3FFCA 5DVNA 4LLWA 1D9KC 1S5HB 5DO2D 2W9EH 5F7DB 3NA4A 3S4SA 4JRYE 4PV9B 1WBXB 1JTOA 1UM5L 5MERA 1RZ7L 3BAEH 2E27H 3EYFB 5DMJB 1FNLA 3C9NA 3MYZA 4MAUL 4UQ3B 3BD5A 4ODHH 4Y16D 4OTXH 1NCTA 1YYLH 2HVJA 4LHUG 3QDJA 3QQNA 4AG4H 4HKZA 1QBBA 3I02A 1F4YL 2QQNH 2FHCA 5DC0A 1JYXA 1E6OH 2AQ1A 5FA4A 4EVNB 2HN7B 4EI5A 5FDWA 3N9GL 2R0KH 5JZ7D 5T5FH 2HKFL 1CN4A 1X7QB 3WFEH 3O9WC 1FVCA 2DQEL 3F7QA 5KSBE 4APQC 1EFXD 5DMKB 1UA6L 5LG1A 4KQ4H 3FQUA 1OCWL 2D7MA 1KYOJ 1E6JH 5B8CC 4MB3A 5I18H 2AJYL 4P23D 4XBEH 2QHRL 3MOAL 2CRYA 5IB4B 1F5WA 3O11B 3CNKA 4KKAC 5DQDL 3IJYB 3ZYOA 3B9VA 3D87B 1JGDB 1QSZA 5F9JA 1YUHB 3TBWA 1P84K 2KZ1B 2HJLA 1X3DA 4KXZH 5E70A 4HWBA 4GT7A 3WMSA 1BLNB 5D7SL 4KV5E 3G5ZB 2Z91B 4TSBL 4HT1L 1XF1A 3RNKA 3QIBB 4JO2L 1I1YB 1U95B 4Q74A 5T1MB 4DAGH 5I8EB 3RGHA 1FNFA 3MUZ1 3RWGB 5M95B 2YKLH 5FYKU 4MWFB 2NMSA 4OAWA 4KJPC 4NCDA 4I77L 4WI3A 4LCWB 4QOKD 3MNZB 5EU5B 4O2FB 3MV7B 5IKCB 1Z0NA 2G5BA 3BN9C 2GUOA 3GK8H 5F72S 3DECA 4GG8A 2YPLE 2CLVB 4QNPF 1J8HB 3F7RA 5JW3L 1EJ6A 3HC0A 35C8H 4YNYB 4GG6E 1KCSL 4BJLA 4QTIH 4WU7B 2Q86A 1BQLH 5TE7L 1DVFD 1VKXB 4FQIH 3L3IB 5AZ2H 2OS7A 3ROOA 3KGRA 4PJ5A 4FMKA 1U92A 1MSPA 4G8GA 4YC2B 4I2XA 4YGAB 1XIWB 5KJRL 2ZSWB 4J3TA 4M8QB 1XZ0A 1YPZB 3WIFA 4HLZH 4F8TA 5AUMA 1AIFB 1IKNC 3K46A 4E42B 3MRCA 2LAGB 1UCTA 4PRAB 5IVZA 4NGHL 2MCG1 3NGBC 1AGCB 3ZYJA 3MRPB 3VFWA 2Y23A 4MA8L 2EECA 5IHUH 3IS1X 5E00A 3MRFB 1KSRA 2ARJQ 2XICA 1R3LB 5IT2H 1LEIB 2VDQL 2Q8BL 2N7BA 3GSNL 1U3HB 1EX0A 2DBLH 3CX2A 4U1NA 3B5GA 2P7TA 4KK5D 5ETUB 3BKJL 5EUKB 3FN0L 3U9PH 1CG9A 2X4SA 2FR4A 1SEBB 2G9HB 1HHKB 1U8PB 3ALXA 3HC4L 1JPSL 2OL3L 2FBJL 1S7VA 1WBZB 1WLHA 3SJVE 5ITFB 4S0SD 4KVNL 5HYSG 4CVZA 5CD5D 4FFWC 3HPLB 5FYJL 5DSCA 5IFHL 1MAKA 5DC9B 4UBDD 3PQYA 4X6CB 5K9QI 5J3HD 5HGBA 4ZMAT 1PLGH 3B5HA 1GIGH 2J88L 5C0FA 2GSIB 2IANA 1ND0B 4V2CB 2A9ML 2NPLX 1DBBL 1ZHKB 4JRYD 5F3HA 2L0DA 4DQOL 4ZFOL 1AE6L 3GHBL 4XHJD 1EZVY 1R5VB 1JYVA 3BQUD 5ENWB 1DSFL 2XZCL 1I7RB 5DJZB 3PXJA 4OFIA 5E8PB 3OKEA 1YEDA 5H94B 2DYPA 1IM9A 3RQ3A 4HH8A 3WKNA 2VR5A 2C3GA 5J6HA 5ICZA 3GNMH 4CU8A 5KTEH 2W59A 3ULVE 2H45A 4LSPL 2AP2A 3MNVA 4NM8H 2X9YA 1BZQK 1JI2A 1HQ4B 2N4IA 3L5IA 2ARJB 2BVQB 3HAEH 3OJDA 4WO4A 1CGWA 4LHUD 3DARA 5J11C 3PNWB 3ZKMC 4TN9A 3E3QE 1PYWB 1IQWH 1JPGA 1JNHB 4P9HL 1J10A 3LRSA 1ULVA 1V7MH 1TDQA 3KLHD 2V2WB 1W0VA 4P5TC 2JF1A 3EDDA 3VDBA 1BD2E 2XWTB 3ILQD 4HCRH 4LSRL 4ZUSA 4ZXBA 4DTGH 2Y72A 5JW4N 1UM4L 2CJUH 4HK3N 1YN6A 5KN5B 3UYPA 5HYJE 1ADQH 3DTXA 1OF2A 2Z0BA 5CGYC 43CAB 3VXRA 1LO3L 2B1AL 1JHLH 3ALPA 3U9UA 4YZFE 5I76A 3T3PF 1IGIH 4M00A 3VFSB 4QHKI 3L6FA 4I0CC 1ZVSB 3HC3H 2IMNA 3QUMA 3CU1A 1F00I 5EUOB 1LE5A 4FQQB 3ULUE 4WU5B 4F2MB 4GKNA 4Z7WF 1GGYA 1RZJL 3WYRA 4XCYB 2CUIA 1QQDA 4J3XA 2IPTH 1E4XH 2DQFA 5F21B 5BQ7B 4ODXA 3EO0B 5BOPA 2VZSA 5IQ9A 1JRHH 1R3JB 2DLFH 4K7PX 3ZKXB 2DD8H 1L9MA 4LKCB 1ODAA 4PLOB 1D9KB 1X5XA 1OTUC 4K3HA 1S9KC 1W72L 4P4KD 3X17A 5D2LF 2O5XL 1TVHA 2XA8H 5E6IC 3EFDH 5SWQA 4C56E 5A2KH 5IIEB 2OQJB 1KLFA 2EE2A 4WV1A 2VMFA 1EJOL 3O45A 3ARRA 5H37G 1MCEA 1AJ7H 4Z18A 3VRIB 2I9TB 4NJ9H 3X14B 3IAGC 2EXYC 2JJTA 2R9HD 3OX8A 3VFNB 3ARBD 3GO1L 1NCBH 4CJ0A 2L7JA 3MV9A 4HV8B 4APQB 4HHAB 4OIAA 4OV5A 1QBLH 3ZE2F 3TV3L 3UEZA 5HDQL 5B8CB 3HUJF 5C08B 5EU6A 4A6YH 5IB2A 3FO9A 2IBZY 4DZBA 4P2QE 2BMKB 2DKUA 4L3AA 4YR6B 4OB5H 2XZAL 3X3FH 3FO1B 3QUXC 4K23L 5D1QC 3NZ8A 1CIUA 1CFVL 4LF3A 1T03H 3TNNB 4U6TA 1CD8A 1VFBA 3BDYL 3F7VB 1MY7A 5JHLH 5GRJL 5CEYA 2EEAA 3DMMC 3KDMB 3O6KH 4TOYL 4ODUB 1ZEAH 4WI6A 2IG2H 2WM0A 1DFBL 2VLLA 5L2KE 3HTLX 4UV4H 1WFOA 3TCLB 5D2LA 3GSUB 2WBJC 2FD6L 4YH6A 5EOCL 4LSTH 5F7EL 4OLWH 3BRGC 2HJFB 1A21A 2P8MB 2YXFA 3CAFA 3JXAA 4WHDA 1CGSL 2PCPA 2OI9C 5AG9A 1QSVA 1FRGL 1IEHA 1NFIB 3L3JB 4Q9QH 1Z5LA 2D03H 5ACZA 1NC2B 3S88H 5JOFB 1VFUA 5INCA 2VJXA 5DK0A 2C4FU 3MJ8A 2ITDB 3RL2A 3SE9L 4NRZB 4NQDD 3HNVH 2Q76A 4UIMA 2P5WA 3UROR 1AQKL 1BD2D 4JFXA 2JK5B 2YBRA 3FQRB 5TPWH 2MTPA 1CTOA 4J1UA 3DVFA 5DJXB 4FQXC 5D7JD 4Y19E 1PEZA 2QR0A 1FC1A 1FZMB 4XXDA 2GCYB 4RAHA 4OLUL 4OCLC 3NGBB 3H3PL 3O4LA 1I1FA 1EEYA 4QRRD 5BZWB 1BFSA 3U2SA 3JVGC 3LKOA 4UV7L 4W6YB 4DOHE 1FL6B 2Y7QB 1NMBL 4H1LH 2P8PA 4PJAE 15C8H 3GMMB 5HHPB 4L4TE 4ODVH 1N0XH 2AXGA 4XGZB 5ESVB 5CKAA 4LCIL 2ZG1A 3ULUD 1NAML 3V2AR 3MRBA 4CVUA 3HZKB 4G6JL 4XBPA 4ORZC 1T2JA 3LY6A 2J6EA 3RGVC 4QRSB 1GGUA 2YEZB 2CK0L 1EUUA 5EO9B 5B39B 2HH0L 4GAYA 2CDGA 3CFKA 5IF0B 4LSSH 2GW5A 2LTQC 2DM3A 3TJEL 5CSBA 5I8CA 5JHDB 5EBLA 2AEQL 2RCSH 3CZFA 3PIQA 4JHAH 2FZ3A 2BDNH 1QR4A 1DN0A 1Z9LA 5MP6H 5DXWA 1WFUA 1IEBB 1FO0A 4Q9CA 4W6XB 4C56D 3C60A 5FUOH 3PGCA 5CWSA 3SN6N 2K1MA 1M05A 4WDIA 2C3VB 1NFDB 4S1DC 5DJ2B 3ZZ1A 4U1IB 3FOMB 5LBSH 4ETQB 2NY5L 5C0DA 2A77H 4M6ML 3UPCA 1IAII 4YHIB 3V0VA 5B21A 1MJ7H 4ZTPH 5T1LA 1U8KB 2QADC 1N7ML 2VZUA 1ZGLP 3VXQA 1MCFA 4X7TB 3TBSA 3IDGA 4UT9H 1N4XL 1BGXH 1NQBA 2EKJA 5J11B 4LOUC 2NY2D 3T2OA 2O26U 4G8IA 1I1AD 4P5TB 5ADOL 1XGQA 1FCCA 4XPFL 2IPUK 5DFWH 3G08A 4P4RA 2GSGA 5DWUL 4WVRA 3GM0A 5B3JF 4LDLB 1NH6A 5I1JL 3RTQA 3DO7A 3DETD 4KKNA 5T1KB 4NZRL 5L88L 3AMLA 4HFWB 5T1DH 3OHXB 1LO2H 1JL8A 1MF2H 3QCVH 5AYUL 3V6FB 1JCKA 5HSFA 4PLNC 3KPQB 1XGUB 2A9NH 1RHHA 3DURA 5KW9H 4P9MH 3PWPB 1A22B 1H15A 3AB0C 3PJSA 4MZ2A 4PV8B 4MDJA 3WKMH 4HIJA 4QRUA 3TIDA 3FN9A 3JZ7A 4PJIE 3Q48A 4Y4HC 3DX9A 1BJMA 3L5HA 4PB0H 2F54B 2D9QB 1QRKA 4U7SA 1IKFH 5FO8B 2YXMA 3KXFB 3WN5B 5I1AA 3P0YH 1UWGH 5GGSY 4R3SB 4UZGA 4JM4H 4M4RA 2JJSA 2VLKB 4LNVA 5JXEC 3EYVB 2VC2H 2WWMC 4PJXB 5C7XL 1NCAH 4ORGB 1ED3B 5JO5A 4MCZA 3P0GB 1QP1A 2EIEA 4B41A 1WUNT 1MFCH 2OJZH 2E7LA 4QTHB 3EOTH 5INDB 4OT1L 4XXCA 4KKCD 1MOEA 3H9HA 4JJHA 4NIKB 4HC1A 5F96H 1SY6L 4GBXD 4W81A 1ZAGA 1E4WH 4OFVA 4L8CA 4XC1L 3UTTA 4M4PA 3NCYP 1X5KA 4WI7A 1ZHBB 2H2PC 1DBJL 5T3ZE 2X7LA 3WBDA 4MNHA 1A6ZA 3PGFL 2X41A 4JQIH 1FYTE 4PTUB 2A83B 4XH2A 3B9DA 1BZ7B 4HWBL 3TFKD 3F58H 4JAMB 1EV2E 4W68A 1TVBB 5AD0A 4EXPX 2XKUA 4Z0XB 2P46B 4FFZH 1QNZH 4HZLB 1HYSD 1UB5B 1A6TB 4L4TD 4DK3A 5FFLA 5AAWA 4FQJH 1D5XB 2ADJB 4JM2B 5ITBL 1I7TA 2BSTB 3HE6C 1SEQH 2R2HB 3BGMB 3QUXB 5D1QB 5TH2A 3D0VA 3NABL 1DUZA 1B0RA 4ZYKB 1D5BA 3CFJA 1BF2A 5ERWA 4PGDA 1QRNE 1NMAL 3DMMB 3WJJA 4ZSOB 4ERSL 4OFKA 1Z0MA 3BXNB 2F8VA 3CVIH 3I2CL 3QI9D 5GS1A 2YA1A 3G5XB 2BC4B 2C3XA 2C4XA 4U31A 5DJYB 3BP4A 4JZNA 2X2YA 4NRYB 4RMVA 1NCUA 4NUGH 3U1SL 5FYKE 3VFOB 2KUTA 4GAJH 4WV1C 4N5UA 2N7AA 3I6KA 3BP5A 2MJWA 3OAUL 3ET9F 4L8DA 5C3LD 2UY6A 3LDBC 1FP5A 1RZ8B 3RWFA 2VL5B 2WBJB 2BVPB 5ANMB 3QEQD 1C08A 2AV1A 3T2QA 5HHOE 3OKOA 2OI9B 4IRZL 5GGVY 3GRWA 4JO3H 3QZWG 3MRIA 5FGBA 5CSZA 1Q1JH 3PGDB 2EYTA 3BKCL 3QNYA 5LXGH 4OZ4A 1EEQA 1NUDA 3MZTA 2OX5A 5GIRA 1VGKA 3QDME 4DZ8B 1GZQB 3OAZH 1UVQB 4XP4L 3CDGA 4E5XB 3MJ9L 4GS7B 4YBQD 3AUVA 2YPLA 3OAZK 1MHHA 3PHOA 3HRPA 4LAQL 3STLA 5A3ID 4CVWA 2AJSL 4FQXB 2C3WA 4I48B 3TZVA 3P9LA 3LSOB 4LSUH 3TNMB 1U93B 1KC5H 3GBNH 4Z7NF 4QXUL 2VXSH 1T1ZA 4WNQB 3P4LA 4E0RA 5T5NF 3ULVF 4I3SH 4OZFA 4ALAH 1I8IB 1L7IH 1N59A 2VDRH 4OBRA 4KAQH 3EJZC 1H8OA 1EO5A 3MBEA 1NBVH 3IFLL 3NIFE 1RUPH 3M17B 2DWDA 3QHFL 3RGVB 4U1SA 5IV2B 4WW2C 3L3GB 3NH7L 3EGSB 5DHYB 5CD3B 3S35X 4UU9B 2LTQB 5TFSL 2IEPA 3NVQA 4HXBH 5CINH 1NGQH 3H0TA 2GFBA 2ZOKB 2PYEE 3UAJC 3U7WH 4JHZA 2KH2B 3OPZH 4PJ5B 4ONGL 1VB9A 4FP8L 1A0QL 4JZJC 4AM0B 3SJVA 1WC7B 1BQSA 4DFHA 4IOFD 3QHTC 2AK4A 4YFEA 5T3ZD 3GJFB 5AWNL 4JLRB 4QT5A 5I8KH 4IS6A 4QRPE 3PDGA 1DL7L 1FYTD 3T77B 1RUAL 4ZUVB 4YHLL 2QADB 4UTAH 5HXMA 3ARYA 3I85A 3SY0B 1P4LB 3KWWB 3VGHA 1NAKH 1JK8B 4C4KO 4JKPL 5EIVA 2WAHA 1UM5H 3QUML 1JGUL 2Y5TB 2X1WL 3FJTA 3SDCD 1RZ7H 3LKRB 3FQXA 1NBZB 1P53A 4MAUH 1Z9SA 4RQQB 3GHEH 1AGBB 3ARDD 1A5FL 3BP6B 1S7WA 3QQ9C 1MCLA 3DRQB 1W0WB 1F4YH 3PDOB 4L9DA 5JW5A 4DKEL 2FLRT 4FS0A 3N9GH 1QRND 3KS0H 2HKFH 3MA7A 1X5IA 3FKUS 2DQEH 3V8OA 2UUDH 3CX5J 2K9UA 2EKSA 1UA6H 2QQKL 2UUDK 1OCWH 1IGYB 2RQ8A 5IB3B 5FAAA 2GITB 3C60C 3DO3A 4M6AA 3T1WA 2AJYH 5FYKD 5DEFA 2QHRH 3MOAH 1BOGB 4Y4HB 3WLWC 1ZHLA 5HYJA 4GOSA 2YZ8A 4OLZH 2YD2A 5E5MB 5DQDH 1FN4A 3FAXA 1LILA 2IBGA 4KK6D 4DUXA 5ICZB 1X5GA 3L3KA 1LP9E 3FB6B 3INUL 5E0QA 5HHOD 2ZPKL 1AKJB 5D7SH 4CDGC 1KXQE 5KAQF 3ZTJH 4JHBA 1N6UA 4TSBH 4DGVL 1B4RA 4FTVE 4JO2H 3I84A 4LPWA 2J8OA 4NZTL 1BHGA 3HS0A 3QDMD 1J0HA 1T20A 3Q5TA 3WHXB 1XF2A 1Q9OB 3S5LB 1IJ9A 2V17L 1A6PA 1RPQA 4I77H 2ZUTA 1NC4D 2XNAB 3KJ4C 1IAIL 3PWJA 4KGJA 2I5YL 2KZWA 4N0FA 1FGNL 1IGJB 5JW3H 4C56A 2DM2A 1T66C 1BJ8A 3VGBA 1R5WB 1CFNA 4D0CA 4YE4L 1KCSH 3DUSA 3QNXA 3NIDE 5DUBB 5TE7H 3RIAK 4PRBA 1OLZA 5JIHA 5TJWK 1JPFB 4HIXL 1WIOA 5F9AC 2FJHA 3E1F1 3C8KA 2C7UB 4KKLC 1KB9J 1WBYA 4YUEL 4ZQKA 5KJRH 1QR1B 4JRXE 1S3KL 1YMMB 3HE6B 4IRJD 4J4PD 4U05A 3SE4C 3P0VL 1FNAA 4OSUL 3ZKND 5C09E 1T83A 1G7LA 1MLBA 1PKOA 5GS3A 3AGVA 2V2XA 3QB7C 4NGHH 2ERJB 3JTTB 3QULA 4MA8H 4P2QA 5ILTL 4YGVB 1T1XB 4XXCC 5DFVD 2VDQH 2PYED 4NKDA 2Q8BH 3GSNH 3C5SA 4MJIE 5F9DC 4HULB 3F12B 3GSRA 8CGTA 3BKJH 3FN0H 2VIRA 4N8PA 1P9MC 2NLJA 2X1QA 1AO7B 3HC4H 4NP4H 1JPSH 5ALCL 2OL3H 2FBJH 3OSKA 2P49B 1G7HB 1R6VA 3ZT7A 2F74B 4KVNH 4BQ9A 4EZMA 5FYJH 5IFHH 4XTRD 1X4XA 3TJHD 4FMFA 3WNPA 3RX8A 1YEJL 4XBGA 2J88H 5IJVA 3MREB 2A9MH 5MHSE 5L2KA 4D8PB 1DBBH 4JCMA 4ZNEE 1FFPB 5F44A 4X9FA 3QWQB 4DQOH 4NQVB 1AE6H 3GHBH 4P2OD 3RNQB 4X6EB 1KCUL 4XRCB 3GMRB 4WENB 1AH1A 3KJ6L 3DV4A 1B3JA 1S8DA 1OPGL 1DSFH 2XZCH 4PB9L 4HD9A 2ZUUA 3RBGA 3RJDA 5CGMA 1U91A 5DI8A 4ZFFA 3K81A 4Z7WB 3KPRD 4MXQC 3CK0L 1OGTA 3VFTA 1MUJA 3ARFA 3KYMA 2VE6A 4LSPH 4I0PC 1KNOA 1T3FA 2AJUL 3BW9B 3DSFL 4U6XB 5BMFL 4PRHB 3GMNB 1DE4B 5FM4A 4YAQA 4F7TB 3I6GA 3FZUD 4DKDC 4P9HH 4TNWF 4GRWH 4M5YL 3DVNB 3PXHA 2D31A 3VE0A 4G9DA 1IT9L 4L3CA 4Y19A 3TA3D 4G8EB 4V1DE 3OR7B 4K7FB 2FEEI 2OZ4A 3KYOA 1TJHL 3AU1B 4LSRH 3D18B 5BS0B 3EOYG 4EIZC 1UM4H 3LN4B 3MRRA 4WW2B 1JUFA 2R4RL 3ARGC 4MX7A 4O58L 1EGJA 5DEGB 1CD1B 5KS9F 4LVHC 2V5TA 1MFAL 4TUJB 1Z9OA 3JV4A 1LO3H 2B1AH 2PW2A 2PXYC 3OB8A 4JZOA 3MNWB 1KTKE 2E6PA 3HN3A 2HWZL 4D9RE 2VZ3A 4FTVD 3DPBA 1LO0H 3C6LD 1JF5A 2F8OA 2FX9L 1Q72L 4JZJB 1IFHL 5HHVL 1KCVL 3DX6A 3U36A 3HUJB 5IFJB 1RZJH 2E7BA 4XPTH 1U3ZA 4MCYA 2WV3A 2EH8L 4PLKC 1JWMB 3FO2B 3PWVA 3S36X 3TZVC 1FZKA 3SEPA 4HPOL 3B43A 3RDTC 4KZDL 2OTUB 2VQ1B 4NC0B 2FECL 3LQZB 5EOQL 1IMHC 4O51B 2A74A 2CD0A 4AIZA 5ID0A 4OV6F 5K9KA 5IWLC 5F9OL 1A4KA 2IAMB 2HTKC 1W72H 2X10A 4YLQT 3UPRA 2O5XH 4XWOD 3EYSL 1EAJA 4X6DB 1IGCH 4FQ1H 3MBEC 4PGZA 1GGBL 2NR6D 3RRQA 3REVA 5GZND 2BOBB 1R0AL 2DJUA 1DJSA 4JRXD 2R1XA 2NZ9C 1EJOH 3I9GL 2EXWC 1NGZB 1HINL 3Q6GL 2H2SD 5C09D 1T22B 5KSVA 3ARWA 3WIHA 3EYUL 2X4NB 3O2VH 4R0LB 1P7QB 3MLRL 4XNZC 3GO1H 2P5EB 5J6GB 4MD0A 3CZJA 1EA9C 4I18C 3H2WA 3V52L 3OKMB 4BFGA 4YHKL 3VXNA 3WUZA 4EDXB 4MJID 1FFRA 3L3HB 1B2WL 5HDQH 4HC1L 4YHYC 1MI5B 1SJHB 5GGSA 1KPVB 3CXHK 2ZUVA 3GJEA 3HMXA 4NKOB 4NZDA 1S7TB 3FT2A 5FM5M 3OKKB 2XZAH 5D7IE 2CMRH 4K23H 4DEPC 5C0DB 1YJDC 2FSEB 3MMEB 3E8UL 1QSFA 3EBAA 4Z7VB 4RIRA 4DVBA 3BDYH 3KPOB 5GRJH 4WFFE 1NCCL 3TPUA 4FQPA 4TOYH 5MHSD 2CLZB 1G9MC 2FJFA 3OKDA 5CZXD 4E9LA 4YJZL 1K2DA 1VHPA 4HKJA 3VWJA 1N8ZA 5CIPH 3V6BR 4F80A 1VPOL 3W9EA 3QIWD 1DFBH 3C2AL 2BNQB 4JFFE 1PZUB 2BHZA 5H2BB 5HJ3B 1MRFL 4KK8C 5J9PB 1RK0A 2ICCA 1Y18B 1BQHA 1KIRB 2FD6H 5EOCH 5F7EH 1KCLA 1TCMA 5F7UA 1Q0XL 2OTWA 3KJ4B 1FIEA 4PJ9B 1HYRC 1CGSH 4POUB 5C6TL 4G7YL 5E2JA 3IU3B 4EUPG 3MRMB 1AXSA 4RA3A 1FRGH 5I6XC 1N6QL 4JFDD 2BRRL 3U7YL 5FYJU 4J8RA 4WFGE 4PREB 3V6OE 3DBXB 1QFPA 4LLUB 1U8QA 3NN8B 4JVPA 4V1DD 3SE9H 5EWIL 4Y4FC 1ES0B 1OD9A 4JVWA 1MHCB 1MFBL 2C1PB 2ENSA 1AQKH 1CFTB 4NO2B 2X70B 4Y5XA 1OP5H 2VLRE 1CVSC 4CW1B 4H1LG 3CVHA 1OP5K 1F3DH 4OLUH 3H3PH 5EBGA 1EHAA 4OJFL 3GRWL 2ADGB 2Y6SD 3H42L 3BUYA 4UV7H 1NMBH 3MUHL 4D9RD 3RVXD 4KQ3L 3ARDA 1F4XL 1UXSA 5EIQA 1J05B 4LCIH 1PFCA 3SDDA 5F1NB 1NAMH 5C6PB 4MS8C 4Y2DA 4G6JH 1F6LL 3UTQA 5C8JB 4JANA 3FT4A 4AIOA 2X4OB 4XH2B 2X9XA 1MQ8A 3VA6A 2CK0H 2HH0H 2ATPA 5I1GL 1HSAB 3TJEH 2AKRA 4GRLD 2BHYA 4HK0A 5DD6A 4G80A 1Y6KR 5CCKL 2AEQH 1T7WA 5IR1A 4EN3A 1A6UL 4WWKB 4OGXL 1FFNB 3MLXL 1IRAY 5D2NE 3HR5A 4EDWL 3LIZL 1XGTA 2B4CC 5HI4D 4MZ3A 1YY8A 5E2UL 2ORBL 4LRNH 4B7LA 1OOAA 4I13B 1P7KB 4RISL 3ECBA 4PJHF 4RNRA 5HHOA 1REIA 1S7SB 5E2TL 2VKXA 4ISVA 3QFJE 4X5XA 1RJYB 4R8WL 2NY5H 3M8OL 4M6MH 3QUKB 1K3ZA 3X3GL 5DQ9B 3HR6A 3CCHA 4I0PB 2FO1A 1GPOL 4J2XA 1N7MH 1T1YB 2BRQA 2IPUG 1OAKL 4M5ZL 3HNTL 5ESAB 3FB5B 4AY0A 1QACA 4KROD 1DN2A 3IVKB 1N4XH 5DA4A 5EDXA 1TZIA 5DS8A 5HPOA 5DJ0B 4LEXH 4ZUTB 3EDEA 5L9DL 25C8L 2P42B 1QA9A 4XCNA 4YXKL 5ADOH 1L4IA 4XPFH 4ZTOH 1CGYA 3S97C 1N5AA 5DWUH 4CN1A 1ZVYA 5CBAB 5I1JH 5KSAB 3O6LL 4OCRL 5HY9B 1TITA 4I4WA 4NZRH 5L88H 3ARGB 4RGNB 3GDBA 4OM0L 4NM4L 4FABL 2R2EB 2QKIB 4WFFD 3FQWB 4NN5C 3RUGB 5E1AA 1U8NB 2PXYB 3MR9B 3NCJL 4PRPB 3C5ZA 3O41B 1UYWL 2CH8A 4I3GA 8FABA 1A6VL 1MRDL 4Y1AE 5DT1L 3M45A 2Y5EA 2ZG3A 4JFFD 4JEGB 3MRKA 4QXTA 3ARUA 4JDZA 4KJYB 4CADB 3ULVL 4J3UA 1TFHA 3FMGL 4F7PA 1IAMA 5C86A 3G6JF 1E27B 3LPFA 3TZVB 3EDKA 5FUCC 3RDTB 1DLFL 3MQIA 1INDL 4RGMB 3CFDA 2BY1A 4WHTB 3B2VL 5HGDA 5GGRY 5C7XH 2F53A 3O2WL 4FRWA 3MPCA 3FQNB 1G7MB 5EC2B 4XVTL 3MRQA 5HHMB 3MRGA 4OT1H 1LP9F 2B5IC 2V6HA 1SY6H 4WFGD 2CDFA 3SGEI 1MCDA 5MEQB 4PFEA 4JFEB 4XC1H 4QRPA 3H3KA 1QPXA 4GAGL 2BFVL 2VXTL 3HZYB 1ZANL 2FL5A 1FDLL 1P5VA 5CKGA 4G9FB 3PGFH 4X83A 4NQEB 1UZ8A 4EXKA 2CR3A 4XNZB 4L3EB 4HWBH 4NBZB 1I3VA 4M7ZC 4PGCA 5EBWA 3SGJA 4H5SA 2QSTA 1A9BA 3A67L 4P2OA 5I75C 4I18B 2BNRD 3ULUL 1Z2KA 3V5DA 5IP4A 3C87A 4ZAKC 4M9PA 4MVBC 5SWZA 3TH2T 2EIDA 3MRHB 1RD6A 2H32B 3SDXE 4WFHE 5EZJB 2FEEL 2AK4B 3V6ZA 5ITBH 2XN9A 2O5ZL 3P77B 4FQ2L 3NIDF 3RWCA 4MJ6B 4LP4A 3BGFC 4GAFB 4QHLA 3NABH 4HDIB 2CKBA 2XTLA 2DICA 2LQRA 1GOHA 1QEWA 1NMAH 1FLTX 4L4VA 1TZGL 3G6JA 3MUGB 4ERSH 2EYSB 3I2CH 2E6JA 3MRJA 3KYAA 2V5SA 2UWEE 5EPMB 2VYRE 3M07A 1BBDL 4QHUA 5F3BA 4K3JL 4NNPL 2QHLA 3U1SH 3REWB 2H41A 4ZS7L 3MJ7A 3MSPA 3IFOB 1FHGA 1ONQB 1LP9A 5F89A 2AI0L 1KLUA 2CPCA 3OAUH 4RCAA 3RI5F 1RULH 5HGHB 3PWUA 3OGCA 3T4YA 1S7XA 3VH8A 1XGYL 4FTVA 1EXUA 3EJYC 1NLBL 2VWEC 4IRZH 4P46A 1CXHA 4QXWA 2DWEA 5CSGA 4CJ1A 1J1PL 5I6XB 2FEDD 2FB4L 1T0MA 5DJDA 1QVOA 2BHUA 3BKCH 3HCVB 4U6YB 4TVSa 3D2UD 4B5EA 5KBNC 6FABH 5D71L 1LNUB 3LKPA 3UBXB 3BMVA 1Q0YH 5FKPA 4S1RL 2E8YA 4Y4FB 4XP4H 3FTGB 5JA8B 5HDBE 1DUYA 5JIIA 1U8LA 2AJSH 5EIIA 1C5DA 3HFML 3FT3A 5KSUB 1C12B 3IAPA 2BOCB 4LP5A 4YO0B 1FLRL 4U1MB 3QNZB 2J7LA 3W0WB 2DDQL 2VABA 3IXTB 2QQLH 3I50L 4QXUH 4C4KT 2FIRT 1GAFL 1FVEB 3JWOC 4BH7A 3OZ9L 3HS0B 3RWJA 1I3UA 4LLAA 4Y1AD 3BIKB 2X6MA 1KCRL 1C7SA 1CICA 4X6BB 3QUZA 1KB5A 3FOLB 1FL5B 3QA3B 4HLJA 3K80A 2UVEA 3IFLH 3QHFH 2E9JA 5IVXE 1Q9WB 3QJHB 4XCFL 3NH7H 2W07A 1T0PB 5I1KL 4IEFB 1CL7I 2AJ3A 3O3EB 4Y5VC 1QBMH 5TFSH 4F7MA 2DBJA 4N0RA 5JR1L 3ZL4L 3MODL 4DUVA 4EBQL 1ACYL 5ACMA 3T0EB 1HHJA 3JSSA 1NCDL 1QFWI 1UT9A 2FJHB 1QG3A 1BZ9B 1XGPA 2YR3A 4ONGH 4FP8H 1A0QH 4IRSD 4ZQKB 1FIGL 4QHNB 2KPNA 2A0LD 2XG4A 5HD8C 2OZ4L 4ZNCD 4RMWA 1S9YB 4HWUA 3ZHKA 2MCPL 5FCSH 3V5KB 1XCQB 4KZEL 5KZCD 5IM7A 2AJVL 5GPRA 1FG2A 3QR2A 4FFVC 1M4KA 2WK2A 1DL7H 5T3XL 4X7CC 1RUAH 1EGJL 2XA3A 1T1WB 4YHLH 4LCCB 5FOJA 1I8KB 4Q6IC 3A6CL 3QO1A 5GRZA 3QIWA 1U8JB 5EFIA 4JKPH 5FO7A 5IB5A 4A2LA 1A02N 2NW3B 3GI8L 4NOFA 2YK1L 3QUMH 3SDDC 1JGUH 3WEXA 2NLJB 3GSWA 1J8HE 3N1MC 2Z31D 3DIFA 3CMGA 4KU1A 4DGIL 2R56L 5IEKA 1UZ6E 4XPGH 1A5FH 4PJ8A 3LEYL 4Z7OF 1NGYA 3HA0A 4O02L 5I1DB 1F6AA 4F3FA 3L5JA 5IROA 1AP2A 4DKEH 4ELKA 2AEIT 3P4NB 3ULSB 3SCMD 4F7CB 4R4BA 1A7PL 5ALBH 1K4DB 1HK6A 1YPZE 4NN5B 1R5IA 1CT8B 1DBKL 3D85D 4GRMA 1IC4L 2IH1B 4NKMB 3H8NA 2QQKH 4JN1L 2APBA 1UFUA 4MNGE 3MV11 4L1DA 2M2DA 4U7KA 4NQXB 1CE6B 2K7QA 3T0XA 1HEZA 1AGDB 2X4TA 1LGVA 3QDAA 3W39B 5L0QC 4BZ1L 1T6VN 3NCFB 3WIHL 1U8IA 3MRNB 1MCSA 1ZV5A 5KANI 3J7HA 3INUH 5BVJA 2ZPKH 3IF1A 4LPYA 2NY1C 4UOW0 3H9SB 2EC9U 5D7IF 2VRAA 1G1YA 3VMPA 1Q9KB 2J5LC 3BZ4A 5SWSD 5J1AB 1KJ2B 1S5IH 5DRWB 4DGVH 1G7IA 3BEVB 3TO4C 2HLAB 5EOTA 3F7YB 4S2SA 4GLRH 3T8XA 4UQ2B 5C0IB 1JGVL 2B5IB 2XKNA 1HSBB 3UJTL 3CH1B 4NZTH 3V0WL 3CSYB 2P8LA 2NY0D 4RDQG 1V3MA 3QRGL 2AK1L 2V17H 3Q3GB 3RZCC 2HFFA 4IIQA 3WS3A 1PKQE 4I9WD 4H20L 4BFIA 2HT3D 1FH5L 3IT8D 5D1ZD 3CSBA 5D7LB 1IAIH 4WJ5A 4E41E 2I5YH 5LGJA 1FGNH 1AHWB 4M7ZB 1OTTD 3GSOB 1WT5A 3EYOB 5I75B 3NPSB 4YEEA 4JFOA 4Z0BL 4YE4H 2W0FB 4RZCB 3DUUB 4CMMA 4ZAKB 4Z7UF 5EN2A 3CXDL 4GW4A 5F7MC 1NGPL 4HIXH 3UTSB 4NZUL 4XNMB 4YUEH 4JG0L 3QUYC 4OZGB 1D5ZA 1S3KH 2R2BB 1HOCA 1RY7B 3P0VH 4OSUH 4KPHL 3BGFB 2HG5A 4PJFB 2LV4A 1JBJA 3PWLA 4R7NA 3VRLF 5D6DC 4HJGB 1B4JL 2ZUQC 1JGEB 2FNBA 5KVEL 1P84J 4PGJA 5C0CD 4H8WL 3MV8B 5HHNB 3KPLB 4JY6B 1T0NB 5ILTH 1MJJB 4KRMB 1D3CA 4L8SA 3BZEA 3GGWB 4YDJB 1I8MB 5D7IA 1HHIB 4JB9L 1RZKC 3CU7A 4OUUA 4WHYH 5T3ZL 1ZT7A 4F33A 4WUUE 5ALCH 1EEUA 3QH3A 4YPGB 4P2RA 1BIHA 1CK0L 3WNLA 4PJGF 4KJWC 1XMWA 4F9LA 3BEWA 3CVHL 1JFQL 3VWKD 3SGJC 5JPNA 1YEJH 2X5PA 3SHSA 1Y0LA 3HG1B 3MYJA 4HS6B 4U6VL 3NCBB 5FYJE 4Z78B 5KS9B 1S9WA 1F11B 2D7OA 3HKFA 1WQVT 3O4OC 4XAKE 5FV2A 3I3DA 4POZC 3VD3A 1CXFA 1J8HD 1KCUH 4U1KB 5ID1A 1ZKAA 2E9WA 1DDHA 3KJ6H 2VQUA 3NCMA 1OPGH 1G0XA 3BPLC 4HKXB 1BFOA 4PB9H 5TGBA 3VXSB 1NDMA 4HSQA 1TETL 3TIEB 1LHZA 5GGVL 3CK0H 2GIYA 2ILLA 2C1OB 2J6EH 2JCCE 3T3MF 3EHBD 4LPUA 3HI6L 4Z5RA 4OZIF 2EZ0D 1VEOA 1XIWD 2AJUH 2CXKA 3U30C 1AD9B 3DSFH 3NBNA 5BMFH 3V6OA 1RIHL 4NRXA 1R3KB 1CXIA 2WIIB 1Q94A 2A6JB 2VAAA 5IVOA 1KENL 2XPGA 4CVXA 1FO0H 4M5YH 5C0ND 1UWXH 5JW4R 2VLRA 4PRIB 1A7NL 1IT9H 2J12B 1S7QB 1UWXK 1TJHH 3RWIB 1FJ1A 5JOPE 3W82A 3HPJA 3B3IA 3AXLB 4K94C 2BXZA 1OGAB 3KPNA 4O58H 3V7AG 1FPTL 1ETZA 3WCYA 4ONHB 1BBJA 4X7EC 4Y5VB 1ZT4B 1MFAH 3T65A 3HI5L 3UCRA 1INQB 3THML 2CRMA 3VCLA 2HWZH 2YPKB 5CP3A 3DX8A 4PJBE 5JDSB 5I66B 1YDPA 1FZOA 3QG6A 2FX9H 4LGSB 3U4EB 1Q72H 4R7DA 1IFHH 1J7VR 1KCVH 3VMOA 3LV3A 3IFPA 3LQMA 5F7KC 3V5HB 3V7AE 1X6NA 5DO2C 3K4AA 1R3HA 2EH8H 3V4UL 3D39E 4HPOH 1YNKL 1KIQB 1CLZL 2HAZA 5DRXB 3KAAA 4KZDH 1H3WM 4K9EL 4E41D 4Y16C 1F90L 3GSVA 5EOQH 5IMOB 1RJCA 5D2NA 4DVRH 4Q6IB 4FFYL 1DQQB 4AIXA 1U2HA 5F9OH 3O6FD 1UXSB 4OZIA 1ORQB 2O61B 4J3WA 5JZ7C 3EYSH 1H3PL 1YC8A 2GEEA 3QFJA 5C0AB 4PTTA 1GGBH 3WL9B 1QKZL 5GRWA 3OB0H 4NO3A 4OD1L 1R0AH 5GSVA 1HXYA 5JIKA 1T2XA 3DX7B 3DHJA 3I9GH 3OB0K 1HINH 3Q6GH 32C2B 5FB8A 3AFLA 3EYUH 1SYVB 5GSRB 5BRZB 3MLRH 2MKWA 1YEIL 2CR6A 1Q38A 4MAYA 3H6JA 4NNYA 1T21A 1NGWA 3V52H 4YHKH 4PJ7B 3OWEA 4JJ5A 5C0RL 1B2WH 4HC1H 4NQUA 4KKBD 3VI4E 4R2GD 1JI1A 5I2IA 5DD5L 3TT1L 4HJ0D 5ESQA 1NKRA 2LU3A 4NN6B 5D1XB 4WUUD 4M8VA 4ZFZB 4G3YL 1CXLA 4QYOA 1LEKA 1O0VA 5GGRA 4KI5F 3T4AB 3E8UH 3SDXF 1I7ZB 3IAQA 4WEUD 4PY7A 4HH9B 2B0SL 1CL7L 4GW1A 3TVMA 1JTPA 1JWSA 5CBEB 5DC4B 3STZA 3N85L 1NCCH 2NY1B 5MEND 4Y1AA 5DK2B 5FYJD 2NY3B 4AEIH 5TDPA 2JTDA 4TTGA 3TO4B 3DV6B 4HUVA 1M1SA 2WW8A 3WE6A 5J13C 4XAKD 4R4FL 2ZOLA 2A6DB 3FAWA 1ZTXL 3QAZB 3C2AH 2HMID 1U8MB 5F1IA 5JHDE 3HI1B 1D9KD 4AG4L 1TQCC 2ESVE 2VZ1A 3RZCB 1IEAB 5IROC 5C07E 1LE9A 1VADB 4NHUB 1DVFC 2IADA 1Q0XH 2CKBL 4KK9D 2LU7A 3SKMB 1MCWM 5D7KD 2NY6D 3IDXL 3S96A 5C6TH 4G7YH 4G8FA 4MA1C 1E4KC 1G84A 2XWJB 2HVKB 1H0DB 1MHPL 3BZFA 4M62L 1N6QH 4NQCE 4X7FC 5EB9A 5J1SC 1IM3A 3TYFB 2BRRH 3U7YH 3LKNA 2Q7NA 5C9KA 4LPCA 2H6PA 5IW3A 3O9WD 4RBPH 2DL9A 5EWIH 5EU7C 3QUYB 4RBPK 1A1MA 5C9JB 1MFBH 1M71A 3OKNA 3WD5L 4WIQA 4KK5C 5BXFB 4PJHB 5IW6B 1LK2B 1OSZB 2QEJA 5KVFL 3QXTA 3DHMA 4MLIA 5BV7C 3PWNA 1PZ5B 2CQVA 2ZUQB 4EI6A 2GJ6D 2X40A 4KKAD 3R06A 4OJFH 3GRWH 3ZT5A 1EHLL 3SDXA 3H42H 2Z31A 3PG2A 5BZDA 5I19L 3RWDA 1A4JA 4NT6B 5LWYL 3G04A 4MQ7A 1K85A 5J3HC 1MCKA 1F4XH 3OQ3B 3AAZB 1PAMA 3PP3H 1MJ8L 2UVFA 4IIQC 1RZGB 1EK3A 3PP3K 3LKSA 2DQGL 3U0TB 1D6EB 1NFKA 3E6HB 3D39D 4WEBL 1ZS8B 5EO1A 3DGGB 2UWEA 3FB8B 3GK8L 2V2TB 4CU6A 1AD0A 3SGKC 2GK0A 4X6FB 4XZUA 5I1GH 4NFBA 3CIQA 4KGLA 4KJPD 3QIUB 3KXFE 3LQAC 1ZA3B 1A7BA 3RBSA 1A6UH 3F65A 1H3XA 2PO6B 4DGYL 2H3NB 4OGXH 3JV6B 3MLXH 4FQIL 1BVKB 1E0OB 5LGKA 4OZFH 4EDWH 2ITCA 5F7YC 4PJXE 2OM5A 5E2UH 4OCXL 2ORBH 3RKDD 5ICYB 1J9CT 1XF4B 1KB5L 4DJMA 1NEZG 3BPLB 4RISH 4KMQA 1FCGA 1IGTB 5E2TH 3D3VB 4R8WH 3KPSB 3M8OH 3U6RA 1RK1A 3X3GH 3G6JB 2NNAA 3IXAB 4EIGB 3CJJA 4G43A 1QSEB 1LEGA 4MNQD 1GPOH 3C08L 2VISB 4DKAA 2J8UF 4IOIB 3BT2L 4L8SC 1OAKH 4M5ZH 3VXUB 1JF1B 3BKYL 2ED8A 5F7DA 1M7XA 4R9HA 4PV9A 1N3NA 5FYLH 1WBXA 2VZOA 5L9DH 3JWDC 25C8H 3EYFA 2WZPD 4HUUB 4YXKH 4UQ3A 5I71C 3B8YA 3QDGD 4F9LC 4GMTL 3O6LH 4OCRH 1HH9B 1YMHB 1R24B 1YJDH 1PLGL 3S4SG 4EVNA 2HN7A 3KPTA 4OM0H 1GIGL 2IBBA 3PHSA 2EO1A 4NM4H 4FABH 3L7FB 1UZ6F 5ABDE 4U33A 4Y4KC 1QVOB 5FEBA 1X7QA 1AQDB 5E9DE 3DXAB 3QEGL 3NCJH 4R90H 4FFWD 5DMKA 1UYWH 1A6VH 4U7MA 1MRDH 5DT1H 5JMRA 5GGUB 3FFCE 1TQBC 1T6WA 2FH6A 5K9QG 1TTUA 1NANH 3ULVH 3FRPA 2ESVD 4BSWB 3FMGH 5IB4A 1U8LB 2YUWA 3O11A 4X9HA 5C07D 3IJYA 4MXVE 1JGDA 1OQXA 2VN4A 5GS0L 1F97A 1YUHA 2YD6A 4NM8L 2WSKA 1DLFH 2P44B 4LLQB 1INDH 4Y16B 3B2VH 4WCYL 3O2WH 2HT4D 1BLNA 3MCLL 4LQ1A 5CP7B 3G5ZA 2Z91A 4NQCD 4XVTH 4U4BA 2NXZD 2R9HC 3QIBA 3ARBC 3ABZA 5I8OL 1I1YA 1KJVB 1U95A 5T1MA 4Q0XL 5I8EA 3QWRD 1IAOB 3X12B 3MACL 3RWGA 4YDLC 1EFXB 2NY4C 3UJIL 3MO1B 3ZKMD 4X6CF 4Y0GA 4MWFA 2BFVH 2VXTH 1ZANH 5EZOL 3BRDA 3WNKA 5A2IH 4LCWA 3MNZA 4PBXA 5EU5A 3MV7A 4P23B 2R29L 1WEJL 1KYOK 2Z4QB 3QXVA 4ZS6C 3KVQA 2DQHL 2CLVA 2PTVA 3A67H 1J8HA 3ULUH 4UNVA 4MD5B 4YNYA 5T1KD 4N8VB 3EUUA 4WU7A 3L7EB 1GC1L 4D0DA 1ZXQA 4K8RC 2EDOA 3SPVB 1VKXA 2X4UB 3L3IA 2EC8A 3E6FB 1TVDA 2ZCKL 2O5ZH 4FQ2H 2F58L 1XIWA 2ZSWA 4M8QA 1FG2B 4K7PY 5FM5O 5FA3B 5JR1H 2R4SH 4CMHC 5LGHL 1J8KA 1F3JB 1CDUA 1AIFA 1F4WH 4E42A 2KQMA 1FVDB 4OD3L 1JRHL 1OAUH 4PRAA 3RVUD 1AGCA 3UJJL 1TZGH 4XC3L 3MRPA 2BJML 3B8SA 5E5UB 3KXFD 3ROLB 3MRFA 4JFHE 1R3LA 1LEIA 4QOKB 1U3HA 1BBDH 2Q6WB 5J13B 4K3JH 5F9WC 4NKQB 4R4ND 5ETUA 5EUKA 4ZS7H 5IJKC 1SEBA 2G9HA 1HHKA 1MLCB 1U8PA 3LKQB 1TQCB 2AI0H 2MMXA 4CU7A 1AJ7L 1WFTA 4LAJH 1NLDL 2AERT 4WW1B 4MQSB 4PJ5E 1OW0C 5E6ID 4P49A 1DVFB 1G9NC 1WBZA 3VXPB 4OF6A 5ITFA 2NTFB 4NPYB 3K74B 2GAZB 3HPLA 4X6CA 1XGYH 1NLBH 4MA1B 3RY4A 1CQKA 2GSIA 1J1PH 1ND0A 2FB4H 5EUOF 3EYQC 2EXYD 2W1NA 3JBG7 5D7JC 2W9DL 3CMOL 3TT3L 1ZHKA 4A6YL 4IMKC 3O3BB 5D71H 2YSSB 7FABL 2FIKB 3K8KA 3UYRL 3ESVF 2Z8RA 3VXTB 4S1RH 1R5VA 4PGEB 5ENWA 3I75B 1I7RA 5DJZA 5E8PA 3ARED 3ZYIA 5H94A 1I9RL 4AL8L 2V7NB 5GZOD 3HFMH 2PN5A 4XVUD 3VA2C 5BV7B 1FLRH 2DDQH 3DRTB 4LGPB 5E9DD 3RHWF 1HQ4A 2AJZB 2ARJA 2BVQA 5DMGD 3I50H 3PQYE 1TXKA 2VLJD 1GAFH 5GRXG 3OZ9H 1JZ6A 2IANE 1JZ7A 3PNWA 2IG2L 2XI9A 4URTB 1PYWA 3K1KC 2XIDA 1JNHA 3DMMD 4WHCA 1SBSL 2PYFB 3FFCD 5K9OA 1KCRH 1SM3L 3TBTB 4UV4L 4N1CA 2G60L 4QNPE 2V2WA 1H9VA 3Q6FB 4JO1L 5E1HB 4JRYB 2CIIB 2XWTA 5E4EB 4LMQE 1IILE 2EEBA 4XCFH 4UDUB 3QDJD 4K07A 2EEDA 5JNYB 1CD9B 5I1KH 5KN5A 3WUWB 3BQUB 3MLSL 4JQXA 2WBJD 3FCTB 1F8TL 3Q5YA 3S37L 4YWGL 3MODH 3ZL4H 43CAA 4N9GB 4EI5D 4EBQH 5I0ZA 1ACYH 4MSWB 4PRNB 1NCDH 5GS2H 2XACC 3VFSA 4B50A 3NCCB 2MQCA 4NC2B 1VCAA 1ZVSA 1ACZA 1K6QH 5EUOA 1CLYH 1GGCL 4FQQA 1FIGH 1PEWA 3SBWA 4WU5A 3OF6A 4F2MA 1HOCB 2OZ4H 5KSBB 5GHWL 4GW5B 5TPWL 4ONOA 4LSQL 2MCPH 4XCYA 4LHUB 3RVWC 1T7XA 5IEHB 3MRDB 2NY2C 5JA9A 1C16B 1A6WL 1MHEB 2AJVH 2EDLA 2UYLB 5BQ7A 3QYCA 3EO0A 3QPXL 4IMLB 4KI5C 5T3XH 1EGJH 4X8JB 2NYYD 1UXWB 3B6SB 4WFEE 3L95B 4HUWB 1R3JA 3MGTB 1C1EL 5I73C 1L0XA 4F9PC 4LKCA 1X5HA 1YQVL 3GI8H 3SKNB 3VXRE 5C71A 3FQTB 4F58H 3VFVB 5IIEA 1MCPL 4DGIH 5I71B 2R56H 2OQJA 1OT2A 1UJTA 3QISA 4Z8FL 2FJGB 1EFQA 3LEYH 1G0YR 3VRIA 5GISL 2WLZA 2I9TA 3X14A 4AT6B 1A7OL 1AXTL 2AXJA 1UH4A 4J23A 2PF6A 4Y4KB 1DBKH 4JHAL 3K4ZA 1IC4H 3RGVD 1QFUL 4JFHD 4HV8A 2X44D 4APQA 5I1LB 1G7PB 4JN1H 4HHAA 3QPQC 4ZDHB 1QOKA 1PG7X 4BZ2L 4MA3B 5B8CA 3ZHDA 5C08A 1TQBB 4PJDF 5E7FA 2X1PA 4Z7UB 4IDJL 4UAOC 2YA0A 3MFGB 4RWYL 2BMKA 1T7VA 4YR6A 4GG6B 1D6VL 1UB6B 2AABL 2UZXB 1BJ1J 5ADPL 4PJ5D 3FO1A 1HILB 4P4KB 4H88L 4G8GD 1J18A 2N1KA 5DRNB 3WIHH 4ZG1A 1AO7E 1A9EB 3TNNA 1G9NL 4MJ5B 5ICXB 2CUHA 4I8DA 3F7VA 3AROA 1GXEA 3KDMA 1TCRB 4ODUA 3HB3D 3VXOB 3VU2A 2ZG2A 2ICWB 1JGVH 3QCTL 3UJTH 1XT5A 3ARBB 3V0WH 3TFKC 2RAMA 1AXIB 1WCQA 3QRGH 1BFTA 2AK1H 2NY4B 4YDLB 1DQJB 1HYSC 4X98B 4LOUD 3TCLA 3GBLA 1CVRA 4H20H 4P5KB 3GSUA 1FH5H 5DURD 2HJFA 4PJGB 2P8MA 4YDIL 4HIEB 5JTWA 1LK3L 3GMLB 4Z7WE 3PQYD 4Z0BH 1NFIA 2EE9A 3MOQA 3LHPL 3L3JA 1F3RB 2IAND 3WKML 5DDHB 1MQKL 3CXDH 4FXKB 1NGPH 1NC2A 3HMWL 3V9FA 5JOFA 1IARB 5DGQA 1NFDF 4PRHE 2ITDA 4NRZA 1JNLL 4JG0H 5CLTA 5IHZB 5I16B 3P0YL 2JK5A 3FQRA 4KPHH 4CMHB 2Y1VA 2E3VA 5DJXA 5HYSB 5D2LE 1FZMA 1IM9D 2DYPD 1NCAL 4DFIA 2GCYA 1BPVA 1B4JH 4WHYG 1XR9B 3FONB 4H8WH 3ZO0A 5BS0E 1ZA6B 5BZWA 4OLVL 4HWZB 4JREC 3EOTL 3S3JA 1FL6A 2Y7QA 1KTDB 2IFFH 5JXED 3DJ9A 3GMMA 5F9WB 1CF8L 5HHPA 3SE8L 4JB9H 2IPKB 2YN5A 2APWA 5T3ZH 2DKSA 4XGZA 5ESVA 1RJZB 3TBYB 3LH2H 3HZKA 1CK0H 5FGSA 2P48B 3LD8C 2OXHA 4R97B 4YHOL 5T33L 4NQSB 3CVHH 1JFQH 2P5WE 4QRSA 5HVWA 2YEZA 1QLFB 3HUJE 4H0HB 5EO9A 5B39A 4NQDB 4PJCB 4PP1D 4ZXBD 1I3GL 4WFED 3LEXB 5IF0A 3IKCB 4U6VH 2H2PD 3SQOL 4G42B 1BD2B 2E8ZA 5TQ2L 4YHPB 5A3IC 1UEMA 5JHDA 3K3QA 3O4LE 5D7JB 3KNBB 2DQCL 3VXRD 2VQTA 4WTZG 2DAVA 1A7QL 3SGEH 1IEBA 1MVFA 3KPMA 4QRRB 4YC2C 3CGTA 3WO3B 1NUFA 4L9LB 1TETH 5GGVH 3GKWL 4PJXF 1NFDA 3K7UA 5DJ2A 4X6DE 4U1IA 3FOMA 4ETQA 1CFQB 3HI6H 3QXAB 2K3TA 3EIFA 4YHIA 3T1FB 2VITB 1U8KA 1II4E 4N9OB 1T5WB 3F5WB 1RIHH 4X7TA 2P24B 3UC0H 3DWTA 3A6BL 1C5CL 1KENH 1KACB 4TSAH 2NXYC 1G6RB 1A7NH 4M6NL 4P5TA 2EICA 1ZHNB 4F8QA 2FDBP 4OKVB 4J3VA 3ZKSD 4O9HL 1MI5E 4GH7B 2VXQL 1QLRB 5HI5C 5T1KA 3DSNA 4IOFC 4EEEA 1FPTH 4HFWA 4JFYB 3OHXA 1FG9C 4PS4L 1T4KB 5DFTA 3V6FA 1JHKL 3T0WA 3HI5H 3KPQA 1XGUA 2J1KA 4FG6C 3THMH 2AXFB 1MH5B 1NDGB 3PWPA 2JJVA 4B53A 4JM2F 5H35B 2YUXA 4PV8A 4LARL 5TDNB 4XPAH 2F54A 1G7JB 5EU6D 4EQ3A 1RI8A 3CUPB 5E8NB 4CN4A 1MEXL 3V4UH 5FO8A 2NY2B 3KXFA 1YNKH 3WN5A 3SDCC 1CLZH 4Q6YA 3C09C 4K9EH 1F58L 4R3SA 2VLKA 1I1AB 4A2MA 5KVMC 4HPYL 4R96B 2A73B 3EYVA 3SDYL 4FFYH 3HNSL 4PJXA 4ORGA 5I73B 1ED3A 1JWUB 3G5YB 5MEOB 3VD7A 3G6DL 4QTHA 5INDA 2VDRL 3WFZA 1XGRB 3S3PA 4U1JB 1H3PH 5DHVB 2X42A 3WXVL 1QKZH 3SKUD 4OD1H 3NIGF 4TSCL 1GL4B 1ZHBA 4MD4B 2EDEA 3IDJB 4X80L 5F1SA 3JWNC 5FGCB 9CGTA 1ERNA 4KXZI 4U1HB 3NA9L 3OXSB 1PD6A 2DQUH 5JMOC 1N2RB 4HXBL 2A83A 4PTUA 5CINL 1BZ7A 2DS4A 2RR3A 4JAMA 4KK6C 1TVBA 3U7WL 3IJHB 2VH5L 5CJ8A 3EO1B 4ZUUB 4Z0XA 4KUZL 4HZLA 5C0RH 1UB5A 5DJAB 1V3LA 1A6TA 3VFUB 5DD5H 3TT1H 4MQTB 3PV7A 3QEUB 4UIKL 1D5XA 1KTLB 2ADJA 4JM2A 4G3YH 1HXMB 2BSTA 4KTDL 3GEWB 3QUXA 2R2HA 3BGMA 3UTTE 3VXMB 5D1QA 4NDMB 5FO9B 2P5WD 4G6FB 4GBXB 3U4AA 4ZYKA 2B0SH 1CL7H 3ZKXC 4P57B 4KTEL 3N85H 2OCFD 3DMMA 4ZSOA 1NAKL 3BXNA 3DROB 5C2UB 1N3NB 2QQQA 1UCBL 3G5XA 3O4LD 2BC4A 5EORL 1QFWH 5B3JE 4R4FH 1B6DA 4AJ0A 5DJYA 4X4ME 1M6OB 4NRYA 1ZTXH 4PBVC 1KBGL 2JIXB 3VFOA 1F45A 3GBML 3GHEL 4G6KL 4DOHB 4PJAB 2EDJA 3LRGA 1G0DA 1RZ8A 4L4TB 4Z7QF 2VL5A 2OR7A 2WBJA 2BVPA 2CKBH 3IRZA 5ANMA 4C83B 3IDXH 3WLBB 4NYLB 4Y8AA 3SDAC 4OD2B 4IRJC 4J4PC 1IC1A 1I7UB 1MHPH 3L1OL 4M62H 3OGOE 3PGDA 4HKBB 3RL1B 1UJ3C 1P7QD 4X5WB 3FN3A 4M43L 1WVZA 5IOPB 5BW7C 3RFZC 1DQML 5E7BA 2MHAB 1JGLL 4OLZL 4DZ8A 1GZQA 3QI9B 3GIVB 5DFVC 1UVQA 4E5XA 3C60D 3WD5H 3MLPA 1GOGA 5JIPA 2YN3A 4TVPE 4LBEB 1S7RA 4UMGA 4FQXA 4I48A 5KVFH 2D9CA 3WLWD 4N5ED 1FL3B 3GUTB 3LSOA 3TNMA 1INEL 2FLBT 3B9KC 1EHLH 1U93A 3EOBB 5I19H 4JREB 3JVGA 5T1LD 2J8UB 4RFOL 4WNQA 4OFPA 5LWYH 3QEQB 4FOMA 4XTRC 1GRWA 1CWVA 1I8IA 4KRNA 1MJ8H 3GB7B 2P1YA 3GMPB 4PRPE 2XQBH 5D93C 2DQGH 3LN9A 5L2JB 3LD8B 1LO5B 2E7HA 4WEBH 1U42A 2W38A 3M17A 3TEUA 3ZDXF 1SYSB 1HKFA 3RGVA 1CLOL 4TYUA 5IV2A 5EC1B 3L3GA 4O2CB 4OZFG 3EGSA 5DHYA 5C0BB 4RMQA 3RTQD 5CD3A 1JZ2A 4UU9A 1AR2A 1T89C 4D0DB 2ZOKA 4KRLB 4DGYH 1ZGLB 3M1BB 1EHNA 1ZGLM 3VJ6B 5CLWA 1FFOB 2X4PB 3CLFL 4JPVL 5LQBH 4OCXH 2APTA 3GMOB 4AM0A 3P30L 1KB5H 1WC7A 2ZZUT 5HHME 4AYFA 3FZUC 4KDWA 4LNRB 1JMZA 2X1XR 3GJFA 4JLRA 4JFEE 4KKLD 4PJIB 3T77A 4ZUVA 3C08H 3K0WA 1MWAB 3RI5K 3BT2H 3NCEB 12E8L 1F4AA 3SY0A 4HAGA 4G9FE 1P4LA 3KWWA 3WSQL 1JK8A 3BKYH 4NQEE 1P2CB 4L3EE 2Y5TA 4NP4L 2NXYB 2YOCA 3LKRA 1NBZA 2I60L 5FYLE 5I1HL 3B2UD 4RQQA 3VGEA 2AXHA 1AGBA 3BP6A 4GMTH 5D5MF 1RZFL 2YD1A 3UTTD 5TQ0L 3PL6C 3DRQA 1W0WA 3PDOA 3KG5A 3TBVB 2AK4E 1AGFB 1EH9A 3BSZL 1BWMA 3KLSA 4NQTA 3IDNB 3LMJL 3TC9A 3QEGH 5FCUL 5T5NG 2APVA 3GMQB 3QJFB 4KC3B 1IGYA 5IB3A 2GITA 1FYTB 4POYA 2Y06L 3D48R 1BOGA 4Y4HA 3O6MH 2VDNL 4Z7NE 5E5MA 4N0UB 4XWOC 5GS0H 3SDCB 2D7PA 3C09B 5J56B 3FB6A 5JXEA 4WCYH 1U8OB 1CGUA 5EZLB 4X0KB 3MCLH 3CFBB 1AKJA 3GKZA 3X13B 4MXQD 1OTSD 3D9AL 4WI4A 2H2SC 2GT9B 5K9OB 3BO8B 4QXGH 2OBGA 1MREL 3V95A 1QRNB 5I8OH 1KT2B 3QXDB 1BREA 4Q0XH 1TZHB 4OFYD 2Z93B 2DQDL 3MACH 3WHXA 3UJIH 1Q9OA 4CN6A 3S5LA 4TVPD 2OSLB 5EZOH 5F6HJ 1OLLA 4W6WB 1M7IB 2XNAA 2R29H 3LAFA 1WEJH 5GRYA 1I4FB 1NCWL 2DQHH 1YEFL 1IGJA 4U3CA 2E6QA 3B83A 1FGVL 1R5WA 4ENED 3BWAB 1LO0L 2DLGA 1GC1H 5DUBA 2FO4B 1JPFA 3JTSB 2PXYD 4XPTL 2C7UA 4PRPD 2ZCKH 1J0KA 2DQTL 3WN5C 2F58H 1QR1A 1YMMA 3HE6A 2DF3A 5IFAL 5LGHH 2BY2A 2BY0A 4ACPA 3QDMB 4OD3H 2YPLD 1GHFL 3UJJH 1BIIB 3JTTA 4XC3H 3P11L 4PLKD 2BJMH 2Z35B 3TZVD 3FFDB 3MA9L 3QZWB 3JV0A 1NC4B 4PG9B 1T1XA 4YGVA 3RDTD 1KF9B 1U58A 3LQAH 2ZNXA 1YZZA 4LPTA 3F12A 1IGCL 2EIZB 4FQ1L <