4AZ8A

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
230
structure length
185
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPAGARNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
total genus 34
structure length 185
sequence length 230
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A02
5DJYB 5CCKL 1IGCL 5FYLE 2R2HB 1ZE3C 3JWOL 4J3UA 3SKJH 5E4EB 3L5XL 2FEDC 4KKLC 5CMAA 4U6HA 1JMZA 3G5XA 4UV7L 1NPUA 4UTAH 4ODSL 3EYOB 2G2RA 3B9KD 1KTKE 3DVNA 3KYOB 4HGWB 5AUMB 4KV5E 4S2SA 3RU8L 5F3HB 3NCYS 4IRJC 1JE6A 3MRQA 2DQCH 2R0WH 1OARL 3V6OC 2X4SA 5C07D 3ROLB 2IBBA 1W0YT 4GQ9H 5HYJD 2WINB 1K4DB 2XKNB 1HI6A 5T1DL 2ZCLL 1AE6L 3BJ91 1ZHBA 3DUSA 1U8OB 1E27A 3HG1E 4PGEB 2Z8WC 4ZO9A 4GBXB 1HDMB 3U1SH 5ESVA 5A16A 5I1JL 3B9VA 1LEIB 1J1XH 2KQMA 4L1DA 3RBGA 3HG1B 4FQIL 1CFNB 4YC2C 5ADOH 4GSDL 1ZLVK 1NLDH 3ULUD 4YDIH 3SDXF 1T4KB 2X4OB 1KELL 5JW3H 2YZ8A 5GJTL 4WW2A 4L5FH 1UEMA 4XPBH 3DV6B 2UY6A 2NZIA 5ITFA 2KQNA 3WO4B 1A0QL 4NO5B 2JELH 1I1YA 1U9KA 3LQMA 5I71B 4XCEA 3B4NA 2QHRL 1OY3B 4ODXA 3LRHA 1K3ZA 4ZO6A 4F37F 4E42B 4DKFH 3BQUB 1L7TH 3F7RA 4F33A 4U1GB 2QJDA 1P6FA 3UDWC 4I13B 2CMRH 1YEIH 2GTZA 4YHPA 3EOBA 4K55A 1JV5B 1WISA 4MJIB 1PSKH 4JN2A 1PG7H 4X5XB 1QSEE 1T04B 3I2CL 4KK9C 5D9SB 4PJHF 1IM9A 3NCMA 1YNLH 4AG4H 2WWKO 2VL5A 2ENSA 3MLXH 2R69H 3DRTB 4GBXC 4WNQB 5E5RB 5IOPB 4OZFB 1QSEB 1EO5A 4IMLA 3OMZA 3T0XA 2VZ1A 2V5SA 1WEJL 3T2NL 3BWAB 1N64L 2QL1A 1G9NC 3I6KB 4PV8B 2PO6D 5C0FA 2IC2A 3V5DB 1NGWA 1ZSDB 1LK2A 3C6SA 2JB6A 4S0TD 1PLGH 1RPQA 3I9GH 1ZHNB 2X5PA 3QIWA 3WO4C 5DEGB 3T0VA 5MEPB 4RA3A 1N3NB 4OLZH 5I71C 3GMOB 1MNUH 4ZG1A 4Z7UF 5D6DC 3QI9D 4M6MH 5IB5A 3OKLA 5HY9A 4Y4HB 3GIZL 4ZSOE 1FG9C 3RGVA 5F7DA 2XICA 3WIFA 2YD7A 3WIHL 4PLJD 1NFDA 4ZSOB 4HIXH 4CU8A 5DD6A 1JZ4A 3O9WB 3N85H 4YHLH 2ESVE 5F89B 3QEUA 3AB0B 3NIFF 1IEBB 4K3JH 3MBED 3GBLA 4NKIL 2XQBH 1MAJA 3NCYP 4L9LA 1GGBH 5DK2B 2P5EE 4LCCA 5BS0D 4LLYA 3OXSB 2D31B 5HYSG 5CEZH 1B9ZA 4GW1A 2P5EB 4YGVB 5CD5D 4KJYA 4NN7C 2P8MA 5LKNA 1DVFB 4XPHL 2FO4B 4NHUB 3PGFL 4FABH 2W9EL 4HKXA 3ZDXE 3VFMB 5BOPA 3CDGB 4OZHE 4HWNA 4S1SL 3G08B 4GKZA 3ZSTA 1EJ6A 1B0WA 1XR9A 4XGZA 4QO1A 5GIRA 1RUKL 2HTKC 2ZCKH 3QEGL 5D2NE 4AZ8A 1DBJH 1PQZA 2FBJH 4OZHB 4S11A 4ZUTB 5GS2D 3C60D 4CVZA 4DEPB 1B0RA 1NAML 2V7NA 1FRGH 3W2DL 1FNLA 2VXTL 4UZGA 5D2NB 2E9JA 2APWA 3RNQA 3U7WH 1MLBA 5GGQL 5D7JA 4UOW0 4N0UE 3ZE1F 3MSPA 1ZVSA 3NCEB 1KJ2H 3IDJA 1MCCA 3CVHL 1ORQB 4NO2B 3GGWB 2BOBB 1XF5A 2EO1A 4YBHA 2AI0L 1JFQH 3Q6GH 5BOZG 2ARJQ 3MRGA 3HC3L 1IM3B 1T89A 2HT4C 3ULVD 3EYUL 4UDUA 1G0YR 4YR6B 3V6ZB 1FHGA 3G6DL 5DFWH 4OZGF 1QA9A 5ID0A 4FHBD 2APTA 4M5YL 5T1LB 1E4WH 3QIUB 1ZLUH 2A74A 3V2AR 1I7UB 4WI6A 2VDNL 2PXYD 4LIQH 4PP1C 4WI8A 4NQTA 5CJOL 3K4DA 4JY4B 4ODWA 4RIRB 3RI5F 1GH7A 4QXUL 3RIAF 3VXSA 3VU2A 4DEPC 2OL3A 4MAYB 1VFOA 4TPRL 3RIFK 5B3JE 4ZFGL 2WBJA 4NNYB 4CMHB 1A2YB 5I1AB 1MCPL 3K2UH 1HCFX 2ICWJ 3MOBL 1JHTB 3PABB 1NGXB 4ODHL 2Z92B 1MJUH 2OCFD 3RZWA 2AABH 1H0DB 4K9EH 5FIEA 5B3NA 1M6OA 1U8KB 1Z6JT 2F54E 3WFDH 4NT6B 2HFGH 5I1HH 3LPGA 1BFVL 1UJ3A 2BOCA 4R0LB 1JK8A 1Z5LB 2W9DH 3RPIA 3T0AA 2DJ4A 1PZUB 2OMBA 1KEGL 4PY7A 1MIEL 1TTGA 2VWEE 4CAGA 5ISZA 4LFHG 4U6YB 3C8KA 4UDTA 4OIAA 4ZQKB 3HG1D 2ITDA 3BZEA 1UWEL 1MCWM 1F00I 3GSUA 2ITCA 3WNPA 3QIUC 3CAFA 1V5JA 3GSOB 3V5KA 2A6KB 1MCQA 2EC9T 3SDYH 3T4YB 1PVHA 3QCTL 4HIIB 3WHXA 1H5BC 5FKAA 1S78C 1FZKB 2EDXA 1OAQL 1KNOA 3I6GA 4PGDA 4FS0A 1I1FA 2Q1EA 4CMHC 3GNMH 2R15A 4OFYA 3AGVA 5FF6B 3UTTE 1YEDA 3P0YH 4JFYA 4G3YH 4N68A 3A67H 3P9WB 4Q6IA 3X13A 3HMWH 5IEKA 3UTTB 3V0WL 3GUTA 2UWEF 3UTOA 3TYFB 1UACL 2VZSA 1JP5A 3GO1L 5IFJB 3OKKB 4ONFH 4R0LC 1TZHA 4ZS6C 5HDBE 1F4AA 4W70A 2V5MA 3KWWA 2B2XL 3QJHB 3QJFA 4GXVL 4YDVB 3FB7A 5IBTH 1R6VA 4K3DL 4O2CA 1CL7L 5I76A 1OCWL 4RGOH 3MPCA 1KB9J 5T3ZE 3V7AE 35C8L 4PRPE 5MERA 2LAGB 1T1ZB 3TIDA 4RAUA 3QEQE 3DVGA 4CDHA 4CNIA 1QSFE 3T1WA 3MYJB 1WJ3A 3B8YA 3FO2B 4DZBA 3KPRA 4PD4J 1X5ZA 2EDKA 1EMTL 1C12B 4IRJA 1QEWB 5D71H 3QEQB 1R24A 1QSFB 4NFDA 3V6OA 1MIML 2FCBA 3DYMA 4HK3N 4M43L 1CDHA 4MAUH 5ALCL 4C83A 3EHBD 3BE1H 3FAXA 5E6YA 1WBYB 2N56A 5T3XL 3S36H 3IU3A 2W60B 5E2JA 1T03H 3PXHA 5KAQG 3BZFA 3BD5A 5TE4L 3FQTB 1QFOA 5DA4A 3U46A 1NUDA 2OI9B 2DQUL 2ZCHL 3MODH 3S35X 3O2DA 5JHLL 5HHOB 2VDOH 4H26A 4R4FH 4KQ3L 2X1WL 4OT1L 1HCVA 2WUCH 2ESVD 2VIRB 3SGDI 2NCMA 3FQWB 1D5XB 2R56H 3HZYB 1VPOL 3E8UH 1JYXA 3KPLA 1S7SB 4LPWA 3LKNA 3WD5H 3FQRB 3OHXA 1X7QB 4HKJB 1S9WA 3O6LH 3P9MB 1EGJA 1NAKH 3EGSB 3BPCB 3HRPA 3IFNH 3KYOA 1WITA 5AUMA 5D1XB 3UDWA 1JYVA 4I18B 4JQXC 5F3HA 4JM2D 2NY1C 5EU4B 2YD4A 2DLEA 2QHLA 3K7UA 3D85A 2WINA 5LWYL 4PPTA 3S34H 5B38A 1T1WA 4QTHB 5GJSL 1U58A 1U8OA 4PGEA 3SDCB 4KU1A 1XAUA 4IBLT 1BAFH 4GBXA 1HDMA 1D9KD 1ODAA 4PJFB 4QYOB 4FTVB 1BIIA 4D2NA 5I30L 1INEL 1T4KA 3IDMB 3NFNA 1U6AL 2FH8A 3CSPA 1KG0A 3QDGD 5E03A 3UP1A 4XHQA 4LL9A 4UV4L 4JFPA 3OKMA 2COQA 1ND0A 2XTLA 4XPFH 5E8EA 2NY0C 4JCLA 5EN2A 1BHGA 4LP5A 3FN0L 2EE3A 5D6DA 1NBVH 4E42A 4U2ZA 1MQKH 2MPAH 5LXGH 4NKDB 5D1XC 1QBLH 4LP4A 4ENEC 1RVFH 4I18C 1EO7A 3V4UH 4HFUH 4DKDC 1GAFH 3EFDH 2RFXB 1JV5A 3BESR 5LGHL 2QR0B 1C5CH 3CJJA 4MJIA 2FX8H 4FP8L 2ICCA 3VDCA 4ZNEA 1AP2B 3RVWD 5GRUL 2R4SL 5E70A 4PJ7B 3MREA 4J3WA 5IOPA 2H2PD 2KDGA 4TULH 3OAZH 1AY1H 8CGTA 4YDLB 2BY0A 5D4QA 3WJLC 3CD4A 3MLUL 2C1PB 1SYSB 1IAIL 1KIQB 4NRXB 4D9QD 4CJ1A 4HWEL 5GS0L 1S7WA 3MCKB 1QOKA 1O7VA 4JGJA 3LH2L 4RFOH 1YMHA 1P84J 5EC2B 5JDJA 2XFXB 2A6DA 2BCKB 3NPSC 4KRNA 4Z9KB 1MAKA 5DEGA 2APFA 3SGEI 1DTUA 5MEPA 2YPLA 4KMQA 1QKZL 4FFWC 2F53D 3U4BL 4HJ0D 2F54D 4QHNA 5DVNA 1MLCB 5EZJB 4FXGB 4TSCL 3B9AA 3RWHB 5J9PB 2X7LA 1N5AB 4GRWH 4CL7A 1K8DB 4M5ZH 2H9GA 5EU7E 4LDLB 2UUDH 3VFGH 4ALAL 1W72L 5IP4A 3DIFB 3BP5B 5F89A 3GBNL 4PS4H 5L0QC 4HS8H 1HYSD 4KROC 1UKQA 4IRSB 1IEBA 4K94L 3Q1SH 1FBIL 3B3IB 4BZ2H 4EI6B 1A9EA 3MC0A 3UBXI 2CKBA 5DK2A 5I8KH 3DMMD 3VXRB 4ONHB 4WHTA 2D31A 2H2SC 1ORSA 4Y5YB 4GXUN 4W4OA 4YGVA 4OQ1A 4KPHH 3UTQA 3D3VA 1OWRM 4PTUB 3RA7H 5IR1B 4L3EE 5BZWB 4LASH 4NN5C 2H26B 1LDPL 4YE4L 2WSKA 3VFMA 5JPMB 3B2UD 4C59B 4FRWA 4YWGH 1IGIH 3L3JA 5KVEH 3ZMRA 4F7CA 2QQKL 3FB6A 2VO5A 4FQCL 3LSOA 4HAFA 5EH1A 4WI4A 4ZUTA 2HG5B 5TE7L 2I24N 4H88L 1YEKL 4X7DC 1V3LA 3ECBB 2AXJA 3MRLB 2YOCA 4YQXL 2V9QA 4HUUA 1X5XA 4AMKL 5KAQF 5DJXA 5C3LD 4BFIA 3OJDA 2ED8A 4O02H 4U1LB 2Z4QB 4I0PB 5T3ZD 4HXBH 1RJLB 4NO2A 3HS0B 4PRPD 5D6CB 3GGWA 4NBYB 3TYGL 1PG7X 3EOTH 3F62A 5CBEB 2IMMA 1QSFD 2ZUUA 4J8RB 2V2XB 1JPGB 3B9EA 3BN9C 4NM8H 2IAMB 2XKSA 3MACH 3GI8H 4Y5YC 4P46B 5FO8B 4XCFH 1X5IA 4Y1AE 5DC9B 1GGYA 4BYHA 5J6GA 1UB5A 3HZMB 1R0AL 2G9HB 3OAUH 4YR6A 4L8BB 3V6ZA 3BH9A 5CILL 1RUPL 2NX5E 5T1LA 5E2VL 1MREL 3D2UA 3QIUA 1OL0A 4WFGE 1YQVH 1GZPA 5DEFB 1MHHB 2FB4H 2NX5B 2G60L 3OF6D 4JY4A 1H5BA 4RIRA 2EO9A 4TUJA 4JHAL 4MZ2A 2MHAA 4MA7H 4JO2H 4PFEA 1A2YA 5HI3D 5C8JB 2QSVA 2KH2B 1JHTA 1ERNA 4G9DA 4QOKD 4X4YB 1KLGA 3PABA 1NGXA 3O3EA 3UXFA 1U42A 4ZNCD 1G7JB 1GHFL 2NY5C 4I0PC 4DQOH 3TNNA 3CU7A 1K85A 3TWCL 1CL7I 2VTFA 1ZXQA 2X89D 3CCHB 3RRQA 3FOMB 5IVXB 4R0LA 3STBA 1Z5LA 2IAMC 4UNTA 3RL2B 4P46C 2ERJB 2BP3A 1A14H 2EZ0C 1EJOL 5C09A 2AS5M 2HJFA 1I4FB 3QO1B 4XZUA 2AJUL 4ZQKA 3QWRA 4ZUUA 5HBBA 1UZ8B 4WTZA 3QDJB 1HSBA 5TFSL 1MH5A 2ICEB 2A6KA 2VAAB 3MLYL 1MFAH 4HIIA 1KB9K 4E41D 3X3FH 1RZKC 2NY4D 4OCRH 1FZKA 1SMAA 1YPZE 2D03H 3WE6A 2J2ZA 1HQ4B 2BVUA 2Q7NA 4PD4K 4YUEL 5CGTA 1MFDL 4NDMA 2XA8H 2F74B 1FL3B 5FEBA 1DLHB 2YA0A 3GSNL 4WU7A 4Y19B 3PHOB 1S9YA 3TYFA 2PUQT 3EO9H 3HMXH 3MLVL 1NSNL 4KK5C 1BVKB 4OQTL 4XNXH 3OKKA 3OX8B 4PJBF 1FNHA 3NN8A 3V8OA 4YHZL 4YXLL 4MNQA 3QQ9C 2Z9TA 3BW9B 2J5LB 2VH5H 4M7LL 1ZGLB 5I1KH 3MLWH 3IFLL 4J6RL 5KVFL 4YDVA 4FFVC 2OR9H 4H25B 2JK5A 1JYWA 5F7EH 3WDIA 5D70L 1DN0A 4R7DB 4FG6D 4RRPG 4G9FB 3RWCB 2JF1A 5MEOB 5EBLB 5SX5K 2WAHA 1TNMA 3C5ZD 4R96A 1CU4L 4YXKH 4ODVH 2H1PL 1BBJA 5A1AA 4Q6YA 1UM4H 4ODTL 3NH7H 3FO2A 4JPWH 2DTSA 4MHHG 4JQXA 5IMLB 1SBBA 5FM5O 5C86A 5JLZA 1BJ1J 1Q9OB 1R3HB 1AJ7H 1QEWA 5BCAA 3EYVB 1TITA 3HE6B 3OGOE 1GC1L 4PRAA 3LKOA 4DTGH 4PGBB 1ZS8A 3CFCH 2BVQA 1XZ0A 1WBYA 5GISL 4FXKA 4L4TA 1Q0XL 4LSDA 2NR6C 2Z8VC 3BD3A 3MLTB 5DGRA 5JXAL 1WC7A 2C4XA 3FQTA 3NZHH 3TT3L 5FFLA 4Z95L 2N7BA 3UTSD 3BKYH 5DI8A 5HHOA 4IRSD 3RWIB 3ARWA 1KPRA 3DXAD 1AR1C 3Q5YA 2BSSB 2J5LC 4L8DB 5IG7A 3TZVC 3EUUA 1AO7A 4F9LC 3BKJL 3MFGB 3KLDA 4R9HA 2H6PB 1DQMH 3FQWA 4EQ3A 4WY7L 1DE4A 2V9RA 3HZYA 4NP4L 2AW2A 3E0GA 4NGHH 1S7SA 2GJZB 3PGCB 2Q86B 4KKNA 1B4JL 2LABA 1X7QA 1FGVL 5CJ5A 3P9MA 1CD1B 3EGSA 3IU4H 2CIIA 2EDYA 5IW6B 4KJQC 2AJXL 3O6ML 5D1XA 8FABB 3K8KA 4OJFL 3SCMC 4I18A 1MEXH 2A9MH 3HAEA 3FMGL 1YY8B 5C9JB 1IAII 1AD0A 1ADQH 4L3ED 5B4MC 2A83B 4C56B 1YN6A 5JHDE 4CBPA 1FN4B 2GCYB 4QTHA 2YD1A 2X4NB 4ZAKD 5F8RC 3HNSL 5IQ7L 3MBXL 5JUEH 4DKEL 4HCRL 3GMLA 3WJLA 3MNVB 5HHME 4TNVF 1PGRB 4PJFA 4FTVA 4LF3B 3WCYA 4B53A 4U49A 2BRRL 5FB8A 1RJYB 3L3DA 3ROOA 3ULSB 5IB2A 3IDMA 1V3JA 5CKGA 4MJ2A 3JWOC 1DQTA 2F5AL 2YA2A 5HHMB 3DUHA 4YZFF 3W11D 4RA0C 4HJJL 5ADPL 3OKEA 2ZJSL 1UZ6E 1P84K 1HK6A 5FUOH 1TZGH 2DQGH 7CGTA 3DHMA 3PL6B 4RISL 3D25A 1YJDH 1MCKA 1NCDH 1CR9L 3OKDB 1T0PB 2WW8A 4EJ1C 1YEJH 4Y1AD 3GRWA 3MUHL 1YEEL 4AENB 5KSAB 4GRLD 3VXPB 4Z7NE 4UQ3A 1AP2A 2NX5D 2DKMA 4ZFOL 1OM3H 1Q72H 2YUVA 2W0LA 1TETH 1RULL 4PJ7A 4PRNB 3K1KC 5A43C 4WFGD 1YUHB 4WFED 3FRUB 5KSBF 4PLNC 3OZ9L 2GYSA 2QEJA 3Q3GB 5D5ME 5I1EH 1BQLH 1LO5B 4XCCH 2NPLX 1KIQA 4NRXA 3QHFH 2JJTC 2EDLA 1FDLH 4Z7WB 4RMUA 3GSQA 5D5MB 3P4NB 2FR4B 1MFEL 2XFXA 4NPYB 3I02B 2CLZB 5KVMC 2EEAA 4Z78B 1PX3A 2I07B 3SE8H 2OBGA 3PL6C 4OV5A 5K9JH 4OFIA 4I5BB 4IOFD 4NQCA 2C3VB 1TLKA 3NAAL 4XAWL 3ETBF 1I1RA 3RWHA 5J4MA 3BO8A 1N5AA 5CLWA 3IKCB 4N8CH 5IHLB 1A7RH 4OLVH 5A2LH 4MDJA 4XC3L 5KSAC 3BFOA 1JCKA 1G7HA 4WJ5A 2VLJE 3DIFA 2E3VA 3BP5A 4FQPA 3VI4E 2PO6C 5I1CH 5C0CE 2VDLL 5IMOB 1OP9A 4LHJB 4OTXH 3O3AB 5FHBL 4EI6A 2VLJB 4RDQG 3PDGA 3MLZH 4WHCA 5KS9A 2XZQL 5C0CB 5J1AB 3MQIA 5E08H 3VXRA 4ONHA 3S4SB 2BDNL 4HDIA 1G6RA 1GRWA 3QI9C 1F6AA 4IRZH 4Y5YA 4HH8A 1RMFL 5DXWA 4R90L 3LD8B 4PTUA 5IR1A 1QFUL 2FHFA 1OOAA 2H26A 5GGRA 3SE9L 2OK0H 4MD5A 3U9UB 2APVA 4I2XE 1T21A 2OQJA 2YPKB 1XGQA 4FQ1L 1T1YB 4XVUD 4U7MA 2EECA 1NAMB 3MBEC 2VXUL 4D3CH 3VE0B 2HG5A 1FO0H 1A7PH 2RB8A 3S96B 5H35A 3F6IA 5F21B 3MRLA 1BM3H 5J56B 3CVHB 3O3DB 2J8HA 4KVCH 5CD5C 4WW2F 3SKOA 4RQQB 2L7JA 2B20A 4U1LA 3RX5A 2Z4QA 3LN4B 3G5ZA 4I0PA 4NO0D 4NZRH 3HS0A 5D6CA 4GFTB 1HHHB 1RJCA 3UJTL 1DBAH 1BZ7B 2HFEB 5CGYC 3SN6N 2V2XA 3HE6D 3JBG7 1G7LB 3V95A 4YBQC 2FL5B 3RAJL 1VEOA 3MA7B 2IAMA 1YMME 4NKQB 2D7QA 4P46A 2UYLA 5FO8A 2ICES 1FAKT 3UBXB 2Q87A 5AAMA 3QQ3B 3HZMA 2BJMH 2EDFA 1FQ9C 5DD3L 1YMMB 4L8BA 3WXVL 4JFHE 1P4BL 1XCQB 5F6HJ 4OGYL 5FYJH 2NY6D 5AYUH 3KNBA 2BNRA 3BUTA 3B5TA 1EHNA 4S0SD 3LV3A 4KI5E 3PXJA 2D7TL 2P7TA 2XRAL 4Z7QF 3WFEH 4CU6A 1MJ7H 4YBLB 2I60L 4X7FC 3V4VH 3TGXA 4RMSA 1RUQL 2OJZL 3MRKB 4K07A 2JCCE 5C8JA 1GOFA 4QRRB 3N1MC 3PWPD 3CDFA 1WWBX 3GMPB 1G7JA 3ULVC 1T7VA 4OIIL 2JCCB 2D7OA 4G8FB 3FO0L 2W91A 5L8JB 3CCHA 2YBRB 2E9IA 3FOMA 5IVXA 1DBML 4DUWA 2DYPD 4MDIA 2QTEA 3VXME 2PXYC 1A1OB 3RL2A 4PJXE 4B0MM 4M9PA 4JKLA 4UIKH 2BNUB 1G7PB 1CICB 1S7VB 5JHDD 3BEVA 1QYGL 1CGUA 2F5BH 3H9ZA 1HXYA 1I4FA 3IF1A 3QO1A 3VXMB 4F58L 5TPWL 4Z77B 5EO9B 2XTJD 4C4KO 4R3SA 2GJ6E 5D2LA 3DLQR 4YPJA 2L7UA 3QDJA 3VJ6B 5BV7H 2VC2L 1MCRA 2OLDA 2YSSB 3MZTA 2E6JA 2X6MA 4LSTL 2DIJA 2D4DA 4QWWD 1JGUH 4XC1L 1D5MB 3UJIL 3NTCL 4QCIB 4LLDB 1M4KA 1HILA 2B0SL 1D5BB 3D39A 1HQ4A 4K8RL 2AJSL 1NC2B 3FCTB 3U48A 1TCRB 4LPXA 4JFFE 4WUUE 3CFEB 4MB3A 3WFHA 3ALWA 1QFPA 1WT5C 4FMKA 4NFBA 1FFOB 1Z9LA 3VG0H 5DD1L 1S7QB 5JPNB 3VI3E 4Y19A 3PHOA 3F7VA 2DI7A 3MJ9A 1RZ7L 4G6JL 5INCB 1TJHH 3QO0B 4PRIA 5K59E 1BX2A 3BW9A 1T2QL 2VLRD 2CLVB 3TZVA 4F9LA 2HRPL 1CICC 3FFCD 4H25A 1BJ1H 1Q0YL 4G9FA 3RWCA 5MEOA 4JGMA 3ARDB 4MVBD 1E6OH 1FNGA 1KIRB 1H3PH 2FATH 3PWUA 1CFSB 3O2WH 3C5SA 1OLZA 4QXGL 1JPTH 4HT1L 2FLBT 1ZLWK 5T3XE 3SCMA 5B38G 4EIZC 3QUYB 2IH3B 1IT9H 1Q9OA 5DZOA 4UIMA 3EYVA 3EW3B 1N7MH 3IRZA 1L4IA 4MJ6B 4D9LH 1JF1A 1VFUA 5ESQA 3PQYE 3LVEA 4GQ9L 1CGSL 1DBKH 3HN3A 2R8SH 4KTDH 5JOEA 2IADA 4DGIL 5IBLD 4PJIB 3SBWC 4P57B 4YPGB 1YNTB 3DV4B 3QNXB 1YYML 4NM4H 3RWIA 5HI4D 5BJTB 2BSSA 2DIBA 3HI1B 1ZGLP 1T83C 3QQNA 2PN5A 2IFFH 5FKPA 1IKFH 4EI5B 5SWQB 1VA9A 3L6FB 5FO7B 1E4JA 5C07A 1RD6A 5EZIL 4FZ8H 2GJZA 4XH2A 3PGCA 4JR9H 3BIAX 3RDTD 1FH5L 2DLFH 3H9SB 1ULVA 32C2A 4KDTC 5M94B 1MPAH 1KBGH 1UC6A 3GIVA 5JXEC 4DKFL 4LVOC 3H3BC 5JQ6H 1L7TL 5D72L 4P5KB 2X9WA 2YPVH 3QUYC 1YY8A 2AEPL 3LS4H 2A83A 1MCDA 2CMRL 1YEIL 4J3TA 4QHLB 4U0QB 4C56A 3HB3D 5F9WB 1FZOB 1FN4A 1N0XL 4HS6A 2HH0H 2GCYA 2ZUXA 5BRZB 1RFDH 4WV1B 4MS8C 2BNQB 3T09A 2XG4A 1QQDB 5C70A 2JJTA 3F12A 1G7IB 3SDAD 3ULSA 2QQNH 2ZOLA 3IDGA 5IHUH 4LMQI 4NQDE 2CJUL 4ZFZB 3T08A 1VERA 4MCZB 1PW3A 2VQ1B 5FM4A 4M6NL 3DOSA 2OJEB 5MENB 5DJ2B 3TH4T 1K6QL 5DMIL 3PL6A 4X6EB 1NC4B 1HWHB 1BJMA 1GGUA 5CBAA 1X4ZA 5CUSH 3IXAA 1MNUL 5ENWA 2BVOB 1HYRC 1IEAB 3MA9H 2YD5A 1PKQE 1TJIH 2BVEA 3ISWA 4AENA 1F4XL 2O5XL 5KSAA 3VXPA 2FH6A 3HRZB 4I48A 4JFHD 1PKQB 3C5JA 3SDXE 1N6VA 2VITA 1L0XA 4JZNB 1UEYA 4OCXL 1EIBA 4R97B 4PRNA 3L3KA 5IF0B 4MNGE 4JREC 3FRUA 4OCSH 1EUTA 4LSUL 3BMVA 4K3JL 2QSTA 3SDXB 4ZS7H 5J13B 1PYWB 3LCYA 1C5BL 1G9MH 3P77B 4MA3B 3QI9A 4Z7WA 3M8OL 1QPPA 5JIKA 2VN7A 3P4NA 4P9HH 1MCSA 2FR4A 3GHEL 4OM1H 3VD3A 2EE9A 2UZIH 4NPYA 1GGTA 3MLRH 5EUKA 3PIQB 3WXWL 3MRCB 4U1JB 2IPTH 3TPKA 3CFKB 2MFNA 4X98B 4Z78A 2Y6SD 4PJ5E 1BF2A 4KMTH 4FABL 3QUXB 2I07A 4LGSB 5AWNL 2DM7A 5CEZD 4ZYKB 4Z8FH 4NCDA 5F1IB 2E7BA 3MBEA 1KF9B 5DJ8B 2DQHH 3MJ7B 3T0WA 4PJHE 2H2PC 3VXMD 4E5XB 1W72B 4K7PY 1UH3A 3C6LB 5BS0A 2CK2A 2Z31D 3IKCA 3TA3B 1H8NA 3N9GH 5TQ0L 3H9HA 4BJLA 4PJHB 4RMQA 4F7MB 4XCNA 1DFBH 2LQRA 1XF2A 3V8CA 4LNVA 4XRCB 2GJ6D 5CIPB 4HZLA 5GSVA 3D87B 5IMOA 3STZA 1HHKA 3BXNA 5HDQL 3QRGH 1XGRB 3QUML 4BH7A 3GSVA 5J13C 4ZUWB 3WKNA 3GK8H 3OXRB 4LHUG 1JF6A 3S4SA 4C58B 4HJ0C 1JFQL 4A6YH 1UQSB 4EXPX 1CXLA 4Z7UE 1S7UB 3VXTB 3ARBD 3OBAA 2Y72A 4KTYA 4NHCH 4JFFD 5DJ6A 4WUUD 1T0MB 4Y88A 4YX2H 3CK0H 3O6FB 4Z7UB 1ZANL 1EO8L 4P5TD 3GKZA 5BW7C 1HYSC 1T1YA 2MKLC 1H3WM 1KPVB 3NIFE 4L29B 2R2EB 4XBEL 1A3RL 4FFYL 4X6BA 3S96A 4QRSA 5JW4N 3P73B 5D8JL 3DMMC 1GZQB 3C87A 3FT2A 4RGMC 2EDOA 3KPMB 1TFHA 3LQAL 2CGRL 1MCNA 1IRAY 1T66C 5LGJB 4K94C 3CVHA 1OW0C 3I3DA 1N8ZA 3O3DA 3K2UL 1H3XA 5GZOD 4TSAL 4OGXH 1IJ9A 3LN4A 3OR7A 2XA3A 1I1AB 4HSQA 1UKSA 3EJJX 2BFVL 4LBEA 5FECB 4QT5B 3OB0H 3MFFB 2HFEA 1L0YA 1FC2D 4LHQB 2V2TB 4PJGA 3BVNB 4H20L 2FL5A 3TPUB 1MJJA 3MA7A 3JWNC 4L8CB 2PXYA 3QG7H 4K7PH 5EOTB 5ICZB 4WTZG 3UBXA 4GH7B 4OV6F 2G75A 3VFUA 5AYQA 1MWAL 1KEMH 3PQYD 1XCQA 5DLMH 3UC0L 1ZHLB 4G6ML 4DFIA 3FO9A 5IEHA 5C6TH 3W81A 3ZE1E 4FQHB 1S5HA 3QSKB 5JR1H 3GI9H 4Q9QL 1PJ9A 1WZMA 1C16A 2DQDH 5TDPA 4XB7A 4BQ6A 1DUYA 2CDGB 5EZLB 4JM4H 1QBAA 5DWUH 4QRRA 5GGVY 1UM6H 3SDDB 2I9TB 1LWRA 3WFBH 2DICA 3GMPA 4J1UB 1LEKB 1WT5A 3MXVL 4ERSH 3P0YL 5DK0B 4POZD 3PV6B 1I1AC 3MV8D 4G8FA 4GG8A 1ACZA 5FA4A 4OZGE 1DSFL 3E2HB 1T3FB 1Q9WB 4RGNE 1OTSC 2P24B 4GJTB 5I8OL 2Y07L 3RX8A 1A1OA 2YK1H 4HEPG 4OZGB 3D0VA 3UO1H 1G7PA 1CICA 1S7VA 1TDQA 4RGNB 3QG6B 3T77B 2ORBH 1MELA 1MVFA 4EXKA 5EO9A 4LVNC 2HYMA 2NXYD 4DKAA 2W92A 3FTGA 1D6VL 3W9DB 5C0EB 3CC5A 2XIDA 4JQVC 3O45B 1D5MA 4OB5L 3MCG1 1KJVA 3K4ZA 4LLDA 2O5ZH 4FQJL 2ZPKL 1D5BA 4GAJL 4NQDD 4O51B 3FCTA 1NC4D 2F58H 2X10A 3GSNB 5D71L 3TO2A 5AZEH 5MHSE 3IS0X 2X4PA 4MAUL 1G7MB 1GOHA 1FFOA 1OTTD 3REWA 4J4PD 4XNUH 2VNCA 4NQXB 1UJTA 3EIFA 3BKMH 1YECH 3CPLB 3TCLB 3G5YB 3SBWA 5L6YH 3EOAA 5I15L 1I7ZA 4FQXC 5INCA 4Y2DD 5GRJH 3BGMA 1QRNB 2NY7L 5ITBL 1T83A 4LDOB 4L4VE 4R4FL 1A02N 1N4XL 3IJYB 5BVJB 1JL8A 1ZK9A 1NCCL 3CUPB 3GM0A 4YIQB 2PYFB 3CFJB 2YMXH 1FYTE 2FGWH 1JRHL 3HAEG 4ZTOL 3OV6A 1CFSA 3F65A 4GMTH 4WHYG 2CR6A 4KDTA 3ILPB 5JXEA 3ARGB 2WV3A 1WTGT 3HC4L 2ATKB 3QUYA 3AXLA 2UWEE 4Z0XB 3PWNB 2QKIB 3TVMD 3HC0B 3VG9B 3HNTH 3LKRB 3LS5H 4MJ6A 3KPQB 4U6VH 4PJ5D 2UWEB 4DOHE 2VXSH 3OG6B 2X41A 3I85A 5GRWA 4Q9RH 3Q0HA 4OLYL 2J6EA 1WFNA 4PB9H 3T65B 3TA3D 5LAXB 15C8H 5ILTH 2AJZB 5J11B 1X5LA 1SJHA 5CLTA 4LDEB 1FNSH 4PJIA 3KHOA 4X8JB 1J8HE 4M9OA 2GFBB 5T1KD 4YPGA 3WL9B 4O4YL 5BJTA 2OTUB 2IG2H 3ARQA 3TBWA 2AV1B 3P11L 1DEEB 3HI1A 4LCWE 2W38A 1J8HB 4V1DE 2VKXA 3R1GL 4MQ7A 3X11B 1F3DH 1IGTA 3L1OH 3AS2A 3NMEA 5EO1A 5SWQA 5CINL 3WN5B 5FO7A 1NEZA 2C3WA 3DECA 4JKPH 3S8WA 4V1DB 1R3JA 4RFNB 4HIHA 3H9SA 4H0HB 5K9QG 1GGIL 2Q7YB 3UTZB 5JDSA 3ARGC 5DMGC 4I1NB 1AGBB 5E56A 4P5KA 1MFNA 3X3GH 1QBLL 1NBYA 3KS0H 3WSQL 4HFUL 3C2AL 4PP2B 4QHLA 5F96L 1FZOA 5HYSB 3OJMB 3PHQB 3QDGA 3KG5A 4H1LH 4ELME 3BDYL 3C9NB 3ZHLA 5IMMB 2V5YA 1WZKA 2XN9E 4LLWA 3MUJA 4CUCA 1O5DT 2BNQA 4LEOB 1A6PA 1CD9B 5J11C 1XMWA 4OUUA 5FHAH 2XN9B 3BYTA 1CE6B 4WENB 4PRHE 1FORL 3O2VL 2BX5A 5IFHH 3D18A 5DHVH 3VWKD 2ZUYA 4UU9A 1FE8L 3ARFB 4PJ8B 2OL3L 1CLYH 1UA6H 1CDGA 4AM0B 4Q9BA 4ZFZA 3S37L 4RFOL 3F58L 3DX7B 2GQHA 3O0RH 1KV3A 3JUYA 4DZ8B 4QEGA 5KSVA 3WN5C 5ESAA 5GGSB 2FYYB 2OJEA 4XVJL 5MENA 4FQ2L 3BP6A 2OS7A 3DRQB 4RFNC 5EB9A 5F3BA 4AK1A 4LRIC 3CLEL 1KC5H 3BKCH 1OP5K 3UPAA 4ZAKC 1HOCB 2BVOA 1CGYA 1IEAA 4HJGB 4YXHH 1I75A 3BZ4A 1VGKB 2FZ3B 1OAKH 3OAYK 5F7KC 5F93C 5KVGH 2SEBA 4ZFOB 3QISA 3HRZA 2EXYD 5CZXC 5C0DA 4EDWH 5FYLH 4PS4L 4JRXE 4MB5A 4HS8L 2A73B 5BXFB 2HMIC 1DDHB 1YC8A 2FX7H 1EGJH 1NKRA 3MV9E 2PNDA 3EZ8A 5I66B 3BH8B 5TDNB 3BT2H 1OP5H 3IT8D 4JPKL 2F53A 3G9AB 5JA8B 5CJXC 3AAZA 1MAMH 3ELAT 5TDOB 1J7VR 5EUOB 4EUPA 1ZVYA 3O41A 4MZ3A 1A1MA 1V7ML 1GGCH 1I9IH 3PIQA 4XPAH 1AXSB 4U1JA 1VEMA 4LMQE 3CFKA 4X98A 4PJAB 4GOSA 3IFOB 4GRLC 2EE6A 2B1AL 4LSQH 3ESUF 3H3PH 5ETUB 5BW7A 5FO9B 5EU6D 4NJAH 3PDDA 5TE6H 5I1LA 5DJ8A 2GT9B 4NZTL 1F45A 2NNAB 1BIHA 1W72A 3VFOB 2DBJA 5KTEH 2CRYA 3DMMA 4MYWB 2ZKHL 1A21A 4MB4A 1AGDA 5DRXA 5HYFA 4NZUL 4JG1L 2J8OA 3PP4H 5JTWA 1ZGLM 1OSPH 4F7MA 1PAMA 1OW0A 3A6CH 5CIPA 3VXQA 1ZOXA 3MGAA 5I19H 1OHQA 2E7MA 1S8DA 4X7CC 5HI5C 1V7NH 4O02L 1EXUB 5GGTL 3HPLA 3OR6B 1C7TA 1R3KA 1A7OH 1VFMA 4ZUWA 4Q74A 3OXRA 4MHHI 2JJWA 1JGEA 1VDGA 1VB9A 2W0FA 4IOFC 3Q6FB 3RVUC 4W6WB 4FA8A 1MRCH 1S7UA 4MCYB 3VXTA 5EA0H 2DMBA 1FP5A 3GJFB 4XCFL 1SEQL 1T0MA 3QWOA 5MHSD 1G0XA 1A6AA 2DS4A 4UT7L 3ARPA 5JZ7D 5D7IB 3MOAL 3FN3A 4NN6B 5EWIH 2XWBA 4PV9B 4OZFH 4OLXL 4EOWL 3QEHB 5GS1C 3VMNA 2VE6A 4XMKH 5D1QB 3O4LE 5ACZA 5DR5L 3TO4B 1CXFA 1MCOL 3LRGA 3VFPB 3P0VL 4QHMB 1MJ8H 1K2DB 5DFTA 5HGBA 5JW4R 5I0ZA 2QV2A 4L29A 2R2EA 3WHE0 2EDDA 3LB6D 3CXHJ 1RZJH 5IJKC 4PJFF 4Y4KD 1FFNB 2MOVA 5EORL 5TQ2L 4L4VD 5LGJA 4ZPVB 1IGJB 1N2RA 1H8SA 3DPBA 1CXKA 3WFZA 1FYTD 2GSIB 2VSCA 1I1AA 2OR8A 3X14B 3ARZA 5C71A 2LTQC 3HZKB 4TUKL 1W0WB 4DQOL 2VXVH 5FECA 1SVZA 3VH8A 2JE8A 3KYMA 3B9DA 3JV0A 4XVUC 1BLNB 3TPUA 5FGSA 2EKJA 1WAAF 4L8CA 4KY1L 4OZIE 4BZ1H 3K80A 4G8EB 5EOTA 5F9JA 5ICZA 4MXVF 5SX4I 2X9YA 2XWJB 4KZDL 5JW5B 1Y6KR 5L2JB 1WTLA 1IQDA 1ZHLA 1BECA 3VGHA 4G42A 4QOKA 2W59A 4OF3A 3ORJA 3TO4C 4FFZL 4FQHA 4JQVA 4PJ7F 3LEVL 1MHPL 1AGCB 3O3BB 2QADB 3SPVA 5CHNB 2X89A 3AVEA 1HXMB 3RGHA 4LCWD 2CDGA 4OCRL 4JLRB 1L7IL 1M7IB 3THMH 2I9TA 1F8TH 4J1UA 1LEKA 3MRIB 4M6OH 1I9EA 2XA8L 3RWDB 1NJ9A 1UM5L 3NA9H 1U8IA 2V2WA 1FVEB 1AHWB 1CTNA 2AJVH 4D0CA 3QZWG 1T3FA 3DURA 1Q9WA 1JRHI 4LPVA 1WCQA 4KUCF 4XNXL 4FQXA 1KCUH 1LO4L 2GTWA 4E41A 3STLB 1F02I 1DQLL 4Q7DA 2VH5L 1WBXB 5E8NB 5C08E 2IQAA 4OF7A 1LEGB 4O58H 4H8WL 4HH9B 4R7NB 3U0PB 3LRSA 3W39A 2IBGA 5C08B 1RIHH 3MLPA 3W9DA 2CLRB 2AQ2A 5DMKA 3O45A 5CSZA 1TZIB 3NA4A 2BVYA 4PRHD 3KPOA 1OD7A 2X70B 3F5WB 4JFDE 3QRFM 1IMHC 5KS9F 3NFSH 1BEYH 2CPCA 2ID5A 4HQQH 1JHKL 4XAKD 4AIOA 2YXMA 3V6FB 3GSNA 2APBA 4JFDB 3FOLA 1T5WA 3T2PA 4YDKL 2BXZA 1G7MA 4OQTA 2CQVA 2VDMH 4HUMB 4LQ1A 4JGUA 4NQXA 2XTJC 5C0JB 4OLWH 1AHWC 4YHYB 2UZYB 3TCLA 3TV3H 3G5YA 3QBTB 5A2KH 4FQQB 3DX9B 4TNWK 1GJIA 1X5GA 3NZHL 4QWWC 3KXFE 5CJQL 4HK0A 1QRNA 3VFTA 2XXCB 1IAMA 1NCWH 4JZOB 4RBPK 2CK0L 4UTBH 3SE3C 5FYJE 2MCG1 5DEZA 3KXFB 5BVJA 4LSVL 2R23B 4K7PX 4XP4L 4JRXD 2DB8A 4UINL 1U95B 3CUPA 4YIQA 2PYFA 3QHZH 3MV9D 4BQ9A 1S7XB 1Y0LB 2ZSWA 3CFBB 4NGHL 1KACB 4JN1L 1P7HL 4AQOA 2PTUA 1LK3H 2FX9H 3ES6B 1FAIL 2CKBL 3RUGB 4GAGH 3ILPA 3ARGA 1F90H 4K8RC 3IU4L 4IOIB 4X6CF 2ATKA 4Z0XA 3GMQB 2QKIA 3DGGB 4X5WA 3RWGB 2X1XR 3UTSA 1P6AB 4OKVB 1MEXL 4R8WL 5DVLA 1JN6B 2IEPA 3LKRA 3DXAA 2NY2B 4PJBE 5EG6C 1RZFH 3RVXC 1WZ1L 3I75B 1JGDB 3BPNB 3QIBD 3UPRA 5DJDA 4NC2B 3L5WA 3ZE0F 4OF6A 1XCTB 5GZND 3T65A 2R9HD 4PJBB 1N5YH 1TVBB 3KPSB 5LAXA 4HC1A 1OGAB 2W65B 1QPXA 4YHYC 3QPXL 1LO2H 4MVBC 2GFBA 3P4MB 25C8L 4OIBA 5FYKL 1XIWB 4M7ZB 2AV1A 1DEEA 4F8QA 4N0FB 2QQLH 1UXWB 4M62L 1HE7A 4MNHA 4WEUD 4ODUA 4HPYL 4UT6H 1RHHA 2W9LA 3LIZL 3REVA 2Q8AH 3WN5A 5EU3A 1JGLL 4LRIA 1DQQA 3UTZA 3VFNA 4ZAKA 3TIEA 4YK4B 1OAXH 2FSEA 5JNYB 1KUMA 1HNGA 2DAVA 5ELIA 3NZ8B 1AGBA 4DGYL 5E1HB 5IVXF 1I9RL 1CFTB 3RHWK 4WDIB 3CZJA 2P4AB 4PP2A 4D0BB 3T0EE 5HI4C 1ETZB 1Z0NA 4KTEL 4N1EA 4X6DA 3AM8C 3QAZB 3LKSB 3C9NA 1IC7H 5IMMA 3GSWB 4UOW1 1S7TB 3GMRA 3O4LD 4EDXB 1LO3L 3U2SB 3T0EB 1D5IH 1OM3L 4GRMA 3TC9A 5D2LF 4LEOA 2AXHA 1CBVL 5INDB 3VFRA 4ZTPH 5D7KE 1SBSH 1J9CT 5CJXA 1RIVL 1T0NA 1NCAH 5E6ZA 5FOBA 2YUWA 1W0VA 4TQEH 2FLRT 2XT1B 1CLOL 5F9OL 4HWZA 4AM0A 5I1IH 3S37X 3LHPH 1IGML 2Q6WA 3FRPA 3O11A 4HV8A 5EBWA 5D1ZD 1JNLL 4DZ8A 3OSKA 5E9DB 5GGSA 2HLAB 4GRLA 4RWHA 1I3RA 4XPGH 1U8QA 4U1MB 3DRQA 3I84A 4CADB 2NW3B 5E8DH 1XGUB 3X17A 3P0GB 4LU5L 4LQFL 1HOCA 4YK4C 3T8XA 1A7QL 1ZT7A 4U7SA 1WV7T 2J8UA 2FZ3A 1K5NB 4I4WB 5ICXB 1MUJB 1R5VB 1PY9A 4WI5A 3SDAC 5DC0A 3PV7A 5GRZA 5FCSH 3LAFA 4AL8L 2XQYG 5I1CL 1DP0A 3QAZC 2VDQH 2Y06L 1GIGL 4MA8H 2W0PA 5BXFA 4NYLB 4IDJL 4P2RE 1IC5H 4YZFE 2R2BB 5I66A 4X7TB 2W0KA 3BH8A 4QY8B 2AJYH 4YAQA 2ICWI 4P2RB 4NQSB 5EUOA 2X1OA 1YYLH 3WFCH 1HHJB 3RNKB 1CF8L 1RUAL 5E2UL 3ZDZF 2GITB 1AXSA 5DMYA 3UTPD 2H8PA 3TN0B 2DLHA 4PJAA 1PEWA 4JO4L 5M95B 1P5VA 3NCJH 1R5IA 3CSGA 2NXZB 2YKLH 1JTOA 4M1CD 3MRPB 1AGFA 4O2FB 5ETUA 5H2BA 5FO9A 5GS1A 9CGTA 4DUXA 3VFVA 3IDYC 4Y4FB 2KKQA 2A6JB 4K3GA 4JANA 5E2TH 5L7XH 4MSWA 4WO4B 5IJKA 2OXHA 2DWEA 2L4OA 5KSBE 3S88H 5I8EB 2BC4B 1TVHB 3CXHK 1P69B 5KVDL 3U9PH 4BSVB 1DLFL 1IFHH 3U0WL 1AXTL 5KSBB 1XGPB 3QUMB 4LARH 1VFAB 3E6HB 2FD6H 4WCYL 2DBLL 1TJGH 2ARJA 1EXUA 2EIBA 3T1FA 2HLFD 4LKXA 4ZXBD 1B90A 4S1RH 3ZKXB 2DDQH 3WLWD 3BSZL 3U4EB 1Z3GH 2V7HB 3BX7C 2J88H 1UYWL 1U3JA 2Y5TA 3V5HA 4LCIH 3O8XB 3Q6FA 1CLZH 1KN4L 4KJPD 1RU9L 2PCPA 5GGRY 3RJDA 1CCZA 5GQBA 5FYJU 5E6IB 4BSWB 1OPGH 4GKNA 3RQ3A 1TPXB 5D7IA 4Z5RA 2VABB 4LCUA 5C2BH 3ULUF 4PV9A 1EZVY 2HAZA 5SWZD 3QEHA 4JDVB 3TO4A 2ADFL 3BIKB 1H3TA 2MWCA 1MHCB 1YNKH 2Q8BL 2E27L 3VFPA 4QHMA 3ARYA 1K2DA 1WLHA 3KXFD 1ZA3A 4NKMA 4WO4C 3C09B 3MNWB 2BY3A 3ARXA 4WFFE 5FYJD 4XTRD 2KZWA 4PY8J 4N0YH 5AD0B 4PG9A 3EJZC 5JO5B 2D7NA 3FO1B 3ARBC 4Y0GA 3QNZA 2IGFL 5CMAB 4U6HB 3NFPA 4W6YB 4HMDA 4O5LL 2KL6A 2R4RL 3G5XB 3HZKA 5F7NC 1W0WA 2G2RB 3O6KH 3DVNB 5E99H 3ZKXC 5CZVH 4S2SB 5GSRA 5I73C 3O8XC 1MWAB 4P4KD 3DYPA 4G8EA 4KFZC 5LG1A 3D69B 3CH8A 4JDTH 2XWJA 2X4SB 5E6IC 5SV3A 2E8YA 5JW5A 3FQUA 4Y89A 4XWGH 1HI6B 4M93B 1ZHBB 1E27B 2K7QA 1QD0A 1KFAH 3LEYH 3PWPA 1BD2E 4LAQL 3LMJH 1YEGH 4GMSL 5ACMA 3WNOA 3OPZH 1AGCA 3O3BA 4TSBH 1I9JH 2HT2D 5CHNA 4WWKD 4PJDA 4WW1A 1UWXH 4OBSA 3C09C 1HXMA 4WW2B 2A9NH 2DYPA 4JLRA 4Z7WF 1QLFA 4XVTH 4JFEB 4K9EC 2A77H 3RWDA 4XCEB 3VGGA 4ODXB 4YHML 4PUBH 5I18L 1FVEA 1AHWA 3H42L 3MXWH 5HGAA 5SWSD 3EYSL 1SM3H 4EN3B 1WF5A 3OKYA 4F33B 2PW2A 1A22B 2H32A 4KKBD 5T5FL 1E6JH 4LSPL 2GTZB 3SEPA 3WUZA 4ONGH 1KYOJ 4OFKA 1TJHL 4OD1H 3SE3A 2V6HA 4M8QA 3GRWL 2ZUTA 4Y16C 4Z7QE 5E8NA 4LSSL 2F19H 2AEQL 4KAQL 3ZTJG 4OD2B 1LEGA 1S5IL 2VL5B 1JIBA 1KT2B 1CT8A 1INDL 2LVEA 1MVUB 4TRPL 1IAIM 4IMLB 3TBYA 5D7KD 2VR9A 1QLEL 1UKTA 4LK4A 1IE5A 4Q0XH 4P2OD 2FATL 3VW3L 5DGQA 4M4RA 4JHWL 2BK8A 4N5ED 5C0FB 1B2WL 4J23A 5GS3A 1LK2B 3C6SB 2JB6B 4KRPB 3V6FA 1MCEA 3R8QA 3QIWB 3DARA 2VLRA 3MRDA 4HUNB 3FFCA 5CSBA 3KLAB 2VL4A 4QRPB 3VD4A 4GAYB 4JRYD 5IW3A 1J0KA 3GHBL 1YEFH 1KCRL 2WIIA 4JO1L 1RZKH 3OKLB 2IMNA 1NFDE 5DD0H 3U6RA 4EN3C 4KC3B 5F7DB 5F7FA 5C0RL 2E9WA 3WIFB 2ADGA 1NEZG 4OAWA 4HEME 1C1EH 4ZOEA 3I6LE 4X7EC 5DD6B 2I5YL 4NCC1 4APQB 1J5OH 3LDBB 2R23A 2J4WH 1U95A 5D96C 5DJCB 5IB1A 2KUTA 1RIUH 1J12A 2AK4A 4I3RL 4GW4A 4TVPL 4L9LB 3ULVF 1NLBL 2IQ9H 2DD8L 4LLYB 2AK1L 4L1HA 4WEMB 3RUGA 1A3QA 1F2QA 1V8HA 4J4PC 4R2GD 4XNQB 2EYTB 1TQCC 3T4AA 4OF5A 1AKJD 5DRWB 5JW4M 1KBGL 3L3OA 3GMQA 4PJGF 3RWGA 1Y6NR 5JQ6L 1G6RL 2B5IB 4KRPC 3TESA 2VDRH 1JN6A 4XMLH 4KHXH 4WUKH 3BEWA 3AM8A 4HXAH 1I8MA 1X4XA 5B39A 1JGDA 1LO0L 2CO6B 4GKZB 1XCTA 1XR9B 4XGZB 3KPSA 5GIRB 1OGAA 1PQZB 3KLHD 1B0RB 4DW2H 3GJEB 4Z6AT 4F7TA 1CE1H 2V7NB 1BGXH 4N8VA 1H15A 4Z7OF 5GHWH 3DWTA 3HI6L 4I3SH 1MLBB 4P2CG 5D7JB 1Q9LB 4KXZI 4M7JL 4XPTL 4APQC 2GK2A 1ZVSB 1CS6A 4K23H 3RZCD 5EO0A 5FUCE 5K33A 3MJ9H 2OR7A 2GY7B 1WFTA 2FEEL 2M26A 4N8PA 4MMZC 2NY5L 1NMCB 4EEEA 5JNYA 1XGYH 2AJ3A 3NZ8A 4MXWH 7FABH 3U7YL 5BMFL 4JRWA 4WDIA 1QNZL 5A2JH 4JG0L 3SDAA 4UDUB 4D0BA 1ETZA 5DJZB 1EFXD 3EDKA 3K8MA 3LKSA 2RR3A 3WO3B 2DQEH 3VXSE 1QBML 3GSWA 2EICA 2A74B 3TH3T 4LCYB 3CMOL 3GSRA 4EUPG 5INDA 1CN4A 3MYZA 1CFVL 1HIMH 1QG3A 1A7BA 5BO1L 1JJUA 2IFGA 2OL3B 3VXOB 3WNMA 3VRIA 4G6KL 4F3FA 4XP5L 2WBJB 4WFFD 5DURD 2MQ0A 5IFAH 4ZUSA 5C7XL 3KYKH 1NBQA 1BQUA 4OM1L 3IVKB 5E9DA 3HE7D 3KR3L 5MP6H 5F8QC 1M6OB 1MFBH 4U1MA 3MOQA 4NJ9L 5J7CC 1UJ3B 1IGCH 1VESA 1F4YL 1JK8B 5ISZE 5LGKA 3RPIB 1J05B 5F6IB 3ARSA 3JTTA 3L5XH 2VISA 2DOCA 4PY7B 3SE4C 1K5NA 5ICXA 1AQKL 4G6AD 1BFOA 4QTIL 4UDTB 3VWKC 4ODSH 2JTDA 2ITDB 1UH2A 3BZEB 3MV01 3GSUB 1BD2D 3RVVC 3P4LA 3RU8H 4PLKD 3A6BL 3VXUD 1URLA 4ZO8A 4QY8A 2VLMD 4HKBB 2DWDB 1OARH 4RMVA 1JWUA 5FKAB 2GAZA 3DBXB 1ZA6B 4NQSA 3WEXB 1KNOB 3MLSL 3I6GB 5T1DH 1AE6H 2ZOKA 4JQIL 4HWUA 1QHOA 3DSFL 4K3EL 1YEDB 5I1JH 4JFYB 3SOBH 4GAFB 1P53A 3X13B 2EXYC 4GSDH 3MRPA 5E8PB 1KELH 4KK6D 4NRZB 4HMEA 4L3CA 3U7AA 4XBPA 1TZHB 4F57H 4PJCB 1SY6H 2NTSP 4WO4A 5F6IC 1EEZB 2O5YL 1IM9D 4PRDA 4PJIF 3SJVB 2YN3A 5DO2D 2FJHB 4LLAA 4QXTB 5CP7A 1KXQE 1RQ5A 2QHRH 5I2IA 4BSVA 1MSPA 3IGAB 2IPUK 5H8DA 3ZHKA 1KJ2A 3VH8G 3ARBA 1QBBA 1XGPA 4RAHA 1WGOA 3FT4B 5MERB 5C0GA 3MV7D 1GVIA 3KPRE 3SGDH 5F44A 1T7WA 1JZ8A 1IQWH 4CNIB 5K9KB 1NGQL 3V6OE 4P9ML 3U4EA 4B7IA 4KKCD 1VFBA 4DZBB 1FJ1A 3KPRB 1X5YA 2R1YA 3O8XA 2ZWLT 3I2CH 3QDMD 4QRQB 6CGTA 1R24B 4G6FB 3U4AA 5E6IA 5GRVK 1U8HB 3DVFA 1TTUA 3NCFB 2VABA 4HUXA 3RGVD 2ICWB 2DKUA 4KQ4L 4G8IA 1WEJH 3RWFA 4F9PC 1PKOA 5DLML 3T2NH 1N64H 3F7YA 4A2LA 1KCVL 1LVEA 4JDVA 5EOCL 3MRFB 1HWGB 3BIKA 1U2HA 3RFZC 5L9DL 2Y36L 5BQ7A 3U46B 1P4IL 3D9AL 2HT3C 4H26B 5JR1L 2H45A 3MNWA 3I6LD 1A5FL 4JJ5A 5AD0A 3VD9A 1JGVH 2R0ZL 3KPTA 4AIXA 5JO5A 3FO1A 2E7HA 2VLKD 3KPLB 3GIZH 1A7NL 3LKNB 4K7FB 3OHXB 3WFBL 5K9QI 1U8JB 3PQYA 4MWFA 1S9WB 3WIHH 4RRPA 3RKDD 1FVCA 2VDPH 4JFOA 5IGXL 3GB7A 1MWAA 1FIGL 4JY5L 3D69A 3LB6C 4NKIH 2OM5A 3CFDA 4Y16A 3D85B 4Y4KC 3B5HA 4ZFFA 3ZKSD 1KYOK 5B38B 3ULUL 1T1WB 2GSGA 3TFKC 1U58B 4JFZL 1EVTC 2CUMA 5GXBB 3GZKA 2LV4A 1OGTA 1HN1A 2EEDA 2JIXB 5HXMA 2FIKB 1BIIB 3MV8A 4RCAA 3ABZA 3ZYZA 3PGFH 3NFNB 1JNHA 2AQ1A 2W9EH 4P59L 1KG0B 1U8LB 3G04A 3VGAB 1CXHA 4JFPB 3OKMB 1A6WL 1L6ZA 5H37H 1ND0B 5L2KD 1N59A 5C0AD 1RUKH 3QEGH 4JFEA 5E8EB 5EN2B 4NNPL 1C8PA 1TMCB 5LBSL 3VCLA 4FN0A 5J1SC 1NAMH 5CD3A 3W2DH 4CRPA 2VXTH 2AVGA 3QCVL 5AG9A 4XNUL 1U3HB 3SGEH 4EN3A 4X8XA 4MJIE 5HHQB 5GGQH 3QUZD 5KZCD 4ZNEE 1IAKB 5IMKB 4B7LA 1J1OH 4G7VL 3CVHH 3HUJA 2BVTA 4OI9A 1FCCA 1IGFL 4YFLF 4GO6B 1MRFL 4OD2A 3VXSD 2P8PA 3ZO0A 2NZ9D 1RURH 5LVEA 1GYAA 3MREB 2EDTA 4TTDD 5K9OB 1KT2A 2F9BT 2PW1A 3HC3H 2BHZA 1MVUA 1OTUD 4ETQB 1CI5A 4HLZH 3ZT7A 3EYUH 4J4PA 1WFUA 3UX9B 1S7WB 2R1WA 3G6DH 2EH8L 3WKMH 4M5YH 1YMHB 4NN7B 3VGAC 2YPLE 4U6TA 1TXKA 2A6DB 1RHFA 2VDNH 3NGBC 3HNTL 3LS5L 4OFDA 2YPLB 5CJOH 4QXUH 3KLAA 4QRPA 1MCFA 2VXSL 4GAYA 4TPRH 4QHNB 4ZFGH 1U8NA 1NFIA 3BPLC 3OG4B 2DF3A 1MCPH 5ISZD 1U3HC 2DQJL 2FEEI 2VAJA 3MRNB 2I9LA 1P7QB 4UNVA 2X7LB 2PYEA 4ODHH 4JKKA 5DSCB 2H9GB 3PF2A 2M1KA 2IG2L 1QRKA 4APQA 5J0BA 4H8WC 4X0KA 2FHCA 4LKCA 4KHTL 1CGVA 1Q1JL 2Z91B 5DJCA 3ILQC 1BFVH 3TBVA 3L1OL 2GK0B 1A9EB 2CKBB 1EEYB 1CFBA 1RUML 4G80A 1KEGH 2B1HH 3D3VE 3RX7A 1P5UA 4WHTB 4XNQA 2EYTA 5F1NB 1ORSB 1VGEL 5DRWA 5FV1L 2VLLB 4X80L 3UTQB 4K2UH 3D3VB 5T1KA 3JZ7A 3P4OA 5D7LA 2YHGA 3BYYA 1RK1B 5LCVH 5DYOA 1ZHKB 5DQDL 3DGCR 3QCTH 5C0BB 3UROR 3EDDA 4PGCB 3L3JB 1NMAL 4GLRI 4F7CB 3FB6B 4RMWA 5HVHC 1OAQH 3LSOB 1ZLSL 3TJHD 4JEGB 2PTVA 1EZVX 3GJEA 3FRPG 3UJJL 2E7CA 4HF5L 2FEDD 3LQZB 4HUUB 3PUCA 1Q9LA 1T7XA 3V0WH 5DJXB 1UACH 1DANT 1UA6L 4BFIB 3OJDB 5EZOL 1CXIA 3GO1H 3AREB 1JPFA 1JWMA 1ZLUK 1U93A 3KYNB 2OXGA 1FSKB 3ULVL 4IRJD 1Y18B 3KAAA 3QIBC 2B2XH 1PX4A 4LLMA 5GZNC 4H5SA 1L0QA 5E1AA 1KC5L 3RL1A 3EFFA 4K3DH 4BK5A 3SE4A 1CL7H 5J6GB 1OCWH 1JNJA 3EAKA 1UB5B 2C5DC 1KB5L 4OF8A 4LHUB 5DF0A 1N6QL 35C8H 3E3QC 3VWKA 2C9AA 3BH9B 5DJZA 3D2UB 4NQED 1SYVB 4TYUA 4LCYA 1GZPB 1A6ZA 2VR5A 1EMTH 1CXEA 4Q97A 4U4BA 3ZDYF 1GOGA 1H5BB 1MIMH 4M43H 3VXOA 4TUJB 3DI3B 5ALBL 2MHAB 5J12B 5EULV 5T3XH 5FYLD 4NNXA 1CK0L 4NWTL 4LLQB 5HD8C 1QR1A 4PYHA 1U2CA 4G9DB 4R26H 1KLGB 3O3EB 1KTDB 5TE4H 3IVKA 4HS3B 4CN1A 1RZIA 3AREC 4YNYA 2DQUH 3TNNB 2L0DA 5JHLH 4L3AA 1YJDC 1FSKC 4D9RE 4KQ3H 3BD4A 4UILL 4OT1H 3H3PL 4MQXD 4HPOL 4NJAL 5C09E 1QFWH 1T5XA 1J05A 2X4RA 4KK9D 4LGPB 5F88B 1OAYL 1TQBC 1BQHA 1VPOH 5F6HI 4GBXD 3O4OB 3WS3B 5C09B 3PWVA 2HJFB 1NMBL 4XZUB 5DRZB 1UG9A 4ZUUB 1RZGB 1X6NA 1OD9A 1HSBB 1MH5B 5I19L 3QPQC 5B21A 5EIQA 3TJEL 4HKBA 1XFPA 2DWDA 1TCMA 3UYPA 4TOYL 5EU6A 3DBXA 1ZA6A 3OTTA 3WEXA 5LWYH 5J12C 2Y25A 5HHPA 1S9VA 1UCBL 5GJSH 5F7UA 1KJMA 3WE6B 5CEXB 2DI8A 1VACB 3CX2A 3BHBB 3ALXA 4UAOB 4NDMB 5FK9B 3BQUD 1UGNA 3EJYD 1XF1A 4BELD 4F9PA 4WU7B 5I30H 1INEH 1S9YB 5E8PA 4MNQE 1U6AH 4HUVA 2DQIH 3EYQC 4NRZA 1HH9A 1LGVA 4MJID 4UV4H 2XNAA 3VFSA 5JOFA 3NN8B 4PJCA 3R06A 1MJ8L 4MNQB 1N6UA 3KPNA 4KH2A 1EEZA 4Z7VA 2R0KL 3SJVA 2FJHA 4QXTA 4GW5A 3FN0H 3O4OC 1QSED 4JVPA 2JK5B 3IGAA 1DN0B 5T33L 2IANB 1ACYL 5GGTA 5E24E 4MXQD 4P2QA 1NANI 2GUOB 3FT4A 4R96B 5I0DA 1RK0B 2EDRA 4LLUA 4U3CA 4NSKB 1ZT4A 2LU4A 1BBJB 3CLFL 5K9KA 4M1CC 2N4IA 1WFOA 2Y7QB 4FP8H 43CAB 5GRUH 5JLZB 1AI1L 2NY1B 2R4SH 5TJWK 4QRQA 4BZ1L 1ONQB 4IJ3C 4L4TE 1U8HA 4PRAB 3LKOB 4UAOC 4Y4KA 3INUL 4F37K 1JZ5A 1ZS8B 4Y4HD 3W0WB 3KDMB 2BVQB 4DFHA 1XZ0B 3NACL 4O9HH 4QNPF 3MLUH 1DBBL 2ICWA 1IAIH 2NYYC 4FXKB 4L4TB 3KPPA 4HWEH 4Q58C 4X6DF 5GS0H 5HHOE 3MRFA 1MRDL 1WC7B 2UVFA 3HFML 3O9WD 1AO7E 2J6EL 2WWKT 4JKMA 5DI8B 1DL7L 1KIUA 4ZXBC 4DGVL 1KPRB 5FXCH 5DS8A 3WLWC 5HVWA 5IG7B 1AO7B 1AFVL 2P48B 2LVCA 2ZP0T 1QKZH 2EKSA 3ZTNL 4AEIL 5IHZA 4KJPC 1DE4B 2V17L 6FABL 1LE9B 2NY0B 3QCUL 2D9QB 2O93L 3QDHA 1KOAA 4TSCH 4K7FA 5F7HA 1KIPA 1U8JA 2P5ED 4M6OL 4HBCL 1KXTB 4U1KA 2XYCA 2CIIB 4F7EB 4M7LT 1DVFD 4V2BA 4ALAH 1W72H 3GBNH 3HAEB 4K94H 1AD0B 1FBIH 5DVMA 1YN6B 5CIPH 2MKWA 3ZSSA 2J8UF 5FDWB 4PIRF 4PP1D 2B8OT 4LLVA 4XTRC 4PJFE 3MUGB 4FTVE 1E4KC 1KCKA 4GQPH 4UMGA 3GMLB 2JIXA 2FIKA 1NL0L 1RIHL 5FB8B 3L3DB 3ROOB 5IB2B 3N0PB 4PBVC 1JUFA 1U8LA 1LDPH 4YE4H 2HP4A 1KN2L 3P30H 5EUOF 2QQKH 3NPSB 3OKEB 4P4KC 4FQCH 1KSRA 4LVHB 1F42A 5TH2B 2Q20A 3B2VL 3I50L 2W07A 4MXVE 5TE7H 3GBML 3ARVA 3QHTC 3D25B 3OAZK 1YEKH 4H88H 4PJAF 5HTSA 3NOIA 1U3HA 4I77H 4YQXH 4LSRL 1KCLA 5HHQA 2VXQL 4AMKH 3SQOL 3MV11 3VWJB 3TV3L 1IAKA 4ETYA 3N1FC 5IMKA 5T1LD 1MCBA 1M05A 1F13A 3QIUD 4PJ7E 5L0QB 2GI7A 4UQ3B 3TYGH 1NCWL 1AC0A 3HNVL 1JZ6A 4KROB 3SO3C 4NWUL 5BV7C 4OD3L 1S78D 4MAYD 5K9OA 3ZKMD 1AXIB 4YFDB 2BSRB 3VMOA 4OGAD 3H2WA 4ETQA 1R0AH 2BMKA 2FX9L 3GSQB 2EDEA 5CILH 5B39G 1K8IB 5E2VH 2DQTL 2UUDK 2HKFH 1I85C 2YD3A 3QFDB 4NN5B 2EIZB 3C08L 4NQCE 1E0OB 5C92A 4LVHC 4QGYA 2G60H 2VZTA 4ZS6D 1RZFL 2NY3B 5I17A 1CDBA 5D7IF 4OV5B 4D9RD 4N8VG 3H7BA 2OMNA 4NQCB 4BK4A 3MV9A 3MRNA 1P7QA 3VWJC 3QWRD 3BO8B 4MX7B 5F9AC 1X5FA 3KHQA 1AGEB 5DSCA 3G6JA 2MCPH 1GHFH 4N0CD 4MDJB 5EU5A 4P2OC 2WLZA 4WJ5B 1G7HB 4N5EC 5DUBB 4NZDA 3TWCH 1NBZA 2PR4L 5F9DC 4U0RC 1NDGB 5KS9E 4M3JA 2Z91A 3RIAK 3RI5K 1LQSR 3VXRE 4UT6L 2GK0A 4KVNH 5CS7A 4EBQH 1EEYA 3BAEH 2A0LC 3QIBA 5KS9B 1BZ9A 1XF3A 2C1OB 5HJ3A 1IC4L 2CUIA 4UT9L 4XVSL 3FT3B 4HDIB 1FC1A 5LJYH 1G6RB 2XZCH 4KGLA 2VDKL 1M1SA 5F1NA 1G84A 1F6AB 2AJUH 2VLLA 1ADQA 1JNNL 1ITCA 4IOSD 1OQXA 3UTTD 4M1DH 2DM4A 3IDXL 1RK1A 2P5WB 1EDQA 5GGRB 4D0DA 1ZHKA 2PKDA 3AUVA 1BBDL 1C5DA 3MLYH 4MD5B 4LOUD 1U91A 1JWSB 3VD7A 5C0BA 5FM5M 1T21B 2OQJB 1XGQB 4PGCA 2NY3C 4YHKL 1UENA 4XP9L 1ZVHA 4J3OC 2Z8SA 5EC1B 5BVPL 1CFQA 4ELKB 1KXVC 3L5IA 4KDWA 2HKHL 5H35B 5T3ZL 3G5VB 5KBNC 3RTQB 3T3MF 3LQZA 3MRJB 1BVLB 4PJ9B 4HULB 5IB3B 4R2GC 3GSNH 1QLRA 2Y9RT 4PJDF 4FZEH 2I26N 3SKOB 1AC6A 2AKRB 1FPTL 1NSNH 2P8LA 2XWTA 1FNAA 3DNKA 4OQTH 4BA8A 5JORA 3AREA 3G5ZB 3FKUS 3WMSA 1LP9B 3KYNA 2ED7A 4YXLH 2P43B 1EAJA 3QEQD 2CH8A 4M7LH 1Y18A 4X6CB 4J6RH 5KVFH 4EVNB 5CKAA 3MUY1 1ITBB 4OCWL 3ZL4L 3ZT6A 5ANMA 3ZE0E 2UYLB 5D70H 3V4PL 5JA9A 5MEQA 1A6TB 1IAOA 4GUPA 4RWYL 2BNRE 4NUGL 4LHUA 5DD5L 1CU4H 3D0LB 5HGDB 3KNBB 2BNRB 4RZCB 4ODTH 5HHOD 4PRBB 1SYVA 5E00A 4ESKA 4QHKJ 4JPVH 5KG9B 3EO1B 1D6EA 4KZEL 3LV3B 2P7TB 4PB0L 1ZTXL 4P2YA 2B4CL 4LRNL 4FOMA 5L88H 1GC1H 1J1PL 4G5ZL 2ZG1A 2BZDA 1IVLA 3RTQC 2WP3T 5I75C 4PR5B 4PJ9C 5F97E 2R1XA 4LLQA 5GISH 3GM8A 1Q0XH 5C9KA 5GGSY 1KTDA 4IIQC 3ZKQD 5JXAH 4HS3A 3TT3H 5D1XD 2Y4SA 4Z95H 5IVXE 1CDYA 4ENED 1CDJA 2FJGB 1LE5A 2DMCA 3WIIL 1YA5A 3MGTB 3OQ3B 3T3PF 4MDIB 4WY7H 5F88A 2EH7L 1IBGL 5D2LE 3SDCD 5JQHC 1AQDA 3QDJE 2RGSA 3WS3A 4CU7A 1MI5B 3BEVB 1B4JH 2JB5L 1RV6X 1HXYB 3BPOC 3IF1B 1FFPA 3JUZA 1FGVH 4P23B 5DRZA 4FTVD 5KJRL 4R3SB 5D2LB 3U9PL 1RZGA 2AJXH 3O6MH 1IFHL 4OJFH 1NCBL 3IJHA 2A38A 4J7RA 3FMGH 3HE7C 2RBLA 4I9WE 3D39E 3C2SA 3IFPB 4U3HA 1G9MC 2ZG3A 1W2KT 5EFIB 4S1RL 1HILB 2DDQL 4R4ND 1F6FB 5DVOA 1A4KA 2K7PA 3EZJB 4P9HC 3RUGF 3D39B 5CEXA 1VACA 3BHBA 4Y19E 4CJ0A 4RX4A 3PP3H 4QRTA 1L9NA 5IQ7H 3MBXH 3WFHB 4HCRH 5FK9A 1KTLA 1YY9D 4G6AC 1QSVA 5C0IB 3UZQA 3IETB 2BRRH 2QLVB 2IF7A 1XT5A 3F7VB 5IJVA 4PRIE 2F5AH 3HR6A 3NABL 4AIZB 3BGAA 4ZO7A 1FO0A 4PLKC 4HGMA 1P7KB 3SO5A 3RBSA 2XG5A 4HJJH 5ADPH 1T1XB 2ZJSH 4ZXBA 5ACLA 4PRIB 1BX2B 4G9FE 2WMPA 3TZVB 1K3IA 3QZWB 2AERT 2X05A 4RISH 5J3HD 4OFVA 1JPSL 4P23C 2FDBP 1CR9H 1F11A 2IANA 2VUOA 5MI0B 2F15A 2H2SD 4L9DA 3QXWA 1I3GL 2GUOA 1FNGB 3QFJA 5F1SA 4JFXB 4BFGA 3ZDZE 3IDNA 1RK0A 3PWUB 2HTLD 4NSKA 2HWZL 2DQFB 5SWZA 3C5SB 2Y7QA 1Z9MA 3SCMB 3CSYA 43CAA 3JV6B 2WZPD 5IVZB 1WWAX 4UIMB 5FUZH 1RULH 2GJJA 1ONQA 4KUCD 3VD5A 3OZ9H 1JF1B 1L6XA 3W0WA 3KDMA 5IM7A 5ESQB 4G43A 4NBZB 5KW9L 1MFCL 1OAUH 1WCBA 1E4KA 2VZVA 2YWZA 4R6UA 4FNLL 3UAJC 5IBUB 5AG8A 4M4PA 2IADB 1SVCP 3HR5A 3EDJA 1MFEH 3GMNA 2LE9A 3OPZL 4HC1L 5LQBL 3N1PC 4P3CL 3TCXA 3L3HB 3ZE2F 3F6LA 5C07E 3VA2C 5FKPB 4JFQA 2HVJB 4P4KA 2FRGP 1JTTA 2A9NL 4WEBH 1IL1B 1HZHL 3O3UN 5EIVA 3VXRD 3NAAH 1LE9A 4XAWH 5MI0C 5C07B 3KLSA 2KPNA 4XH2B 3FL7A 5HYJB 1BMGA 4J3XA 3VXNA 32C2B 4KKAC 2EDWA 3L95A 2AXFB 3AS0A 4F7EA 4C56E 3GIVB 1J0JA 3QXAB 3QQ4B 3VA6A 3GSXB 4XP6L 4P48A 1X3DA 5FHBH 4DWHA 4DVRL 3GMMA 5FDWA 3AS1A 4HZAA 4HS6B 3MUGA 3KJ6L 2BDNH 1FLRL 2EXWD 2ADIB 5CGMA 1RMFH 4ORGA 4XNYL 4R90H 4HWBL 2ZSVA 1QFUH 3F12B 3ZYJA 5JW4Q 3SE9H 3B9KC 4GG6B 5DVKA 3LN5A 4NQVB 2ZOLB 5SWSA 3RWJA 4I0PD 2R0LL 3IDGB 2O26U 3GJFH 3FFDA 4C54A 1FGNL 4FQ1H 1I85A 3OKNA 1P1ZB 4X9HA 3E6FB 5FGRA 4PJXF 1P4LB 2VXUH 1LNUB 2DJSA 1GSMA 5TH2A 4YFLI 2IAMD 3AROA 3U0TB 4BQBA 2CRIA 3DROB 4P46D 2I27N 3SGJC 2HJLA 1WAAA 5CBAB 4CMMB 3IXAB 1WSST 5ENWB 3EDEA 3DUUB 3WNKA 3VWJA 1DQDL 4M1GH 2NLJB 4P2OA 4X4MA 3MRHB 4QRUB 3ULUC 4UB0L 1B88A 1PG7W 2PO6B 4I48B 1C1EL 3C5JB 3UJTH 3S97C 2VITB 1NGZB 3MRRB 4LEXL 4YO0A 4DAGH 4X4ZA 3L3KB 4N90E 1J0ZA 2J4WL 3RAJH 5FUCC 3PWLA 4Z7WE 4BUGA 2BSRA 3NBNA 1NGPL 3CMGA 3TT1H 3ZLQC 4JRYA 2YR3A 1MF2L 3QI9B 5DD3H 2BVPA 1KULA 1P4BH 5HHNA 4DJMA 4OM0L 1X4YA 1K8IA 1O7SA 4XX1G 1FL6B 3M07A 3QUZC 5IKCB 1F58L 4NKOA 5EUKB 3QFDA 5GPRA 2P45B 4DN4L 3L9RB 4KMLB 4KK5D 3CIQA 3GKWL 2EIZA 4DN3L 3S5LG 2D7TH 4S1DD 1F4WH 2XRAH 4NC1C 3QXTA 3QQ9D 4X83A 1EK3A 4ACPA 5BS0E 2I60H 1RUQH 1I1CA 3MBEB 4TTDC 2OJZH 3L7EB 4R4BA 3DO7A 3H0TA 3QXVA 5IQ9A 2DTML 5BS0B 4MX7A 1AGEA 1AH1A 3QDJD 4OIIH 3H9HB 1MCIA 1PZ5A 4XCNB 1AKJA 1XF2B 5DUBA 3FO0H 4HZLB 1NDGA 5IVOA 1IKNC 1UXSA 5GSVB 2BERA 3STZB 1HHKB 3BXNB 2H41A 4I9WD 4BH7B 3GSVB 3LKQB 2C1OA 4RSVA 1QYGH 2R29H 3FT3A 3KJ4C 1HINL 4F58H 5TPWH 1AIFB 3C60B 4Y19D 2VC2H 5DJ6B 1T22A 3CDYA 2NR6D 4LSTH 3RIFF 5IT2L 2P5WA 4PLJC 4XC1H 1JWSA 3UJIH 2A1WL 2GIYA 2CDEA 2X1QA 2OP4L 1AR1D 3RY6C 2B0SH 5EC1A 3TZVD 4K8RH 2AJSH 4ELKA 3UEZA 4X6BB 3IDIB 4EQ2A 4QRSB 3G5VA 3LKPB 4G9FD 3RTQA 1EBAA 1HIML 2JJSC 2OSLA 1EERB 3FT2B 3ULVE 1S9KC 3MRJA 1BVLA 4PJ9A 5IB3A 3X12B 5DD1H 4K3HA 1QVOB 5HGHB 3MRBB 1N8ZB 1EHLH 2AKRA 4IIQA 3UPCA 4KJQD 3V6BR 3OR7B 4PJGE 1LP9A 1RZ7H 4G6JH 2QSCL 1EFXA 4LBEB 1BQHG 1T2QH 3S35L 4X6CA 1YEHL 4P0DA 2HRPH 4PJGB 1KCSH 4EVNA 3T2QA 1MJJB 1X5KA 1KB5B 2PXYB 3HPJA 1I7TA 1Q0YH 1A6TA 3TJHC 3C60C 3WHE1 4G8GA 3VFUB 2G75B 3VGDA 2OTWA 2E9BA 3D0LA 3HUJF 4Z7OE 5HGDA 4QXGH 4RZCA 1WWCA 4HT1H 4PRBA 3FO9B 3LOWA 4XP1L 5KG9A 5IEHB 3EO1A 5J6HB 3HE7A 1S5HB 1HHGB 4F15C 5DJ0B 3F7PC 1C16B 4S1QH 5TDPB 3PDOA 3CVIL 4QRRE 1DUYB 3WNNA 5CP3A 3P9LA 4PR5A 3SKMA 1CGSH 1J87A 1B6DA 3O81A 5I16A 3UYRH 4DGIH 1B0GB 3MNZA 2PTTB 4LGRB 4GG8B 2FJGA 3SOBL 1YYMH 5HHXL 1X6LA 5FA4B 3HA0A 1BD2A 5FGBC 4C56D 1BFTA 3MGTA 4JB9L 3VXUA 4LPTA 4F57L 3IDUA 4BH8A 3D0VB 1SY6L 5EZIH 5E4EC 1MI5A 4YHIB 1I8KA 1FH5H 5FCUL 4XMPL 5IHBA 4P23A 4M61A 5AZ2L 1VKXA 1CD8A 1X9QA 5D72H 2D7PA 3FTGB 5HHMD 1SMOA 3CC5B 1RJZB 2AEPH 3IFPA 1ZLVH 2EDJA 1KENL 2IPKB 3QULA 1KJVB 4A6YA 5EFIA 1IQWL 1PFCA 1N0XH 4MQXC 1R3IL 2NTFA 1NCUA 2GHWB 3PL6D 5EOQH 1G1YA 3D5OF 3TO2B 2X4PB 3LZFH 5C0IA 3JWDH 3IETA 3REWB 4FQLH 5IK3A 4IM8A 4DCQB 3I3EA 5F70A 5I1GL 5KSAD 1FZJB 4AIZA 3EOAB 3JV4B 1I7ZB 1P7KA 2CJUH 1ZMYA 3MV7A 2AGJL 1T1XA 2WIMA 3BGMB 4M6NH 5A3ID 4MQSB 1BQSA 1K6QH 3QZWA 5DMIH 4RFEB 3QDMA 4TNVK 4P99A 2ZNXA 2BHUA 1JGVL 4N90D 5GRVL 3BN3B 3SKJL 4JY6B 5FGCE 1S3KH 3BQUC 4JFXA 3EJYC 5JOPE 4U1GC 4HFWB 4OBRA 1F4XH 1ZT1A 2DQFA 2O5XH 5A40E 4UTAL 1FZMB 3MCLH 5FGCB 1A1NA 2W1NA 4LVOB 3AXLB 3JV6A 2VDPL 2D4FA 2DMKA 2AQ3A 4OCXH 4OCYH 5IVZA 5BZDB 1NQBA 1OP3K 4RDQF 3T0BA 1U36A 4JVWA 5DC4B 4LSUH 2D0FA 5IW1A 2DQCL 2R0WL 1DJSA 4N1CA 2ESVB 3SY0A 4PJIE 1C5BH 3TF7C 2VLKA 3M8OH 4L4JA 1YZZA 1ZKAA 1SJHB 4MXQC 3U1SL 3GHEH 1WK0A 3BI9X 2Z93A 1J1XL 2OZ4H 1RZJC 3WXWH 3B9KA 5ADOL 3L3HA 3TBWB 2NW2B 1NLDL 4YDIL 4B50A 2VLJD 4QHUA 3R0MA 5JW3L 2LU3A 1OP3H 5AWNH 1ES0A 4MQ7B 4L5FL 4BZYA 2HVJA 3H9SE 5CGYD 4XPBL 1IGTB 4JM2B 5C0CD 1IL1A 5EO1B 1KLFA 4YBQD 1NEZB 3FJTA 4M00A 2VZUA 4ZUVB 5HYJA 3ZHDA 2JELL 1R3JB 4Y4HC 2EC8A 4HIHB 3EHBC 3SGJA 5J1TC 3H8NA 1INQB 5DRNA 5IWLC 2AXFA 5TQ0H 1FVDA 3K46A 1D9KB 5JDSB 3QDGE 3QXAA 1DUZA 3QQ4A 1F3DJ 1PBYA 3O9WC 3GSXA 5BRZE 1NBYB 5ICYA 3MMEA 1UVQA 2HN7A 4GRWF 1J1OL 3AB0C 5HDQH 2BNQE 3QDGB 3QUMH 1JYNA 1PSKL 1PG7L 4N0UB 4Z76A 3ME0A 4LLWB 3VFWA 2QQQA 4JREB 5L2KA 2ADIA 4XHJD 5C0AA 1RURL 4KWUA 1YNLL 4AG4L 3MLXL 2IALA 2R69L 4DK3A 4TUOA 3KS0J 4W4OC 2RJMA 4OUUB 4LAJH 4GG6A 3WV0A 3D18B 4NQVA 4UU9B 1DVFC 1ZANH 3WKML 1EO8H 5MENE 3QUZA 4YHOH 1P1ZA 4JM2C 1U3ZA 4HX1A 5KSVB 3E6FA 1PLGL 5ESAB 1A6VH 1KLUB 3I9GL 1P4LA 1QSZA 1LNUA 4XBEH 1A3RH 4FFYH 3U0TA 4N0RA 4EKXA 3DROA 2FJFA 1I7RA 5D8JH 3BP6B 5IIEA 3PNWA 2J1KA 5F3BB 2CIKB 4OLZL 1EHXA 4D9QE 4M48H 4CMMA 3LQAH 2CGRH 4YH6A 1D3CA 3TBTA 4M6ML 1YMMD 1D9KC 1QP1A 3DUUA 5D2NC 4PJEA 4Z18A 3BZ4B 4TN9A 4CW1A 2FWOA 4TSAH 2NLJA 3OJVC 3MRHA 4QRUA 4PJCF 2SEBB 4U1SB 5C1MB 1BPVA 2PO6A 4Z7VF 2BFVH 2YD8A 4HIXL 5C0DB 4YHLL 3N85L 1NGZA 2RQ8A 3MRRA 1IKNA 3DX8A 2VN4A 2F53E 2GW5A 4H20H 1I8IB 5FAAA 4KI5D 2XQBL 4PBWD 1GGBL 4QRRD 3TBSA 2F53B 2XACC 1MWAH 2B1HL 2XPGB 2F54B 3AAZB 2LFGA 3UC0H 4AQ1B 4EUPB 5CEZL 1EAPB 4IS6A 4G6MH 3O41B 1FL6A 1WZLA 5IKCA 3WNLA 1A1MB 3GDBA 4CVUA 1EHAA 4K2UL 3L9RA 5LCVL 2LAAA 4Q9QH 3DSNA 3RVWC 4GT7A 3PJSA 5DHYB 3RY6A 2HJKB 5I1LB 1CICD 4MAYC 3L7EA 2DRUA 4HIJA 3ZKMC 2ZCKL 1DBJL 2O61B 4OGAC 2FBJL 2VOTA 4TVSa 2JJSA 3DMMB 1F2XK 3MXVH 4RGMB 1AGDB 5DRXB 3MO1B 1FRGL 1D7FA 3RWEA 3U7WL 1CGWA 3VXQB 2YC1B 1DSFH 3VRLF 1UH4A 1YN7A 1S8DB 5DQ9A 5I8OH 1LD9B 1KJ2L 4NFCA 4J12A 2Y07H 3B6SB 3HPLB 2AP2A 1R3KB 4JPIA 3LKQA 1NC2D 3PGDB 43C9A 1B6UA 3QXDB 3L5HA 1XF4B 1JGEB 2ATPA 2W0FB 2IBZY 1U0QA 3Q6GL 1AIFA 5E5MB 3C60A 4AH2A 2IJ0C 3DO3A 2B7DT 3QWOB 4EZMA 1A6AB 4U1HA 2EYSB 2HVKA 5DK3A 1HQRB 4H1LA 1D6VH 1TVDA 4N0CC 1MQ8A 2VWEC 5E4IA 3SGKC 1H3VA 4X7SH 4OI7A 2XWBB 4OB5H 2FO1A 3I3BA 2WP3O 5T5NG 5SX4H 2VE6B 2R2CA 5ACZB 3OB0K 4FQJH 2ZPKH 1E4WL 4C4KT 1NGYA 4GAJH 4ZOAA 3S9DB 4PRPB 5HGBB 4CDGC 4UUJA 3WJJC 3N06B 4LIQL 3IDIA 5DHVA 3LKPA 3CZFA 4JDZB 3ARDD 5CFHA 3X12A 1X5JA 4U2YA 1QVOA 5HGHA 3MRBA 4BKLB 4MQTB 1N2RB 4R26L 5JXED 5I15H 4Q2ZB 1YQ2A 3K81A 1K4CA 2WK2A 1MJUL 3QUYD 5JOPD 2RAMA 2AABL 4LOUC 4K9EL