4AZ8A

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
230
structure length
185
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPAGARNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
total genus 34
structure length 185
sequence length 230
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A02
3HG1A 4Q58C 3KHOA 3STBA 5I1CH 2AJYH 3KR3L 3O41B 2AXHA 3DV4A 5EOTA 4DOHB 5IBTH 3WN5B 4WFFD 1V8HA 1KB9K 3LAFA 3JV5A 3REWA 5FIEA 1HIML 5AWNH 2ZPKL 4L8SA 1QVOB 5ITFB 2FGWH 2KBGA 3GO1L 1NCTA 1PY9A 2FLBT 1JUFB 1UB6B 1JVKA 1J8HD 3HZKB 2DRUA 1D5IH 5IW6A 3UTTD 4OGYH 4OTXH 5CGTA 4Q74A 3UX9B 2BVOB 4KUZL 3H3KA 1OAKL 3ZDZE 2YBRA 3LKPB 5CD3B 1U8HB 4W6XB 3ARDB 3JWDH 2PW2B 2BK8A 1FN4B 2EO1A 4LVOB 3PWJB 1YEHL 3TZVA 4ZFGH 2X4QA 1XH3B 1KCRH 3X12A 4JKMA 4HJGB 4ONOA 1ZT7B 4YC2C 2CR3A 4BUGA 5D1XC 4QOKB 1RIHH 3HE7B 1RMFL 3SKNB 5IFAL 2BRQA 1T22B 4ZSOE 1RUMH 1OM3L 1V7NH 2CDEA 4Z7OE 2MHAA 1JTPA 2DI7A 3BH8A 4LQ1A 4BM7A 1QQDA 3H3BC 3GB7A 5IB3A 4HPOL 3UXFA 1JZ4A 4WEBH 2AXGA 1SMAA 4JDVB 4RAVB 4CW1B 3O6ML 5J9PA 1OAYH 3B6SA 4DGIL 1KB5B 2G5BA 1NBZB 2CRMA 1IM9A 5F1KC 4HK0B 2BVQA 3BI9X 3NGBC 1D5XB 1HHGB 1LWRA 2LE9A 4XAKD 4BZ1L 5DYOB 3ULUF 2EDFA 1Q72L 3BPCA 5D70L 5HHMB 4JFPA 3OR6A 1FRGH 1UH3A 5I9QC 5C0CE 1JF1A 1VADA 2A77H 5D71L 1KPUA 1EEYB 5GQBA 2B4CC 1FBIH 4KZEL 5E2TH 1LO4H 5HDLA 1AO7A 3TZVC 4I9WD 2AJZB 4LCCA 4ZPTB 5ICXB 1GZPA 3SE8L 3FN3A 3LKOB 3VD7A 1SBBA 1QRNB 1N4XH 1P6FA 5GHWH 3Q5YA 3IXAB 3WN5C 3IFOA 5LGHH 5JIKA 4YR6A 2JJSC 4Z5RA 4H8WL 2PR4L 1N3NA 3UTPE 2X6MA 1EX0A 1Y18B 5IHBA 3ARDD 2E3VA 4KWUA 4RZCB 1ZHLA 5EZOH 4Y4HC 2AEPL 3TBVA 3V5HA 3OB0H 4UILH 2R1WA 2BSRA 4QF1B 1RVFH 4KVNH 4OZHB 3HTLX 1UWGH 1HH6A 5BS0A 2EDOA 3L9RB 4AQOA 3DBXB 1JV5A 4F8TA 3N1PC 1KB9J 2F58H 2BHZA 3O4OB 3C60D 4NM4L 5E2WL 5D5MB 1XZ0A 4PJ5D 2VYRE 4BKLA 1UZ6F 2COQA 4LVOC 4TN9A 1PSKL 4YXKH 2Y06L 3ROLB 3OGCB 3DGGA 1DBKL 4GLRH 4WY7L 1TVBB 4PRHE 1S9KC 2FX7H 4TSAL 1INDL 2HTKD 4AIZA 3HE7C 2VXTL 2OTWB 3MLZL 1U8MB 2YXMA 1RULL 4RMRA 1CN4A 3QCVH 4WW2B 3BP4A 4QYOA 2YMXH 4M6NH 4PRIA 3QEQA 4AL8L 1CICD 4RMUA 4KKBD 4PJFB 3P0YH 5CIPH 2P8LA 3PHOA 4XB8A 4D9QD 5IVZA 3QQ9C 3C2SA 4X7FC 1QSEE 5IMMA 4IOFD 1MNUH 3NGBB 4X98B 5FUZH 3FO2A 1RIUL 3ES6A 3DURA 1OP9A 5J1TC 3RDTA 4CGTA 3L5XL 2VSDA 3LS5L 4I13B 4QRSB 3JTTB 1PKOA 2MQCA 1QPPA 4I4WA 4P48A 4IS6A 5KSAB 4N0UB 1F4XL 3WL9A 2YD8A 1AY1L 4WDIB 4MLIA 4YPGB 3QPQC 4QOKD 4NFCA 2W65A 2F74A 3WFCH 1OF2B 2Q8BL 4L1HA 5KVDL 4S1DC 3CFCL 2WWKT 2DIAA 1CBVH 3V7AE 1OVZA 4R7NA 2F54B 3WMSA 5A16B 1CFQB 1EZVY 1VEOA 4X4XA 5C0BD 4ZUWB 4PRHA 1NCCH 4CNIA 4HUVA 5IB1A 3ZSTA 4NZJA 4PGCA 3QUKB 1ZVYA 3FFDA 1MRDH 2XKUA 5CJBA 2HT3C 4HKJB 1PG7W 2A6IA 3I75A 1FL5B 1WBZB 3KJ4C 5IBUB 3ULVD 2RIKA 3B6SB 3T4AB 5EU4B 4KJYB 2APVA 5H37G 2M8XA 4AIXA 2NX5B 1K3IA 3DROB 3EFFA 2NY6B 4OLWL 3O4OC 4O2CA 4HUNB 1ZMYA 3LKQB 4GRLA 1CIDA 4JPIB 4UINL 1NC2D 4JKPL 4PTUA 1RUPH 1XGRB 1AI1H 2CDGB 5E0QA 5I18H 2GIYA 4JO3H 4UQ3A 1NAMA 3VH8B 2FEEL 4N8VG 4WO4B 4HKXA 2FSEA 2P48B 4QCIB 2IPUG 3QEUB 3EFDH 4BSVA 1TCRB 3UPRB 4X9HA 2CSPA 3GMQA 2ZSVB 3GMOB 5CWSA 5F9OH 5C8JB 3MLRL 4RNRA 2VDQH 2CKNA 4TTGA 4OZFB 5JOEA 5EPMB 4YQXL 4PJIA 3FRPA 1V3JA 4HLJA 1VGKB 4IRSD 1F02I 1J1XL 4LASH 1EUTA 3G6JB 1WQVT 2KUTA 5AZEH 2X1PA 5TQ2H 3UJJL 4UU9A 3WBDA 2V5RA 4U0QB 4NRYA 4GO6B 4Z7QF 3QWQB 1OTUC 4HUWB 3ARXA 2IF7A 1I1AC 2DB8A 3UTSD 4ZUVB 1F90H 2JJVA 3A67L 3CVIH 1GGIL 3DIFB 1J9CT 4MJID 2ZKHH 1ZA6B 2AJVL 3O2WH 4JPKL 2OJZL 1RUAL 5ELIA 1QR1A 1Z5LB 4Z7WB 2GCYB 5ICYA 3ELAT 3H8NA 4KRNA 4LBEB 1KIPB 4TRPH 1YC7A 3K8MA 3GSXA 1FE8L 1XF1A 4Y4FA 5GS0D 3RL1A 3F12B 3MRLB 3REVB 2H32H 1TITA 4MS8C 2YKLL 4GAGH 3RGVA 4ETQA 1E4XH 2JCCE 4X9FA 1UKQA 1UZ6E 2XWTB 2BY2A 3DUSA 4ELMA 2C7UA 2JB5H 4JFPB 1EZVX 2DLTA 3VFOA 4XCCH 4S1DD 5D1XA 3MV9E 5HY9A 3QWOA 4DUVA 3M1BB 3WYRA 4X5LA 3BZFA 4LEOB 3GI9L 5HHNA 2A83B 3JV4A 1U8KB 4N8CH 1UC6A 4L3CA 3O81A 1MAKA 1UYWH 3ZHLA 2AJUL 3FCTB 1KTKE 5HGAB 4R7DB 4KTEL 1V3MA 5DK3A 1MQKH 3NBNA 5J13B 3KLSA 1H8SA 4FZEL 1UT9A 3ARVA 5DRNB 4OLYL 5A3ID 3CSPA 3CLEL 5CEZL 1L6XA 2YHGA 3UEZA 4XBGB 4XHJD 3JV0A 1GIGL 5GGVH 5IEHB 4NO3A 2HKHL 4G8EB 5I1EH 4YGAB 3OF6A 1MREL 5GSRA 3B4NA 4XNXL 2HN7A 4EI6A 5HYFA 4N0RA 2Z4QB 5K59E 3ISWA 4XBEL 2FYYA 4KKLD 5F72S 3IYLW 5EU6B 4KI1A 4MLSA 4EDXB 4RFNB 5C08B 1Z3GH 2FATL 1MH5A 4ELME 5HVGB 5IB5A 1D6VL 4NHCL 1CFNA 4PLKC 3Q5TA 4K8RH 5I1GH 1J05A 1MCQA 1YEFH 3D1MC 1WIPA 2YD5A 1KT2B 4X4YA 1KC5L 4PLJD 1AR1D 5JW4R 1E28B 2I27N 5CSBA 4RDQF 4OM1H 2FNBA 2A1WL 2R23B 4NWTH 2IH1B 5EBMB 2LTQC 4PJAA 5IQ7L 4GT7A 3RUGA 1AKJA 1B6DA 1DANT 2DTSA 2GTZB 1HHHB 1RHHA 1OGAE 1UM4H 4RA3A 5D7JC 2PTTA 1WF5A 5E95B 4HKXB 4ODXB 1FFOA 2J4WL 5FKPB 4X8JB 1REIA 4L29A 1ZTXH 1I8IA 2DJUA 3GKWL 4UTAH 4NQCD 4POUB 3LOWA 2VDMH 4PJDA 2WV3A 3H0TB 4I4WB 5KAQG 3NCMA 1E6JH 2HP4A 3LVEA 2Z31B 3TNNA 4CDGC 3TO2A 1CLYH 3OBAA 4XP5L 2VXUH 1CDIA 4NNYB 2IQ9H 2J8HA 3EO0B 4JY5H 4ZOBA 3MFGB 4OZHE 4MJ6A 5H94A 5HHQB 3I50L 1RPQA 2IQ9L 3UJIL 4DZBB 3RWCB 4PY7B 1RK0B 4JPVL 5K9KA 3KDMB 3LEYH 4XP5H 2OL3B 4H25A 1V7ML 3W0WD 4ONHA 5I1LA 2OBGA 4G6KL 4JHAH 5I30L 1JRHH 3KXFA 5JHDE 1MCJA 1UZ8B 4S1RL 1FFNA 4TVPE 3IDIA 2LFGA 5BMFL 3DO3A 1FG9C 4OFYA 3IS0X 2QHLA 3SDDD 1R5VA 3QQ3B 3QNYA 4PB9H 5GZOD 4IRJA 4UIKH 5E6ID 1BOYA 1KELL 1JE6A 3CVHB 4N5EC 1A6WL 5DRZB 5C0RH 2B39A 2XKSA 3VXUA 3PABA 3ZDXE 1I7ZB 1T5WB 3VG0H 4RFNC 1TTUA 5FYJH 1I1YB 1WFOA 3LDBC 3G6AA 4X7CC 3SGEH 3QDGB 43CAB 1NBYA 2FWOB 2VISA 4J12A 1ONQA 1EUUA 1ZHBA 2EEDA 4QXGL 4NGHH 5FGCE 4PJHE 4AG4L 1NAMB 2WAHA 5D5ME 5C6PB 5F1IB 5C6TL 4XBPA 3DO7A 1OSPH 4KPHH 4HCRA 4TUKH 2FEEI 4Y5VC 5D4QA 5BZDB 3EO9L 4H0HB 2P8PA 3TYGL 5I1JL 2E7HA 3U36A 1IARB 1O0VA 3ECBB 5IBUG 3RWGA 5IT2L 3Q3GA 5D72H 3GRWH 2WLZA 3EJYD 2Q86B 3PV7A 1A1NA 2ATKB 2OTUA 3HNVH 3ARYA 3L5HA 1MCBA 5D1QD 1A0QH 4F9PA 4P3CH 9CGTA 3AREB 2H8PB 4GQPH 4WUUA 4RX4A 1BFVH 4JHWL 5GGUB 1HNGA 3OGCA 4PUBH 5JLZB 1JPFA 2W0KA 5T5FL 1INQA 1XGYH 2HTLC 2QSTA 4MQXD 1B0WA 1OAUL 5DSCA 2IADB 3U4BL 1J0HA 3IAGC 3KPSA 5ETUB 1IGTA 2HT2D 1U2HA 3VD9A 3V6FA 3DX7A 2A73A 3P4NB 3MV9B 2R0WH 5FA3A 2IALB 4J6RL 3VG9B 1AE6H 4KI5C 3EYSH 2CO6B 2JK5B 1CFSA 4P46D 2P5ED 4PJFA 4BSWB 2IAMD 3GSXB 2O5YL 4DK6A 3MC0A 3QUXD 1NBZA 2WNGA 4JRYA 2DQHH 5L88H 3U6RB 3QRFM 4JRXA 3MLVH 1CT8B 1JWSB 2VJXA 4U05A 5BS0B 5IROC 3KHQA 1X4ZA 5I0DA 1A7NH 1LD9A 3N9GH 5CZXC 3HG1B 2OTPA 1OAKH 2X9YA 5GRZA 2V2XA 2PTTB 1DUZB 3X13B 3VJ6B 2FB4L 4JY4A 1GH7A 4FFVC 5DHYB 2GK0B 4LVNC 3BIKB 4FOMA 4KQ4L 2BNRD 1F3RB 1VGEL 3OXSB 3BMVA 1EFXB 1EH9A 3ARFC 4FN0A 2ZPKH 1KCRL 1UWEH 1BJ1J 3A67H 3CVIL 1U8JA 3TVMA 5EU6E 4YBQC 1PLGH 2JE8A 3LDBB 4AENA 4S1QL 1PEWA 1RUQL 2P8MA 3OSKA 1YJDC 3G5XA 4XPBH 5F9WB 5SWSB 3I3BA 2XN9A 4RZCA 1S7VA 4CVXB 4GAFB 2AEIT 1BVKA 4MDIA 4Y5VB 4EUPG 2NLJB 3BOVA 1NGYB 1RK1A 1L4IA 4ZS7L 3K46A 3MRGA 1K5NB 4YHNB 1BZ7A 2XWJA 3K2UL 4FQCL 5F8QC 3S7GA 2G75B 3SN6N 4Z7WE 4NC1E 2VLRE 3TO4B 3AREC 3GMLA 4M1DL 4RMWA 1AD9B 4CVZA 4I2XA 4RAHA 4UQ2B 4G8GE 3OKKA 5T1LA 1U0QA 2E7CA 1J12A 3MBXL 2X4TA 3V79C 1CDUA 2VB5A 1DL7H 1F2QA 4PJBA 3F8UB 2W60A 5T3ZL 3ZE0F 2N7BA 2JJTC 1VFBA 1BX2A 3I85A 3IJHB 4RISL 4AIZB 5HHVL 1BFOA 3O6FC 5DTFA 3UTTA 1RUPL 4MSWB 3UROR 5D7LE 4C56A 3TBSA 5CP7A 1ZLUK 4K7PH 3KPMB 5T1LD 1U3HB 1YEIL 4JZNB 2I60L 3VG9C 1P9MA 2IANE 4Y0GA 2XZCH 1K6QH 3TIEA 8FABB 2F53E 3H9HB 5ISZD 5C9KA 5FM5M 4U3XA 3ALPA 5DJAA 4HKJA 4XVSH 4XVUD 1T80A 1KULA 3CH1A 5GGTH 1IKFH 4FQXD 4MJ2A 2HG5B 1OB1B 1SEBA 2VZOA 4JM2A 1FNSL 4CDHA 1NBVL 5JOFB 1Q0YL 1Q38A 4HDIA 5IMLB 4GFTB 1UH2A 4UV4H 1UB6A 3EBAA 1OY3B 2PYED 4FFWD 3VRLF 3GMRB 1T3FB 1B90A 3QQ9D 3VXRE 4D8PA 2VDRH 2IAND 1P4LA 3WXVH 1OAXH 4M62L 4XPFL 4Q9RH 3ARGD 4LPXA 1KPVB 3HE7D 3MCG1 1OF2A 5KSVA 1FGNH 1DQLL 3HI1B 4ETYA 4H88H 4D3CL 1S9VA 4KXZI 1AJ7H 2GJZB 2ZUTA 5TE6L 2QADD 3VXNA 1NUGA 1DBBH 1ACYL 3DPBA 4HS3B 4U1SA 4HIJB 3O6LL 4JANB 2VDPH 3J7HA 1AQKH 2D31B 1WZMA 3PDOB 3STLB 4JLRB 1CFSB 5LGJB 4P4RB 5FV1L 2CGRH 5IF0A 1FL5A 1WBZA 1IGJA 3GSVA 4JQXC 2H32A 3OB0K 3U4EA 5F89B 4TUJA 4OAWB 4YDLB 1JYNA 4XXDB 3QIBD 4UV7L 3PABB 1HKLL 3BPLC 1TVDA 3L5WA 4HXAL 3D25B 2E9WA 1Q9LB 2W9EL 4PGJA 3MYZA 5CEYB 1PAMA 2A74A 3MROB 5F97E 3CNKA 1WLHA 3T3PF 2OTWA 1XR8B 1SHMA 4Z95H 3OJ2C 5DT1H 3WDIA 5HDBF 2A9ML 2Z8WC 2NY0D 4M7JH 2CD0A 4G6KH 5IVXF 5B3NA 3ULVL 2RR3A 5CGYD 1ZHLB 1BQHG 3TN0A 3RP1A 3VWJD 5C09B 4E5XB 2P8PB 4PRNA 1EHXA 1TCRA 3UPRA 3CMOL 3MJ8A 1KLUB 5DT1L 4F7PA 1H8OA 4M8VA 2WANA 2C3GA 4LIQH 4EI6B 3VXMB 4IIQC 3LN4B 3WXWH 3QDAA 4JCLA 1II4E 3B9KA 1DQDL 5JIPA 1UXWA 3IRZA 2EXWD 3KPNA 3ULSA 2X4NB 1R3LA 1ZE3C 3HB3D 2XWBA 1CLOL 2DWDB 5D1ZB 2BSTA 1TPXB 2H2PC 2ESVD 4DN4H 3MLSL 1X5KA 3MUY1 1I8LA 3GBLA 1G7QA 5ABDE 5JZ7D 2HJLA 4DTGH 5I8OH 3EO1B 4WHCA 1JZ3A 3QNXB 4G6AC 1MSPA 1FL3B 1JGEB 4PJHF 2ITCB 5C07B 4ESKA 5IG7B 5I17B 1RIVL 3CSBA 3CFCH 5E9DA 1EEZB 4GXVL 3FO9A 3LH2H 3BGFB 5FYKE 4JO2L 1YPZE 4NZTL 2EIEA 2I9LB 2F8OA 3VG0L 4P46B 4UQ2A 3NH7H 5AZ2L 3QUML 5KJRH 2XXCB 2FZ3A 5E00B 1IC1A 2ZOKB 1PBYA 2FIKB 1ZLSL 1KPUB 4E9LA 1EHLL 4YAQB 4HQQL 1XCTA 4YO0B 4KZEH 2Y6SC 5JXEA 2A77L 4MNQB 3GMNA 1BFOB 5DTFB 1WTGT 3ES6B 1CLYL 4Z8FL 3L9RA 5D7IF 5FGCB 3HZYB 4B50A 1TETH 4IDLA 4BZ1H 4D9LH 2QSCL 1ZWIA 3TNNB 2V2XB 2A2QT 2XACC 4Z8FH 2XG5A 4HIIB 2VH5H 3SE3C 4J7RA 5KSAA 1IQDA 3UJIH 3F7PC 1C1EL 4HWZB 4YDLC 3S5LB 1HQ4A 4NC2B 3MRIA 4LMQE 5CEZE 1ADQL 1IAKA 5EWIL 1GGCL 1JHKH 5EBLA 3TWCH 5DRXA 3DYPA 5F96H 5JOFA 1L0XA 4QY8A 4NN5C 3S4SB 4DFIA 4GSDH 3VH8G 1JHLH 1YUHB 4YHPB 5K9QI 1FNGB 5DD3H 3VFVA 2UVEA 4HWEH 1EHAA 3N85H 5E8EA 4DGYH 2NTSP 3E6HB 4BH8B 1VFAA 3IT8D 4QLRA 5L2KA 3G6JF 5C2UB 2XG4A 4TVPH 2FR4B 2A6IB 3I75B 5ANMA 2WUBH 1PYWA 3FFCD 5J0BA 1XGQB 4K3EH 2ENSA 2YEZB 1SYSA 1BZQK 2VTFA 3C09B 1YMMB 1MUJA 3O0RH 5IJVB 1N59B 1J0JA 1OWWA 5D6CB 5TE4L 1IGCH 5F6IB 3MBEC 4JM4L 4UU9B 1L9NA 2HRPH 5DQJB 5DFTA 3EW3B 3FT3A 5ISZE 4JLRA 1TPXC 2CUIA 3HC0A 3FAWA 3IFNH 5TGBB 2DF3A 4Z7NE 4G42B 4HH9A 3W0WE 4H1LH 4Z7VE 5BW7C 3LQZA 5BS0E 4H26A 3IJHA 4PRBA 5IOPB 4XTRD 3SE4C 5HYQB 2NX5D 4P99A 3HC4H 5E8NA 3SJVB 2YKLH 4IJ3B 5FYKL 4R7NB 5FYJE 1DQJB 1AGEB 2DYPB 3R06B 3DROA 3EFFB 5KZCD 5F3HB 1TXKA 1FQ9C 2BOBA 5KANG 4YHOH 4LLDB 3EAKA 3GJFH 5C0AD 1T0MB 4ACPA 4YDJB 4P2QD 4U6TA 5ADOL 5ID0A 3EIFA 4LOUC 3NZ8A 4HMEA 4M3JA 2R39A 3FFDB 3K2MC 3CK0L 4OJFH 1TZIB 2VLLA 4JR9L 1A7PL 1SEBB 1IGFL 2X5PA 2FJGB 2XY1A 3D69A 3GI8L 2VAJA 1U8KA 3BESR 4QXUH 1SJVA 4W70A 3I02B 3H0TA 4MHHI 3KNBB 4ELMF 4WTWA 3HMWL 5L8JB 3HZMB 4HHAA 1YJDL 1HHJA 1YN6B 3MBEA 1SJEA 3BPNB 1IAOB 3WO4C 5E6IC 2ESVA 3RBSA 4QXUL 3QDJD 3ARPA 1MCSA 5IFAH 4ODUA 3OAYK 1M05B 2GJ6B 4LRIA 2A9NL 4G7VL 5BW7A 3QFDB 1BLNB 4NN5B 4K3JH 1CR9H 2MQ3A 3RL1B 1FC1A 4O9HH 1LK3L 4LAQL 1OTTC 1TJIH 1XH3A 1UADC 1T7YA 1EA9C 4OT1H 4WGWB 4JE4B 1WAAF 1YYML 4WHYH 5I18L 5EZLB 2E5EA 4EN3D 3VW3L 1BD2D 1WTLA 1LD9B 4XP4H 5IF0B 4YBLC 5IM7B 1Q0YH 1R3HA 3FB6A 4KY1H 4HKBB 5KANI 4NUGL 4J4PC 2X1WL 3FTGB 5GPRA 1GC1L 3C09C 3BWUC 5KW9H 3GMNB 3K1DA 2HVKB 4JFYA 4KROB 1HYSD 4N68A 3CDCA 5DSCB 4JJHA 1G7MA 4R7DA 1KJ2A 3VXTB 4WFFE 3U30B 4PJ7A 5FEBA 4APQB 5TPWL 4OZHF 3LCYA 1VERA 4MHHG 1VEPA 1YECL 1NCUA 5BRZE 1JNHB 1CL7L 1KJVA 1G9ML 3MCKA 2IPTH 3V5KB 3I6KB 1F3DJ 1BHGA 3D2UD 4YQXH 3QDHA 2WBKA 2R56L 3U2SA 4D0DB 2VZVA 3K8LA 2R2BA 3F5WA 1B0GB 4HWBL 3VFVB 5KVEH 3DTXA 4UAOC 4YEEA 3NIDE 3H9SE 2YSSA 1AD9A 5HHOA 1I7TA 3SKMB 3GO1H 2P5EA 3K4DA 1FFRA 3KPRA 4Y2DD 5C7XL 2EDEA 3DXAD 2XA8L 5EBWA 4XC1H 3W2DH 5D7IE 1U93B 3VRJA 3V0WH 3FCTA 5FOBA 4MJ6B 3FN0L 3QXUA 6FABL 5E99L 4LQFL 1D5XA 4GQ9L 1IFHL 4PGBA 2CUHA 3WO4B 4WVRA 1U3YA 2PO6C 2BNQB 2X1OA 2XA8H 5E6IB 3C5ZA 3UTSE 4Q9CA 4OI7A 2Z92A 4PGZA 3PL6D 3MREA 4FNLL 3SDCA 3WLWD 1CBVL 1F3JA 4G8IB 1FFNB 4LL9A 2QADC 2AI0H 3HI5L 4ZD3H 4WWKC 2VDKH 3KYMA 4FQCH 2YD9A 5DJ2B 1DBMH 1RK1B 2Q8AL 4IRJB 4U6YB 2R2EA 3EYVA 1HILA 4XCYB 1TZGL 4PJ5B 4E0RA 1TVBA 1KFAL 3PJSA 3SDCD 2P24B 4YBLB 2VR4A 3ZTNH 1P7KA 4JJ5A 5CILH 5IJKA 3MA7B 5EBMA 3RA7L 1UJTA 5T5NG 3DMMC 2R2CA 2XN9D 4FTVB 1GGTA 2FL5B 4FXKA 1S9XB 3QI9D 1BPVA 1RZJH 5C09E 2RFXA 4M61B 2ZSWB 1URLA 4I18A 1QFWH 4CVWA 3QUZD 4R2GC 4DQOH 1AGDA 2P49B 1KB5L 1MWAA 2R1WB 3I6LD 2GSIB 3PIQA 3ABZA 3FO2B 5J7CC 1KCSL 5CSGA 2BERA 4X4MA 4YPJA 4JFEE 5ALCL 5DVOA 5GS2H 2X4OA 4ZQKA 1PX3A 2JF1A 3BYYA 2HLAA 5AUMA 5T3XE 3T04D 2Z31A 2BHUA 3QUZA 1CD1A 3MGOB 4NQXB 1ZKAA 1I3VA 2ATKA 2OTUB 3FQWB 3P11H 1B4JH 4LNVA 2FR4A 3TA3A 3TZVD 3CLEH 5IMOA 1SY6L 4BQCA 2F54E 4WIQA 3GMMB 4JHWH 4L4VA 4B0MM 3MUZ1 1JZ6A 1BZ7B 3TT1H 4JY6A 4WTZG 3CZFA 5DF0A 4UAOB 3BYTA 1NDMB 1ZVSB 4ZAKA 3MROA 3VA6A 5T1KA 1A1MB 3KWWA 4QRUB 1JK8A 4O51B 2RGSA 2A73B 4WEMB 1JGUH 3RZWA 2AVGA 3H9SA 3MV8E 1EAPA 3RPIA 3T2PA 4D94A 2UUDH 3JV6B 4G9FE 3FONA 4HXBL 2HJKB 5IMMB 1P2CA 2E7BA 3NIFE 4DZ8A 5ADPL 4LSRH 3DJ9A 3DURB 3G6JE 1QBLH 5FDYA 1JN6A 2PO6B 4NO2B 1PEZA 5DLMH 2OK0H 5ECJE 1DN0B 2NYYD 2G60H 1ITCA 3G6AB 4I2XE 4X4ME 1QRND 2OZ4A 1K6QL 5EH1A 5HYJB 3C2AL 1L7IH 4H88L 3RZCC 4D3CH 2B1HL 5GGUA 4P9MH 4XXDA 2P43B 4MXVE 5SWQB 4N1CA 4KJQC 2XTJC 3VI4F 1CGUA 5EUOF 2ZUVA 1BMGA 4YNYB 4OD1H 5FO7A 3S3SA 4L5FH 4TSCH 4O4YL 1QNZH 2DQDH 3QDJB 2DMKA 5FA3B 3DGCR 1WT5C 4CU8A 4TNWF 3QXWA 2HJFA 2GJ6A 4R2GB 5I1HH 1ZS8A 4JAMB 5DUPH 2N7AA 4OCXH 5EIIB 4RMQA 1UH4A 3O4LA 4HMDA 4HS6A 3QXAB 1A4JB 1ED3B 1KYOJ 5HHPA 2ORBH 1QLEL 4KK8C 1NCWH 2DKSA 4KJYA 4ZPVA 5DRZA 1A6WH 2EYRA 1OM3H 3T09A 1ACZA 1KB5H 3HUJB 3OWEA 1KELH 2WUCL 6CGTA 3FQRB 2XZCL 2ZCLL 3LS4H 1GL4B 4XXCC 5I75C 4YHOL 1J86A 1L0YA 3O3AB 3D3VE 3GMPA 4NP4H 4BK4A 3O4LD 4MVBC 5HGDB 4L4TB 1CL7I 4ZTPL 3SCMA 4QRRD 3TO4A 4NKQB 1XGRA 4DCQA 3O3DB 2YD3A 4DN3L 3RVVD 1U8LB 2RB8A 3KPQA 3PV6A 4M4RA 5DJ2A 3CVHL 4U1NA 5DJXA 3QO0A 5EORL 1FL3A 2FSEB 2DQJL 3MXWH 3NIDF 2CKBL 5TF0A 4GW1A 1V7NL 1RUKH 5AEAA 4JFZH 4UT9H 1MCOL 4ENEC 4R26H 3SKOA 2IBBA 3QUXB 2A1WH 5A43C 4OB5L 2EDJA 1LO0L 3MV7B 4DKDC 3QIBB 4NYLA 1BF2A 1CG9B 3MJ9L 1BECA 4IIQA 1MLCB 2ZG2A 3EJJX 3S3PA 1LO2H 3QAZC 3SDAB 5F93C 4FFZL 1A9BA 3T2NL 3KPSE 4O2EA 1IC5H 4WFGD 4HUUA 2LV4A 1RAMA 4M8QA 1ZTXL 5AYQA 4LLVA 5I1CL 2FEDD 3PHSA 5DK2A 4HWEL 3HN3A 3V6FB 1MQ8A 5DMJB 5F1NA 2NY4C 3I6GB 4Y89A 4ZDHA 1HYSC 3JTSA 2NY5L 5L0QB 1INEH 4Q7DA 5GRWA 3NH7L 3EUUA 3OKLB 2IGFH 2YRZA 1MF2H 5CUSL 2ZUXA 4G8EA 3L7EB 3VWKB 1E6OL 4LKXA 5D6DC 1RZ7L 4XMPH 3VGGA 2EDLA 5T3ZD 4WI5A 2DM3A 1DE4B 3T0EB 2Y5TB 1IEBB 4OLUH 4AQ1B 2BMKB 4GKOA 1S5HA 2AK1L 1DQMH 4X5WB 1FH5H 4TNWK 2NLJA 2O5XH 4X7TB 4N0YH 4KK5C 4BA8A 3FAXA 5EC1B 5SX4I 1JGDB 5GRUH 2W60B 3THML 5I2IB 2X44D 3VXSD 3H7LA 5BVJA 2DTML 3MA9L 2G60L 3FHQA 1NCDL 1W72H 1EEQA 1KGCD 2GKIA 4C56D 1HN1A 1JNJA 1VFOA 4TULL 4NGHL 1E4XL 4PJXF 2DLEA 3AS1A 4O2FB 1HQ4B 1AKJB 2GITB 3E8UL 5L2KD 1KNOB 5FUOL 3T3MF 1IJ9A 4FZ8H 3GSUB 3F58L 4IMLB 3CH1B 4NO3B 3D18B 3BN9D 3W9EB 2DDQL 3MPCA 4PS4H 1PQZB 5BZWA 2R15A 5CIPA 2VQ1B 5K9JH 4WI9A 1B3JA 2YMXL 1UEYA 4QOKE 5CEXA 2DQUL 3QUXC 5GRUL 3VRIB 3V4UL 3GI9H 3QIBC 1DBJH 5DZNA 1KXVC 4MZ3A 5DQ9A 1DQQA 4NRZA 2VDLL 1G6RH 2D0HA 2GJ6D 1FNAA 4P2RD 2PR4H 1CLZL 4ZXBB 3T1FA 3TBYA 1NUDA 5ESAA 2HT4C 4PJHB 2CH8A 3H3PL 3HMWH 4KHXL 3WIFA 5JHDA 3DX8A 3SJVD 4HGMA 4K23H 5SWSE 1KFAH 3AY4C 5FUOH 5BVPH 1YEGH 4G7YH 1KCVH 3FQRA 4WUUD 4D9QE 3I50H 1LE5A 2VLKD 2NY4B 2VO5A 4HIEB 4Y19D 5E9DB 2FBOJ 1VFMA 5CEYA 2O61A 1FHGA 1TQBC 4QHKI 3HE6A 4ODTH 4PP1C 1J7VR 4AEHL 1JI1A 3AS2A 3FO1B 5F3BB 2VE6B 2W1NA 5HYQA 2ZOKA 1I8KA 2NXZB 3P0GB 4KKCC 3U4EB 4Z0BL 3VGEA 4HAGA 2BVQB 5D7IB 2PO6A 3MRQA 3AGVA 4RISH 2HAZA 3GKWH 5E1HB 3H2WA 4R4NC 3RL2B 3T0EC 3FQNB 1T0MA 2PETA 3QDJE 1A3LL 1YJDH 4NWUH 5A2KH 4RA0C 4R4FL 4ODWA 4PLKD 3TO2B 1J5OH 5JNYB 3C8HA 3MOAH 4GRMB 3S88H 1CU4L 3EOBB 1QFUH 3SKMA 5FF6A 3PDDA 5H2BA 1WWWX 3RNKA 3MV01 2IGFL 5F1IA 3VFUB 3MJ7A 3GRWA 4WCYH 1S9VB 5GGRY 1U95A 4JO4L 5IGXH 4OJFL 3LKOA 2IEPA 4P57B 2X4SB 2CXGA 3ZYIA 3D5OF 1EAJA 1BQHB 1IT9H 3TFKD 2A6JA 5I16A 4KJWC 3ARGB 1WBXA 3KPRE 1JTOA 2B8OT 1P84J 4R2GD 1JNHA 3EOAB 5F88B 3MREB 4DGYL 2ICWB 2GEEA 4ERSH 1P69B 3CSYA 5B22A 2DLGA 5H8DA 3R1GH 4NDMA 1I8MB 1R5VB 3QQ3A 2AXFA 3KPPA 4U7SA 1Y0LA 3OKEA 2V2TB 4HCRH 4IOSD 3QG7H 1MRFL 3LB6D 3GBNH 3OKDB 1A6VL 5BS0D 4MA3A 5D2NB 5IB2B 4J3WA 3VXMA 3W9DA 5ITBL 1TQCB 2XXMB 4JM4H 2DI9A 3IU4H 4ZXBC 3MV9A 2UZIL 3FQXA 1NLDH 4K7PX 1P4IL 4UZGA 2BNQD 3SKJH 3WN5A 3SGJA 1NCNA 4P2OA 4XP4L 3BIAX 4B5EA 3VXPA 5HGGS 4ZNCD 2NXZD 3GSNH 1MWAL 4KHTL 1AD0B 4NQED 5IBLD 5GRJH 3VXSA 4Y4HA 3SPVB 4AL8H 2QQNH 2OR9H 4M03A 1TQBB 4NHUB 3LV3B 1T1WB 1KCUH 4M1CD 4DVRL 2AJ3B 3NPSB 2WW8A 3RAJH 4HS8H 4N8PA 4U6VL 1T1ZB 4DGVL 1RJCA 3O6KH 4NSKB 2W9LA 2VXSH 3BVNB 2NXZC 4G9DA 1OP5K 1MREH 4H1LG 3MRKA 5F7LB 1JHKL 4N0CC 4L8CB 2C3VB 3SQOH 4YO0A 4J23A 4L8BA 4EI5B 2PYEA 3LEXA 3EZJB 4KFZC 4OIIH 2DBJA 2FD6H 1HWHB 1A2YA 1N59A 4NP4L 3KNBA 1ZA3B 1NGWB 4U6HA 3O9WC 1HQRB 1LK2A 1WSST 1P9MC 3VXME 4NQSB 4I18B 2QR0B 3V52L 5DS8A 2YC1B 2VZ1A 1CF8H 1BAFL 2NX5E 1KCVL 2ADFH 2ICEB 2BHYA 4PGBB 3GK8H 4Q2ZB 3ARGC 3BT2H 4PD4K 2QL1A 3RJDA 4EJ1C 3C5SA 3SOBL 4OZFG 5KSBA 3EYUL 3VCLB 2I07A 4WFHE 3QI9B 1T83A 5LBSL 3FQWA 3HC0B 1C5CH 4LSPL 1RY7B 5EO0A 4MNQD 1FO0B 1GZQA 2F58L 1UWXK 4JM2F 3FB7B 5D7KE 3BKMH 3T8XB 4L3EE 4X6DA 2F53A 2X4QB 4I0PC 2V9TA 5EUKA 5D2NC 4HXAH 3BEVA 3CXHK 1Z0NA 2VKXA 2UUDK 4IRJD 5B4MD 3OHXA 3WLWC 3TYFA 3CGTA 4GRLB 3UTTB 3V8OA 1DQDH 2Z8SA 4BSJA 3HMXA 2SEBA 1JK8B 4HLZH 2FX8H 4O51A 2BVOA 4PJFF 3QDJA 1U92A 3QHFL 1KNOA 4RIRA 4G6MH 2ZSWA 4AY0A 3Q6GH 1D5ZB 4JFOB 3T0DA 2V5MA 2ED8A 3QZWA 3REWB 1ACYH 1F6AB 1ZT4B 4QRTA 1A6TB 1BQLL 1QVOA 3ET9F 2AQ3A 3IDYB 4J3TA 4LLUA 3QJHA 4GW5B 2XTLA 1YMMA 4LKCB 5IJVA 1MIMH 2ICES 3P73B 1AKJD 4XNMA 1GGCH 2XY2A 3DETD 1RMFH 3ARGA 1DQLH 5HYSA 4ZOCA 3QUZB 4X7SL 1FH5L 1T7VA 2EZ0C 3ARDA 1XF4A 3T1FB 3OR6B 2C1OA 1MCEA 3VMNA 4EI5C 1FZKA 2BC4B 1FLRL 5F7UA 1IAII 3PWJA 1DR9A 1XGUA 4HGKC 4KK6D 4JO3L 4YXHH 5J6HA 3DMMD 4ZMAT 2AJSL 1IILE 1ZOXA 1NLDL 4HV8B 4C54A 3O9WB 2E8ZA 5CILL 2BOBB 2YPVH 5I8EA 4KUCD 1BOGA 1T22A 5H37H 4HS3A 3B8SA 2X1XR 1XF5A 4I3SL 1U58B 1JMXA 2LQRA 5CBAA 4P59H 5DD1L 3DXAA 4GG6B 1CG9A 4L1DA 4YDKH 5HYJD 5HPMB 1C5DB 5I1IH 4MXQC 1UA6L 3C8DA 1DBML 1Z2KA 4M7LT 1KCUL 2VDKL 1IL1A 5KS9A 1CCZA 5HI5C 2CK2A 3D85D 3MSPA 4ZG1A 5I1DB 4LNRA 4C55A 2MPAH 4ZPTA 4OV5B 2EDWA 1NCCL 4U1LB 3BGMA 1RJYA 2D7NA 5F70A 2R9HC 1T1ZA 1P6AB 3QEQD 2FATH 3H42L 5HGDA 1QKZH 3SCMB 5FDWB 4OCYL 3F7VA 3O3DA 5DD5L 3PQYE 1T03L 1BVLA 3MV7D 5SV3A 1DVFB 3FT2B 4I0PB 5MHSD 1I9RL 4R26L 1IC4L 1MHHB 3VRJB 3S8WA 1KEGH 3L7FB 4GRLC 4LPCA 4OLXH 3ARBD 5BOPA 1KJ2B 4MNQE 2WINA 4MAYC 1DP0A 4YX2H 1IM3A 2O5ZL 3WHE1 4F7CA 1F4YL 2OYPA 1AIFB 5DFVD 4MA1C 2J2ZA 4ONGL 4N5UA 1IEBA 4QRRA 2ICWA 3PNWB 5CS7A 1A9EA 1KUMA 1MY7A 5FUCC 3HFML 3NIFF 4QO1A 4LCWD 1NEUA 1HSBB 2UZYB 5EZJB 2DLFL 4BFGA 1NEZA 2V7HB 5JORB 2MOVA 2NNAA 3UZQA 1FFQA 1A4KB 2EDXA 4YWGL 1J0YA 4PGDB 5B39A 5GSRB 4M48H 1UB5B 3IJSA 1YA5A 2V2WB 3DHMA 4L4VB 3LD8C 4LAQH 3QPXL 3MLXL 1S7TB 3QUZC 1NGXA 3C5SB 3QIWC 2P46B 1TTFA 5EZOL 4MYWB 3FQXB 3PWVA 3KYNB 3MMEB 4PREA 1U6AH 3PP4H 2NZIA 3EDJA 1J5OL 4NUJA 1W0VB 4R4ND 3T0ED 1G6RB 3RDTD 2RFXB 4YPGA 1IRAY 2IWGA 2W65B 4XCFL 1BIHA 2CDFB 2YOCA 2YS4A 5JW4Q 1AGDB 3TPUB 2NY3D 2VQ1A 3C5JA 4I0KA 1NC2A 1FE8H 2BX5A 4PJ5A 4KMTL 1U8MA 2QEJA 4BZ2L 3A6OA 4PJDE 1DSFL 5E9DE 4Q9RL 1I9JH 1DQQB 3QB7C 3EDEA 1HWGB 1M71A 3CFJB 4PBVC 4NKIH 5ADOH 5IHLB 5K9JL 1PG7L 4OFPA 4G7VH 1VFUA 2HJLB 5IP4A 4OQ1A 1FVCA 2D0FA 2R9HD 1F13A 3AUVA 2Q7NA 4V2BA 5E2VH 1YMMD 2IBZY 2HT4D 3PG2A 1MWAB 4UDUB 3FO9B 3D6GA 2DJ4A 1KJ2L 3VU2A 4O4YH 4XP1L 2XNAB 5DD0H 1CXIA 3Q6FB 4LGSB 2X7LB 4Q6IC 4FQ2L 3HR5A 3NMEA 2Y6SD 3QUMA 4PTUB 4RQQB 5CGYC 5KSUA 4GKZA 1NANH 3LY6A 5AUMB 4FXKB 2BNRA 2ZKHL 1N8ZA 2KDGA 2FIKA 1H0DA 1NSNH 2XFXB 4BH8A 4HS8L 4BZYA 1G7JB 1FNEB 2W9DH 4N8CL 3Q2CA 1FN4A 4YUEH 1YEIH 1XR9B 5JTWA 3EJYC 5DZLA 3HUJF 2DQGH 4D2NA 2NZ9D 1FIEA 1I1FA 1NFIA 4XMLL 1MFCH 1HILB 4XCYA 4AYFA 3WHE0 2VN7A 1SYSB 1RQ5A 3BGAA 4MA1B 5JO5B 5KSBB 3BH9B 2AAVA 5J1AA 5I6XC 1TTGA 5ERWB 1ZHNB 4ELMB 4HEME 3O45A 4KJQD 1AGFA 3SKNA 1KJMB 4YFDB 1NFDB 1S9XA 4OI9A 3IKCA 1KPRA 1S7QA 4HJJH 1JFQL 3CU1A 5BV7B 5GJTL 3BKJL 3EDKA 4HC1A 3CDGA 5D1QA 4JR9H 3QO0B 3BAEH 1F3DH 3QIWB 4P3CL 3PL6C 1I1CA 4RWHA 4GBXC 1JWUB 5CLTA 5D2NE 3D3VA 1I85C 4AM0B 3IDGA 2MMXA 4LGPB 5CGMA 3G5YB 4LAJH 3IVKA 5E4EB 1SYVA 4WV1B 5EUOE 3MV7A 4S1RH 5D2LF 4Z7WA 5ICYB 4W68A 4P23C 1XEDA 4K94L 1SJHB 2VXQL 4CUCA 1NFDF 1NGPL 1YEJH 4TVPL 4FFZH 4RAVA 2BNRE 1RZ7H 2E6JA 3D69B 2A6KA 3LQMA 4XRCA 5JZ7C 3E2HB 2YEZA 2UZIH 4LCYB 4EBQH 1VA9A 4NNXB 2J6EH 5TDOB 3ZE2E 2NW3A 4OQTH 3HE7A 1BFSA 2DMBA 3D0VB 3EFDL 1E4XI 2RCSH 1P5VA 3GB7B 4EDWL 4TUOA 4E41E 2HA1A 3T0XA 4JKKA 1IMHC 5D2LB 3RX8A 3QEGH 1VACB 1FZOB 2H26A 4KKNA 4PJBF 3NN8A 1QFHA 1G9NC 4OZ4A 4X6CB 4EKXA 3LV3A 5T3XL 2BOCA 3RU8L 5E5MB 1JV5B 2R4SL 2DLHA 3QUXA 3S98A 2HLFC 3T0EA 4HF5H 3K80A 1C08B 4NYLB 2BMKA 3PUCA 4ODTL 1EEYA 2A83A 4OFIA 3QXAA 2VQUA 4KTYA 4S11A 5KVEL 4L8DA 1A9BB 4G5ZL 1MCOH 4QHUB 4FFWC 5FCSH 3V0AC 3TJHC 2H45A 3LKRA 4OCWL 1X5AA 5D93B 5I6XB 4HF5L 4OFKA 2HH0H 4OCYH 4LGRB 3KGRA 4RAUB 1UXSB 5JHLL 1MELA 1TJGH 3WV0A 1N64L 1NH6A 5DJYB 3GMPB 2L7JA 4Z5RB 3I6GA 5D96B 5DD6B 3X17A 4XMKL 5C0GA 3M1BA 2I9TA 4G6ML 3BE1H 4N1EA 32C2B 4ZFZB 4EVNA 5C2BH 1FVCB 1LEGB 3UAJD 4OZIA 1EJOH 3FN9A 2VR5A 4XPTH 5CJXC 3INUL 4GBXB 2H3NA 2OP4H 4NJ9L 4HUXA 2OL3A 3RWFB 3M8OH 4JB9L 3TV3H 5E4EC 1UQSA 5ID1A 3STZB 3JTTA 1OSPL 2R1XA 3BN3B 1C5CL 1BVKB 4Y5VA 4P23B 5GISH 4N9GA 1RIVH 3D39D 4NZRL 1NCAL 2NNAB 4M5ZH 5J12C 2XTJD 4YGVB 4OD2B 4TPRH 1YEFL 3WL9B 1KXTB 3MRDA 1XR9A 4K23L 4NKOA 5CKGA 2HMID 4ZFFB 4FZEH 4CKVX 3OKDA 4KC3B 4WI6A 3RIAK 3MLSH 3TVMD 1GRWA 5C0RL 1JJUA 4GW1B 4WTXA 3WS3A 1LK3H 1I1AD 2AJUH 4PJDB 2ADGB 1MVFA 3VXUB 3BZEB 5ERWA 4FQXC 1MEXL 3WEXA 3C08L 4MJ4A 4YZFE 1F58H 3B83A 4N90E 1BBJB 2DYPD 3G6DL 4O02H 1ONQB 3RZCA 5FYJU 4OIAA 2EH8L 3P9LA 3FMGL 4KDVA 5DO2D 5FA4B 2NY3B 1ZT4A 4QRTB 4TQEH 1Q1JH 1CXKA 2VWEE 3DVFA 5C0EA 4OIIL 4PB0L 3OR7B 1BWWA 3TEUA 2VRAA 3RDTB 3ZKSD 3VFNB 4KK8D 1F2XK 2CLRB 4K71B 3W5MA 2HTLD 5MEPB 1X7QA 4KKBC 4R96A 5FO9A 2RHEA 3RWEA 3WFHB 2VAAA 3OZ9H 3MNWA 1FYHB 1NGQH 3D87B 1Q94B 3IDIB 2NY5H 4JG0H 3ZHKA 1U8QA 1HKLH 3N1GC 2AQ1A 4Y5YB 4WDIA 1LMKA 3RNKB 1E6JL 2YXFA 3T8XA 2AK4A 3GSUA 4OBSA 2OQJB 5FHBL 5T33L 4KK9D 2VN4A 3QIUC 1KCLA 1AO7E 1FGVL 5K9KB 2NX5A 4UNVA 3Q6FA 1ZSDA 1CFQA 2O93L 4U6XB 4XCFH 1DE4A 2BCKA 3GMQB 2A6JB 1YYLH 3RY5A 5EO9A 1A3RL 5F9DC 3OPZL 4YFLF 4GAJL 1JPGA 3QUKA 3QYCA 3W0WA 5HDQH 2D0GA 2EDDA 4HFWA 2V9RA 4K2UL 3B9KD 1FYTB 2HRPL 3KYMB 3L3OB 4MJIA 4MXWH 4MAYA 1BIIA 1U2CA 3L3DA 2YPLE 1OAZH 4U1HB 2CJUH 4F2MB 3O2WL 2VLRB 4YHMH 1A6ZB 2JKXA 1EHNA 3ZTJG 1QHOA 4RRPG 1S7XB 4GMSL 4MXVF 1VPOH 5DQ9B 3BUYA 3S6CA 3RHWF 5J12B 5CZKA 1H15B 1FAIL 2PCPA 1IBGH 2JJUA 6FABH 4KDWA 2AJYL 4KUZH 4WUUB 4EXPX 3GSQA 3X13A 3BFOA 1OP5H 4OTXL 2BDNL 2EYTA 4CU7A 1M7DB 4RX4D 3W9EA 5D6DA 3V7AG 2PW1A 4MNGE 5DJZB 3WO3B 1I7ZA 5AWNL 4L4VE 5HHMD 1R5IA 3RGVB 4ETQB 4CJ0A 4DGVH 4EI5D 2O61B 1IM3B 4OD3L 4H20H 5C8JA 2WBJB 4N0CD 2NZ9C 2W92A 2DQFA 4HUMB 5D7JA 4PTTB 1T03H 1FL6A 2NY1D 3X11A 3IETA 4E41B 4XP9L 4TYUA 1J0KA 4TSBH 5D9SB 3LZFL 1RZ8A 4OLYH 3BKCH 5A2JH 4K8RL 1A4KA 2XV6B 3U7WH 5E94B 3IFPA 5EB9A 5F7KC 2E9BA 4M93C 5JDSA 4K3HA 4G9FA 2Q8BH 4FQPA 2R0KH 2DM4A 3RTQD 3MV9D 4LCWE 3GJEA 4JRYD 3WCYA 5IESH 1ZLSH 2HRLA 1E4JA 1QSFB 5E7FA 4RGNC 5F7DA 5IEKA 5JOPD 1C16B 3GBNL 3BH8B 1Y18A 1SY6A 1A7RH 5AAMA 4AMKH 3QH3B 3RPIB 1KXQE 5ESVB 3PGCA 1GOFA 5E08L 3OXSA 2XKNA 2IADA 3KPSB 1MJUH 4JKWA 5BVPL 3EHBD 2VITA 3ULVE 2VH5L 2BOCB 2J8UE 3S9DB 4KRPB 3AMLA 4NN7B 5BQ7B 4Z76A 1CD9B 1EBAA 3P9LB 2NQCA 1YEEL 3QWOB 2F19H 5HY9B 4J8RB 1H5BB 3HNVL 3KLHD 5EZJA 3BJ91 3RVWD 4LIQE 4ONFH 3VXQB 4NKMA 1AP2A 4HH8A 1ND0A 4QT5A 4Z7VA 1K5NA 3EYSL 5ICXA 4RAUA 1PVHA 3FZUD 4GAJH 5KW9L 5C09D 1A2YB 2YPKB 5GRYA 3VGHA 4BYHA 3MNWB 3KLHC 4JO2H 2GAZB 4APQD 5H35A 2F5BH 5IVXB 1U8QB 4NUJB 3RHWK 5GS0C 2BNRB 5GXBB 1QRKA 3BD5A 3WFBH 5F6HJ 4FQIL 1AGCB 1RZFL 2O5YH 1VFBB 1D6EB 1BEYL 1F42A 4S1SH 4EN3C 2Y1VA 3RGVC 4Z7UB 3BRFA 1U8NB 2WBJC 1T1WA 3MLYL 4Z7NF 4WENB 5J1AB 3F58H 2ZJSL 4PRPE 4JQIH 5F1NB 3ZE1F 5IHUL 4N1HB 3W0WB 1EO8H 4KZDL 4Y8DC 1A02N 5LGJA 1MH5B 2KQMA 1L6ZA 1VKXB 3OJVC 4JFDD 4PRHD 3MNVA 2W0PA 4XNUH 5EUOA 3HCVA 4TUJB 2VL4A 1D5BB 4F7EB 4M5ZL 1CGYA 4U2YA 1BM3L 4GG8A 1S7XA 1YEDA 3BD3A 5KVFL 4S2SB 4HV8A 3GSOB 4HWBA 5JW3H 3OQ3B 2YPLB 3IDJB 5E2JA 1I8LC 1S7UB 1OSZA 4HX1B 3H9SD 5GSVA 3MACH 5CSZA 5E6ZA 2H2SD 2Y5TA 2E9JA 3JWOC 1FDLL 1N8ZB 4DKFH 1Q72H 1Z0MA 2Q1EA 5FYLH 2PYEB 3GSRB 4LCIH 3FB7A 5B8CB 3V0VA 1HHIB 1KN2H 5HDBE 4MSWA 5L7XL 3ARTA 4KRPC 4O58H 4GJTB 4G6FD 2VLMD 3TCLB 3FO0L 5JA9A 1QYGL 3QNZA 5GGTL 2UYLA 1A7RL 2KL6A 3TV3L 3WUWG 1H5BC 4WJ5B 4P2RA 1YNTB 1OW0A 4KJWD 5DK0A 5IB5B 1X4XA 3T4YA 3HZVB 1C5BL 2QR0A 1PZUB 3FZUC 3RVUD 5HGHB 3MRBA 1QD0A 3EO1A 5TDNA 2R0KL 1J10A 4F33B 3LIZL 5DMKA 2IANA 3S97C 4OF0A 1OQOA 3HAEA 1RK0A 4PY7A 1HXYB 1ORQA 1JWUA 5EA0H 3GSWA 3K81A 2JIXB 4L9LC 5LAXA 2Z93A 1CDYA 2IPTL 3SO3C 4D9LL 3ZDYE 1UACL 3DI2B 4F3FB 2VZTA 1QLRA 3M45A 4QRPA 2FGZA 3FKUS 4JM2D 2JCCF 1ORSB 2AV7B 3MO1B 5E08H 3C60A 2VLRA 4HFUH 2VC2H 4OCRL 3DWTA 5JLZA 1NQBA 3BSZL 4P9HH 4Y2DA 3GIZL 5JIIA 4XNMB 5BVJB 1I3RB 4JZJC 1Q9OA 3D9AH 3I9GL 1QFWM 4U6VH 5EO1A 1F4WH 3OJDB 2Y5EA 1T4KA 3MR9A 5B38B 1HK6A 4PLJC 1KIRA 1U41A 3GIVA 3QG6B 2DWDA 2VSCA 3MFFA 4MA7H 4TTDC 2VWEC 3WKNA 5EOCJ 3QP3A 1N0LA 1G6RA 1TMCB 2A0LD 3IGAA 3Q5OA 2ID5A 4OD1L 3W81A 4POYA 1GPOH 3TBTA 4QGTA 4Q6IA 1A8JH 1P4IH 5E5UB 3Q48A 5FHAH 4LVEA 1HZHH 2E7MA 4HPYH 2IAMA 3QJFA 4GH7B 4I3GA 2MCPH 5AAWA 1RJYB 4Y16C 1H3UA 4YBHA 5DO2C 1XIWC 4OGAD 3RNQA 3QCUH 1G7HA 3WNNA 2R0LL 3E6HA 3UTTE 3DETC 4J3XA 2XICA 1X5JA 2DQDL 1UCBL 5B8CC 5LQBL 2CDEB 2E7LC 4L5FL 4OFVA 5MEOA 5CHNB 2XQBH 4ZO6A 1EO7A 1S9YB 1WEJL 1CT8A 1OOAA 4BQ6A 1FP5A 1WISA 1IM9D 3GI8H 4XVUC 3QDME 5LCVH 2ADIA 4GS7C 4X99B 4Z7UE 3CK0H 1MI5E 1CD0A 1IT9L 4Y4FD 5LGKA 3MRPB 5GS0H 1ZHBB 5LJYH 1D5MB 2XRAL 3ARRA 4O00A 4KTEH 4NZUL 2DIJA 1ZA6A 3EYFA 4RGOH 5C07D 3WSQH 2E27H 1I8KB 3HRZA 2W9DL 4JRYB 2C1PA 4PRAB 5DUPL 1ZLWK 5KSBF 1XGTA 2YN3A 4X6FB 3QXDB 5DUMH 1AO7B 3GZKA 3R0NA 3H7BA 4MA3B 3RL2A 1J8KA 1JPSL 3V5DA 1S7UA 5SWZB 2CIIA 1MAJA 3AREA 2VDQL 5FO8B 5D1XB 2KKQA 1R3KB 4MZ2A 1HSBA 5JPMB 5ALCH 3RX7A 2K1MA 2W59A 3EYVB 2R2EB 3OKOA 2ARJA 1FYTE 1FG2A 3U0WL 5E4IA 3L6FA 1R5WB 1D9KB 3ZE1E 2VABA 2Q76A 3QO1B 4PV8B 3UP1A 2FIRT 1Z9OA 3GKZA 4PRPB 5JXAH 3UZEA 4TUKL 2YWZA 2I9TB 1SJEB 2KH2B 1MPAL 32C2A 1ZEAL 3WKMH 2Y7QB 5DMGC 4XVJH 4X6BB 3BKYH 5D5MA 5BV7L 1QBML 5JUEH 3RY4A 3QEHB 4BKLB 4U0RC 1T0NB 5C0BB 4GRWE 1CICA 4TRPL 4NCC1 4XWGH 12E8L 1NLBL 2CDFA 3RRQA 2EDNA 4JN2A 3GIZH 4JM2B 4YHZH 3C5JB 4OLZH 5ISZA 1I8IB 3HZKA 1JGUL 1MVUA 4R4BB 4Y16B 5DRWA 5ICZB 2HN7B 5IB2A 4JFHE 5JW5B 1QACA 4K3DH 1MHPH 1F58L 2I60H 5BMFH 3QUMB 2AKRB 3BJLA 4GMTL 4UNTA 3UJJH 3M17B 2BY1A 1R3IH 4MNHA 3GMMA 3LQZB 4K3GA 2FJGA 4PJBB 3KXFE 5JA8B 1LQSR 3UYOD 3T77B 3T0AA 2ADGA 5D2LA 3IFLL 2CK0H 1WBYA 3DUUA 4Y4HB 3SPVA 1VACA 4DKEH 1ES0A 5E03A 4EN3A 1IE5A 3MR9B 3VXUD 5LG1A 5C7XH 4GSDL 3TIEB 3MA9H 4AT6B 1BD2E 4YDKL 4OUOA 3S96A 3CFDB 4R9HA 3DV6B 1KN4H 2C4FU 1M05A 1MRFH 3KPTA 4RWYH 2IFFH 4ELKB 2PYFA 2PUQT 1OB1A 2ZCKL 4P49A 1KOAA 1M6OA 4BH7B 1KACB 4OFYD 4LCIL 2EE2A 3RVXC 5AYUH 5DJCA 1RUQH 1T7XA 3LZFH 4CVZB 1T3FA 4D8PB 4PBXA 4Z78A 4YFLI 3QXVA 5D7LB 1NFDA 1N6UA 5C0GB 5T3ZE 1U91B 3KPLA 4GG6F 2Y9RT 1X5ZA 2FLRT 5DR5H 4ZUSB 4PYHA 1F4XH 4EZMA 1BM3H 2OL3L 5IVOA 4PLOB 4WU7B 2Y25A 1CE6B 4PP2A 1D7FA 4F3FA 5EO9B 1BJMA 1IGML 3ZYJA 5GS1C 2DL2A 3EHBC 4P2QE 4XPAH 3FO0H 3AAZB 3VXOA 1EO8L 4FQHA 4U0RB 1HI6A 5EU7C 5L7XH 5L9DL 5DEFA 1FO0A 1CD8A 2K3TA 5IWLC 5KSAC 1DBJL 1WFUA 5DWUH 4PJDF 1KG0B 1QBAA 1U42A 4OZHA 4QT5B 4W6YB 1HH6B 1A14H 4PJAE 3SDXA 2LU3A 3ILQC 1Q8MA 2HKFL 4NN6C 1TLKA 1WITA 2AJXH 4HG4J 5E7BA 2VXVH 5DA0B 3U4BH 5B3JE 4LLYB 1R24A 2Z91A 3QXTA 1BVZA 3V5KA 2YK1H 4P5KA 2AEQL 2DL9A 5DVMA 1BFVL 3FFCE 4W4NA 2WBWB 4N0FA 1X5FA 3KJ4B 4PV9A 3CUPA 4ZUUB 5BZDA 3O3BA 1AJ7L 4C59B 4UMGA 3W5NA 2X4OB 1X5IA 4JFFD 5EZIH 2ZCLH 2NY6C 3LS4L 3FT4A 1S7WA 1OPGL 5DJYA 1X7QB 5F9JB 1NGQL 3LRSB 4OKVA 4ZTOH 3MCKB 5D7LD 4UILL 1AGBB 4U1KB 5DHVH 2ZUUA 3RI5F 1ETZB 2H2SC 5IW1A 5IWLA 1CGXA 5EUOB 2N4IA 1C12A 3RJQB 3PL6A 4LSRL 5FYKH 1R0AH 3EDFA 3VWJA 3EJZC 3T0EE 1YEDB 1JPST 1FZJA 4G8GD 4LP4A 5CBEA 5GHWL 1ZHKB 3WSQL 4OT1L 3B5GA 3KYOA 1HCFX 5ILTL 1YY8B 5HHME 4Z7QE 5JXED 4YAQA 4PJ8B 3TBWA 1M7IA 3WFDL 4G8GA 5B8CA 4GBXA 1RZKH 1UB5A 3AB0B 4HBCL 5KVMC 5GS1B 1MWAH 2QQKH 3NOIA 2CIIB 1B6UA 3T3ME 4PJEF 1QRNE 4XNQA 4WI8A 2X4NA 1QR4A 1YMHB 2R1YB 4NCC2 5DD6A 5M95B 4NNPH 4ZFOL 4UUJB 4POZC 1UKSA 2R0LH 1I1AB 3KPOB 4GRWB 3HPJA 5DD3L 1X44A 4MAYD 4XPGH 2BFVL 5D8JH 2VLME 3TH4T 1QUNA 2VLJD 2D7PA 2ZZUT 4ODBD 4NN6B 4I3RL 4ORGA 3MV7E 4K3EL 4QHLA 2XRAH 3EKCA 4N8VB 3VWJC 5IESL 1RIHL 4MMZC 1N7ML 4IDJL 4YHPA 1YUHA 1UQSB 4RGMC 4JZNA 3RUGF 3C6LB 3G5ZB 5E8EB 5J3HD 1KBGH 4AEIH 3QHZL 5TF1H 2FD6L 1XF2A 3TT1L 1T0NA 5C0BA 5FM4A 5IMOB 4FG6D 4X5XA 2VMFA 1SJXA 4PRBB 3QEUA 5IOPA 2EYSA 3BKCL 4HWUA 3CD4A 2WUCH 3P4OB 4F7TB 1S5IL 4KH2A 1HCVA 3MBXH 1T20A 4ZPVB 1MI5B 2A38A 5DFVC 2P5EE 4JFDE 1YNKL 3R06A 5CJOH 2HLAB 5DQJA 1I9RH 5BXFB 1BD2B 4LSDA 5TJWK 3OKNB 4FG6C 4MD4A 1N5YH 4LSUH 2OX5A 1WIOA 1GPOL 3MRCA 3RI5K 3LSOB 4C4KT 2X89A 4PJFE 2E6QA 1FNEA 1Z9LA 5SWZE 1BIIB 1P7QD 1CICC 4O58L 3PGDB 2EDYA 3W39B 2DYPA 2WWKO 4X0KB 3D0LA 1JIBA 3IRPX 3LMJH 4F37K 1DEEB 3RVWC 1ZANH 3FO1A 2J88L 4KK5D 2FHCA 5DHVA 2HJFB 4NJAH 3UDWC 2CLVA 2CMRL 3OMZA 4ODUB 3WE6B 1TZIA 1RURL 2VLLB 2X09A 3GBMH 2AERT 4JGJA 3CMGA 2HKHH 4NWTL 4UI2A 5L8LB 1NAKL 4OM1L 3AB0C 1ZV5A 2PXYA 3S34H 1WICA 1KC5H 5F89A 5D1QB 4PJCA 4Y19A 5KAQF 1Q9OB 3MUGB 1QNZL 1MFEH 1GYAA 4PJXB 5MEQB 4X6CE 3LKSB 3BUYB 3QQ4A 3U7AA 5A2FA 2EDTA 3IDGB 3VXRD 3LRSA 2EH7H 1I3UA 5IHUH 4KZDH 1MJ7L 2LTQB 4M9OA 1F6LL 1NPUA 4IRSB 2OMNA 5TDNB 3WFDH 1FYTA 4P5TA 4JPWH 5GIRA 2JJTA 3PGFL 3BP5B 4F9LC 1AY1H 5HI4D 3V5HB 3WUZA 2BVPA 4TSAH 3VWJB 4ODSL 5I74C 1KTLB 4UV7H 4MWFB 4ZO7A 3C6LC 4JFFA 3NFSL 1VENA 4APQA 5F7EH 3DTXB 1A3LH 1JZ2A 4Q6YA 2AK4E 3P0VH 4Z76B 4XBGA 4PJ7E 1PZ5A 1I7RA 4KRMB 1LO5B 4Z95L 2ZP0T 3CIQA 2IQAA 4QXTA 1A4JA 1ED3A 5HHPB 3HRPA 1FORL 1W8NA 3L3KA 3O6LH 4KXZH 4C4KO 2GFBA 5JPMA 1G7QB 3QH3A 1T2JA 4Z0XA 5LVEA 3HUJA 3F6IA 2DQIL 4OFDA 1BZ9A 3NFNB 5DJ0A 4P3DA 4OF7A 1AHWA 3CXHJ 4WEUD 3LEVL 1CLCA 1EEZA 2B0SH 5DWUL 5FAAA 1JYWA 3O8XD 1EJOL 5GGSA 4JGUA 5JW3L 4OF3A 1MEXH 3ECBA 5B4MC 4RFEA 1ZLVK 4KK9C 5DJ6A 3ULUH 4M5YH 4WTZA 4WW1B 3IXTA 3IGAB 4XNYH 4YHZL 15C8L 4LFHG 2BY0A 1OCWL 2XZQH 3RWHA 5JHLH 1CICB 1CTOA 1QZ1A 4YXKL 3DX6A 2EXWC 1QOKA 1GGUA 5GISL 4LLQA 4PR5B 3F5WB 4LLVB 3UYRL 1UVQA 3TCLA 1I7UB 2NCMA 5EZLA 2OS7A 5BQ7A 3BWAA 5CAYB 5TQ0H 3BVNA 5INDA 1V5JA 3O6FA 4MMXC 3MRKB 5D70H 1TZHA 3SDAA 4J4PA 2NW2B 4U1GB 1JWMB 5KTEL 3B2VH 4FP8H 3B43A 4NQEE 1QHPA 5ESVA 4FS0A 4Y4KB 5T1DL 3LRHA 2XKNB 4O5LH 1MCHA 3CX5J 2R4RH 3WLBB 3PP3H 3E1F1 4L8SB 5ITFA 2GK2A 1J1XH 2XQBL 4LASL 3DSFH 1JUFA 5DURD 4OLUL 7CGTA 4PJCF 2J4WH 5J56B 2JCCB 1E4WL 3TP4A 3QHTC 3VD3A 1JGLL 4H1LB 5DMIH 1HSAB 5ID1B 1DBBL 3D39A 4IRSC 4OBRA 4G3YH 5JMRA 4GKSA 3CFDA 5FM8A 2YBRB 3LKPA 4NRXA 4CAGA 1IEHA 5F3BA 3LB6C 3QEHA 1KIQA 4OQTL 5HYSG 1MAMH 4LSVH 4XP6H 4ODVH 1LEIA 3VGDA 3BQUB 4D0CB 1FBIL 5I74B 1PQZA 4CADA 3OL2A 2GK0A 4BELD 3KVQA 1MLBB 3MXWL 1MHEB 3CFBB 2FO4A 5J8OA 5I1GL 4GKNB 1UXSA 3QNZB 1OWRM 1UZ8A 3BRDA 4QRPD 3QI9A 5HYIA 3O41A 4N0UA 3TNMB 5GGRA 3HFMH 3ZO0A 1G0YR 3GHEL 4LFHD 5C0AE 1OAQH 1E6OH 1GOGA 1YNTA 5DK0B 4I48B 1OAYL 3K3QA 4DGIH 1CDCA 3QUYD 4HH9B 3W2DL 3NABL 3AXLA 3AMKA 4Y4FC 1PJ9A 1T21B 2Q7YB 3W82A 1FAKT 2NY0B 3PIQB 2DKMA 4ZAKD 1VGEH 1DCLA 2WP3O 1YQ2A 4PJ9C 3V4PL 2FWOA 2VISB 1WZ1L 5I1HL 4NRZB 4J2XA 3RWEB 4EXKA 3DV6A 2AJSH 2R29H 1A3RH 2VE6A 1PDKA 3TA3B 2BVYA 4KHTH 4LMQI 3NZ8B 5L2KB 1G0DA 3OGOE 1AXSA 3T4AA 3GSNA 4OCSH 1Y0LB 3OKEB 1YDPB 5C3TA 1EMTH 4LSSL 3EGSB 1IZKA 3J8F7 2DQTH 4LVNB 5JW4M 1Q9WB 2DQGL 2EXYC 3IU4L 1NGZB 3ARFB 1LO0H 1OD7A 4NQVB 5EU3A 4F37F 5IFJB 2UYLB 4G80A 3PWNA 5LAXB 3NCFB 3T0WA 2C1OB 1PZ5B 4U1JB 3UAJC 4U1GC 1QP1A 4ZFOA 2EDBA 5KJRL 1EVTC 4Y16D 3QFJE 4Y4KC 1OLLA 4Y1AE 3O8XB 2D7OA 2YPVL 3L3IB 2BFVH 5D8JL 5J6HB 3LHPL 1EGJH 4L8SC 1S7SA 1MCPL 5C0AA 3W39A 4AIOA 3SDDB 1IGYA 5I8CB 5E8PA 4PJ7F 5FUZL 1XF3A 4PRAA 2NY5C 4HJ0D 4P2RE 4X6FA 2G5RA 3UTOA 3TM6A 5DRNA 2V17H 2XPGA 1PFCA 1UENA 2WQ8A 3TLRA 1HH9A 4PJGA 4MD5B 1DTUA 5HYEA 3TO4C 3BQUC 1J88A 5IT2H 3C08H 2AEPH 4L8BB 4U1MA 4EI5A 4LP5A 4MX7B 4LNRB 1KPVA 4Y88A 2HVJB 3U4AA 1C5BH 2P1YA 4HK3N 3PWPB 2M2DA 1QFUL 1WC7A 4A6YB 3I02A 5F44A 3ZT6A 4G3YL 5AZ2H 4XPHH 3N9GL 43C9B 1OTSC 3PP3K 5J4MA 3MRHA 4LOUD 4YK4C 2V7NA 4PJ7B 3IXAA 4PG9B 3O6FB 1MY5A 1KGCE 1PSKH 1UCBH 4YEFA 5LQBH 1H3VA 2W0FB 4JQVA 7FABH 1RZJC 3D85B 4GXVH 1JP5A 1U3HC 4XPHL 4WHTA 4DCQB 1OGTB 3MYJA 3AVEA 3GHBL 3ARBA 4F57L 5CJQL 1MCRA 5D72L 4Y4FB 1QEWA 3MLRH 3RIFK 1LGVA 5JW4N 2V9QA 4P5TD 4LCWB 1FJ1B 1U8IA 1IM9B 4O2EB 4NQUA 2BSRB 4QF1A 2DQCL 2EYRB 4PJ9B 4E41D 3MLTB 3OZ9L 1AIFA 1OGAD 4RSVA 1MVUB 4R4BA 1S7RB 3U1SH 3D39B 3QEQE 1MFNA 3TA3C 4Y4HD 2QQQA 35C8L 4KK6C 3KYKL 3BZFB 4FTVE 5SX5K 4P5MA 2QJDA 3GSQB 3KPPB 4LU5H 5J3HC 4QWWC 4HGWA 5HTSA 3OG6B 4RRPA 3ULUE 1YMME 3O3EA 3VXSB 4OZFH 4M8QB 4R97B 2VZ3A 4U49A 4LLWA 1KEGL 3L7EA 4CMMB 3CCHA 4L9LA 4M5YL 1MFBL 1W72A 4HFUL 3MLPA 2IH1A 2CXKA 4G43B 4JY5L 1IEAB 3TNMA 1NDGA 3JTSB 4HPYL 1OAXL 1YY8A 2Z0BA 2EH7L 1S5HB 4IRZH 1DFBL 3P9MA 1FPTL 1TNMA 4NQEB 2QHRL 2BSTB 1J05B 1YEKL 4OCSL 4U7KA 1NFKA 2B1AL 5FYLD 2V6HA 3VXQA 4WFGE 1QSED 2BY3A 3L95B 1JGDA 4KPHL 4HUUB 1LP9E 2M1KA 4EUPB 3LEYL 3VWKA 1T20B 1A7QH 1YN7B 1M6OB 3OXRB 3R4DA 2F9BT 3H7BB 2Q6WA 5JQHC 5FYJL 4QRSA 1A6AA 3BPLB 5F7EL 4NSKA 4XVSL 2FHFA 1P7KB 4LPVA 3V8CA 3MRFB 1VHPA 3DV4B 5EOTB 2Z31D 3KPQB 4LF3B 3SE9L 5E00A 1LHZA 4WO4A 5EIVA 2DQTL 1RIUH 2VLKB 4YK4B 2X7LA 1AC6A 2YUVA 3BQUD 5HJ3B 4B41A 3KR3H 5HHOE 5ICZA 1BQUA 3ZZ1A 2GQHA 1N64H 2VXQH 4ZUWA 1KTDA 4LCUA 4NOFA 5FYLL 1PW3A 3GMOA 3IDNA 1XF5B 4DN4L 5IV2B 4IIQB 2QSVA 2AKRA 5HI3D 4GRLD 1RULH 2X9WA 1F8TL 5EC2A 5H94B 3P30H 3HLAB 1F6AA 5D1ZC 4OKDA 4PJHA 1NFIB 3RGHA 1DANU 4EBQL 2JLLA 1MI5A 1U3ZA 4FMFA 5JQ6L 4O2CB 4XCEB 3VFGL 2UWEB 4QGYA 2APXA 3LKQA 2QQLH 5GGRB 4NUGH 2BNUA 2Y36L 3MGTA 1XF4B 4AEEA 1JL8A 4FQJH 3KPOA 3ULVC 2HFFB 2FL5A 4NM4H 5E2WH 2VZUA 4YE4H 1G7PA 3OKMB 2I24N 3QEGL 2HFTA 3HI6H 4I9WE 4OIBA 3UBXI 1CXLA 1DL7L 4R97C 3HB3C 5GZNC 3CLFH 4QHLB 1PKQB 3FOLB 2A9NH 1MUJB 4WCYL 3NA9H 3JWDC 4R90L 4M7LH 5HYJE 2X4UB 4LLAA 5IBLC 4CMHB 3BZ4A 2H8PA 1IGIH 3T08A 4X6EA 1KIUA 4ENED 5ACMA 5FM5O 5E6YA 4OKVB 2VDPL 5DDHA 4QEGA 3WIFB 5DQDL 5JHDB 3MJ7B 4G9FD 3G6JA 4HC1L 5MI0B 5T5NF 4ZUTA 3U36B 4A6YL 4JY6B 4K9EH 4EOWL 3Q6GL 2FJHA 5TDOA 2K7PA 3HAEB 3TPKA 3B3IB 1YECH 1NDMA 3RKDD 1G84A 2DWEA 3IKKA 3SDYH 1DQJA 3EYQC 1BOGB 4LLMB 1PG7H 5DVLA 5DJ6B 2QV2A 1RSFA 1JCKA 1AC0A 3MRMA 3S4SG 3A6CH 3CFKA 3OG4B 4OGXL 4I0PA 4KKAD 1CDHA 4OCLC 5LCVL 3SDYL 1JYVA 2NY4D 4OZIF 3C6SB 3ZL4L 5C0DB 4P2OD 3C9NA 2Y07H 3CUPB 3WFEH 4K94C 4H8WH 2F5BL 3BGMB 3I3EA 1DEEA 1IEAA 2L4OA 4POZD 5FCUL 3PQYD 4F7CB 1X4YA 3DBXA 5ENWA 4K55A 4MD5A 4ODHH 3RQ3A 3MBEB 2NPLX 3AAZA 1RJLA 3CU7A 1P5UA 2VXSL 3EOBA 4IOIA 5FF6B 3VXOB 1J8HE 4Y5XA 4LPWA 3WS6A 3QCUL 1NC4A 2K7QA 1YQVH 1VGKA 4LEOA 3JV4B 4JPWL 1QSVA 3ROLA 4K7PL 4Z0XB 4H5SB 3EYQD 3ARED 3CX2A 5HBBA 4Y2OA 4K9EL 4LSSH 3WLBA 3HZYA 2APBA 3TBTB 1UM6L 1FVDA 3GNMH 1Z6JT 1E28A 3QQ4B 5HVHC 4W81A 3CFEA 5GGSB 2DLFH 4J3UA 3K7UA 4LHUG 1BQSA 2H1PL 3JWDL 4DUXA 3IAQA 5C6TH 1T1YA 2ED9A 1O5DT 1QSEB 4KQ3L 3SBWA 4FQHB 1O7VA 2X4TB 4OUUA 1XGPB 5EG6C 2GTZA 4ZO9A 4N9OB 3M8OL 4JB9H 1DVFD 3WNLA 3VFGH 4X5XB 3DX6B 2APTA 4CADB 3QPXH 1KTLA 3DGGB 2CUMA 3SDXB 1A14L 2VQTA 1F4HA 4X4ZA 4NBXB 1G1YA 3U0PA 3LPFA 4CMHC 4YDIH 5AD0A 2AP2A 2OSLB 1N6QL 1MCIA 3UO1H 4M6AA 4WI7A 1CK0H 3BXNA 1QKZL 4NKOB 1WCBB 2ZWLT 1FIGL 1MFAH 3WFZA 2V5YA 4NQSA 3U7WL 4X8XA 2O5ZH 3VXPB 1XGQA 3PHOB 1C12B 1DEDA 1OARH 4X6CF 4HIXH 5MENB 1BBDH 2XWJB 3RPKA 1TENA 3TO4D 4Q0XH 3U2SB 1MJ8L 3QFJD 3KYNA 2JCCA 4GXUM 1F11A 4KRPD 1MAML 5I1LB 1S8DB 1F4WL 1U36A 3E6FA 4MCYB 4ZSOB 3FT4B 1AR2A 2HKFH 1JNLH 1YMHA 1KCSH 1X3DA 1CU4H 2QKIA 4ZS6C 3BSZH 3QUMH 3O0RL 4P9HL 1G7IB 4PG2C 3TWCL 1I7TB 2XFXA 1R3KA 4DW2L 3ZKXB 1FFOB 3LEXB 1IAIL 5GJSH 5LWYH 3MLWL 1GOHA 2BDNH 5SWSD 3ZHDA 1AGEA 4MDJA 5D7KD 3GHEH 5F21B 5C07E 5T1DH 4DUWA 5JO5A 1KBGL 3HPLB 4PYGA 2HWZH 1N5AB 4KROC 4LK4A 3PWNB 2F5AH 3UJTH 4XGZB 1HQRA 3SE9H 1PKQE 3U30C 1EFXD 5DJAB 4UUJA 1UWEL 4P59L 1KPRB 5DEZA 2EIZA 4NPYB 1HXMB 4X6BA 5DC4B 4KQ4H 4M6OL 1EBPA 2ERJB 5E8OB 3ZKQD 1J8HA 3QULB 1S7SB 1G1CA 5DI8A 4ZNEE 5HVHB 1GC1C 4FA8A 5AG9A 2IAMC 3KPMA 5GZOC 4U6YA 4P4KA 1A7NL 3IDNB 3QRGH 3VRIA 4M7JL 1IFHH 3LH2L 4XNYL 3ZE0E 3WIIH 5E99H 2CRZA 3VD4A 2Y4SA 4XAKE 1R6VA 5HHXL 1IGJB 1T89A 4LSTL 4LPYA 4X8JA 4B7IA 1B88A 2EYSB 2OJEA 3KLAB 1W0WA 4P9HC 1A64A 3QJHB 4GW5A 4XVTL 1UM4L 4PJEA 4LVHB 4MB4A 1X5YA 1R5WA 2UWEA 4GKNA 3BPOB 1A1OA 4NQVA 5EU3B 1FSKB 4BSVB 3D3VB 5IIEA 2QTEA 2OI9B 4NRYB 2J8OA 3S3JA 1LK2B 4MD4B 5C6WH 4QHNB 1U92B 4HKBA 3S35X 5TFSL 2Y7QA 3S96B 4TULH 3DIFA 1XAUA 3CPLA 4XBPB 1XGYL 3CDGB 3OAYH 1CWVA 2R2HB 3O2DA 4QNPF 3VXRB 1T21A 1CXEA 1EERB 3TN0B 3P4OA 4LCWA 5BZWB 2PXYB 1FLRH 5DXWA 1CLZH 4E42B 4NJ9H 3CDFA 3ROOA 4X6CA 3O9WA 4JG1L 3TT3L 3LRGA 3ORJA 1MIEL 3DVNA 2ZSVA 4IMKC 5CWSB 1MHPL 3HA0A 1KJVB 3GHBH 1A1MA 2FZ3B 4QHMB 3U0TB 4N9GB 2I5YH 5ESQB 5TH2B 2CDGA 4JHAL 5I30H 4ISVB 2YWYA 4MX7A 4UQ3B 1N4XL 1A47A 1CE1H 3EOTL 1SY6H 1AH1A 1U95B 4K8RC 2APFA 4KY1L 5I17A 3SJVE 1NBVH 4WWKD 4D9RE 4U1LA 4NT6A 1LE5B 3D2UA 1BQHA 4JRXE 4P23D 3ARFD 1NUNB 1NCDH 4HUWA 2ZUSA 2JIXD 4PGEB 5E56A 3DRTB 3QZWG 2AJXL 1K8IA 2C9AA 1C08A 2JK5A 3W11D 2FDBP 2ERJC 3T65A 3C8KA 4J3SA 3QZWB 1DVFA 4BSWA 1UYWL 1C5DA 1BEYH 1U93A 4MDIB 5CZXD 2PYFB 1IGYB 5I8CA 4OLEA 1KLUA 4F7PB 2DM2A 1DQML 2F19L 2CGRL 5T1MA 5KG9B 3S37X 2AEQH 1EDQA 4FQ1H 3DUSB 3ARDC 1NJ9A 2BZDA 1F3JB 2R29L 4LDOB 5E24E 4XCNB 3IFNL 5D7LA 4C56E 2QBWA 3ARWA 3NIGE 3OKKB 5GRXG 3QSKB 5CUSH 1HDMB 2DBLH 2DIBA 4P5TB 2J6EA 4WGVB 1TCMA 1KIPA 4LVHC 3AY4A 1IGCL 2IPKA 1N2RA 3VFPA 3BPOC 4PY8J 4YC2B 2CKBA 4HK3J 1FSKC 1PD6A 3EYOA 1DJSA 4PP1D 5BOZG 5ETUA 3CFEB 3BZEA 3QDMA 4CL7A 2Q3AA 2NMSA 1RFDH 4FXGA 4R6UA 2UWEE 3VFMA 4JQXA 3MX0A 1GSMA 2BRRH 2EIZB 3QBTB 1LP9F 2YD6A 2XN9B 5BO1H 1BWMA 4PJCE 4OD2A 4Y19E 3TN0C 1K2DB 1MCPH 5IR1B 4WUUE 3P9WB 3V4PH 5E8DH 3V6ZA 1S78C 4I5BA 1T66D 4TSBL 5JQ6H 3KG5A 4HUXB 4HZLB 2R69H 3T0BA 4F2MA 5J06A 3QWRA 1GHFH 5GGTA 1RUML 1S7RA 3UMTA 3UTZB 1EEUA 4H20L 2XTJB 1MCKA 1F8TH 1R3JA 1JMZA 4DVRH 3GMLB 1N0XL 3GMRA 4WHDA 1ZHKA 3MOAL 3S88L 5GGQL 5FYKD 1G9EA 1JZ5A 5C08A 3U48A 2L7UA 3RUGB 5BRZB 3U82B 3TZVB 2BSSB 2XI9A 1NGPH 2G9HA 3MRNB 3PWUA 3LN5A 5CD5D 5EA0L 3GNML 5SWZD 2G2RB 2PW1B 1MCNA 5TF1L 3RWCA 3WEXB 1Q9KA 4FQJL 3QCTL 4Z0BH 1FCGA 3G04A 3UPCA 1EVUA 1NBQA 3N85L 5DJ8A 4FFYL 5J1SC 4JDTL 1XF3B 2GSGA 3CX5K 1YN6A 1F4YH 1FFPB 2VZSA 4FP8L 1UA6H 3VMPA 1IAOA 5J6GA 1S7WB 5DUBB 2B5IB 4RCAA 3H9HA 3DHJA 3FOMB 5FA4A 1QSFE 4MQ7A 4X6EB 3EJZD 3JV6A 1FV1A 1KSRA 1RD6A 5GGVL 5C0JB 4OZGA 4DVBB 3OR7A 1QBMH 1OAUH 4HBQA 3TA3D 3LQAL 1RV6X 3FFCA 3DVNB 5IVXE 4HDIB 5IBTL 5IMLA 3D25A 3KDMA 2XZZA 1KEML 2F54A 5IK3A 4PRPD 5ID0B 3UPAA 3X3GL 5I19H 1XCQB 3O4LE 1CL7H 3A6CL 2ESVB 1JPGB 3UC0H 4P5TC 1LVEA 4YHML 3JWNC 4U2ZA 3I6LE 4Z7UF 1LEIB 1ZGLB 3B9AA 4D0CA 4HQQH 2MKLC 2DBLL 5F7WC 1W0YT 2DQIH 3RVVC 4JG0L 3SGKA 4HAFA 3TBSB 2C3WA 3DMMA 3VXNB 4WW2C 5EFIB 1HHKA 2CLZB 4JN1L 4UT7L 5FECB 1SM3H 4QNPE 3B9KB 3PDOA 3ULVF 2D31A 3VA2C 3BZ4B 3NCBB 1R0AL 4IOIB 2F8VA 1CZ8L 2ZJSH 4NO0D 3WDHA 2P5WD 3RIAF 3Q1SH 4U1HA 5HVWA 1Z9SA 3B9DA 3IFPB 3IDMB 1K3ZA 1A1OB 3NZHL 1BGXL 3BISA 3QIWA 3JSSA 1DLFL 4NZUH 5C07A 2D2OA 1R5IB 5E8PB 1NGZA 3ARFA 1OPGH 3TN0D 4BUHA 3IAPA 4L4TA 4OGZA 3UBXB 1XR8A 1P4LB 3C6LA 4KMTH 3L3HB 2PYEE 2AK1H 4P46A 1H3PH 3SHSA 5C0IA 3M07A 4LHUB 3VFRB 1AQKL 4OUUB 1DBKH 1SM3L 4X7DC 3QRGL 2PXYD 1TDQA 3QFDA 4MB3A 2AS5M 1QEWB 5IMKB 5ESAB 2XZQL 4PJXE 4EEEA 5FOBB 3MUJA 1RZGA 2W38A 3QDGD 3SGJC 1TZGH 5JXEC 4F58L 3MJ8B 3QDMB 1MRCH 3S34L 1XFPA 4NNXA 3MLTA 2FCBA 5JOPE 2XPGB 2E27L 2B5IC 4PJXA 3HI5H 1DLHA 4CN4A 2GY7B 2NTFA 4U31A 1UXWB 2X4PB 1C16A 1RZ8B 4TVSa 1QLFA 3BKML 4D0DA 1ND0B 1QSZA 2J3SA 3BIKA 4G9FB 4BJLA 5C9JA 1FZOA 1FVEB 1NCAH 5EBLB 3NN8B 3MZGB 3L7FA 4JCMA 3MRLA 4H0IA 2C4FT 4PJGE 2P7TB 1W72B 1FLTX 4PG9A 2I9LA 4HPOH 3BT2L 2ZNXA 2HH0L 5T3XD 3GK8L 1TJHH 2XQYK 4PJ8D 1A9EB 4WO4C 4I3SH 3HNTH 4K7FA 4D9RD 2WWMC 2VLJA 1VB9A 5H2BB 2EXYD 5IKCA 3MNZA 2ITDB 4U1MB 4A2MA 2HYMA 3ZT5A 1YNKH 2EZ0D 5CJOL 5F6HI 3P77B 4NZDA 1NGYA 2YN5A 2JJWA 2IJ0C 3VDAA 2WK2A 1WT5A 4GUPA 1BZ9B 5D2LE 3T2NH 3B9KC 3UJTL 1G9NL 5C0CD 1NGXB 1QO3B 1D6VH 3CC5B 3O2VL 5MEQA 2QHRH 4XGZA 1K8DA 4GQ9H 2XN9E 3G9AB 3QA3A 1MOEA 5IVNA 2V5TA 2DICA 4KROD 4ZTPH 3BXNB 1S3KL 2Y23A 3G5XB 4XI5C 3MLWH 1PG7X 3L6FB 2VXTH 2IFFL 3K2UH 2IANB 4KI5E 1EFXA 3SE4A 5IG7A 3HNTL 4NJAL 4ZXBD 3QG7L 1MCCA 3TCXA 4FTVD 3RY6C 4IM8A 4JJ5B 3HUJE 3DYOA 4JO1H 2R4SH 3AU1B 1FNGA 1I7UA 3WD5H 3WJLC 3S5LG 3S36L 1A7OL 1IBGL 5SWS<