4AZ8A

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
230
structure length
185
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPAGARNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
total genus 34
structure length 185
sequence length 230
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A02
3AUVA 3WUZA 1GL4B 1ODAA 4PV9B 3TJHC 3RY4A 1U58A 4YO0B 3QIBB 2A73A 3AXLB 1OGAA 1P9MA 2CKBA 2FBOJ 5GGRB 3LEVL 2OK0H 5BZWA 3P0YL 1LO2L 2GITB 2AXFB 2V2XB 2GUOB 5FO7A 2AK1L 1WWCA 1HZHH 5HYJA 1HHJA 2O93L 4LLVB 3RDTB 4M6OL 5ADOL 4P2RB 3K1KC 3GRWA 2F54B 1E6JH 5KZCD 1UGNA 4AL8H 4YQXH 2HLFD 4I4WB 4TYUA 2Y36L 4Y4FB 1JP5A 1MCJA 3SO3C 1U8KA 4XH2B 5GRZA 3DUUA 4H88L 1G6RB 4KRMB 4PRID 5EFIA 2Y4SA 2XQBH 4R0LC 2JB6A 2R2BB 1KNOA 4ONOA 1XIWA 1YEGH 4J8RA 1UWXK 2PXYA 1OTTD 1KELL 3BKJL 5GGVH 5EU7C 3S34H 1C08A 2VR5A 1AJ7H 2H32A 5EU3B 5CD5C 4NC0B 5F9JA 3MV7B 3P0VL 5BJTA 4PJ8A 1Q0XL 3UMTA 4CADA 5AG9A 1YEHL 3MRFA 4WFFD 5HHOB 1AC6A 3RA7L 4EDWL 5FOBB 1CD1B 4DOHE 2Z8RA 2CO7B 3NACL 2FIKB 5TQ0L 4Y1AB 1U41A 5JXEA 1ROWA 4LEXL 3VWJC 1LO3H 5EO1A 5GISL 2OMNA 1TZIA 4NGHH 5JIIA 1H5BB 5I1JH 4LRNH 4BH7A 2I24N 1KIRB 3QQ3B 4DZBA 3CXDH 4W68A 1UVQA 1J1XH 1ZANL 2ILLA 1HXMA 3BDXA 4NM4H 5FYKD 5EC2A 5GGQL 4MZ3A 1BFSA 1PJ9A 5EZOL 1EGJL 3FB8A 1CT8A 4JRXE 1QLFA 1YQ2A 1I4FB 4K94C 1CFBA 4L4VD 3OR7B 3REVB 3LD8B 3DVFA 3ZDYE 2AGJL 3FFDA 3MFFA 1GHFH 3HTLX 1FIEA 4LCWE 4ZFGL 4F9LC 5TDPB 1Q38A 5DK2A 1S9XB 2MTPA 3F6IA 1EAPA 4OFVA 2QSCH 4V1DE 1DVFB 2MMXA 4HUKB 5B3NA 5IG7B 4LL9A 3LKQA 5C2BL 3HZMA 2I9LA 5ANMB 2YKLH 1ZTXL 3Q3GA 5GRJL 4GRMA 1K3ZA 1FGVL 1G1YA 4ELMF 5C0NC 2W9LA 3KPRB 1D3CA 1MRDL 2VISB 1P7KB 3UTPE 4O51A 4BUGA 4KWUA 1XR8A 4P23A 5LBSL 2OI9B 5C0CD 1LO4H 2D03H 2X4SA 2FO1A 4XXDB 1AGCA 1QQDA 4K71B 3HAEA 3KDMB 4HFUL 1KPVB 4HDIB 1F3RB 3L5HA 4D0DB 1IFHL 3WIFA 5FIEA 2W9DL 2HYMA 3BHBA 1OSPH 5C6TL 5EN2B 4J3TA 4UZGA 2IADB 1NCUA 3OG4B 3ARED 1IL1A 4JKPL 3PGFL 4M7LH 4HGWA 5LGJB 3RAJL 1A14H 1NCBL 5INCA 4WV1B 1OVZA 4MSWA 3B3IA 2EH7L 2G75A 1PBYA 3R8QA 1GSMA 3VWKD 1D5IL 1XF2B 4BKLA 4F37K 4L3CB 1X4XA 2Y5TB 4GKZA 3DRTB 4KK9D 4Q0XL 5IOPA 2PO6A 1R24B 4ZYKB 3WFCH 5D7LD 5IHZA 4O2EB 5C3LD 4ZFFB 1RZKC 5DD1L 4PJAE 2VLJD 3JV4A 1MH5B 2MFNA 5IFJA 1AXSA 5D7IA 4HLZH 3QIUD 4GQPH 4NCC1 3IVKB 4RWYH 3CC5B 2ZPKL 3O0RH 4HSQA 1QSFB 4MNQD 1TTUA 1CDYA 2AQ1A 2K3TA 5AYUL 5J13B 3HCVA 3QIUC 5C0JB 1U2HA 4J3XA 4UIKH 2YSSB 2XKNA 3QEQB 1FG2B 1INEH 1G9NH 1L7IL 4NRYA 3S5LB 4NQDE 1IAMA 3VMOA 3U7YL 3SGKA 5FGSA 2VH5H 3AMKA 3SDDC 2GJ6B 3TH4T 3VXQB 3O8XA 4O2FB 2ZUWA 1RZFH 3KPLA 1FNEA 3U2SA 1LD9B 2WM0A 5FYLD 4X5WA 5FYLL 4X6EA 4Y16A 1EO8L 3VFUB 3QG7L 3FT3B 2Q6WA 3WLWC 2XTJD 4KVCL 1IT9L 4Z7VB 2H2PD 4LPVA 4ZDHB 4EBQL 1J86A 4G42B 2B4CH 2ED9A 5E24E 2R0WL 1ND0A 4O4YH 4LLVA 2FECL 3IJSB 2GW5A 1HYRC 3K81A 2AXHA 3UBXB 4JFXB 3GSOB 1NBYB 3QG6A 3BGMB 3REWA 2DLFH 1AJ7L 2VDRL 3MLXL 4NQDD 4LLMA 2F74B 1S5IL 1A6PA 2D7NA 4XC3L 2WNGA 1JPFA 2UWEA 5ISZB 4MA8H 2NR6D 3MNVB 3KPTA 5FA3A 3TVMA 5JA9A 5K9OB 4ODXA 4LSPL 4KZEL 1O0VA 4KVNH 3KLSA 2Z31D 4JN1H 3HC0A 1ZHLA 4GKSB 5D7JA 1RK0B 5F7MC 4QF1A 1JBJA 3VXUD 5FKPB 3JV0A 4TUOB 5I6XB 2C9AA 3GSXA 5ILTH 3WJJC 3WKML 1CFQA 2YD8A 3TCLA 3SPVA 1IARB 2FHBA 1NGXA 4YDLB 4RGND 1ITCA 4KMLB 1FH5L 1JNNL 1PEWA 3F7QA 1DCLA 3I6KB 3KJ4B 1TMCB 4PG2A 3KS0J 4JJHA 1A1OA 4RGNE 5I1HL 2F53E 5IB2A 4IOSD 3RZCA 3VXMA 1SBSL 2HFGH 2P5WE 3VWKA 1K8IA 3C60D 1N4XH 2AGJH 2HTKD 4RRPG 5C0BD 1UJ3C 5ICXA 1NCWH 3L9RA 4I5BA 1NBVH 5E94A 2Y07H 3DHJA 4XNMB 4P23B 5T5NF 3IJHA 1LMKA 3MNZB 4GG6F 4G8GA 4D9RE 1MCWM 3IDNA 4ZNEE 4CDHA 2AEIT 1HHHB 2G60L 4Y5YA 4ODTL 3VA6A 1RUQL 2VLLB 2IMNA 3VXRA 4XVUD 4HS3B 1ACZA 2YD4A 4I0CC 1OGTA 3C60B 4WWKB 1KPUB 1UACL 2C1OA 1S7XA 3L3HA 1JPST 2WBJC 2B0SH 1RPQA 4CU6A 2PR4L 4APQB 2PCPA 3ZKMC 4JFYB 5SX5H 1CDBA 1G9MH 1L9NA 1BQLL 1MELA 2B39A 3DRQA 5KAQF 4YFLF 3U7WL 2P24B 4F8QA 2Q86A 2CMRH 2NMSA 3LPWA 4MNGB 2VDPH 3MYJB 4ZUWA 3GSXB 3KPSE 1NFIB 2DWDB 3ARGC 4XX1E 4ETQB 4IRSD 1J9CT 1I9RL 4GBXC 4PBWD 3HE6A 1KT2A 3TFKC 3KNBA 3SKJL 3NIDE 4LMQE 2A1WL 4F7MB 3WIIL 4QRUA 2BNQA 4UDTA 2X10A 4HIJA 3K3QA 4ZNEA 4XWOD 2DD8L 3FO2B 1AKJA 3C09B 1A14L 5KG9B 5FUOH 5E2UH 3UJTL 4OCWL 4U3HA 1E27B 4GRWE 3O4LD 1T03H 2P47B 3D85D 4NQDB 4C56B 1U8OB 2J12B 4MVBD 3CH1B 5IHUH 4WTZA 4GLRH 2D4DA 3A6CL 1MCOL 4EQ3A 4RDQF 3TBSA 4YUEL 4L4TE 4JLRA 5I73C 1IQWH 3QDJA 5CMAB 1M7IB 1UXSA 4Q2ZA 2V6HA 1BOYA 1JV5B 1NUGA 4MAUH 5IMLA 4U49A 1MFCL 2GY5A 1FZJB 3GSNB 3C8DA 2YPVL 1OAYL 4E41B 2SEBA 2C4FU 1NMBH 1NC2D 2GSIA 1KCRL 4YEEA 3RWJB 3MLSL 5D9SA 2OR8A 1CFTA 1K9TA 4XBPA 5EBMB 4ZFOL 5CGMA 5FAAA 3WFEL 1S7SA 4K7PL 5IB5A 2WIMA 3MRJB 1I3RB 3QYCA 2H45A 4PJXA 4YX2H 4JO2L 3VDCA 3G04B 5T3ZE 1G9NL 4RFEA 4FFZH 1FVEA 3FQRA 3LY6A 3NAAL 5DO2C 2AJZB 1FNFA 1A4KA 2R0ZL 2AJVL 5HYSB 2YEZA 1RULL 1JGUH 1KB5B 2HT3D 4WWKC 4AEIL 2A2QT 3LPGA 4LLYB 5L88L 3GMLB 4TRPL 4CN6A 1KTLA 3MLPA 1S9YA 3QXDB 3K80A 4G7YH 1UFUA 3NFSH 2WP3O 4F33A 5IKCB 5HHNB 5FUCC 1CLOH 4OCRL 1ZHBB 5HYJB 1WICA 3WJLA 5E4IA 3ZKND 3OAYK 1PX4A 3MRDB 4Y2OA 3D39B 5DEFA 3I75A 3LHPH 3IKCB 3GDBA 2VLJB 3QFJA 4P2QB 1ZGLB 3HMWH 1A64A 4CN4A 4I0PB 1MLBB 2VXSH 1FNEB 4H5SB 3FFCE 4PJDA 5F3BB 5IMMB 5E6IA 2WQRA 4NZDA 4PJHE 4ONHB 3GSNA 4R9HA 3FTGB 1RJZB 4X7TB 4LP5A 5DVOA 5GRVK 2J6EA 3MA9L 5CEXA 4RA3A 1OD7A 4D3CH 2VLRD 4NQVA 3GSUB 3TN0B 4JR9L 2AXGB 2W9EL 5DVLA 4JRXD 4DFHA 4LPXA 3QDGB 4X9FA 3QXAA 3W0WE 1BLNB 3KXFD 2MCPL 3EYFA 1QLRA 1I1AA 5EBWB 3KS0H 3QCVH 2FGWH 3L6FB 2Z91A 4F57L 4LCWD 1AKJB 1JRHI 5KG9A 4GMSL 1BBJA 4YBHA 2X4UA 5IFJB 4ZFZB 1RIUL 4MJIE 1KJVB 3P40A 4Y5XA 1QUNA 4N8CL 3SDAD 4HS8H 4U0RC 1V3MA 4RMUA 4O2EA 3T0DA 3IAGC 4LGPB 4XP1H 5C0CB 4C54A 1MLCB 3BD3A 5JMRA 3V6ZB 3Q1SL 4Z0BH 3X14B 2LVEA 5ALBL 1TJIL 1JGLH 1E27A 1NGPH 1YNTA 2D7TL 5T5FL 4BK4A 4JRYB 2VDOH 1QSED 1DDHA 3M17A 2R4SL 4QOKA 1FYTB 3O4LA 4JVWA 1UB5B 2XTJE 2EDXA 2PCPB 1KLUA 3GSWB 2APXA 3O2VL 1LP9E 3UCRA 3QNZB 1BZQK 1QZ1A 5IJVB 4UNVA 1ED3B 5D4QA 3N50A 3JUYA 4D9LH 5SWZE 3PV6B 5LCVH 2LU4A 1X5ZA 3MXWL 4WFFE 1BX2B 4L8BA 1VESA 4RCAA 3O45A 5CP3A 1RIVL 2CDEB 1KV3A 1JK8B 2FBJH 3VRLE 4JFDB 3BGFC 4Z76B 3U2SB 4QXGL 3WHE0 1Q0XH 4U6YA 5FOJA 5CEZL 1EK3A 4K7FB 4L3EB 1F3JB 5IIEB 1YJDL 5DJCB 1B2WH 2ENSA 3VXUE 1G9ML 3PQYE 4XMPH 5FGRA 1F2QA 1CICD 4OLYL 3NFPB 4OLZH 4RFNC 4WHTB 4HD9A 3ROLA 2VLLA 5EDXA 4OGZA 5CGYD 4FXLA 1HQ4B 3VI3E 4CKVX 2H2SC 5JHDD 2WINB 4JPWL 2P8MA 1OD9A 2X4QA 3NPZB 3AGVA 1M05B 1B0RA 3MREA 3Q5YA 1JHTB 4FNLL 5LXGH 2HFTA 1UM5L 2G2RB 4FRWA 4ISVB 1G6RL 3CFJB 1ZOXA 2X7LB 4LFHG 4O58H 4LLMB 2F5AH 4HUMB 1KXQE 4PJ8B 3WD5H 1U8PA 3QUZA 3WJJA 1YMMB 5FXCH 5CGYC 1RK0A 4Y5VC 1IVLA 3GSUA 1FVDA 3O2DH 2XFXA 5L0QB 4S0TD 1G9MC 1DR9A 32C2B 4OQTH 1P7QD 4KPHL 3PQYA 4XCCH 2Q6WB 4AMKL 2ZUVA 4U1MB 1P4BH 1KCUH 1PY4A 1WEJL 4HCRL 1U8MA 4M7ZB 4RGMB 1LD9A 4MMZC 1PSKH 3VFOA 2DBJA 3MRQB 2ZCLL 1IMHC 3BT2H 2BNRA 2P5EE 1T1XA 2EEAA 4CVZA 1HHJB 3S98A 1A7OH 1EHLH 1OCWL 1UENA 3P4NA 3KDMA 4XPGH 1QVOB 3BXNA 3QI9D 4NCC2 4I3RL 3MA7A 2X2YA 1RZ8B 3GUTB 1FDLH 3C6LC 3RBGA 3O41B 3I9GH 3SJVB 1OGAB 1BZ9B 1B6DA 5CS7A 5ITFB 1I3GL 4HFUH 4GJTB 3AS1A 4JN2B 3GBNH 5CIPB 3RVTD 1Z2KA 3IU3B 4D0CB 5GRUL 4OV6F 5KSBA 5KVFH 4WI3A 2BVEA 1CLZL 4YBLB 1WBYB 2JB6B 1LEKB 4U1JA 5HGAB 1J05A 4Z7UB 1RUKH 2UZIH 3ZKQD 3NPSC 3U0PB 4M6MH 5FA4B 1ZA6A 5IBLC 1EVTC 3W11C 4XHJC 5IFHH 2JE8A 4APQA 4MQ7B 1RZJC 4AZ8A 1DQLH 3MBXL 4L3CA 4YHLH 5D1XD 4P46D 4I9WD 2EYTB 3QFDB 4G5ZH 5KSAB 3DX7A 3S37X 1KJ2A 1MI5A 4F58L 3RTQB 4OZFB 2XZQH 3ALWA 4OFKA 2GK0B 4NO2A 3PWNB 4X5XA 1PZ5A 5C0RH 2YUZA 3WN5A 3VGAB 1J87A 3UTSA 1WT5C 3MA9H 1BHGA 2XA3A 3GZKA 4GKZB 4M6OH 4U0RB 4RAVA 1KXVC 4X7DC 3QHFH 4GW1B 4L5FL 4S1DD 4FTVD 2A83B 4Y5XC 4HX1A 4H26B 3K8MA 4LU5L 3TT1L 3X13B 3KHQA 5CSZA 2P8MB 5DMKB 3W81A 4PYHA 3TZVD 4XCFL 4YBLC 3GMNA 4OD1L 3HZVA 5DVMA 5LWYL 5L2KD 1JPTH 1TNMA 1H3WM 4K3EH 1T80A 4N8CH 3O6MH 4U7KA 3DRTA 2APBA 3QJFB 3E6HA 4ETQA 1CFQB 2EDBA 4PRHA 1JWUA 1YC7A 1YY9C 2X89A 4RMVA 4X4XB 3M45A 1EFQA 2C3HA 2CUIA 5D7SH 1HHGB 5INCB 1AFVL 1UZ6E 2BVOB 4LIQH 5MHSD 3EJJX 4KVCH 4KDTA 3OKNB 1HQRA 3ULVC 4EBQH 4KAQH 3MUGA 2Z35B 4YC2C 1CTNA 3LN4B 3AAZA 3MXVL 4GW5A 5HXMA 5JXEC 3QP3A 2FJGA 3G5ZB 3ARYA 3ZTJH 3CXDL 1FYTA 4NQSA 1PY9A 2D7PA 5CZKA 2I07B 1BZ7B 2EO9A 3R0NA 4XTRC 4UIMB 1BVKB 3DYOA 1FAIH 3T2NL 1RZKH 3T09A 5FEBA 1FFQA 1TZGH 3ZYJA 4LCWA 3D39D 3Q0HA 1W0YT 2VXTL 4M43L 5EZOH 3WS3A 1KIPB 3HB3C 4MD0A 4YGAB 5DSCB 4KJWC 1JHLL 1KC5L 4IRSC 1D9KD 3HMXH 1JZ8A 3FT3A 4P2CG 5E7BA 4NKMA 5I30H 4LEOA 3T2QA 4JDTL 2ADFL 4PJBB 5I1AA 5IW1B 1P7HL 5IG7A 1YN7A 4CVWA 1MCEA 1NEUA 1CICB 3DX9A 4K8RC 1QLRB 1B88A 1DQML 2E9WA 2P8LB 1FH5H 3AS0A 3QDGA 4IS6B 4QHMA 2X1WL 4L29B 2ORBH 1V5JA 1IILE 3U9UA 4D9RD 4HAGA 3QCTL 4HJGB 5D5MB 2CPCA 2R69L 3FQTA 3QNYA 1U8NB 3MODL 3V95A 4K9EC 3ARVA 2CR3A 4JHBA 4JFPA 1DBAL 5E9DE 5KTEL 1M71B 1KPRA 3S37H 1CR9H 4TUJB 3IVKA 4DGYH 4ODHL 1SJVA 4WVRA 3V4PL 3SKOA 4LSTH 1W0VA 4LBEB 2H9GB 3MUY1 1I8KB 4PG9B 5DR5L 1QYGL 2BRRH 3D0LB 4MQSB 2Y06L 3RHWK 4AK1A 1ZA3A 1RHFA 4P46B 3D85B 2ITDA 5A2JH 4ZTPH 5FO8A 5CJQL 1UM6L 1MCBA 4OM0H 4NQXB 3QUKA 4OLUL 1CVRA 4WU7B 1AD9A 1QFHA 3DUUB 3WIHA 1TQBC 5DI8A 5DJ6B 2VR4A 1MRCL 2XZCH 4GRWB 4KXZH 3WFDL 1FVCA 3JVGC 1TFHA 4L8BB 5EUKB 3C9NB 3H2WA 3MGTB 3IYLW 2Q8AL 3BH8A 3HG1E 1MFBL 4DZ8A 1LEKA 1V05A 1HQRB 3D2UD 1U8IA 4BSVA 3RX8A 1AIFB 1V7NL 4QRPA 5BVJA 1WLHA 2V2XA 3W82A 2EKSA 1K5NB 4OZHE 4NC2B 5E6YA 3WNNA 1AGFB 3NIGE 5GS0H 4PP2B 3PWPA 4DFIA 3O11A 2ESVB 4KQ4L 3O41A 2HMIC 1NAMB 4YO0A 4XPFL 4FP8H 5IB3A 2ATKA 3QO0A 2B5IC 5FHAL 5EB9A 2DF3A 3QUMH 3R1GH 5JOFB 1X5KA 3CFJA 4AYFA 4JCMA 3GFUA 5DF0A 3CSGA 3QDJB 1N6UA 5HI3D 5EORL 2H2PC 3MV01 4RISL 2QKIA 2R1WB 2WSKA 2IH1B 1FNHA 1FPTH 3HPJB 2X9YA 3OR6A 4N68A 2DQCH 3SCMC 1FZMA 5GXBB 1RI8A 3U9UB 3RUGB 4KRPC 1ULVA 4AIZA 3RGVD 4K23L 4KMTL 3DHMA 1QFWH 2NY1B 4YHIB 5BS0A 3KLDA 1VFBA 3NIFF 5FYKL 4JO3L 2DL2A 5HHXH 3LS5H 3CMOL 2IFGA 1E0OB 1HZHL 1D6EA 2WLYA 1E28A 5FK9A 1JUFB 2EKSB 4NM8L 3LRSB 2XQYK 5F9OH 1EX0A 1M6OA 4UTBH 4XNQB 4FABH 1IL1B 1K6QH 1NSNL 4WEBH 4ZUWB 4RGNB 3BZ4B 3EJYD 3L5WA 2QQKH 2Y36H 4PJIB 3U4BL 4AG4H 2VMFA 3C6LA 5EU6D 5DZLA 4P46C 1I8IA 4M1DL 1XF5B 3F58H 5D1XC 4G6JH 3B9KA 4M4PA 2VXUH 4LCCC 5DFVC 5JZ7C 1WAAF 5F3HB 2JCCF 2AV1B 2DLEA 4MJ5B 4X4YB 4UU9A 5C7XL 4Y1AA 4XP9H 5BS0E 1AFVH 5DWUL 3T1FB 4QHKI 3RIFF 2GI7A 3LHPL 3TPUB 4P48A 1IKFH 4PY8I 5CIPA 1HH6B 2A0LC 1IAII 4C59B 4J4PC 5ETUA 2G5BA 1FNGA 5JPNB 4XP6L 4RFEB 2HG5A 5F89B 5DRWB 1T0MB 4G6FD 4JPVL 3B9EA 4KJQD 2JLLA 5GGRY 4APQC 2W65B 1LO3L 1AQKH 4TNWF 1CFTB 5EBMA 1S7VB 1RZKL 2X4TB 4PBVC 5A1AA 1EDQA 4XP5H 4C55A 2AV7A 2PYFB 4RFOL 1RURL 5D5MA 1FFPB 5I9QC 1UH3A 3PIQA 3ZO0A 2ATPA 4X4MA 2HFEA 1SVCP 1IC5L 4B50A 3KHOA 3WEXB 1U91A 1H0DB 2HT4C 4XBEL 4OV5A 4HUWA 2EYRA 4KRNA 5I0ZA 2V5TA 3SGKC 1HXYA 5JDSB 2IBBA 5SWZB 2XN9D 2XQBL 1FP5A 4GW1A 3OKOB 3MRGA 1F00I 4PLOB 5CUSH 4DZBB 3H9SA 4C56A 1QRNE 2CRYA 3WN5B 3D0VB 4HUUA 4QXTA 4H0IA 4YR6B 3BQUC 3EGSA 1JF1B 4EEEA 4PJ5E 3ARFD 5HI4D 3ULUL 1FLTX 1KEMH 4P2YA 4Z7NF 4X6BA 1MFEH 2IQ9L 3H8NA 4DKEH 2NYYD 3QPQC 5JUEL 2G2RA 4TN9A 2EDWA 2QQNH 3OGCB 5E8EA 5D6CA 4UQ3B 1VKXB 5EOCH 3O2VH 1CQKA 1T2QH 5E08H 5C0CE 5DC4B 3EYSH 1LILA 4IDJL 3LN5A 1KJ3L 3VGBA 4PGZA 2OTUB 5CEXB 1NJ9B 1KLGB 4G8GE 2P24A 4HS6A 3D3VB 3HE6C 5MP6H 3RNKB 3EOAA 3RWJA 3V6FB 1G7IA 3FQNB 1OSPL 5C6TH 3VFMB 3FT2B 3FAWA 4IDLA 4W4NA 4LSSH 1BQHG 1F4XH 4UT7H 1IC7H 4LFHD 3OG6B 3PNWA 2OLDA 2BSTA 3FRPG 1M7IA 1UXSB 4Q2ZB 2XY2A 3T1FA 2B2XH 4DUXA 3B4NA 3BKCH 4MJ4A 4AEEA 3MZTA 2AJUH 2IANE 4M7KH 2FYYB 3NCYP 4LPWA 1Z9SA 5DMKA 3BN3B 4WUUE 3VGEA 5D7LA 2YZ1A 4PRBA 1KB5A 1UM5H 4XC1L 1FRGH 1MFCH 3ARRA 3STZA 3KPQA 1JZ5A 1N64H 4BQBA 4E9LA 2FX8H 5GHWL 2UWEF 4PJ5D 2KUTA 1JZ4A 5GRJH 2QADC 1S7QA 4MCZA 2CSPA 4R8WL 5I1CL 4PJXB 4YFEA 1F3DJ 3OKDA 1B0WA 3N06B 2IEPA 4X98A 4BFEA 5IB1A 1VGKB 1PLGL 3IGAB 3HE6B 3MCLH 1FPTL 2F8XC 3Q48A 1BFVH 4X4XA 1EMTH 1A6AA 4K7PY 4FQPA 1ACYH 1KJ2L 2DQCL 4XCCL 4K55A 4PB9L 3VW3L 4M1CC 4IBLT 3QJFA 2ICEB 1DANT 1SY6L 3OKEA 3ZTNL 1HSBA 2XKUA 2OTWB 5KJRH 4KUCF 2DYPB 4HFWB 4HZLB 3MRCA 4ALAL 4TRPH 4MB4A 4URTB 3PWJA 3WNKA 4P9HH 4WFGE 3H9YA 3ZT5A 3CFBA 1ORSA 4S1QH 4L8SC 1OGTB 3C60A 5F7EH 1JPFB 2UWEB 2VUOA 1OARH 4FQXD 2I27N 2OXGA 1NKOA 4GT7A 4LHUG 4PFEA 3DXAA 3FN0L 3WHXA 3V4UH 3NIDF 5F9OL 4E41E 3N85L 1P2CB 3TJHD 4LSUL 4K3GA 5KSUA 1CGYA 1XR9A 1JGDA 3FO2A 1EHAA 3MOAL 3QG7H 3O6KH 1D5IH 3S7GA 1PKQB 2EC9T 3H3PL 3MNWB 1YPZE 3SJVD 3V52L 4NBZB 1QSEA 1SHMA 3DROA 5FUZL 5IP4A 3RKPA 4L4TA 1RUKL 2UZIL 1Q94A 3QIUB 3EUUA 4M6ML 5IVOA 3MRQA 2QV2A 4OQ1A 4NZRL 3D25A 2ZUUA 5D93C 1FN4A 1UWEL 5C0AE 3UTZB 1J0ZA 4CAGA 4X99B 3L3IB 3EW3B 3L5JA 5AYUH 3DTXA 5K9KB 4WEMB 1CG9B 5GZND 3CU1A 3AFLA 4MXVF 2XG4A 4GKNB 4YHOL 1E4WL 4NO0A 4NQTA 4U6XB 1RK1A 2OL3B 4JDVA 2PTVA 3NZ8A 4D0BA 1ZT1A 2BC4A 5LGHL 4U1NB 4U4BA 1CK0L 5GRYA 1A7RL 1NLBL 2PW1A 1IE5A 1YPZA 4K8RD 4TULH 1RZ8A 4XNMA 5ID0B 3JWOH 4G9DB 4UAOC 1PVHA 4ISVA 1MH5A 2ARJB 5LQBL 3P30L 4I3SH 3ABZA 4FQCH 5FECA 1H3UA 4PY7A 1TCRA 4HC1L 1KIRA 3RKDD 1SJHB 4QEGA 4G6ML 3TVMD 3VFRA 4CU8A 4Z6AT 1S7RB 4YAQB 1KB5H 4NDMB 1YPZF 1I1FA 2VDMH 2XIDA 4MLIA 1DZBA 1U3HA 1YNLH 4G6KL 3FO0L 1MJUL 4Y4HD 4KFZC 2UY6A 4XP4H 3FZUC 3S3SA 2ZOLA 2G75B 3H9HA 1CICA 4L3AA 4PRIA 5E6IB 1EFXB 1GGYA 4ZS7L 5ECJE 1MEXL 3AY4C 4OBSA 2Z31B 5JUEH 4L8DB 1T2JA 2YBRA 1ZLWH 4LVNC 3NZ8B 5E9DA 4O2FA 4KMQA 3OV6A 2WUBH 4LARH 1A2YA 2YA2A 3RWEB 3U46A 3JXAA 4PRAB 3EOBA 3GBML 4WTXA 4KDVA 3PHOA 3GMPB 2PXYD 4HKXA 1Z5LB 4J7RA 1K4DB 5HYSG 2NY5L 3QCUH 5IKCA 1NEZA 3PABA 5A3IC 1BWMA 1MF2H 1BIIB 2ZUTA 5JPMB 2ZUXA 5ETUB 5LJYH 4OF3A 1KENL 2CD0A 3MRNB 3O6FC 4JM4H 1R6VA 3A6BH 2XYCA 2VN7A 5ID1A 4Z7WE 2GTWA 1QSEB 3DROB 4JHZA 4JFZL 3JV4B 1N5AB 2QR0A 3D3VE 5JLZB 4Q97A 5J6HB 5D1XB 3MUJA 1FBIL 4GRWH 4JZJC 2YRPA 2ZOKB 4LLAA 3V5HA 4TVPL 1QR1B 4HMCA 2J4WL 3FT4B 1BBJB 4WI4A 1MHPH 4N8PA 1JWUB 5DUPH 4JPKH 5J57B 2ESVE 4M8QA 4NUGH 5E56A 5F6IB 5IQ7L 4XBGA 3RL1B 6CGTA 2VZ1A 1VSCA 3S5LA 1PSKL 2ICWB 3HN3A 2X6MA 3VFWA 3LDBB 4QRPD 5IV2B 1KG0B 2BXZA 3P77A 1DLFL 1GZPB 3VD3A 2FNBA 4PJGE 1ZTXH 1VFMA 2DMBA 5IEKB 3MX0A 1L6XA 1EMTL 4LCCB 5CEZD 2NTFA 4R2GB 3EZ8A 4W6YB 2CMRL 2X1OA 3ARBA 1YEIL 4K07A 5T3ZH 5TF1L 4K7PH 4PD4J 4ZD3H 2NY4B 4TTDD 3UZEA 3NN8B 2YD3A 2AJSH 5KJRL 5MEOA 3QRGH 4ODXB 4OZGA 3TVMB 5DD3L 5HVFB 1I3VA 5J1AA 2YWZA 1CFSB 1V7MH 1PQZA 2F54D 2NXYC 1TQCB 3CSBA 1OAXL 4UDUB 2NR6C 4I1NB 4QKXB 1NL0H 2MJWA 3M1BA 3D48R 3RGVA 4OUUA 5FUCE 4M6NL 5IMKA 5IBTH 3NFSL 1R3IL 4EI5D 2OSLB 2X4NB 2ARJQ 1IC1A 4P57B 3TH2T 2A0LD 1Q9OA 2EC9U 3ZHDA 1IAIL 4N0CD 3PNWB 5CZXC 2FEDD 3UYRL 1U8KB 3P9WB 2JB5L 4DGIL 4XPAH 5D5ME 5ABDE 1LK2B 4WFED 4MD5B 1QFUL 5CJOL 2ZWLT 3SKMB 4PY8J 4AIOA 1E4XH 4YXLH 1EHNA 1A7NL 2NW2A 4HG4J 2MNUA 1UXWB 2NY7H 2ICCA 4P2QD 5JPMA 4PGEA 3MLSH 4AEHH 1VACB 1IM9A 3EO1A 4IRJC 3C6LD 5B21A 1T6WA 2PYEB 1A6VL 1TVHB 2CK0L 2YXMA 2AXFA 4HXBL 3QUZD 4XCFH 1LE5B 1CZ8H 2XKNB 3QEQA 5HJ3A 2DQIH 4KK6C 1A8JH 4BQCA 1HKFA 2X89D 1I7ZB 1MCKA 2Y7QA 2VTFA 3KJ4C 1AQDB 3KPMB 3T0EE 3ULVE 2PW2B 5IR1B 2GFBB 7FABH 3OL2A 2YA1A 4HUXB 1FV1B 1TETL 1XCQB 2W0PA 1KLGA 3U4EA 1PG7L 1PYWB 2F53D 2MOVA 5I1LB 3ZYZA 5C0IA 1IQDB 4I3SL 1A7BA 4PRPB 4WJ5A 4G6MH 2EH8L 5JIHA 4WO4D 5K33A 4Z7VF 3VA2C 3LQAH 4PREB 3C5ZC 4PJGB 1ZS8A 5MEQB 1B4RA 4EJ1C 4CRPA 4PJ5B 2IQAB 4JG0L 1BQHB 3MBED 3X12B 1KELH 3LMJH 4FQ1H 3BKJH 4YPGB 5GGVL 4N0RA 4J3SA 2XXCB 1FJ1A 1XT5A 2BNUA 3FB7B 3BRGC 5JW5B 4CU7A 1Z6JT 3GJFH 4Y4HA 5F93C 1WWAX 3RA7H 5HHOE 4ENED 1IGCH 1KBGL 1YEEH 3KPQB 4PP1D 5I15H 4MJ5A 4QXGH 4X4YA 5I1KH 4HKJA 4NM4L 5F7NC 3WFZA 5T1MB 1S7UA 4YZFE 5K9QI 3RRQA 1YJDH 5EIIA 5ALCH 4WO4A 2EE6A 3MTRA 1PKQE 3CXHK 4JQVA 4PJHF 1P69B 4NPYA 4QRRE 2VE6A 4R4BB 4XCEB 4K7PX 5ILTL 4G8EA 1IEAA 2VXQL 3GB7A 3GSRB 1I1YA 3EBAA 3QO1B 1S7WB 4X7SL 5ALBH 5CP3H 3C5ZB 3WN5C 4F2MB 4F7TB 4NN7C 4B41A 2VLRB 4GXUM 1Q9OB 1F6AA 4PG2C 4S1SH 4HFWA 5DEGA 4HMEA 1MQKH 3QQ9D 3TYFB 3VMPA 1MWAA 3WNPA 4P2RD 3WL9A 1UB6B 1IGML 1R3HA 5CHNB 2AI0L 2QSCL 4JPKL 3T77A 2ZNWA 4KQ3L 4G3YL 5E7FA 4NUGL 3I50H 3Q6GL 1I4FA 3HPJA 2FX9L 9CGTA 4OCNC 2UV3A 1PG7X 3QEHB 3EOTH 3MFGB 5TDNB 3TBWB 4P2OD 3TBWA 4CMMA 2JJSC 2ZCKH 3BYTA 1YEKL 5C0BB 3EAKA 5I66B 5ISZD 1EXUB 3ARFB 3LKRA 1WIPA 1NC4D 2ZCLH 4X9IA 5LBSH 3T0BA 1LO4L 3IDIB 4JANA 5HYIA 1QRNA 2PR4H 4ZD3L 5JDSA 2ICWA 1NC2B 3U7WH 1K3IA 3G6AB 4OF8A 1NGXB 1WGOA 1LE9B 3VXME 3NH7H 4Z9KB 3WE6B 3TV3L 3WS6A 4Y5VB 3V5KB 5BJTB 3CK0L 4G80B 1CXKA 4M7LL 5DXWA 1RAMA 1FYTD 5JOPD 3VXQA 5DHVA 2EH7H 1F4XL 4FOMA 4QCIB 3VDAA 4XVTH 4E41D 3I75B 5LG1A 2P5WB 1FL5B 3HPLB 3W9DA 2DQHH 3BD4A 2F53B 3BX7C 5K93A 4PJEB 3BKCL 1B3JA 3G9VA 4YHLL 1U8HB 5GJSH 2EEDA 2NY6C 3G08B 1QPXA 4TSCL 4IIQB 2HH0H 1RUAL 5FYJD 1QFUH 1G84A 4OZIF 5F3HA 3GI9H 1NC4B 5GGSY 5BO1H 3VXSE 1QSFA 4POUB 3QEUA 2FYYA 1TIUA 2R0LH 2ED7A 1RVFL 3VFPA 4JO3H 1TVBA 4BZYA 3KXFB 4WHYH 3TIDB 3QDGD 2A6JB 3DJ9A 1S9VA 3VFOB 1EHLL 1OCWH 1U8QA 4QYOA 1WZ1L 5C08E 5IOPB 3OAZH 4BA8A 4LF3B 1T21B 4H25B 4IS6A 1N0XH 3MR9B 1FDLL 5J3HD 1LO5B 4LHUD 3C5ZD 2CJUL 4LKCB 3TT1H 3L5XL 4UINL 1YEDA 2LU3A 4ELME 5EOQH 5F6HJ 2P8PB 4W81A 3F58L 3WO4B 1QPPA 3D2UA 4FFVC 4R4NC 2R0WH 1RZGB 3BN9D 2GJJA 2FD6L 4HKZB 4PRPA 3FB6B 1ZVHA 1HCFX 4JJ5B 3RVTC 4OIAA 3UTSD 1HHKB 4WHYG 2PTTA 4G43A 3ECBB 3DYPA 1L7TH 3FN0H 2H32H 4F9PC 2CDFB 1CFVH 4U1KB 2XWTA 2DJUA 1JHTA 5D7SL 4OI7A 2UZXB 5DTFA 2NZIA 5FB8B 5T3XH 4QHUA 1EA9C 5MEPA 5ITBL 4KVNL 4DKFH 4JG0H 1KB9K 1ORQA 4IMKC 5ESVB 4P23D 1NMAL 2QKIB 2R1WA 4I18B 5F7DA 1JI1A 3BGFB 2DJSA 5C71A 4WDIB 4GRLD 4NQCE 4HLZG 5FO9A 3RQ3A 4R90H 3QUYD 1Q9LB 1S5IH 3DXAE 4U3CA 1QACA 3ILQD 1N0LA 4XP5L 4U31A 3DX9B 4OT1L 4Z7UE 5CEYA 4JO4H 3O11B 1HHGA 1DLHA 2ESVD 3KVQA 3UC0L 2BY1A 3MRKB 4GLRI 3HI6L 1X5FA 4LU5H 1NFDF 4LEOB 4X80L 4N0CC 4QRPB 3DVNB 1KC5H 2EDTA 2ID5A 3K74B 3BZEA 1YYML 1DL7L 3AAZB 4GW5B 5DJDB 5GGVY 1NH6A 4OD1H 4FQLL 2EIDA 2HWZH 3PHQB 2K7QA 1N4XL 1OB1A 4YJZL 4KHTH 1Q1JH 4PJEE 1J8HB 3AMLA 5DJ2B 3O9WA 1A5FH 1MHCA 3ZDYF 4EI5C 2P5EB 3UDWC 4XXDA 3X17A 1UG9A 4EI6A 4BELD 2Y6SD 1EGJA 4HX1B 1OM3H 1FL3B 1ERNA 4MZ2A 3B43A 3P73A 1P7KA 15C8L 1PQZB 3LKSB 3OXRA 1AHWA 1NCWL 2AAVA 3EJZD 3P0VH 5GS1B 4KAQL 1UACH 1CFNB 1WBXA 2D9QB 2NX5D 2CIIB 2VLKB 3GJEB 4C83B 2IBZY 4HIEB 1MHHA 3STLA 1FNAA 4LCUA 4P9ML 2IF7A 4IRSB 1DVFD 2HVJA 4PJ9A 1B90A 3OQ3B 4HK3J 5GGSA 4DQOL 4ZUSA 3RZWA 2DI7A 1A1MA 1EJOL 1NEZG 1RZIB 3KAAA 2D9CA 2B7DT 1CWVA 3CH8A 2RHEA 1Q9KB 5SV3A 1J1XL 4JKMA 4E42B 4NN6B 3PP3H 1IAOB 2W1NA 4RQQA 5FF6B 3WIIH 4ZUTA 4OZFA 2M1KA 3U36A 2DWEB 3L95B 5BVJB 3MMEB 4HKBB 2WIIA 4HIHA 1YNKL 3IFOA 5EFIB 5JOFA 2EE9A 4M7KL 4YGVB 5EWIL 5J89A 3I2CH 5T3XD 2Q8AH 5KSBF 1C1EH 2I07A 1J1OH 1MJ8H 1S7UB 3D18A 1SM3H 3HE7B 3M8OH 3F7YB 3A6CH 4Q6IC 3BVNB 1QVOA 1NUNB 1FZMB 3G5ZA 1ZLUH 5B39B 5L8JB 4WU7A 3LZFL 4M7LT 1X44A 5EPMB 1HH9B 2ERJC 4NKQB 5E2UL 4A2LA 3KYOB 1CD1A 2GITA 4ZG1A 3BUTA 1X5HA 4U6HA 4OIIH 2YMXH 3RU8L 1BFVL 1XGUA 4X6EB 4WUKL 5D8JL 5DGRA 5J11C 3J8F7 1EEZB 4N0YH 4RX4A 1OAQH 3HE7D 4OF7A 1C16B 1ZA6B 4F7TA 4MAYD 2R4RL 3HKFA 2GJ6A 5DRNB 3CSPA 3GSRA 4NQCA 3TYGL 4XBPB 1A2YB 1RVFH 3OKYA 1NJ9A 3IS1X 3QNYB 1KIQB 1X7QB 1ONQB 5B38A 5C0IB 1JGUL 4AQ1B 1MCRA 1UA6L 4UB0H 3WFEH 3BW9A 2R29H 1DUYB 3KPNB 4G7YL 3SDYL 2NX5E 1LQSR 2XN9A 2I9TA 3RY6C 2BHZA 3PGFH 3MOAH 4P2OA 2Z93B 3OJDB 5I1IL 3CSYB 2A74B 4PJ8C 3TBSB 4LSQH 4OLXH 3VJ6A 2C7UB 5CJXA 5GRWA 1D6VL 2ICWI 4X8JB 5DFTA 4WY7H 4QTIL 1AP2A 4GAJH 1CU4H 5GS3A 1CDGA 5HJ3B 1HKLH 3PWUA 3CVHA 5DVNA 2VLKE 3HE7A 1VPOH 4LBEA 4QY8A 3UP1A 4WFGD 4M1DH 4CMMB 4Q0XH 5T33L 2DKMA 4TNVK 4G9DA 5TDNA 3RAJH 4FTVB 1CL7L 3JZ7A 4NZRH 1YN7B 1B6UA 3QUML 3R1GL 5DFVD 4BJLA 3PL6C 4Z76A 5F88B 5DQ9B 3LAFA 2KDGA 3VXTA 1YN6A 4DN4L 4FXGA 4U6XA 2VXSL 1CN4A 3RTQD 4PJAA 2OK0L 2PYFA 5FA4A 2LV4A 3LCYA 5KSAD 5FYKU 3GIZL 1XCQA 3GRWH 3ISWA 3KYKL 4MX7A 3AROA 1M4KA 1QFWL 2VIRA 1U9KA 4N5ED 4YXLL 2BVPA 5HYJE 1BZ7A 5LGHH 4F58H 2UUDH 1NANI 1H3VA 3TN0C 1NBZB 5CJBA 1F2XK 4F15B 1T0PB 4B7LA 1MNUL 1JK8A 3CDFA 4YEFA 4YHZL 4O51B 5B8CB 4Z5RB 3RWGB 5J12B 4OZGB 1HH9A 5FYLE 5ICYB 4M9PA 1X5YA 2XZZA 5ITFA 5BZDA 2YD2A 3U4BH 2FH8A 1ZMYA 5F1OB 1T5XB 4O2CB 2DLGA 3VCLB 1CDHA 2EXWC 3FO0H 3ZYIA 5B38G 3SDAB 3M17B 4K3EL 3SKMA 4GSDL 4YE4L 2IAND 4BQ9A 1QLEH 2BSRA 1CD0A 2NQCA 2VDOL 1LGVA 2WAHA 5HGBA 32C2A 3PHSA 4GW4B 1IGIH 1T5WA 4OZHA 2VLME 4CW1A 4UTAH 1WCBB 1M6OB 1N7ML 4XNQA 4H20H 4MNQE 4P57A 2Q3AA 4ZXBA 2HTLD 4RDQG 3IS0X 4PJ7A 1UEMA 5FK9B 5D7KE 5JW4Q 1BFOB 5KVDL 4I2XB 1NGYA 5IBUG 5E2TL 4XMPL 1P7QB 4DN3L 5H35A 4Y4KD 1BD2B 5D7JC 4LCIL 4TOYL 5HVHB 1ETZA 3HC0B 1OW0C 2KPNA 3NGBC 4L8SB 3WLBA 3RVXD 1H5BA 4P59L 3O3DB 4U1GB 1AP2B 1YMMD 5ESVA 4R2GD 1PYWA 1U92A 1S3KH 3OR6B 5MEPB 3U0WL 1KBGH 2F74A 4RMWA 2Z93A 3OJDA 1F97A 3IDYC 3RDTD 2XWTB 2GCYB 4M5YH 3ARUA 3TVMC 3PXJA 4M1CD 4KI5C 3ZKMD 3QO0B 3GJFB 2CXGA 3TZVA 4I0PA 3BPCA 5JHDB 2MPAL 3OB8A 4MNQA 3RZCC 3W2DL 5F21B 5INDB 2XZAH 2ADFH 3MV9E 4HIIA 4L8CB 4JFOA 1XH3A 2HJFA 3S96A 3ZDXE 5H94A 2NY2C 3PDDA 3VFTB 1JGVH 4YFLI 5IVXF 3O9WC 3RPKA 3SE9H 2N56A 3DURB 3O6LL 1MFEL 2IQ9H 4X5WB 5DMGC 4DGVL 4ODTH 2Q7YA 3UDWA 3BH8B 5EIQA 3GMLA 4KKLD 1IGJB 4LLYA 1IGJA 1RUQH 1EEZA 1BWWA 4G80A 3CX5K 2LABA 3K1DA 3O2DL 5IK3A 4DVBB 4YK4B 4O5LH 4ZSOE 4WUKH 4NNXB 2OZ4L 1CL7I 3H42H 1KFAH 1UWXH 5DD5L 3D69A 2WBJA 4UBDC 4AIXA 2AI0H 3MLZH 4XPGL 1EV2E 4HH9A 4OLEA 3CH1A 4D0CA 1PZUB 1S9YB 5DRZA 3BPCB 3TYGH 1YDPB 4JFQA 1FL6A 4PY7B 4IIQA 3MBEC 3ELAT 3GUTA 3UTSE 1KN4H 4ODUA 4Q9RH 1KSRA 2FIRT 2O5YL 5I74B 3FO9B 1GVIA 1IM3B 4GRWF 1KCVL 1A9BB 4PJ9C 2VQUA 5FCUL 1FVDB 4XPTL 2VERN 3KR3H 4FZEL 2QLVB 4MB5A 5E6ID 4DVRH 2XZCL 1D5XA 2D7MA 4U7MA 3B2VL 4CVUA 5CHNA 4QNPE 2Z31A 3C5SA 5HSFA 3L6FA 2RB8A 1CDCA 4POZD 4KY1H 4LGRB 5IFAH 1VPOL 1BFOA 2DDQL 3CFKB 3QUYB 2AJXL 4Y2DC 3MOBH 3L3IA 4YUEH 1YEDB 2IH3A 3KG5A 1ZLVH 3TN0A 2DD8H 2XZQL 4JQXA 1UKQA 3EYVB 5D70H 1BJ1J 4N5EC 4LRIA 1NANH 4Z0XA 4HBQA 1S7TA 1UQSB 3BZFA 4X7FC 3RIAF 2W0KA 1FO0H 1TJGH 5KSAC 2RQ8A 4S10A 3PP3K 1SMOA 1QSZA 1I7RB 1MCOH 3OKMB 3QUXA 1T89C 1KJ2H 1NPUA 1INEL 3LEYH 4PB9H 4DTGL 3S36L 5J1SC 1M7DA 1ZGLA 3SCMA 2BVQB 5T1MA 4JO2H 1LDSA 2YPVH 5KSBE 1YQVL 1KCRH 1IZJA 2EECA 4FQIH 3ET9F 1TETH 4LHUA 3BSZH 5HHVL 1ZLUK 4QRTB 3EYUL 3DGGA 4PRPE 3DTXB 5K9KA 2L7JA 4ONGL 4MCYB 3MRBB 4DOHB 5CWSA 1FN4B 1KOAA 1V3LA 3UTZA 3CFEA 4HC1H 2JJWA 1KPUA 3QZWG 4UOJA 5DHXB 3TC9A 2VXVH 2CDEA 3K2UL 4M62H 4G7VH 1IEAB 3MXVH 4AG4L 5CLTA 1EHXA 1ZHLB 4JM2F 5D7JB 1UADC 5HD8C 1EEQA 1A9BA 5J56B 1GZQA 5T3XE 1FE8L 4WHDA 2OJZL 2PYEE 3BP7B 3OBAA 1HN1A 3X13A 3RGVC 3GHEH 1XCTA 4LP4A 3HE7C 5T3XL 5KVDH 2W9EH 5E6IC 1YDPA 4JPIB 5B22A 5E2TH 4GAYB 1VGEL 2DYPD 5A2IH 4HCRA 1J8HD 1LE5A 5IUSA 5IVZB 3ARFC 5HI4C 3UTQA 1KCSH 4P2RE 1QSVA 1JN6A 3X3FH 5I2IB 3AU1B 4NGHL 1JNNH 1UM4L 2VN4A 4LRNL 2NZ9D 3FO9A 4DEPB 1D9KA 3OB0K 2XQYG 1LO0L 1AQKL 4PJGA 3HI6H 5GGQH 5LQBH 1AGFA 4JKLA 4JY4B 2C5DC 4NNYA 4HWBH 4XCNB 5L9DH 5FM5O 1KIQA 5I0DA 4RAHA 4KRPD 1S5HA 4LF3A 3MRBA 2VAJA 2WV3A 3D3VA 2VIRB 1F6AB 4M5ZL 4PJDF 3QUMB 3BPOC 5C0ND 5BRZE 3MV8B 1Q1JL 4HZAA 3MRRA 2E6PA 5HGHB 4XH2A 4CVXA 4PR5B 3KPMA 3QXDA 5DJ0A 4APQD 3JWNC 4IOIA 4L4VA 43C9B 1SJEB 1F11A 3U1SH 3NA9H 4J6RH 4WCYH 1X5AA 4IRJB 1N8ZB 3IJYB 3FQRB 4MHHI 4QTHA 4P2RA 3VXRB 2I60H 2J5LC 5ELIA 3BISA 1D9KB 2VOTA 4OM1L 2E5EA 2F53A 1DEDA 1X4ZA 3WUWB 2H2SD 3FJTA 4OUOA 4PS4H 3QDMD 2JF1A 3MLZL 4X8JA 5D7IF 1QEWA 2VITA 1K2DB 2NCMA 2YOCA 2V9QA 2FBJL 3GSVA 3NCJH 3VXUA 4ODBD 4Y4HC 3QUYA 4OM0L 5C9JB 1GJIA 3BP7A 3CK0H 3QRGL 3ILQC 4LHJB 3P77B 3U79A 2CIKA 1ZS8B 2W9DH 5J06A 3G5XB 3VWJD 1T5WB 2BVUA 3UBXG 1S7SB 1Q9KA 2F5AL 2FLRT 4QF1B 1S5HB 3KR3L 2CLRB 2DQHL 4PJ7F 3AREB 4XWGH 4M1GL 2HLFC 1NUFA 5FFLA 2DI8A 5CFHA 4OZ4B 5GJSL 3VI4E 3U48A 5ID0A 5JMOC 4RBPH 2DQFB 2GTZA 5JO5B 2XA8H 4YBQD 3L3GB 3PG2A 4YR6A 4KPHH 1IAIH 5F7HA 1OAYH 2X4QB 1OTTC 3T3MF 2JB5H 1NLDH 3ZSSA 4EN3A 1RK1B 2B5IB 3HZKA 3P73B 4HGKC 4XT1C 1LDPH 4NN5B 2V17L 3I6LE 2PYEA 3QHZH 4RISH 3SGJC 4HWZB 3WL9B 4JY6A 3VRIB 3NGBB 1I1RA 4GFTB 1KACB 2NXYB 5T3ZL 1YEIH 3DPBA 1WZLA 5DK2B 1ES0B 5I1EH 1RMFL 2HTLC 2I26N 1F4WH 2AJVH 4F2MA 1OTUD 4JKWA 1F4YH 2W91A 2X4PA 3ULVH 4G6FB 1F90H 4UUJA 1YQVH 2GT9B 3E3QE 2GT9A 3VFTA 4PGJA 3TNMA 4CN1A 3U36B 1KPVA 1E4KC 4PIRF 1J5OH 5AUMA 1WK0A 5SV4A 5CD3B 1G7LB 1OF2A 2EDKA 3QPXH 4HHAB 3IJHB 5CWSB 5DD6B 1VFAA 1EAJA 4WWKD 4JFHD 4EI5B 4JDZB 1DQJB 3BJ91 5F7EL 5C0FB 1XGRA 1JGDB 2J8HA 4EDXB 2BZDA 1QFWI 4XP9L 2KBGA 2DTMH 1A7QL 3PL6B 5BV7H 3EHBD 4LSQL 4J23A 4OLXL 4L4JA 4PJIE 2W92A 5ANME 1XF3A 3LKPA 4Y4HB 4KKAC 4NYLB 3T3ME 2P43B 1MLCA 1FORH 3MLYL 1ZEAL 3V2AR 5DUBB 4F7CA 1ZT7A 2PNDA 2GJZB 1BIIA 3RWIA 2QQLH 1AGBA 5MERB 2OP4H 4IJ3C 5CCKH 5MI0C 2DN7A 1GOGA 1KCKA 5BMFH 4F15C 1EEUA 3EOBB 1I8MB 1A6VH 1P1ZB 2CK0H 3WFBL 5I1GL 1T04A 4WV1A 1NCDH 2AXGA 3TT3L 1IQDA 1WCBA 3GHBL 5F88A 1U8IB 4BSVB 3ESUF 4RX4D 2VDLH 5DFWH 2BSRB 4L9LC 4XP1L 5C6WH 1LO5A 3CFKA 4OKVB 2QHLA 2HFEB 3P0YH 3QHFL 1NMCC 4X6CE 1HCVA 4KROD 2HFFA 3Q2CA 1NGPL 3BP6B 4PRBB 5FYLH 4P4RB 1T6VN 1OM3L 1A7PL 1A7RH 1NLBH 1BP3B 1AXIB 3TFKD 2R2HB 1Q94B 3QIUA 2W0FB 1OP5H 1AGDB 3MNVA 1T7ZA 5B8CA 5TF0A 4D9LL 1YPZB 3GBLA 2CRIA 3BKYL 5B3JE 4H88H 1I85C 1WWBX 3MYZA 2OR7A 2O61B 3TZVB 2N7BA 3LKQB 2OTPA 1C12B 5CJ8A 4EN3D 5EU6E 1TITA 2HLAA 4M61B 4Y19A 2G60H 2KQMA 4XB7A 5F7KC 3JTTB 2ZUQB 4KI1A 5EPMA 5AWNH 1CIUA 1OL0A 5DRNA 3ECBA 1RQ5A 3EZJB 2CQVA 4ZS7H 4JN1L 3T2NH 5EBGA 1EPFA 3ROOA 3UX9B 3SY0A 3QULA 5DDHA 1J18A 1XGUB 2X9XA 1RZGA 2GJ6D 4PS4L 3LPFA 1JL8A 1EFXD 2BDNL 3GGWA 3O6FA 4JPWH 3U9PL 3NCJL 1UH4A 3MMEA 4DKDC 1VADB 2F5BH 4FQQB 3VE0A 3ZKSD 2Y72A 3L7EB 2QSQA 1SM3L 4GUPB 3EGSB 5LGKA 2R2EB 5F8RC 3B9KD 4ZYKA 3FB8B 5GS1A 1T1ZA 2W07A 2YSSA 1X5LA 3SE8L 4XMKH 5I66A 2WLZA 1ZLVK 5KVGH 4NQEB 5TQ2L 1WBZB 3W9EB 2CUMA 1SJHA 3RWIB 1XCTB 4JRYD 3MLTA 1ADQH 3DXAB 3WHXB 5HI5D 5D8JH 4PV8A 3FB5B 4YHML 2MCG1 1J7VR 4KQ3H 1H8NA 4LLQB 4Y8DC 2YRLA 2FX9H 1MHPL 2N7AA 5SWQB 1IQWL 1W72B 5DUPL 3RVWD 4KJQC 3DVNA 5ICZA 1FG9C 2VKXA 1ZVYA 5IQ7H 5DHVB 1CE1H 3O2WL 1DBAH 3OB0H 4X4ZA 1YEKH 2R0LL 5DLMH 5A16B 2XPGA 3DSNA 3PV7A 1XIWC 1VDGA 2E8YA 1G9NC 1YYLH 3IRPX 4Z8FL 3E6HB 3P2TA 1TENA 3FRUB 5EU6A 1JRHH 4UUJB 5KZCB 1MPAH 2XKSA 5JLZA 4MWFA 4GG8B 3V4UL 5KANI 4KGLA 4HC1A 3FOLB 3UZVB 1YY8B 1AD0A 1JTPA 2HRPH 5TE4H 4MJ6B 3GMNB 1QRNB 2EDHA 2DKUA 2CJUH 2KQNA 3DIFA 4Y4FD 5DT1H 5KVFL 3GMMA 3DXAD 5CJ5A 1MRFH 1JZ2A 2V9TA 4KGJA 3IRZA 3BEVB 3QUYC 5ESAB 1WBZA 3W9EA 3CJJA 4K3HA 2J8UE 4WHCA 4XVTL 2V2TA 3F12A 4N0UA 4KZDL 4WDIA 1A7QH 5JXAL 4R7NA 1HOCA 4RZCB 3LRSA 1JNJA 1DJSA 2CKBB 5GGRA 1LEIA 5LAXB 2BMKB 5KVEL 4OFDA 1CD9B 3LDBC 5DJXA 2MHAA 1HYSD 2FIKA 3GMOB 1H3TA 2ZKHL 3MJ9L 4S1RL 4MAYA 3FQWB 3IXTA 4HULB 1PAMA 4KUCD 5IROC 4PJCF 4Y4KA 5BCAA 1P9MC 1BVZA 3ZE1F 4M03A 1E6OH 1T4KB 1C08B 2DRUA 4JZJA 1I75A 4LNRB 5IJKC 1E4XI 5GS2D 1S7WA 4LSDA 4ZPVB 3RIFK 1XGQB 3FB5A 4QHNB 2ADGB 3TBVB 3WV0A 5JQ6H 1B0GA 1MIEH 2XNAB 4JR9H 5K9JH 5DTFB 3TESA 4MXWL 5FOBA 5JHLH 4U6TA 1JWSB 1FFNB 3TIEB 4N1EA 3THML 4F3FB 1UWGL 4Z78B 4I77L 4FABL 1S8DA 2VDQH 1REIA 3BJLA 4GMSH 3RHWF 4P2QA 4ODWB 2E27H 3QNXB 1U8HA 3GMQB 2WWMC 1FL6B 3LS5L 2CH8A 4JAMA 4MD4A 4G6JL 5ESAA 3QR2A 3MRPA 2B4CC 1BM3L 3BOVA 1MHEA 4P4KD 5H2BB 1OAUL 1PG7H 1INQA 1MJJB 5EIVA 2E9JA 5DO2D 3CX2A 4WEBL 4ODSH 5HYFA 4WRLA 2QSVA 3NTCH 3V5KA 2A73B 3AXLA 3CVHH 2DQGH 3RL2A 4YZFF 5BQ7A 1BQHA 5ESQB 2UZYB 1X7QA 5BXFB 5CBEA 1AD9B 4DN3H 4NO5A 5EU6B 2WIIB 3CDGB 3DI2B 3T1WA 3RDTA 1FLRH 2HKFL 5E99L 5D72H 1SEBA 1K4CA 1G0YR 5GISH 1FAIL 1F58L 3E6FB 1WIOA 3B9KC 1G6RA 3VI4F 1INDH 1IRAY 4MDJA 4WW1B 2DM7A 2BNQD 4I4WA 4MNHB 4WGVB 3QEGL 3BP4A 3ARQA 3QCVL 4OGAC 1AGDA 4OF0A 1T1YB 5IMOB 2P5WA 4LRIC 3STLB 2WINA 4QXUH 1MSPA 4M9OA 3RUGE 2F5BL 5DRXB 3KLAB 5HHQB 5ALCL 3T8XA 4EOWL 4RIRB 1A6ZA 4R26L 2EYSA 5EUOB 3WDHA 2EKJA 1OQXA 2Y5TA 3D3VD 2V2TB 4PRIE 1TJIH 2D7TH 4FNLH 4ERSL 1KJMB 1FYTE 5LXGL 2A9NL 2A83A 1RY7B 4Q9CA 1JZ7A 5DEGB 2ZG2A 1NC2A 4PTTA 2YUVA 5A3ID 3QIWB 1FGVH 4Q9QH 1CGUA 4L9DA 2DQUH 2NY2D 1T04B 5BW7C 4YPJA 2WP3T 4E42A 4OZHB 4CW1B 3G5VB 1MRDH 5EOCL 1OHQA 4U3XA 1A3LL 1RZ7L 4P0DA 5DZNA 4LVEA 4XAWL 4XX1G 3K0WA 2YUXA 4KI5D 4J6RL 2XPGB 4Y16D 3RUGA 2O5XH 5D71H 1Q72L 1YUHA 4X6CF 4NYLA 2J8OA 5EH1A 1I7UB 4R0LB 4L9LB 1RJCA 1TDQA 2B0SL 1J0KA 4FN0A 2YS4A 4HQQL 4NZUL 5FO9B 4Z7OF 3Q3GB 4P5TA 3WS6C 2HT2D 3OAYH 4U6YB 5TE4L 2VDPL 2A6DB 3K8LA 2X42A 1I3GH 2BVPB 2AJXH 4OZIE 1BX2A 3TGXA 2DMKA 2X4PB 4XPAL 4OI8A 2YA0A 4G9FA 5E9DB 1QA9B 1V3JA 3IETA 4HJ0C 2HFFB 3TZVC 5IJKA 2WWKO 1DTUA 5I1LA 5EORH 1FZOB 2B2XL 1X5XA 3O0RL 1WF5A 1A4JB 4OCWH 2DQTL 4YDIH 5EO0A 4H1LH 4NQXA 1VEOA 1WISA 2H8PB 1YNTB 2O26U 4LVOC 2HTKC 5E5MB 4PP1C 4I0PD 3JTSA 3KPRE 1RU9H 3HFMH 1JF1A 4K3DL 5E8PA 1NCCH 1WAAA 4Z18A 3RUGF 1CCZA 1BJ8A 4MAUL 5HYQA 5J9PB 3LRGA 3LRHA 1N5AA 2QR0B 2ARJA 3SKUD 3IDYB 2FSEB 1BJ1H 2VC2L 1OAKL 3LVEA 1WFNA 3G6DH 1RZFL 1IKNA 1MI5D 4HUNB 3SDYH 3MCLL 3RFZC 1JGEB 1JMZA 4LCYA 5F71A 1ACYL 1NC4A 3OKLA 1X5JA 2NXZB 2DQIL 3MRFB 3HI1B 4WI6A 5DUBA 5I71C 4MQ7A 2H41A 1F4WL 3SY0B 2Z92B 3BE1H 3DV4A 4ZFOA 3ROOB 1F4YL 3O8XC 1P6FA 4ALAH 4MB3A 4GKNA 3V6BR 1S7VA 2X4TA 4ZUUA 5TFSL 3QUMA 5C9JA 4PBXA 1DQJA 5E8OB 5EC1B 4I8DA 4XCYA 4NSKB 5T33H 4HBCH 1T1WA 2FR4B 4H8WH 1KLFA 5DYOB 1IKFL 1HI6B 1UKTA 5HVGB 2VLJA 3QFJB 3DVGB 3INUL 1QSEE 1BVLA 3Q5TA 1S9VB 3P4NB 1IGCL 4GMTL 2J7LA 4JZNA 5E1HB 3UO1H 3RWHA 2VWEC 5MEOB 4JAMB 1E4JA 4YDKL 1NFDE 3O3BB 1EZVX 4JANB 4CGTA 5DC9B 4LVHC 1FGNH 3GMMB 5I8OL 4PRDB 5E70A 1TCRB 5I17B 3P4LA 1INDL 1OPGH 3QIBA 5CZVL 3ILPB 3OX8A 1MNUH 3HC4H 3ZHLA 4MA7L 3RVVC 4NO3B 5D1QD 3WKNA 4WNQA 4XPBL 3MUGB 1KPRB 5I19L 4OJFH 5KS9B 3VFWB 1E6JL 1NFDB 1W2KT 5C08B 3OWEA 4AL8L 3MRCB 4PJFE 4OZGE 5J6GA 1WTGT 3O6ML 3HI5L 5EZJB 4Q6YA 2P1YA 1DQTA 1T66D 2Y07L 4EOWH 2NY0B 2X1PA 3X3GH 4GSDH 2VDML 1MWAB 4EI5A 4TULL 3SO5A 4OCSH 4NUJA 3PWPE 4AJ0A 4XAKD 4C56D 1CGWA 5DJ8B 4IEFB 3G5XA 5D2LB 5C08D 1XF4A 4XZUB 1H3GA 2Z0BA 1U93A 4LIQL 4GXVH 3TA3A 1XF3B 3LKPB 5JIPA 2BHYA 1CICC 3MODH 3OJ2C 4HDIA 3SDCD 1F42A 3DSFH 4HWUA 5HI5C 5E5RB 3DO3A 3HAEB 5L8LB 2C4XA 4G6KH 1YNLL 1I1CA 3CPLA 5GZOC 2YZ8A 3DV6B 3HZYB 3MJ6A 4RAUA 5EUOF 1YEJL 3H3KA 4FTVE 2EXYC 2ADIA 3BKML 1CDJA 5CSGA 3QH3A 6FABH 2VXTH 1SEQL 4M43H 1AIFA 1UCTA 3L3DB 3DVGA 1CE6B 3K2MC 2DWDA 4ONFH 2VQTA 3WDJA 5CJQH 3W39B 4KHXH 1R3KA 4R3SB 3EOYG 4M5YL 2YEZB 1T1WB 2FR4A 4OCMC 1DVFA 4NSKA 4JDTH 3HMXA 4YFDB 1U8JA 3BDYH 5C0BE 5A16A 4PGCA 4Y19E 3KWWA 2MPAH 2G9HA 3UJTH 3BI9X 3GSNH 4LLDB 1EJ6A 1WVZA 2GTWB 4LDEB 1FRGL 5F7YC 5KSBB 4XRCB 1YMHA 4YK4C 5I76B 2HLAB 1IAIM 3IXAA 1JGVL 3QI9A 5I1DA 4X6CB 3QCTH 4JRXA 1QNZH 1JHKH 3ZE0F 5L2KB 4I18A 1RUAH 2AJ3A 1PG7W 4LMQI 5K9OA 2BVQA 3F8UB 4EN3C 2Z9TA 5C0AB 5D5MF 3O4LE 4DCQA 5KTEH 2YKLL 3MOQA 1OOAA 1TPXB 4MXQC 1H15B 4O5LL 3BFOA 4X0KB 4NWTH 3W0WA 4H26A 4G9FD 5I2IA 1MI5E 3TJEL 4NQED 4OFYD 3SDXE 1PGRB 2ZUYA 1UCBL 2DL9A 3HG1B 3HUJF 2FWOB 5DJZB 1WFUA 3DX6A 4MA3A 2XOTA 1KG0A 4BK5A 3I6KA 4M93C 3MUHL 1UJ3B 1OAQL 2IH3B 1FC2D 3FQUA 3KPRD 5DJYA 3IFLL 2P8LA 3TP4A 1J5OL 2LTQB 3PQYB 3VXUB 1IFHH 3BPLB 1V7ML 1UZ8A 1FQ9C 5EU4A 4LPCA 2GKIA 1OP3K 4X6CA 4F8TA 1DN0B 3MC0A 4HJJH 5AUMB 3RWCB 4PJXE 5CSBA 3WBDA 1LK2A 5DMIL 3MO1A 3ZKNC 3G6JE 2DTML 3O6KL 2V2WA 3B6SB 4I3RH 4JFDD 4M7ZC 4RGMC 5FECB 1NDGA 1KIPA 3LB6D 4TNWK 4JM2D 4F7EB 2DLHA 3V4VH 3A67L 5EOTB 3QEUB 5FCSH 3DOSA 5I8CB 2VXVL 4JG1L 4NQEE 4PRDA 4ZAKC 4HWZA 3OKLB 1L7TL 4JFFB 3TO4C 1BZ9A 5GSVA 3IDJB 1A3QA 3BWAA 4IM8A 5EUOE 1NEZB 3PABB 2H1PL 4JQIL 1OTUC 4JZNB 3S88L 2GJ6E 3QH3B 1L0YA 3QDMA 3PWLA 3MRIA 4XB8A 2ITCB 3NZHL 4KTDL 3S3JA 1X5GA 3DX8A 3S6CA 2JCCE 35C8L 3BN9C 4RAUB 4AEHL 3D18B 4I0PC 1KTDA 3NCBB 5F7UA 5GZNC 4X99A 4NQUA 1E4WH 4H0GA 1NMAH 3MRGB 2ZKHH 1UXWA 1HK6A 3L9RB 4I5BB 4PV9A 4EUPH 2Q7YB 4U1GC 3VWKB 5SWSE 1A4JA 2EIBA 5HHOD 1U3ZA 4HJ0D 1LHZA 4PLKD 3U6RB 1T0NA 3PIQB 2E8ZA 1T7YA 1DE4B 4NM8H 4PTTB 4BFGA 4UOW0 3VU2A 4LDOB 3C5JB 4LPTA 4XVJL 4OQTA 4PPTA 1N3NA 1NDMB 2BP3A 1KB5L 4YHZH 1F3DH 4OZGF 1X6LA 4RBPK 5JTWA 4JREB 4XNUH 15C8H 4PJDB 4Z95H 3B9VA 3M1BB 5DUML 1A5FL 4QRSA 4D8PB 3OPZL 4NHUA 4EUPG 4PJIF 4M5ZH 4O4YL 3LQAL 4TUKH 2FEEI 4X98B 2PO6D 2FB4L 3JWDH 3ZDZF 3DNKA 2GK0A 1KT2B 3MXWH 4NO2B 3ARBC 3E2HB 2OX5A 2JCCB 3QBTB 4QTHB 3FT2A 1ZHKA 4LOUC 2OJZH 4LARL 5I73B 4EDXA 2Q76B 1IGIL 1K5NA 1ZXQA 4YDJA 3UTPD 1MCSA 2AJZA 4Z7NE 1JNLH 5D2NC 3WDIA 3ZE2F 3C5ZA 1YA5A 4PJ8D 3GNMH 2BSSB 3HNTL 1FAKT 5F7WC 4L4TB 1T7XA 5IK3B 4DVBA 3HHRB 2IPUG 3RVXC 3RX5A 3QIWA 2X4OA 2PO6C 5MP6L 1SYVB 3S36X 3S4SA 1J1OL 1MJ8L 3OGCA 3RJQB 5KVGL 1PKQA 2B1HH 2AK4E 4KHXL 4UT9L 5H2BA 1KLUB 4Y4KC 1T22A 4X6BB 1W0WA 3C08L 5BS0B 5EA0H 4YHIA 3DUHA 1A6ZB 4JLRB 4L9LA 4PD4K 2Q8BH 4L3ED 4MA1B 3QWOA 3F7RA 4MA3B 3OXSB 4ODWA 1T83A 3ZSTA 4JPIA 3UJJL 4D9QD 5SWZA 3CSYA 1U8MB 3CVIL 2MQ3A 5HYSA 4PRHE 1JJUA 1I9JH 1KEML 3QT2A 3RGHA 2QSTA 4TVSa 4CVXB 3OKEB 1W8OA 1WQVT 4HS6B 2XWBA 4ZO6A 1N64L 1BGXL 3Q6FA 5D96C 1ZGLP 2F54E 1FCGA 2NXZC 4UDTB 2QQNL 1MREH 5KBNC 4HIXL 4A6YL 1I1AB 3C5SB 5EBWA 3O6LH 5E08L 4R8WH 5I1CH 5AYQA 3FHAA 4PJDE 2J1KA 4CMHB 4NNYB 4X7EC 1I85A 5DQ9A 1RJLB 1KNOB 3T4AB 5H35B 3I50L 4KJYB 4QRRA 1DQDL 1U3YA 1WZMA 1DEEB 4Y1AE 2GY7B 4LLDA 4PGBA 1MCCA 2CDGB 3UYOD 3FO1A 3H42L 3SGEI 2R0KL 3CFEB 2BY2A 3KPSB 5JW4R 3TO4D 1R5VB 1VHPA 3UPRA 5D71L 1OGAD 5SWSA 4ZS6D 3GBNL 5DQDL 4N9OB 4MS8D 1GC1C 4NDMA 5E8PB 4M6NH 5DJZA 2C7UA 3KXFA 4UV7H 3L3OB 3RBSA 4V2BA 4HQQH 3WLWD 1ZA3B 1OSZB 4X0KA 1CL7H 1XGYH 4BFIB 1B4JL 4YHYB 3VXRD 1BBDL 4MQTB 1T03L 3UYRH 3GKWL 3MLWL 1U58B 3QQ4A 4G6AD 1P4IL 4WI7A 4ZTOL 4OCYH 4XNZB 4F37F 2J6EL 3SOBH 2W65A 3ALPA 4CDGC 1MQ8A 4ZUUB 1IAOA 4WI9A 3JWOC 4CJ0A 4GAGH 4MAYC 2Z92A 4ZFOB 3K4DA 5IESH 1FNGB 5D2LE 4J3VA 4WW2A 1T83C 1CF8L 1R3JB 1YEFH 1WC7A 1YC8A 1FO0L 3GRWL 5HYJD 1WZ1H 1XMWA 4JRYA 1A6TA 2FJFB 3F5WA 5IW1A 4MD4B 2DIJA 4HEME 3ULVL 5LWYH 2CIIA 2VLKA 3LEYL 3OR7A 1EUTA 3SDDA 5B39A 4JGMA 5C2UB 7FABL 3VXTB 5IBLD 3BUYB 3AS3A 1CT8B 1RULH 1BAFH 1AXTH 3EDKA 4AT6A 5SWZD 1R5WA 1U2CA 2HJKB 2LAGB 3KPPA 4DW2L 3FL7A 2A6KB 1XGTA 2APFA 3SCMD 2APVA 3EYFB 4XNUL 3SDXB 3VD4A 4UTBL 5BRZB 4ZUTB 1KEGL 2VJXA 4NZJA 4ONGH 3CFBB 4PJGF 1OP9A 2IH1A 3HUJE 1S9WB 1DE4A 4U2YA 1FORL 3KNBB 3GO1L 4F7PA 2FX7L 1GGIL 3CMGA 4Z5RA 2ICEA 1KJMA 4M7JH 5EU7E 4CADB 1II4E 3RPIB 1NFIA 4LCIH 5D2NA 4TOYH 2VDKH 5IF0B 3S9DB 2GEEA 1AGCB 4H20L 5CCKL 1YEEL 5C07E 5I15L 3TO4A 3B5TA 2A9MH 1FFOA 2N1KA 2YXFA 4ELKA 3DURA 3RVWC 3VXSB 4AEFA 4BH8B 1JZ6A 3F6LA 4G8EB 4KTEH 1Q9LA 4X6DB 2C3VB 3SGEH 2NY1C 2ZCHL 3ZLQC 1AHWB 2MCPH 4YXHL 1JNLL 3ETBF 4P3WA 2L4OA 1KN2H 3BP4B 3ORJA 5EUKA 4F57H 1FL3A 4GG6B 1KYOJ 4LVNB 2OS7A 4N0FA 5DJ6A 1RIUH 3LQZA 4JQXC 1NQBA 2IPKA 4X7SH 4LCYB 2JJTA 1OTSC 5FO8B 1GGBH 4XPBH 5JA8B 3CUPA 2FZ3A 4RAVB 1K8DB 3UTTE 1MAKA 4WENB 2IPTL 3BAEL 5T5FH 4DGVH 3VXMB 3RZCB 3VFUA 5CKGA 4K94L 3BZFB 2HRLA 4BZ1L 3SKNA 4X6DF 4TVPH 2HT2C 3S37L 1NGQH 1EERB 4PJAF 1H0DA 3EDJA 4XVSH 4UNUA 2ITDB 5DMGD 3O3EB 3LSOA 3T04D 2OCFD 1JV5A 4JFEB 3CFCH 1QYGH 2BRRL 5AD0A 3PWUB 1RUMH 2YN5A 2F58H 4FFYL 2ARWA 4ZTPL 5FGCE 4WCYL 4UOW1 3T0WA 3V7AE 5C07B 3EKCA 5CEZH 1QBAA 3HNSH 5FB8A 4WGWB 3ULUF 4HUVB 4IRZL 3X11B 2O5YH 2GJZA 2NY5H 1T0MA 4NRZA 2WW8A 3V5DA 4KTYA 2MHAB 2O61A 2R56L 3RDTC 4OGXH 3NVQA 5CD5D 4WUUD 3EFDL 4JM4L 1VCAA 2IFFH 3HRZB 3H9SB 2IGFH 4R96B 5I71B 3D2UB 3VE0B 4U05A 1XZ0B 4JGUA 5IFAL 4JFZH 3FQWA 2E6QA 3IXTB 4XNYL 4UIMA 1HWHB 1TQBB 2F19L 5FCUH 1C16A 5CBEB 4IOFC 3ZE1E 4TQEL 2XICA 1CDUA 2MQ0A 4YNYB 1ADQL 1NGZB 3VGGA 4H1LG 3C8HA 3IETB 4JGJA 4KZDH 4GS7B 4MX7B 4PJEF 3VFNB 1P5UA 4XWGL 4KY1L 2YMXL 2BSSA 4Q6IA 4Q6IB 3H7LA 2GSGA 3P3YA 4YH6A 5GJTL 4OQTL 1D9KC 3G5VA 4DWHA 2VZOA 3OJMB 4MQXC 4Y5YB 1BF2A 3ARPA 3T0EA 5JORB 4HIIB 4L8CA 3O4LB 1E4XL 1WEJH 4N0FB 4QWWC 3DIFB 2EXWD 3FN9A 4D94A 2A77H 4HWNA 5L2KE 3T65B 3CDCA 5ICYA 3PP4L 2JCCA 3BT2L 5MENA 3V6ZA 2XRAL 4FXKB 4HIHB 4NJ9H 3MV7E 3RP1A 4R0LA 4LCUB 1W72L 5EU5B 2XT1B 3L5XH 3UAJC 1CGTA 1MFDH 3BE1L 1A1OB 5C0EB 1LEGB 3MRLA 5I16A 5CINL 5KW9H 4G8FA 4Z77A 2X40A 1OGAE 1QBMH 4W4OC 5DT1L 3THMH 2LU7A 3QAZB 4GQ9H 1GRWA 2OR9H 4FG6D 1J0JA 2E27L 5IB3B 3ULVF 5F8QC 1GPOL 4NOBA 5DC0A 1CLZH 5B39G 5F9JB 4S1QL 1MY7A 1ONQA 4D9QE 1R3LA 1CI5A 3T0EB 3U6RA 4U1LA 4U1LB 3L7EA 1SEBB 4JFHE 2R9HC 3ARGB 1ZLWK 1OB1B 3RY6A 4N0UB 1H5BC 3UO1L 2W60A 3MLVL 4NO5B 5EZIH 4MD0B 5DSCA 3P11H 3BHBB 4DN4H 3RWDA 3MGTA 3BIAX 3ILPA 3I85A 3DMMD 3JV6B 3FMGL 3QQ3A 2EYSB 3MJGX 4C4KO 1X4YA 1QKZH 3VXOA 4WU5A 5GIRA 1NGWA 3WUWA 3EIFA 4QOKB 4BFIA 5DRXA 1OAZH 1OT1A 4GRLA 5K59F 4GUPA 3KYOA 1UM4H 4N0UE 1JE6A 1BOGA 4PGDA 4NZTL 5BVPL 1D5MA 1S9KC 1EO7A 3IDJA 4GKOA 2Q1EA 2EZ0C 35C8H 3TBTA 1C12A 3OKNA 4XMLH 3LIZH 4R7DB 3QEGH 5BZWB 1NCTA 3LQZB 3MLUL 4U1HA 5DURD 4A6YB 3TYFA 1KN2L 1CXEA 1OY3B 3G08A 4EIZC 2M2DA 2VDQL 1QBLH 3LEVH 2Y1VA 4AQOA 3W11D 5HPMB 4EZMA 4J3OC 4AM0A 1EAPB 3PGDB 3MZGB 1M71A 4U1KA 4QRRB 3DO7A 3DO7B 2UY7A 1WFTA 3VGDA 2GSGB 3FKUS 2VSCA 2AK4A 5D9SB 2WK2A 2AK4D 4YE4H 5EU4B 5LKNA 1ZKAA 4U2ZA 2QADD 4XGZA 1AO7A 3U1SL 4TTGA 3TWCH 3WIHH 1QO3A 3KLHD 2WBKA 4YWGH 4LGSB 3FTGA 2VR9A 1JCKA 43CAA 2VWEE 4JFDE 2APWA 4KC3B 3E8UL 1N7MH 4HKJB 5IW6A 5CMAA 1U3HB 1M05A 1UYWL 3QUKB 1DBBH 2J5LB 1NGQL 2XXMB 2R8SH 2FSEA 1Y6NR 3R06A 3SDXA 2DM4A 1CS6A 3S4SG 3CFDB 3QUZB 1SEQH 1QFPA 3QNXA 4DUWA 3L3GA 3TA3D 2XTJB 2ED8A 3VJ6B 5J11B 4LASL 1MCDA 3ESVF 2EYTA 3QFDA 4PREA 1KTLB 3VRJA 1H3PL 1GOFA 3ZZ1A 1FIGL 4L4VB 1WFOA 4UT7L 5ENWB 1HE7A 3LQAC 1AO7B 1AD0B 4WHTA 3UZQA 2D31B 1IBGH 4P99A 1T4KA 4LQFH 2Z31C 1A02N 4M1GH 3HR6A 3PL6A 3PHQA 2E7BA 3STBA 4PJHB 4POYA 1WC7B 4X6DA 3H9SE 3DBXB 3VFPB 5F9AC 4A2MA 1Y6KR 1KCLA 4MAYB 1FO0B 1OW0A 4FZ8L 4EIGB 3D9AL 3V7AG 4XNYH 1G7QA 1T89A 4K9EH 4X6FB 1U95B 1QHOA 3QWQB 5J13C 5FM5M 2RAMA 4KK6D 1CFSA 4Y19D 3LKSA 1LK3L 3QUZC 2ADIB 3V6OC 2IG2L 3N1FC 5FGCB 2CRMA 1XGRB 2XA8L 5IVZA 3QNZA 3MACH 4OLWH 4K7FA 2MSPA 5E00A 1BF8A 1VEPA 2VQ1B 2OL3L 3HC3L 3IFPA 5E2WH 5TH2B 3C8KA 2VL4A 4GXUN 5CSZB 2Y6SC 2Z91B 3IFLH 1XF5A 3ARSA 5C2BH 2P7TB 4TSAL 5FDYA 1MAMH 2P44B 3TA3C 1OLLA 1AGEB 3QDAA 1BLNA 1NMBL 4LAQL 3ZDXF 3L5WB 2KH2B 3QEHA 2BNQB 2Z35A 2XTLA 3EYVA 3OKKB 2R1XB 1U3HC 5E03A 4NJ9L 3ULUD 4YNYA 2Y23A 3TO4B 3L7FB 4YHPB 2P8PA 4JFEE 4CNIB 1DDHB 3SDCA 2YPKB 2EDLA 4FQHA 2B8OT 1RJLA 5CGTA 5HGDB 4UT6L 5FKPA 2JJSA 3H3PH 3QULB 1JIBA 4OF6A 3VH8A 1JN6B 1CGSL 1Y6MR 3OKDB 1AO7D 1KTKE 3I6LD 4GRLC 3GJEA 3ZE0E 1J05B 3H0TB 4Z7UA 3V9FA 5C0EA 4JKPH 1T2XA 3S88H 1A6TB 2R1YA 1YECL 5BV7L 3BIBX 4FP8L 4R4FH 3BWAB 3X11A 1UWEH 2AEWA 4M6AA 2P45B 2FH6A 5JHDE 5IEKA 1R5WB 2JIXB 4FQXB 1K2DA 1NAML 1XGPB 2NX5A 4DKAA 1NAMA 3MLYH 2H3NB 5DD6A 4ORZC 2J8UB 3OZ9H 4OCYL 3KXFE 1JF6A 4ZDHA 4HH8A 5EZLB 2QQLL 3E6FA 2PXYB 4YDKH 3SGDH 2VDLL 2XG5A 3B83A 4IJ3B 4NNXA 1UT9A 3C2SA 3VFMA 3NCYS 2WBWB 1A7NH 2C3WA 2M8XA 5ADOH 2HN7B 3GGWB 5FYKH 2WZPD 4HWEL 2NY7L 4Z7UF 2ZPKH 4FQIL 5D7LE 4OAWB 1BD2E 4XVJH 3TBYB 1H3XA 5DA4A 2JJVA 5DEFB 4OJFL 5HGHA 2FGWL 5L2JA 4YDVB 4PGBB 4K2UH 4UILL 3H7BB 1A6WH 3V0AC 4BZ2L 3C87A 1JI2A 3D85A 1TNNA 5TFSH 4KK5D 4KHTL 4EN3B 1HNFA 1XGPA 1F13A 1DBKH 5F7DB 4LLUA 1YMMA 2JIXD 3GK8H 4TPRH 5FYJH 3U30C 3PWPD 1P4LB 2SEBB 4NKIL 4U6VH 4NFCA 3IDMB 5BV7B 3G04A 3VH8G 1B9ZA 4WFEE 5E0QA 3MLRH 2QHRL 3QZWA 1I3RA 4MVBC 2DIBA 3WLBB 3UBXA 3SQOH 2VSDA 1C5BH 3K2UH 3OXSA 4LSRH 1HHKA 3BP5B 2IMMA 3BPNC 4BKLB 3CVHL 5E8NA 4Z7VA 5I6XC 1HINH 1FGNL 5I8OH 3C09C 1PX3A 1UB6A 4NQCD 2VRAA 3CZFB 1N3NB 1F3JA 2RCSH 3FO1B 2VDRH 3MLXH 3O6FD 4Z7QE 4JHWL 4JE4B 2OJEB 3PDOA 1VFAB 3IU4H 5DK3A 3HAEG 4H5SA 3A6BL 5DJXB 1IGTA 3ARDC 5D1ZA 2YK1L 4GS7C 1YYMH 4YAQA 3BD5A 1LNUB 3SE8H 3ULSB 3IKCA 4N90E 3EDEA 4TSBL 2UYLB 4HPYH 1IM3A 2BX5A 5TE7H 4BFBD 4HWBL 1YJDC 4OBRA 1J0IA 2Q8BL 5D93B 1G7JA 5EZLA 2UUDK 1BJMA 2J3SA 2J4WH 4UBDD 3TLRA 2X4SB 4AT6B 4JFYA 5TH2A 3WFHB 3QUXD 4P5MA 3SGDI 4YHMH 5A40E 1G6VK 2ZOKA 4U1HB 3V5HB 4A6YA 4ZSOB 5HHPA 2DICA 2ITCA 3BH9B 3PWLB 2QL1A 4LLWB 2VXQH 1K8IB 4R26H 4Z7VE 5I8EA 3D1MC 5BW7A 1FVEB 1BOGB 1MREL 4TVPE 1K85A 3MRRB 1TZHA 2J88L 4GBXD 4RNRA 3BESR 4P3DB 4ZQKB 3LN9A 1LWRA 2XI9A 4K71C 1J1PL 1JYNA 5IIEA 1KFAL 4G8GB 4ZOAA 1IJ9A 3DVIA 3WNOA 1GAFH 3TBYA 4NWTL 4Z8FH 2OL3H 3HC3H 1IGYB 1O7SA 3TJEH 4N0YL 4OZ4A 5KN5B 1EJOH 2UYLA 5EZJA 1P53A 5IT2L 1A3LH 5BV7C 1NDMA 2CR6A 5DQDH 3O4OC 3QWRD 4DAGL 4ONFL 4KKAD 5AZEH 4OD3L 5GS2H 5ACMA 3NN8A 2M26A 4OGYL 3IDIA 2NTSP 1U8OA 4XPTH 3RL1A 4K3JL 3N1PC 1UA6H 4UB0L 4ZOEA 3MLTB 1XGYL 2PW2A 4OLVH 5JQHC 3RVUC 1HILB 1JPGA 1HILA 2GCYA 5HDQH 4AIZB 5DEZA 2AXJA 4NZUH 1MLBA 4P4KC 1DQQB 4JZOB 2EIZB 1MJ7L 3H9SD 2VQ1A 5BOZG 1D6VH 4P49A 3QIWC 5KVEH 4NBXB 1D5BB 2L7UA 4MHHG 3MRIB 4NRXB 1J11A 1DUZA 1UZ6F 5MENB 2X4UB 4FQQA 5EBLB 1IM9B 3EO1B 1I7TB 3DETC 3NCCB 4QO1A 1RIHH 2PW1B 4B53A 5CILL 3WUWG 3TN0D 5L7XL 5B38B 5HTSA 5D2NE 1OP5K 2AK4B 1YEFL 4WW2C 2P42B 3VD5A 4DTGH 2ZJSH 4CUCA 5C08A 4E5XA 1AR1C 2XTJC 1MIEL 4UIKL 5FA3B 3BPLC 4PYGA 4X4ME 4JFED 4NIKB 1DBMH 4MXWH 4U1JB 2JELL 2DQTH 4HS3A 2G9HB 3CLEH 5IR1A 1DSFL 3FAXA 3MPCA 2X1XR 5C0JA 5B4MD 1E6OL 2VE6B 3BGMA 4R4BA 3REWB 4NFDA 1RU9L 4MJIB 4CJ1A 4JFQB 5IMKB 4Z7WF 3QQNA 4HPOL 1MCPH 3EYUH 5EOT<