4AZ8A

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
230
structure length
185
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPAGARNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/immune system
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 34
structure length 185
sequence length 230
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4az8A02
3CMOH 5IB1A 2DIJA 5DVMA 1KLUB 2NY6D 2UYLA 5SX4I 3W9EA 5CD3B 1RZFL 2DDQH 1ZSDB 2FHFA 2X10A 4YHKH 4L8CB 1X5YA 2XG4A 5JXAL 3T09A 2GSGB 4LP5A 2AJ3B 4YAQB 5DDHB 2O5YH 3QDME 4PJ7B 4YFEA 1MCKA 3WV0A 4IMKC 4U31A 3BKJH 5C09A 2C4XA 2HT2C 5E8NA 3QDMD 3K80A 2FX7L 1MRCH 3I6KB 5DUPH 1FNEA 3ZKXC 3NAAH 1BQLL 4U1GC 4GRMA 3EFDH 2IAMB 2W91A 3RWFB 5C0CA 3RA7H 3PJSB 4UT9L 1IC4H 1EDQA 2EXWD 3VH8A 1KFAH 4YK4B 1I8LC 4HUKB 2W65B 4KVNL 1FFRA 1U3JA 1UB5A 4D3CL 3GUTA 1I3GL 4YX2L 4GJTB 3PGFH 3FN0L 3MQIA 4EI6A 1DDHA 1SJEA 4NQDD 2P5WE 1B0WA 5IIEA 1QBLH 1AGDA 4JM4H 4WHYG 2L0DA 2ZKHH 3HC0A 5EZOH 4KHTL 4ZOEA 5JO5B 4PRIA 2JCCF 2J4WH 2P5WD 4JFEA 1NCDH 4P23C 4APQD 1XGQA 4ZNCD 4WY7L 3UP1A 1UYWL 2G9HA 1C5BL 5D7KE 4AT6A 4OZIE 2W59A 5FFLA 4NWUH 4QRPA 4GQPH 4YHLL 4OZFG 3LS5H 2NXZD 1D5IH 1EUTA 3RBGA 1RUQL 4R97B 4MZ2A 4I4WA 3OKMA 1NH6A 3HE7C 2ZCHH 1A3LL 1NFDE 3AU1B 5DK3A 1UFUA 1J5OL 4M8VA 2VLME 2IBZY 4PJ5D 4NBZB 3GSNH 4Z7VE 1AE6H 2HT4C 3ALXA 5AYQA 4HXBL 2VLMD 1E4XL 4ZS6D 5IR1A 3EGSB 2AGJH 3BHBB 3KJ4C 2PTUA 4QHMA 5EU6A 5INCB 2XQYG 3WKMH 2HTKD 1DZBA 3ULVD 2OJEA 4NO3A 1NFDF 1JF1A 3O2VL 4MB3A 1MJJA 2XT1B 4PRPA 3TNNA 5C7XH 3RNKA 4NNPH 4F58L 1NBVH 3T2OA 4P0DA 2IMMA 3QIWC 1TQBB 4G6FD 1L9MA 43CAB 1KBGH 4JZOB 1Z5LB 2VN7A 3ARBA 3S5LA 4MDIA 3EZJB 2V7NA 5C70A 3ULVF 1T1XB 4PV9A 5D6CA 1A7OH 1AFVL 4LMQE 4NZRL 4E41E 3WFDH 5JHLH 1RJLB 3BP4A 5I15H 1ZLUK 1JVKA 4LCIL 4OZGA 1OOAA 3ROLA 3TBYA 2PCPA 2V9QA 1ZHLB 3FQXB 2DYPD 1FLRL 3QJHB 2Z0BA 3KPSE 4O2CA 5FO9A 1UJ3C 1F4AA 2B4CH 5D2LA 3B9VA 5A1AA 2AABH 1KIPB 3KPSD 4JG0H 3MV8E 1EGJL 1X5GA 5ESAA 2A77L 3ZKXB 2XKSA 2ZCKL 1NJ9A 4LPTA 3NTCL 5T1MB 3F7YA 3SQOL 4RWYH 3PWPE 1FDLL 4PJ8A 4OZFB 3F7VA 5ITFA 5L9DL 2QHLA 1LO4L 1UXWB 2RCSL 3U0TA 3MFFA 1J0YA 4KQ4L 3PWPD 4JVUA 1I9IL 1D9KA 1WBZB 2VLKA 3D39D 4M61A 1OP9A 5CBAA 3E3QC 2V2WA 3HFML 4KK8C 4YFDB 5JZ7C 5L8LB 3THML 1N5AB 1B4JH 5E5MB 1DBKH 1P2CB 4Y16D 4CVZA 4DFIA 4JG1L 5LGJA 4UNUA 3KXFB 2FJFB 2OL3H 4FMFA 4UTAL 4XCNB 2VDML 3OKLB 2YA0A 4RFNC 1I8IB 4ERSH 2XV6B 4JRYA 4JHWL 4WVRA 2VL5B 4S1RL 5I76A 4IRJB 4QRUB 3FFDB 4Y89A 4HPYL 5C2BH 1VDGA 3ZTJH 1NFIA 2P42B 4F9PA 2VXVL 5IJVA 4GRLB 1WBYB 3FAXA 3Q6GH 3VFGL 5C08E 4X6FB 2F8XC 4YHNA 3GBNL 3QWRA 2VSDA 3IXTB 3PL6D 1FZMA 4OAWA 4R0LC 1Q9WA 5E9DB 3MRIA 2R1XA 4LCWA 3B2VL 4JKKA 5C08D 1DN0B 4X7FC 4AQOA 2VDNH 1XCTB 4LL9A 4Z95L 3ULUL 3QI9D 3DUUB 1D3CA 5TFSH 3ARPA 5IW1B 4BSJA 2D0HA 1OGAB 3L95B 5GISH 4FQXD 3UBXB 1OTTD 4Q58C 3ILPA 1JPSH 2CH8A 4QXUH 4S1DD 1JRHH 4F7MA 4TTDC 2JELL 3NCJH 5TDOB 4XWGL 3KS0H 3FQNB 5ADOH 2F74A 1PQZA 3GMLA 1NMBH 2KZ1B 3L3GA 3IAGC 2VC2H 4OGAD 2GEEA 3D69B 1S8DA 4LSUL 5EWIL 3F58H 3CLFL 4FQLL 3KG5A 4X7TB 3RDTA 2X9WA 1QBML 3WNNA 4WV1A 4W6YB 5LGHL 1MFDL 3WIFB 3QO0A 1L7IL 4QXTB 5AEAA 4LFHG 5CZVH 1QACA 1YN6A 5CHNA 1ZLVH 1WUNT 1CFTB 1XCQA 1NL0L 4U6HA 3UTOA 1JF6A 2HG5B 3FQRB 1QRNA 2OTUB 3ARDA 2FCBA 3O9WD 2F19L 1KJ2L 5TDPB 1UJ3B 1BM3H 5JMOC 1XFPA 4HULB 4PREB 1RK0A 2YXMA 1U91B 3V9FA 4LK4A 5I30H 2ZG3A 4U49A 1CDUA 5DD5L 4MQ7B 2F54B 3AY4C 2YN3A 4PJFB 4HGMA 4WENB 3E8UH 5E2JA 3I85A 2X4RB 4BSWA 3NIDE 3AROA 3QEUB 2GJ6D 1Z6JT 1PG7W 1AI1H 5FECB 4I48A 4FQHB 1HINH 1WZ1L 3DSFL 3SN6N 5D2NC 3OJMB 1KG0A 1F58L 3EYVB 3OZ9H 3MROB 3RWDA 4Z9KB 4NZDA 3VU2A 2PO6A 4C59B 1UADC 4OM1L 4JQIL 1DE4A 4MMZC 3W5NA 2WP3O 1WEJL 2BMKB 1CN4A 3P11H 2OR9H 2GUOB 3QZWB 1D5ZB 3NIDF 5BOPA 1SY6A 4MMXC 3S4SG 4FFWD 4FFVD 2BNQB 5KVEL 1PG7X 3K74B 5EPMA 4POUB 4RFNB 3N9GH 4F7CB 3KPMA 3GB7A 5FM8A 5HHOB 2VLJB 2Y36L 1CT8A 3K1DA 2PYFB 2NY0C 1Z9SA 1G7HB 1HIML 1KPVA 4GO6B 3EFFA 5JQ6L 3BZ4B 4Y88A 5DJ8B 4KI5C 1LP9B 4HIJA 4H25B 4PGDB 4HIHA 2HTLD 4HJJH 3T65B 2XN9E 1V3LA 2ENSA 3RY6A 2X4PB 1IKFL 3B5GA 2P43B 1A7NL 3ZKQD 3HR5B 2XN9D 2ORBH 3EOAB 2A6KA 1IEAB 4ENED 1F42A 5DJ2B 2FIKA 3MUHL 1CICD 1HHHA 1T3FB 2VABB 3ZYOA 4JVPA 2BNRA 5I18H 3T0EB 7CGTA 2RGSA 2GY5A 4ZFGH 4XNUL 1T2JA 3OQ3B 3AGVA 2FGZA 3CZJA 4XBPA 5I75C 3RTQD 4KKLD 4P5TA 1ED3A 4F7EA 2ATPB 3MODH 3V6FB 4H1LA 1UACH 1YMHB 3AREC 2HMIC 1IT9L 5ICYB 3FOLA 4B41A 1GOGA 3V0VB 2WUBH 5AUMA 3U1SL 3D0LB 4V2CB 3QXAB 2Q86B 1QR1B 3C60D 5E6IB 3DX9B 1Y18A 4E0RA 2ZOKB 4TSCL 5BS0E 2W38A 3E6HA 2X05A 4HF5L 4JDZB 3U9UA 3PP4L 3VGBA 1OP5K 2AJUH 5DD1H 1QSEE 3RRQA 5BS0D 4Q2ZB 2KDGA 2Q7NA 1EEUA 2EDDA 4MNHB 1CXLA 3QFDB 5E2VH 4U7MA 4NO2A 4GS7C 2VR5A 3DURA 1NC4A 1T83A 5E8EB 1S9WA 1QNZL 4WNQA 1U2CA 5FKPB 4XVSL 3O41A 1BF2A 1R24B 3QXDB 3MNWB 1AP2A 4LEOB 3MACL 3KLSA 3NOIA 4BKLB 1JUFB 5D7IB 2AJVH 5E2WL 4OCLC 5JOEA 2X1QA 4AZ8A 3CAFA 3CDCA 1VGEH 1JK8A 3TWCH 2EC9T 2P8PB 1JTPA 3LN4A 4DQOH 2XFXB 3QUZB 1UXSA 3TVMD 3L7FB 4QCIA 5DQJA 1DQQA 3MCLH 2XQBH 2R4SH 4MNQD 5FV2A 3CFBB 4XCCL 4FP8L 3CLEL 5IROA 3H2WA 4Z7UE 1SVCP 4I3SL 1OTUD 4AEIH 2W92A 2PYEE 5D7SH 3FO0L 3HZVB 4ZFOB 4JGJA 4O02L 3RUGB 3PQYB 4HK0B 5AZEL 3I9GL 5T1LA 4N0CC 4U1HA 1EMTH 4K2UL 3Q5OA 3PDOB 1N64L 3LRHA 4F57L 1HI6A 4PJXE 4ZFFA 2H2SD 4XP5H 1W8NA 1TLKA 4P4KA 5IFJA 4OD1H 2JJWA 2VWEC 1E4XI 5KSAA 4PGCB 1NAMA 4Z7UF 2MHAB 3W9DA 2DQIH 3OHXA 1CDHA 3DIFA 4HH8A 4KMLB 4PJEE 5C6TH 1CE6B 4LCCA 3D18A 3G6JE 3QDJE 4TSAH 5CEXB 3NFNB 3V0WL 4JY6B 4NRZA 1WV7T 3MNZA 2DBLL 3A6OA 4H5SB 4P2OD 5HDQL 1ZS8B 4TYUA 5DZOA 3QDJD 5IV2A 2F53E 2P24A 1PSKH 2CLZA 2AV1A 3QUXA 3QCVL 5IFAH 3KYKH 1AXSA 3AREB 4MA3B 3WFZA 1NGWA 3GRWH 1CIDA 5C07A 3HAEG 5TQ2L 4NSKB 1G6RA 4O58H 2QADD 1S78C 2ZP0T 3WE6B 4PJEF 1K6QH 2AJZA 4LIQE 3G6JF 3QXTA 2X4QB 1V7ML 2L7UA 3U79A 1S5HA 3VXNA 2YUVA 3WDJA 4HPOL 3GIZL 3QPXH 2BFVL 4OBSA 2A0LD 2G60H 4P46B 4JFED 2XQYK 1UM4L 1HHJB 3UPAA 3PGCA 3IDNB 2DLHA 4XAKE 1G7IB 1HHKB 1KN2H 2CIKB 1A6UL 2CDFA 1P69B 3B9AA 1GGTA 1RU9H 4XAKD 1ND0B 4R4FL 3VMNA 1RPQA 4OCRH 4HIEA 2C3HA 2E3VA 4MHHI 1JWSA 2W9EL 3K3QA 4FN0A 3FQUB 3U0PA 4DKEL 2NTFB 1F6FB 3GMQA 4ONHB 5D93C 1Q9KB 2CUIA 4RAVB 4MWFA 4OLEA 5DC0A 5AAMA 2HRLA 3OGCA 1UKQA 2QQNH 2BOCB 5E03A 1RSFA 1JGDA 3O6KH 3RKDD 2WZPD 5BVPH 4YXKL 1BFTA 4PRPD 4GW5B 2W60A 3LKNA 3JWDC 1S7UB 3MFGB 1QHOA 1IEBB 3MJ9L 4J7RA 1YPZE 2IALB 2L7JA 3C5JA 1P4IL 1TVBB 4OFYD 4Q6IC 2QQQA 5DJ0B 5D70H 1XF5A 5GGVL 2HWZH 2X5PA 5TE6H 1T5WA 4S1QL 4X5XB 1AY1L 2XYCA 5EBMB 1XF3B 3HAEB 3VA6A 2FGWH 1E6JL 2V9TA 3B9DA 4XMKH 3TH3T 1IM3B 1YPZF 2O26U 4OZIA 5HHPA 1A1OB 1BQHB 5HTSA 43C9A 2H6PA 3CUPB 4GAGL 3TV3H 2O5ZL 1NDGA 1J0JA 4YEEA 1EPFA 1HXYA 4D2NA 3RVVD 1I8MB 3TJEH 2KKQA 4NC0B 1S7QB 4WUUA 4Z7VA 3S37L 1NKOA 4Z0XA 3F12B 3VG9C 2VE6A 4OGYH 3RHWK 3H9HA 2XZZA 4ZTOL 5HYFA 1NGPL 3FFCB 1FHGA 3VGEA 3Q3GA 1P7QD 1I7ZB 4YR6A 5F7WC 1ADQA 3EW3B 3MGTB 5LCVL 4I77H 2EYRA 3V5KA 5FXCH 3JVGA 1CIUA 3GSWB 3U7WH 2Y07H 5K9QI 5HGBB 1BLNB 2MMXA 4ZXBD 3T0WA 4OIBA 4G9FD 2JB5H 3LV3A 3S6CA 3O45B 4KKBD 5ITBH 4YDVB 5SX4H 1SYSA 3BH8B 1U3HD 1FAKT 3VGDA 2WQRA 1JZ3A 4CMHC 4U6YB 4ZOBA 3GMMB 4E41A 3WUWB 4HWEH 4ETQB 3U7AA 3BE1L 3EOTL 4J3WA 3MUGA 4R7NB 1IARB 1IGTA 4WW2A 4BK4A 3JBG7 1DUYB 4LCWD 4HH9B 4LSTH 1I7TA 2XRAL 4XNXL 4IDLA 1GGIL 1IGCL 4LU5H 3EDFA 2MQ3A 4JB9H 1BZ7A 2Y5TA 4D8PB 1CZ8L 2X4OA 2NZIA 4XXCA 4HJGA 2XG5A 1BHGA 2XICA 3EJYD 3MO1B 3MV8A 3PUCA 1OP3H 2XXCB 3IF1A 2C7UB 2HP4A 1BJMA 4DJMA 1LE5A 4YFLI 5FF6A 1ROWA 5HVHB 1NCUA 4XMLL 5DEFB 2ADGB 5C3LD 1YDPB 4K3JH 4LGPB 5EOCJ 1U3ZA 5I1LA 3S36L 4X7DC 1T7XA 3P9MA 5BXFA 3OJ2C 4BH7B 1NUNB 5I1GL 3QNYB 1M7IA 3S35X 5L88H 1TTGA 4MX7B 3TF7C 4MD0B 1R5WA 4CW1B 3UPRA 1HNFA 3I3EA 5D1QD 5KSVB 5EO9A 3ES6B 3WFEH 1ZKAA 1QRND 3VH8G 3LDBC 4PTUA 2DWEA 1JNNL 4IRSD 1OHQA 5J9PA 1ETZA 4FZEH 4UV4H 5LG1A 5CINL 1EHNA 3GMNA 1K4CA 4UINL 5KZCD 4L8SB 5E94A 5C0DA 1N0XL 4GKZB 1QYGH 4NQCE 1O7VA 3KYMA 4L4VA 4LNRA 1RUAL 2X4NA 3DXAB 1B90A 4LLAA 1N6UA 1CD1A 4PRDB 4HGKC 3QFJA 2AEQH 2YPLD 1ZEAH 3IGAA 1PEWA 4RSVA 4O5LL 5C0IB 3VG9B 2GKIA 5KW9L 4UOW0 3IU3A 3RNQA 1MJ7H 3GJFB 4OLZL 3BT2H 4XI5C 3UTTE 2EYTA 5FYKU 2I26N 3AXLB 1T04B 5EUOE 3HE6D 4ODSH 2EE3A 2BSRB 4X7SL 1DVFA 3UTTD 1K3IA 5HPMB 3QG6A 1LWRA 3MV9B 4BJLA 2ITDB 4Q0XH 2Z4QA 3PWNB 5BRZB 4PLKC 5DJ6A 1M71A 5I1EL 4J3XA 3LKRB 3NN8A 4U6XA 4MQTB 1DBJL 3P4MA 4XZUA 3NIGE 4HBCH 3V6ZA 2DOCA 3GDBA 4M6OL 2XWBB 4OIIL 1OL0A 4BELD 3F7QA 3MOAL 2UYLB 1CDIA 2D7TH 4Y19B 3QULB 1BVLB 4FFYL 3L3IA 4RGND 4B53A 3GSQA 1TIUA 4O9HH 4JZJC 3E1F1 3QCUH 3TZVD 1F4XL 3KYNA 1I85C 5C09B 4F37K 5E8NB 3VD9A 4KUCD 3LKQA 3ARXA 5E2UL 3MC0A 4KZEH 1EJOH 3NIGF 4JVWA 3VXME 4LHJB 4EUPH 3LKOA 1Y0LB 4H0IA 2GITB 1U8OB 5IMMB 4P9MH 1R5VA 4ZPVA 5AZ2L 1I9JL 5EORH 5ADPH 3L5WB 4Y4HB 3IXAB 4KUCF 3VFVA 3BW9B 2HLFD 2BC4A 4IIQA 2A73A 4LLYA 4ZO8A 1NBYB 1KC5H 2HJKA 4HHAB 1AGDB 2DQJL 5LWYH 4G8GA 3HC0B 4TPRL 4PRIB 1FVEA 4Q74A 5BZWA 1AD9A 3QUMB 3ZL4L 4JRXE 1MWAA 2E6PA 1N5YH 3IKKA 3ULUC 4O4YH 1K4DB 4CN6A 4QRPB 3WFCH 1RZKL 4JRXD 2EDKA 5HI5D 4M7LH 5D9SB 3LDBB 1AIFA 3SDYL 1AHWA 1Z0MA 3HCVA 2EKSB 1MHEA 4JCMA 4OTXL 4OF0A 2M26A 1C12B 4V1DD 2AERT 2NY5C 2AK4A 2IPTH 2VDQH 5D7JD 1W0VA 3REWA 4OB5H 4C56E 3AB0B 3IAPA 1CBVL 1QLRB 1OAZH 3L3DB 3DWTA 1T0NA 4NM4L 3FO9A 2ADFH 3L6FA 1FORH 3GSUA 2IANB 4H26A 1RMFH 5EU6B 5AAWA 5HHME 4M1CD 3N85L 4WFFD 4NO3B 2YMXL 4TNWF 5HHMD 3VWJA 1BMGA 2IPUG 2NR6D 5JQHC 2VSCA 5IWLA 5T3XE 5KG9A 4ZMAT 4UU9A 1RHHA 1RJYA 5T3XD 5IB3A 4AYFA 3NFPB 4IRZL 2X1OA 1FSKC 3QQ3A 1KB5A 5ILTL 2GK0A 3T1WA 1W72A 3MRRA 3X12B 1I9RH 1I1FB 1YJDC 5CJBA 2ZCLH 4HFUH 4OZGB 3ROLB 5CILH 3C6LA 5SWSE 3SCMD 5CP7A 3N50A 1XF2A 5KVFL 2HAZA 3LN9A 4O2EA 1QSEA 1A7RL 3VRIB 4WFGE 3VXQA 1IGFH 4ZD3H 1R0AL 1QEWB 1BX2A 2OQJA 5DRXA 5F96L 2GTWB 5LBSH 5SWSD 4F7TB 5D2LB 2R8SH 2OP4H 1Q0YL 3V4UH 2EDOA 1GPOL 4WO4C 3KAAA 4WFGD 3Q48A 4EDWL 4BSVB 4MDJA 3U48A 1GGBL 2R39A 4UUJA 1PKQE 4LASL 2MQCA 4PGEA 5ANMB 2AJSH 2MKWA 4L8BA 5DTFA 5ITFB 5EU5B 5FYJH 3IFOA 1HHGB 3DETD 3ZDZE 3MFFB 5D1XC 4R3SA 4HLZG 1D9KB 3DJ9A 5IOPB 1DEEA 1NCCH 4HCRA 3ARSA 1ZLSH 3NA9H 1MCOL 3DVIA 3QJFA 3MRMA 1MJUL 4QRSB 1NMCC 4HKBA 5E00A 4KAQH 5FK9A 3L3KA 3AUVA 2IMNA 4Q9QH 3E2HB 2CKBA 4RDQF 2EXYD 4OQ1A 4PS4H 4Y5XC 1W0WA 3JWDH 1SVZA 1U8JB 4GKNA 1X7QA 5KJRL 3ZDZF 2HT3D 4P9HL 4KK5D 4Z7UA 2CDEA 5KSBF 4QHUA 2PYEA 2YRZA 1OAXL 1CG9A 1VACA 2J88H 3IJSB 3V95A 2LABA 4PLNC 3TGXA 4G3YL 4PLOB 1JN6A 2H1PH 2Z93A 4PJXA 4KJYA 3TO4A 1INEH 3I84A 1L4IA 4P2CG 1CS6A 5E5RB 3QIBD 2B20A 4PP1C 5BZDA 3UJIH 4OCSH 5CSGA 3RWEA 3WD5H 4KJWC 4UB0H 4OD3H 4NPYA 1F6LL 1B88A 4PJEA 3ZLQC 1FL5A 2AV7A 3ILPB 1DBBH 3G6JA 4HZAA 1GC1C 2PXYD 1BVKA 3H0TA 3RZWA 1WC7A 3LQAL 1PQZB 3O2DA 4HQQH 4K07A 1G7QB 5E4IA 2F53A 5EIVA 5F6IC 5DFWH 3BPCB 2EYSB 3IDIA 3GJFH 1FSKB 3EJZC 3H7LA 5HY9A 2E6JA 3C5ZC 3CFJB 1OAKL 1RZFH 2Y23A 1PJ9A 4NNYB 3C8DA 2UZXB 3MGOB 4FQQA 3T77B 3VWKA 4L3ED 4JAMB 5LAXB 1NGZA 3DPBA 3U0WL 2R23B 4K94L 4N8VB 2X9YA 3CDGA 5JNYA 4YDIL 2XTJD 5HDLA 2BRRL 1X5HA 4H1LG 2R2BA 2XA8H 1BQLH 4JY5L 1RK0B 1HYRC 1U41A 3DVGA 5DS8A 4WO4B 2D03H 4UT9H 5F9AC 2BVOB 3U4EA 1RJZA 5FGBC 3ZDYE 4F9LC 1S7TA 4JQXA 3T4AA 4CVXB 5DHVH 2W9LA 5JXEC 3AS1A 3PXHA 1KN4L 4I18A 4JDTL 4ONGH 1I3GH 1A6PA 3KPQB 2FBJH 5GRUL 4YX2H 1EA9C 1M05A 3ARGC 4I48B 4PB0L 1DCLA 2WWMD 3QPQC 5E2TH 1NC2A 3VI4E 1KG0B 1UWEH 5EFIA 2FO4B 2EDFA 3MLXL 4PFEA 3W0WE 2VDRL 5IKCA 4LHUA 2PO6B 2JIXA 4ODVL 3C6SA 3DRTA 3JV4B 2OTWB 3ZDYF 1C5BH 1K85A 2QSVA 5EUKB 5DLML 1FFPA 3BEVB 2X4UA 3OGOE 2HRPH 4HC1A 3HN3A 5CEZE 2MQ0A 1P9MC 3VXOB 1SBSH 5JR1H 5H94A 2Q8AL 1A3LH 4YDLB 3KPMB 3WN5C 1I1AD 3VI4F 3VFUA 4Y8AA 1J5OH 1A47A 3WXWL 1YPZA 5CEZD 1CT8B 1GL4B 3WNOA 3BZFB 3LEYL 3U46A 4P59L 3QEGH 1TXKA 2QBWA 3EFFB 4KJQC 4RNRA 5FV1L 3QUMH 2C3VA 4QRQB 2D3VA 1E4XH 1FJ1A 4Y4KA 2VH5L 4YBHA 4EJ1C 1JWUB 2D7MA 3JV6A 5FGCE 3D85B 1MVUA 3RVXD 2I5YL 1TZIA 2O5XH 3SBWA 4K3GA 2PTTA 4F58H 2NCMA 3M17B 5J1SC 1NCAH 2JK5A 2X6MA 1A9EB 2BNRB 3H9SE 3WO4B 3BEWA 1CYGA 1FO0B 3NA4A 5AG8A 5L2KB 4XBPB 4YHZL 4P5TB 1ED3B 3X3FL 5E7BA 1KNOA 1AFVH 2DD8L 1ZLWH 1CDGA 3OKDA 3HPLA 1F6AA 3X11A 4ALAL 4PJHE 4OD2B 4FTVD 4KKAC 2EEBA 4WI8A 3F62A 3F8UB 1FYTA 5C0AB 3C5ZB 3F6LA 1W0YT 4Z8FH 1TVHB 4E0RB 1CGWA 5EO0B 4FXGA 3GSVB 4NKIL 1MY7A 5GS3A 3LS4L 3KYAA 4ZYKB 1YEEH 4RMSA 4KTYA 4NP4L 3VFTA 5GZNC 2YR3A 3CNKA 1EGJH 4GAYB 4AIXA 4L4TB 2A77H 4PJHF 5LQBL 3O4OC 4NO2B 2ZCKH 5ALBL 1NC4B 2APWA 3NTCH 4WNQB 5F7KC 1SEBA 4Y1AE 3SQOH 2NY6C 5ESVA 3O41B 4JFOB 5L9DH 2XKNB 1AP2B 1LO4H 2RCSH 3HUJE 1EFXD 1ZK9A 4KQ4H 3RVWD 4FNLH 4LSVL 1YUHA 4Q9RL 3ARGB 5FGSA 4Y4FD 3SGJA 3T4YA 3HFMH 2P44B 5A16A 5I1DA 3THMH 1JK8B 3ZHDA 5CBEA 4JG1H 1AQKH 3MCG1 2J8UB 5DEGA 4QRTA 4A6YB 1WWBX 3CK0H 3CSGA 4WI4A 5FCSH 5T5NG 2ESVB 4UTAH 4JM2D 5F1KC 5C3TA 1YEDB 2VDMH 3K2UL 3UJJH 3VXRD 2EXWC 2QLVB 1DQQB 2FNBA 3HUJF 4J23A 4PTTB 4JHWH 5DQJB 2M1KA 2IH3A 3IDGA 2W0FA 4HPYH 1II4E 2B0SL 4ZUVA 3BP6B 4XT1C 1MLBA 3VXSD 1ZHBA 3LKPA 5B8CA 5DJZA 2VXVH 3CVHB 2V7HB 5IEKB 2YWZA 3VFGH 3JV0A 4JM2F 1CFNA 2BSTA 1HI6B 5SWQB 2VKWA 4JFFD 3U36A 4APQC 1X3DA 6FABL 3B2VH 1MHCA 2LTQB 3ULUH 4M1GL 3IRZA 3D2UA 4AENA 3SDDA 5F7NC 2Q76B 2QEJA 3B9KC 5FDWB 3KHOA 5IFJB 5KSAB 5MEPA 2NXZC 3B5HA 4QOKE 1BQUA 4YC2B 2I9LB 5JDSB 3W9DB 1M7XA 2QSTA 3PGDA 3VD3A 4QOKD 4GBXA 1JGVL 1RIHL 4KDTC 2JE8A 3QWOA 3VE0B 5FB8B 1IL1B 3ECBA 2EH8H 2E8YA 2NY5H 4XWGH 5HD8D 3MNZB 5SWZA 1L0YA 5B3NA 2DI9A 5FYKL 3UX9B 4NQCA 2OSLA 3OAYK 4LF3A 4LSUH 4NBXB 4S1SL 2AV1B 5EWIH 3CLFH 4ZS6C 1IQWH 4FQLH 4NC2B 1BEYL 3IETA 1I1YA 1QBMH 3MXVL 5C07B 2DQGL 1VENA 1CFBA 3TN0A 1U6AL 4LKXA 1MFDH 1G6RB 2ZOLB 2CRIA 1L7IH 2HTKC 4NQXA 3ULVC 4N9OB 3VXPB 3VRJB 4Y2DD 1LO3H 3CU1A 2KZWA 3KPOB 5T33L 3IJYA 1A1MA 4MLSA 3IFNL 2Z31B 4WWKD 1UWXH 1G7JA 1R3LB 4DN4H 5EUOA 4U6TA 1MCWM 2E6QA 3LSOA 3U82B 3PGCB 2HN7B 2AXFB 3TA3A 3SJVA 1FNGA 3GFUA 4QO1A 4M7ZC 2IPUK 5DD5H 3UAJC 5H37H 3O4OB 1MFBL 1YJDH 5JW5A 2NY6B 1HH9A 4LKCB 1U8LA 4CJ0A 3UTSA 1JWSB 4NN7B 2NY3D 4IDJL 1VKXA 1U8PA 1WZ1H 2AEPH 1OP5H 4QRRD 5HVGB 3RQ3A 1YECH 4U6VL 2YHGA 5I17B 1SY6L 3BVNA 5T1KD 3QDGA 4OM1H 4JQIH 3ZO0A 3QDMB 3JTTB 4XNYL 1EJ6A 4WW1A 3FO1B 3FONA 5FCUL 1AQDA 4PY7B 2CIIB 4X4YA 2R0KL 5IB2A 4J3TA 1YEHL 1BQSA 2W60B 4M62L 3O0RL 1WWAX 2BNUB 5DK2B 4GG6E 2Y36H 1AGEA 1NBQA 1JGEB 1UZ8A 2C5DC 3BP7A 4F3FA 1HIMH 1G7LA 1XGYL 4YHYB 4I2XE 4NN5C 1PVHA 3MR9B 1UM5H 2R0WL 3K81A 2P46B 5T3ZL 3FB5A 1M6OA 2CGRL 2IPKB 3RWGA 1S3KL 2P5WB 3WDHA 3B5TA 3OMZA 5F7EH 4APQB 1GZQB 4JHZA 5IG7A 1A7NH 3A6CL 1F4YL 4PG2A 3BPNC 3KXFE 4HX1A 4OQTA 1JPTL 4FG6D 4I5BA 5C71A 4POYA 3G08A 4GG6F 4X6CE 5D1ZA 3OF6D 5DR5L 5ENWA 3SDAD 4TUJA 43C9B 1G9ML 1EV2E 3UYOD 3LB6D 1OSZB 1A7QH 1YEJL 1INQB 2VZOA 1L7TL 5IQ9B 3HE7D 1NFDB 1JZ7A 5I8OL 1IT9H 2V5RA 4L5FH 2APXA 2CRYA 3PL6C 1MFCL 5ID0B 4XNZB 3O11A 1TJGL 4F33B 3N1GC 2C26A 4BH8A 3QI9C 4C56A 1T7VA 4Z0XB 2K9UA 3ARUA 4X6CF 1JI2A 4U1NA 4HF5H 2VITB 4JJ5A 4FQXC 1OTTC 2XZCL 1ACYL 4YR6B 4S1DC 2OI9C 2PNDA 1E27B 1GC1H 5KVDH 3VW3L 4KKCD 2JJSC 4TOYL 5GS1C 3RIFF 4OGAC 4RIRA 1AKJA 4PJDA 3MV7D 3PDDA 5F9WB 1QNZH 1VFBA 3QHZL 3ZHLA 2OMBA 2ZUTA 1R3IL 3QIWD 4M7ZB 4ZAKA 1RULL 2ZG1A 4K23L 2DQEH 2DB8A 3L3JB 5GS0D 5CIPA 1MJ8H 2H32H 4HEME 4D9QD 4HKJA 4KC3B 3M8OL 3MUGB 5J0BA 1T7WA 4XP6L 4MD5A 3O9WC 2CK2A 3NCYS 1C5CH 3GSRB 5E5UB 4P5MA 4WCYL 4AG4L 4Z5RB 4HG4J 1XR9A 3KPSB 4U1KB 4KRMB 5B38A 5MEOB 3RX7A 3TBVA 2X4OB 4HFWB 1MEXH 3TIEA 3MV8B 1CL7L 2F54E 1JWMA 3CLEH 1SEQH 1CLOH 1YNTA 1OB1A 4I3SH 4F8TA 1T22A 3FO0H 3S88L 3HRPA 2IEPA 5EBLA 4O02H 3T1FB 5B3JE 3BSZL 3I9GH 4G7YL 5JW4R 3PWPB 1AO7E 3P77B 4X9IA 4NO5A 4NRYA 1N64H 5E56A 4NN5B 1NAML 4A6YH 5CLTA 3RI5K 4PJIE 1AO7D 2CSPA 3WO3B 1QRKA 4Y16B 1RZ7L 1OAUL 3V79C 4FFWC 4FFVC 1ZTXL 4PJGA 5KN5A 1FFQA 5KANI 3M45A 5B3JF 5IJKA 4MQXD 3V6OC 5JPNB 3CVHH 4RMWA 1HDMA 4JLRB 2ZZUT 3QB7C 1MCDA 4G8FA 3V0WH 2R56L 1HQ4A 2Y6SD 4Y5YC 4H20L 3LQZB 4R90L 1K4CB 4PJIF 1WIUA 4KROB 4JFZL 5GIRB 3D87B 1BOGB 3KYMB 2HTLC 4X99B 3O3BA 4S10A 2X40A 3PL6B 3MRNA 1CE1L 1S7RB 5TQ2H 5C08B 2XY2A 2J2ZA 5F1IA 3VGFA 4HXAH 1J05A 1CXHA 3BXNB 3IGAB 1KPUA 2NY2D 3HZYB 5IESL 3QI9B 2GTZA 2KPNA 3GSNA 4ENEC 4R96B 3IU3B 1V7MH 3LEXA 1BJ1H 1I8KA 1FRGH 1AR2A 4FQXB 2XWTB 3T0BA 1WLHA 4CGTA 1KEML 4O2FA 3KJ6H 3RTQC 3RVUD 1KJMB 1JPGA 3GHEL 1CR9L 2Z4QB 3GJEB 1E6OH 3OBAA 1WT5A 2J7LA 2KQMA 5DJAB 5I1AB 1KCSL 4R4FH 3NN8B 3C60C 1RZJC 3NIFE 2V17H 2W9EH 4D0BB 3HI1A 1IAKA 3V6ZB 5JUEL 4DKEH 2R9HD 1FZJA 3PG2A 5E8PA 4ZFZA 3O2WL 1WIPA 5BCAA 1KLGB 3BUYA 4EN3A 1OAYL 1BGXL 2CR6A 2DM4A 2W0LA 5CZKA 2P48B 3VDAA 3TFKD 3KYNB 2LVEA 1OW0C 3TYGL 2R0LL 1H8OA 2WWKT 2IG2L 4A2MA 3LKQB 1NUDA 3HLAB 3NIFF 4LGSB 2VB5A 4XBEL 4LPCA 3P4LA 5GGSA 4KY1H 4QTHB 4X4ME 3LKOB 4W4NA 3PWVA 3MJ9H 4XH2A 1VADA 1P4IH 3U2SB 4QHNA 5CJ5A 1MAJA 2GFBB 4ZPVB 5BO1L 4YHOH 5GGVH 4Z7WE 3B9EA 1OARH 3I3BA 4JQVA 1MI5A 4FABL 1IZJA 4PJCF 5D2NE 4QNPE 4WHTB 1KYOK 4PR5A 4S1QH 2HFFA 4DW2L 1AY1H 2HJKB 5DWUL 2ICWI 3TVMC 4P3CL 3WLBA 3W0WA 4GQ9L 5GGTH 3U4BL 3TO2A 3QIUA 1FVEB 4J3OC 4KJPD 5BZWB 3JTSA 1AD9B 4MA8L 2DL9A 4POZD 4MAYD 1KT2A 5HYQB 1OTUC 2LVCA 3FOMA 5KS9E 4ELKB 5IMLB 1GGUA 4CUCA 4Z7WF 1ODAA 1I4FA 2MKLC 2OL3A 3HCVB 3OX8A 4GAGH 4NIKB 4W6WB 2O5ZH 4QNPF 2FD6L 4PJ9A 3RIAF 4Y5YB 3SO3C 2OXGA 2H2SC 4KI5E 2N4IA 3DX8B 1ACZA 3S37H 1CQYA 1ADQL 4L8DB 4I0PA 5J11C 4KI5D 1A9BB 4ZTOH 1I7UA 2WINA 2XN9B 5FA3A 1T0NB 1NGPH 2DRUA 2I60H 2YOCA 3VCLA 3L6FB 5KS9F 3HG1D 3GSUB 4H26B 1IGYB 2I07B 3VFNB 4LEXH 1XR8A 3H3KA 1RK1B 1CICB 5LCVH 5CJXA 1T6VN 1WAAE 2LQRA 3WKNA 1XIWD 1XGUA 4P2OC 2ZSVB 1T4KB 3FZUD 5EOTB 3MCKA 1JHTA 4P2QA 3D3VD 4K94C 4HKXA 4KI5F 4IOIA 1U8HB 3AS2A 1KJVB 3TBWA 3H9SA 3BIKA 4AL8L 3MXWL 2DQCL 4EVNA 4RCAA 5IVXA 3J7HA 4K3DL 3H3PL 2R2HB 4JY4A 1JGUH 1HQRB 2QADC 3ULVH 3ARFD 3ZDXE 5F3HA 1E4WH 2ZUQC 3C60B 1FV1A 3WJLA 2R1YB 5KOVC 1W72B 1PZ5A 3IDMA 2BY3A 1RURL 1GH7A 1VFUA 3BE1H 1FVCA 3EOTH 4RMVA 1S9VB 5TQ0L 3WJJC 1NAKH 4M6ML 1WBXB 1JZ2A 4LAQL 2A0LC 3I6GB 4XC3L 5C6WH 5L2JB 2HKFL 5BS0B 3UROR 1C5DA 2XRAH 2C1PB 3RWHB 5CP7B 1BJ1J 5DJXA 1FL3B 2E8ZA 3SY0A 1JBJA 5JHDE 4MJIA 4QT5A 1OY3B 3UZVB 4PRBB 3EO1A 1XGRA 5F7MC 4ZDHB 3MA9L 3VXUA 3GSXA 1T03H 1CFQB 1YYLL 1JNLH 3HNVL 4R9HA 35C8L 4LLMB 4Y1AA 5MP6L 2YD5A 1KLUA 4OCWL 3REVA 2KUTA 4L8BB 5DTFB 2WIIB 2VDKL 1ZSDA 3DI3B 2E7CA 1YMME 3QAZB 2X2YA 3OKKB 2AJ3A 5FKAB 5DDHA 2GCYA 1J1OH 2Q3AA 2MCPH 3TVMB 5BW7C 3RKDC 5FK9B 5MI0C 3I6KA 4YJZL 4NRXB 2CKBB 1HKFA 4W70A 2NLJB 5CGMA 3G6AA 3RWFA 3L1OL 9CGTA 2X1XR 1JNNH 3BGAA 1X7QB 2B1AL 3PJSA 2FIRT 5CINH 4UINH 5IVNA 4Z7UB 2W65A 1P7HL 1NCNA 3DI2B 4QHUB 3RVTD 2PYEB 1T0MB 4P57B 4LLWB 3UYRL 1CG9B 1VACB 5DVNA 3LAFA 3SO3B 3O3UN 3AM8C 2J8OA 3ZE0E 4PJXB 4KJYB 1X5AA 5JO5A 2APVA 5KW9H 5I73C 1V7NH 2D0GA 3VMPA 5J11B 5LXGH 2P5EE 3EDEA 3LCYA 1YNKH 3RWEB 1Y6MR 3IYLW 1MNUH 5D5ME 4X7SH 4NPYB 4YLQT 5E8DL 4PJEB 1IGML 1FL5B 3G6JB 4U1JA 3QDJB 5I8KH 3ZE0F 3AU1A 3RVVC 3P2TA 2OR8A 5BVJB 3I75B 5JIPA 3H0TB 5F1NA 4HAGA 5I1EH 2XOTA 3DGCR 4NZJA 1JP5A 4G6JL 1DBJH 1VPOH 1S9XB 3L9RA 4M5ZL 3T2PA 3W39B 3IDIB 5ICXB 4M6OH 2QADB 3L5XL 4OIIH 3MLUH 3MOAH 1LNUB 3P30H 2ZUQB 2VLRE 5HY9B 2HFEB 4UDTB 3EGSA 5T1DL 3BHBA 3NABL 5C0BE 4DVRL 5INCA 5D5MF 1UM6L 1J88A 4GXVH 4ZS7L 3HS0A 3SDXE 1S78D 4FQQB 3KGRA 3LKSB 1I7RB 1BD2D 2FEEL 5GGRB 5HDOA 4ZXBC 2Q8BL 2X89A 5E2UH 3UPCA 3CC5B 4KKBC 2ILLA 2R2BB 1IC7L 2CR3A 1DQMH 4JZOA 1Z5LA 1U3HC 1MSPA 4HUNB 2YUZA 1EEQA 1T1XA 4JRWA 1RJZB 3U4EB 4M6AA 2F8VA 1CL7I 5AZ2H 1I9JH 3LIZH 1G9NL 4YGAB 3SDXF 2G5RA 1RJLA 2X7LA 1JZ6A 1ZGLP 3ZT6A 2WM0A 1HE7A 4GG8B 3QWQB 3T8XA 1MWAL 5FYJE 1ZHLA 1NC2B 2J8HA 4O51B 4G80B 3WS3B 2BRQA 5EFIB 3QJHA 4BUGA 4IMKA 4TPRH 2JIXB 5IK3B 3DVNB 3ZL4H 3DRTB 3EJYC 1H5BC 4AEHL 1KIPA 4CKVX 12E8H 5I16B 4M7KL 1FFPB 3SDYH 3QXVA 1AJ7L 5T1MA 4OTXH 3O6FD 2FHBA 5H94B 1IC5L 1AKJD 4OI9A 1GHFL 1I8LA 2D4DA 1YPZB 3HPJB 4KGJA 3BD3A 5D71L 1FNAA 5EZLB 1JZ4A 1WBZA 1T20B 1CBVH 1NGQH 2A6JA 3NPSC 4RNRB 2C3VB 3A67L 5IBTL 3QA3B 5D1QC 1N5AA 5DMIL 5E5MA 1P2CA 1EZVY 5B39B 1FIEA 3JV6B 2R4RH 3SGKC 4P23A 3WUZA 3KXFA 2FJFA 1DFBL 3ALWA 3WIIH 1PX3A 4H88L 4IRSC 3BZDA 5KVGL 2YMXH 1BFOA 3OKLA 4FS0A 2V2XA 2PTTB 1I8IA 1X5XA 1KCUL 3IDYC 5F8QC 1I75A 2VL5A 3DUSB 1M7DB 3BESR 4IRJA 4QRUA 3FFDA 1N7ML 2DJ4A 1KB5L 1QBAA 1Y6KR 1FGVH 3EYQD 3BEWB 3CZFA 1O7SA 2CMRL 1WBYA 1MY5A 4IRZH 1XT5A 1YY8B 2BJML 1KNOB 2FX8L 3UTQA 3OKDB 5K59E 1J8HE 3IXTA 3IFLL 3X11B 4BQ6A 2COQA 5IFHL 1QHPA 1MUJA 3DUUA 1P7QB 3HE6C 2F5AH 5F1OB 3SKUD 5IW1A 3T2NL 4FXGB 4ELME 1OGAA 2W07A 4NZUH 2YUWA 3FN9A 3UBXA 4LQFH 5CZXD 2ED9A 2O61B 5F96H 1PFCA 2IQAB 4ODHH 1N4XL 1GPOH 3FQNA 4G42A 1RZJH 4EDWH 3D69A 1U3HB 3OKOB 2ADJB 4OGXL 4LASH 1SEBB 4XGZA 4HCRL 5DD3L 1OM3L 1SQ2N 2VAAA 4NQEE 1IZKA 1C16B 4RGNC 4ELMF 4QXTA 5I6XB 4E9LA 4NQED 4X80L 3RY6C 1MCOH 3H9YA 1CFTA 2VISB 4FQ1L 2HG5A 5KAQF 4RX4A 2ICWB 5TDPA 2WK2A 2FR4A 1UJ3A 4KFZC 1MFEH 4NUGH 2N7AA 4QRTB 4PREA 1H5BB 4JREC 3OG6B 1TJIL 2Z92A 4D9LH 3HMXL 5GS0L 5ABDE 4G8IA 5KJRH 2YD2A 3L3HB 3RPIB 3RX8A 4MQ7A 2F54A 3FB8A 3BKMH 4LVNC 4PJFA 3L5IA 1U2HA 2Q1EA 3LOWA 2YN5A 3QEUA 2YD9A 1FNSL 1H3GA 2GHWB 2HLFC 5JOPD 5E70A 2CXKA 1F13A 4TNVK 3JSSA 5DJZB 2JB6B 2BSED 5FECA 1G9MC 4FQHA 4NKQB 4CADB 3NVQA 2AJXH 4Z6AT 3EYVA 1CFNB 4RQQA 3MROA 2BSTB 1BBJB 3NPSB 1U42A 3U36B 4ZTPL 4JGUA 1QVOB 1MHCB 3TM6A 4DVBB 1T66C 1QQDA 4N5EC 4KZDH 4ONFL 4AENB 3SDDB 2BMKA 5I1CH 3QZWA 1D5ZA 3MRKA 2BNQA 2Z9TA 4IRSB 4TVPD 1R6VA 1CCZA 2B39A 1I1CA 3O2DL 4JFDD 4X8JB 3MA7A 3IDYB 4LCYB 2EDYA 2VLJA 3EO9L 3OR7B 2PYFA 3BH9B 1A3RH 4PJAE 5D7JC 3EO0B 1A6TA 1G7HA 3BD5A 5FA4A 1MH5B 4XXDB 3V8OA 3BZ4A 4NQCB 2YPLB 4PGDA 1TMCB 4JFYB 4M6NL 5CSZB 3T65A 1F3DH 2JJVA 3T0VA 1NUGA 4JCLA 2YD7A 4WIQA 2X4PA 4JR9L 4R0LA 4YWGL 3PHQB 4M1CC 1RVFL 1X5JA 3MBED 1MI5D 3SDCD 3BKYL 4AY0A 1J18A 1ZMYA 3HR5A 3EOAA 4XVJH 3U0WH 2NR6C 3HE6B 5DJ2A 1CDCA 3ARWA 3H6JA 3IJYB 4K94H 4HLJA 1A1MB 2YPVH 3UTTB 4JFHE 4PJAF 2VXSL 3GMPB 2BRRH 1G7JB 4RFEB 2WBKA 3T0EA 4JY5H 4JFHD 4UQ3A 3HB3D 5IROC 3MOBL 4AM0B 1YMHA 2IGFH 1G7PB 2FEDD 4R8WL 5IMKB 3QO1B 1BREA 2P47B 3D0LA 2EZ0D 1KN4H 3QXAA 1HH9B 2Q86A 3L7EB 4JDTH 1QR1A 1J1PL 4LIQH 1T6WA 3NZ8A 1N8ZA 1F11B 5GRUH 3UCRA 3DX9A 4PB0H 2ZOKA 3QEQE 3SCMC 2NY1C 4URTB 4G7VL 3MLXH 1JGLL 2VDRH 4KMTL 5H35B 3TZVB 4ODVH 3QEQD 5I66B 3MREB 4XPTH 4HC1L 3C9NB 3G5ZB 4MNHA 5GSRB 3MLZL 3KPRD 3JZ7A 4WW1B 2DJUA 4Q9BA 1CDJA 4HJ0C 1AQDB 1QFHA 5DLMH 3DX7B 2Q6WA 1NLDH 3ROOA 3MJ8A 3VXMB 5FKPA 5ANME 2Q8AH 1R24A 3AY4A 3SOBH 4LVNB 3QXDA 2OJZH 3DETC 3WXWH 4LEOA 4EXKA 3JXAA 1GSMA 3BWUC 4BKLA 1UZ8B 3LEYH 4P59H 3BP7B 4OLYH 1G7LB 3P9LB 4GAFB 4Z7WA 5CMAB 4WUKL 3RZCD 1TZGL 2VH5H 4NO0D 4L3CB 1TJHL 2XFXA 2EXYC 2ZSWB 4IOFD 3GI9L 3MPCA 5IG7B 1WFNA 2I5YH 3JUZA 3QUZA 2WBJD 1HEZA 1WCBB 3ULUE 5I9QC 1S7VB 4J3UA 5C9KA 4JRXB 5GRZA 3VJ6B 2HT3C 5L0QC 4RDQG 4KK5C 2NW3B 3CFBA 4KH2A 1HSBA 2QHRH 4NN6C 1MFNA 4TUJB 5CAYB 3HZVA 4ZFOA 5CD5D 2AQ1A 2V5SA 3PQYA 2AXJA 4L4JA 3VXUD 4HK0A 2Y4SA 5C0RL 3G6DL 5D7JB 4U1MB 2A1WL 4WI7A 1KGCE 3NCMA 4ALAH 2XZQH 3QIBC 3OAZH 3ULUF 5DD0H 1RFDL 1YQVL 1ZANH 1KGCD 4HUWA 4G6AD 4OV5B 3RL2A 3U30C 2GJJA 4YDKH 4LPUA 4PGCA 5C0JA 1RZGB 1EO7A 4NKIH 2MHAA 5CSBA 4EIGB 3LS4H 5HHMB 1WAAA 4NP4H 2PXYC 5DHXB 5CEXA 3DMMD 2HH0H 3NFNA 4JY6A 1FZOB 2WIMA 4HK3N 1ZS8A 5LQBH 2FEEI 2IAMD 4RIRB 4Y5VB 4IMLB 1NCBL 4KTDH 4OUOA 4PJ7F 2BXYA 4OM0H 4MA3A 3AREA 4RFOH 4JN1L 4ZNEE 4X7CC 1FN4B 1CGYA 1OLLA 4NSKA 1KCRL 2V5YA 2RAMA 4XPHL 3WE6A 5GGVY 1Z0NA 3Q6FB 4OFIA 4Q6YA 2X4QA 3SCMB 4N0FA 4P3DB 2XKUA 2XTJC 1QA9B 4P46A 2DLIA 5FOJA 5SWSB 1ZA3B 1TETH 5FEBA 1MCRA 1HHJA 4P5MB 3IDNA 1XR9B 2F58L 2BZDA 5DHYA 2X1PA 5JHDA 1G7IA 4X98B 1HHKA 2CIKA 2D9CA 3P4NB 4Q7DA 1K3ZA 4UNVA 1R3HB 1FAIH 4UTBL 1ND0A 3G5XB 3K8KA 5SV3A 4TUOB 1LVEA 4UDUA 3PWJB 1PKQB 1WTGT 2WWMC 3FQUA 4EUPA 2NTFA 5IQ7H 1PX4A 4NO5B 4MJ6B 3MUY1 4KUZL 6FABH 4ONHA 4MS8D 4M1GH 1Q9KA 2F15A 4RAVA 5DO2D 2QQKL 3FT2A 3RFZC 3LHPH 5HHVL 3QDHA 1EK3A 4QWWD 4P2YA 4LPVA 4P2RE 3JVGC 5E1HB 4EBQH 1I1AC 1JGVH 1RIHH 5L0QB 1YQ2A 4P2RD 5HVFB 3LQMA 4NN6B 1TVBA 1XGPA 1ZGLM 4H0HB 1CF8L 5DJ0A 5CFHA 1T21B 2D0FA 3MLTA 5IGXL 3SE4C 5HYEA 4XP1L 4FHBD 3MXVH 5IBUG 3MRNB 4YGVB 1U6AH 4X5XA 4JFXA 3RVXC 2YC1A 5EBMA 2DL2A 1KPUB 1MIMH 1XF3A 3GSNB 1JPST 4MCYB 3ARRA 3HI6L 3LEXB 2P5EA 1A22B 1LDPL 5T33H 1I8KB 1IM3A 3IFNH 5IMOA 1OD9A 1BQHA 1MQKL 2RFXA 4O2FB 2PXYB 4WDIB 5IVOA 5C6PB 1P1ZB 2BVPA 4HT1L 3P0VH 1Q94B 2K7PA 5FYLD 4XNQB 1FNFA 4AEFA 1A1NB 4DK6A 3FT4B 1NCTA 1MFBH 1I8MA 3P0YL 2E7LC 4GKOA 2NYYD 1S7QA 1PG7L 1RAMA 3F12A 3HI1B 4MAUL 4IDJH 5DMGD 1QFOA 1MCPL 1TCRA 1U8IB 4OLWH 2VLRA 4M5YL 3U4AA 3FFCA 5GJTH 5DURB 5C0BA 3VXTB 5E8PB 1UCTA 1A4KA 1I7ZA 5CJOL 4XPGL 3MGTA 1J0KA 4KV5E 2XTJB 3UO1L 4XNYH 1IEHA 3ZKMD 4L4TE 2HKHL 5GQBA 2R0KH 2KQNA 1BLNA 5HGBA 3O45A 1YEHH 5DRZB 3PE9A 4M62H 1A6ZB 1Q72L 4LGRB 3O81A 3BH8A 3PV6B 5E1AA 3SEPA 3RVWC 1WJ3A 4U6YA 1DQJB 3GMMA 4QHNB 3WUWA 4GRLD 1XGYH 5JIIA 3TIDB 4ETQA 4KV5F 4Y4FC 2R0WH 15C8L 4OQTL 2XI9A 1DUYA 2CGRH 4OGZA 5E9DD 1A8JH 5MENE 4PD4K 3CJJA 1PW3A 1HYSD 4JM2C 3QBTB 4D8PA 3RU8L 2EO1A 4JPIB 3W82A 5MEND 1K5NB 2IBZX 2CLVA 2FJHB 3JTSB 1LK2A 3MO1A 5DR5H 3N1MC 1BFSA 1KT2B 5JW3H 2C7UA 2A9NL 3D25A 2X70B 1I1AB 1G9MH 3PIQB 1YEJH 4UIKL 3MZTA 4UQ2B 5DEFA 4JO3H 3FN3A 4G5ZL 5I8OH 1IQDA 1DUZB 1YDPA 2IFGA 3ZKSD 3V0AC 4M3JA 5F7UA 4BH7A 1TPXC 3VDBA 2NMSA 2FYYA 4YUEL 4I0PB 4MX7A 4M00A 4MD0A 4CW1A 4PBVC 1BFVL 4LSPL 1I7UB 2WINB 5FA3B 3VG0H 5KSVA 5FGCB 3R0MA 3ES6A 1ACYH 4PRHE 4OT1L 4DGIL 2EIDA 1L6XA 3ARQA 1OGTB 5HD8C 4PRHD 3NCEB 4L9LC 1KJ3L 3MRHA 1LK3H 5INDB 2ERJC 4J4PD 3QHZH 3DYPA 3H9SB 2DQUL 3CMOL 4R2GC 1R5IB 1UENA 1RULH 5LGKA 1QFWM 3NACL 4K23H 5J1TC 1DQDL 1MCWW 4FTVB 3AS3A 4XVUD 2E27H 1ZHKA 4PRDA 5TDNB 2MSPA 3RP1A 5F3HB 1HCFX 4FFZL 3IKCB 1J8HA 5C0IA 3ESVF 2DDQL 4Y2DC 4PJHB 5I1JH 4YHKL 1WICA 2V5TA 2BVQB 4GW1B 4M48L 4K3EH 1G9NC 4IJ3C 5EZIH 3GJFA 4XP6H 1EVUA 4ZO6A 3CVIL 2X1WL 4WWKC 1KELL 1JPFB 3H7BB 1AH1A 4OCYH 2BSRA 4WCYH 3VFMB 3AAZB 1GOHA 1MRCL 2IBBA 1UH2A 3GBML 5DJXB 5MERB 5HPMA 3MV9A 2H45A 2ITDA 3TBSB 1J86A 3PWNA 5DRWB 4UMGA 5F9OL 5BRZA 1CL7H 5J89A 2VXUH 3LKRA 1X9QA 3GSXB 1KFAL 1OSPH 5HHOD 3RHWF 1L0XA 3S88H 2VLJD 3S9DB 2NY3C 2WLZA 2FATH 4OLVL 4Y1AB 1QG3A 3BSZH 1EFXB 3FRUB 2XWBA 5BV7L 3REVB 1U8MB 3IDUA 4PRNB 4UV7H 5EU7C 1FFNA 3HUJB 4Y19A 3QULA 2X4TB 5F44A 1BVLA 2APBA 1NAMH 2DMBA 3R06A 4LRIC 5CJQL 5EA0L 2IWGA 4JPKL 3EDKA 1RZ7H 4LDOB 1OAUH 2GCYB 4XRCB 1VESA 4RBPK 4EI5D 3ULSB 5I74B 4JM2B 1GOFA 3RWJB 1MRDH 1OPGL 3VXRB 2LU7A 4ODTH 3WHE1 3V4VL 1DTUA 2HVKB 4LFHD 3G6AB 2JCCE 2ZUWA 3MRJB 4HMEA 1Y0LA 3GNMH 5CLWA 2EDTA 4RMTA 2R56H 2GITA 1U8OA 5IMMA 4H20H 2PTVA 1G0YR 1PAMA 2UUDK 3QNZB 3L5WA 4Y4HA 3IXAA 4JFZH 4YZFE 4NQDE 3BW9A 1AE6L 3MLWL 1IM9A 1CE1H 4CN1A 4C4KT 1NBYA 4HHAA 5E08L 4NC1C 4W81A 1DBAL 5IESH 1NEZA 4FG6C 5E6ID 3V5DA 1PBYA 3BZEB 1S7XB 5TPWL 3C6LC 3OB0H 1F90H 3QUMA 4H8WC 4LSSH 1K4DA 3SDAC 3B9KD 3QQ4A 4NNPL 4QOKB 3VGHA 1QFWI 5D9SA 5DSCA 3LB6C 4YZFF 1NBVL 2EKSA 4QY8B 1H3XA 1BOYA 4L9LB 5DT1H 3GHEH 1C12A 1CR9H 4PJ5E 1YA5A 4U1JB 3CH1B 4PUBL 2VR4A 5F1NB 4PY8J 4D9RD 2QV2A 2FJGB 3BYYA 1MIEH 4YDJA 2ED7A 5TF1L 3L9RB 4YBLB 2NXYB 2G5BA 2OTPA 1QLRA 2W9DL 3KDMA 1YC8A 4DZ8B 3L3DA 2NW2B 5JUEH 4TVPL 1E28B 1RV6X 3MRGA 3ULVE 1SBBA 4Y2DB 4J1UB 3SGDI 4KQ3L 3QH3B 2IANA 3O2WH 4WU7B 1VA9A 4IJ3B 1OCWH 1S7SB 3BQUD 4KKCC 1BGXH 3HS0B 2B1HH 4WWKB 1TQCC 1UCBL 4PP2B 3BDXA 2B4CL 3C2AL 3RAJL 2RQ8A 3TYGH 2AABL 2R0LH 4JG0L 2YK1H 4BZ1H 3D0VB 1OTSD 2IG2H 1PLGH 1PD6A 4N5UA 1MCFA 3NPZB 3NFPA 1SYVA 4RWYL 3ME0A 5GS0C 1EGJA 2HA1A 3VFSB 3UAJD 5GGUB 4J3SA 1EHXA 1LGVA 5BO1H 2X7LB 3X12A 1I1FA 1TTUA 4QRRB 1OWWA 2BERA 4NYLB 3T8XB 4HWBH 5I8EB 3UBXG 1SHMA 5T1KB 4QXGH 4U1LB 1HKLH 4JKMA 5DWUH 5IT2L 5E95B 4XNMB 1FGNL 4GQ9H 2OMNA 3U4BH 3VRIA 4NGHL 1QEWA 2OL3L 4F7TA 3RUGF 2GTWA 1I85A 4MA8H 2B5IC 4ZPTB 2VJXA 4NCC1 4ORGB 4BSVA 4U1GB 3BN9D 2YZ1A 2PETA 1JL8A 2YD4A 3ORJA 5ANMA 3E6FB 2FD6H 4KRLB 5EU5A 3D39E 4GG6B 5D8JL 1HHGA 2CO6B 1CFVL 1ES0B 3LRGA 1SJHB 2BY2A 5C86A 5D7LE 3EYOB 3TBTA 5IOPA 2DQDL 3EYFB 2BK8A 4I2XB 2A6JB 1TNNA 4W6XB 5DD6B 4F37F 5EO1B 4OZHE 5D7LD 4QRSA 4LCUB 3WNMA 4YPGB 3SKJL 2JLLA 3BWAA 2ZUUA 3O8XD 4MQXC 4XPAL 4P23B 5GISL 5CEZH 5KBNC 1U8JA 1BFOB 4P46D 3SDAB 2V2XB 4LLQB 2Y6SC 4X6CB 1QP1A 3SGEI 1QSFE 2HJLA 5A2LH 5HGHA 3X14A 2OM5A 5AYUH 3HE7B 4AL8H 2VC2L 1QSFD 3R0NA 4GMTH 4JDVA 1HH6B 4OZHF 3IJSA 5F7LB 3QISA 3CZFB 4K3DH 3H3PH 3SKMB 4I18C 3UTZB 4ZUWB 1YEIH 3I6LE 2NY2C 4XMPL 5KTEL 3UTQB 1KYOJ 2DLGA 1BWWA 3CDYA 3QZWG 3I6LD 1CGSL 3AMKA 5TQ0H 2GAZB 4D94A 5GGRY 4LAQH 4XC3H 3KJ4B 4JKPH 1MUJB 3O6MH 2HKFH 5F72S 4N8CL 1YEKH 4MJ5B 3RVUC 1TCMA 4J8RB 4MA7H 1TQCB 3BO8A 1JMZA 2DI8A 3S35L 3MRCB 3F5WA 4ZSOE 3QUYD 4X83A 1H8SA 2Q7YB 5DEZA 3B8SA 4G42B 3QIWB 4R4BB 1G7QA 1YYLH 1CFSB 3E8UL 2UWEE 35C8H 3BPCA 2EYSA 1GXEA 4XGZB 2R9HC 2VAAB 4U7SA 1GGCH 5L6YL 1QPXA 3CFJA 1NDMB 4NNYA 3TESA 1NCWL 3OZ9L 3MGOA 4LLUA 2ZUVA 5CGTA 4OFDA 3T77A 3TFKC 4JAMA 5LAXA 2R23A 1TFHA 4KVCL 2NY7H 1AGFA 4N8VA 2FO1A 1P84K 1RUPH 3EYUL 5HGDB 3SBWC 1BBDL 2V2TB 2FR4B 4OSUL 2UWEF 1ZGLB 4GUPA 1P6FA 2Q3ZA 3U6RB 2B5IB 5DI8B 2Z92B 3L1OH 5C0EA 4XB8A 2L4OA 4WO4A 5ACLA 2BVOA 4G8IB 3SO5A 1NSNH 2GJ6E 3FB8B 4Z77B 1MLCB 4CVXA 3KPTA 1HNGA 1A0QL 4TUKH 4B5EA 5HHQB 1CXIA 3KPQA 4XAWH 2FL5A 2EC9U 1S9YA 1AO7B 5D1XA 2VQ1B 4HJJL 4B0MM 4OCMC 2FO4A 1R3KB 4RQQB 2DS4A 2ZJSL 4GRWH 4KJPC 3VI3E 4PJIB 2UZYB 3VD5A 5DUML 5GGQL 4POZC 3JV4A 3FFCD 1QQDB 2AW2A 4MAYC 2OTWA 2F5BH 3G04A 1ZLVK 5EUKA 4X4ZA 4Y5XA 4M9PA 3X13A 1VEPA 3MRKB 3BEVA 3V6OE 3C8HA 2YRLA 4LLDA 5I1KL 3ESUF 1A2YA 5E8DH 3VXOA 5I18L 3VRLE 1C08B 4WJ5B 3MA7B 4ZFGL 3BGFC 4S2SB 4LSRL 1ONQB 3MODL 1FH5L 5EBWB 3BZFA 5HI4D 4G6JH 4RISH 1A6TB 4YXHL 3VI3F 5FA4B 4OZ4A 4QRQA 1AXTL 3CFDA 5FHBL 2ICEB 3L5XH 3O3DA 3Q5YA 4M7JH 2JTDA 1Q0XH 1JWUA 5T1DH 3D85A 4R0LB 3RY4A 1KCKA 4TVSa 3VFOA 1MHPH 4NKOB 4ZG1A 3VRLF 1NKRA 1XIWC 3VMOA 5DD1L 3FZUC 3LH2H 1DN2A 1ZOXA 2XPGB 3EIFA 8CGTA 3M17A 4HG4K 4NUJB 4G6KL 4DEPC 2BHYA 2YUXA 3RGVD 1IC7H 1A9EA 3V7AE 1X5IA 4UQ3B 4F15C 1FO0A 5L2KA 1S5IL 4NOBA 2NY4C 3EZ8A 5ISZE 3ARFC 4JO1L 3PWLA 4K8RD 1JNJA 5B8CC 1RZ8B 2IBGA 2PW1A 1G9NH 4OD2A 5ISZD 1YC7A 4UI2A 3NZ8B 1N8ZB 2B8OT 5C0AA 4D0CA 3C5ZA 3GIVB 1MWAH 1V05A 1TVHA 4PJBE 3GEWB 1VGEL 5EO0A 3HR6A 2OZ4L 3TWCL 5AD0B 3DO3A 1YNLL 5DGRA 1D5XA 3GSVA 5ICZB 4DQOL 5FYLL 2H32A 4ZYKA 2FHCA 2QQLL 1DL7L 4DGVH 4AEHH 3BJ91 5FYJU 4DKFL 1EXUB 4PJCB 3GSOB 3NCCB 2CRZA 4GAYA 2XQBL 4L4TA 1AC6A 2W0KA 5C0GA 2Q6WB 2BVUA 1AJ7H 1HCVA 2WBWB 5CKGA 3ROOB 3MJ8B 2J3SA 5FGBA 3V5HB 1IC5H 4JFOA 4F7PB 3B4NA 4PJBF 1GHFH 2J6EA 1SM3L 2XKNA 4QHKI 3QHTC 5JXEA 1EMTL 2NX5E 2H3NB 2BP3A 3ALPA 3DXAD 3UDWC 1QLEL 2C9AA 3ARGA 3OAUH 4Z7WB 1QFUL 5I19L 2NX5D 4HUXB 4XP5L 5D2NB 1KIUA 3STBA 1DQTA 5DMIH 4X6BB 4XTRD 2XACC 2UZIL 4M7LT 4XP4L 2J8UA 4OD1L 3ZTNL 4A6YA 5FO8B 4IHOB 4MNQE 5DMYA 1UQSB 3HMWL 2ESVA 1CLYH 2RBLA 1HEZB 2DQIL 1YEDA 5KVGH 5E99H 1UJTA 3O4LE 3V52L 1KCUH 2XA3A 4PTTA 1IE5A 4TSAL 4OLXL 3TA3C 1P4BH 5HYJE 1HSAB 1HSBB 1X5ZA 4EUPG 1EX0A 3MV9D 3O4LD 3RVTC 1P9MA 5KS9B 3BP6A 3BGFB 4N0UE 4LRNL 5HYJD 3CVHA 2V7HA 5IEKA 2ZUYA 5IBLD 3N1FC 3C8KA 1F02I 1ZXQA 5IFAL 1M1SA 5E6ZA 3UZEA 4WEBL 2BJMH 2NY0B 3HA0A 2VDLL 5SWQA 3S3JA 3T04D 4XCEA 2VDOL 3HNSL 4O58L 4H8WH 3IVKA 4EIZC 5FHAH 5IFHH 1K6QL 3HG1B 5CUSL 4HUWB 3CX5K 4X5LA 5DUBA 2Q76A 5B4MD 5GRYA 5JLZA 5FDWA 3RL2B 1VCAA 3QPXL 5C0JB 2I9LA 5JDSA 4CRPA 1XIWB 2BOBB 5F7FA 4XPFH 5C09D 3BJLA 3D3VB 2A83B 3RWCB 3WL9A 1N4XH 3LN5A 3VE0A 5FB8A 1IL1A 5C0CE 1KN2L 1T2QL 2I9TB 3H42L 3MMEB 4NFBA 1IKNC 1HN1A 3S34L 1U8KB 3GI8H 5C0CD 4F15B 2BXZA 4OCRL 5I8CB 4N1EA 5I75B 5JA9A 2Z8RA 4QGYA 3ARFB 3I50H 2FSEB 1HHIB 3OKEB 1J7VR 2EKJA 1E0OB 3MLVH 5JORB 1U93A 3ARVA 2ZOLA 2WNGA 1JE6A 3VXPA 4X80H 3VRJA 5HGAB 2QKIB 1KIRB 4HSQA 3BN3B 2M2DA 4JFEE 1BQHG 4DGYL 3KPOA 4N0FB 1HWHB 5I1IH 1YEGH 2Z31A 3MLYL 4RGMC 3VFPB 4PRID 4ZODA 1R3LA 2QQNL 1TJIH 2HN7A 2AXFA 4WI5A 4MD4B 1IAOB 3HMXH 3L3OB 5DHYB 5GS0H 5JHDB 4QRPD 2NTSP 5I71C 2GK2A 2YD3A 3AC0A 4GS7B 2LAAA 3WHXB 1IMHC 1FNSH 5TE4L 4JPVL 4LKCA 3SKOB 4UDUB 4M02A 1AD0A 3UZQA 5EOCH 3PHOB 4EUPB 4RGOL 1INDL 3NZHH 4OLUL 1YMMB 5I17A 4HUVA 3GM0A 5DF0A 3QDMA 3JTTA 2VL4A 3FT2B 1KULA 1QKZL 2Z35B 5EU6D 3FO1A 4PRPE 4PY7A 2CIIA 4YXLL 1L9NA 2ITCB 3O2DH 3O6FC 5GGTA 2JCCA 3CXHK 3WUWG 3QYCA 3TV3L 4K7PH 2BNUA 5DK2A 1JGEA 1XGPB 3JWOL 5ETUB 3G5YB 2EDQA 1I3VA 3ARBD 3MLTB 3MR9A 1EFQA 1UB6B 4DK3A 2GJZB 4OGYL 2IPKA 4CBPA 1E4KC 4JR9H 4YWGH 2P5WA 4APQA 3GM8A 4JFXB 1RVFH 1GZQA 1A5FH 2YC1B 5I1HL 2H8PB 3BKYH 3MRLB 4MCZB 3F7PC 1LO2H 1GZPB 5DK0B 2P5EB 3FHAA 4N68A 1LDSA 4FQCH 3QHFH 5CWSB 3DROB 2AQ3A 2VXSH 4Z78B 4KTEL 5IMOB 3DX6A 2VIRA 4MJ2A 3QUKB 1W2KT 4CU6A 1VEMA 4HWZB 3U7WL 2RFXB 2DICA 2EH7L 3EAKA 4KDTA 4OF6A 3EYQC 5D5MB 4NJ9L 1OSZA 1INQA 4I1NB 2BVPB 1LO0H 3NGBC 5IQ9A 1NFDA 4PJ5A 5A2FA 1FP5A 1DLHA 5ID0A 5DZLA 2A74B 1F4WH 2WUCL 4NKDB 1A4JB 4F33A 1P4LA 4YBQC 1X4ZA 4PIRF 4PJ8D 2VLKE 4HWEL 3W2DL 3JWNC 3ZSSA 1TCRB 1FIGH 2VLRB 1D9KD 3K4ZA 2C3GA 5BV7C 2VLKD 2DF3A 5LVEA 4G7VH 2VITA 4HS6B 5C0BB 3QG7L 1JGLH 3MGAA 4XBGB 5CZXC 4DCQB 1A4KB 2Y06L 3HI5H 3BPLC 4HC1H 1E27A 4LU5L 3SDXB 3MLZH 4H0GA 4U7KA 4G9FE 2H41A 3FRPA 4JRYE 1JZ5A 4BUHA 4DUXA 4JRYD 8FABA 3OTTA 3SQBA 5HDBE 1MCIA 3IDJB 3L3JA 5E1AB 4M3KB 4K3JL 4WI6A 3LPGA 4BK5A 4LCWE 4WUKH 5GRJH 2DYPA 5JOFB 2DKUA 3QXUA 3QWRD 3PNWB 3BI9X 3GHBH 3GSRA 1XGTB 5J6GA 4Z5RA 2HJFB 3KPSA 4U1KA 5D93B 1CDYA 3WS6A 5MEOA 3WFEL 3B6SB 4NKMB 4ZFOL 4HFWA 5HDBF 2CLVB 1LK2B 2W0PA 4YIQB 2CD0A 4FQJH 4UV4L 5EU4A 3O6FB 2D9QB 3D25B 1A6AB 5DRNB 5F6HJ 3T1FA 2CJUH 3SE8L 3GGWB 3V4PH 1B2WL 1YYML 5C0RH 3FTGB 1JHKL 3P77A 1B3JA 3PWPA 5ECJE 4Q6IB 1IQDB 4TSBL 5GRWA 2GSIA 1Q9OB 5SX5H 1X44A 5FYKE 3RDTD 1RFDH 1YQVH 3EUUA 1DSFH 3T3ME 4Y16A 4IS6A 1CTOA 2FYYB 1MJ7L 4OBRA 2AS5M 4W4OC 5FYKD 4OCNC 1ZVHA 1QFWH 1QRNE 3BT2L 2P8LB 2APTA 3WFBL 2EDLA 4GAJL 4ODSL 3ARDD 5JPNA 5DQDH 4JLRA 3H3BC 3BDBA 3MRHB 2AJYH 3UJTH 3CD4A 3LQZA 5CEYB 1P5VA 1OP3K 2BCKB 3VA2C 3T3MF 1NCBH 3DTXB 3NGBB 5GIRA 1BOGA 4X99A 2YPLE 4BQCA 1NEZG 4JN1H 3IU4H 4GW4B 3PL6A 4AMKL 3ZE2E 3NCBB 3SGDH 1S7RA 1VFAB 1CU4L 5C08A 5ESQA 2A2QT 1ZHKB 3MBEC 1KCRH 2HLAA 5ERWA 3SDCC 4DN3H 3BXNA 3HZYA 3QI9A 1J8HB 2D7TL 4XPHH 5BMFL 1AGBB 1F2XK 4R96A 1XF4B 4WFED 1ZT7B 4O9HL 5GSVB 4FQXA 2XWTA 2PO6D 1H0DB 5M95B 3WBDA 2EDWA 4ELMB 3BPLB 1NPUA 3HB3C 1D6VH 3CSYA 4FOMA 2F58H 2WQ8A 2JJSA 1KJMA 1EJOL 3ZE2F 3GJEA 3KLAA 2FEDC 5CGYD 4OV6F 5DJAA 5I1AA 1RIVH 2EZ0C 4N0YL 2J12B 4UT6H 3U9PL 4D0BA 3IAQA 1J87A 4LP4A 1B4RA 3CFKB 1LEGB 3BP5B 1EO5A 4RGNE 1BIIB 1MAML 3GBLA 4NQEB 4CMHB 1FFNB 1V3KA 3R06B 4KUZH 2VQTA 5DHVB 1KLGA 2HFGH 5LWYL 3O9WA 4FRWA 3OPZL 5T3ZE 2QQKH 3D85D 1K8IA 4PGBB 2G2RA 2XZAL 2Y25A 4XP9H 1N5YL 1T89C 2AXGB 4LDLB 5T3ZD 2G75B 1HOCB 3WFCL 3KPLB 3HLAA 5DFTA 4MZ3A 3PV7A 4MHHG 4QTHA 5DQ9B 1N2RB 3EBAA 2GJ6A 1C7TA 2BNRD 5F9JB 1UKSA 1CF8H 3U2SA 2GFBA 5L2KD 3MV11 4P5TD 3RZCC 1A7PL 5T5FL 3KPPB 4OB5L 3UEZA 2DTMH 1F3RB 4WHTA 1IM9B 4HIXH 1PKOA 1XAUA 4IOFC 2R69L 4HK3J 1QOKA 2WBJC 1NEZB 2BDNH 3V5DB 5C8JB 3HRZB 5E0QA 2YD1A 2BSSB 4HMCA 1U8QB 3ZE1E 2ZNWA 3HI6H 1UVQB 4QTIH 1LDPH 3SGEH 1T66D 4ZO7A 4N5ED 3IDXL 5HYQA 4OIAA 5K9OB 1OLZA 3QQ4B 4ELKA 5IMLA 3V6OA 4EDXB 5CD5C 5DSCB 1KPRB 4V1DE 2B7DT 4RAHA 2VXTL 5FM4A 4CNIB 5IHLB 1CLCA 4NWTH 4Y5YA 3RI5F 1NC4D 1VGKB 3P0YH 1A6WL 1U58B 4PJAB 1A02N 3DX8A 2IF7A 4YDJB 3ZE1F 4NT6B 1UWGH 2G5BB 4G6AC 4L8DA 3KDMB 3PP3H 1MCEA 3X3GL 3MYJB 1A9BA 1ITBB 3KR3L 1XZ0A 3SDCB 2ZCLL 2XN9A 3WXVL 3MRGB 4WFFE 5CILL 4NQVB 1IGYA 2I07A 3T08A 3VFNA 4WU5B 3VFRA 1NGYB 1RK1A 1CICA 4ODUA 4XPGH 3AMLA 2AK1L 3DMMC 1IGFL 2ZSVA 1T4KA 5EOTA 2IAMC 4GLRI 3N1QC 2HKHH 1EEYB 5EN2A 1T1ZB 1U8HA 3RTQA 1KJVA 3TYFB 5E4EC 4YK4C 2EICA 3QR2A 5FO7A 2R2HA 1SYVB 2AJSL 1LILA 5DMKA 1HQRA 2EIZB 3C60A 2R1YA 3TEUA 2AI0L 2EDXA 5T1LD 3WIHH 1MREH 4KHXH 1S9VA 15C8H 2X4SB 3NA9L 1EAPA 3INUL 1WBXA 1P7KA 3I6GA 3MBXL 5L2JA 2FZ3B 3QEQB 5BS0A 2C1PA 4KAQL 4UILL 3RWHA 2NY1D 1FL3A 1KLFA 4K8RL 5K9QG 4JZJB 4X9FA 3RU8H 1VERA 5AWNH 4P4KD 3JWDL 5KSAD 1OW0A 1T1WB 2WSKA 5IB5B 1GIGL 4Y8DC 4PRBA 2FX9H 4ZDHA 3PWUB 2E9JA 3BKCH 3TH2T 4HJ0D 1CFQA 2BHUA 1V3MA 3P40A 5H37G 3FKUS 3P9WB 4LLMA 4UIKH 1C1EL 2LE9A 5D4QA 1ZAGA 5DXWA 3CXDH 4PG9B 4G5ZH 4EQ3A 2WIIA 4N9GA 2YD8A 3QUXD 4N8VG 4MS8C 3NH7L 1OD7A 3OKKA 4JO4L 5FKAA 5DO2C 3TBTB 5C07D 5KSBE 4NO0B 1KXVC 2Z8WC 3DBXB 3MRPA 4I3GA 2AVGA 3BWAB 3TVMA 4QWWC 1QUNA 3WD5L 2YKLL 4NRXA 3R8BB 4DGIH 2YA1A 4OD3L 2NLJA 5JMRA 2A38A 2Z31D 2X41A 1WZKA 2DMCA 3GK8L 2P8MB 5JPMB 1KTKE 2HJLB 3B3IB 5HGHB 3X14B 3OL2A 1TVDA 3TCLA 1T0MA 4HQQL 4N0UA 3QDAA 4P57A 4LLWA 2NNAA 4JDVB 3IFPB 3NACH 1DQDH 2RHEA 2GQHA 5JDJA 1S7WB 3BDYH 4FFZH 1RJCA 4GSDL 4PD4J 4M48H 1EIBA 1P6AB 4X9GA 3CVIH 3TT3L 1KELH 2ARWA 4G6ML 4K7PX 1MELA 1QLFA 5T5NF 1ORQB 2J5LC 3UYPA 1BPVA 2QSCH 5FAAA 5IHZB 3DV4B 3DMMB 4L1HA 3GBMH 3ZKND 4P2OA 2XA8L 3BO8B 4DUVA 1G1CA 3F5WB 3QDJA 5F9OH 5BVJA 2D03L 3I75A 1VSCA 1KJ2B 4NNXA 2NYYC 1JIBA 1UEMA 5E4EB 5ACZB 1S9XA 5DMGC 2IH1B 4OLVH 4PPTA 3PDGA 3W39A 5ICXA 4ONGL 4JFQB 2O93L 4MXVE 5BV7H 1LNUA 2FBJL 3GMOB 4CVUA 2HFEA 2AEWA 4UDTA 1R3JB 5E2TL 2A6IB 4L3EE 5CJQH 3QRFM 1EHLL 1UWEL 5EA0H 5JXAH 3DO7B 1AXIB 1XEDA 4JPKH 2OXHA 3WJJA 4AH2B 3FQWB 4LLUB 4A2LA 2XTJE 2VZUA 3LKSA 3QNXB 3S96A 3ZKMC 1I7RA 1AGFB 5GGRA 4XCYB 4QHLB 1S9KC 1OPGH 2FX7H 3CC5A 4GUPB 4IRJC 3V4VH 5D7KD 2XNAB 2HRPL 4MXVF 5C0EB 1BZ9A 5M7QA 1SBSL 5JR1L 1D5BB 5HGGS 1FBIL 4GRLC 5DVKA 1U92B 5DVLA 4R7DB 4KVNH 3QEGL 4K7FB 3KVQA 1ZLUH 2VMFA 5IF0B 1ZT1B 4WUUE 4D3CH 1UT9A 3MLWH 1IRAY 4GG8A 3QUML 4W68A 3FN0H 2FL5B 4OZIF 1S9YB 2DQFA 2ID5A 4R4ND 5D1XB 2XWJB 4O51A 4G80A 4WUUD 3GJFK 3IRPX 5TGBB 5E08H 1DBAH 3WS3A 1HYSC 2CPCA 4YHIB 4Y7MA 4MNGE 5TPWH 4KHTH 5IK3A 3DVNA 3K4DA 1U36A 3UXFA 1J1XL 1NMCB 2LAGB 2O5XL 4WY7H 1UYWH 3CFEB 5BW7A 3G04B 4CMMB 5I16A 1CGUA 4Y5XB 4YHLH 3T2QA 3X13B 1NCAL 1CK0L 4LLDB 4P2RB 3FMGL 1RUQH 4Z7VF 1A2YB 2XY1A 4OFYA 2LV4A 1QTYT 2PN5A 4PUBH 1C8PA 3HPJA 5F8RC 4N0RA 4MB4A 5EZLA 1ITCA 1DEDA 5TF1H 1W8OA 1WF5A 1T20A 3BYTA 3E0GA 2W9DH 4OZ4B 3AM8A 4HXBH 4ISVB 1WTLA 3CFDB 3O3DB 3V7MA 3QA3A 1MHHB 4TVPH 4E41D 1U3YA 4Z8FL 4JE4B 5B39A 4KQ3H 2NPLX 4GKSA 4E5XB 3VFOB 4C4KO 1OT1A 1YEEL 1U95A 4C83A 1UCBH 3C2AH 3O2VH 3RAJH 2J5LB 3DUSA 1M7DA 4J4PC 2ZUSA 4JN2B 5A2IH 1MCHA 1EBAA 3STLA 1RZIB 4R6UA 3MV8D 5IB4B 3WSQL 4M93C 4XVUC 4QYOB 4FTVE 1NUFA 3PWLB 4WW2F 4DOHE 1YY8A 3SKNB 4NZRH 4QF1B 5F6IB 1QR4A 4X9HA 2PW1B 4FNLL 4KGLA 4P4RB 2ZPKL 1T0PB 5KSUA 4D0CB 2N56A 1X5FA 1ZVYA 4LCIH 1P7QA 5FM5M 2R2EA 4ESKA 4HD9A 4AQ1B 1D5XB 5IT2H 1AQKL 1FLRH 2D31B 1FGNH 5F3BB 2H32B 5HHXL 4NGHH 2O61A 3CK0L 5TE7L 5J1AB 1TZHA 2IQAA 5F9DC 5E7FA 4ZXBA 3UJJL 3OG4B 4G9FA 3DV6B 1K8DA 1QD0A 2CUHA 2QSQA 2Z91A 1QSVA 5LJYH 5C0GB 2BVTA 1U3HA 1A3QA 3OKOA 2ADJA 3TH4T 4K7PY 4L4VE 3DUHA 4LPWA 2JJTC 1FDLH 1IC1A 5D8JH 4KROD 1C16A 4Z7QE 1CFVH 3FCTA 4L4VD 3QFJE 1I9IH 2DQDH 1Q9LA 3JWOC 4XHQA 5CCKL 1ZLWK 2GW5A 2R1WB 4OKVB 2VISA 3QFJD 3KPNB 1REIA 4EI5C 2GT9B 3SKJH 2VLLB 2ICWA 5MENB 2CDGB 3S3PA 3VXRE 4XPAH 4GRWE 1M4KA 1H5BA 3DVFA 3T0EC 5LKNA 3L3HA 3RPIA 5IW6A 4Z7QF 3VXSE 2DM2A 1DVFD 4S1RH 2EH8L 4IM8A 5FGRA 2NY5L 2PW2A 3HKFA 4QHKJ 1DQLL 4K9EL 3WN5B 2JB6A 1AGCB 3EKCA 3C8KB 4JFFE 1IQWL 4ZUTB 4CADA 2E7MA 4XMPH 5KTEH 2VDPL 4L29A 3KNBB 4HUUB 5E6IC 3GBNH 1FPTL 4GRWF 1BBJA 4OI8A 4XCFL 4XCEB 3IVKB 1QVOA 2CRMA 1CGSH 4DVBA 4J6RL 5D1QA 4Z95H 4AEEA 4WGVB 1LO3L 5DUBB 4LSQL 5JLZB 3SGKA 4N8CH 2MOVA 4IRSA 4DN4L 4PRHB 1KTDB 1V8HA 2FECL 4X8JA 3S35H 4LCYA 4UOJA 3WL9B 3LN5B 4M4PA 2JELH 4K71C 3OR7A 3A6BL 1H3VA 5E6YA 4BYHA 3BH9A 2IQ9L 3EO0A 2NZ9D 5HI3C 1MH5A 1ZVSA 4XXDA 3BAEL 2DLFL 1YJDL 2VAJA 4M93B 1YN7B 2YPLA 4IBLT 4JFYA 3OJDA 5CSZA 3JV5A 1EEZB 4HZLB 4R2GD 4PB9L 1D5MB 5L6YH 5LGHH 3PHQA 2AEPL 4NQTA 4PRAA 1U93B 3QP3A 1NCWH 3BQUC 2EDNA 1H9VA 1YECL 4EQ2A 4G8GE 4U4BA 3MJ6A 2AKRB 1KCVL 4LVOC 1NL0H 3HE6A 3QUZC 4KVCH 4NDMB 4ODBD 5IEHB 5EZJB 3RKPA 3UTTA 3EYUH 2F19H 1KJ2H 1OTSC 3K8MA 4G8GD 1BBDH 3GMPA 4RFEA 4OSUH 3WFHA 4M1DL 5I2IB 2IC2A 4AM0A 5C1MB 5SV4A 3C5SA 1G7PA 1U8NB 5IMKA 2D2OA 3QO1A 2MJWA 2AK4E 1A0QH 3L7EA 3CFCL 4QRRE 1AD0B 5EULV 4CU8A 1F11A 1LD9A 3FO2B 4HKZB 5EU7E 1UM5L 3LZFL 2AK4D 3DSFH 1RUKL 1F58H 1H3WM 3RBSA 1SMOA 2ZJSH 1OT2A 5F7EL 3TZVA 5H35A 4HUVB 1QZ1A 2YS4A 3FRPG 6CGTA 5I66A 5DUMH 3MREA 5GGQH 4EI5B 3C9NA 3G5ZA 5GSRA 4N1CA 4NFDA 1Q1JL 1WEJH 5IW3A 1KIQB 3BN9C 1MCQA 3DX7A 5I1KH 1KENL 4TQEL 2E5EA 5KVEH 1KTLB 3VWJD 1UWXK 2PKDA 3VXMA 4AK1A 2JCCB 1A7QL 4LSRH 3L5JA 1FH5H 1RHFA 3Q5TA 4L5FL 2DWDB 1F3JB 4YXHH 3P9LA 5CP3H 2DKMA 5JQ6H 4ODWB 4NQDB 5CMAA 1AXTH 5FHBH 2IFFL 4C57C 4KDWA 4NC1E 4L3CA 3O8XC 1IKFH 1X5LA 2ZSWA 2GYSA 1Z2KA 1P84J 1T1YA 1H15A 3CPLB 1WCBA 4FMKA 4B7IA 4P46C 1S7VA 3B9KB 3C6LD 4JRXA 3QQNA 1GC1L 1FO0L 5KVDL 1FC1A 3VJ6A 3HC4L 2NXZB 2NW3A 4U1SB 1QSED 3K4AA 4TNVF 3DX6B 2VIRB 4G6KH 1WZMA 4HV8B 2YPKA 5HBBA 2HFTA 4V1DA 3OR6B 2ATKB 4XNUH 4K71B 2DQHL 1S5IH 5EIIB 3KS0J 3DYOA 4JO1H 1LEIB 4PJ5B 5D7JA 4U1MA 3HNTL 2OR7A 1WZLA 3S4SB 2DQEL 1DLHB 5D96C 1LO5A 1FL6B 3U1SH 3MNVA 1P4LB 1MJ8L 2HVJB 1N59B