4PP2A

The crystal structure of der p 1 allergen complexed with fab fragment of mab 10b9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
DIQMTQTTSSLSASLGDGITISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain of Fab fragment of 10B9 antibody
publication title Structural Analysis of Der p 1-Antibody Complexes and Comparison with Complexes of Proteins or Peptides with Monoclonal Antibodies.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 211
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pp2A01
3L7EB 1CDUA 3IAQA 3GO1H 5D7LB 2XV6B 4V1DA 2DIJA 5HGDB 1QO3A 2YS4A 4ZAKD 1RK1B 3PGCA 1PYWA 1NAML 3MCLL 5KANI 2HMID 4OZHB 4PYGA 3O3EA 4FFZH 4K94H 4KVNL 4NO0B 4RX4D 2DIBA 2OL3L 1P7QD 4HXAL 4IOSD 4J4PD 2UWEF 4U1LB 1LO4L 3K8KA 4YPJA 4X98B 5CJOH 1IGFL 2NLJA 1FFOA 4WW2A 5HVFB 3SE9L 4PRIB 3LV3B 2HT2C 3JSSA 1C7SA 3GDBA 4X7SH 3OF6D 5IVXF 3NCJL 1TZIB 3UTZA 1NAMB 4F2MA 1NBQA 2QR0B 2VXSH 2ZUQB 2X4NB 3LKQA 4WDIB 4H26B 2XPGB 3MACL 1QFWH 2O93L 5DHYB 2OL3B 4IOIA 3O6KH 4HWZA 3VFNA 1Q9KA 5F97E 1I9RL 4JFYB 1INEH 3M17B 3WXVL 4P9HH 1PJ9A 4PJGB 5ANME 2W9DL 1BJ1H 4ZQKA 2ENSA 5IJVA 4NHCH 1NH6A 1N2RB 4DKEL 5FECB 1UM5L 2X9WA 4Z95H 4XNQA 3BQUB 4M61A 2ZCKH 3UTSA 3MRFB 2PTUA 3I02A 2IH1A 5JIHA 5HYJD 5I9QB 3P4OB 3V4UL 4PRHA 2CK0L 4D9LH 5LGJA 4UT6L 3MBEA 2Y06H 5FXCH 2H1PL 5I2IA 5HHNB 3S34H 5C8JB 2AJSH 3TIDB 4YHOH 5I8KL 2Y4SA 4ZUSB 3C6LA 5I17B 3MUGB 4HFUH 5FM5O 4GBXB 5C08D 4GW4B 4HWEL 4QGYA 1PZ5A 5D93C 3RX5A 3V79C 4ZS7L 3W11C 3BDBA 3KLHD 5IR1B 3HAEH 4XCCL 4ELMB 4P2QB 3RUGA 3IU4H 1SM3L 3GNML 2IH3B 4L4JA 1JZ4A 3WJLC 4NN6B 3RVVC 5K9OA 1KEML 4FZEH 4GKZB 5EOCJ 2OTUB 1AD0B 1OTUD 3ARBC 1GPOL 1F4XL 1ZGLA 5MI0C 4F9PC 4CW1B 1K8DB 4OGXL 5JXAL 2HLFD 3U7WH 2MMXA 3LPFA 4HKXB 4BK5A 3GSWB 3QZWB 3LKRA 1IQDA 1F4WH 4C83B 3BKYH 5KZCB 3UXFA 2GCYA 4O5LH 4GUPA 1XGRB 3AM8A 4WEUD 4KZEH 4XHJC 3Q1SL 1DQDL 1SEQH 5EZJA 4CDHA 4Z77B 3PQYB 2AXFA 4JO3L 5LBSL 1A4JB 2V2XB 4UINH 1LP9E 5JOFA 4LNRA 4Y19B 1CFVL 5C7XL 1RZJH 5CP7A 3GMRA 5FYJL 5IVNA 4LKXA 3MV7E 5I75B 4PJXF 3GJFB 4OT1L 4XMKH 5HDQL 2BHYA 3EFFB 3W5MA 3QCUL 1J1PL 3NGBC 1NMCB 2R2EA 1CXEA 1IC5H 5DWUL 5E24E 3PWLB 5E6ZA 3VWJC 1CE6B 3BE1L 2D7TL 3DV4A 4P4RB 1KB5A 1VFAB 2EICA 4KKBC 5C09B 2DI9A 1Q9WB 5DUPL 1A9EA 5JOPD 1T2QL 2C5DC 4I3SH 3A0OA 3K46A 4O02H 5FO8A 1DLFH 1DBJH 2EDOA 2VXUH 4WHYH 5DURD 5D72H 3DI3B 1CBVL 4ONGL 2EIDA 2NY2C 1C12A 3QEHA 5DF0A 1DEEA 3OJ2C 2C1OB 2HFGL 3WUWB 1MFCL 5K93A 1MFBL 4RFNB 3QNYA 3VG0L 3ZL4H 1WFOA 3BPCA 3HI1A 5C0CA 5DEFB 4DK3A 5IVZA 4JZNB 4KJPD 5H8DA 1E4XI 1UKSA 4NPYA 2I25N 4X99A 5T5NF 1GHFH 3VDBA 4NWUH 5TPWH 2VERN 3DXAD 4CNIB 7FABH 4LRNL 2BNUB 2X40A 2HFEB 3IT8D 5TE6L 1FNFA 3GK8H 1C08B 1REIA 3O3DB 1K4CB 1FZMA 1GVIA 2KL6A 2YK1L 1YEKL 4HS6A 3VWKB 1RUML 5D71L 4NKIL 4YBHA 1WQVT 2OJZL 5GRXG 1V3KA 1J18A 3D87B 4UTAL 3QDGB 1Z0MA 2BX5A 5ALCL 1H8SA 3GRWA 4XVJL 5DJ8A 4P46B 1KTRL 2AEPH 4G42A 1NDMA 1QLFB 5LXGH 4YJZL 3WO4C 4PGDA 1A6UH 3RPKA 5JHDA 2Y72A 3H7BB 5IHUL 1QKZH 3TM6A 4TUJB 3UZQA 5ID0B 2PYEB 3VG9C 4XI5C 1G0YR 5HHOD 5GIRB 3OAZH 1ZGLM 1F3JA 4FS0A 2DDQL 2D4FA 5CEZH 2C3VB 1I75A 3UJIL 2AQ1A 4NNYA 3FN9A 1KT2B 5D96B 2H6PA 4JO1H 3HC3L 3VXRD 3CLFL 2A6KB 4E0RA 4Z7QF 3X3FL 4EQ2A 3O3UN 1HIMH 4YHNA 2BOCB 4R26H 4L8BA 3MLXL 4L3AA 1OGAA 4HSQA 3T0EA 1N5YH 4WWKB 2HH0H 4XX1E 3RAJL 2NW2B 5E5MB 3UP1A 2Y5TB 3LKSA 5GGRB 3D5OF 4S2SB 2F5BL 3C9NA 4MZ3A 4PV8B 1D5IH 1FL6A 3L3HA 4EUPH 2D03H 5CLTA 4ZPTA 4WUUD 5HY9B 5D7KE 4P4KA 4M9PA 4OUOA 4FFVD 5D1ZA 5JA8B 3U4AA 1VACB 2FNBA 3A67H 3OKMB 2R0WL 1YN6B 2NY7L 4Y16A 4M1GL 4PS4H 4RRPG 3OBAA 1EA9C 1GC1C 5E8PB 4IDJL 2XI9A 4L8CB 1IGTB 2YWYA 2BCKA 3R06B 4NKMB 4XBGA 2X4PB 4ZOCA 4M7JH 4X9GA 2AXGB 2BZDA 1JGEB 5EORL 3FOMA 4QRPB 4LSPL 5LQBH 1GZPA 4TUOB 4RAHA 4JDVA 4GQ9H 5D9SB 1FFPA 1NLBH 2J8HA 5B38A 3PP3K 4QY8B 2ZWLT 3KPNA 1QEWA 4NKOA 3ARGC 2HT4C 1CXHA 1AP2A 3EFDL 4Z7UE 1NMBH 1HSAA 1UC6A 2FEDC 5IBTL 1NCDH 8FABA 4O9HL 2JCCF 4EI6A 3HTLX 1G7QA 3KNBA 3S37L 2BK8A 1G7LA 1JI2A 3CFIC 3O3BA 4NO5A 4G6MH 1ADQA 4P2OA 2EDXA 4ZDHB 43C9A 3HRZB 3GMPB 2RIKA 5FOBB 1QRNE 2BSTB 3B9KC 3FMGH 3UTTD 5EO9A 3EO0A 2OR9H 4LCWD 5I1CH 3TFKD 3UYPA 4G43A 4N9GB 4JFPB 2XG5A 4GS7C 1KC5L 3K1KC 3U6RA 3MRKB 2NXYB 3MODH 4JAMA 4JLRA 1JGVL 4RX4A 3BXNA 3GIZL 1WT5C 4TVSa 1T7VA 1P7QA 1S7SB 3QFJB 4AQ1B 5GS2D 4J4PA 1OB1B 3MRRB 5D6DC 1D6VL 2CR3A 2QQKL 1RUAL 4P2YA 3FONA 1WGOA 2WBKA 1JRHL 3QHTC 2GSIB 1J1XH 1YEIH 1UVQB 2H32A 3IFPB 3OF6A 5D5ME 5J6HA 2AVGA 3BP6A 1IAMA 4BUHA 4JJ5B 3RA7L 4H1LB 3JWDH 1J0HA 4N1HB 4V1DE 5ISZB 3T77A 1XCTA 5D6CA 5FIEA 3RX8A 4D0DB 3TLRA 4Q6YA 4WW1A 1RPQA 2J12B 1ZVYA 3BGFB 4GLRH 1EEUA 3TJHD 4BZ2L 2ATPB 3RKDC 2QEJA 4Y4FC 4NT6A 4XC1L 1QLEL 3DPBA 1U3HA 3MRHB 4MD0A 2CO6B 1UQSA 4OF3A 4XNXL 4RA3A 5HYJA 2WIMA 3DROB 1A6WL 4YBLB 1VGKA 2K3TA 2WUCH 1MLCB 5KSBE 2JKXA 3RKPA 1Z2KA 3OHXA 3GBLA 5FYLE 2CH8A 2NY4B 3JWOL 4XAWH 1I8KB 1CE1L 3SJVD 4OGAD 4JFOA 4G80A 3ULUE 5C08A 3QEUA 1DL7L 3OB0K 4OZFH 3LKPA 3PABB 2WBJB 5FO9A 3CMGA 3BEVB 4DOHB 1LO2H 4X6DF 3SDDC 1FO0H 2D9CA 2A6DB 4JFHE 1RUPH 4M1DL 5CMAA 3KYKL 1F00I 4RGOH 4NFDA 5I8OH 4NO3A 3UTSE 2GTZB 1KCSH 1T22B 3GJEA 1YPZE 1CFTB 1UH4A 3CGTA 2LVEA 5DUBB 3V7AE 4GXVH 4PRHE 2DB8A 5CZKA 3TNMB 3LPGA 4EEEA 2VISA 4DW2H 3QG7L 2RFXB 2DKSA 3IXTA 4ONOA 4XPTL 3SDYL 3WNKA 4L9LA 2X89D 1EGJA 2P8MA 2ZNWA 3LDBC 5CZXC 2XZZA 5HPMA 2EDTA 5JPNA 4LCIL 5I1EH 3MYJB 3QXAA 4YO0B 1PY4A 5DRZA 3CSYA 4QXTB 3MGTB 1U2HA 4D9QE 4HKZA 3RUGE 4RFOH 3EYUH 3MLSL 2X4TA 3HFML 4IMKC 4F37K 1T3FA 1A6VH 4YC2B 1IC7H 5SWQB 3VXMB 3ZTNH 4I1NB 3CDCA 5DHXB 1U95B 4JR9L 4X8JB 4RRPA 1YYMH 2I9LA 3U0PB 4KRNA 2AV7B 5C3LD 5CGYC 5DVOA 3VI4F 1VESA 1FL5A 4TPRH 1RJZA 3P77A 1HHIB 2R1XA 5DTFA 1N7ML 3EYSL 3OAYK 2Z93A 4P57A 5FKAB 2OI9C 2APVA 3OAUL 4YHZH 3T2NL 4HMDA 2VXTH 3GUTB 1EFXB 3B9AA 1I1YA 2EXYC 1CQYA 1ZSDB 1LNUB 1D5MA 4PJAB 3KG5A 3W2DL 1JHLL 2YZ1A 5HHMB 1JGLH 5E6YA 2JELL 2F8XC 5E08L 5DFVC 1EFQA 2QSQA 3GSOB 3L5WA 4KDTA 4OGYL 2Q3ZA 5EZOL 1J5OL 5DYOA 5IMMA 3BDXA 2AJVL 3TNNB 4DVRH 1NCTA 5J12B 3RY6C 3REWB 2O61B 3I3BA 5LJYH 2V2TA 1V3LA 5DDHB 2GJZB 3QUZD 5T3XL 1PSKH 3HE7B 4YK4B 1CXFA 5F7DB 3PWPE 1N64L 4WV1A 5D7IF 3NPZB 3VXNB 2BNRD 1CK0H 2FYYB 3WUZA 4F15C 1HEZB 2AI0L 5E6IB 1TQBB 5CBEB 5IQ9A 5DLML 1AY1H 3CFCH 3UTPD 4PGZA 1NEZB 4XP5H 4NJ9H 3TV3L 1KB9K 2GY5A 1NGQH 4JZJA 3ULVE 4KK9D 2N56A 5DZLA 5HYQB 4XB7A 1LP9B 3D3VB 4HIHB 5A43C 5GGQL 3SE4C 2FWOB 1KIQB 4E5XB 4UNTA 2FIRT 3FHQA 5ACMA 2YA0A 4PB9L 5I1JH 2DQHH 1W0YT 1ZT4A 4TN9A 3U0TB 2Z8SA 2BNQD 2M8XA 5IBUG 1XZ0A 3EJYD 2XTJD 1R3KA 1T1XB 3EKCA 1SYSA 4JDZB 4KAQH 5BRZB 1LD9B 3ARDB 4I2XA 5HDBF 3RIFK 4XWGH 5INCB 4JFDD 5GJTL 2CIIB 3HMWH 3VXRA 4YXLL 1JV5B 4AENA 3UBXG 2B5IB 2ZCLL 2YUXA 4U1IA 2FGWH 2H26B 4O2CA 3FO2B 5F7KC 5C0RH 3DBXB 5DFTA 1T0MA 2ZG1A 1UCBL 4TQEL 2EZ0C 3T0AA 1VADB 1ZVHA 3RJDA 3ZE1E 5J1AB 5JNYB 5KG9A 1KPRA 3OPZL 1W8NA 3S98A 2IF7A 1EERB 4GSDL 1EJOL 1QOKA 3L6FA 3T1WA 5JHDE 2QHRH 4PJHB 5F8RC 4GW5B 2DWEA 4PJDE 4WUUA 1RZGB 1A02N 3GZKA 1RZ8A 5AD0B 1TZGH 2WWKT 1QBLL 2XKNB 2FX9L 3U30B 3F58L 5KSAC 4XCYB 1YDPA 3QXTA 4S1SH 2AJXL 4OD2B 4LIQE 2HP4A 4YHLH 2VXVL 3QI9D 2OMNA 4RZCB 1VENA 4UT7L 2EYSB 4NQUA 4XPGH 5HHQA 1KJ3L 1OGTB 1IGJA 1W2KT 4XNUH 1OGAE 3KYMA 4OZGA 5E8DL 5JUEH 3JV5A 3T0EE 1V7NH 1I8MB 2VRAA 2Z91B 1D3CA 3GJFK 1L6XA 4PIRF 2GT9A 3U4EA 1LO0H 4PJFF 3BPLB 1A9BA 3ARQA 1I3GL 4KC3B 2D0GA 1KEGL 4U2YA 3H42H 3HR5A 4BQBA 3CUPA 3UPCA 4LVHC 1AO7B 1DBML 3QHZH 5KTEH 2J3SA 5MEND 4J3WA 1NCBL 4NN5B 4XAKD 5H2BB 5C6TL 5IGXL 3OG4B 1P4BH 4GXUN 4OSUL 2PF6A 3LS4L 2IG2H 4OM0L 4MJ6B 1V5JA 2YN3A 3V0VA 3WLBA 4F7TB 3OKLB 1R3IL 4JHWH 1AQKH 4HBQA 3GSQB 3BDYH 2WNGA 4LOUC 3OB8A 4Y2DC 5ESVA 3U46B 5MEPB 2EYTB 2O5XH 4KUCF 3UTTA 4LCWA 3O8XB 1T5XA 1EUUA 2VTFA 2NNAB 1XGQB 1WBXA 1HXMA 4CN1A 3JZ7A 3UCRA 1JVKA 1WBYB 2FHCA 1I8LA 3W11D 2FR4A 3G6DH 5GS1A 4HK0B 2P7TA 4YAQB 1RK0A 3TYFA 4HX1A 3MV11 3TBSB 4HG4J 4QWWC 1A7OH 1V05A 2JJSC 4Z8FH 1W72A 4MDIA 4LGSB 3WD5L 4B0MM 3ARBD 1HOCB 5J4MA 5IEHB 1EX0A 1QBBA 3QEGL 1DE4B 3UAJC 3PWNB 3B2VH 3DSNA 3L3JB 5BJTB 4C56B 3LQAL 1DQML 4ZODA 4Q2ZA 2XA8L 2UY6A 4G3YH 1LE9B 3STZB 4XNZB 1AKJD 3LN5A 4C57C 1CU4L 4NM8L 1MJJB 4ZUUA 5GRZA 2ZUQC 4ZTPL 2YRZA 4CKVX 1EO8L 1EH9A 2NY5H 3PG2A 2BVUA 3OKEB 2ZOLA 1NBVH 1OPGH 1BFOA 4O58H 3PP3H 4MCZB 2HRLA 3CAFA 3HZKA 5C2BH 5F1KC 4LSRH 3IDXH 4GO6B 1C16A 3MR9B 3NBNA 5F7WC 2Q7NA 2YPVL 5TDPB 1QFUH 4KJWC 3BQUC 4MMXC 4Z7UB 5KOVC 4JJHA 3RIAK 2DQEL 3BT2L 3V8CA 1BZ7A 5D1QB 5DJ6B 5I9QC 3T65B 3RL1B 1IAIM 5IFAH 2F9BT 3SGJC 1YEEL 3B6SA 1FZJB 2KQNA 2W1NA 3SJVA 4WU5B 4HMEA 4GT7A 3VWJD 1G0XA 1AXIB 4HUVB 4G6FB 3VGDA 1T21A 3I85A 3UDWC 1NUGA 4KKBD 1JUFA 3QEQD 2ZOKA 1RJYA 3IAPA 4M48H 2P5WD 4OFKA 2WQ8A 1DANT 2P8LB 3P9MA 1FE8H 4GBXC 4KVCL 4Z5RB 1FZKA 1HWHB 4RBPK 5IOPA 1FNEA 4WVRA 3G5YB 4QF1A 3LN4B 2NY2D 4MMZC 5HYJE 1RIHL 4U1KA 1IAII 4NN6C 5CLWA 3F7PC 4QHLB 1CD8A 4QRQB 3UBXA 4ZO6A 1M05A 4Y1AB 1OAKH 1WWWX 5E95B 4U7SA 2X89A 4PJ7F 3SDAB 2VABB 4XPAH 5FFLA 4FNLH 1U8OB 1UT9A 1VPOH 5DMIH 2DLHA 2FO4A 4Q97A 3N9GL 4GFTB 5D5MB 4PGEA 4PY7A 4X6CF 5C08E 4LP5A 3JTSA 5MP6H 5HI5C 1K6QL 5GSRB 3T3ME 4I13B 3SGDH 1DSFL 5GGTL 3C5JA 1FHGA 5C86A 5T5FL 1OTSD 1NGPL 3O3EB 1XR9A 1V3JA 3BP7A 2XWJB 3BWAB 1BAFH 1MFEH 3QO1A 3ILQC 4JVUA 3IDJA 3U82B 4IOFC 4Z7WA 5I75C 1RMFL 4MA7L 3SBWA 1I3VA 4OM1H 4WHDA 1QFPA 3KXFD 3QCVH 1ACZA 2FIKA 1KLGA 4HKJA 4X4XA 5KSBB 1H3GA 4X4ME 1NMCC 3GMLB 2CDFB 5AWNL 3I75B 3RGHA 4MLSA 1P84K 2EO1A 3Q6GL 4OV6F 3HKFA 3RWIA 1ZT7A 3B2UD 4R4BB 3OB0H 1OAQH 4MQXC 4D2NA 4DGVH 4LEXL 3BP5B 3MRLB 3WS6A 1TITA 2B20A 3TT1L 5EA0L 1A5FH 1WWBX 2GI7A 4ODUA 5CJQH 2E6JA 5F21B 4BQCA 2VDKL 1G1CA 4ZUVB 1EBPA 1GCFA 1A47A 2BSRB 3X14A 5IJVB 1CFBA 5ITFB 3HPLA 2DF3A 3CVHL 4JPIB 3UTSB 2AK4D 2IGFH 2IH1B 3CFEB 3QUZA 4RFNC 4ZO9A 2R29L 1YPZB 5DK3A 1LEKA 5CKGA 3TCXA 3UTQB 2MCG1 4NYLB 2ZG2A 4KRPB 5M94B 5LGJB 1OAXH 1JWSA 1U8QA 4YDKL 1S9VA 2BNRA 5CILH 4LSTH 3BN3B 5I2IB 4X9IA 1U8PA 4IM8A 1N0XL 4RWHA 4B53A 3UYRH 1A3LH 2LU3A 3K74B 3SE3A 1T2JA 1BX2B 1ZA3A 2FX7H 4RMWA 4NJAL 4I18A 4K7PH 5GHWH 3C60B 3Q3GA 2C7UA 5FUOL 5FKPB 3VWKC 3MO1B 3OGCA 5GGSA 2EE2A 1BM3L 1XGPB 5D70L 5FGBA 5K9OB 1KBGL 5F88B 5SWZD 2FHBA 4RMUA 2Q20A 4P46C 1FDLL 3EJZD 2YC1B 2BNQA 1G7MB 5KVGH 3DXAE 1ZGLB 4HKBA 3SDXA 4MLIA 5DQJA 3ZKQD 5C0JB 2DQGH 1BFVL 3LQZB 1H3VA 3U1SH 2DD8H 3FOLA 1G7HA 5K9QI 3TYGL 1G1YA 3GMMA 3HZVB 2HT4D 32C2A 4WTZG 3MJ8A 1YNLL 2FEDD 4C4KT 3G6JB 2BDNL 3S5LG 2XN9A 1KELH 4Q6IA 4QGTA 2E9BA 1IGIL 1MWAA 5D96C 3LEYH 5HTSA 1OM3H 1Q72L 2OTPA 2R9HC 4ISVB 4KUCD 1A6ZA 2J88H 1A7NL 1L0QA 1IAKB 3RPIA 1WICA 2Z8VC 4DZ8B 1EEZA 3NIDE 5IF0A 4KTDH 4JG0L 3B9KD 1OW0C 3E3QE 4NHUB 4WWKC 3S6CA 3FT4A 4XCFL 1U42A 1TNMA 3T4AB 1HHHB 3GSVB 4YHPA 3HUJF 5HHOE 5AZ2H 3LH2H 4BFIB 5JDJA 2CK2A 4I2XE 3H0TA 2P46B 4YX2H 4P3CL 3ULVL 3PWPB 4JPVH 2QSTA 4HH9A 1A9EB 3VXRE 5EO1A 3CDFA 2MSPA 1DBBL 1Q1JL 5E8OB 3QI9A 4ALAL 4YDJB 2A0LC 3DUSA 3P30L 4DN4L 1A2YB 3U79A 1TQCB 3F6LA 3FFCD 3S4SG 3I9GH 2UZIL 1BQLL 3T0WA 3S3JA 3RL2A 2ZSVA 1C12B 3FQXA 5FA3A 3SE9H 2JIXD 4IRJB 1KSRA 4FRWA 4LLQA 1UENA 3P9LA 5I1HH 2AV1B 3ZSSA 1R24B 5CEXA 4UV7L 3HI1B 3PHSA 3DUUB 1RZ7L 4WUUE 1OWWA 1XF3A 3FN0H 2JLLA 4FA8A 2X05A 2J6EL 1BWWA 5CSZB 1ZHKA 4Y4FD 4WEMB 4M6MH 3HNSH 2VDQL 4YH6A 1FBIL 1DQLH 3TIEB 3CVIL 2V9QA 3WFHA 1N59A 5T3ZH 4J3VA 3SO5A 1DQQA 1OWRM 4PJ5B 1MHPH 4HS6B 3EOAB 3VRIB 3W9DA 3MOAH 3H9SD 4J23A 4JFXB 1RFDL 3PE9A 4F58H 4PV9A 5I1AB 5DJ8B 2BRQA 4JRYA 3TBTA 1NDMB 1NC2D 1ZHBA 4MAUL 4LIQL 1JGUH 4PGDB 4HFWA 5EUOF 3IU3B 3VGAB 4A2MA 2RGSA 3BSZH 3WJLA 1UEMA 4PJDB 1FNSL 2NX5D 1Q9OB 3PP4L 2X70A 4PREA 4NO2A 5T1LD 3LS5H 3KWWA 4LSSH 3LRSB 3Q0HA 1JZ7A 2HFTA 3ARBA 2GJ6B 4CVXA 1I1FA 4NNYB 2APFA 4QHUA 3U9UB 4F9PA 1FGVL 1KN4H 3DVGB 3MLYL 4K3EL 1IGCH 1AGFB 1GPOH 3LHPH 4E0RB 5KVEL 2LV4A 4YR6A 1OAYH 1U93B 5CZXD 3DX6A 1RV6X 4U3CA 4YE4H 4LCWE 3UTTE 1GOHA 3EOTH 3WJJC 1FYHB 3VH8B 3T0EB 1CFNA 2VZ3A 2VSDA 3HE6B 4OFDA 3GM0A 1BFSA 2NTSP 3NIGF 3LKSB 1Y18A 4XMPL 3WNNA 4YWGH 3WLWC 1QPPA 1XIWB 35C8L 1U8LA 3BGFC 3C9NB 3KYNB 4P59H 2OZ4L 3EOBB 5KSUA 3LB6C 4HPYL 2XZCH 2YKLH 4JM2F 4MCYB 5HD8C 3JV6A 4ORGA 5CINL 5DD0H 4OCNC 2XZAL 1B6DA 4YBLC 3OXRB 4IRZH 1M71A 4LU5H 3E6FA 1EV2E 3ESUF 1FAIH 5IUSA 2BXZA 3LKNA 3VWJA 2NY4C 3TC9A 4PJBF 4GAFB 1S7RA 2WQRA 3QEQA 2WINB 2P5WA 1RI8A 4K2UH 2EO9A 5KS9A 2DOCA 1KPUA 2EXYD 3FOMB 5JHLH 1MIML 4YHYB 1J05A 5DGQA 2H3NB 1ZTXL 1CFSA 3NAAL 4UNVA 2X6MA 2WBJC 2J8UA 2DTSA 3OJVC 2A1WL 2H2PC 3C2AH 3KPNB 1UCTA 4P99A 2DWDA 1QNZL 4R9HA 3EGSB 3JWOC 3QQ4A 4CUCA 5J3HC 1D5ZB 3S5LA 5DC9B 4MNGE 3VXTA 3DTXA 1HSAB 2J2ZA 4MA3A 1BIHA 1K5NA 5EOTA 2DQDH 4NQXA 2C1PA 2A6JA 4RAUB 3BH9B 2F5AH 5IMLA 2XZQH 1FL3A 1EXUA 4HMCA 3KPLB 3SJVE 4U1SB 4OUUA 5FO7A 2QSCL 3W0WD 43C9B 1GGBL 3W9EB 1BFTA 4XPFH 3QNXB 5SX5K 3BD5A 4Y4HB 2F58L 4L29A 2RQ8A 5DJXB 2Y36L 3CLEH 4ZNEA 5EO9B 2CKBH 5HGBB 3JWNC 1SYVB 5DHVH 5CGMA 4ZAKB 2WUBL 3FQTB 2YPLB 5CWSA 1ZEAH 5BW7C 5HPOA 2L7UA 15C8L 4P5TD 3GKZA 4WEBH 4JLRB 5D71H 2K9UA 5IK3A 4XVTH 4XMLH 4YC2C 5EB9A 1LO3L 3RP1A 2BVOA 4PG9B 1CXIA 5D7SL 3KXFA 5F1NA 5IB4B 4P2RD 3BIBX 1J86A 4P5KA 3FONB 5C0IA 5ILTL 1RZKL 1LEIB 1MFNA 4GAYB 1UM4L 5C2UB 1JNJA 5IV2B 1J0KA 2VDLL 1J8HD 4FQLH 4YNYA 4YBQC 1H5BB 3T77B 3RZCD 3H8NA 1RHHB 3P4MB 3RNKB 1DN2A 2G2RA 4QTIH 3C87A 4NT6B 1T7XA 3X3FH 2X4UB 4F7CA 3PJSB 1KCRL 4K7PX 4Z7WE 4GRWH 5ACZA 2AK4A 5M95B 2R2HA 1I4FA 3AXLA 1G6RH 4YDIH 3DURA 1MIEH 1U3JA 1ED3A 4UZGA 2DLFH 5GS0H 1C5BH 4Q58C 5J12C 3VRLE 1WSST 2XQYK 1KV3A 1GIGH 1PGRB 3OKDA 5GGVL 5FCUH 2OTWA 1T89C 3HE7C 5CEYB 3DETD 4YQXH 4YK4C 2B4CC 2CJUH 2LAAA 5ALBH 2G5BB 3ZDYF 2R2CA 2Z8RA 4NQCD 5KSAD 4M43L 3O41B 4UDUB 3PGFL 5EU3A 1TLKA 5JO5A 4G80B 5C08B 3QEUB 5E6IC 1TQBC 2R0WH 5C70A 3EDFA 3HZYA 4KDWA 3DIFA 2R8SL 5FV1L 1U8HB 3KJ6L 4JDTH 3EDJA 1JTPA 2MQCA 4TOYL 4EBQL 4JPKH 5JW5A 4OZIF 1DEDA 2JK5A 3DO3A 3DV6B 5FF6A 5SWZA 3NTCH 3AVEA 3UJTH 4XWOC 1LE5A 2F8VA 1CGSH 3KAAA 3UMTA 5I66B 2Q3AA 4LFHG 3MJ9A 2B2XL 2BNRE 2FRGP 4W6WB 3P4NA 3TWCL 4HF5H 1BIIB 1NCUA 4ENEC 5EO0B 5EU6D 3AAZB 4N1EA 2JB6B 3GBML 3ARDC 4S1QH 3T4YB 3G6AA 5AZEH 2E6QA 2Q7YA 2YR3A 5AUMA 4XP1H 3BIKA 2ITDB 5ERWB 2UUDH 4YEFA 3CSYB 1I7ZB 2GHWB 2R4RH 2B5IC 5CGTA 3U9PL 3ES6A 4Z78B 1G9ML 5DJAA 1ZANL 2ERJB 4M1CC 1RY7B 1KJ2H 1ZT1A 3RY4A 3VRJB 3RIAF 4N5EC 4PRNB 5TQ0H 1ORQA 2LQRA 3FQUB 3KHQA 4Y2DD 4ZUWB 3B9KA 3O9WB 3QHFL 1DBKH 2IPUG 3SDXE 4YIQA 4AZ8A 5JW4N 4JB9H 5D7LD 3OXSA 3P40A 4J3TA 1RJZB 4O2FA 3VJ6B 2JCCE 3S35L 1NFDF 1WT5A 4JFDE 5FYKH 3CC5A 2VH5L 4PGCA 3IDMB 5D6DA 3U30C 4NO0D 5IHBA 1S9XB 4H8WH 3MRGA 2ADFH 3FFCA 1MRFH 4L8DA 4D3CH 4GRWF 2HJKB 2PW1A 4N8PA 2JIXA 3T0DA 3GHBH 3X11B 5FHAL 5F6IB 1S9WA 2B39A 3L5WB 4OF5A 1I3RA 2F74A 5FGSA 1H8OA 1BZQK 4HBCL 5ADPL 1A1OB 4Q9CA 3QRGH 3BPLC 2XRAH 1AC6A 3BVNB 4Y4FA 5DR5H 1AI1H 1JYXA 1ROWA 3DXAB 4NNPH 3ZDZE 4EXPX 1UXWB 1Q94A 4HIXL 4WI2A 3ROOA 2R4SH 4XP6L 1U8IA 4NN5C 3GMNA 3SKMA 3UX9B 3CFKA 3FZUC 3ECBA 3PWVA 3QDMB 4KJWD 4R0LB 2GFBA 1HILB 3ARUA 4HW6A 1II4E 1ZLVH 1XGTA 5IQ9B 1JNHB 4ZTOL 5L8KB 2ZUUA 4AMKL 5I1KH 2FEEI 2NY0D 4A6YA 4RIRA 3J8F7 3MV9B 5L2JA 1IRAY 1MFDH 5E8EA 2CQVA 4BZ1H 3G9AB 5E94B 4PGJA 3IKKA 5DD5L 1T03L 1WFNA 1NC4D 3STLA 3O8XC 3PHOA 4LSVH 1P69B 1N3NB 4FN0A 4Q0XL 1IM3A 5DSCA 5JPMA 4MQTB 2DQIL 5MENE 2IADB 4KUZH 3SDDA 4XAKE 4HC1L 2NX5A 5F93C 5HHOB 1R3KB 1I8IA 4M9OA 5T1LA 1G7IB 4I2XB 4F3FB 1U92B 3QXWA 4NBXB 4QHNB 43CAA 2IQ9H 1N4XL 3WDHA 4JQVC 4GG6B 3CFDA 3VW3H 4WWID 4OIIL 2BY0A 2X9XA 1ND0B 1YNTB 4NQVB 4NCC1 3QG6B 1I9JL 4G6JL 2ICES 3I50L 4XNZC 4BK4A 2FZ3B 5SV3A 4X6DE 3SEPA 5KZCD 3L3DB 1YQVH 2HWZL 5EBLB 1AJ7H 2Q6WB 5HI5D 3MRIB 3DHMA 2YA1A 1AIFA 5DJYA 4OB5L 4LBEB 4ZPVA 1T80A 1ZHLB 4IMKA 4UILL 3BZEB 2W60A 2EEBA 4DJMA 2D0FA 4JKPL 2OP4H 4ZUTA 3NCYP 1RIUL 4TTGA 4Y19D 4MZ2A 1KTLA 2FJFB 2N7BA 3GHEL 2XFXA 2LABA 1Z6JT 1CS6A 1FVCA 1TJHH 1XT5A 4IOFD 1Z5LA 3GSNL 3DGCR 3QIUB 4PJEA 3WL9A 5IVXB 2DBJA 5D1QC 4MWFB 3LEXA 4XRCA 1OSPL 4JANA 5E7FA 3PF2A 5CSBA 4M3JA 1HINH 4CVZA 2GSGB 4K7FA 1M1SA 3OAUH 4IRSB 1B0GB 2AK1H 5L7XH 5C09D 3WFCH 1BVLA 3MX0A 2Y23A 3U2SB 1A0QH 3U4EB 4MQXD 5IM7B 1A9BB 1SQ2N 5FYJD 4LVOB 3SQOH 3QUMH 3GSNB 4PUBH 4MXVF 4N0FB 3R4DA 4UT9L 2XNAA 1JGDB 4ZD3L 2HJLB 4KQ4H 5JW3L 4LSUH 4I0CC 3C08L 3DX9A 4FQQA 3IJHA 5EZOH 3RY6A 1A7PL 5TE4H 4LRIC 4BFEA 4X80L 1FQ9C 2WLZA 4JKKA 1V7MH 4HCRA 4QCIA 2MCPH 4OCWH 5L2KE 4X6BA 5DQDL 3V6FA 1RUKL 3SDAC 4G7VH 3TCLB 3W0WA 3QEQE 1FIEA 4NWTL 5H35B 4K9EL 4M8VA 2P5WE 2V2WA 3WHXB 2W0LA 5KS9E 1IZKA 2ADGB 4X9BA 3FL7A 5ESVB 2V5TA 1GC1H 3UTTB 3GO1L 1BWMA 1G7PA 4LCWB 3DX7A 1T5XB 2M2DA 1FFRA 1K3ZA 3OR7A 4GOSA 5DJ2B 5C0FA 3QA3A 2J8UE 1PX3A 3CFBB 4P5TA 2AEQH 3OZ9H 4Y5XB 5AAMA 4PTUB 4PGBB 4FFZL 4RNRA 4ODBD 5KN5A 3K4ZA 4K94L 1RK0B 1DUYA 3MJ7B 4JEGB 4JY6B 3SE4A 3QDGD 3OKNA 3B83A 3FO1B 4P2RA 1Y6NR 4MDIB 1MH5A 4P46D 4NC0B 4U7KA 5DA0B 4HEME 3BZ4A 1A7QH 3CIQA 3MLTB 1AHWB 4DGIH 4X7SL 5IB1A 1BLNA 1J8HA 2X7LA 1WISA 2VXSL 1G9NH 2PYED 4FXGA 4OBRA 2ZP0T 4ZNEE 3RZCA 4ZUUB 3U0WH 1LILA 4L3EB 1QFWL 3O6KL 2RJMA 5CHNB 5DC4B 1WAAF 1INEL 3REVA 1DLHB 1A14H 4KRLB 1Q0XH 3D9AH 4P9HL 4AK1A 4I5BB 2YD4A 4PJXB 5EZLB 5FM5M 3HZKB 5C9KA 3X12B 4NHCL 1WZLA 3EYVB 4Z95L 3QJHB 1A3QA 2ARJB 2ZCKL 1JNLH 3KXFE 3IB4A 4JFQB 5CD5C 5GRJH 4QT5B 4MNGB 4WWKD 3IYLW 4D9LL 1F3DH 2E6PA 2FD6H 5FHBH 4MD5A 1BZ7B 4QHMB 5IW3A 5B39B 1XGUA 4P9MH 2Y06L 1QVOA 1Q0YH 3MYZA 2CLVA 1KLUA 4KRPC 1M4KA 4M7KH 1NGYB 3S34L 1SJXA 1CFQA 4NQCA 1RD6A 2AJSL 4YHOL 5KSAA 1LDPH 1K85A 1PX4A 4HFUL 2G75A 5SX5H 2GITA 3V4VH 5CJXC 2A0LD 3CPLB 5HSFA 1CGVA 1JN6A 3G5VB 5FAAA 3C60C 1A7BA 3IU4L 3VFUB 3ZDXF 3VDCA 2Z35A 3MRBA 1IKFH 4BFBD 4FZEL 4LCYB 3VXUB 3DYPA 4OLVH 1TCRA 5IW6A 5F7YC 1JI1A 2DMKA 2QKIA 3NZ8B 1U8MA 1LGVA 1M05B 4QRPD 5JR1H 1CVSC 3MRMB 1A1MA 1BZ9A 3O2DA 3NACH 1CYGA 4JFED 1QG3A 2VLLA 1KPVA 3HAEB 1R5VA 3JVGC 5EU6A 2W91A 3RX7A 1F4WL 3SOBH 3BKYL 3N1GC 3DGGB 2VLMD 4O5LL 1F11A 4BFGA 1FV1A 4KZEL 1MAMH 1SEQL 1TMCB 4U1HA 1ZLUH 1IEAB 4MD4A 3WUWG 1TETH 3VFTA 5BCAA 1KIUA 1X6NA 2ADJA 4OI9A 4QTHB 3B43A 2K7QA 5HGHB 1IM9D 3NZHH 1U8NB 3T3PF 4NQSB 4Y7MA 4Z7VA 5SWZE 5D2LF 2DLIA 2YXFA 2CLZB 1RZJL 3FQRA 3WIIH 4Y2DA 3BP4B 4ZSOB 5KW9H 4HT1H 1MEXH 1NGXB 3FT3B 4X4YB 3BP7B 3L7EA 3QO1B 4XMKL 1YEGH 5ESAB 3OQ3B 1B6UA 3THMH 5D7LA 4G5ZH 3B5GA 2DYPB 5HGDA 2DIAA 1OT2A 1ERNA 2FIKB 1IC5L 4HUXB 4OKVB 1RK1A 1EIBA 5E4IA 4B41A 5I8EA 3TZVB 2IEPA 4OZHA 3MV8E 4NO0A 2JJSA 2GIYA 3R0MA 3MLUH 2AERT 4HJGA 3BI9X 1L6ZA 3KVQA 4HAFA 4O02L 1DLFL 1DBJL 4U1LA 1MHEB 1FC2D 4KI1A 4X98A 2VXUL 5D72L 1UWEH 1TQCC 3GEWB 3LV3A 3KHOA 5DUMH 2CR6A 2E5EA 1W0VB 1HDMA 1TZIA 1NAMA 3B8SA 4IRJC 2X4NA 3ZL4L 3BJ91 4H26A 4WDIA 2EYRB 3HPLB 2XPGA 4DEPB 3ULVC 5ISZD 3GGWB 1JHTB 5DHYA 2OL3A 4IJ3B 4DTGH 1OP3K 5MEOB 4JFYA 3SGDI 1AC0A 4GMTH 1GHFL 4NWUL 5TPWL 3RWCB 1M6OB 2VQTA 2Z31B 7FABL 1U8KB 4HUMB 4WGWB 4WUKL 1N2RA 3JUYA 5F9WB 5FECA 5KAQF 5HD8D 1WCBB 3FFCE 3MRFA 3GK8L 4NSKA 3QULB 4JPWH 3P4OA 1ZA3B 3W39B 3SGJA 4I18B 2GTWB 3Q3GB 4D0BB 3WFBH 1JPFB 4OLZL 5CJ8A 4ZFFB 1A64A 1CIDA 3UDWA 3O6LH 5C8JA 2AEPL 3S36X 5J0BA 3VU2A 4BSJA 4MYWB 5I17A 4ZUSA 5LXGL 2FX8H 1FRGH 4HGMA 3MUGA 4ODXB 4LLMB 1A6UL 2VDNH 12E8H 4N5UA 1JZ6A 2YD9A 4GW4A 3SDXB 3V6ZB 1NUDA 4NOFA 3VFWB 4ELMA 4PJCA 3VGAC 3NFSH 2H2PD 2VJXA 2IH3A 2CUHA 2FECI 1RJCA 2JCCB 3V2AR 3B5TA 4R3SB 5CEZL 1JYVA 5J3HD 4JFDB 2CXKA 4AQOA 3MJ8B 5DMGD 4GKZA 2OTUA 1AD0A 2XKUA 4RGNB 4Y2OA 4JO1L 5EBWB 4W70A 4X5LA 3H9SE 2ARJQ 1CR9H 5A2FA 2HKHH 2PCPA 3VXSE 4CW1A 4HPOH 1K8DA 3L3KB 1HIML 4R26L 5SX4I 1PZUB 2IQAB 1INQB 2WANA 3QZWA 4JN1H 2PUQT 5GISH 1KFAH 3IS1X 1MCJA 1N5YL 2HH0L 1MCFA 2P8PB 4RISH 3T0EC 3FT4B 3CXHK 3HE6C 4Z77A 3PQYA 5DVLA 1SJHB 1D5IL 1H0DB 4YHPB 2D03L 3O6FB 1BBDH 1PKQB 1A4JA 2V2XA 1XIWC 2EXWC 5F89B 5FUZH 2Q8BH 4Z7NE 5J1TC 1MY5A 4Y19A 4X6EB 3A67L 3O45B 5GZND 2EE9A 1QQDB 3VXMD 3UZEA 1BD2D 3GJFA 3QI9B 1DQJA 4C58B 4P49A 2FBJH 4NZTH 2QL1A 1CGYA 2VDOH 4M7JL 3PWLA 1CE6A 1KULA 4P4RA 3QCTH 5C09A 3V5HB 1Q9WA 2A77H 5H37G 4YBQD 5LQBL 4XB8A 1Y6KR 2D7NA 4KK6C 4GQ9L 5CEXB 1UFUA 1VFUA 2CKNA 4QRRE 4YHYC 1NLBL 3QIWB 5CJBA 2LFGA 5FCSH 5HHMD 3TT1H 4GRLB 2A9MH 5MENB 4JVWA 3FB5B 2VDKH 4HJJH 4G9FB 1NMBL 2C1OA 3WUWA 1KG0B 3KDMA 3RVWC 3FQNB 1NCDL 4H1LG 4PJEE 4XXDB 1FSKB 2OSLB 5DEFA 5ICYB 3CVHH 4FG6C 5E8NB 4K8RC 1X9QA 4G6ML 4MHHI 5J56B 5I1IH 3HE7D 4CNIA 3ESVF 4QLRA 1BQHG 1NANH 2BNUA 3FMGL 3VFOB 1S7XB 2OR9L 5ESQB 5I1CL 3O4OB 4XBEH 1MNUH 2HFEA 2VN4A 4X6DB 4Y4HC 1FPTH 3NA9H 4K71B 2SEBA 3FT2A 3O3DA 1K4CA 3ARTA 4HFWB 3GI9H 3MODL 4ZAKC 4YZFF 3EIFA 5T3XD 5JZ7C 3QDGA 1XGYH 4X7EC 1VKXB 4AT6B 2CUMA 4GRMB 1UG9A 4NO2B 2YXMA 4P46A 3WIHH 3AREB 3D3VD 4XWOD 1QLFA 4XNYL 2I9TB 5D7JB 1J1XL 1L7IH 2HAZA 2LE9A 1YEIL 4R4NC 3W0WE 3I2CH 3H7BA 4TUJA 1AKJB 5ID0A 2PYEA 3N50A 4EIZC 3BKMH 3JWDL 4X4ZA 3SDCB 5BRZD 2RCSH 4UIMB 2VDPL 3ARDD 5BMFH 1QUNA 1E4WH 1H5BC 4R8WH 1I1AB 1KT2A 4JO2H 1P6AB 2QADB 1FVDB 4OTXH 4XP9H 3HN3A 2A6KA 3L5IA 1U8LB 4QRTB 4F8QA 4M1CD 2Y6SC 5KSUB 4N5ED 4P2RE 3AROA 2EKSA 3FCTB 4KXZH 3EHBC 4WWKA 2WUCL 1R5WB 3IDIB 2NW2A 5EG6C 1LEGB 4L9DA 1ZGLP 2Y5TA 5IB3B 5GGRA 4H20H 6CGTA 2HFFB 4S2SA 1IKNA 2Y5EA 2PW2B 1MFAH 5KSVB 2ZUSA 4XAWL 4PV8A 4YHIB 3CX5K 3EOYG 5L2KB 5HY9A 3HG1D 5DI8B 2DQCH 2J8OA 2P5WB 3OKMA 4FQ2H 1KPUB 1YN6A 4LHUD 2Q1EA 3BEWB 1J05B 2VXQH 1LO2L 5SV4A 1QHOA 5E8PA 5DD6B 5GRVL 1FO0L 4L8CA 1RUPL 1IGTA 1S7TA 1TVBB 2J8UB 4WENB 1SY6H 4EZMA 4RGOL 1F97A 3R06A 5I8OL 2X4PA 1KCSL 3ZZ1A 3R0NA 2AXGA 1NL0H 3DX8B 4N0RA 1JGEA 4GXVL 1KTDB 4QRPA 2VIRA 4DW2L 4R7DA 3SPVB 4OZFB 1D9KD 1FL3B 5D9SA 4X83A 4OV5B 3N0PB 4AYFA 4QY8A 1XF5B 4LARH 1FO0B 5FO7B 4WI9A 4PP1D 4NKQB 5I1EL 2EE3A 1AO7D 2E27H 1HZHH 4TVPH 3M45A 5I0DA 3L5JA 2C3HA 1NBYB 1DN0B 3FZUD 4CJ1A 2BJMH 2R2BB 1WZKA 4RFOL 3EYUL 1HI6B 2OM5A 3D0LB 1JL8A 3VXQB 3KPOB 1WZ1L 4JCLA 5C6WH 1A6VL 1JNNH 4MA1B 1IC7L 2ATKA 3HRZA 3QSKB 3ZTNL 2ERJC 3BPOB 4BM7A 4JFFB 1YYML 3P3YA 3O9WC 2BSTA 2EDYA 3O8XD 3KXFB 5IEKB 3LQMA 3WE6B 4BSVA 4TPRL 3BMVA 4N9GA 4JFPA 1TJIH 2V7NA 2FEEL 5CP3A 3BZFB 3MRKA 4YHZL 1L4IA 1H3WM 1NEZG 1CDBA 1A7RH 3WS3B 2VXTL 1G9MC 1ZWIB 4WFED 1S7SA 3QFJA 5EWIH 1OB1A 3MRRA 3LAFA 4W4OC 4I4WB 3U83A 1GGTA 2GSIA 4Z7VE 1FNLA 1UVQA 3IFPA 3DRQB 3KLSA 2G2RB 4IBLT 3N1PC 3EYQC 5TDOB 4C56D 4JJ5A 4H1LA 3WJJA 1DR9A 5F1OB 5F6IC 4OQTH 5LVEA 4XBPA 5D7LE 4DVRL 5ISZA 5ACZB 3ZHLA 3FRPG 4KI5C 5D4QA 1Z9SA 3VXOB 4D0DA 2X5PA 2QJDA 4U6TA 5LWYH 2Y9RT 3OL2A 3V5KB 5F9JB 2D31B 4OZHE 4BKLA 1CK0L 3LSOB 3PNWB 4EDWH 2H41A 5IBLC 3MRHA 3M07A 3MUY1 2D7OA 1P6FA 3DROA 1PQZB 1S7QB 4K3DH 5JO5B 4Q7DA 4LASH 4M6AA 1AY1L 1MLCA 3CFCL 4R0LC 1MAJA 4XP5L 3DIFB 4NJ9L 5D1QD 1NGQL 3NA4A 4P23B 1MCPH 1HYSD 4PJFB 4PJGF 4N9OB 4HLZG 3IDNB 4HUUB 3OKYA 5I1JL 2DQHL 5IG7B 2NW3B 5MEQB 1M7XA 1OQOA 5DFWH 3LOWA 1CXLA 4JRWA 1HQ4B 4OLUH 4FFYH 4OFVA 1S5HB 3MXVH 2IFFH 3BEVA 1U9KA 3E6HB 3NFPB 3E3QC 4KAQL 2A6DA 2YPKB 5E2UH 4GW1B 4XWGL 4OBSA 1KJMA 1S8DB 3P0GB 1T22A 2AW2A 3MV8B 3WKNA 3CDYA 3G6AB 3HMWL 1T04B 5DUBA 3D6GA 3TNMA 3BIKB 2CO7B 2FGWL 2FLRT 1NCCH 4Y1AD 5EFIA 5C0RL 1KYOJ 4NNXB 5LGKA 3UC0H 5D1XB 3SDAD 5DJAB 4ONHB 4ODSH 5CIPH 5KANG 4KKAC 4XCEB 4HWBH 4M8QB 4HQQH 3F8UB 5DK2A 1GGBH 1DP0A 4BA8A 5T3ZE 3NN8B 4YO0A 1B3JA 2QHRL 4CAGA 2F58H 4FZ8H 4QXTA 2DJUA 3MGTA 3OXSB 4PJCE 4ELME 5BW7A 5FB8A 1HHGB 1KNOA 1MCWW 1TZGL 3I84A 2JJUA 4JN2A 1B4JH 1HYRC 1UM6H 4FFVC 5SWQA 3VXMA 4S1SL 3WN5A 4PB0H 2HKFH 1U95A 5HGAA 1LK2A 4YHLL 3U0PA 1GOFA 1XMWA 1FH5H 2VN7A 3QIUC 4XPGL 2X44D 4L8DB 1HHIA 4XNUL 4XX1G 1LO5B 5FKAA 1FGNH 1S7WB 1AFVH 1V7NL 3MA7B 1T66D 2NMSA 5ABDE 4Y4KB 1EHNA 3GUTA 2VDLH 4IRSC 1LO0L 2F74B 1LNUA 3MRJB 4PJAA 1A6PA 2AKRB 4RWYH 3H42L 1AXTH 4L1HA 1XF1A 1ZS8B 4LVOC 3QHZL 4MQ7B 5KTEL 4QXWA 4Y19E 4X7TB 3GSOA 1SMOA 1N8ZB 2NY1B 1YZZA 1P4BL 3TNNA 3S8WA 2IG2L 2O61A 5I19H 5I73B 3BOVA 3RWDB 5TFSH 5DDHA 2GJZA 4F7EB 2W0KA 3H9SB 1T89A 3PDOB 4XVSH 5EU7E 3HE7A 4JHWL 1AQKL 5AYUH 1FCGA 5F7DA 3BDYL 3VXSB 5C09E 1YQ2A 3VXNA 2O5XL 4G6KH 5E8EB 1HEZA 5FYJE 4ZNCD 1NC2B 3T1FB 5C1MB 5CBEA 1EPFA 1QFHA 5DS8A 1S7VA 3G6DL 4UOW1 1NEZA 3C60D 4UQ3B 2GY7B 1I8LC 4Y5XC 1JRHI 4OCLC 1I8IB 5HYQA 1A7OL 4HIHA 3D3VA 4Z8FL 4U7MA 4PJ7B 4FQXB 1KIQA 4E5XA 3MRPB 4LCCB 4G8FB 3U0TA 3B2VL 4X6CB 3JUZA 5LCVH 5L6YH 4Q9BA 4OF7A 3MSPA 4XCNB 4G3YL 5I30H 1AHWC 1C5CH 5BRZA 3KPSD 1LD9A 3ARDA 1J88A 3OKOB 3FRPA 2K7PA 2BSSB 1SVZA 1I9EA 4JGUA 3TP4A 4K94C 5INCA 2NY5L 4OZIE 4OI7A 3MGAA 3MNZB 4OCMC 5I74B 4L4VB 3U7YH 4WFHD 3UJJH 4MJ5B 1NBVL 1OPGL 5C0BD 4ZYKB 4PRAB 3HMXH 3RDTB 4O58L 3ROLB 1EZVX 2H26A 5C2BL 4QRRB 3FO2A 4LSRL 3IDXL 3IDYB 3DBXA 3MROB 1WJ3A 1VADA 5JNYA 5J1AA 3MMEA 4N0CD 1QFUL 1QBMH 2GEEA 2AJYH 2X42A 1Z5LB 3KPQB 4PJEB 4NZDA 1J0ZA 5H37H 4PJHA 2PYEE 3LEXB 4GW5A 2N4IA 3LZFH 2YD5A 4JY5H 3HG1A 4N0YH 4B7LA 4P9HC 2XKNA 3PGDB 4OGAC 4M48L 4PY8I 4XCYA 3PWPD 1FE8L 1WVZA 4OD2A 3HS0B 4HS3B 3ZKXB 4RZCA 2YRLA 5HI4D 2EYSA 5E4EB 1OGTA 2XNAB 2W07A 4C54A 3MXWH 4TSBH 1I8MA 1VERA 4JQXC 2Z91A 1OAKL 2HG5A 5C0DA 5GGUB 3BHBB 3ULVD 4QCIB 4XPAL 4F9LC 4FNLL 1VPOL 5DMIL 1AO7A 4GRWE 2OJEB 4PD4K 2OBGA 4FP8H 2ICCA 5H2BA 5MP6L 3DX7B 4YFLI 3OR7B 4LQ1A 2FGZA 4MJ6A 4P3DB 4P5TB 4KWUA 4QXGH 1F4HA 4NGHL 4F7TA 1Y0LA 3IF1B 4PJ5D 3V7AG 3OKLA 5KN5B 1BAFL 4H0HB 1MFEL 4EVNB 3U46A 2MKLC 5MEPA 4QRPE 2EYTA 3NOIA 5C3TA 3O8XA 3CZFB 2NNAA 4P2RB 1XGQA 4JFEE 4OM1L 3RBGA 3QCVL 1AGBB 4DCQA 4H25B 2YBRB 2DJ4A 5F7MC 1WBYA 2VLME 3BZ4B 4CJ0A 5CD3A 3CDGB 4KV5F 5IWLC 3X13B 4TNWK 5IB1B 1EJ6A 4HK0A 1QFOA 4YAQA 5HYIA 3TZVC 1SBBA 1OF2B 3SE8H 3QNZB 3SN6N 3TBSA 3RZCB 1UB6A 4JQVA 4HUKB 1UWGH 4JO4H 4U49A 4ZXBB 1OAQL 3QYCA 4DGVL 2FJGB 3NABH 2VLRB 1F58H 1N4XH 1A5FL 2GJ6D 5CJQL 5IEHA 3T0XA 2V5MA 3KS0J 3WS6C 4QOKB 1YY8B 4RMSA 2FECL 3PWNA 3L3JA 5EN2A 4C56A 4PJIF 4EXKA 1LE9A 3STZA 4NRXB 3I3DA 4U6YA 4CGTA 3T0BA 2AGJH 1MJJA 3MA9H 3HUJB 2IGFL 1BVZA 3RVXC 4DEPC 4GAJH 5L8JB 3OKEA 1A6AA 5E70A 4IJ3C 1J11A 1OAXL 1QVOB 2EH8H 5CILL 2JE8A 1IE5A 4MCZA 4LSTL 3Q6FB 1NKRA 1XIWD 2EDQA 3BAEH 5JLZB 5ACLA 4AEHH 3MR9A 2Z31C 2ICWI 2A83B 3WV0A 2QTEA 3UYRL 2YUZA 1A3LL 3QXVA 3L3OB 5F9WC 3IETB 1I1RA 5TDPA 4YDVB 2GITB 4AEFA 2FX7L 4K7PL 4Z7UA 5DJ6A 5D1QA 3T65A 4XGZB 3RL1A 3DECA 4KH2A 3HLAB 4UIKH 4I18C 1FZJA 1U58A 2Z35B 5I1LA 4WU5A 3WKMH 4HUVA 5ISZE 1BMGA 4IDLA 3U7AA 1TCRB 2CD0A 2P8LA 5KVGL 4KK6D 5EU5B 4O51B 4LL9A 4Z5RA 2DQGL 5FOJA 4ODTH 1IBGL 3EJYC 4L1DA 1HCFX 1R5VB 3LN4A 4PJ9D 2DD8L 3CMOH 2P4AB 3V5DB 5E1HB 1WLHA 4MNQD 3RVWD 2ICEB 4U1HB 1KELL 4QRQA 1LDSA 4MD4B 2GKIA 4FMKA 4Y1AA 3LEYL 2B4CH 1VFBB 4RGNC 3RWJB 1OM3L 4ODHH 3SDAA 2CMRH 2VABA 1U8OA 2J88L 5E2VH 1I7UB 4Q9QH 4Z7VB 5DRXB 4XH2B 4K9EH 4KTDL 5EUOB 1ZLWK 4DKAA 1MRCH 1EO5A 1O0VA 4Y4HD 1DUZB 1PD6A 5GSRA 4DOHE 2X1XR 1SJEB 5FV2A 5AZ2L 5IB2B 2R0LH 3LH2L 1P5VA 5DMKA 4YX2L 5GRVK 4ZFZB 5I8EB 3O6FC 2YPLD 4XPHH 2EH7H 1J10A 5JZ7D 4JPVL 3BWAA 2XWJA 3UTOA 3WNLA 4HJGB 3BD4A 1CGWA 3WNMA 3HNTH 3QI9C 5JIKA 4R4ND 3I9GL 3MOBH 1G84A 3MRNB 5KSBA 3ZE0E 5BQ7B 3GMLA 5GGTA 2CDFA 4Y5YA 1HDMB 3I75A 5I1HL 2BFVH 2VDRH 1FVEB 3B5HA 4M02A 4OAWB 3AMKA 4R4BA 1WFUA 3N1MC 3VGEA 1MHCB 3FN0L 3BP5A 3MRLA 4NRZB 1K2DB 1DDHB 4JM2B 3QIWC 2EDEA 4M6ML 3HNSL 1QSEB 4ZUVA 3GMOA 3VXME 4GRLC 2ITCB 1F8TH 1BD2E 4H88H 1CICD 2Y6SD 4BQ9A 2BSRA 1K3IA 5ITFA 1DQLL 3PV6B 5FDWB 1YJDH 2NPLX 2AXJA 3EHBD 4JPIA 5T3ZL 5IFJB 3CFEA 4NSKB 4CVUA 1YPZA 2AEIT 3F12B 3IRPX 1FSKC 5FM4A 1MHPL 4HLZH 4YUEH 1P4LB 3BUYB 1E4KA 3UTQA 4NYLA 3MOAL 1CG9A 1UACH 2NY0B 3RGVD 4F58L 1XH3B 3WO3B 3R8BB 5MERB 3O4LD 1INDH 1NC4B 2H2SD 4PJAE 1KACB 1OY3B 5HHME 4FXLA 4HS8H 5CJXA 1JGUL 3O4OC 1BX2A 1IQWH 3C60A 4TSCH 4K71C 2MFNA 3BSZL 4U31A 1BVKB 5FKPA 1UZ6E 1QLRB 4PJCB 3MO1A 4HGWB 4F7PB 4M62H 2XXCB 1XGPA 3LS5L 1CD9B 4LSSL 5CFHA 5F88A 1S78C 4WTWA 2AJ3B 1KN4L 3INUH 3AREC 1T7ZA 1IGCL 1MI5E 2YC1A 1G7MA 1AGDB 5EIQA 1B9ZA 3LHPL 5D7JC 2PCPB 3JVGA 1OAYL 2ED9A 4ODWA 5C0JA 2VKXA 4YE4L 3AFLA 3LQZA 4FQIL 3S37X 3EOTL 2M1KA 5B38G 3K3QA 3HZVA 2V9RA 3SDCC 1LP9F 3MLZH 4IEFB 4BYHA 3G6JA 4OD3H 1YECH 4DKFH 3M8OH 4YWGL 1I1AC 2Z4QB 5T3XE 1GL4B 2QADC 4P59L 3ME0A 5HYSB 4ISVA 2MPAH 3D3VE 2XZCL 1IAKA 2YKLL 2XXMB 3UYOD 4OCRH 1YEFH 5DD0L 3FO0H 4DZ8A 2VLKE 1N6UA 2W59A 3JWDC 3MZGB 3BESR 2XICA 3O9WD 4IRZL 4NHUA 4ZMAT 1DQJB 4LU5L 2R0KH 5C6PB 3T4AA 1FAIL 5BS0D 1HHHA 3GSVA 4WNQA 5HVHB 5BRZE 3X3GH 4BFIA 5B3JE 2DM2A 5HYEA 5EPMB 2VL5A 4K2UL 4L5FH 3PWPA 3T3PE 5T1DH 4JHAH 4LEOB 5D2LE 5JHLL 5E8OA 4PR5B 4YDJA 1A2YA 1NAKH 1FLTX 1T83C 1GGIH 1TDQA 1FLRH 3C2AL 5J8OA 4UV4H 1N0LA 3EYQD 4GKSB 4IRJA 3IRZA 3T2OA 3KDMB 2AV1A 2DQDL 3ZT5A 5HHPA 1R24A 4KI5D 2F5AL 4PJHE 2XZQL 5TGBB 1T7WA 3DUUA 3ZSTA 2BOBB 3HG1E 1MVUA 5SWSB 4U1NB 1MCWM 2VAAB 4NZJA 5CSZA 1Z9MA 4XPFL 3B9EA 1YEDB 5IQ7H 3NMEA 5IBLD 2NZIA 3CLEL 4WUKH 2CKBL 3LN9A 3TIEA 3PL6B 1F5WA 3QDMD 1OQXA 4G7YH 2FBOJ 4OZIB 1ZEAL 2EDJA 2SEBB 3FT2B 4PJ5A 4CU8A 1A8JH 1FYTB 3EOAA 3VRIA 4WEBL 3SCMB 2J6EA 1CL7H 4XVTL 4JFXA 1OTSC 4MA1C 4XMLL 4OLZH 4EN3B 1K8IB 4XP4H 5I1AA 3BPOC 3MV9D 2PXYB 1X4ZA 2PR4H 3SKNB 5DA4A 3H7LA 4HHAB 1U8JA 2CKBB 2WLYA 5BVPH 5DHVB 3QWQB 3IU3A 4UTBH 2O5YL 1AO7E 5C07B 1JMZA 1E6JH 1HCVA 4PJDA 1PVHA 4OJFH 4OZ4B 1Q9OA 4FQLL 4DGYH 2DM7A 3LRSA 3B2UC 2GJ6A 2PYFB 2YN5A 3U9UA 2Y07H 3DVGA 1IILE 1AGFA 4E41D 5D8JH 4QTIL 5GQBA 3MREA 1H3PH 1U93A 4B50A 4KKAD 1BOGB 1NANI 1G6RL 4YDIL 3VH8A 2EKSB 1MIEL 3FFDA 1LHZA 2DLFL 5GS0L 1C5BL 1U41A 4WFGD 4J3SA 3HE6A 1NFDB 2KDGA 2HRPH 1GIGL 3P11H 4PLJC 5FCUL 2Q86A 2P24A 1XIWA 4WFEE 4WI4A 3KYNA 4NN7B 4YQXL 1HKLH 2A73B 2EDBA 2CJUL 5ALBL 5DZNA 5IB5A 3EOBA 2GK0B 1B0RB 5T33H 1FFNA 1UJ3B 4MCYA 5A16B 4AIOA 1VSCA 4GRWB 1E4XH 1G6RB 3OXRA 2V5SA 3FB7B 3JV4B 4JDTL 5FYLH 3QIUD 4C56E 3P4LA 4I0PB 4HH8A 3PWJB 1ETZA 4X6FA 3ZLQC 1S7TB 4JPKL 4L8SA 4P23C 3NTCL 3MPCA 2OZ4A 1WBZB 3IFOB 2WINA 3UJTL 1CGSL 1F6FB 3ULUH 4NZUH 4YPGB 3KLDA 4IRSD 4EI5B 2R1YB 2VIRB 4IS6A 4R7DB 3EJZC 3BGMB 2H3NA 3RVTD 1CTNA 1OCWH 4Z7OE 2EIZB 4HF5L 4JFEB 1CLYH 3M1BB 2G60H 1BJ1J 4LQFH 4CBPA 1B2WH 4V2BA 3K7UA 4S1QL 3P0VH 3DMMB 1T6VN 4MNQA 1IT9H 3EGSA 5AZEL 1D5ZA 4WIQA 3MC0A 4XP1L 1I3UA 5FA4A 4KXZI 2R39A 2K1MA 1CCZA 4RAUA 3BH9A 3BO8B 4KPHH 1IM9B 2R4RL 3VD3A 3KPLA 4U1SA 1B4RA 1KJ2L 5D1XC 3P9WB 5TQ0L 5A2IH 2ATKB 1HKFA 1OSZB 3W9EA 1PKOA 3QNXA 1DBKL 1X5XA 3T04D 4Y4HA 5B8CB 5DJXA 1L0YA 4JB9L 4N8CH 5HGBA 1SYVA 4WHTB 4BSVB 3UEZA 4ZAKA 4ODVH 3FQTA 2V7NB 2H45A 2YPLA 1FJ1B 3BH8B 2YWZA 3OKKB 5FYKL 1WIOA 5J7CC 4PLKC 1P7HL 2LAGB 2QSVA 5D5MF 4Y1AE 4H8WL 4PG9A 2IBBA 2I60H 1E27B 1P1ZB 2ADFL 3DJ9A 4F8TA 1MRFL 5IB4A 4LLWA 4D3CL 4XNYH 5F6HI 1UYWH 1LEIA 4GAYA 3GHBL 1KXQE 5IVOA 2EEAA 4D94A 3AUVA 5IV2A 5DJDA 4K7PY 3WEXB 4YZFE 4YFDB 4XBPB 4Y4KC 1H5BA 5EUKB 2VDPH 4ELKB 1A22B 1RHHA 3QRGL 4L3ED 2XRAL 3P4MA 3RNKA 5ETUB 1ZA6B 5DR5L 1AI1L 4NNPL 4WW2F 1CICA 4BKLB 2ZJSH 4P2CG 1QD0A 2R4SL 1SMAA 2X4UA 3DHJA 3PDDA 1JPGA 3PJSA 4Y5VA 2NY1C 2BC4B 1GZQB 1MLBB 5CKAA 2C3XA 5I73C 4RMQA 5DQ9A 1NSNH 4KQ3H 3RGVA 3ULUF 4MNHB 5GRYA 2JJTC 1KB5H 5I1KL 2GYSA 3Q5OA 5CEYA 3O4LA 1MFDL 4BZ1L 2ENYA 2G5BA 2AJUH 3I6GA 2CRZA 2VITB 4KK5D 3O41A 4UDUA 2JF1A 4LSVL 4TNWF 2L7JA 1ZLWH 4Y88A 3V0WH 5A2KH 4KUZL 3IGAB 4M7LH 5I71B 1U8HA 2ZKHH 3OJDA 3QQ3B 3L5HA 3FO9A 3U36B 4MB3A 5CUSH 2RAMA 2R23B 3DV6A 1UH3A 3Q48A 2IQ9L 1KJMB 9CGTA 3VXUD 3VW3L 5I66A 4FQXC 4KHTH 2X4SB 4LCCC 7CGTA 3RWEB 3G08A 5EFIB 3ZTJG 2CSPA 1BIIA 5DEGB 5EO0A 1ZLSH 5JDSA 4X4MA 4HUWB 3AAZA 1FORH 2DI7A 2JB6A 4JRXD 4P5MB 3RUGF 3WDJA 1I9IH 3T4YA 1YQVL 5DK2B 1AJ7L 4O2EB 5K33A 4FHBD 4KKCC 4DVBB 2ITDA 1GAFH 5ERWA 5I74C 5I16B 1I7ZA 3MFGB 5F70A 2RB8A 5BVJA 5FB8B 3RDTC 2IMMA 1KNOB 4Z78A 2XOTA 3GRWH 4XZUB 2BY1A 1WZ1H 2OP4L 4JN2B 1YMME 3VRJA 3IDYC 3EDKA 4PRNA 3FQUA 4R6UA 5F71A 4ZUWA 1RUQH 1KOAA 3O9WA 1TJHL 1BD2B 4QKXB 3WN5B 3R8QA 5HGAB 1LK2B 5FYJU 2DM3A 3KPSE 2DYPD 2NY5C 1F02I 3D39B 3I6KB 2DQFB 3VJ6A 1HINL 2EC9U 3TZVD 1CGTA 5KVFH 2AK1L 4WFHE 4AIZB 5T1MA 3G6JE 5L7XL 3IDMA 1GYAA 3WFCL 5C0BE 1NGWB 1A0QL 4W4OA 1S9XA 2B0SH 3SQOL 3QUML 3C6SB 1X5GA 3OR6B 4PUBL 4Y89A 1Y6MR 4FFWD 3ZKXC 2HJKA 3TPUB 1KCVH 4KQ4L 4AEIH 3X11A 4LSUL 5E4EC 4Z0XB 5TE4L 2APBA 2P42B 4H5SB 1V7ML 1IVLA 3RVXD 4J1UA 2MCPL 4OCWL 1A1OA 1YC7A 2DI8A 5J89A 3BVNA 3QUMB 4G7VL 1F4YH 1MI5B 5ICZB 4DKDC 3DXAA 1UXWA 3LEVH 1JCKA 5C0NC 1LVEA 1S9YA 4OLYH 4DUXA 1GC1L 3C5ZB 2Z31D 3MLRH 2A9NH 4DUVA 5F7EH 4KHXH 4R0LA 3QDMA 4M93B 1HILA 5DS8B 3VFPB 1S7VB 5B3NA 2AEQL 3OZ9L 2OK0H 3H9ZA 1JNHA 4NCDA 3QAZB 2V5YA 4CVWA 5B39G 4P5TC 5L88H 3QXDB 3TBWB 5AAWA 3G04B 1XR8B 3Q5TA 4IIQB 2FSEB 3T2PA 3MV9A 1MCCA 1HH9B 5E94A 1DCLA 5L8LB 5K9QG 4N68A 2OR7A 2VLKB 2GJJA 1N3NA 1A7QL 2IADA 4DGIL 1J0IA 5GZOD 1MJ8H 1G9NL 5HHOA 4S1RH 5HHVH 2ICWB 1G7IA 1YNKH 4WO4C 4K8RH 1PFCA 3TBVB 3U0WL 1U92A 4F3FA 5LKNA 3L1OH 1XF4A 4QHNA 5FUCE 1X5LA 3RZCC 4GG6A 1EEYB 4ZXBC 4PJ5E 5D2LB 1ADQH 1B0WA 1A14L 4RGND 1Q0XL 2DQTH 3D9AL 4FQHB 3ILPB 3MLPA 4NQVA 1ND0A 1YNTA 3HNVH 4M7ZB 3ZKNC 1MREH 3QG6A 1R3HB 5IKCA 1UWXK 3HAEG 1JNLL 4HC1A 2B1AH 1GXEA 2FZ3A 3MMEB 4HJ0C 5GRJL 4J3UA 2F54E 1A21A 1FNGB 3L3DA 3VMPA 1CLOH 5EBLA 2COQA 2FD6L 5FHBL 2Q6WA 4P9ML 3MRIA 5CEZD 4UU9B 1Q0YL 1QPXA 2X2YA 5DJ0B 4LBEA 1ZHLA 3PDGA 4M7KL 5DRWB 3BZEA 3O6FD 3DETC 2WMPA 3HG1B 1LDPL 1NCWH 4HGKC 2UWEA 4FXKB 3A6BH 3CXDH 4J6RH 2GJ6E 3F7YA 5A1AA 2FJFA 4LHUB 5HJ3B 1MCKA 3V4VL 1RJLB 5TF1H 2F53E 1EVUA 2CIKB 2H32H 3QIUA 3LKOB 5IVXA 1TJGH 4ZOEA 4MWFA 4MXQC 3WXWH 5K9JH 4MJ4A 4JZOB 1X5YA 3TJEH 1IKFL 1P2CA 5GGSY 2VR4A 2GSGA 2P48B 4MJIB 4OLVL 4E42B 4WI6A 4IRSA 2VZTA 1B0GA 4PTTB 1JF5A 2ZUYA 3HCVB 2HG5B 3U2SA 1D9KB 3VFMB 5C0DB 5JR1L 4MB4A 1ZAGA 1A3RH 5IM7A 3MBXL 3VE0B 1AXSB 3NACL 1H15B 3GSNA 5AG8A 1F45A 4N0FA 3QIWD 3SOBL 4MQSB 1JGDA 2HJLA 4R4FH 4GRLD 1MAML 1CDIA 4UMGA 4G9FD 1TETL 5DD1H 4D8PA 3QJFB 3ELAT 3NZHL 3RNQB 1NMAH 2KQMA 3WIIL 1Y0LB 3TCLA 5A40E 5KW9L 4HT1L 1IC4H 1MEXL 1NGZB 5H35A 4WHYG 3WHXA 1YEGL 2ADGA 4HIIB 3THML 4G5ZL 1IGYB 3P73A 5DJ2A 1E28B 5JORB 1CF8H 4DCQB 4XPBH 3CFBA 3MRCB 1MHHB 1U91B 1EDQA 3GIVB 4Y5XA 4UUJB 5CD3B 4PTUA 4PGBA 5J57B 2AEWA 4MNQE 3MJ7A 4DAGH 4I0KA 4JY6A 4MDJB 3MLUL 3V6OC 1AQDB 3FO1A 1S78D 1UB6B 2AABH 1N5AB 3ZHDA 3ARED 1D5BB 1EGJH 1UWEL 3RU8H 3NPSB 5D7JD 3RZWA 3MLTA 1AHWA 1TPXB 3OWEA 1KUMA 5DUML 3IFNH 1I1CA 5EN2B 8CGTA 2OQJB 1JK8B 3H3BC 3K4DA 4U6YB 3TBYB 1UXSB 2BVTA 3SDCD 2P47B 3BFOA 1C1EH 4L3EA 1OOAA 3PWUB 4DTGL 3H3PH 4CL7A 2QQNH 5CHNA 3ZT7A 2EDWA 5DK0B 2YPLE 3TA3B 3UO1H 1I1AD 1A6AB 4GMTL 5ITBH 2OXGA 1DLHA 1ES0A 2QADD 2VLJB 2W65A 3K2MC 3QPXH 5JXED 4JM2C 4I5BA 3EYFB 1HHKB 4PJXA 5EZLA 3X12A 4IHOB 3EYVA 3QJHA 3RWHB 2ARJA 3EYOB 1U0QA 4Z0BH 3LD8B 4JFQA 4JPWL 1P7KB 4QT5A 3DVFA 1MUJA 1U6AH 3H2WA 4MNGA 5C0AD 5B22A 5E9DE 4N8VB 4QHMA 3WFBL 5B39A 5F96H 4K23H 1CDJA 3AMLA 4DFIA 3SKUD 1SEBB 4XVUC 5IIEB 1NGYA 2IALB 1U58B 3O6LL 2NY0C 3F7RA 5I1LB 5D2NB 4M5YH 5L2KD 3JV0A 3ABZA 3GFUA 1GRWA 2FX8L 1FRGL 2MHAB 2BSED 2VDNL 12E8L 1CI5A 1BEYH 1KTKE 3CPLA 3FB6B 2H8PB 5BO1H 1Z3GH 3G5VA 1MF2H 3RHWK 3VFUA 3NFSL 5JQ6H 4HZLB 2IAMB 1MRDH 1RULH 4JQXA 4LCYA 3VXUA 4MB5A 3GI8H 1QSZA 3NFNB 1VHPA 4OIAA 3HI6H 1MCEA 2ESVE 1CR9L 3EO9H 2HKHL 3NZ8A 5JMRA 4F9LA 1WEJH 2RBLA 4HPOL 5IMOB 3VFSB 3MRMA 1G6VK 3DRTB 1FN4A 3O4LE 4Z18A 3DSFH 3HAEA 4X5XB 5BV7H 4JN1L 2W9EH 5GISL 1KFAL 3DGGA 1HQRB 1J1OH 3U48A 4RISL 1IEAA 1KJVB 5T1KB 5EOCH 5FGCB 4QTHA 1QACA 1RZIB 1YN7B 1BBDL 5HGHA 4BH7A 1JMXA 1U8NA 2EECA 5DMKB 5DZOA 2Q8BL 5FUZL 3I6LD 4NQSA 3DI2B 5KVMC 4Z6AT 4NGHH 2CLZA 3WFDH 3BP4A 4ZSOA 1NGXA 3FT3A 4U1MB 4X4YA 4JFFD 1CZ8H 5ESAA 1KGCD 2FBJL 2DYPA 1PLGH 4NZTL 2F8OA 3N85L 5IWLA 1TZHB 2VDOL 4HUXA 4OKVA 1QA9B 4UDTB 3KPRD 3KLAA 3E0GA 5HVHC 1NLDH 5DRNB 3TZVA 1K4DB 2PTTA 3GKWH 3QCTL 4Y5YB 1X4YA 1CD0A 2A77L 2DTMH 2YUVA 5EU7C 2IAND 2FATH 2PNDA 1MHEA 2UUDK 2BVPB 1CT8B 5EBMA 1IAOA 1X7QB 3DARA 2A9ML 1R3JA 4M4RA 1MAKA 4RAVA 4HJJL 4AH2B 1U3ZA 3GMOB 4D0CB 1W0VA 3WIFA 4KV5E 3FB8B 2B8OT 2X4QA 5BS0E 2EYRA 2CRMA 2VR9A 5E00A 3GGWA 1JHTA 3FTGA 5MEOA 4PLJD 3ET9F 4JM4H 1IAIH 5I1IL 5JMOC 1Z9LA 1CG9B 3RWCA 1M6OA 1OAZH 2Z31A 1U8KA 1QFWM 5HVGB 5JIIA 4XBEL 1MNUL 4PJIE 2BERA 5LGHH 1WCBA 1FPTL 3NA9L 3QULA 4GKOA 2X4RB 3GI9L 3CVHB 3W39A 3PL6C 2GTWA 4D0BA 3BKCH 5E2WH 4NKDB 1JPFA 4ZFFA 1XGYL 1DJSA 5C0GA 5EIIB 4P23D 4KI5E 3SCMC 5DEZA 4EN3C 1BPVA 3WIHL 3QT2A 1YMMB 4MS8C 4ODXA 3VGGA 2PXYC 4LLMA 1L7IL 4HLJA 4U1GB 1QFWI 3I2CL 4WHCA 3V6ZA 3VFWA 2DS4A 3KPSB 3BKML 4ODWB 1V3MA 4JQIH 1D5XB 1OL0A 1IBGH 2RCSL 2JCCA 5BMFL 4R3SA 2QQQA 3QDME 4JFZH 5EOQH 1E4WL 4JFDA 3NIFF 4R8WL 4JO2L 2JB5H 3UPRB 3MV8D 4I8DA 1WITA 4OTXL 4LPXA 5EBWA 5JW4Q 5C0BB 4XP9L 4OFYD 3NIDF 1ZLVK 3L3KA 1JYWA 1J7VR 4AJ0A 2RR3A 1WC7B 3TO2B 3MV9E 3HHRB 2IQAA 1INQA 1KN2H 5D1XD 1AD9B 3WNPA 4BUGA 1JPTH 4DN3H 5DGRA 4JG1H 4RMRA 4O4YH 2FB4H 2P8PA 1EVTC 1RHFA 4H20L 1MFAL 5GS2H 1SJHA 3IDUA 3OG6B 1H0DA 2W92A 4M5ZH 4R90H 4WNQB 3O6FA 4WRLA 3BPNB 1IKNC 1PKQA 3MLVH 4RA0C 5F89A 4NN7C 3W82A 1W72H 3IFLH 2DQCL 2VL5B 4X6EA 4AL8H 3EZ8A 2BHUA 4PLKD 3FN3A 4GG6E 4FQ2L 3O45A 1UJ3C 4U6VH 1QQDA 1EAJA 3MNVB 3CFJB 4E41E 4NBYB 1NJ9B 2FJHB 2VXQL 5GS0C 5CBAA 5ADOH 1SY6L 4OLWH 2D3VA 2WWMC 4I0PC 4EUPA 4YXHH 3L7FB 3KPMA 1I7TB 3DOSA 4PBWD 1NL0L 4WFGE 2Y25A 3V5HA 4HG4K 3RTQB 4EOWL 4L3CA 4LAQH 3HC4H 4M00A 4Y4KD 1MOEA 5HHPB 3O81A 1NDGB 4EI5C 3V8OA 3WFEH 3QIWA 1VGEH 4LARL 1MVUB 1DTUA 2UWEE 4GRLA 5MENA 3JTTB 4UB0H 3FB5A 2E27L 3V0AC 1HZHL 4TVPL 4G9FA 3IKCA 2R69H 3DMMC 4OZGF 1KG0A 3FQNA 3GSXB 1NFIB 2EDHA 5F3HB 3BGAA 1T1ZB 3EW3B 5IVXE 2VZUA 2BJML 2NY1D 4XXDA 1IEBB 2OSLA 4KRMB 2PTVA 5ICYA 5E8NA 4DFHA 2IBZX 1JNNL 5IFHH 5ICXB 1JBJA 1U3HD 1UWXH 4LAJH 3VXSD 4KROC 4I9WD 4KKNA 3VFOA 1S7XA 2CLRA 5ESQA 3ETBF 5GRUH 4X6DA 5B8CC 1JWMB 2F54B 3MRDB 1U8JB 1VDGA 1TJIL 1EK3A 3WHE0 2CPCA 1MCOH 4KZDH 4G8EB 3ZT6A 1A7RL 2GUOB 1GGYA 2X1PA 2X9YA 5EWIL 4YHMH 3O6MH 1VKXA 4AT6A 5E99H 4JY4B 4GRMA 2CDGB 5GJSH 3AREA 3CCHB 3QUXB 4FQXD 4JE4B 2I9TA 5HHXH 5ELIA 1KENH 1NCNA 3AB0B 4S10A 3QQ9C 5D7JA 2F53B 3CJJA 3O2VH 1QYGH 5EH1A 1AKJA 4U6HB 1A6TB 3MZTA 3MREB 4OQTL 4R96B 3SDCA 3TVMD 4UIMA 4FQIH 3FFDB 2N1KA 1I1AA 5DXWA 5LWYL 2Q76B 4KKCD 5TQ2H 1FVDA 5JXEA 4L4VD 4H8WC 4U3XA 4JVPA 2C4FU 2Q86B 2P24B 3R1GH 3RDTD 4MJ2A 4QRTA 1YEJH 4EDWL 1A1NA 4QRRD 5IB5B 2F19H 1CL7I 4M7LT 4RDQG 1FFNB 1MJUH 4CADB 4K3DL 2VQ1B 3FCTA 3S35X 2A6IA 4WU7B 4LASL 5C0AA 1R5WA 4XNMB 3IDIA 1LEGA 1UJTA 4NRYB 5MHSE 1MCLA 5IB3A 4ZOAA 2HFFA 3MFFA 2PW2A 5KSVA 1FFQA 1MCPL 4YHIA 1ETZB 4X6FB 3G5ZB 5L2KA 4L4TB 3C8KB 1F3RB 2J4WH 4ETQB 4L8SB 5DJZB 4L3EE 3LPWA 5DI8A 3VFGH 3CZJA 4R2GD 2LVCA 4OLUL 4IMLA 3KYAA 3BEWA 4FFYL 4IS6B 3MXVL 2IFFL 4F33B 1T83A 2WIIA 4FTVB 1PG7W 3RWFB 1PG7X 4PJXE 5DD6A 3SKJH 4PJ9B 1R0AH 3KPTA 1TVBA 5I71C 5E2UL 1HH6B 4RFEB 4D9RD 5J11B 3D2UB 5FEBA 4MNQB 3DX8A 3JBG7 4EDXA 4MAYD 1KTDA 5DMGC 5FA4B 3SPVA 2GK2A 1NCCL 3EUUA 5D7IA 4OZFA 4M6NH 1F90H 3UC0L 4YDLB 4OV5A 4M3KB 4X0KA 4ERSH 1HE7A 2VYRE 4ODSL 1XF5A 1BECA 1T1YB 3GB7B 1FO0A 4HWBL 5C0ND 4HQQL 1YA5A 3HI5H 1NBYA 1DN0A 1NBZB 4X9HA 4FZ8L 1F2XK 2XWTB 1Q9LB 1RU9H 2YHGA 2R2BA 1QR1B 1HI6A 3D0LA 1S5IH 3VXQA 3KPOA 4X5WB 1CLCA 1B4JL 1KCLA 1UM6L 2EC8A 3BX7C 4ZFOL 2P5EE 3VXUE 3VXPB 5CIPB 4PB0L 2HKFL 3E8UH 4JFFA 4X7DC 2JJVA 5GZNC 1FH5L 3WN5C 2BMKA 2L4OA 5IEKA 3WE6A 2V17H 1PEWA 4LLWB 2IFGA 1QBAA 3QWRD 3KPRA 4LSDA 4JRXE 5E9DB 1IGML 4GKNA 3BZFA 1FGNL 3NH7H 1AFVL 3D18B 2O5YH 2IANA 5DJDB 4NZRH 3WS3A 1HNGA 1L7TH 4ZFOB 1BF8A 4WO4D 1ZWIA 1FNAA 1XEDA 1MWAH 2HVJB 5BOZG 1ZLUK 5IHZA 5F1IA 2XQBH 4RWYL 3P0YH 1AXTL 2DL9A 4ZXBD 4I4WA 3TT3H 2VLRD 3O11B 4Z7WF 4GAGH 4HEPG 4WFFD 2MKWA 3DRQA 4ZSOE 1CICB 4QOKD 3VRLF 3ZKND 2IJ0C 4NQDB 1BGXH 5TDOA 5EZIH 1FZOB 1JPGB 1IFHH 4HJ0D 1GOGA 5I19L 4Y5VB 3VXOA 5TFSL 4HIJB 2ESVB 5HDOA 4XVSL 5DQ9B 5AYUL 3V5KA 5F9JA 2D31A 3RGVB 1CGXA 4QEGA 3N1FC 3LSOA 4MGXA 3PNWA 3O4LB 4G6KL 1BBJB 3QUYB 4U33A 1KIRB 4Z7QE 3I6GB 3C5ZC 1K9TA 1PQZA 1S7QA 2FLBT 4JKMA 2A74B 4RGMB 1S7UB 4M93C 1KB9J 5CCKH 4MXQD 4QYOB 1LWRA 3OJDB 1RSFA 3FO9B 4P23A 3ZO0A 3QAZC 4PJFA 4IIQC 4G6AC 3IDNA 4HIEA 4HUUA 2B1HH 1MSPA 5IG7A 2NW3A 3U4BL 5MEQA 2R56L 4UOW0 1PAMA 1Z0NA 4JKWA 1HQ4A 1NCAH 3BW9B 5LCVL 3RWGB 5L6YL 1S5HA 3CSBA 3G08B 3ARZA 3E6HA 3NFPA 5I30L 2G9HB 1C5CL 1X6LA 4GLRI 2XA3A 5JDSB 2BVQB 1GJIA 2YPKA 4GW1A 3T09A 1S8DA 4LCUB 2ID5A 3MV8A 3OX8B 4ACPA 4Q9RH 1T04A 3U7YL 3UJJL 4OFYA 2P44B 3HMXL 3W5NA 1P53A 4KJYB 4N90D 2WZPD 4NNXA 5BVJB 2LU7A 5D1XA 3SDXF 3PV7A 3EJJX 4ONHA 4M7ZC 1QBML 3QDJE 4XCEA 4M8QA 5HGGS 2AJYL 1G9NC 1PEZA 4G9DB 3NN8A 25C8H 5J13B 5CJ5A 4WJ5B 5L9DH 1HWGB 1SHMA 4TNVF 5BS0B 2VAJA 1T2XA 3D85D 4LLUB 3LZFL 3C8HA 1L9NA 1HHGA 4JY5L 3S97C 4QHKI 4N0YL 1Z9OA 5F7NC 2V5RA 3X17A 3MLWH 5HVWA 2HJFB 3ALXA 4K3JH 5T1MB 4RGNE 3LY6A 3RHWF 5ID1B 4PJIB 4UQ2B 1XFPA 2YSSB 1RZFH 4KGJA 3AC0A 2I5YH 4Y8AA 3DVNA 2DBLH 2IPUK 1LO5A 4Z9KB 4HXBH 1S7WA 3MA7A 3MXWL 4TSBL 4N0UA 4NM4H 4Y4KA 3ULSB 5CEZE 3ZDZF 1FG2B 4PP2B 2BRRH 2CUIA 3MRJA 3QWOB 4J1UB 3H9HB 4LF3A 1D9KC 2AKRA 1DFBH 1PKQE 4MSWB 1ZS8A 1P4IH 3P2TA 5F9OH 3Q2CA 3C09B 4MQ7A 4LPCA 4JM2D 4NQEB 4X7TA 4FP8L 1R3LB 1S9YB 4PP1C 1T4KB 1QSED 3RI5K 1N8ZA 4KMTH 4S0SD 4OCYH 1TIUA 1NQBA 4PBVC 3RWDA 1BQHB 3L5XH 4QXGL 3UPAA 4F7EA 2JJTA 1VCAA 3IXAB 3H9SA 3PDOA 4G8IB 2CDEB 3VXSA 3SGEH 4XVUD 1TVHB 1S3KH 5E03A 1NC2A 3T1FA 5FK9B 3DYOA 1EO7A 3G5XB 4TTDC 1JZ8A 1UZ8B 2XT1B 1KIPB 5T3ZD 2HYMA 4UQ3A 1QSVA 4G9FE 3AY4A 4QNPF 3SE8L 4G8GD 2I27N 1X44A 4JO4