5EN2B

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSIGDRVSITCKASQNVGSAVAWYQQKPGQSPKLLIYSASNRYTGVPDRFIGSESGTDFTLTISNMQSEDLADYFCQQYSSYPLAFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GD01 heavy chain
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
total genus 55
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2B01
5D7IA 3CDGA 5DSCA 2OCFD 4X5WA 3D25B 5D7LA 1N0LA 2X4QA 3VDAA 3GMQA 4XXDB 1KB5A 3O3EB 2BHZA 1Q1JH 4PP1C 4U1NB 4U1HA 1B0WA 2X4OB 1P6AB 1FC2D 3MZTA 4X7EC 1HHKA 4BZ2L 1JGEA 5D2NE 2IG2H 3OR6B 1ES0B 3QEQA 2L4OA 3M17A 2I60H 5HHXH 4HUXB 1S8DA 3BSZL 1FLTX 5JNYA 1U9KA 3FB8A 1JYNA 4M62L 2DL9A 3ARDB 4ZSOE 3VXRE 4BFBD 1XGTB 1NJ9A 1OB1A 5ISZD 5F1OB 4KTYA 3MRQA 1NGZA 1Q8MA 4M3KB 3S4SG 3M8OH 2V7HA 1LILA 4KDVA 2HH0L 4PJEE 4NNPL 4WW2B 3PDDA 1A9BB 1YQ2A 4EUPB 2A6KA 4GOSA 3QZWB 4YDIH 5J12B 3P3YA 3QA3A 2HRPH 1OSPH 3P30H 4MJ2A 4KTEL 5J11C 2PXYB 5IGXL 4DVRL 3MRCA 3G08B 1FV1A 3UTSE 4N0UB 1FH5L 4G80B 1ZVYA 5K9OB 5DHVA 3JTSB 5C07A 4HJGB 3ULUE 3GMPB 5D9SA 1I3GL 3S7GA 1OSZB 1ZHNA 1JGDB 1XH3B 3LQZA 2AJ3B 5D5MB 5CP7B 1NEZG 3UJJH 1BFSA 4OAWA 1RZKC 1ZGLA 4DUXA 4JPKL 1IBGL 1JZ6A 1YMMA 5KVMC 2DIJA 4PRAA 2AS5M 3ECBA 3MLUH 4EJ1C 3IS1X 3WDIA 4AENB 4I77L 4PJXF 1WCBA 3HI1A 2CK0L 2X70B 4LEXH 5EDXA 1CFSB 3LDBC 2XWJA 1BVKA 1T80A 5F8RC 3W11C 5EN2B 1LE9B 12E8L 3HZVA 4M7LT 15C8H 5E1HB 4IMLA 5DJZA 3RUGE 3BKMH 1P7KA 4N8CL 3V4VH 3RVTD 1A3QA 1J10A 2GCYB 1ZLSH 3IDYB 1WICA 2XN9B 5C0IB 4CDHA 2QHRH 1MCWW 5HGDB 1QRNE 2JJSA 4ZTOL 3FRPA 1VSCA 4JM2F 4YAQB 4F2MA 3MOAL 4UOW0 1I7UB 4PJHA 3GUTB 4JJHA 1PY9A 3MUHL 3WFHB 2F19L 2W07A 2RIKA 3RRQA 4IIQA 2VDML 1R5WB 3PWPA 3S9DB 4QHMB 3KPSB 3B2VL 4PJ8B 4MAYD 2XWTA 3ZT6A 3C8KB 3NGBB 5FYKE 3TBVA 1NANH 3S5LG 1DQQA 1MJ8H 4XP5H 3MSPA 1KIQA 1Q94A 4P3DB 4JO2H 4P3CL 4FQPA 3BPOB 4LQFH 3BPLC 2MPAL 1RK1A 2H1PH 4QTIL 3GKZA 5IVOA 1LO4H 4F7MA 5D70H 3K8MA 3OXSB 4NQXA 4GW4B 3O3UN 4FFWD 4ISVB 1MQ8A 32C2B 5KSVB 1GGBL 4ODXA 1JGVL 5D7SL 4GKNA 1YEEL 5E8EA 1AGDA 3DETC 5I76A 1DL7H 5DJCB 1CGUA 5EBWB 3QDME 4YBLC 4OM1L 4ZUUB 5LQBL 2IANB 3WJLC 1JZ3A 2AK1H 3QSKB 4QRRE 1G7MB 3DSFH 3MLSH 4PV9A 4CRPA 4U0RB 2JK5B 3D2UA 4BKLB 3AAZA 3VRJB 1BQSA 4ETYA 4J7RA 1CXIA 5F6IC 2YKLL 3MA9H 4I5BB 2KDGA 2H32H 4TPRL 3FZUD 3VD9A 4Y5VA 4LLMB 5GS0H 2GJZB 3CNKA 4MNHB 3WFBL 1KJ2L 4LCIH 5IVXE 3TH2T 1VHPA 2BERA 4WEUD 4YH6A 3MREA 3QUXB 4S1SH 3NFNB 1WWWX 4WI3A 4I3SH 1UGNA 2AK4D 4KQ3H 3VW3H 4X5XA 5I73C 3F6LA 2Z4QA 4OGXH 2NY4B 1KIRA 4WUKH 4H8WC 5IMOB 1MELA 4M3JA 3FONA 5IUSA 4MD5B 5KN5A 2BNRE 2G75B 3F62A 4R26L 4JN2A 3SDXB 2ADFL 2AGJH 4U6HB 4MAUL 4IHOA 1RU9H 5C09D 2JELL 4CADB 1T6WA 5EZOH 5EU6A 5FKPA 5BOZG 2AEPL 1B4JH 2SEBB 3L9RB 5JW3H 4UINL 4OCLC 5IV2B 1YNLL 2DOCA 4LLUB 2LE9A 4LLQA 1OF2B 4ZO9A 1XFPA 3O8XD 4I0PB 4NHCL 1ND0A 3VG0H 3L3JA 4XC3L 1W8OA 5TDPA 4ZD3L 4N0YL 2Z0BA 3VMOA 2FATL 2HT3D 5FKAA 2BVEA 5GHWL 1PSKL 1U8LB 1EJOL 1R5VB 1MRDL 5KJRH 1QEWB 4Q9QH 3UTTB 3WFDH 2X05A 4Y19D 2XT1B 2AI0H 3L5WA 3UDWC 5L8JB 2C1PA 5D2NA 3FTGA 3PE9A 3D25A 3IAGC 1OP5H 1MVUB 1RJYB 3ARGC 2VLJE 5C86A 3O3EA 2AP2A 4HWEH 2X4OA 4CNIB 2F53B 2DQDL 2ZSVB 4XRCA 1X5JA 4LARL 5FUOL 3OR6A 1ZS8A 2HT4C 3QNYA 2BSTB 4HUXA 3B6SA 1GAFL 2HJLA 3IJSB 3MACL 4NZUH 1DZBA 4PJEA 3DYMA 2O5YH 1SM3L 3MV8D 3ARDA 4OF5A 3NCJL 1SYSB 2ZUVA 3KYNB 1MCKA 5C7XL 2ICES 4WW2A 4PGJA 3VA6A 2QSVA 3P9WB 3QZWA 1MCHA 1OLZA 5E24E 2WINA 4OB5H 4UT6L 2YPLD 2R23B 4RGNC 3LPWA 2VRAA 1FJ1B 4DEPB 2PXYA 4XCFL 4HH9B 3RGHA 3KPOB 4N0UA 3BP5B 4YNYA 2Y7QA 1UXWA 4U6YA 3BQUD 4QHLB 3JTSA 2R1WB 4YXLH 4HJGA 5KTEH 3QI9B 3GMPA 3HE6B 3MOBL 3TCLA 1OSZA 5CD5C 1XH3A 2Z93B 2AJ3A 3QIUC 4RMUA 4FQ1H 5CP7A 4QO1A 2VR9A 4JG1H 1KELL 1YYMH 4OD1H 4HHAB 1D5MB 3LEVL 1ODAA 4Y4KC 3DROB 4AENA 5T1DL 4OD2A 3ILPA 3RL1B 3WJJC 2X70A 3MR9A 5T1KD 3VE0B 1CFSA 4LVOB 1OP5K 3LEXA 5FYKU 4Y4HD 5EN2A 4YHKL 1LE9A 4KPHH 1YN7B 4YQXL 4PRIE 5F88B 3VXNB 1NCWL 2FRGP 2EXYC 4XBEH 4ORGB 1IVLA 3VGGA 2KQMA 4XNQB 1F90L 4HAFA 1QO3B 5JDJA 2GCYA 4WDIB 3SO3B 2XACC 3DIFA 4QGYA 2ZNXA 2EDWA 4WI8A 4ERSH 4P2QD 4UV7H 1G0YR 1DBMH 5DXWA 3U0WH 1PQZB 1S7TB 4R6UA 3R1GH 1R5WA 4WFHE 1AY1H 3MJ8A 2ARJB 4QHMA 3MRMA 5I6XC 4PJ8A 4XHQA 2JB5H 1BJ1J 5FGCB 3QIWB 3VFVA 1FNLA 3MFGB 4JY6A 3Q6FB 3LD8B 3LH2H 4XTRD 3EYQD 2E7LC 4P3DA 1DQDH 3NH7L 1FNEB 1WIOA 4M93B 3S88L 2VERN 4LU5H 4JDTH 2YD5A 3ALWA 2YPVL 4O4YL 1XZ0B 3G04B 3OXSA 4IRJC 2H41A 4PJXB 3D3VD 1IGFL 3WS6C 1NC2D 4KWUA 3VGAC 4ISVA 4I2XB 4R7NA 1I7TB 1YEFH 32C2A 4Y1AD 2GHWB 5KSVA 1OAUL 3WLBB 3HS0B 2I24N 3P40A 4QRRA 3DHJA 3WUWB 5IB4A 2C4FT 1BVLB 4LCWB 5DJCA 3OKKB 5EBWA 1BGXH 2Z8SA 4ZUUA 1ZLVH 2IANA 2EC9T 2WBJC 1N2RA 3FMGH 4OUUB 2PO6B 2EO1A 1NCDL 1WQVT 4RDQF 1PEZA 1G7MA 2C5DC 4JM2B 4U1KA 2JK5A 4ETQB 4BKLA 4YEEA 3VRJA 3NABH 5AUMB 4I0KA 3TT3L 1A21A 1UQSB 3E1F1 4I5BA 2O5XH 1LO0H 2BP3A 4LAJH 4H1LA 4JFZH 2GJZA 2OYPA 2FGWH 3TVMD 1ZANL 4MNHA 3STZA 2CLZB 1VCAA 1I3RB 3QUXA 3NFNA 2OR9L 4XPTH 5C0AE 3F6IA 4P5MB 5GRJH 5H94B 3HAEH 4HCRH 1Q0XL 4YBQD 4WNQB 2HFGH 5F7DB 1CBVH 3SDXA 3K2UH 4U6HA 4X80H 4CKVX 2FX8L 5JHDB 4GAFB 2YC1B 4CADA 5CBAB 1L0QA 2SEBA 1DUYA 1Q0YL 4LVHB 3MNVB 3L5XL 3S98A 4LLUA 1CFVL 1JMZA 4ODVL 4O02L 4JFPB 1E4WL 3V4UL 2AVGA 4M7KL 4L4VB 3BN3B 3QULB 4R4BB 2EE9A 4UNVA 5I8EB 1F4WH 2DF3A 4O2CB 4UT9L 3GSNL 4JG0H 1QEWA 4D94A 1U8JB 5D1QC 2VLJA 3ILQD 3UTTA 3WFEL 5AZ2H 4CVZB 3IXAB 4CGTA 1BEYH 3VI4F 4ZAKC 4ZO6A 4G8GB 2QQNH 5C0CB 1MVUA 1RJYA 3FO0H 1IKNC 3ZYJA 4NUGH 4NC1C 1A7OL 3MNZB 3V5HA 1WZ1L 1BJMA 3Q48A 4GSDH 2ZSVA 4Q7DA 1ZLWK 3GBML 3SGJC 4CMMB 4C56B 1HHGB 4P57A 3GRWL 4KY1H 4S2SB 1KJMB 4JRXB 3D0VB 2N4IA 1RD6A 1UACH 2J6EL 3FHAA 5CP3A 4ODTL 3SDYL 3QPXL 1A7QH 2GK0B 2PYFB 1A14H 1NMCC 1BWWA 2W9EH 5ESQB 3OV6A 1SYSA 3PJSA 1WTGT 2HFFA 3KYNA 3LQAC 4FFWC 4YPJA 1A6TA 1RZFH 5JOFB 4O58L 4KROB 4WTZA 2R23A 5B22A 4KDWA 3SJVE 4EN3B 3WFCH 2GJ6E 3HNVL 3TWCH 2B1AL 1BZQK 2LAGB 3FHQA 1IGIL 3ZKNC 3BZDA 4E41D 4M61A 1G6RA 5IBLC 4QHLA 2IGFH 4XGZB 3FB5B 4AMKH 3RPKA 2R1WA 3SKNB 1AGBB 3HE6A 1DEEB 3RX7A 1BFVL 2Z93A 3D39D 3L5JA 4X9GA 4CN4A 1IILE 5IW6B 3QWOB 2VZ1A 1UJ3C 4HHAA 4DKEH 5D71H 1WK0A 2YEZB 4NBYB 1LEKB 4XAWH 4PR5B 3BP7B 4XPHL 5CEXB 4HBCL 4UIMB 1DANU 3HG1E 1AD9B 2APTA 4BSWB 4MJIE 3VE0A 2XYCA 4G6MH 2D31A 3BYYA 4YXHL 4I4WB 3SE3A 3VXPA 5LGHL 1Q38A 4I3RL 3B9KA 4UQ2A 1ZT4B 2NY5H 4HSQA 1TJGH 4FFVD 4B5EA 5AEAA 5HYIA 3QNZA 4LK4A 4QT5B 4L9LB 4ORGA 4B41A 1UZ8B 1G9ML 4XNQA 1MCSA 3SDAC 2FEDD 5D93C 3LIZL 1QO3A 3GK8L 3F8UB 3X3GL 3DX8B 3S6CA 1VGEH 1W0WB 3OHXA 2DBLL 2ATPB 3EYSL 3FB7A 5DJ6B 3CC5B 4HT1L 2YPKB 2YMXL 3QRGL 1PQZA 5AYUL 3T2QA 5M94B 4YE4L 4LOUD 5C9KA 3QIWA 1KCRH 2Q8BL 3QUYD 2Y07L 4PGCB 3U1SL 3PWVB 1S9KC 2P8MA 2LTQB 2G9HB 4HC1L 4Y2DB 4ODSL 2HT3C 4LLVB 1EX0A 5JR1L 3MRJB 4Y88A 4HEME 1PLGH 2BDNL 5DJAB 1XZ0A 3G04A 4UV4L 4JVPA 5IWLA 5HGGS 3KLAA 3GBNL 4PJXA 4TSBH 1T21B 2FZ3B 4NRYB 3QO1A 4I2XA 2BOCB 3T04D 2D03H 2FD6H 2OJZH 4JQIH 4WV1B 3ME0A 1AXTL 1MWAB 4DWHA 2DLEA 4K7PL 5E00B 3WLBA 4KUZL 4K71C 4AEIH 2F74B 4GRLB 4OF6A 3UYOD 3WUWA 4JFOA 3OKKA 4PGBA 3WKMH 3N1PC 1F4AA 5INDB 2E9JA 1HWGB 2HLFC 2VLRE 3KPLB 2Q1EA 2PO6A 3UYRH 2I27N 1MFBL 4JM2A 4ETQA 1T3FA 2D0HA 2W91A 4DQOL 1AR1D 5AUMA 1YEIH 3U9UB 2NXYB 3FKUS 4XPFL 1BJ8A 1UQSA 4F9LC 4AG4L 3EGSB 1D5XB 3JTTB 4OLUH 2Y9RT 4OZGB 1HDMA 2IFFH 1RV6X 3CX5J 1JTOA 3DBXB 3ZYIA 1QZ1A 3UBXI 4OSUL 1FVDB 2CLZA 4ZYKB 1O5DT 3LRSA 5ALBH 3VFSA 2IWGA 5HHME 4FQXC 1IGML 2XQBL 5FA3A 4NCC1 2GITB 3O3DA 4NQCE 3U79A 4P5MA 3C08L 2BZDA 4ZPTA 3S97C 5ADPH 1RUKH 1JPSL 4KXZH 3KHQA 2EH7H 3W81A 4UU9B 1NMAL 1U8IB 4WNQA 5F7DA 4BFIA 4J3WA 4EXKA 4PRHD 4NJAL 4OLWL 5HHPA 5GZND 3WHXA 5JHDA 4R96A 3GZKA 3MA7B 4OI9A 5DVNA 3T3MF 4WI7A 1ZGLP 3KPPB 1CFNA 1LNUA 3MNVA 1KXTB 2R0ZH 1V3JA 4Y4HC 1XIWC 4FZEH 4NKIL 3FOLB 1KSRA 3BH9B 3ES6A 4FFZH 3MJ9L 5KZCD 2HRLA 4KHXL 4UDTB 5T3XD 2ZOLB 1HI6A 3REWA 5D7KE 4O2CA 5CWSB 2QQKH 3IDJB 5SWQB 5D1ZA 2WMPA 3MLVH 1C08B 1IFHL 1ITCA 4M8VA 3IXAA 3BT2H 1N7MH 1WV7T 2AJVL 2YWZA 5J11B 2JB6A 1FAIL 4EI6B 3MNZA 1BM3H 1JI1A 4OLVH 2BXZA 3BE1L 4CMMA 2GSIA 2UWEB 5HYSG 5J6HB 4C56A 1HHGA 4S2SA 5J8OA 1QD0A 2DM2A 4P5KB 4JRXA 3EZJB 1C16B 1MRCL 3QQ3B 3NTCL 1HNFA 3SDDC 3ARED 1I4FB 1FYTD 4BZYA 3VI3F 1NL0L 2GK0A 1QLRB 2PYFA 2DQCH 1J8HE 1UKTA 4QXUH 4U1SB 1KC5H 5I8KL 1Q9LB 1S5IL 3O4OC 4S1RH 2KZWA 3SJVA 1YMHB 4YLQT 4MCZB 3RVVC 5K59F 3N0PB 1AGFA 4AL8H 5JOFA 4Y5XC 4L8SC 4XP1H 5BMFH 4PRPB 1SBSL 3KJ6L 3WDHA 5A2KH 4EN3A 4MNQB 4S1QL 3C5ZC 2NX5D 4MA3B 2EO9A 1JNLH 2DTML 3BRFA 4LHUA 3RU8L 2P47B 1WZMA 3H42L 3FT2B 2DWDB 3LAFA 5KVDL 4QHUB 4K3GA 2BX5A 5C0EB 3SKNA 1BF8A 3KYKH 4KH2A 1UADC 1U36A 4X5LA 4NKQB 1BF2A 2LVCA 4UI2A 5A2JH 3DTXA 1E27B 3MJGX 4NWTH 2ZUXA 5IW6A 2ITCB 2L7UA 4XVUC 1HILB 1WEJL 3U0PB 3VFRB 3TVMC 2VR4A 4PR5A 3VI4E 4C55A 4LSSL 5CEXA 4YX2H 3BJ91 1INEL 2J2ZA 2A38A 1U8HB 3W0WE 5BRZE 4I4WA 4DKFL 3ARYA 2GTZB 2GFBB 1NC4D 1ROWA 4QT5A 4L9LA 1J11A 1T83C 2VAAB 3TIEA 3JWNC 1B88A 3BMVA 4UTBH 4GAGH 5IMLA 4M43L 4MDIB 4JN1L 1FRGH 4KVNH 3MV01 4H20H 4XP6L 4N1EA 1FFNB 5TF1L 3MLWH 4QRPD 4RAUB 1MVFA 4TRPH 1AO7B 5AG8A 1JWSB 3F58L 1KJ2B 4M6NH 3RKDC 3TCXA 2VJXA 3PF2A 2ESVD 3DURB 3JWDH 5HY9B 5DMYA 3MRFA 4YBLB 5T3ZL 1R3LB 1MOEA 4MNGE 3V8OA 8CGTA 3WBDA 2EECA 3PWVA 1AR2A 1AD0A 2YD4A 3BIAX 1K6QL 3M8OL 2NNAA 3MC0A 4HAGA 4Y2DA 5F6IB 2IPKA 4LSTH 4LLVA 3HRPA 1CLZL 4YDIL 4LF3B 4LFHG 2HRPL 2XZAH 1UWXH 5DJAA 3BGMB 3ILQC 2FJHB 3R4DA 3GSXA 4Z9KB 1I3UA 1T21A 1U6AH 5D6CB 4NRYA 4FNLL 2BOCA 3GNMH 3UJIH 3MXWH 3MV7E 4JLRB 3VFMA 1P84K 4KK6C 5E00A 1ZOXA 5E9DB 4GRLA 5I73B 5KVGL 2M8XA 5F9AC 1NQBA 4M1GL 1A8JH 4LIQH 1MREL 3KPLA 3CFJB 1J0YA 1XCTB 2VE6A 4K94H 4F57L 5HYJB 2J8UF 4RQQA 5E2UL 1PG7W 4ZUVA 5I1LB 2BHUA 1P9MA 3ARBC 3U9UA 4X6CF 1DSFH 4OUOA 2K7QA 3EGSA 4M03A 1CD8A 1C8PA 3JTTA 4JE4B 4OZGA 2EKSB 4PJAB 4PGDB 4W4OA 1TTUA 3KLDA 1DBJL 3DBXA 4LCYB 4CVXA 2B4CH 1FVDA 3G5YA 4ZYKA 2FBJL 4RX4D 3RJQB 3K81A 1XGUA 4G9FE 1T1ZB 5DJ8B 4JO3H 4ELME 2N56A 5E0QA 2G2RA 2GITA 3T0ED 1KB5H 5FCSH 1VKXB 2BY2A 2VTFA 5EU4A 3OB0H 2EH8H 4UZGA 3TPUB 3RDTD 1FIGH 3PL6D 1U8IA 2DLFH 5C08E 3ZZ1A 5E6ID 1UWXK 5DURB 4CUCA 4TSAH 2IBBA 5ACZA 3WCYA 3T4YB 3LKPB 2W1NA 2BRQA 1DBAL 1IEAB 4RZCB 1YECL 1UKQA 2IAMC 1JHLH 3O9WA 3SN6N 4NO3B 1A7BA 3QFJE 3BH9A 1NLBH 1TZIB 1XR8A 5AWNH 5DEZA 1INDH 5TQ0H 5FO8B 3MLRL 1TETL 4XBGB 5IEHA 2FEDC 3MYJA 3SCMC 3ISWA 2NYYC 2ZOLA 4OJFH 1F97A 5CWSA 5ACLA 4KRPC 3TNMA 5SWQA 1C08A 3P11H 2Z31D 4AEHH 5DHVH 4RGNB 4P2RE 1DL7L 3FB6A 3KYOB 4RRPA 1NCCL 3EAKA 2RFXB 3TJEH 3HI6H 1KCVL 2NXZD 3GSVA 5F1NB 4JHWL 5ADOH 1ZA3B 1IZJA 4MS8C 5GGTL 4L4TE 5DZNA 1CGTA 2W92A 5J6HA 4YWGH 1JNHB 5DJDA 1T5XB 1S7VB 4ZOAA 3UJTH 3QQ3A 1PZUB 3DX6B 2GIYA 1YPZF 3MCLL 1MCJA 2FL5B 3B9EA 2DICA 1NAMB 3DRTB 1WF5A 1I4FA 5GS0L 1CXLA 4HIJA 5F9DC 3IFOB 1AGEA 2NY7H 4Y4KB 4U1SA 2QSCH 2VISA 5SWZB 2K9UA 4W81A 1BZ7B 3GHEL 4MXWH 2ZJSL 1NAKL 4MCZA 3G6AA 3MRDA 4WWKB 3HFML 3OG4B 2H8PA 1PBYA 1L9MA 1CS6A 3QG7H 1MY7A 1T1YA 4PRPA 1JFQH 4OV6F 3DGGB 1AXIB 5BS0B 4MA3A 2EDKA 5TE6L 3QDGA 4HQQL 1E6OH 5F96L 1NBYA 5HI3C 3V5KB 1G7JB 2AGJL 1RURL 2DWDA 3DSNA 1KXQE 2DMCA 4QHUA 2AJUH 3PGFH 2ZCHL 4CVUA 5ETUA 2PR4H 2Q8AH 4YR6B 3K4ZA 1KOAA 1MLCB 1AR1C 1E27A 2R1XA 3ZKMD 3IDMB 5I6XB 2APFA 2OX5A 3UTPD 3U0PA 2OR7A 4MB5A 2VUOA 5E8PB 4Q6IC 3VFRA 4LLYA 2M26A 3W39B 1QSEE 1MCOL 4OT1H 2EDYA 1IT9H 5FF6A 2BC4A 4ZSOB 5E99L 2NW3A 2GTZA 4GMSH 1OQXA 3WFDL 4U4BA 5BV7L 5SX4I 4IRJB 2ZUQC 4MSWB 1HK6A 4GG8A 3U36B 3LSOA 5GRXG 4MDIA 3VI3E 5IHUH 3B5GA 1HH9B 2OQJB 2BVTA 4RAUA 1AO7A 1DQMH 4KZDL 1KJ2A 1DLFL 1V05A 5ILTH 1FZOB 3AM8C 5HY9A 3DURA 3RVXC 3VH8A 3WJLA 2WBJB 3FQXB 2BSSB 3CXHJ 4D8PB 1QP1A 2QHLA 5E7BA 3EDJA 4YDKL 2RGSA 4BZ1H 5ICZA 3SGDI 4FZ8L 3F5WB 1S78C 4N9GA 5IP4A 5SWSD 3MBXL 3MV7A 1TVHB 5JZ7C 3BGMA 1CL7L 2FJHA 4RMQA 5ISZE 3D1MC 1GYAA 2CD0A 3WNMA 3U6RB 2CIIB 5D6CA 3GFUA 4XNUH 2R69L 4QEGA 4KUCD 2E6JA 3OX8B 3FT3B 4JLRA 4URTB 1T03L 5F7WC 4NFDA 5E9DA 4NQVB 5KTEL 1DQLH 1QLEL 1QRNB 4G42B 3DXAD 2V5MA 4JG1L 5EWIH 4YHMH 1YYML 3UTZB 4AH2B 3CFJA 3QXDB 4D9LH 1F4XH 3OMZA 2X1QA 5T5NG 3GSNB 3FRUB 5HYJA 3HB3C 4ODHH 5FB8A 4NP4H 3VWJC 1VACA 2WIIA 4MYWB 5I1LA 4KKLD 2KQNA 4IRSC 3PGCB 3F7VB 5IQ7L 4G9FA 4NZDA 1XF2B 4KPHL 1E4KC 1FYHB 3ULSB 1BMGA 2EKSA 2DYPA 3A67H 2VIRA 4BH8A 3BJLA 4LCYA 2DIBA 2BMKA 2I9LB 3BGAA 4M4PA 3DO7A 1T1ZA 5FUZH 3GSWB 4FQLH 2WP3T 4HKBB 4YDLB 4R8WL 1JNJA 5FYJD 1ZT1B 3P0YH 4D9RE 5C08A 1GRWA 4HJ0D 5D1QB 4L4JA 3BDYH 3TPUA 1VDGA 3L3IA 1QQDB 1N6UA 5HPMB 3TO2B 2JB5L 4R90H 1A6UH 1S7WB 3RWHB 3AUVA 3LB6C 4Z7NF 3BXNB 1G9NC 1XF5B 3LKPA 5EBLA 3RVUD 3QFJA 3QO0A 4L3ED 1IEAA 4PS4H 4WO4C 5C70A 4LU5L 5IHLB 1OGTA 4K7PY 4NO3A 1WBXB 2J8UB 4JZJA 1CT8A 3I9GH 2EE3A 6CGTA 5FO8A 1F02I 3L5HA 4XBGA 1D5IL 1RVFL 5C71A 5JXED 25C8H 5FGBA 1NMCB 4X6CB 2N1KA 4P2RA 2IMMA 3BFOA 4OCXH 1UM6L 2EDFA 1OPGL 4XH2A 1FBIH 3KAAA 4L4TA 2P24A 2JIXD 3ZE1F 3LPGA 1AH1A 4K9EC 5E5MA 3FMGL 2X6MA 5KG9A 3GIVB 1ZA3A 1E4XL 4IJ3C 2VAJA 1IAII 3G9AB 3RL2A 5JA9A 3VRLF 1ED3B 1P4IH 2R0WH 3I85A 2APVA 1S7VA 3U7YH 3IDNB 2YA1A 3DX6A 1VFAB 2F54B 5HGBB 2AABL 2FL5A 3HAEG 1Y18B 4ESKA 1UJ3B 2DMBA 1TCRB 3IFOA 3OPZH 3ARTA 4Y4KA 1MHCB 2DL2A 2ZG3A 5SWZA 4J4PC 1BZ7A 1LO2H 1GC1H 1OL0A 5DHYA 5HGAA 3CCHB 4WWKA 2BNUA 4MCYB 1RHFA 1NGWB 4QYOA 3VWKD 3VXMB 4HCRL 3DGGA 5BS0A 3O6FC 5JUEL 4Z7QE 5IJKA 3SDAB 1OAZH 3RTQD 5TF0A 4GFTB 2ZUUA 5DRXA 2X4SB 3V5KA 5GGQH 1G7JA 3K2UL 2AK4E 2XTLA 3EOAA 4HFWB 1HHJB 4YR6A 3C8DA 2NTFB 3H7LA 1CWVA 3RZWA 1MLCA 3AC0A 4KMTL 5F3BB 3LKRB 4D3CL 4JM4H 5ICYB 5ID0B 3IDMA 4MD0A 4JGJA 4K8RD 1RUAH 4QXTB 2LQRA 3HMWH 3HE7C 5C09E 1MCPH 4HKXA 1T1XA 3OKOA 2G60H 4U1GC 1MFAH 3O8XB 5DD5H 1MCRA 1CDJA 1QLFB 3W39A 1XGYH 3BDXA 5E2WH 1N0XL 1BIIB 4KV5E 4KI5D 4P9HL 2HAZA 2VDPL 3GGWA 4U05A 3T0EC 5AZ2L 4IRJA 2DQGL 1JUFA 1YPZE 5ESAB 3GSOB 2QQNL 3RDTC 1P53A 4O2FA 5HXMA 1RZJC 3MRKA 4ZFFB 1PX3A 2VSDA 1G6VK 4U49A 3QHZH 3AGVA 3QIBC 1WFUA 1CCZA 1P6FA 3O3AB 4K71B 4Y19E 4KY1L 3I50H 5E94B 3EOTL 4KKAD 1FZOA 4KGJA 3QG6B 4BK5A 1JTPA 4B0MM 3FQXA 5JPNA 2BSSA 4H1LH 1KPVA 4HPOH 3W2DL 3D0LA 1SQ2N 1RMFL 2UVFA 4O51A 4UUJA 2D9QB 2P43B 4IBLT 1I1AD 1UA6L 3NFPB 3DVFA 4XAKD 5ISZA 3ZO0A 2AJSH 2HMIC 3BAEH 3F5WA 3C5JB 1HOCA 5J4MA 3NZHL 3MV8E 5DVOA 1W0YT 3D9AH 1QFWL 4NYLA 2LVEA 1MIEH 1U91B 2NY2D 4X6FB 3U6RA 1Y6NR 3ALXA 3OF6D 3MX0A 4FQXB 2NXZC 3OX8A 1MFCL 3FT3A 3QHFL 3AU1B 1NSNL 3C5SB 4NQVA 1CD9B 1KIUA 1FPTL 5IESH 2FIKA 5IHZB 4L8CB 5GRWA 2CH8A 2LU4A 4X4ME 4GT7A 1AHWC 1L0YA 3NVQA 1CL7I 1A7RL 3GSNA 3X12A 1QYGL 4JKPL 1WFTA 5TH2B 5M7QA 4EI5D 5H37G 4G6ML 5DQ9B 3ROLB 2Q7YB 1TVDA 4H88H 3VXUE 1XF2A 1TNMA 2ZCKH 4HIIB 2NY5L 1YEHH 4Y4HB 1EH9A 3KPRD 2M1KA 2UY6A 4B50A 5L9DL 3NA4A 3L3KB 5D2LB 3GRWA 5I30L 3FO2B 4LSUH 5GGSY 2J6EA 3GSWA 4HKBA 1CD1B 1OP9A 2B7DT 1ERNA 4YXKH 1ZT1A 1QVOA 1OT1A 3VXSD 1MCFA 4LPYA 1VFBB 5EU3B 1BOGB 1FVEB 4N0RA 1HINH 4P2QB 1A7NH 1JPTH 1T89A 1QQDA 3IKCB 4ONFH 3A6OA 5DRZB 5TJWK 1KCRL 1QKZL 3P77B 4MAYA 5CP3H 2NCMA 3DMMD 3BXNA 4ZFOB 1XF5A 1L9NA 1FCGA 2F5AH 1JBJA 2BCKB 2CIKB 4OZHE 3TV3L 3V7MA 5D6DC 3SDDB 3IDIA 5DZLA 5A3IC 5I19L 5MP6L 2J8UA 3P4OB 2C4XA 2W38A 2GT9B 4ZUTB 3EYOA 1KB9J 3RGVD 2X4UA 4X6CA 3D3VB 3O4OB 1X5LA 5TPWH 1NC2B 2DLIA 4UOJA 4FQ2L 1CXKA 2JCCF 4X6DF 3BH8B 4L1DA 3B8YA 1G6RH 2FHBA 2X7LA 4Y5XB 5MEND 1NUDA 4OZFB 1GXEA 1J1PH 4G6AC 3L95A 3EDFA 3C5ZB 3CVHL 2P44B 3IAQA 4Y1AE 3UPRA 3GIVA 4P2OD 4RIRB 4DW2L 5CJQH 3BKYH 1XCQB 2R56H 5E08H 1IL1A 2G5BB 4LNRA 4KKBC 4H26A 4N0FA 4MLSA 1CICA 5DFVD 3CDYA 3RWDB 1IKFH 4OCYL 5D1XC 4PJDE 5HGBA 4PLKC 3CDCA 1TCRA 1KV3A 1N8ZB 3L3HB 5ABDE 3TVMB 5C0ND 2CLVB 1A3RH 1A6PA 4NQSB 1W2KT 3WD5H 1T6VN 5I1KL 5B3JE 1FFQA 1RUKL 2YA0A 4WENB 1EHLL 4G6FD 2AK4A 4Z7WF 4HX1A 4FS0A 2AKRB 3QPQD 2YD9A 5T3ZE 1QTYT 3U0TB 1KEGH 5DMJB 2BVQA 5IT2L 2OSLB 4UAOC 3RWJB 5DUBB 5E70A 5FEBA 4FTVE 3I6KB 4HFWA 1FG2A 2A83B 1A9EB 1HHJA 4NFCA 5C09A 5ALCL 3MLXL 4WY7H 2PTTB 5F3BA 1U3HD 4JRYD 1MJUL 2R0ZL 4R2GC 2WLYA 1NKOA 2IC2A 4FZEL 2DJUA 4AYFA 4QXTA 4G7YL 1TVBA 3OSKA 4NKOA 3ARXA 3BZFB 4O2EB 5EU5B 2DN7A 3OKYA 3O8XA 1QLFA 3BOVA 1BIIA 3C09B 5T1LD 4X99B 3OJMB 1YPZA 3VCLB 2RCSH 2X42A 2QQKL 3O11B 1DEDA 2BK8A 5BZWB 5JLZB 5F7NC 2VOTA 5EO0B 3RY6C 1WT5C 2OTUB 1N7ML 5CSZA 1U8PA 5SX5H 4Y19A 4HMCA 3KXFB 4JFFB 5CCKL 1V5JA 4NM4H 1I1FB 2VDRH 2V9QA 1UYWH 4LRNH 4WHTA 1GGCL 3BDBA 2OTPA 3STLB 3BD4A 1F11A 4HIEA 3W82A 3RVUC 3G5VB 5ELIA 5EUKB 5EA0H 3C6LD 4Q9RH 4JHAH 5DD3L 5FYJL 5F7KC 5DC9B 1JE6A 4KQ4H 3EDKA 3L1OL 1YN6B 2HP4A 1F4HA 3MRRB 3MV8A 5MEQB 4M6ML 5JXEC 3ARBB 3NFPA 4PY7A 3EJZC 4JFED 1C12B 4AY0A 4UOW1 3LCYA 4JO4L 4N5ED 5FO7A 2XNAB 1RQ5A 3BESR 2XA8H 1MEXL 2OXGA 2YPLA 3NN8A 4X6FA 2CRZA 3L7FA 5I18H 3BN9C 1G9EA 4H0IA 1OY3B 4OZIF 4E41B 2VITA 2DQTL 1JGLH 5CUSL 2EDQA 4YJZL 1S7UA 4EXPX 3BQUA 5D8JL 1XMWA 5D72H 5IHZA 5KANI 4L8CA 5TE4H 5DK0A 1R3KB 5DGQA 1IC4L 5DS8B 4PJGB 3OJVC 1YYLH 4NWTL 4OF0A 5HHOE 3D39B 4D0DA 2XPGB 3CFDA 1FL5B 1V3LA 1N6QL 1EO7A 1JF1B 5CS7A 3ZL4L 4U1MA 2MHAB 1XGQB 3AMLA 5D4QA 5TH2A 1Z9LA 5SX5K 4ZNEE 1FL6A 3H3KA 3SE9L 5DQ9A 3ROLA 4U1IB 5T1KA 1S3KL 4NRZA 3WNNA 2IAMB 3S34L 3C60D 4Y4HA 3LS5L 2VXQH 2CRYA 3RA7L 5FECB 4J3VA 3WDJA 1IQWL 1V3KA 4JFXB 3FO2A 3SCMB 5C0RL 1HXMA 1CD1A 1Z2KA 1QNZH 1FRGL 4XCYA 4KRPB 3HR6A 3Q1SH 1CTNA 4PTUA 3SGKC 1VFBA 5EU3A 1BOGA 3LN9A 1CGSH 4P2QA 4I8DA 2XN9D 4GBXA 4R4FH 4QRUB 3IKCA 2E7HA 3UEZA 5DRZA 4E5XA 2QV2A 3P77A 4K8RC 1H3GA 1QUNA 2VDNH 3QUYB 2IFGA 5I1GL 2BCKA 3KPSD 3H9SD 1GIGL 2CIKA 2VN4A 4KI5C 3MXVH 1G1YA 3QDHA 4P9MH 4PV8B 5F1KC 2F9BT 2H2PD 1VPOH 3P4OA 3C2SA 2J3SA 2Y25A 4DGVH 2I07B 4OD3L 2YRPA 1LK3H 3PGDB 4Z7VF 3D3VA 3U4EB 4JFYA 1KN2L 1JWUA 3BH8A 3G5XA 5CIPB 4Y1AA 4Y5XA 2Y06H 4OZFA 3TBYB 2L7JA 1CGXA 4LLDB 1S9YB 4I3GA 4LIQL 2IBGA 3TIDB 5DTFB 4I1NB 1CU4L 3REVA 4HF5H 4J6RH 2DQJH 4KU1A 3NCBB 4KK5D 2EICA 3TT1H 1N3NA 3RWDA 3SE8H 2YWYA 2DDQL 3B9AA 2J88L 1QFHA 2W0LA 1MHPH 4Q6IB 3TVMA 3R0NA 4NQSA 5AD0B 4LDOB 4PGEB 3JWOC 4YZFF 5KS9E 2P4AB 3FQWB 1X5ZA 2C1OB 2FBOJ 4E9LA 3ZT7A 2BY1A 4NM8H 2W60A 3BKJH 5EO9B 3I75B 3DJ9A 1KJ3H 5EOQL 3V6ZB 2I26N 2EH8L 1X6NA 3SKJH 2XV6B 3VXOB 5ANMB 1T83A 4S0TD 1CG9A 4Z7UE 1UEYA 2A1WH 2A74B 4X7CC 2DLFL 5IM7B 1NFDB 3I6LE 2NY4D 4Y0GA 5I8CB 3GJEA 3TPKA 3NFSL 5EC2B 1A1NA 1OAQL 4PRHB 5C92A 3SO5A 4HXAH 1XF3B 4EI5C 1YY8B 2RHEA 2JCCE 4X6DE 4YUEH 1JYWA 1NEZB 5J1TC 1PKOA 1CE6B 3KYAA 4QRTA 1INDL 5AWNL 1E28A 5D7JD 2N7AA 5EU5A 5TQ0L 1AXSB 3IXTA 1NBZB 4LVNC 1CXHA 3ZKXC 4JPIA 5MI0C 5KZCB 4X99A 4OJFL 2E7MA 1HSBB 3MLTA 2ZKHL 4BSVA 3VCLA 5L0QC 4PFEA 4IDJH 5BZWA 5JLZA 1Z0MA 5EO0A 4I0PD 1TIUA 2OTUA 2Z8WC 4WHCA 3FFCE 1L7TH 4AEHL 3HNSL 3HI6L 5E2VH 1WBZB 1I1FA 4HIHA 1W72B 2A9MH 3KPQA 3BX7C 2AJYL 1KXVC 1PG7X 1YEKL 3QDJE 4YWGL 4YFLF 2W0PA 3ARZA 3NIDE 2Y5TB 2XFXB 4O9HL 5EUKA 4X9HA 2UUDH 3FRPG 2EYRA 1FVCB 2F53D 3L6FB 4Z7WE 4YHIB 4XCNA 4P46C 1YN6A 2EE2A 4K7FB 3RNQB 4BZ2H 3MUZ1 3TN0D 5L8KB 1NPUA 1C12A 1FYTE 1RJCA 3W0WB 3BZ4B 2O5ZL 3QG7L 4P4RB 4R0LC 2WUCL 4M62H 3QNXA 2XNAA 4WEBH 3QUZC 4JCLA 2Q20A 1E6OL 2R4RL 3MNWA 4P5TC 1TJHL 1ZHKB 3PWUA 5CILL 3RX5A 2J5LC 4NO5A 2HH0H 4E41A 2AJUL 4NNPH 3MO1B 1NCAL 2PR4L 5JA8B 1JTTA 4WCYL 2NX5E 3OKNA 4C57C 3HZKB 1R3KA 1T5WB 4KTEH 1ADQA 5DS8A 4PJGA 2P5EE 4ZNEA 5DFVC 3D39A 4DVRH 2XPGA 1FL5A 1I7ZB 3GI8L 2ARJQ 1V8HA 1BZ9A 2NLJB 2MHAA 3TO4C 3MRIB 1B0RB 4ONOA 4OT1L 4ACPA 5C0NC 3MOQA 2V2TB 1I3GH 3QWRD 2XG4A 2CO7B 2Z8RA 4U0QB 2YBRA 4KUCF 4OGYL 4WO4B 1CK0H 1WVZA 5F6HI 3V6BR 3NOIA 4MGXA 4JPKH 5GGTA 2FEEL 1KJVB 3WS3B 5CZVL 1NC4B 1CDYA 3FOMB 5FECA 3V4PL 4I77H 4JFXA 2CK0H 2UUDK 1RPQA 2ADGA 3GI9L 4W4NA 1IM9B 5FV1L 12E8H 1T7XA 1Z5LA 3LEYH 4IOSD 4MA8L 2CDEB 1MFDL 4QRPB 3OKMB 1SMOA 4X9FA 5CMAB 3R06A 1H9VA 4N8CH 1M6OB 1II4E 4YHZL 1JRHI 5J9PB 3RZCC 4B53A 2ESVB 4OZIB 2D7MA 4DK3A 1CDBA 4ZTOH 1A6WL 3OQ3B 4IJ3B 5F71A 3MOAH 2E9WA 4PY8I 1UB6B 1WAAF 3QUYA 5J6GB 4GKSB 1UVQB 2F19H 5A2FA 2X9WA 1DP0A 2VDMH 4G5ZL 4R97C 4YHOH 4H5SA 3B2VH 5BXFB 4L5FL 1Q9KA 3MCKB 4K55A 2CLRA 4X7FC 2I07A 3HRZB 3I02B 3STBA 2YUZA 3H6JA 3TJHD 4XNUL 3PGDA 4RFOL 3MRBA 4P3CH 3T2PA 3ARFC 4QHNB 3U4EA 1FIEA 4OCSL 1J88A 2XZQL 2MPAH 4TOYL 4QTIH 5CIPA 3FJTA 3LKSB 5IF0B 3TBYA 4OGZA 3BEVB 3P4MB 3TIDA 1F4XL 3F7PC 2VLKD 3U46B 3BWUC 3C6LC 1R0AL 2VLLB 3VGFA 1J0HA 4A2LA 1GGBH 2CDGB 5EC1B 1JGVH 4XHJD 2BRRH 4F37K 4LCWD 4DJMA 5D7SH 1YEEH 3ZYOA 1KLGA 5IIEB 5LQBH 4OM1H 5FDWB 4DAGL 2R39A 4N5EC 3HE7B 3UBXG 5IW3A 1WZKA 2R29L 5F70A 4EIGB 4U1GB 5AD0A 3T0XA 1TITA 2C1OA 4PJ5E 4W68A 3NZ8B 1K4CA 3JV0A 4TPRH 4BQBA 3S4SA 4M5ZH 4D2NA 5JOPD 2FLBT 2GJJA 1CD0A 3TA3D 3T0EB 4MJ4A 1ZMYA 3OAYH 5ANMA 3WFBH 4DZ8B 5EOTB 1KJ2H 1KUMA 3TZVC 3ORJA 1FQ9C 2VC2L 5IM7A 4NRXA 3RDTB 4X6DA 1NFDA 1IAOB 2BSED 3QIBB 5EC2A 4PRHA 1BFTA 4Z7VE 3SKUD 3MJ7B 1P4LB 1XF3A 2F15A 3O4LE 2QLVB 1LEIB 1X4ZA 3IDGA 5IMMB 4GLRI 1DN0A 1NEZA 2PCPB 4R26H 1NCTA 2ADFH 1OW0C 3D18B 1X7QA 4PJFF 2JELH 1OGAD 25C8L 3MUJA 1MCQA 2AEPH 4HWBA 4UINH 1F6FB 4M9PA 4R7DB 1BFOB 4UNTA 1G1CA 1JMXA 3DUUB 4NHCH 1M4KA 4L4VD 4N9OB 3O45A 1YEDA 4QCIA 1EZVY 3M45A 4H8WH 2WAHA 5F44A 1WBZA 4UBDD 2XQYG 4ZD3H 2EDNA 1W72A 1HYSD 4Y4FC 2B20A 2FATH 2NXZB 5JDSA 1EHXA 2UZIH 1PVHA 1EJOH 1MRDH 3VFUA 1B6DA 1FZMB 4Z7WA 4YHNB 5C0CD 4KMQA 1FFOB 2XFXA 5SV3A 4WUUE 1MI5E 1CR9H 4AQOA 3JVGA 3L6FA 5DGRA 1I8KB 3AREA 3OPZL 1BD2B 4DN3L 3FQTB 1FYTA 2P5WB 2DQDH 4GRWF 4M00A 4K7FA 1FG9C 4LARH 5FUOH 4M6AA 3KWWB 4UIKL 3C87A 3S5LA 4NQDD 2FIRT 1PKQB 2QSQA 3QB7C 4X4ZA 3ZTJH 1X4XA 3D85D 3MACH 1D7FA 1EEYA 1SM3H 2Q76B 1OAZL 1ZXQA 3NCJH 2NX5A 1ZHKA 5CZXD 1BJ1H 3BIKB 2Y6SC 5CGYD 5C7XH 5ACMA 5DK3A 3DVNA 5FM5M 2BSRB 2VDKL 4UT6H 4KK5C 4QOKD 3ZHLA 3OZ9L 4LRIC 4TUJB 5HVGB 1EXUB 4XCFH 4KK9C 4W6YB 1OCWH 1MJ7L 3AB0C 4ZODA 1RUAL 1UWGL 5GSRB 3LKQB 1B0GB 1B0RA 5IB2B 3O2DL 3MOBH 5IVNA 4RAVB 1JNNL 2JJTC 2F8VA 1KELH 2Q3ZA 4D0CA 2MFNA 3Q6GL 4WU5A 1NC4A 3LEVH 1T0NA 3U4AA 5DRNA 4C58B 2ZCLH 5F7FA 3N1GC 5T1DH 2Y4SA 3VFTB 4U2ZA 1I9RH 1MH5B 3DV4B 4M7LL 3TFKD 3F12A 2YXFA 3T08A 3QHZL 4YHKH 1WSST 4YQXH 1BPVA 3V0VB 1MUJA 1NCWH 3I50L 1EGJL 4QRPA 4QWWD 5CMAA 1EVUA 4CL7A 1M6OA 5C0BD 4WW1B 2H9GB 4OZIA 2DKMA 5DEGA 4HPOL 2P42B 3WLWC 3X14B 5D7JC 1UB6A 1RZ8A 1I1YB 3EIFA 3SE4A 3J8F7 1EUUA 2MQCA 1PGRB 4G6KH 4CU7A 5D1XB 1T0PB 4PJ7B 5TGBB 1KYOK 3MCKA 1A2YA 1YZZA 5SWSB 3HRZA 5LG1A 4NKMA 1MF2H 5HYEA 2KBGA 3VXQB 3NH7H 2A6IB 4QHNA 5TDNB 3S88H 4ODUA 1FZJB 3LKSA 5IF0A 2YPVH 5IESL 4O4YH 1A0QL 3U9PL 3BEVA 4G7VH 4L3AA 2IPUG 1ONQB 1IGFH 3P4MA 3TNNA 3DXAB 3CUPA 3O2WL 5J0BA 1YNKL 3U46A 4P4KC 4UAOB 4JPWL 4NQEB 1OAUH 2CDGA 5KAQG 5EC1A 4PJBB 1KCKA 3CH8A 2VO5A 4OKVA 3RKPA 2DM4A 2X1XR 5B38A 3K74B 4YGVB 4HS3B 2AXFB 4F7EA 2B5IC 5EUOF 4UT7L 3DUSB 1NCDH 3CSGA 4LGSB 3O41B 4HDIB 4WFED 2H45A 4RX4A 3TT3H 1U95B 4AT6B 4KJPD 1FGVL 4X7TB 1RHHB 1WAAE 3IDXH 1ZANH 2WANA 2Q6WB 2DQIL 4EBQL 5CGMA 1EHAA 5J3HC 4DZ8A 2EXWD 5EOTA 1DVFD 1S9XA 2VQUA 3QQ9D 4Z7VA 1NANI 2I5YL 4KKCD 5GGRY 5TQ2L 1A1OA 3RDTA 3PL6A 1U92B 5B8CC 5E6IA 4D9QE 3MJ7A 3H9HA 5DUML 5JW5B 4UTAL 1Q0XH 2F5AL 3AFLA 4TVSa 1B90A 1LEIA 4M02A 4L3EB 2VDLL 1LMKA 5IMMA 3D18A 4GW5B 3VFPB 3ZKQD 4DCQA 3MROA 5E2TH 5L2JA 1LP9F 2CKBB 3CZFB 3WN5C 4NBZB 5CJXA 1Q0YH 2GSGB 3GB7A 5IG7A 3L5XH 2GUOB 1DQJB 1INQB 4MWFB 4R7DA 1BFOA 1AIFB 1CFVH 1J1PL 1RZGB 3V6OE 4ODVH 2Z31A 4O02H 1E4WH 4CMHC 2C4FU 2B8OT 4XWOC 4M7KH 3N06B 4JJ5B 4ZMAT 3B3IA 2ATKB 1K8DB 2EC9U 2QJDA 1KBGL 3BIBX 3BKYL 2R56L 1MI5A 3GSNH 1KLUB 4ZO7A 3WFEH 1GGUA 4DZBB 2DB8A 4I0CC 1SBBA 4PUBL 1TCMA 1KGCE 5F72S 4X83A 3D87B 4GW1B 5I17B 1I8KA 1A7OH 3FQTA 3JV5A 4XMKL 4N8VB 2DMKA 3GRWH 3KWWA 1SVCP 1FFPA 1T2JA 1PKQA 5DI8A 1ZWIB 4GS7C 3T1FB 2J6EH 1GGTA 2DKUA 5IFAL 3IVKB 5B39B 4PJCF 3QPXH 3SDYH 5C6WH 1DJSA 3HPJB 4PJFB 1HXYA 2Q76A 5ITFB 4KFZC 4NNYA 4BH7B 3PIQB 3U2SB 1SEBA 2OL3B 4O58H 3E6HA 4MNQD 1ZVHA 4XHJC 1P2CA 4A6YL 3D48R 2HJKB 4XI5C 5E1AA 4WFGD 3DNKA 2B1AH 2D9CA 4TUJA 1EXUA 5I71C 3QUMB 2HVJB 1B0GA 3PDGA 1F6LL 5IROC 1CFBA 1EO5A 1BFVH 3OJDB 3CVHA 5ICXA 3KPTA 5D7LD 1BBJB 2RCSL 1TQBB 2D0GA 2ITDA 2GY5A 1J05B 4LIQE 4NKDA 1J9CT 3I3EA 4XPHH 4GRWB 4OQTL 4RWHA 3E3QE 5I1HL 4HBCH 4ZQKB 3IF1B 1J0IA 1IGJB 4LAQL 4YXHH 1K5NA 2VDRL 4QLRA 5KSBE 3HR5B 5LGHH 3RWIB 2VN7A 4LDEB 5FXCH 2GY7B 4V1DD 2FX7L 1G9MH 5D5MF 3LIZH 4WW1A 4NDMA 1XEDA 3GK8H 2NY5C 1IQDB 43C9B 3X3GH 5D7IE 4RMSA 4XPBH 3X14A 3VD3A 2CUIA 5D96C 4LCCC 1S5HB 4L8BB 2DBLH 3EYSH 1YJDL 1KTDA 1QOKA 1AFVL 4HT1H 1HKFA 3NCCB 5EU7E 1A7PL 3QRGH 5AYUH 3QDAA 2EDJA 5T1MB 1I1AB 4U3XA 4DOHB 4YE4H 4KVCL 4YDVB 3QEQE 3TH4T 5SWSA 2Q8BH 2Y07H 3U1SH 5I18L 3ROOA 1MAML 4LSQL 4XAKE 5TDNA 4ZXBD 4ODSH 1HYSC 5GSVB 5IQ9B 4M8QA 5JR1H 3NIGF 4NHUA 2BOBA 2BDNH 4UV4H 3CH1B 4NGHL 1TTGA 1AE6H 1X5XA 1JK8A 3DXAA 1I85C 5GS3A 5L8LB 4G9DA 5IEKB 4FABL 1T2QL 3HNTL 2A73B 5DRWB 1AXTH 5HVHC 2VXTL 2NY0D 4KUZH 43CAB 3JV4B 2VL5A 1MHHA 1UZ6F 1EBAA 3CSYA 4LGPB 4EI5B 2C3WA 3EO1B 5HYSB 2AXFA 3WYRA 2EIZB 1FNHA 4PG2A 3DUSA 1NUNB 4LEOA 1MFNA 3H9YA 1MFBH 1X5FA 3ZE0E 4OZHB 1SJVA 4F8TA 3O41A 4HDIA 1WAAA 4DQOH 3O3BA 3ZKXB 2FDBP 4XPFH 1U95A 1YMME 5MI0B 2OLDA 3CX5K 3PQYD 3UCRA 5CZXC 1M05B 4X7TA 5L0QB 3EOBB 1Y0LA 3KPRE 5AAMA 1RHHA 4AEEA 2MJWA 4U1LB 2Q6WA 4OSUH 3VXSB 3X11B 3LHPH 4JB9H 2PTUA 4HKJA 3W9EA 2EDHA 5DF0A 2A6JB 2FB4L 2HLAA 1MCLA 3MV9D 4YHLL 2V7NA 1IGMH 4UNUA 4WJ5B 3HTLX 3PABB 4Y7MA 3C08H 4HULB 1SEQL 1J12A 2R2CA 4L9DA 3DMMB 1JPSH 4M1DL 1S7QB 4U7MA 3E6FA 3ALPA 1QSZA 4L3EA 3ARGD 1NMAH 2Z35B 5ENWA 1PYWA 4CJ0A 1A4KA 4L29B 1EPFA 2CPCA 2OMBA 4N5UA 3A0OA 4NJAH 4OLWH 4X8JB 4ZUSB 4OIAA 2QADD 2IQAA 3FN9A 3E8UL 3PWPE 3RIFF 1LK3L 3CZFA 2OK0L 1EEZB 3V6OA 5IVZB 1CZ8H 3RGVB 5JW4R 2XG5A 4WTXA 1DQJA 4MWFA 4H0HB 1UXSA 1XGPB 2D7NA 4NKIH 4R0LB 1NMBL 2EZ0D 4Y16C 5SV4A 1XF4B 4QWWC 3MJ9H 3RWFB 2JIXA 5EUOE 5GGSB 4KHXH 4HF5L 1VEPA 5BQ7A 3SDXF 2J5LB 1TMCB 1R24B 5MENE 5F21B 1I9IL 5CJ8A 1IFHH 3TT1L 4DZBA 4FP8L 2AJVH 3SE8L 5E4EC 2X1PA 1W0VA 2ZWLT 3LS4H 3ULVD 5CGTA 4XBPB 5KBNC 4GKZA 3KYMA 1FAIH 4XNMB 5GS1B 4ENEC 5I17A 5CEYB 3WNOA 1AC0A 3T65B 1H8NA 2FSEB 3BE1H 2OJEB 3TO4B 3QIUD 4Y8DC 1WC7B 5JPMA 5DLMH 2FCBA 3S36X 1MRCH 4J3UA 1ZWIA 3T1FA 2AEIT 1OTUC 4N1HB 3IVKA 1UH3A 3NTCH 3E2HB 2IADB 1LQSR 3VWKA 1NL0H 3HPJA 3H3PL 1X5GA 4PJFA 5EU6D 2Z92B 4H25B 1CLOL 2C3HA 5I8KH 1S5IH 3G6JB 1RY7B 1HNGA 4U2YA 4JFQB 1FGNL 3MZGB 2DM7A 4X6EB 3P73A 3RTQA 4BH7A 5DQDL 3U2SA 4IMKA 3H8NA 3BWAB 1LP9E 2EXYD 2NMSA 1ZHLB 4JQXC 1BQHB 2Y36H 5HYFA 4LSVH 3KJ6H 2HJKA 4PB9L 5CD3B 3KDMB 4S1QH 2DTMH 1U3HB 4JRYB 3RZCB 5KW9L 4Y5YA 5ERWB 3QUMA 2HFEB 3H42H 2HVJA 4CN1A 5KVDH 1CIUA 3L3GB 3VFOB 5L6YH 1CDGA 1P5UA 5F7HA 1LE5B 1BBJA 3HA0A 2X4TA 3PWJB 3BMWA 5SX4H 5DDHB 1MWAL 4LKXA 3OXRB 4W6XB 5FHAH 1F8TL 4Z0XB 4WRLA 2W0FA 4E42A 5J56B 1Z9OA 4LSSH 2CO6B 1DVFC 1INEH 4ZQKA 5DO2C 3VXRD 1EIBA 2NY1C 1WWAX 4I18B 3ARFB 2OS7A 3RWIA 4JKKA 4NT6A 1NEUA 2V17L 1KCUH 5IKCB 3EDDA 4APQC 4R3SB 5I1IL 1U93B 5ESVB 3TBSB 1G7HA 1IQDA 43C9A 1JPFB 4PJCE 4M43H 5E6ZA 2HA1A 3UTSD 4JN1H 5HHOB 2XA3A 3C6LB 3Q2CA 4XP6H 5TF1H 8FABB 1M71A 3PWLB 4U6VH 4L8BA 1HE7A 5DMKB 3FQRA 3F58H 3ULUD 2WBJD 1GZQA 1I1AA 1K9TA 5HDQL 5DWUL 5T3ZH 4JFEB 4YDVA 2ICEB 4WEBL 4JFDB 1G7LB 2IBZX 1VEMA 4M7ZC 3JWDC 5FGSA 4RFEB 1K6QH 3OF6A 3UAJC 1CLZH 1A4JB 4Z77B 3EO0B 1TTFA 3GMRA 1T04B 1WGOA 3CH1A 3GSQB 5ECJE 5FUCC 2FR4A 2FHFA 4TUKL 4FQHA 4ORZC 4PRNB 3TZVB 4FNLH 2H32B 1RUPL 2A73A 5DRWA 2V5SA 1XR9B 4NZRL 1T20B 1QRND 4TQEL 43CAA 3RHWF 5KVGH 3EFFB 4NN7B 1P7QD 3AY4C 3MUGB 4M1GH 4N0UE 4EI5A 1OD7A 3SDCC 3EO1A 1GGYA 1CK0L 1MREH 2EIZA 4MQTB 1WJ3A 3MRLB 4OKDA 4QNPF 5FYKD 4BYHA 4F57H 2JJUA 3C60B 5D5ME 5E2UH 2Y1VA 3BKCL 3KPRA 1ZHBB 3MLPA 3E3QC 1KNOA 2E8ZA 3EOBA 4K94C 3LEYL 3HN3A 4OI8A 4U1LA 4HGMA 1DBJH 3T0WA 5IOPB 3VXSA 1P4BL 3X11A 1I3VA 2FBJH 4NIKB 5DD6B 2A6JA 1NGQL 4ZUWB 4HLZG 1RZKL 4Y4FB 2B4CC 5D1QD 3FFDB 4HS8H 3DMMA 5HVFB 1S7QA 4ZAKD 2XN9E 3ZTNL 4YHOL 3NIGE 3H9SB 3QDMD 4X4YB 3IFLH 3PDOB 4F33B 2JKXA 2VNCA 1NFIB 4QRRD 4X8JA 3P9MA 4OFVA 1DBAH 1E6JL 1E0OB 2WK2A 3RGVA 4JANB 3T3PF 1YECH 2VKWA 5EUOA 2R2BB 3BUYB 3MGTA 4R0LA 1UZ6E 3UTQA 4RA0C 5MENA 3MLRH 1XF4A 1TETH 2PYEB 4G3YL 4KI1A 3RWFA 3NA9H 4JREC 1ADQH 5I1AB 1EUTA 2B2XL 4NCDA 1WITA 5FOBB 1VFOA 3BW9B 4OBRA 2BRRL 3KJ4C 4P2OA 4PREB 1U8NB 1BQUA 4XP9L 1ZT7B 1R5IB 3ZKND 2WWMC 5GPRA 5K9JL 1NCCH 4HK3N 4XBPA 1MCBA 4XNMA 1KCVH 4GAJL 3JSSA 4JHWH 2BNRD 4WGVB 5GS1A 5IBLD 3AB0B 5GGTH 2DIAA 3RI5K 3I6GB 2IANE 1WC7A 1MLBB 1N59B 2F54D 3VH8G 3ARSA 3MCLH 4ZXBC 4XPAL 1UM5L 3OAUH 4M5ZL 1NLDL 3KNBB 5JO5B 3QEUB 4C54A 5CLWA 4QY8A 1LP9A 2Z92A 4H25A 4OIBA 4PJ9A 2OI9C 2VZOA 3GHEH 2ZJSH 1NAKH 4DVBB 2PW1B 3VXMD 4N90D 3HFMH 4I9WE 4X98A 4E0RB 1LO3L 3BP6A 1F2XK 1NCBL 2CMRL 2NY0C 3SDAD 5LBSL 3KDMA 2ICCA 2ENSA 5TE6H 2W65B 4HQQH 5IMKB 1MCEA 2C3VB 1BLNA 2CDFA 2FGZA 5F96H 1U3HA 4JRYA 1UCBL 4JZNB 4P59L 5ERWA 2VLME 2JJSC 1RURH 4IS6B 4MJ6B 5BW7A 3L3GA 1F3RB 2X4PA 2BVYA 2ZCHH 4KHTL 2V9TA 4HUUA 4IOIA 3VFOA 5F1IA 35C8L 4U6XB 5D7JB 2YUVA 1KF9B 4IIQC 3SDXE 3MGOA 3QXVA 4LBEB 5T1LA 2Z91B 5DDHA 3MRNA 1T1WB 4LCUA 3O6LL 3CMOL 4WHYH 4FN0A 5CIPH 5DJYA 5I1DB 5HDBE 1I8LA 1CYGA 1EEQA 4H8WL 1MCOH 4LSRL 5DD1H 2Y5EA 4I18A 2ADIB 4JPVL 3ZDZE 4GRMA 5E99H 2UZIL 5EZLB 1RIHH 2PUQT 4FQIL 4N8PA 4PJCA 2EIEA 3V0WH 1Z3GL 3KG5A 3ZDYF 5BV7H 1FNSH 2RJMA 2YN3A 4XMPL 4R3SA 3ZTJG 3WFZA 1U93A 5ESVA 3VGEA 3O2VL 4ZPVB 1CR9L 4XXDA 4ZDHB 2NZ9D 3UTTE 1Z9MA 4MQ7B 4U1NA 4P4KB 3C6LA 3PWLA 2QADC 1ES0A 5DMKA 2AV1B 4KZDH 1DLFH 2HLFD 3CXHK 4OIIL 3TN0B 5I1JL 2F53E 2B5IB 3K2MC 4JFEA 4LLAA 3H7BB 3PWNB 4QRQB 4RAHA 5J1SC 1XGTA 2DLTA 2EZ0C 1CDHA 4GMTL 4P2CG 4YDKH 2ADJB 3MFFB 1RIVL 5FYLL 4FZ8H 1URLA 1A9BA 1VGKB 4EUPA 4Y5VC 1A4JA 3UC0L 1L0XA 3MBXH 5EO1B 4JR9L 2H6PB 4PRID 4DFHA 4Z77A 4CJ1A 3EO0A 5CZKA 1T04A 5F89B 1CL7H 2B39A 5KANG 4FQXD 4TTDC 1S7RB 4PRNA 2R69H 2AEQL 1OCWL 3G08A 4Q9CA 3ULVC 4G80A 1T03H 4XCEB 5B8CB 1OTSC 1T20A 4HG4J 2A77L 5K9OA 3EFFA 3MUGA 1IZKA 1JGDA 1NGYB 1QLEH 5D5MA 2ZUTA 4HWBH 5EBMB 4WFHD 4ZTPL 1QFPA 3Q3GB 2I9TB 4FMFA 4S1DC 3C60A 3HAEB 2P45B 2ZCLL 5F9OL 3UP1A 1GH7A 3EYUL 4U33A 1I9RL 1HIML 3WN5B 3GJFB 1R3HB 1ZKAA 2I25N 2W0KA 5IQ7H 1XIWD 4K23L 1W72H 5CEZD 1KFAH 5HHQB 3HKFA 3PHQB 5IOPA 2ZG1A 2ZUWA 3GM0A 5DD6A 3WKNA 1J18A 4F7CB 4J3TA 4ZUWA 5DHXB 2VB5A 2XN9A 5C0IA 1NAML 5HGDA 1F3JB 4R8WH 4YAQA 4X9BA 1I7UA 3GUTA 3WFHA 3ARRA 3VGBA 4V2CB 4G6KL 5D2NC 1L4IA 4LVEA 3LMJL 3KPSA 3H9SA 2OP4L 4X4YA 3NCFB 4OZGF 3C8KA 3PDOA 4F33A 2RBLA 4A6YB 4ZS6D 1KYOJ 3DV6B 1MF2L 1A3LL 3RPIB 5FGCE 4ZO8A 3EZ8A 4JANA 3SDDD 4GS7B 4JCMA 2EDEA 3P4NB 4AQ1B 4GAYB 1H5BB 4OF3A 4GW4A 4G7VL 3ARDC 3O2DA 2VZUA 1D5IH 1RVFH 3BO8B 3RVVD 5I1AA 2YXMA 4BQCA 5IK3B 4WW2C 5T33H 4QNPE 5IR1B 4QF1B 1UM6H 4PJXE 4PREA 1JWMB 4MB4A 2VLKB 1OPGH 5JW4M 5C0AD 4XVSL 1U8NA 3CVIH 1CGVA 4I2XE 1MRFL 1ZT7A 3C5ZD 1KIPB 1NKRA 2PXYC 3ULUC 3KPMB 3OAZH 3UZEA 1E4XH 5I71B 4LCWE 1EGJA 3I6GA 4JHZA 1MLBA 1N59A 4CU6A 5DQJB 3HZMB 1JZ5A 2FJGB 3VA2C 4XVUD 2AABH 4K3DH 1NGPL 4LLMA 3M07A 3IDXL 4F37F 3TA3B 1SMAA 1ZLWH 1EA9C 4TUOB 4DVBA 4FA8A 2PW1A 4E0RA 2BFVL 4OCWL 1QHPA 1YUHB 1EK3A 2UWEF 3SGEI 2R0LH 5IMOA 1OT2A 1GC1C 3T3PE 5JUEH 1YC7A 3TESA 4MD5A 2C3VA 2G75A 5H2BB 1BBDL 2FECI 2ORBH 2CR6A 2XTJE 3S35X 2XKNB 1X9QA 4WUUB 5E2TL 3VU2A 2R2EB 5HPOA 5DC0A 3RAJL 4U6XA 3RKDD 3L9RA 3MBED 1OGAB 4KMTH 5IV2A 4D3CH 2Z91A 5JHDE 1WWCA 3SY0B 2LU3A 2V2WB 1OF2A 5JTWA 4PJIB 4I0PA 1OQOA 1T0MB 4OCRL 3OAZK 1N0XH 3BPOC 2NTSP 3MRPB 4P9HH 1U8LA 4XMLL 5EZLA 1R5VA 5B4MC 2VDPH 4F9PA 4BA8A 4L4VE 3KXFD 5FYKL 4JFFD 3MQIA 2DQGH 3UROR 2GJ6D 2WNGA 3AS2A 4DGIL 1GPOL 1TQCC 1T2XA 1H3TA 4ZDHA 2MSPA 4KK6D 5BOPA 1L7IL 4MQ7A 3NCMA 2WWKO 1Z9SA 4CNIA 2F53A 2MQ0A 5HVHB 1I9JH 5IB1B 4G8GE 4BUGA 1JVKA 4KJQD 2R9HC 2AV1A 5C0CE 1HKLH 2A9NL 3KPNB 3A6BL 2E6PA 3B9VA 3EOTH 4JY5H 4UDUB 2PW2B 5HI4C 2BSTA 3B8SA 5HYQB 3TN0A 4NQDB 3WIFB 4YPGB 2AERT 4G6JH 3IJSA 4C56E 1DFBL 3H7BA 4HUKB 1ZE3C 3PWNA 4JRXE 3W2DH 3ZE2F 3CXDL 3D85B 3ARBD 1QBAA 4L1HA 1RMFH 4ONGH 4WI4A 3CPLB 2ADJA 2BVOB 3HG1D 1UA6H 4MJID 1OM3L 1IAMA 1B4RA 3HUJF 1VGKA 3DHMA 3PV6B 3EYVB 3NCYP 5EO1A 2H6PA 3NZHH 1KTLB 1QFWH 4OQ1A 5F89A 1FJ1A 1JIBA 3LN4B 1S7RA 4HH9A 3KPOA 4QOKB 1HHHB 3BP5A 1NCNA 1SY6L 1MFCH 1BQLL 3QHFH 1RZ7L 1NSNH 1D6VL 3QI9A 1FPTH 1REIA 2EYTB 3QWRA 4MA7L 5EBMA 3HC4L 1I1CA 1P1ZB 3LQAL 3AS0A 5C0JB 1D5MA 4JKLA 2I9TA 1QSFB 1A7RH 4MQSB 3DROA 4C4KO 1TLKA 3OKEB 4B7LA 1QYGH 4JKPH 1MCDA 2HTKC 2CQVA 3RL1A 5MHSE 2WQRA 3GJFA 1R3HA 1YEJL 5E8NB 4JRWA 5DEFB 2IAMD 4XNZB 3I2CL 3OWEA 1YN7A 4OZ4B 4XNYL 3DLQR 5F88A 5HHQA 3VXNA 3HLAB 3PHQA 5L2KB 3K4AA 5L9DH 3IT8D 3SCMD 1U3JA 5I30H 2NYYD 4WDIA 1EVTC 3K1KC 2E6QA 5C0BB 4KRPD 2YK1L 2HG5B 4XPBL 3PP4L 3DYOA 1NDGB 5DJ0B 5IFHL 1P7HL 3GO1L 1S7TA 3HI5L 5BVJB 2KL6A 5DUPH 5E4EB 1H3XA 2ARJA 1G7PB 5J13C 4MS8D 4N8VG 4PJAF 3QUKB 2VLRD 5K33A 1QKZH 5LCVL 3Q6FA 4A6YA 1HCFX 3DV6A 3CU1A 4HD9A 5C0FB 3QQNA 4K2UL 1FNEA 1FHGA 5MEOB 3RPIA 2BVPB 5B39G 4GG6B 3FAWA 1IEBB 1SJEB 2PTVA 3P4NA 3TV3H 4XT1C 1KB9K 1U41A 5I19H 5MP6H 3S96B 5J89A 1H5BA 2ZSWB 1AE6L 1JI2A 4OFIA 1ETZB 5H35B 1MNUL 3BO8A 5HHMD 3TLRA 3GIZH 1I7TA 1V7NL 3FO9B 1QR4A 5IK3A 4FQ2H 5IW1B 2NZ9C 4U7KA 3HS0A 1UEMA 4RFNB 4J3XA 2VLKA 3MLYL 4NQCD 2KZ1B 4OQTA 1BVLA 5JORB 4LCWA 1LO5B 2IH3B 4KDTA 5JIIA 5HI3D 3CVHH 2ERJC 4OUUA 4OFDA 4DW2H 5MERB 1YEGH 2W9DL 3HE6C 1QFUL 5HDLA 5DQJA 3HZMA 3DX7B 4RMVA 1C5BH 2FJGA 4LDLB 5EORL 4OCYH 5MEPB 1FNGB 3PNWB 4XX1E 2WBWB 5BO1L 1NDMB 4HJJL 2VXUL 2P46B 3LHPL 4QKXB 4JB9L 3TA3A 4XVJL 4AIZB 3OL2A 1I3RA 4LVOC 4OZGE 1DVFB 1KT2B 3SE3C 3THML 3B9KC 4AIOA 3PHOB 5I1KH 1YA5A 5D7KD 5H94A 1YUHA 1EHLH 5FDYA 3RY4A 4F7TB 4IOFD 4APQB 5I1CL 1CGYA 5IT2H 2XKNA 3SQOL 2V2XB 4ZFGL 3T2OA 2YC1A 1PAMA 5CBAA 2R2EA 4YGAB 5DMIL 3GMNB 1QACA 5A2IH 5ALCH 1OGAA 1CZ8L 2D7TL 2GW5A 3MLXH 3RVXD 1MJUH 4J1UB 1FZKB 3SY0A 5GJSL 3TBTB 3QIWC 3V6FB 4G7YH 4LNVA 3FQNB 4PTTB 4JFPA 3OR7B 3WE6B 1J8HD 2LU7A 4OFYD 3T77B 2HTLC 2LV4A 3T2NL 4L4VA 4R4BA 1WIUA 3QULA 4M7ZB 4F8QA 2HKFL 5I8EA 1S78D 4U3HA 3F65A 1U8JA 5JZ7D 3N85L 4CVZA 5IWLC 1X44A 2FWOB 2DD8L 4NNXB 4DN4L 5IBTL 2CGRL 3KLHD 3LS4L 2OM5A 5I15L 5FK9B 4G8GA 4TULL 1FE8L 1FDLL 1I85A 5C0CA 5CCKH 5GGRB 4LKCB 2BNQB 2UYLB 5BCAA 1IC7L 3QH3B 4LPTA 3IB4A 1GGCH 5CEZL 5IB1A 2VQ1B 4ZS6C 5DLML 1KJMA 3KPNA 3D0VA 1TNNA 4UDUA 2EEBA 5HYQA 4U3CA 3HB3D 1DBKH 4JM2C 3VWJD 3BD3A 5DD3H 5FYJH 3HC0B 3D85A 4IRSD 3L1OH 4NUJB 5ESQA 4PLNC 1IC5L 3CPLA 1Y6MR 4M6MH 2BVOA 5IB3B 3LDBB 3MRGB 3W0WD 5BRZD 1QBML 5I2IB 2X44D 3PV6A 3CU7A 2VXVL 1VADB 5GQBA 2Y36L 4JO4H 4LSVL 3RWGB 4ZOCA 4ZFOL 1MEXH 4QOKA 4ZFZB 4PRPE 4MNQE 1J8KA 4MVBD 1G84A 4XGZA 2DQTH 3FB5A 4NN6C 2XTJC 5CUSH 3QDGE 5L6YL 2HT2C 1AGBA 4WFGE 1DEEA 5D8JH 3CDGB 3CK0L 1I1RA 5DSCB 1IC4H 3QWOA 2HJFB 1P1ZA 5D7LB 2X4QB 4XXCA 3GMQB 5EULV 5FHAL 2YEZA 2WW8A 5LAXB 2OBGA 3LB6D 1N6QH 2D2OA 2F58L 4OGAC 1LEKA 3ZL4H 3BP7A 4U1HB 4UIMA 1AD9A 1JGEB 4BSWA 3SE9H 4WO4D 5GRUH 3K0WA 1S3KH 3BPLB 1ZT4A 1PX4A 5FA4B 4MQXC 1HHIB 3C2AL 3S34H 5JNYB 3LS5H 3OGCB 1KCUL 3FB8B 2QQLL 1MAJA 1UZ8A 3RA7H 5KOMC 4V1DB 1IQWH 2VWEE 1IM9D 1UKSA 1OAYL 4MD4B 4WVRA 1NGZB 4JREB 5C0BA 5C0RH 2V7HB 3DX8A 4PYHA 3ZMRA 1N4XL 4HPYL 3HUJB 1W0WA 3ZE2E 5D1ZC 3MV7D 4U6VL 2A6KB 3KJ4B 1NDGA 5DJ0A 2ATPA 3QA3B 5DJ6A 3CC5A 2YPKA 3LKOB 5LJYH 5BVJA 3MBEC 1Q72H 5DVKA 1Y6KR 3SBWA 3IJYB 2X4RB 3QUKA 1AO7E 3WO3B 4PGCA 1WFNA 5DHVB 5C07B 3WNLA 4G43B 5C0FA 4Z0BL 2G9HA 5D9SB 5E56A 1ZHNB 5I1GH 1GIGH 2CUHA 4MMZC 1SJEA 4OAWB 2XOTA 4ZXBB 2RQ8A 1ZGLB 3MRJA 1J0ZA 1YMMB 4PRAB 2HWZH 4IM8A 3I3DA 4J4PD 5EIVA 4OD3H 3QRFM 1PY4A 1ETZA 5H35A 2FZ3A 3HI1B 5GS2D 2OI9B 1PEWA 5EFIB 3NPZB 1BQHG 1BVKB 4WV1A 1KN2H 1MWAA 2ARWA 3O6ML 5IW1A 3QUMH 2F74A 4IRZH 4PD4J 2AXGB 2D7PA 4K8RH 3O6FD 4PBXA 2NY0B 1P7KB 1LO5A 4KJQC 2FO4B 5INDA 1P69B 5E9DE 4HWUA 5FHBH 3WO4C 1CU4H 4NWUL 4W6WB 2CR3A 2R15A 2X4NB 4JFHE 4F2MB 1FORH 4PJHB 2AQ2A 4GRWH 4N0CD 4ALAL 1MFEL 2R4SL 5KVFL 4IIQB 5HYJE 2YA2A 5MEPA 1D5XA 3PNWA 1NDMA 3PQYB 2EDDA 3U4BH 3HE7D 1WTLA 4MXVF 2DDQH 2J88H 4RWYL 5HD8D 1RULL 4AIZA 4HK0B 4PJAE 1CQKA 3DUHA 2AJZB 2CUMA 4FQCH 1JZ7A 5F7EL 2XKUA 3MV9B 1HWHB 1RK1B 3PHOA 5JHLL 4NC2B 4F7MB 1CE1L 4HS8L 4L9LC 5EOQH 3UZQA 3V2AR 2VSCA 4KMLB 4F7TA 4GLRH 4P2RD 2OXHA 4UU9A 3JXAA 4HUMB 3IFLL 5BVPL 3LKNB 3ARGB 3QIBD 2V2XA 4ODXB 2K3TA 3NFSH 1OAQH 3MA7A 4WFFE 2QADB 5FYLE 2DM3A 3CAFA 2VH5H 3KPPA 5I76B 4MA1C 1C5CL 4FRWA 1IAIM 4J3SA 4J1UA 1FZKA 2EEDA 2MNUA 4EDWH 1BREA 3QCUL 3FOLA 4QXWA 2IF7A 4PV9B 1WBYB 4PTTA 1X5IA 1QPPA 4BM7A 4S0SD 3NA9L 2LTQC 3T77A 1IAIL 2YRLA 1ADQL 5GJTL 4UDTA 2HMID 4Y2DC 3MODL 2ZKHH 3IDJA 4CU8A 3HMXA 4QGTA 2VQTA 3OTTA 5KAQF 3HNSH 2COQA 1IARB 1RJZB 3AMKA 4EI6A 1M7DB 3LZFL 3MREB 3AVEA 2UYLA 3QH3A 2AJYH 4X7SL 4FG6C 4RGNE 4GRLC 2Z9TA 2UWEA 1OP3H 1D5BB 1YEKH 2Z4QB 4P5KA 1T4KB 5EOCL 2XICA 1C16A 3QIUB 4Z95H 3FONB 1CXFA 4AEFA 4XWGL 1GSMA 4O9HH 3OAUL 5KN5B 1BD2D 3S8WA 2P5WD 5GGVL 1T7ZA 1QLRA 4IHOB 1FL3B 4RGMC 4NUJA 1P9MC 1Q9LA 5EU6B 5FKPB 2NW2B 1YMHA 1QSED 3J7HA 5IB3A 3QHTC 1N26A 3RY5A 3P0GB 4Z78B 1VADA 3IGAB 3T3ME 5SWZE 5F7MC 2O5ZH 5BJTB 1KPRB 2WUCH 4MNQA 1JCKA 3L3JB 5GRVL 1A64A 2R4RH 4XB7A 1SHMA 5TDPB 4WHYG 1TJHH 5CILH 3FT2A 5BS0E 4KGLA 1NCAH 5EG6C 1QR1B 4DGYL 5C0EA 4NZTL 2V9RA 2DQHL 4PLJC 4WCYH 1F2QA 3SKOB 1JL8A 3L5WB 4RGOL 2C1PB 5D2NB 3E0GA 1AJ7L 2HJFA 2ITCA 3FTGB 5LAXA 1HILA 3GI8H 1HQRB 3CLEL 2NR6C 4NOBA 4EQ2A 2E27L 4XRCB 4UMGA 1N5YL 3DI2B 1U8HA 4OLZL 4MB3A 5DD1L 3UBXB 1ZS8B 2AV7B 3VXRB 3QNYB 4OGYH 1RIHL 2GFBA 1CQYA 3B6SB 3O9WC 5FA4A 1HHIA 5E7FA 1D9KD 5A3ID 3ABZA 1OP3K 2HJLB 3OGCA 5GRYA 3V0WL 1H3WM 1FNSL 2VAAA 4PJEB 5CZVH 4YEFA 3V4PH 4NQTA 4V1DA 4IOFC 1H15B 4MD4A 5EOCJ 3VGAB 3GI9H 3HUJA 4HXBL 3B2UD 1FFNA 3UTSB 5C6PB 4MA8H 2WINB 1MFDH 4G6AD 1JWSA 3LKOA 1JHKL 2XWBB 5K59E 4YHZH 3CFCL 1R3LA 3IJYA 2X4RA 4YNYB 2Y7QB 5GXBB 1UXWB 4U6YB 1A6WH 5D2LF 3LOWA 5JQHC 4KKBD 1NBVL 1PG7L 2AXJA 4G43A 3DVGB 3KS0J 4BFGA 2AEWA 3TCLB 5D1XD 1BX2B 4PLKD 1DE4B 4G5ZH 3PXJA 4ZXBA 3U30C 4LF3A 2YD7A 4L5FH 3A6CL 3H0TB 3K7UA 3V7AE 1I8MB 3L3DB 1M7XA 1EEUA 5DT1L 4OD2B 4F7PB 3ILPB 3RUGB 3KLHC 3MR9B 5EFIA 4RFOH 3LEXB 4OCSH 1B9ZA 2XZQH 4TOYH 3UX9B 2UZYB 2AXGA 4D9RD 5E03A 5B21A 2X5PA 2FO4A 4NO2B 4HWBL 1F3DH 1P7QB 4HKZB 4WWID 4NQED 1XCTA 5T3XL 3DIFB 3EW3B 1R0AH 5GZOC 2X4NA 2WUBL 1CLYL 3TYGL 1XAUA 3BI9X 4KZEL 2AJXL 4R2GD 5HHNB 1AI1L 1W72L 4KC3B 3KR3L 1KFAL 3MJ8B 3MRMB 3N1QC 3PQYA 4PGDA 4PJAA 4ZS7L 1EJ6A 3V0AC 4DAGH 2EDTA 3VFVB 1EAJA 4JY6B 2Y72A 4YDJB 2R29H 4HK0A 1J7VR 5DJ8A 2AJZA 2VWEC 3MV9A 5DVLA 1CI5A 1G7QB 4MVBC 1VKXA 1GHFL 3UDWA 1A6ZB 4ZAKB 5HGHB 1N64L 5J57B 2VC2H 3Q5YA 4R7NB 1TQCB 3LKNA 2AAVA 3ARGA 4QRSB 3QDMB 4MMXC 4YHYC 3VFNB 1DLHB 5I1EH 3T4YA 4QRRB 3GHBL 7FABL 3ARVA 5IB4B 1MJJB 1AKJD 1A6VL 4RZCA 5IBUG 3HC3L 4C83B 3DRQB 4NC1E 3SEPA 4RMWA 1N2RB 4EUPH 1K85A 2DI8A 3FT4B 1TZIA 4MXQC 4U1KB 1WBYA 2MQ3A 1CICD 4FMKA 1H3VA 3EJZD 5DMGD 4TVPD 5T33L 2J8UE 1S7XB 5IVXB 1H3PH 1KTKE 3FN0H 1YDPB 3CVIL 4GH7B 4H1LB 4X6CE 1BIHA 3STZB 4CN6A 1G9NL 3KYOA 3BN9D 4HUVB 2RFXA 2QBWA 1RJZA 5F1NA 1M7DA 4MXVE 4OCNC 1PZ5B 1CXEA 2BNRB 3Q5TA 1D5BA 4OM0H 1JNHA 1QG3A 1T5XA 1T4KA 2H26B 3QIUA 3I3BA 1NAMA 3DRTA 4K3DL 4DN3H 1FL3A 2UVEA 4JO1L 2F54E 2H2SC 2NW2A 3WJJA 1PFCA 4UIKH 1DUYB 3JUYA 4K9EL 2X89D 1OOAA 2YZ8A 1F13A 4Z78A 3IGAA 1IGCL 4KRNA 5BJTA 2R0LL 1KPRA 3RI5F 1J1OL 2P48B 2KKQA 5D93B 1BECA 3DYPA 3VXME 2ORBL 4N90E 3UTOA 4Q6YA 4HFUL 1X5YA 2MOVA 1QR1A 5LGJB 1JJUA 2YD6A 2VDKH 2VLJB 3ARWA 3SKOA 2OTWB 3T4AB 1CF8H 4N0CC 1JYVA 2BJML 3OZ9H 3WIIL 4M48L 4GXVL 5J13B 1MJ7H 1HQRA 1UWGH 5E8PA 3V5HB 5B38G 1UB5B 3IU4L 3EJYC 2J7LA 2GYSA 3O2DH 4P57B 3VXTB 5HD8C 2E7LA 3UBXA 2AV7A 4ZSOA 3VXRA 5KSAD 1JNNH 2FO1A 1MQKH 3NACL 3T1WA 3QXWA 4K3HA 3Q6GH 4F58L 4JZJC 1KCSH 2EDOA 4HWZB 3QCTL 5FGBC 4MSWA 3O0RL 4PJGF 1H15A 2YD2A 3IRZA 4LSPL 3WS6A 3U36A 3BPCB 1O7SA 3PJSB 1R3JB 2HFFB 4M7LH 2NY3D 2VDOL 1A6TB 1U3ZA 4IEFB 1HH9A 1I9JL 2OQJA 3UTSA 3TH3T 1QFOA 4K3EL 2DLGA 2XWBA 1EGJH 1HKLL 4JY5L 4EKXA 1T7YA 4TNVF 4UB0H 4L8DB 2X1WL 2ERJB 2WBJA 4G6JL 4M61B 1T66C 4FQQB 4GQPH 1G6RB 4KJYB 4Q0XL 4D8PA 3L3OB 3R0MA 4ONGL 2XZCL 2XZZA 1QFWM 3DVGA 1S7SB 2NY6C 1BX2A 1TFHA 4I13B 1DE4A 3VXUD 1RZJL 1C1EH 4GJTB 5LWYL 3Q5OA 1TVHA 3H0TA 1I8MA 1B2WL 5J1AB 3L3DA 4PRIB 4RCAA 2GK2A 4F7PA 2Z8VC 2CIIA 3QEGH 3RUGA 2AQ1A 2D31B 4WWKC 3VXPB 3VRIB 4UQ2B 2R8SL 3B9KB 2YPLE 1R3IH 3QNZB 4G42A 1QRNA 1A0QH 3ZLQC 3U9PH 5IJKC 4NO2A 1P7QA 4HKZA 2XKSA 3UTZA 4AH2A 3P4LA 3QXDA 3O2WH 1YNKH 3FRUA 2P8PB 4JPWH 3FCTB 3MLZL 3K4DA 3OHXB 1MIML 4FQJH 3FB7B 3BISA 3PGCA 3F7VA 1QA9B 4GBXD 5HHNA 3BEWB 3ULSA 4UT7H 4PBVC 1XIWB 2I9LA 4YDJA 1A5FH 4PLOB 1EERB 4O5LL 2P8MB 3QR2A 5HI5C 2AW2A 5HJ3B 3EHBC 4PPTA 2J4WL 5CEZE 1FGVH 5D2LE 3TBWB 1OARL 1G7QA 5D1QA 3RIFK 4EBQH 2DQIH 3KLAB 1FFRA 1KACB 2YN5A 3EBAA 4OI7A 5DUPL 1A6ZA 4ZAKA 5HGHA 5HPMA 2CJUH 3TO2A 3QO1B 2I5YH 1S7WA 5TQ2H 3RWHA 1IKNA 4QRSA 3QDMA 3VFNA 1LEGB 1DLHA 1J0KA 4P2QE 3SGJA 4WIQA 2UY7A 5DUMH 1MJJA 4UTAH 2BVUA 4JFOB 4PGBB 3PG2A 3NAAH 4C83A 3DRQA 5HDOA 1SY6A 2VDLH 2EDXA 1WBXA 1D9KC 3FT4A 3S37L 4P46D 1J5OL 5GISL 1T3FB 4GUPB 5HTSA 3G5ZB 2IMNA 3GIZL 4PB0L 1S7XA 5IVXA 3H9ZA 1NFDF 2R0KL 3DI3B 4OTXH 5CJOL 1HDMB 1YDPA 3B2UC 4L8SB 3QUZD 1N6VA 3D3VE 5C0AB 3LRSB 3VFSB 1ZEAH 4P5TD 4HUVA 5T3ZD 4HS6B 5FA3B 1PZ5A