5EN2B

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
b'DIVMTQSQKFMSTSIGDRVSITCKASQNVGSAVAWYQQKPGQSPKLLIYSASNRYTGVPDRFIGSESGTDFTLTISNMQSEDLADYFCQQYSSYPLAFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GD01 heavy chain
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
total genus 55
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2B01
1ZTXL 4PJAF 3GMRA 4IMKC 4E41D 4JG1L 5K9OA 5HDQL 2AEPH 3C60B 5IR1B 5KS9E 1NC2D 4IRSB 4JEGB 5I0ZA 1N6UA 1TPXB 5ID1B 1DVFB 4LOUC 3TBSA 2JCCE 3HNSH 4XPFL 4Y2DA 4HT1L 5J8OA 3F7YB 4LVHB 3TO2B 3HG1E 2EDBA 2Z8RA 3QISA 2IFFL 4TSBH 1G7QB 3C5SA 5BMFH 1OAZH 43CAB 2AJXH 2CDEB 1AGBA 5F44A 5IVXA 4ZFOB 5I66A 5I73B 5IVZB 5IW3A 2H26A 1CFQB 1WFOA 43C9B 1FZKA 1WGOA 2C4FT 5IMKB 2W60A 3ZDXE 4KUZH 3MGTA 1FL3A 3ARGC 3MLZH 1I8LC 1TTUA 2EXWD 4S1DC 1IM3A 3GJFH 5KAQF 4LLQA 1PBYA 4L8DA 4N90D 2X9YA 2NY7L 4H20L 5D1ZA 5I1AA 4WWKD 1IEBA 4OTXL 2QQQA 4QT5B 3C8HA 4LFHG 3GSWB 1INEH 4DN4L 5CJBA 2FWOA 5DWUL 1F4AA 4IOFD 1BFOA 4QNPF 1NJ9A 1H0DA 1XCQA 4R8WL 4TRPL 4QKXB 3HKFA 1BOGA 4JO3L 4ZO6A 4LEXL 3L3GA 1VFMA 5ENWB 4MX7A 4XT1C 4OIIL 2HTLC 2PW1A 1NBYB 2V17L 5GRXG 4APQA 2IADB 2B5IB 4S1QL 1TMCB 5D7LA 3CDGB 5D5MA 1KCKA 1EXUA 1ORQA 2YRLA 5T33L 1HYSD 1XGQA 4KI5C 1KTDB 3RBGA 5EOTB 3W11D 3L3OB 2A6JA 1MCIA 3O4LD 4KTYA 2EO9A 4M7LH 5TJWK 1ZS8A 5FYJL 1UZ8A 5E5MA 2XZAL 3VXSD 5E2VH 4ORGA 1DBAH 3GSRA 3F7PC 2VMFA 3VXQB 5DJ0B 3F58L 5HGGS 4LSTL 4NRZA 2Z93A 3DX9A 3KPOA 2VO5A 3ARED 1B0GA 3MLTA 3GBML 5JHDB 3NPSC 5EN2B 3AAZB 3MZGB 1JVKA 3PG2A 4BM7A 2EKSB 2NY0C 4K3HA 4YDLC 1R5WA 3HG1D 5A2FA 1BWWA 1UH4A 3SQOL 5IMLA 1V7ML 3CU1A 4NCC2 1A7PL 1ZOXA 3V4PH 2WBJB 1QBLH 4X83A 5DTFA 3BOVA 1A5FH 2X4OB 4K9EL 4OGAD 5IF0B 4EI6B 4YHNB 1E6OL 2R23B 3SKMA 3W39B 4MDIA 3QBTB 4QRUB 4Y88A 2ESVE 4NNYA 1F90H 4NJ9H 1IT9H 4HG4J 3KXFD 3FZUD 2X9XA 4AEFA 1N4XL 3GIVB 5I1KH 3UTOA 3JXAA 4WHYH 4U6HB 3QT2A 1BAFL 5TDNA 5FCUH 3FOMA 2UWEB 3QHZH 1Z9LA 4HJGB 2AXHA 3IFLH 2QSTA 2W0FB 1PG7W 2XN9E 1CL7H 2RJMA 8FABB 5KSAA 1T04A 4U05A 3VW3L 2BZDA 3BPNB 4YXKH 1ND0B 4PJXA 5DUPL 3DECA 1OPGL 3LPWA 2QQLL 3MJ9L 3T2NH 1SBBA 3PDOA 5SWSA 3AU1B 5FHBH 3QUZC 5K9JL 2PNDA 3EJZD 4XVUD 1CDYA 1V7NH 4PJFE 3BP5B 5EU6A 2BMKA 4OSUH 4RFOH 3E6FA 2CRMA 3W5NA 3Q1SH 2FX9L 4YHIB 1OSPL 1D9KB 3MLYH 4L29A 4D94A 1BZQK 5ESVB 2NR6C 3O6KL 3VG0L 2H41A 1WAAE 3VXRB 4GKZA 2F74A 3DTXB 1WBZA 3OKEA 4ODHL 4WV1B 1GHFH 2D0GA 1LEGA 3CJJA 5J9PB 1G7MB 1AP2A 4HFUH 1LP9B 4K7PL 2F9BT 3GB7B 4WY7L 3K81A 3PGCA 4LKCA 4GRLA 5EO1A 4HH9A 4LKXA 4KK6D 1FIGL 2E27H 3I2CL 4R0LC 4ZD3H 3G6AA 5IESH 4OLVL 5F9JB 4BQ8A 3QQNA 5DDHB 2WP3O 4V1DA 3V95A 1WF5A 4JVUA 3W9EA 2WWKO 2AJSH 2WQRA 3DRQA 4HZAA 1U6AH 1IGCL 4PRIB 4LLVB 3OKNA 4Z7VF 2XZCL 2FNBA 3WFDH 5JIPA 2EDQA 2LTQC 2E9WA 3DBXB 3SE3A 1Z5LA 4OQTL 1I4FB 5E8OB 3DV6B 4XAWH 1L9NA 4Z7UF 1Y6KR 3OX8B 1F13A 3MO1A 3LQAC 2J6EL 1RMFL 4NGHL 4TSAH 3VXOB 4I18A 3DX6B 2H8PA 4JRYB 3S88L 3SHSA 4L4VA 2R0LL 4PRDB 2APVA 5TF0A 3A6CL 4FABH 2XA3A 4CJ0A 5E1AA 2B20A 5KVGL 2VDKL 1OP9A 2IANA 4K71B 3EGSA 1CDBA 4P5MB 2ZOLA 2G2RB 4JFPB 3ARUA 3ARFC 3SE8L 2ZSVA 3LN4B 1ZLWH 1BQSA 2HTKC 4D0CA 1NAMB 2JIXB 3DNKA 4V2CB 1EMTH 3BDYH 4HJ0D 5HDBE 1U8PB 1JK8B 3JV4B 2V2TA 3HZYA 5DMKA 4OD1H 1M4KA 5CD5C 3HTLX 4M8QB 3BEVB 2ICES 3MRNB 4X6DE 2FBJH 1LO4H 5I74C 1CF8L 1W72L 3SCMB 3CMOH 4QY8A 5I17B 1FE8H 4DOHE 2O5XL 3HE7A 1LO2L 1U58A 2J88L 1LK3H 4KQ3H 4LLDA 3BYTA 3DSNA 3L1OL 2YA2A 5EDXA 5HHXH 2MCG1 5DHXB 4ZAKB 3IFNH 4RGNB 2EDOA 4BQ6A 5ITFB 3AVEA 3SQBA 5BV7B 5DGQA 2R1WA 4NZUL 5I75B 1OQXA 4G7YH 1ZANH 5D7IB 4QF1A 1LO0H 2RCSL 5MHSE 1MI5E 5FUCE 5KSUA 1W0YT 4DZBA 1BVLA 4ZG1A 2CLZB 1MAMH 4QRRE 1MREH 3QH3B 4S1RL 4NN7B 3BZEB 4XI5D 2IPTL 4L9LA 4M7ZB 1KOAA 1R24A 5JDSB 1B0WA 3TBTB 3UCRA 5DSCB 1Q94A 4HG4K 4NM4H 4OT1L 3ZTJG 1QRND 2Y6SC 4XNXL 4MXQC 4P2OC 2C3WA 1A1OB 4MAYB 4X6CE 3BH8B 4UB0L 3EO9H 3O6FA 4WDIB 5C08A 1OTUD 2UY7A 5EZLB 3LEXA 1U95A 5J1AA 3VJ6B 3RU8H 1QHOA 2V7HB 1CD1B 3BGAA 1ZEAH 1UVQA 3QNXA 4A2MA 2PCPB 3EYVB 3RTQD 3K4AA 4K94H 1C16B 2AXFA 5CGMA 1TQCC 1BJ8A 4JPVH 3NZHL 4XVTL 1MFDH 3HHRB 1CD9B 4W70A 4JRWA 1Q9KA 1AGEB 4AEHH 1ZGLA 2WUBL 1FC2D 4X8JB 1J9CT 4HF5H 5EU5A 4CVXA 2C1OA 3C2AH 3GGWB 3MJ7A 3VRLE 3U4BH 1AGFB 1WBYB 5EOQL 2VDOL 5C0DB 1VENA 4WU7A 3V52L 3VXPA 5JA8B 5A40E 3SO3C 1FNEA 1NLBH 4XNUL 1IGMH 2NNAB 3OR7A 4G8FB 3RY5A 1RURH 4QTHA 4LAQH 1YYLL 4I0KA 3SDDB 3WXVH 3CSGA 4G42A 5ETUB 3PP3H 5IMOA 1V5JA 2GAZA 4NUJB 1IM9B 2OMBA 2VL4A 1KN2L 3UMTA 1I3GL 4LSSL 3IXAB 2HVJA 3CLEL 4EOWH 2BRQA 4FFYL 4WEUD 1MI5D 2JELH 3HI5H 5IGXL 3ZL4L 4N8CL 4X7DC 3DHMA 4QRRD 1DN0A 4Y5VC 2I07A 2DIJA 1I1YA 2ICWA 3ZSSA 2BFVH 4IHOB 4WCYL 4D9LH 1T5XA 3EYOB 1P7KA 3HPJB 5FDWB 4IDLA 3S4SB 4Q2ZB 3EFDH 1EO8H 4RIRB 1NBQA 4ODWA 1XT5A 5HHPA 3NVQA 5JUEH 1XF5B 4R4BB 5KVFL 3GKZA 4JDTH 3VXUE 4G9FB 1T2JA 3WNOA 4G8EB 3NOIA 1U8IA 1A9EA 5D93B 1A9BB 5C6TL 3V7AG 1UJTA 5T1KA 4QHMB 1VDGA 1IAIM 4Y16A 3O9WB 1J7VR 4JJ5B 2NY4C 3MMEA 3STLB 4X6EA 2O5YL 4CRPA 1DEEB 3QXAA 4LRIC 4XH2B 5JXEA 5ICYA 5I8CB 1I8MA 3S98A 4AIOA 4ZFZA 4Y2DC 3KPSE 1MCPL 3FT2A 5DK3A 1CFSB 4JFZL 4ODVL 1T0NA 3CVHL 3UYOD 2ARJA 2VABA 4U3CA 3IAQA 4XMPL 1A7QL 2LAGB 1FORH 2OTWA 4HK3N 4C56A 3TBSB 4JPWL 4P2QE 5KBNC 3PL6A 6CGTA 4RAVA 3GIZL 5HPOA 4ODXB 2D03H 3VWJC 1XIWA 1MNUH 1NGQH 1VEOA 3HFML 3C5SB 5GJTH 2FEEL 2JJUA 4M93C 1AGBB 4NN6C 2DQHL 5T5FH 1OSZA 4JR9L 3PIQB 5IVXB 1N0XL 5I66B 4FFWD 5DLMH 5KANG 2H2PC 2H26B 5FF6B 2WMPA 4YHLL 4XX1E 1FZKB 1NCCH 4UBDC 5D1ZC 2QTEA 2VXVH 2ZUYA 4D8PA 3MGTB 1FL3B 3QFDA 3KXFA 5F1KC 5F72S 4HUWB 4NUGL 1IM3B 4GAJH 3P77B 4L3CA 5HI3D 4EBQH 1ZWIA 4LLQB 5IQ7H 2NMSA 1MHCB 4DQOH 3GO1H 4X5WB 3UTSA 1D5ZA 3HZMA 5I1AB 1AXTH 1IEBB 2QLVB 3QPQC 3MLRL 3LMJH 3FB7A 4WNQA 4XWGL 3KYOA 3DO7A 3JBG7 2DAVA 3C6LB 1T89A 2ITCA 1UXWB 3O6MH 1H0DB 1XCQB 4TQEL 3TYGH 1UFUA 3MQIA 1BOGB 5AYUL 5MENE 4QEGA 5F8QC 1ZT7B 3L3GB 4LLAA 3QFJA 4MX7B 1EHLL 4WTZA 1LDPL 3ARYA 1DBBH 2D31A 3EDEA 4XPBL 4APQB 5D7LB 4OGXH 3TN0D 3DXAA 4O5LL 1EXUB 5ISZD 3HAEG 3B3IA 2B1HH 3EJYD 3Q6FB 3VXUD 1K2DA 4W6WB 2A6JB 3H7BA 4KROD 3RUGA 1MVUA 3PHOB 3RRQA 4YWGL 1ZVYA 3ZT5A 1NCTA 2F58H 1CXFA 1P4IL 3CUPA 5E5MB 1HHKA 2A38A 3A67H 4ORGB 3RNKB 2BSSA 3GSRB 4XC1L 1KPUB 3SOBL 3T4AA 2PO6A 4Q9BA 2LFGA 3KPSD 2XWJB 3DWTA 5CFHA 4N8PA 3VFUA 4NRZB 4C54A 2Z93B 4Y5YC 4FFZL 3MLTB 3LEYH 3I75A 5I76A 3GZKA 2X1PA 5JZ7D 2BNRA 5L6YH 1YYMH 5I1EH 4P2QD 4N8VG 4PJAE 1GH7A 2W07A 2DYPD 3TA3C 4Z5RB 3FN0H 4I0PA 2HJFA 5TPWH 1U8OA 1H8OA 3QULB 1U42A 2J3SA 5I1DB 3F6LA 3JWOL 2JF1A 4R4ND 4DZ8A 3CFEA 3HC4H 5DTFB 1KGCE 3A6BH 4WO4A 3SDAD 1MCEA 1OHQA 1NDGB 4OAWA 1WFUA 3SKMB 1JGVL 2VLRE 4NKIL 4MDIB 3WIHL 1CXHA 5CJ8A 3X3GH 3DX8A 4HWBL 5FCSH 1F4XL 1JIBA 3PV7A 2RQ8A 5HHOA 5GZOC 2IFGA 4M9PA 4EVNA 1XMWA 1CGTA 4W81A 2YZ1A 5F9AC 2BNUA 2QHLA 2QJDA 1K3IA 3CDYA 2AQ3A 6FABL 5TDNB 3VXTA 1B6DA 4OUUA 3FOMB 3UTTE 3L6FA 1H3PL 3CPLA 3BKJL 4X99B 1VFAA 3NABL 2G60H 4UNUA 5KSAB 4HCRA 1T04B 5MEND 5DURD 5KN5A 1C1EL 3BESR 5FUOH 4PJXB 3GSUA 3TV3L 4TOYL 5I1CL 1QVOB 2AEQL 2VXTH 3FMGH 4R90H 3RX8A 3PDOB 3QDHA 3LQAL 4F9LC 4P9HH 4QNPE 5LGJA 4GMSH 3WIIH 1C12B 4RDQF 3VGBA 1NCDH 5ANMA 4JLRA 3TH3T 4OUOA 4G6JH 2Y25A 2BMKB 3C9NA 2FEDD 4N0UA 1QO3A 4HV8A 4PGDA 3F7VB 4EQ3A 4L29B 5KVDH 2WQ8A 1HI6A 3JVGA 1E4JA 3HNTH 4FRWA 4GKZB 4NKMA 2HH0H 1WBZB 3SDXB 1J1PH 2ZJSL 3TIEA 3OHXA 4GRLC 4HIXH 3THML 5HXMA 4NCC1 5IBTL 2HRPH 2VL5A 1I1FB 4GUPB 2WBWB 4TPRL 3ZYZA 2F8VA 3UJTH 1AP2B 1I9JH 4HCRH 2EXYD 4ZUSB 4MHHG 3PGCB 1MCWW 4LKCB 5EO1B 5DK2B 4HH9B 1X5JA 4N0CC 2R2HA 3IB4A 1K6QL 5CCKL 3CFCH 3G6AB 5C09B 3O2DL 2P42B 4NZRH 4WFEE 4RMTA 3S35H 1KGCD 1T0PB 3U46A 3SE3C 4O02L 2EYSB 3NCFB 5E00B 4R2GB 3W9EB 1T7WA 2VLRD 1A3RH 3DRQB 2PYFA 4PJ9D 3WDHA 4OI7A 3PWPB 4I18C 4R96A 3V7MA 3MXVL 1Z5LB 2EDFA 5FB8B 5ITBL 1GOFA 3BZ4B 4UI2A 5KG9A 4KPHL 4KJPD 2EIZA 2FLBT 3MO1B 1KFAL 5EULV 3BRDA 4L5FH 2DLFH 3GHEL 4G80A 3QDMA 3OAUH 1A4KB 1K5NB 3UTTD 2H8PB 3IVKA 1NCBH 3RWIA 4L4VB 4PJCA 4KMTL 3TWCL 1JMZA 5EO0A 4LSVL 3TGXA 4FXLA 5E1AB 1P7QA 1KLGA 4O51B 2VKXA 4HW6A 3GDBA 4Z7NF 3EGSB 1NLDL 4WI2A 4MXWH 2A73A 1GSMA 1BD2E 4OGYH 5DGRA 2D7TL 1FP5A 1I1CA 1D5IL 2BP3A 1QOKA 1IGTA 4S2SA 4WW2B 4M43L 1KULA 4ZFGL 4X4MA 1MCLA 1GGIH 5AWNH 3VA6A 4QCIA 5IJKC 2ATKB 5MEOA 5T3XH 4ORZC 2V2TB 2NTFB 1RUAL 1IZJA 2JJSA 5FO8A 4P59L 5I0DA 3NIDF 2VZ1A 2Y1VA 3AB0B 5I1HH 4POUB 4IDJH 4QY8B 1BM3L 7FABH 5F9OL 3HE7B 5DVKA 1U58B 4DW2L 4PGCA 3T0EC 1HHHA 4R7NB 3ILPA 4CJ1A 1DR9A 2XTJE 2Z91A 3ZHDA 3ILQD 1KELL 4K94C 3EOBB 3MSPA 5LCVH 1SY6A 1FFRA 1JGUH 4G6MH 4P4RB 2R1WB 4LSQL 4PJ5A 3W0WA 1C8PA 1HOCB 4WFED 3U1SH 4C58B 3MRMA 2APWA 5FECB 5KSUB 4DZBB 5J7CC 4L9LC 1HN1A 1UENA 1OAKH 4JPKH 2AEPL 5JQHC 5TE7L 5J4MA 3MJGX 1FGNH 1YQ2A 1BECA 3H9HA 3HNSL 3ULUH 1R24B 1T5WA 3ZDZF 5HSFA 3BWAA 1RHFA 4J3WA 5SWZA 5J56B 2VXQH 5BMFL 1OAZL 3O6FC 5E4EC 2AJXL 1Q94B 1RIUH 4OZIA 4OKDA 4FOMA 4BJLA 2ZPKH 4Z7VE 2GK2A 3RWCA 2HMID 5FYJU 1FG9C 1CQYA 3FQNA 3RVVD 1Q8MA 4P2CG 4OCYH 3RY6C 4Z7UE 5E5UB 4KUZL 1RZJH 3HPLA 5I9QB 3MLZL 1Z2KA 3LEXB 1ZT1A 1U95B 1X5GA 4KFZC 2EDDA 1AR2A 1BD2D 1UVQB 3QNXB 3LIZH 1CN4A 3LKQA 2AXFB 4J4PD 4Y4KD 2ZWLT 4LCIL 1INEL 1NC4D 3K8MA 2FR4A 3ET9F 5JTWA 3KVQA 4UT6H 1RU9H 4J3SA 2VXUL 1ZGLB 1NFDA 3HC0A 4XXCA 1M05A 2C3VA 4CVXB 3RVTD 1LDSA 3MJ7B 3U7YH 3FJTA 5CP7A 2EXWC 4UU9A 4J12A 4PV8B 4WHYG 4HAGA 4WU7B 3S7GA 3WS3A 5E7FA 3ARDD 4OCLC 4YPGA 5HYQA 3NBNA 1FNEB 4MSWA 3QIBB 1PKOA 1B4RA 4WWKC 2VDMH 1P2CA 2OL3L 1F3DJ 3IS1X 3CFIC 1M7XA 3OR7B 1CLZH 2AJYH 2F54E 3L3KB 2ICWJ 3FO0H 4JREB 3H6JA 2XTJD 4IOFC 5GRVL 3UDWA 2OR9H 4G42B 3IRPX 4PRPA 4XPAH 5IMOB 2GAZB 3EOYG 5F7KC 3NN8A 2PYEA 4M7LL 1HYRC 2R39A 4YPJA 3H3BC 1TVBA 5E2VL 1GGBL 1DBAL 2ZG2A 1CFTA 1DE4A 4KKAC 2P5EA 1X7QA 2QKIA 1KCSH 1OLLA 5BVPL 1HYSC 3QIUA 5IB5A 2I07B 1I1YB 2ICWB 3AMKA 4AL8L 1T22A 1T5XB 4YBLB 3W11C 1P7KB 1BX2A 1RZFH 2EIBA 3S34H 2Z8WC 3FO9A 3UTQA 1IQWH 4Y16C 1C5BH 1RPQA 4RGOH 4MD0A 4ODWB 4PUBH 1SEBB 4Y1AA 5HHPB 4WEMB 1DQJB 2AJVH 3TPKA 3B2VH 2AERT 3HA0A 1AY1H 1A5FL 1FNAA 1A9EB 2AS5M 1OAXL 5T1KB 2NXYC 3EHBD 5F7MC 4NO2A 5INDB 3QI9D 1N5AB 2GI7A 3MMEB 1FLRH 2X7LA 3MRJB 4MZ3A 4NQEE 4X6EB 1VGEH 3QXAB 4NJ9L 1I8MB 1IT9L 1MFBH 3RNQA 3NIFF 5E6ID 3PL6C 4MD5A 2P4AB 5AYQA 3QWQB 3WUZA 2I27N 1D5MA 5ALBH 2G5RA 1F58H 1T0NB 4DVBA 5I1KL 3AMLA 3IDJA 4BZ2H 1Z9MA 2ARJB 2A77H 2VABB 4OGAC 1MAKA 3F7QA 5FCUL 4ERSL 2OTWB 4GQPH 3BRGC 3QHZL 1EK3A 1WT5A 4PJGA 5CSBA 3IFLL 4F33B 4RAVB 1IVLA 4LARH 5H2BA 3QUYB 1XIWB 2FO1A 4YUEH 1YZZA 4OFVA 5IG7A 2KQMA 4YXKL 1A1NA 3T2NL 1OSZB 4OF0A 4O2CA 4LSDA 4PG2C 3QCVH 4PY7A 5FHBL 3GSXA 5JIKA 4D0DA 3IDIA 2HKFH 5D7JD 4NN5B 1DQMH 2F54D 5D7KE 4N0RA 1TXKA 3QFDB 1KV3A 2HVKA 1JWUB 2AJ3B 4Y4FD 1IKNC 3MXWH 5DUMH 2BVOA 3V6OA 1V7NL 3UBXB 4L3CB 3QAZC 4GQ9L 1MCNA 4H8WH 4OSUL 4RFOL 1YMME 4KMLB 4NNXA 5C0AB 3MLYL 4L3EE 2HA1A 3CFJB 1GRWA 3UP1A 4R4FH 3KYOB 4MB5A 3QP3A 3PF2A 2FYYA 3MNWA 5J89A 2ITCB 3FQTA 1N59B 3EJZC 1GHFL 1YEKH 4XVUC 4MVBD 3K2MC 1IAOB 1I7TA 5DJXA 2NXZB 5IJVA 4JM2B 4HFUL 3L95B 3KAAA 3DOSA 4BA8A 2D31B 2PXYA 1MCDA 2FH8A 2E27L 2NW2A 3MGOA 4ZD3L 4JE4B 1V3JA 3S3PA 2K7QA 1CG9A 4G8GB 4PJDE 1WC7B 3B3IB 5IESL 3BIBX 4OLUH 1RUKL 4RX4D 3VFPA 3SGJA 3H7BB 4BELD 3UXFA 3EYQC 4NP4L 3RUGB 4NRYA 1TFHA 2AJSL 3G5YA 4ETYA 1JGDB 4XPGH 1S7XB 2N7BA 3CUPB 4NQED 5GIRB 3T3MF 1HHKB 4JHBA 5TDPA 5EIIA 1U6AL 3BXNA 1EFQA 1F5WA 3WFDL 4WUUE 2PO6B 3T4AB 1EBPA 4YAQA 4Y5XA 1WZKA 3WDJA 5D2NB 2BOBA 4XAWL 3VFUB 5TE6H 3RX7A 3I75B 2RIKA 5GGSB 5I76B 2CIKA 3O2VH 4P9HC 5IW6B 1OARH 4WO4C 1UYWH 1WCBA 5IKCA 3MLXH 4R26H 4I0PB 5I18H 4JRXE 4FABL 2YWYA 1U8OB 3CFDA 3D69A 2W0KA 5B8CB 4K8RH 2OI9C 4AT6A 1YMHA 3NACH 4OAWB 4YE4L 3D0VA 1RZ7H 2G5BA 2DKMA 3V4UL 4U6TA 1VHPA 3V4VH 4EXPX 4ZOAA 3TEUA 4GS7B 4NC2B 4EVNB 1EMTL 3LH2L 2VSDA 3U0WH 4Z77A 1UXSB 4L3ED 5F3HA 4M1CC 1KXTB 4OD1L 4HWZB 3VXTB 5SWQA 3CPLB 1LO4L 1VFAB 3MUZ1 3HRZA 3HS0A 3HMWH 3ARPA 4J23A 4OFYA 5DVOA 5KN5B 4KI5F 3LRSB 4JFEE 1G6VK 3GSUB 4JVWA 5HHXL 1JCKA 4NQCD 3WL9A 1XGPA 4HJ0C 4LLMA 2PUQT 5I1JL 4ZXBA 5GRUH 3B9EA 4PJEF 5T1LB 3CLFH 3QEQA 4JVPA 5CGTA 3L5HA 1ZANL 1LO0L 1LGVA 2B1AH 3MC0A 5BXFB 4Z76B 3BT2H 1H3WM 1TJHL 1HCVA 3C9NB 1MAML 1X5IA 4Z0XA 1LVEA 4PGDB 1QO3B 4HV8B 3P9MB 1GAFL 1JV5A 3ARQA 2VWEE 5HDOA 5EU4A 4LQFH 1GZQA 2DQUH 5HGHB 3L3HA 1UM4H 4NKMB 3MRDB 4WUUD 2Y36H 3TIEB 1YY8A 3OHXB 4PYHA 3VXMA 4KTDH 5LGHL 4BFBD 1NGYA 2NW3B 4MNQE 4Y2OA 4NM4L 1S9YA 4PP1C 3BO8A 4H1LH 5I1GH 4DTGL 1MCBA 3LB6C 1EO7A 5FM4A 4FP8H 4NO0A 3SBWA 1K85A 4JY6B 2APXA 3EO9L 1T1YB 1RVFL 1AJ7L 3F12A 3TC9A 4D0BA 3U46B 1LO3H 1MF2H 4NRXB 3RU8L 2APFA 5T1DH 1ZEAL 3RVXD 3VFGH 4K94L 4JKMA 4JPVL 5IEKA 1UA6L 1MFDL 5JLZA 4FTVE 4R96B 1XCTB 1KEML 3F65A 4LCWB 5K9KA 5J3HD 4BUGA 4HF5L 1DUYA 2EIZB 1OTUC 3C2AL 4XWOD 5I30H 5D1XB 3RIAF 5IMMA 4G80B 1KCLA 3QDMB 2WK2A 2E9IA 4K3EL 3QUXB 3IVKB 5K59F 3NCCB 3RWIB 3RTQC 1NLBL 4JFDB 4PJCB 3RZCA 1IGML 2R29H 1HZHH 4JFED 4R9HA 1BF8A 1RURL 4BSWA 4GBXA 4LAQL 1KLGB 1FL6A 2PKDA 5GGUB 3GMPA 3WXVL 3DMMA 5HGAB 3N9GL 5C07A 5DD0H 2DJSA 3B5HA 4UILH 2AJUH 5AAMA 5DD3H 5I15H 3ULUC 4R7DA 1IGTB 4S2SB 1IGIH 1KN4H 2IBZY 3ZKXC 4GG6B 4PRHA 3UZEA 1MHEA 5GGQH 1B90A 5MEOB 2BFVL 3WNPA 4LPUA 4TVPH 4D9LL 4H88H 3ARBA 5ILTH 3RGVD 5FO8B 5BQ7B 3VFWB 3EFDL 3EDDA 1M71A 4NOBA 4QXUL 1RZJC 1NKRA 1VFBA 4EI5A 3HI1B 4MNQD 3NFPA 4LVEA 1HHHB 1AO7D 4JDTL 3ILPB 5ACMA 2F53B 3WKMH 4N5UA 2QSQA 1P9MC 1U36A 1BVKA 2GJ6A 5FV2A 2VLME 1SYSA 1AKJD 3U2SB 1IAII 1GGTA 1T80A 4PJ5B 2SEBA 3MV8E 4MQXD 5E8NB 5C2UB 3MRMB 5IT2H 4NZTH 3WEXA 1NUFA 2LU3A 3CNKA 1R3HA 1INQA 1R3JA 1E6JL 4LK4A 1A47A 2PETA 3FFCE 4K07A 3VWKA 1FORL 4FTVD 2WBKA 5HBBA 3NPZB 4IJ3C 2CLVB 1T5WB 2AV7B 5GS2H 3BWAB 1GGCH 3GSNA 1QZ1A 2ZOKA 4ELMB 3ZKND 5T5FL 3FQNB 1XR8A 5DLML 5CAYB 3MV9E 3TVMA 1A6ZB 1NCCL 5IB2A 4WTZG 2K3TA 3HPLB 1IL1A 5FYJE 5KVEH 3VGAC 2EC8A 2YR3A 1U8QA 3TT1H 1ZT1B 4LPXA 4GAJL 2F5AH 1JRHI 4EBQL 1J5OH 3TCXA 1L7IH 1BQHG 4G6FB 4IOSD 5IQ7L 4LU5L 4PS4H 1HEZA 4DQOL 4XXCC 5HYJE 5GGVL 5E8EA 5JORA 3LKQB 1NAKH 1AXTL 3TO4D 1MCCA 3LMJL 3MZTA 1KNOA 4NC1E 3T1FB 4WWID 2FR4B 1KB5A 3RDTD 4FQJH 4Z7NE 3O6ML 3U48A 5JIIA 4QRQA 4O2EA 1A1MA 2P48B 1M05B 4U1HA 4Y8AA 5FKAA 1G9EA 4C57C 4QYOA 1EDQA 1TCRA 2IPKA 5CEYA 3UDWC 5EOCH 1QBBA 3GSNH 3WS3B 4YPGB 5HYQB 2D0HA 1IRAY 1OTTC 4MSWB 4U0RC 4M6NL 4OGXL 1P2CB 2E7LA 4ZO9A 1BBDH 1ODAA 1NSNH 1A0QL 2B1HL 4I48A 5D6CA 4DFIA 5FGCE 4PRPB 3NIDE 2VLMD 5BOZG 5CJXA 1U8HB 3IDNB 2E5EA 2CDGA 2WAHA 3QIUC 5M94B 1A4JA 2FECI 1T3FA 3H9SD 1TVBB 4JO2H 1YEEH 3A67L 1R3LA 2B39A 4ZTOL 3V0WH 3WNNA 3KLAA 3MV8D 1AD9A 3K46A 3TN0C 4CVZB 1X7QB 3B6SA 5IHUL 2QKIB 3SKUD 1QSFE 1RUPH 5DRZA 2FJFA 5IB5B 2HAZA 3DIFA 4NKOB 5DMJB 3SY0A 3QRFM 3NA9H 1I85A 1T22B 2XXCB 1BX2B 5L6YL 4KROC 4F7PB 5I1EL 3FO9B 3UTQB 3QZWB 5C0CE 2JB6B 1F4WH 2JK5B 1EFXD 2VR5A 3TZVA 3KLDA 3QG6B 4MD0B 4Y1AB 3H3KA 4P5TA 2FL5A 5C71A 1FFNA 4YZFF 2AXJA 2ZUVA 4H8WC 1DTUA 2NY1B 3HC4L 3PV6B 3A6BL 4F7MA 4ZUUA 4WI3A 4K3GA 4XMLH 3S6CA 4NO2B 4I13B 3MV9D 5EBWA 1KJVA 1RJCA 3ZDZE 4GRWB 4G6AD 4Z6AT 5JZ7C 5CP3H 2HKHL 1ACYH 2AABH 3GSQA 3X3GL 5D2LB 4JFOA 3RNQB 1TZIA 1YUHA 3ZYIA 4MD5B 4ALAH 1MCQA 3N1FC 3STBA 5ADPH 3NGBC 25C8H 4R6UA 3UTZB 3MRRA 5GXBB 1D5MB 4DVBB 5HYJD 4R4NC 4XCFH 3E6HB 3JWDH 3MCG1 3QEHB 1OF2A 2Z0BA 4HK3J 3SDAC 5IK3A 1NCUA 3BSZH 4HUUA 1YNKH 4CL7A 4MNGE 2X42A 4LNRA 4DUWA 2G60L 3O8XB 5H2BB 1JPSL 2Q8AH 1IAKA 2O5ZL 3DUUA 5TQ2H 5FUOL 4FXGA 3RPKA 4M61A 1OCWH 3B9KD 1A1NB 3FMGL 3JUYA 4R90L 2HRLA 4WFFE 4O2CB 2D9QB 2X1WL 1CGSH 3P4LA 3GSXB 1QFPA 4I3GA 3IDIB 4GMSL 3WIIL 4OZFA 3QXWA 3CSYA 4CMMA 2BSRB 1A3LH 2HVKB 2CKBA 3QIWA 3BGFC 1FZMA 2XT1B 3G5ZA 1AD0B 3MYJA 3MR9A 4P2RA 2BVOB 3OZ9H 3BPOC 3ISWA 2VN4A 2XKNA 4YK4B 2X5PA 5SV4A 3AS1A 3FCTA 3EFFA 4NNXB 3UYPA 5GRJH 4AEEA 5KVDL 2EH8L 3T0BA 4UTBL 1FNSH 3WYRA 3HNTL 3LRHA 1MPAH 2HH0L 1JYXA 1BJ1H 1CE1H 2FYYB 1J1PL 1QSFD 2UUDH 1NMAH 1EUUA 1MLCA 5C92A 5AD0A 2X1OA 4K8RC 4UAOB 5DJXB 3UJTL 5K9QG 1I9JL 3WFHA 3RP1A 5F7WC 4KKNA 3VH8A 4ZNCD 2PXYB 5C0CD 3PHQB 4PLJD 1PKQE 4GMTH 2NW2B 3MGOB 1Y0LA 3CFCL 1CG9B 4NZRL 4JG0H 2OL3B 2VC2H 1UQSA 3S35L 2VDQH 4ODTH 1DUZA 4YGVA 4BZYA 4Y5XC 4N68A 4CW1A 2FZ3B 3WKNA 3QDGB 4YHPB 1A3RL 5DQJA 5LAXA 1FYTE 3G5YB 3GK8H 1FIEA 3GRWA 1EEZA 2ZUQB 4WFHE 4X5LA 5TDPB 2EEDA 5IVXF 2ERJB 1D5BA 3BXNB 3IDYC 4ZS6C 2Y06H 2ZG3A 1H3VA 4PJBA 2HT2D 4XP9H 1Q9LA 2IMMA 2X44D 4KAQH 3QNYA 4YQXH 4L5FL 2CIKB 2DLFL 4OIBA 4RA0C 3OAUL 4MA8H 4YDIH 3NIFE 1JZ3A 3RL2A 5IKCB 4L1DA 4KJWD 4Z7OF 4EN3D 5F7LB 3D48R 3FO2B 3CFDB 3GMOB 3D69B 2Q7YA 1JUFA 3X12A 4IOIA 3VFOA 4WFFD 4MA1B 4KJPC 1E4KC 3P9LB 1MCSA 4MXWL 3PABA 4PRNA 1F2XK 4Z7WB 4JZJA 4M3JA 4KI1A 4OGYL 2EZ0D 4NQDB 1KCVH 4KJQD 4ZYKB 4GAYA 5DJ8A 1CXLA 3GRWH 4KGJA 5D5MF 2J8UA 2VLKE 1HXYA 1GGIL 3DURA 3GJEA 5AWNL 3GI9L 4PREA 4OKVB 3D85D 4ENEC 4TUKH 2BSTA 4M9OA 2X4PA 4LCCA 3O2WH 3OGOE 3HC3H 4HHAB 4XCEA 5CIPA 2QQNH 1PY9A 3SJVA 1FGVL 1KIRA 5FAAA 5SWQB 5I1HL 3REVB 3HRZB 3HS0B 5CGYD 4IDJL 1E27A 1KCUH 1U8NB 5B3JF 5IP4A 5F1NA 5DJYB 3CH1A 3WL9B 1ADQA 1JF6A 3D3VA 2DTSA 1AFVH 4LLMB 5LCVL 2Q3ZA 3DROB 3M8OH 3MJ8A 4ZXBB 3V2AR 2UYLA 1JGUL 4G6ML 4AY0A 1S5HA 5JR1H 2FSEA 3Q48A 4OLZH 4UMGA 1DBML 2BC4A 3FT4A 1S7SA 4GW1B 4OBRA 5FOBB 5GGTH 3U1SL 4TTDD 3V5DA 2NY3D 2ESVA 4XPTH 3BP4A 4XVJL 3HUJA 2EDRA 3MRPA 4O4YH 1FYTD 2DF3A 1AIFA 1JV5B 2FX7H 2ZUXA 4KRPB 4WFHD 5EU4B 2RFXA 15C8L 1LNUA 1GZQB 3ILQC 1FGNL 3L3HB 4HUMB 1CZ8L 4Y4HB 4WEBH 4P46A 1YY8B 2EE2A 3VXMB 4ZMAT 5ERWA 1FH5H 3QUMA 4F9PA 5CWSA 1NGYB 2E8ZA 2XN9A 3MROA 1RIUL 1JHKH 3LVEA 3IFOA 3T3ME 3PQYE 2DQIH 1S9YB 1U3JA 1WTGT 2CXKA 2ZPKL 4OBSA 3HLAA 4X7FC 1A7RL 2MFNA 5CLTA 4NO0B 1QFHA 5L2KA 1GVIA 1ADQH 3OG6B 4Z7QF 4TSCL 2M2DA 3PGDA 2CQVA 5DHYB 3QEUB 4D0BB 5JO5A 2IPUK 2YA1A 3MUHL 3U30B 3FOLA 2VUOA 5C0BA 4PJXF 2I9TB 1S7QA 4MDJA 1P4LA 3LIZL 1H3TA 2ICCA 2VISA 2HMIC 3MTRA 3RVVC 2VLKD 1UM6H 4HGWA 5K9KB 4UT6L 3ZZ1A 1DUYB 2BJMH 1Q38A 2OS7A 5B4MD 5IMMB 5BRZA 3QUMH 3CD4A 4U1LA 3RZCB 4JO4L 2VDML 4Y4KC 4DGIH 1CLZL 4LLYB 1I1AA 1FSKB 4AEIH 1BGXH 3FO0L 1MIMH 1B2WH 4GBXB 4OLWL 4PG9B 4W68A 3SDCB 3H9YA 3GMPB 1UJ3A 4NOFA 3DMMB 3QPXH 1YPZA 3SE4A 5C07B 3MUJA 3QDJE 1OP3H 4P4KD 4KI5E 4Q9QL 2X4NB 5C70A 1CGVA 5ESAA 1RK1A 2OXGA 3ARDC 4R7DB 4U1MB 4XTRD 3B5GA 4PRHB 3HZKA 1AHWA 1KCSL 4K7PY 1MHEB 1EVUA 4KRLB 4S10A 2XTJC 4J1UA 5B39A 4PJEE 2WANA 2CLRA 3N1QC 3ARBB 3QWRD 3S34L 1RZKH 3KYKH 3QCTH 2ICWI 1M71B 3WJLC 2NY6B 1IQWL 1LEKA 1C5BL 5AZEL 4RGOL 4PUBL 3BRFA 4J3OC 1VFBB 1WSST 3FONA 5DJZA 2AJVL 4EI5B 3VDAA 3B2VL 2FH6A 4KDTA 3WS6A 1XAUA 3MFFB 3QXDB 1QNZH 1NFIA 4OLXH 2CH8A 3FB5A 3RI5K 1FLRL 4DGVH 3BW9B 4YX2H 5I6XC 1VGEL 5GRYA 1U93A 3CX2A 1MFBL 2SEBB 3UYRH 1GC1H 2A6DB 2Q8BH 1J10A 1DSFH 1YEIH 3VMOA 3WEXB 2QR0B 1JNNH 3TYFA 5IOPA 3ARGD 5ALBL 5J12C 1F58L 5DO2D 3VMPA 1HXMB 4BZ2L 2XZQL 5EU7C 2A77L 2HFGH 3MBEB 3VWKB 3KLSA 3EHBC 1MRFH 3KHOA 4L8SC 1EHAA 2H1PH 4LARL 4G6KH 4FMKA 2MPAH 1IGJA 2H3NA 2AK4A 4YUEL 2VRAA 3ROLB 5E6IC 3DVGA 2K9UA 4HDIA 2J5LC 3IKKA 1N5YH 1KIUA 1WEJL 2P47B 3QCVL 2HKFL 1OGAB 3TVMB 3PWLA 1DQML 1KEGH 1DQLL 5IB2B 4JDVB 2HTLD 4LDOB 3WSQH 1IL1B 3ARXA 4UT7L 3MXWL 2DWDA 5DUML 3MODH 5CZXD 2CGRH 1QLRA 5J06A 5K59E 4H8WL 3QDJD 3RWDA 3VI3F 1FBIL 5EZIH 1HEZB 1FO0A 3SN6N 2I5YL 1I9IL 4M1GH 5E8EB 3UBXI 5JORB 1ORSA 2R4RH 2WWMD 1NBVH 1KNOB 2QL1A 1FJ1A 2V5YA 1KB5B 5F7HA 4OZHA 3KPRA 2D7QA 4QRQB 2J1KA 1YEKL 5JHDD 2BNQA 3T0DA 1A1MB 4U1HB 5FKAB 4P57A 1Q0YH 4Y4FC 2HFFA 2PR4L 1TCRB 2YC1B 1NCAL 4NC0B 5FA4A 1IKFH 1MJUH 5C9KA 3MOQA 1JYNA 5DEFA 1S7TA 4QHLB 1EAPA 1TVHA 1U0QA 1S78D 4G3YL 2WBJD 4ZUTB 3JUZA 1WITA 4HQQH 2LVEA 4MB3A 4I48B 2K7PA 2A6IB 3P4NB 3I3BA 4QXTA 3JWDC 3CFKB 3B4NA 3W2DH 4XHJC 3GMMB 4FQ2H 3I6LD 4HIIB 1T3FB 1I85C 2R4SL 1AI1L 5L8LB 2R56H 3UPRA 4HGKC 1FO0H 1AD9B 1BOYA 1NC2B 3LS5L 3B6SB 5J11C 2EICA 5DRZB 3PWNB 3SY0B 2HFEA 1T20B 2D0FA 1IMHC 5HJ3B 5E08L 3O2VL 4JRYE 4XC3H 4LDEB 1OARL 2X10A 4L8CA 2XICA 1UYWL 2V2XA 4R26L 3B2UD 3TZVB 5I18L 4RMQA 1QR1A 4WU5A 4P5TB 1UH3A 2FL5B 5DJAB 3MRBA 1KENH 3VE0B 4JQXA 1FFNB 3VFNA 1KCRH 5BVJA 2ZZUT 4Q6YA 4C55A 4K8RL 4F7MB 3WO4C 3NACL 2IEPA 5JW4R 4H1LG 1Q72H 3R06A 2C4FU 2VDNL 3TJEL 3D18A 4L3AA 5HGBA 2YBRA 1QSVA 3DX7A 5IB4A 1Y18A 3V4VL 1PZUB 2R69L 2OJZH 1MRCH 4KK5C 1YUHB 5EFIA 2Q3AA 5FGBA 1D9KD 2DQGH 4YHZH 3MRRB 3MUGA 4LRNL 2GITB 5LWYL 4ZS7H 3D0LA 4F15C 1OF2B 3VG9C 3I50H 3EDJA 2R1YB 5IK3B 4TNVK 4HX1B 1IILE 4HUUB 3E8UH 3BAEL 4LNRB 1F02I 3HMWL 2BVPB 2NR6D 4Y7MA 5F7UA 2QSCH 1CLCA 5JHLH 1IAKB 4UV7H 1J18A 1Q9WA 2WINA 3DUUB 4OQ1A 1UM5H 3MJ6A 1UADC 5D70H 1N26A 4JY4A 5HTSA 4M61B 1IEHA 4HPOH 1I9RH 2NY2C 5GISH 4RGNE 2AKRB 2HG5B 5C0EA 4PB9H 3BPLB 4HAFA 3IDUA 1X5HA 4XNYH 4OZFB 5GGSY 4CMMB 1H15A 2FEEI 2CKBB 2ZSWB 3QIWB 2ICEB 3O4LB 3MR9B 4CU8A 2YD9A 4BQ9A 4P2RB 2UZIL 4A6YH 2XKNB 3BT2L 2OK0H 3OR6B 5FXCH 3WFBL 3EFFB 1PEZA 4P3DA 3KPNA 3AROA 1I3RB 4JGUA 4LQFL 5DS8A 1RFDH 1B0RB 1UM4L 3S3JA 3WUWB 1MRDH 1RULH 4OCSH 4U3XA 3KPQA 2Y9RT 3AREB 3IETB 3GMQA 2VLJE 2A83B 4KTDL 2VLLA 1MLCB 3QYCA 1V8HA 1JBJA 4UINL 5IB3B 4JRYD 3WFHB 3HG1B 5FM5M 1QFWH 3WV0A 5I1GL 1H5BB 2J8OA 5SX4I 3S37L 1T83A 4XPHH 2IQ9H 1Y0LB 5IFHH 1JPFA 1SVZA 3PXJA 4JFXB 4DFHA 3O41A 4YGVB 5DD1H 3EYUH 1BREA 1KJMA 3WXWH 1F4HA 4CW1B 2GQHA 5T1DL 5DQJB 3G5VA 4F2MA 4LHUA 2JIXD 3EKCA 1D5BB 1G6RH 4YZFE 5FYKH 1MCRA 1R0AH 4PJBB 3ZKMC 5L0QB 32C2A 1G0YR 2IMNA 3FO1A 5TFSH 4AIZA 1Q9LB 5I30L 4GAGH 3QNYB 1HQRA 2Y5TA 4ZSOE 2P5WE 1U2HA 3I9GH 3MRCA 3CIQA 4DN3H 3RVXC 4ZTPH 3ELAT 2FJGA 1B3JA 1HZHL 3MOBH 5CD5D 5HY9A 2DRUA 4WI4A 4KJYB 4MA7H 3SPVA 4DUVA 3MRFB 3X12B 4IOIB 4IRJA 1VGKA 4RGND 1AGCA 4X0KA 1S9WB 5DD0L 3ULSA 2W9EL 4JZJB 3DRTA 2AJUL 3DYOA 4X80H 4LCCC 2BHZA 5DJ8B 1IGIL 5HYFA 3O3EA 1UC6A 2J8UB 1UB5A 3DURB 3FFDB 3GJEB 2GUOA 4RNRA 5E1HB 4D9QE 2EEAA 3OSKA 2Z92A 3MV7A 3F8UB 4FQIH 2E7MA 2N4IA 5K33A 2X4PB 2Q86A 4GKNA 4H88L 1HH9A 5ILTL 1MQ8A 5CIPB 4YHYB 3RUGF 2IGFL 1Q9OB 2YK1H 4Q7DA 4P3CH 3HNVH 2VLJD 4M1DH 3B8YA 3SKOA 1E27B 2V5RA 2YD6A 4P5KA 2Z35B 4G9FE 2MQCA 1PQZA 3CH1B 2J4WH 1NGWA 2W0PA 3WKML 3D3VB 4MAYD 5B38A 3Q2CA 1BWMA 4HS6A 5F7NC 4NCDA 2VWEC 3GSVB 4CUCA 2UYLB 5LBSH 5IBLD 1S5HB 2FSEB 3NIGF 3FT4B 2BC4B 3C60A 1S7SB 4KHTH 5CHNB 4AH2A 4CAGA 4IRSA 2KBGA 5C6PB 4P2OD 5IT2L 2CJUH 4NQVA 2H32H 1DVFA 1FAIH 2ESVB 4NZTL 3BP4B 3MRPB 5BOPA 3QG7H 4OCXH 1AIFB 1QKZH 2BRRH 3F7YA 1LNUB 1G7QA 1MCOH 3S36H 2AI0L 2CDEA 1HHJA 2X89A 4P46B 2QQKH 4WI8A 4XCYA 1FRGL 3CXHK 2V5TA 4OI9A 5ERWB 4ZFOA 5D7SH 1FN4A 5CWSB 2XN9B 3IFOB 4MQXC 2YHGA 4I5BB 5IVXE 2B2XH 2FJHA 4F8TA 1CBVH 2DQFA 4YR6A 4DAGH 1ZHNA 1NGPH 3MNZA 3I3DA 3PGDB 5C7XH 5KVEL 1MWAL 3TT1L 5C0RL 1NMCB 2W9LA 1S7VA 2F5AL 4RGMB 5GGRB 5I71C 4K55A 4QT5A 1J5OL 1L7IL 1BZ7B 4PS4L 1SEQL 1YDPB 4LP5A 4MDJB 1P4LB 1RZKC 4Z7OE 4PJFB 3ZKNC 2VISB 5ELIA 2NZIA 1QP1A 4D9QD 5ENWA 4FQJL 3E2HC 5IVOA 1Z3GL 2ZNXA 4XP5L 2VZ3A 1J1XH 1KLUA 1OWWA 1ZVSA 2OLDA 1KXQE 1KB9J 3G04A 3CDGA 5FUZH 3BDXA 5IIEA 1EEYA 4QXWA 5DT1H 5EOCL 4JHAH 5D7LE 3K7UA 1NL0H 5D5ME 4U1LB 3SE4C 2I24N 4HKJA 1KTDA 4Z0BH 1RIHH 4U2ZA 3TO4C 2UVEA 1KPRB 2VZTA 5KTEH 3L3OA 1T6WA 4G9FD 1GC1C 1I1AB 2ED8A 1WWWX 1NSNL 3RDTC 3TT3H 1UJ3B 3UC0L 4FQQB 3O9WD 1AHWC 2DQJL 3FQUB 4E5XA 1KJ2A 1TVDA 2R2BA 2CUMA 2DD8H 4MMXC 5DJ0A 1I75A 3FB8A 2CSPA 5B3JE 5GJSH 5GS3A 2M26A 5FM5O 4JO2L 4WGVB 3ULVD 5L9DH 5F1IA 1RK1B 3N0PB 3V0WL 1NGZB 1U91A 3H3PH 4U7KA 5EN2A 1N2RA 5HYSB 2C3XA 3MCLH 2EKSA 3CGTA 1J0ZA 4J1UB 3RA7L 3EOTH 2CLRB 4Y2DD 3GNML 2R0WH 1F4WL 3BIAX 2P44B 1T03H 1NGXB 4YDVA 1K4CA 2BY3A 4AMKL 4EI6A 1BMGA 1U8JA 3BD5A 1KIPB 1J88A 1QQDA 4XRCB 4Y19A 1MELA 1JZ5A 2XFXB 1NFIB 2KDGA 3IXTB 4DKDC 1OM3L 1KIQB 1TZGL 1ACYL 1VPOH 2AABL 3GIVA 2DQDL 4PJCF 4YC2B 2AV1B 3VD9A 1NEZG 3D9AH 4ALAL 1S7WA 5D1ZD 3EYFA 5IOPB 5D8JH 2UWEA 4HJGA 5I8KH 3QJFA 4XCFL 1J8HE 8FABA 4YDKH 5BCAA 3BSZL 2EDJA 1YNKL 5HHVH 4YXLH 2V6HA 5GSRB 2Q8AL 2EYRA 1IGJB 3ARRA 4OCNC 4P23A 1JYWA 5TQ2L 4X6DB 3DVGB 5SWSE 4APQD 2Y72A 5I8OH 1OCWL 4GLRI 5D7LD 2XWTA 2YPLE 3OF6A 5FYLD 4DOHB 1FPTH 4ODSH 5F6IB 4AQ1B 2RAMA 3ULUF 3PWLB 2YPKB 3H0TA 1WISA 1KUMA 1A3LL 3VH8G 4YHIA 5EU6E 1PYWA 1ULVA 1BEYH 1QLRB 4NWTH 3SDYL 3VXRA 3RWDB 1PW3A 4CGTA 1MI5B 1FNSL 1ZLUK 4HIJA 5J9PA 2ADFL 5E5RB 1FJ1B 1G7MA 1CE1L 3FRUB 3GBNH 3KPRB 4IIQA 1NMAL 1UCBL 3GUTA 2V7NA 2ENSA 3GB7A 1MH5A 1JHLL 4P57B 3Q5YA 5JOEA 2R8SL 2HFFB 3KYMA 2Z9TA 3MLUL 3N1PC 4PBXA 5FA4B 3TBYA 2QV2A 5F9JA 5DEFB 4GMTL 1S7TB 2ZG1A 4Z7VA 5F88A 3BE1H 1B88A 5E2UL 1FL5A 4F7CB 2VE6A 4V1DE 2VC2L 3U6RA 5E2WH 4JHWL 4ODTL 1RIVL 2OZ4A 4PRIA 1H3UA 4OZIF 1JZ6A 3GK8L 3WFCL 4URTB 4Y0GA 2CMRH 1CFVL 2WV3A 3UPRB 5D71H 4ZUWB 1A6PA 3OX8A 4PLJC 1YA5A 2QADB 4HC1A 4G7VH 1EHNA 5J13C 1L6XA 2MWCA 3DX6A 3GMNA 1F45A 1FFPA 2DWEA 3O4OB 4JQXC 1H3GA 4L4VE 5KSAD 2BK8A 4R97B 1I8IA 4PJIA 3JTTA 3NH7H 5ICXA 3X13B 3WHE1 4WU5B 3ESUF 3PGFH 5SWSD 2IANE 3VFNB 5BVJB 2G2RA 4RSVA 3AC0A 3RWEB 1NFDF 4EUPA 2X4UA 3R06B 3RHWK 4FXKB 1WUNT 1KB9K 3LN4A 1KCVL 2OZ4H 5LKNA 1TJIH 3DX7B 1U8PA 3MREA 4F7TA 1AR1D 1C7TA 1NCWL 3JV4A 5EU6D 4N9GB 4GKSB 3QO0A 2HT3C 4KJWC 4EN3C 2VR4A 2W0LA 4JM4H 4M8QA 3MUGB 1HH6B 3MRNA 2BY1A 2W91A 3D0LB 3TPUB 4WFGD 4EIGB 3SCMA 2QQNL 4KKBD 5T3ZE 3NA4A 4U6YA 3FHQA 4G9DA 3VI3E 4KJQC 1XH3B 4ZAKA 1L0YA 1Q9WB 2HWZH 3U36B 4JY4B 4RFNC 4KVNL 4XB7A 3B43A 3NCYS 1K4DB 4GRLD 4GT7A 1AFVL 1ES0B 3ZKSD 5JXAH 3M8OL 3GKWL 1XGYH 5D7IA 4I77H 3BGMA 3T0EE 4OLZL 2CLZA 2ADGB 4FQXA 3QUKA 5GGTL 3UZQA 5DQDL 4R2GD 1NAMH 5HI4D 4N0CD 3BKCH 3BZEA 4XPTL 4WI7A 2FX8L 4BSVA 4O4YL 4P3DB 2FX7L 1I8KB 1PLGH 5DS8B 4UTAH 1CK0L 4RWYH 4ZODA 3L3JB 3TBTA 4WEBL 5DSCA 4GRWF 1IC7H 3KPQB 3GMQB 2ENYA 5TQ0L 1T7YA 2L0DA 5DR5H 3IYLW 4UDTB 4TTDC 3LD8B 1JHKL 2X4SB 2DQIL 3BH8A 2BSED 2OSLB 4L4VD 5DVNA 4WDIA 2EDNA 5EC1A 3X3FL 5BV7H 3MLVL 5C08E 5CUSH 1GGUA 3AM8A 3QXVA 1JPFB 2EIEA 4G43B 4E41E 3VFMA 1CD1A 2IAND 4PJGF 3IAGC 3X14B 3LS4H 3EYVA 4CMHB 3JZ7A 1VFOA 3OAYK 1C16A 3C09B 1KJMB 2ARWA 3PDGA 4J8RA 5HHMB 4KHXH 3C2SA 4F2MB 2BERA 1AGEA 1AC6A 1QPXA 4LHUB 3HE6B 4TUOB 1YMMA 2DLEA 3GGWA 4OF5A 5FKPB 5L8KB 1AGFA 1UM6L 4DUXA 3C08H 3KR3H 5C0DA 3FO1B 4M6MH 2DDQL 4Q6IA 3BH9A 1A6AA 2Y5TB 5MENB 5T3ZD 4G8FA 2HN7B 3MRCB 3HE7D 2E6PA 4Z95H 1P5VA 5B39G 3SDDA 1NDMA 2FJGB 3HR5B 2Q1EA 2PW2B 4QTIL 5TH2A 1IM9A 3SPVB 1KYOJ 1BGXL 1MIML 5J6GA 1B2WL 4YHKH 4IRJB 4S0TD 3EYSH 1VGKB 1AGCB 3QPXL 4X0KB 3IXAA 4PJDA 3ULSB 4NHUA 2VXSH 2XQBH 1CDGA 4OB5H 1WV7T 2FIRT 5EORH 5HVHB 1LD9B 2X9WA 1UB5B 2LVCA 2EDXA 1N64H 5FDWA 3S4SA 4PJ8A 2VJXA 4XNZC 1IARB 4RIRA 2Q86B 4HXAH 3WFEH 4GKNB 1HH9B 2B0SH 1RZKL 5CBEA 4YXHH 4P4KC 4M7KH 4Z9KB 3SKOB 1A9BA 4P5KB 4XTRC 1EA9C 3C60C 4IRSC 1RJZA 1XR9A 1GOHA 1ZA6A 1QNZL 1PG7L 2VDRH 3VXSE 1TPXC 1DVFC 2IQAA 1MCJA 2BXZA 4HUVA 2O61A 3O6FD 5C08D 3O0RL 1KSRA 4DGVL 1CFSA 2IG2H 4LVHC 4YX2L 1FZOA 5J0BA 4AH2B 4QOKA 4X7SH 1GIGL 2VLRB 3UYRL 4NQVB 1DSFL 4PJ9B 3ZE1F 1JNNL 3OJDA 3AS0A 5I73C 2GFBA 4ODXA 5CSGA 4C56E 2HFGL 3OJVC 1QBAA 2KZ1B 1I7RA 1NANI 4JPIA 4KMQA 3RWGB 1MRFL 5H94A 1HHJB 1X4YA 2MPAL 3U9PH 4XCYB 4ZPTA 3BQUA 5HHNB 2GW5A 1YEDB 3PIQA 3UTTB 1FN4B 1IAIH 5FF6A 5C0NC 3NCJH 2FJHB 1N5YL 1JNLH 1ZVHA 5DO2C 1RK0A 1GYAA 2DQFB 4HUWA 4YR6B 3N1GC 3HRPA 5EO9A 1ZHNB 3BD4A 3KXFE 3P77A 4QHKI 1KEGL 4NNPH 3MNZB 3C5ZA 1MHCA 1N6VA 4KDVA 4LGPB 5F7EH 1II4E 4X5WA 5GHWH 3MODL 3ULVH 1S7VB 2CGRL 1J1OL 4CADA 4MQSB 3L5WB 1MJ7H 3UTSE 2XPGB 5EZIL 3DSFH 3C6LA 5H8DA 4M1GL 1UXWA 2B5IC 2R4RL 4UOW1 3JV5A 1ZGLP 1CFNA 1ZT7A 4GH7B 5CEZD 1K8DA 4UQ3A 2VZVA 3QFJE 1KLUB 1Q0YL 1ZVSB 2MSPA 3LKOB 4JFQA 3N85H 3G04B 4KKAD 5CZXC 3ABZA 5IIEB 1EEYB 2NY5H 3WN5B 3FB6B 2B4CH 1MJUL 3DXAE 2G75A 3Q6FA 4ZFFA 3KS0J 4HKJB 4EIZC 1SYVA 2WWMC 2Y7QA 3BKYL 4NBYB 3PHOA 1P6FA 3QSKB 4HQQL 3WE6B 3AXLA 5T1KD 5F7YC 1RZ8A 3RUGE 2V9TA 4Y16D 3I02A 4C4KT 3RNKA 4E5XB 1KJ2B 3FRPA 1A8JH 1JFQL 1KPUA 2R2BB 5JXED 3WD5H 1A14H 4FQ2L 3FB8B 2XWBA 2XWJA 3HMXA 4LEOA 2R56L 2IAMA 5F1IB 1MOEA 1FO0L 1VKXB 2NXYD 1U91B 1S78C 2WBJC 1PDKA 1N2RB 2IBZX 5E9DA 4Z5RA 1ZHKA 2BNRE 5C3TA 4C56D 2LU4A 1EGJA 3NIGE 3PL6D 3FL7A 3B8SA 2RHEA 1XGUB 2XQYK 3QULA 5DC4B 5I1DA 5FYLH 1EVTC 1XIWD 2KH2B 3K1KC 1MHPH 4NT6B 1KTLA 4YDVB 1K4CB 5FK9A 4N1CA 1NDGA 1U8JB 3TNNB 2UY6A 1KCRL 1QQDB 2HJLA 4Y19B 4HEME 4LVNB 2GY5A 1Q72L 1JTPA 1HCFX 4KTEH 1RAMA 4UZGA 2R9HD 1MFAL 1P6AB 5HHOE 1CICA 3U7WL 7CGTA 3RVWC 2OJZL 3BPNC 3B2UC 3Q3GA 1U8KB 5KW9L 2IH3B 3M07A 5C0AD 3LKPB 3ESVF 1S7WB 3UTSD 3EYFB 4YHZL 2WLYA 3P0YL 4JAMB 3P11L 1KYOK 1AE6H 1X3DA 3QJFB 4X99A 2WIIB 4FMFA 4BKLA 5JA9A 4GJTB 1G9MH 4NQSA 1QVOA 2EYRB 4JANA 1HWHB 2NZ9C 3QFJD 4P23B 2ZCKL 1UM5L 5D70L 1A6WH 3TCLA 1C12A 2QHRH 1D9KC 1I9RL 2XWTB 5GISL 1CWVA 2OTUA 3DXAD 2GTWA 1BIHA 4LBEA 4KWUA 4XNYL 3M17B 3H0TB 4IS6B 5ANME 4WV1C 2AP2A 4TNVF 2W59A 3F7VA 1A7NH 4HEPG 1PYWB 1UKTA 1CVRA 4N0UE 4A6YL 1ZTXH 2OK0L 1MWAB 2FHFA 1J05B 2W1NA 3SDXA 5ECJE 5HDQH 2IH1B 2YOCA 3JTSA 2PO6D 1I1FA 4HIJB 4GUPA 3WNKA 3EYQD 4XBEH 2XY1A 1MRDL 5D9SB 1RULL 1AXSA 5C9JA 1HSBA 4PP2A 1A22B 4IIQB 4ZUSA 5DZLA 5D72L 3GUTB 2V7NB 2V2WA 1MH5B 3DVFA 2BNRD 3IGAA 2IFFH 5DK2A 3KYMB 1CGYA 1Z0MA 5IROA 1QFWL 5C09A 4I0PD 1HKFA 3TBYB 5T5NG 4XPHL 1F97A 2IQ9L 4Z7VB 5F88B 3QNZB 1FL5B 2EYSA 5IFHL 3PWUB 1LE9B 5E00A 3WNLA 5HYEA 1XGRB 2VE6B 4WO4D 3MBXL 3U6RB 3QI9B 12E8H 3HN3A 4Z7UB 5DD1L 2AJZB 4MS8C 5DJ2B 3PWPA 4LIQH 1TQBB 4LASH 2X1QA 3TNMA 2COQA 3FT3A 5FV1L 5HHOD 3MUY1 5FB8A 3BZ4A 3EIFA 4DJMA 5ACLA 1G6RL 5T3XE 4OTXH 3BYYA 4OCMC 2AGJH 4DN4H 1QRNE 1A4KA 1K5NA 1RQ5A 4G8IA 3GMNB 4K71C 1OD9A 2A1WH 4R8WH 4TRPH 1FFPB 2DWEB 2Z31A 2WIMA 1MIEH 4GAGL 1PJ9A 1N3NA 4HJJL 3CC5B 4J3TA 5D1QA 4PJCE 1Z9OA 1X5KA 4BH7B 4DN3L 4ZTPL 1I8IB 4PJIB 3JTTB 4M1CD 4NJAH 4O51A 2YD2A 5ICXB 3UPAA 3MOBL 2DN7A 2VDLL 3LV3A 4MA7L 1A6TA 2HLAB 5GGVY 1BZ9A 4JFFA 5D7JB 1QLEL 3M1BA 3LEVH 4EUPB 1CDCA 2X4UB 1WFTA 2E7HA 3NFSH 2R1XA 4FS0A 4WW2A 3ALPA 4MQ7A 3FQRA 5DQ9B 3KPLA 4ZUVB 2YD3A 2XKUA 2G9HB 3MREB 3SCMC 4F7TB 5KSBE 2ATKA 5B38G 2XZAH 5CEXA 1MQKH 2NTFA 3QO0B 3V6FA 1QYGL 1J12A 3C5JA 4LSTH 4AZ8A 2R15A 4FQIL 5E6ZA 3ULUE 4ZAKC 3RL1A 4RGNC 1S8DA 3V0AC 1KBGH 5BV7C 5GS1A 1LEIA 3GBMH 1U3HA 5I75C 4U6YB 4R7NA 4P3CL 3HNVL 3T2QA 1JTOA 4G9DB 4PGBB 2V9QA 3PDDA 1WFNA 3EOBA 4YNYA 3K8KA 3SQOH 2VH5L 4LCUA 5A3IC 3MJ9A 4RCAA 1V7MH 4P4RA 2J4WL 1MY5A 4KC3B 4ELKA 4NN7C 1IFHH 1HOCA 2D4FA 2F19H 3EOAA 1ONQB 3SGKC 5LXGH 4XVSH 4MB4A 4PJ5E 1OB1B 3W0WE 5LBSL 3BGMB 5FECA 3T3PF 4PP1D 4M7ZC 3A6OA 2EDYA 2I9LB 3LB6D 4KHTL 1ZLVK 1YEFH 1G7HA 3QUKB 4FQXB 5HVWA 1FAIL 4NQEB 5D96B 4OCWH 4BSVB 3N06B 2WW8A 3QG7L 4OCXL 1QKZL 3V5HA 4HH8A 3BP7B 5T3XD 3BZDA 4MAYC 4R3SA 1ETZB 1MCOL 2EC9U 3S36L 4PJ7A 5T3ZH 5IBLC 3QJHA 2QQKL 5SWZE 4K7FB 2VYRE 3MRQB 3NZ8A 3RAJL 4OZIE 1HNGA 5D7SL 1IQDA 3QDMD 1GJIA 3VGDA 3QUXD 5IFJA 5IWLA 1RUML 4IBLT 1CDHA 2HT4D 4OV6F 1OPGH 5EBLA 1EEUA 1CBVL 2QQLH 4OZGE 3HZVB 5EC1B 4DAGL 2YN3A 1T66D 1P7QD 1NGPL 2ZUTA 3VFMB 5C7XL 4IMLA 4QGYA 1T7ZA 5I8EA 1VSCA 5FEBA 1WIOA 2GYSA 1KJ3H 3QHFH 1L4IA 5HPMA 4OFDA 4J8RB 3STZB 1FQ9C 4FQLL 2FX9H 1OSPH 2BHUA 1YMMB 2Z4QB 3VG0H 4L3EB 1NFDE 4OQTA 5DUBB 3ARVA 4I0CC 4PV8A 3SDDC 1PY4A 3ULUD 1YY9C 1L6ZA 1J1XL 2J6EA 4Q6IB 3BH9B 1A6AB 3QIBA 2X4RB 3OAZK 2BDNH 5DT1L 4JHAL 3L3KA 1RIHL 1OW0C 1NDMB 4FNLL 5KTEL 1FIGH 3I2CH 4J6RH 5TH2B 4WW1B 3K2UH 5J6GB 4DKAA 1E4XL 3KLHC 3TT3L 5IBUB 2PYEE 3HB3D 1WQVT 4PJDB 4ZNEA 3RJQB 5EA0L 4NHUB 4PJ5D 3W0WD 1X6LA 4RBPK 1UKQA 2CDFA 4W6YB 3UX9B 1EJ6A 4L4TA 4AG4H 1JTTA 3MRIB 5CLWA 4LPTA 5L9DL 2P5EE 1HQ4A 1IGCH 3MOAL 1GXEA 3H3PL 2AQ1A 4N1EA 4DCQB 4PJ8B 5D93C 2VZOA 4EDXB 4OQTH 3EOTL 3WLBB 3O9WC 4U33A 5F71A 1SEBA 5GGRY 3U7AA 1DQJA 2DKUA 5CBEB 5ISZE 4JQVA 2R0WL 1W72A 1P1ZB 5SWZD 2ZUWA 4MYWB 1SJEB 4JB9H 5FM8A 1U8LB 4KXZI 3ULVC 3ZLQC 2R0LH 4HMCA 2YXMA 4PJBF 5INDA 3E1F1 1A2YB 1N5AA 5EG6C 4U1IA 1RJZB 1XR9B 4MD4B 3MRJA 4JRXB 3MRKB 1ZA6B 2IQAB 3U0PB 4GRWE 4PGEA 2P1YA 4HUVB 4U1SB 2O61B 1JWSA 1R5VB 1FZOB 3S96A 1JZ4A 5HHQA 4QOKB 4G6FD 1F3DH 4D9RD 3D9AL 5CEZH 5D8JL 1E4WH 3OJDB 4AYFA 5DFTA 2NY5C 5I8KL 4F33A 2GFBB 4N5ED 2B4CC 3QUYA 3UJIH 2MKWA 1IGFH 4PJGE 2KPNA 4S11A 1I7RB 4JPIB 3D25B 5H94B 2FATL 2Y07H 5HHVL 2D7MA 4YXLL 3C8KA 3K4ZA 2FIKA 4ZPTB 3BQUB 2YXFA 2O93L 1CF8H 1CQKA 1HWGB 2J8UF 1LO2H 3ZDYE 5I8OL 1GGYA 3L1OH 1FPTL 3LKRB 1JWUA 2AJ3A 5E99H 4HULB 1RK0B 5EO9B 3UBXA 2VAAA 3C6LC 3T08A 3C5ZB 1WIUA 4PRPD 3LDBB 5C0AA 1ZE3C 3FQWB 1FVEB 1RSFA 1OTTD 5FO9A 2PYED 1JF1B 4KQ4L 1BEYL 4CADB 1PSKL 4NWTL 3CFJA 3IJSA 2EYTB 2RCSH 4Z78A 3C6SB 4BK4A 4CBPA 4APQC 1N59A 2A9ML 4HMDA 2P5ED 3ZKQD 1ED3A 1IAOA 1CFNB 3KJ6H 5EWIH 3QIUD 4ZOEA 5EZOH 1K8DB 4UQ3B 3OKKB 1S3KL 4JM2A 2IPTH 3L95A 1NUDA 2R0ZL 5IUSA 3RGVB 4JFQB 4U1GB 4X7CC 3P30L 4MAUH 3HUJF 4OT1H 4G8GA 3QO1B 1WC7A 4Y1AD 2G75B 4ZFFB 3DYPA 1L7TH 2MMXA 1PZ5B 3PQYA 3ETBF 3SKNA 1SYVB 3BE1L 1NBZB 2Y7QB 1XGTA 1T1WB 4QRPA 4UB0H 1Q1JH 1ZHBB 1JGDA 3AXLB 3OXSA 4M48L 1RZ8B 5E2WL 1AKJB 1S7XA 5GIRA 3I02B 3ES6B 3NCMA 3BHBA 1M7DB 2XWBB 3NAAH 1G9MC 1ZAGA 5D2NA 4LEOB 3H42H 2IAMB 4GO6B 5D71L 4X8XA 5GGSA 1I8LA 2N7AA 4G7VL 3D39A 5IW6A 3KGRA 1CGWA 5E9DB 1ZHKB 2WUBH 4K7PX 5KZCD 4HWNA 1BQUA 1MCHA 1X5YA 1HILB 2VDOH 5B8CA 1LMKA 1KTLB 1JZ2A 4S0SD 4KH2A 4M5YL 4FQ1H 5FK9B 3OJ2C 3CU7A 2HJLB 1IC4H 5FA3B 1YYLH 5H35A 1FDLH 5DI8B 4Q9RH 4LLWB 4YFLI 4OF3A 4FG6C 1TJIL 1CICB 1OTSC 5KSAC 1UXSA 4LSSH 2CIIB 3FTGA 4ZOBA 4WVRA 3CLEH 4NO3A 3Q3GB 4FFYH 5DHVA 4HWZA 4MJIA 5EB9A 4JM4L 4LSUL 3CVHA 3ZL4H 4NFDA 2VDPH 5J1SC 5DEZA 1YPZF 1DJSA 3VD4A 4WCYH 1DQTA 3LRSA 4BKLB 4HBQA 2JB5H 3QRGL 4KZDL 4PJEA 4Q9CA 4NQSB 1HINH 4JANB 4FFVC 1KC5L 1AR1C 3SE9H 4FQCL 3TCLB 4RRPG 2PXYD 1B4JH 5T1LA 2OTUB 5DRWA 2GTWB 3N50A 5JXAL 4K8RD 1XGYL 1U3YA 4I77L 3QEQE 4LBEB 5C6TH 5BXFA 1NUNB 4Z76A 3EO1A 5ACZA 3KDMA 4KKBC 4PTUA 1UWGL 2JE8A 3P9MA 2O5YH 4LVOB 4P9MH 1NAML 5DYOA 3BKCL 4HD9A 3DGCR 5HGHA 4UIKL 3RKPA 3MRDA 4WIQA 5INCA 2M8XA 3MV8B 4RMVA 4ODVH 5AZ2L 3JTSB 2MKLC 3VGGA 4RWYL 3WO3B 2LE9A 1FAKT 4OI8A 2NW3A 3VXME 5HI5D 1AXSB 3FFCB 5C9JB 1IC7L 1HSBB 4PP2B 1D6EA 4OM0L 3GBLA 4BH8A 5ALCL 3GIZH 4AK1A 2V2WB 4ZS6D 1U92A 2W65A 3IGAB 5DR5L 4R2GC 1ITCA 5HI4C 1PEWA 1U41A 4IRZH 3HFMH 4JY6A 1EFXB 2ZKHL 5DFWH 1T1YA 1G84A 2DQHH 3IF1B 3RY4A 4JR9H 4Z8FH 1OL0A 5CS7A 3T0AA 5BV7L 1X6NA 5C2BH 4MNHA 5CUSL 4NRXA 3L7EB 3IT8D 3LS4L 1C5CL 3DUSB 3MV9B 5CBAA 4XNMA 1QACA 2M1KA 3TNMB 1XCTA 3DGGA 3FT3B 3QUZA 4KHXL 2OR7A 4LCWA 1R6VA 4PFEA 4HS8H 5DA4A 3P2TA 4TVPE 5E8DL 3MLRH 1NEUA 2Z8VC 1N6QH 5D1XA 1F6FB 2EDKA 2EDTA 4XWGH 1JPGA 4G8IB 4RMUA 5SX4H 3QUXA 4TQEH 2Z31B 2UZYB 1RI8A 2YUWA 4JFDA 5AYUH 4M02A 1N3NB 5D1QB 5FFLA 1V3LA 1EHLH 3RX5A 4OFYD 3S4SG 4ENED 3R0MA 1LDPH 4KU1A 5DJDA 4Z95L 4WW2C 5GGUA 5EUOA 3RZWA 5DVMA 3UAJD 5ID0A 1QUNA 5HGAA 4JN1H 3B9KB 4NKQB 3LV3B 4O5LH 1A6TB 1BZ9B 4OZHF 4JFFB 2C3GA 4JDZA 4ZXBD 4P49A 5TDOA 3M1BB 3U79A 4GG6A 2R1XB 3G6JA 3QEQD 2BVEA 3WIHA 2GSIA 4MQ7B 1OP5K 5BS0A 3EDKA 2VXSL 3FQRB 3KPLB 2XQBL 3AB0C 4YWGH 3VXNA 4HWBA 4R0LA 4PRHE 1P4IH 5CMAB 3HE7C 4GSDH 5L7XL 4PGJA 1EJOH 5CEXB 4XC1H 1Y6MR 1N64L 3V6FB 4RFEA 4KRPD 5BQ7A 3VFWA 3C5JB 4S1SH 5E8PA 3RL1B 2DQEL 4HXAL 3WFEL 1S8DB 1QSFB 1CR9H 5GS1B 2B0SL 3IDMB 3BN9D 4FFZH 1LEIB 4U49A 4I2XA 4F57H 1U3HB 3HI1A 1YNTA 3VXMD 4BQCA 3HAEA 4M7KL 4JY5L 2F53A 2VQ1A 4CNIA 1KACB 3VGFA 4YNYB 5C0CB 5SV3A 4NBZB 4LCUB 3UPCA 1YC7A 3U2SA 5JW5B 1YN7A 2GJ6E 5F93C 3T77A 4HGMA 3LKSB 2APBA 4NO0D 4ELKB 3JWOH 1BFVH 2DL9A 2VDRL 3EOAB 5E8NA 3BDBA 3KYAA 1I7ZB 4KGLA 4DEPB 1JGVH 3IS0X 2Y23A 4NKIH 5AUMB 1G7HB 5JDJA 1I7UB 4X7EC 2X70B 1CLYH 3T09A 4HLJA 1D6VH 4PBWD 4RZCA 4WI9A 1F4XH 3VRIA 5F21B 2DQCH 3F5WA 4W6XB 5DJ6B 4KDWA 4H0GA 3Q5TA 3P9WB 3V5HB 4YFLF 4NQUA 5CJ5A 2CLVA 2AV7A 4TSBL 5IWLC 4R3SB 4TVPD 3ARFA 2W38A 2CRIA 1OOAA 4PJ7B 1HHIB 3QJHB 5I9QC 4ELMA 4F80A 3P0VH 5CZKA 4FN0A 5EU7E 3GI8H 3NZ8B 2XNAA 3NABH 3P4MA 1IQDB 4MNGB 5JOFA 5IFJB 1C1EH 1A6ZA 3LHPH 3NCJL 3RZCD 1JNLL 3TV3H 5TE4H 5EBLB 1SY6H 2DM3A 4JZNA 5M95B 3L5JA 1HKLH 4PLOB 4E0RA 3O2DA 2NX5A 2CXGA 4GBXD 4NNPL 1QFWM 5LGKA 3DMMD 4IMLB 5I8EB 5F7EL 5GHWL 1SJVA 5C07D 3ULVL 1LILA 4LHQB 3L7FB 5HPMB 3OB0K 1MJ7L 3T1FA 3U82B 3LSOB 3LZFH 4AQOA 3QIBC 4PRHD 1FZJB 4JREC 4AIXA 1AH1A 3G5XA 3ARBD 5IBTH 3N85L 3CFBA 5GS2D 4FA8A 4I1NB 4Y8DC 2YUZA 3LQZB 2YD1A 4U1KA 3KWWB 2B4CL 3BKMH 3L9RA 4BK5A 4LSPH 4EI5D 1A6UH 1A7OH 1T2XA 1U8HA 5CCKH 3IDNA 4KK9D 4KK8C 3AY4A 2GJ6D 4WJ5A 4YBLC 3RVUC 3H7LA 1MJJA 4FZEH 4O02H 3G9VA 3WD5L 2CDFB 3T8XA 4CVZA 4L4TB 2NY3B 4NKOA 2D4DA 1HQ4B 3L5XH 1FYTB 4JQVC 3R0NA 4BZ1H 2P45B 4CN6A 4F7PA 4NZDA 3QZWA 3VWKD 2JB6A 3T3PE 9CGTA 1QG3A 3DV4B 2JK5A 2FLRT 3QG6A 3DVNA 2JJTA 1A21A 5JXEC 5FYLL 1W72B 1IE5A 1VESA 2HFTA 3V4PL 1QBLL 1MHPL 4CVWA 3PV6A 2A0LD 2P5WA 3TIDB 1MFNA 5MI0B 3P73A 3T0VA 2FECL 4U1IB 2FGWH 1K8IB 3QDAA 5T5NF 3TVMD 1F90L 2UV3A 1FNGB 4PGEB 5D2LA 4KTEL 1RJYA 1JWSB 3KJ4B 2OQJA 1DANT 2I25N 5CKGA 3UTZA 5C1MB 3QUYC 3S96B 2GCYA 5HHQB 1XIWC 3MLSH 3E6HA 5FGSA 3QEHA 2E3VA 1UB6B 2XKSA 4ZFGH 1EX0A 5DC0A 2AEWA 2CUHA 1AE6L 3MACH 2EEBA 4TNWK 4KVCH 1CL7L 5HVFB 1F6AA 3O8XA 4NN5C 8CGTA 1G9ML 5F7DA 2R9HC 1AXIB 3V0VB 1VADA 3C8KB 3QHTC 2FIKB 3A0OA 4Y5VA 1BM3H 5JMOC 1A6WL 1J86A 3D5OF 5F9OH 5GS0D 1G7LA 1S9KC 2E9BA 1AQDA 2BSRA 1AD0A 4B50A 4GRWH 4J3UA 3REWB 2VAAB 5F3BB 2GHWB 1T89C 1SM3H 1W8OA 2C4XA 4P2RE 4UNTA 2X41A 3Q1SL 3GJFA 1A7NL 2EE6A 5DD5H 5FO9B 2MOVA 2NXZC 4ODUB 3IJSB 4JM2C 5BJTB 4Q0XH 4Z78B 4RAUA 3TESA 5MEPB 1ED3B 1RJLB 5TE7H 4LRIA 4XBEL 4XHJD 4RISH 2A74A 4GLRH 4NQCE 1JZ7A 4EDWH 1OD7A 3PHQA 1ZA3A 2X1XR 2NCMA 3TZVD 4GG8A 1MY7A 2OL3A 4P5TD 3PQYB 3SKNB 1XF3A 3VFTA 2PO6C 3VFSA 2C5DC 1XGTB 3VWJA 5D2NC 2FZ3A 3PJSB 3QDGA 4QRPB 4YHPA 3OXSB 5EBGA 4YEEA 4LP4A 12E8L 5E95B 3P40A 2MJWA 4YGAB 4LIQL 4FQHB 4LASL 3BHBB 3T4YB 4I0PC 4PJBE 4DKEH 3ARGB 2VNCA 4X6FB 2AGJL 3HCVA 4LCIH 1G7JA 1A64A 1T1XA 4TSAL 3K4DA 3D39B 5DK0A 5B8CC 1X4ZA 2QBWA 4J3XA 3T04D 2A1WL 3OGCB 3VCLA 2VXUH 5I8CA 1OT1A 1MIEL 3BP6B 1P69B 3DI2B 4KK5D 3TFKD 5EPMA 35C8H 3FO2A 3GMOA 2UVFA 4NJAL 4PBVC 3TF7C 1Q0XH 4GS7C 3P9LA 2FD6H 2OL3H 3GM8A 4Z7WA 2IALB 4NQDA 4RQQB 4OZ4B 1KPVB 4ZYKA 3LEVL 3NMEA 5H35B 1D3CA 1FLTX 2P8PB 3NFSL 1HHGA 3QIWD 3OKOB 1EV2E 2FBOJ 1XF1A 4P2RD 1S9XB 1WIPA 2NY2D 3BDYL 2J8UE 4OKVA 3QDJB 4W4NA 3IRZA 3FTGB 1MQKL 1GGBH 4PB0H 4NO3B 3Q0HA 3C8DA 2MHAB 5DHVB 4MJIB 4HHAA 4TN9A 3CVHB 5BVPH 2FBJL 4HIEA 3REVA 3SJVE 5I16A 3CMOL 1FE8L 1KBGL 2HLFC 2R2CA 4AL8H 1U8NA 3K8LA 1LK3L 4KQ3L 3O11A 1J11A 4PJEB 5DJYA 5E94B 1AQKH 2ADIB 5MEQB 3IFNL 3DROA 5FHAH 3ZO0A 3NFNB 2A6KB 1CYGA 3D3VE 4Y5YA 1IFHL 3JVGC 3NPSB 2F19L 4GW1A 5DRWB 5LXGL 1URLA 5FOBA 4G7YL 4XVSL 3I6GA 2NY0B 3SKJH 1OAXH 3TA3A 4YDLB 4OD3H 3EO1B 4U31A 5ACZB 3KDMB 4PTUB 1YEFL 4DGYH 1MREL 1QSEA 5DYOB 3HUJE 5FOJA 2EDHA 4OCWL 3D2UA 4QO1A 4Y4HA 5INCB 3KYNA 4E9LA 4IEFB 1MCWM 1PAMA 4ERSH 3IJHA 4JFHE 5T3ZL 1AO7E 1J8HA 4JKWA 1D6EB 4BH8B 3T0XA 5CILH 1U92B 2W65B 1WZ1H 4LLUA 3ZKMD 3V6ZA 4HKBA 4ONGH 5KOMC 2UWEF 5L2KE 5JPMA 1BPVA 1EERB 5DHYA 3QEUA 4MNHB 4I3SH 2YPLA 5L88H 3ZE0F 2I9TA 2RBLA 1S7RA 1KJ3L 5C0BE 5CBAB 3QHFL 3KNBA 5D1XC 4XNMB 2CK0H 1N0LA 4OV5B 5GPRA 4F9LA 4ZPVA 3QUXC 4GQ9H 3DGGB 2HT4C 3QUZB 3CCHB 4AEHL 3OL2A 2P24A 4NFBA 1F8TH 3U4BL 3K3QA 4M7JH 1T66C 3UTPE 1JPGB 2DJUA 5BRZE 3JWOC 3SJVD 2BDNL 5CINH 5T1MA 4LLYA 2DI8A 4PG9A 2BCKA 3SDCA 5DJDB 1FCGA 5EUOB 5ID0B 1EHXA 4GXVH 4HK0A 4J6RL 4X4XA 3K2UL 2J12B 3D3VD 1YPZE 1CI5A 2X4NA 1OAUH 2H2SD 4JDZB 1LP9F 5TDOB 3WCYA 4EOWL 1RUKH 4U1MA 4HUXB 4Q74A 2JJSC 3G6JB 2GSIB 3FAXA 4NP4H 3JV6B 4P99A 5BS0B 2JELL 3HI5L 3VXNB 1R3KA 4R0LB 4AG4L 3PNWA 5C0GB 3OBAA 4BQBA 1UEYA 2ESVD 1EZVY 2GJZA 4RFEB 1CT8A 1MAJA 3LPGA 4LHJB 1SQ2N 1EO8L 4H5SA 4WHDA 1H8NA 5E8PB 1ROWA 2JJWA 1UGNA 3FHAA 3HB3C 3V8CA 4P46D 5JUEL 3PWVA 4I2XB 1YNTB 4JFHD 3HAEB 4B53A 3L3IB 4XB8A 2LTQB 2XN9D 4JB9L 3MFFA 3VRJB 2VQ1B 4CNIB 3QXDA 1ERNA 3MYZA 1NKOA 2V9RA 3LKNA 4AM0B 1YN7B 1AGDB 3T77B 5B22A 3NCBB 3BW9A 5F1SA 5L2KD 3H9SE 4WI6A 2X4TA 4WGWB 3TM6A 4GRMA 2A6DA 5DF0A 1A6VH 2Y5EA 2QR0A 4F3FB 4YE4H 2XRAH 1CU4H 4LSRH 5EUKB 3V4UH 4PJIF 1FNLA 3PXHA 4NPYB 5F89B 1HXMA 5C0BD 4RZCB 3MBEA 3UBXG 4O2FA 3VRIB 5CEZL 2DLTA 2CRYA 3F5WB 1E4WL 2GY7B 3WLWC 3LH2H 4N8VB 2H6PA 2D03L 3UJIL 1IGFL 1F4YH 1MNUL 1NGQL 1FG2B 4QLRA 3ROLA 3ARFB 2MCPH 5GJTL 2Y07L 1ZSDA 2AK4E 3UTPD 4JKPH 2GEEA 3WIFA 4OCRH 2XNAB 5BRZD 3P4MB 5IJKA 5JOFB 1OGAA 2P8MA 2VXVL 4JDVA 5E99L 5FO7B 5EIVA 1FVDB 4JZNB 4N5EC 1I1AD 1X5LA 4E0RB 1JWMA 2NX5B 4DVRH 4K3JH 1L0QA 5I74B 5I1JH 1RV6X 3WNMA 3GO1L 4N1HB 3T0EA 1WICA 1G0DA 1UEMA 1NANH 3ZYOA 1DDHB 1M1SA 1JPST 1TJHH 2LV4A 3OTTA 1FCCA 2JJVA 3TYGL 4DKFH 1GAFH 1UWEH 4FZ8H 4OZHE 3KPRE 3KJ6L 5D7IF 1TNNA 5EWIL 5EZOL 2BNQE 1IBGH 1TZHA 5BW7A 3OV6A 2YC1A 1SBSH 1DBBL 3G5XB 5BZDA 3CFBB 5JW3H 5LGHH 4QHLA 3AY4C 2VLJB 4ZUTA 4MAUL 3G9AB 4U1KB 3EO0A 3OWEA 4QRSA 1X5AA 3L9RB 2BXYA 1L7TL 4DTGH 2A6IA 3P4NA 3W81A 2AXGA 3CFKA 4YBQD 3GMMA 1Q1JL 2HJKA 2VR9A 1RVFH 1BF2A 2F58L 3DI3B 4I4WB 4HIIA 4WJ5B 1AJ7H 4DK3A 5I2IB 3CSPA 2N56A 4E41A 1MJJB 3RIAK 3KPPB 3OKLB 5GRZA 3GSOA 2DTMH 1NC2A 3T8XB 3NAAL 4P2OB 4U1NB 4PJHA 4BYHA 3RY6A 1DLFH 1CLOH 3H42L 3PWNA 2JJTC 1KB5H 1T20A 1UA6H 4HUNB 3LEYL 1PX3A 5HJ3A 3EAKA 3L3DB 3ALWA 4TTGA 1YYML 2NY1C 1KEMH 3FN0L 4J7RA 3DVNB 5DJAA 1TQCB 5TPWL 1OQOA 5GS0H 3VE0A 2AK4D 4HWEH 1TITA