1QYGH

Anti-cocaine antibody m82g2 complexed with benzoylecgonine
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
220
Chain Sequence
b'EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB M82G2, LIGHT CHAIN
publication title Diversity in hapten recognition: structural study of an anti-cocaine antibody M82G2.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qygH02
4J4PD 4P59L 5F7FA 5F6IB 1JFQH 2R0ZH 4JDVA 5CCKL 5GGUB 4U1NA 3SDCC 5EU5A 1L9NA 4LU5L 3CFBB 1ORSB 3GRWH 2C4FT 4RMWA 4K9EC 2Z35A 5CD5C 3U9UB 3DROA 1MIML 4MHHI 5IR1A 1TVBB 4OJFL 3LKRB 5I76B 1KPUB 2FEDD 2FEEI 2ORBH 4PP1C 3IS0X 4OQTA 4ZTOL 1BWMA 3E6HB 1H15B 2FL5A 3ULVL 4HKJA 4UU9A 1WBXA 3C8DA 5J13C 4IMLA 2ZUWA 2NY7H 2YR3A 2HH0H 2P46B 4KK8C 5DRZB 1FGVL 4K3DH 1LD9B 3OX8B 4G8FA 3VDBA 4Q6IC 3QIWD 4U05A 4XMLL 4OGYL 2X70A 4LSQH 1N2RA 2HA1A 4Z0XA 4MS8C 3E0GA 4X7TB 5HHXL 4KU1A 2GTWB 4QNPE 4JPKH 2ZSVA 5AWNH 4B5EA 3MGTA 1KJMB 3RZCC 1AGFA 3OKEA 1DVFC 3VXOB 1RIHH 1OLLA 4UZGA 2OXGA 1IL1A 4V1DD 4ZYKA 1TFHA 4UI2A 3MNZA 3RWJB 3MCLH 1RZGA 1W72H 2XXCB 4JFDA 4L1DA 1R3LA 4Q2ZA 2OQJB 4XBEL 3QUYA 4NO3B 4ZPTB 4JZNB 4YQXH 4NQEB 1KPRB 1WZLA 5FUOL 1ADQA 3WUWG 3Q5YA 5HGDA 5FB8B 2DLFL 3TCXA 4PJGE 1JGEA 3T8XA 4PJIA 2VLKB 4WEUD 2IAMC 1T1YB 3L5XL 4PB0L 4D8PA 1P69B 3T3PF 4N5EC 4FXGB 4NZUL 1L6ZA 3GSRB 3S96B 3BW9A 1X5HA 3WN5C 5MHSE 1QR4A 3TN0A 1MY5A 1I7TA 4MCYA 4FFYH 1QEWA 1WBZA 1UCBH 1UZ8A 3LIZH 5DMJB 2AKRB 4M7LH 4X5XB 1SYVA 1BM3L 2QLVB 3IAQA 3NGBC 3O4LD 1DANT 3QEGH 2XA3A 3VWKC 4NWUH 1WK0A 4XH2B 2X1WL 1CYGA 3FO2B 3KJ4B 5EORH 2NY1C 3LPGA 2YD5A 5DJ8A 1CD0A 1FL3A 2P44B 1S9XA 3DURA 5CEZL 2PETA 5J1SC 4LLWA 5L9DL 5GXBB 4OZIB 2Y5TB 4PP2B 4Z9KB 4KKLD 3KYNB 5FHAH 1SY6A 3QDJE 5GGVH 3RA7L 3IYLW 4JFQB 3SE8L 4AM0B 2I26N 1D5IH 3IJSA 4RNRB 5D7JD 4NQED 4XPAL 5E4EB 4MXQC 3IU3A 1WBYB 4O00A 1PAMA 1X4YA 4ODXA 4K3EH 4RDQF 2VDQL 4OSUH 3LPFA 3QDAA 2AABL 2PN5A 1HQ4A 3T3MF 2D0FA 2KH2B 5TH2A 2OP4H 5HTSA 1KNOA 3P73A 1CI5A 5CLWA 3QRGL 1C12A 5F9AC 4KKAD 4XMKL 4RAUA 2CLZA 1NGQL 4XPHL 4MA8L 1Q1JL 4MCZB 5HHNA 5DR5H 4WFFE 4UT7H 1RK1A 2C7UB 4D0CB 3PABA 1XCTB 1T6WA 4Q6IA 3QXAA 5ADPL 1AHWB 2JB6A 1MFCH 3S5LG 2R39A 3L3IA 5HVGB 1QA9A 3VG9C 4C55A 2AJSL 3RZCA 2H8PB 4WTWA 3FCTB 3U83A 3UTZA 2VE6B 3ARRA 4U1SB 2DKSA 1P9MC 3OJ2C 4X7EC 1J86A 1FIEA 1KSRA 5BRZE 3ZDZE 2L4OA 1RHHB 4AEEA 4ENED 5F97E 5DQDH 1MFEL 1D5XA 2WBJB 3EHBD 3GSWB 4OUOA 3WFCL 5DK2A 2GJZA 1WT5C 1TCMA 5F7EH 4J3UA 3GSNA 4LQ1A 4N0FA 3IFOA 1JNJA 1WEJL 1M7IA 3L1OL 4LSVL 2AJUL 1J1XL 5IHUH 1XH3B 5BS0E 1RJCA 4RISL 2DQGL 4BQCA 2LV4A 4TPRH 4D2NA 1GZPA 3EYFA 2L7UA 3EDKA 5M94B 5HHQA 4KXZI 3N85H 1CGYA 4FTVB 3WXWL 3KAAA 4ZSOB 1P4IL 3NH7L 3RWCB 3NIGF 1EZVY 2EYRB 5DUBA 4HMDA 1A7QH 2IWGA 2NXZD 2Y4SA 4I2XE 3RKDD 2VDOH 2XG5A 3QWOA 4IDJH 1BBDL 3A6BL 1WAAF 1ZHKA 1QACA 4MAYB 3U36A 2PKDA 1JPTH 2VXQL 3KPRD 5E6YA 1N5YH 3WLWC 1BFVL 3I9GH 4OZGE 1U2CA 1K8IA 3UYOD 1FDLH 2EDBA 3WD5H 4O02H 2YK1H 1YPZA 4BQ6A 3W0WE 2M8XA 2AXGA 3ZE1E 3GSUB 1XAUA 3GMRA 1KLGB 3G6JB 4R2GD 5IB5B 1OD9A 4Y16B 4Q0XH 3C5JB 1WQVT 1DN0A 1GSMA 4IRSC 1TPXB 5CJBA 1EEZB 2Q8AL 3HE7A 3O3AB 1BBJA 3TZVC 1U8QA 4HG4K 1YEGL 2OR7A 3UTTE 2FB4H 1IE5A 2NZ9C 2R2BA 4YDVB 5E8PA 2EIZA 1KT2A 4NM4L 1OM3H 2O5YH 1OARH 4MMXC 1PY9A 2YKLH 3FT2A 3H42L 4LEOA 4OUUB 3RWHA 3KNBA 4RMSA 3MJ9L 4DN3L 3SKNA 3WUWB 3P77A 2FIKB 2QR0B 4AT6B 3LN5B 5B3JF 4BH7B 3PWJA 4Y5YC 3HMXH 5CZXD 1AGCA 1P9MA 5DJZB 1FORL 5F9DC 4U1IB 2FYYB 1AD0A 4UTAH 3A67H 1L0XA 2Y07H 3VXUE 5KS9A 1KIPA 4TULH 4WW2B 4DVRH 3MGAA 1P5VA 3AAZA 2DAVA 2EDHA 1MJUH 1TZIA 4J3XA 5D6DC 1MJ8H 4HUVB 3MUGA 3QULB 4Y16D 2EDXA 4UOW1 4G8GA 2ZPKH 1Z3GH 1G7IB 2IH3A 4XPFL 4X6DF 5TDNB 3MFFB 2VMFA 4QKXB 1SJHB 4PJ7B 1XF3B 2B1HH 2JJSC 1PW3A 2E27H 1ZA3B 2VXVL 4X7SH 5E8NB 3BDBA 4FQ2H 1FSKC 1I8MA 1FO0H 4WO4C 3TPUA 2QEJA 4ERSL 1R5IB 1GGBH 3DECA 2J3SA 5FYKH 5FA4A 4AIZB 3BP7B 1RZJL 4QYOA 1U3HA 3MRCA 3TWCH 4Q9BA 4EOWH 4KH2A 1X44A 3V7MA 2MWCA 1BQHG 4GRMA 2A77L 5FXCH 5KANG 5DO2C 3VRIA 5DRWA 4M1DH 1GRWA 4N1HB 2OTUA 3FT3A 4BK5A 4HKZA 5EZLA 1QLEH 3VXMD 4LARH 1VA9A 4O4YL 4DN4H 3JV4B 2R23A 4HMEA 1E4JA 4N8CH 4NGHL 3ARQA 4FQXD 1TVHB 3BWAB 4QOKD 3ARDB 1LK3H 1M71B 2PXYD 1MFBH 2QQLH 3ULVD 1SHMA 3VFUA 1QQDA 3UC0L 4JB9L 1U8KB 4GRLA 3EGSA 3S5LB 3UTSA 2EO1A 4IRSA 3V5HB 4F9PC 2XFXA 4KJQC 3FOLA 2PTVA 5EUKA 2EH8L 4POZC 5D93B 5J1AA 3TZVA 4GG8A 4AEFA 4H1LH 1CE1L 1MF2L 3FQUB 4ELME 3MLVH 4CRPA 4MMZC 4JM4L 3HZVA 4XWGL 2AEQL 3NFPA 3H0TB 1BF2A 4ORZC 2ENYA 4P23C 2WQ8A 4AMKH 2Y6SD 5MI0C 3L7FB 3QUMH 3EJYC 3NIDF 1ZE3C 5F1OB 1L7TL 5AAMA 1RJYA 4Y5YA 3B9KC 5FV2A 1CLOL 4PJFF 4F15B 3KPSD 3T4AA 2ERJB 2WIMA 5IB2A 1BOGA 2UZIL 2GJ6E 3LKQA 3LPWA 4FZ8L 4JREB 3RHWF 1XF4B 3UJTH 2YD4A 5D6DA 3IXAA 5ACLA 3PJSB 2GT9B 1LO0H 4L9LC 4FZEH 3M17A 2JIXA 2DQDL 1JE6A 5JA8B 3KWWA 1NFIB 2E3VA 3L7EA 1EGJA 2BVTA 1HYRC 3MRFA 1U6AH 3CFKA 4GAJL 1F4WL 1NGYA 1UG9A 4M8QA 4M5YL 1EFQA 5H8DA 3KYMB 1VKXA 4MNGB 3RVWD 2AEIT 3CXHK 3O3EA 1WWAX 2WP3T 5E1AB 1LO5A 3EOTH 2BOCB 3T0XA 4CVWA 4ODVH 4WO4A 1Y18B 3S36X 4KVNH 5DHVA 4N0RA 4MWFB 5IV2A 5JHDA 3E1F1 2WNGA 1VPOL 4CMHC 5H35B 3TV3H 3BUTA 3OG6B 3I50L 3ZKND 2O5XL 3MLWH 5K9JL 2XN9A 2BCKB 3P0VH 32C2B 1CL7I 1G9NC 1Z9LA 3CMOL 3GJEB 4Y1AD 4YDKH 4CGTA 3R0MA 3VFGL 3BVNA 4LHUG 4NRZB 1EHNA 2XOTA 5J57B 1EJOL 1RFDH 5IW1B 1SJEA 2E6JA 4U1LB 3KGRA 4PREB 3RY6C 3UZVB 2R9HD 4PB9L 3LQAL 4WI3A 5J3HD 4FFVC 5IHLB 5DMIL 4D0BB 2WLYA 4OF3A 4IMKC 3E6FA 5LAXA 3FOMA 3U0WL 5GSVA 4F9PA 2VAAA 4JO4H 5HHME 1Q9OB 4RAVA 2MQCA 1F3RB 2CR6A 3FB6A 2XWJA 4CVXA 1ORQB 3BDYH 3JWOC 3OJDA 4YHLH 3FQRA 2VOTA 1RU9L 3B6SA 3O6KL 4ISVA 3CJJA 3W2DL 3CFCH 4ZFFB 5ABDE 4G8EA 4YK4C 4EI5D 1E0OB 3MNVA 1A1OB 4UUJB 3HG1E 2FD6L 2GTZB 4OCYL 3SDAB 1OAKH 4GKZA 4P4KC 1A14L 3P40A 3TYFB 3B9KA 4ZQKA 4XXCA 4PJAF 5KVDH 2EO9A 4HHAB 4AG4H 3G9AB 1DL7L 5TF1L 4MDJA 4MB5A 1I8KA 1QSFB 5HY9A 4LASH 2DB8A 2CIIA 2VQ1B 4YHNB 4KV5F 1J8HE 5BZWB 1NH6A 3M07A 5D1ZB 4EEEA 3RNKA 3ET9F 1HHIB 1K8DB 1FNSL 5IW6A 1Q0YH 5FGBC 4Z7VB 2YOCA 5TDPA 3QAZB 1UT9A 3IDGB 5J0BA 3JWNC 4JZOB 1H3WM 3TVMC 3ZT5A 3SCMD 4HUWA 4RSVA 5HHOD 4Y19B 3QEHA 2J7LA 2CK0L 2JK5A 2DKMA 1BQHB 3WNNA 1YQVH 2GAZA 4JFOA 5JXAH 1A7OL 1UXSA 5IB3A 3SE9H 1GPOL 1G0XA 5EWIH 4IOFD 2VISB 3S35X 4P5KB 4U3HA 3U46B 2NQCA 3ROLB 3GIVA 4HLJA 4W4OA 5C0JB 1H5BC 3VE0B 2BVPB 5HI5C 5HVHB 5BO1L 1A7NL 2WK2A 5DC9B 3JTTB 1MCSA 3QDGD 3MRKB 3MUZ1 5JDSB 2I9TB 4Z95H 2ITCB 4AIOA 1QOKA 3RGVC 2DM3A 1LO3L 25C8H 2DTSA 3U9PH 4YHIB 5EO0B 3RY6A 1A4KA 1DQJA 3D18B 5DQ9B 4Y4FC 2FX8H 3IS1X 4ODWB 4ODUA 3HHRB 3QDMB 3DO3A 4KI5D 1AIFA 3MLZL 4X6DA 2MKLC 3UJJH 4XBPB 3K4AA 4IOIB 5JORB 3WIIL 1AGDA 1S8DA 4BSVB 4OKDA 4I48B 4PJEB 3GMLA 4HJ0D 5F6HJ 2ADIA 3QJFB 5DZLA 4JFDE 1W0VA 3I2CL 3NFSL 2ZUVA 1RULL 3OB8A 3VGHA 2IADA 3FB5B 1K4CA 4F2MB 2EC9T 2OMNA 2BK8A 4LLQA 2VQUA 4Y5XC 3G5VB 2Y5EA 1JZ6A 1KUMA 4IJ3C 5F7DA 3VFRA 3MRDB 1LE9A 2BOBA 2FATL 4PJIE 3KJ6L 2Y7QA 5EU6A 4P48A 3MTRA 1R5VB 1HE7A 4OLXH 4P4KA 1KFAH 1FP5A 5TDOA 2VDKL 3EYOA 4JN2B 3MX0A 3CK0L 3IFPB 2YRPA 1BOYA 3H9SD 4U1HA 5EOTA 4LSSL 5B39A 3AXLA 1U8JA 5AD0B 2G2RA 4EKXA 4OV5B 1NCCH 2VDNH 4ONFL 1PG7L 5GRVL 2FECL 1GVIA 1S7XA 4MXWH 43C9A 5DJCB 2HWZH 3IETA 1AJ7H 4JHWH 4QXTA 4L29A 4PGCB 4NQTA 3KPMA 1HINL 3MXWH 1U8HB 2MQ3A 5T1KD 3HI5L 1WWBX 3RJQB 1OTSC 1CQYA 3QPXL 3D0LB 5FKAA 5FYJU 4L5FH 1HCFX 3STBA 4APQD 4MJIE 3FQXB 4WI6A 3OTTA 5I15H 5DJAB 4G9FB 5KSBF 1MCEA 2HFFA 3MRGA 5ADOL 3LKSA 1QFOA 3TCLA 1W8OA 3CVHA 3MJ8A 4LHUB 4R90H 3ZYIA 1I85C 1DBMH 1KGCD 4JO1H 2UUDK 1C8PA 1UH3A 4UNTA 2EKSB 3O8XA 4U0RB 4HUUA 3FT4B 4RGOL 1H5BA 4C83B 3QCVH 4HG4J 5BZDA 4PG9B 1JGDB 1NC4A 2Z9TA 3JV6A 3V0WL 2Y36H 2G60H 2RR3A 4JGJA 3RGVA 4NQCD 2XKNB 5JPMA 1N0XL 3MA7A 3MOQA 3VFPB 2F8XC 4NQVB 4UV4H 3S88H 1J5OL 1C16A 1YNKL 4L3CB 2ICES 5L7XL 3ZDYF 3ZHLA 4XTRC 1H8OA 5IBLC 5I1KH 1G9ML 2J2ZA 1GH7A 1FG9C 4HIHA 5DEZA 1Q8MA 5E8OA 2Y06H 3BHBB 2YPVH 1BVKB 3L3KB 2EDOA 1UACL 1KIQA 1U91B 1ZWIB 4RBPH 2F5BL 3GHBH 4S0TD 3P9MB 1YNTB 4MD4B 4K07A 2NY3D 2YSSA 4MJ4A 5C9JB 1F6AB 5BCAA 5F7KC 2GK0A 2DLHA 4FFWC 1JPSH 3OPZH 4KTEH 4Z7OF 4JLRB 1IC4H 4H88H 1EEUA 1I3GL 2YBRA 3JSSA 4Q74A 3BRDA 4NQXA 4QTIH 5EULV 3SKMB 1BGXL 4P4RB 3QEQB 1I7RB 3DBXB 1IBGL 4PJ5D 4A2MA 4UBDD 5GSRB 5DFVD 1AGBB 4XMPH 4G43B 4I4WB 4XRCA 1KBGH 2X4UB 2W9EL 3V0VA 3BD3A 4P59H 2A0LC 4HLZG 3QZWG 5CCKH 4DQOL 2PO6B 4P2OB 3OAYH 1TXKA 4NKDA 1KTRL 5J12C 4LU5H 5EC1A 4QY8A 3OJVC 3WE6A 4PGBA 3GSXA 4UTBL 1JGUL 4R97C 4Z7UB 5F3BB 4OJFH 1G7HB 3P9LB 4ZODA 3WLBB 3VRLF 1FL5B 1IAII 3MRIB 2LE9A 1NLDL 2BNQA 3FMGL 4KUCD 4ZTOH 3CXDL 4XVSL 4WV1B 3ULVH 2CH8A 2VR4A 4PJXF 5DJXA 1DJSA 4PRHB 3CSPA 1FFNB 1YPZE 1MHCA 5DEGA 3FAWA 1MH5A 1P7KB 2YD6A 1FGVH 3VG0L 2PW2B 5E2WL 3RY5A 1W0YT 1KPVA 4L8BA 4XMLH 5CJ8A 4OGYH 5C0DB 1EMTL 4OLYL 1IGJA 4PGJA 5HHXH 1SM3L 5EU4A 2X9WA 3EZ8A 3QFDB 4NQDA 4OLZL 5BVPL 1EIBA 1TZHB 2BVOA 4HZAA 1IAIH 1JNNL 2BNRB 1INEL 2Q20A 3QIBD 1GC1C 1HEZB 1XF1A 4XBEH 5GGSA 4HKXB 5GJTL 3PGCA 3SPVA 3L3GA 1RI8A 4I9WD 2H26B 3RUGA 2DLFH 5E9DB 5IJVB 3UJIL 2EZ0D 2CO7B 4PB0H 3GMOA 3EYQC 3DX7A 4NZUH 3QUZA 3V6ZB 4U1MA 3C60C 2NY6B 3BN9C 4X9GA 5KS9E 2MSPA 4GRWH 4X99B 3HZKA 1F42A 1LNUB 4M8VA 4LEXH 1BM3H 3B8SA 5ERWB 4G8GE 2WBKA 3U7AA 3S7GA 3CXHJ 4ODTL 1U92A 4PRID 3DIFA 2NTFB 3DLQR 3ZHKA 1OCWL 3BPLC 3RL2A 1KCUL 4HUNB 5CEZH 3C6LC 2DWDB 4QHUB 2NY4D 1EFXA 1PZ5A 3OF6A 3RA7H 1ZLVK 4U3XA 3JTSA 4ZUUB 5T5FL 2VDQH 3QI9C 4M1CC 4X6BB 2AABH 2MTPA 2VZOA 3OXSA 5C08D 5IQ9A 2HLAA 4NFBA 1NBVL 4OIIL 1EHXA 3VGFA 4PGDB 3L5WB 5ENWB 4L8CA 3QRGH 3MYJA 4XMKH 5E8EA 3F5WA 3F7YB 5I75C 1NGQH 4XPHH 4MA8H 1Q1JH 3MGOB 2ITDA 3U2SB 1YYML 1JPFA 5MEPB 4ZO9A 5F1NA 2IBZX 5SX4I 1GGIL 5L2JB 1B0GB 2VUOA 4QGTA 5ADPH 3TIEA 4Z7NF 2WUCL 5C71A 3UTSE 3T3PE 5H37H 3OWEA 5T3XL 4DUVA 4W70A 2IEPA 1HK6A 1QRNA 5ILTL 1VDGA 2AJSH 3AS0A 5DJ0B 2WM0A 4GBXA 2KKQA 3MV9D 4QRUB 2E7LC 5I73C 2NPLX 3T2PA 3WIFA 2BERA 4JPVL 1N6VA 4M93C 2CKBH 4GAYA 3MLXL 3PQYB 4JY5L 1MFEH 3MO1B 3WFCH 5IESL 2GCYA 2RCSL 4TTGA 1FNAA 5CWSA 2GSIA 3N1GC 3T0EB 1AXIB 2APVA 3DRTB 4LLUA 5C0FB 4XXDB 3L1OH 3U79A 2AJUH 1J1XH 3RDTD 1RAMA 4RISH 2DQGH 2VXTL 3K46A 3D6GA 3TA3B 1J05A 3C60A 3S37L 2MKWA 1IAOA 3D39D 5KSBA 2FO4B 1CT8B 1AR2A 3V6BR 4F58L 1UFUA 3QZWB 1V3MA 2YC1A 5LGJA 4RIRA 1NBYA 3WXWH 4Z6AT 3T3ME 4NOFA 1F3JB 1P4IH 3NH7H 4ZXBD 5C0RL 3C5ZB 3PHQB 2OCFD 2GJJA 3PNWA 2VH5L 1QTYT 5J89A 4CDHA 2HJLA 1B4JH 1PLGL 2CUHA 1II4E 3QFJA 5KZCB 2H9GB 2ZP0T 4XP1H 1V05A 2YRZA 4LLDA 5FYKE 1BBDH 1N5AB 5SV4A 1BF8A 2V7HA 3A6BH 4WFGD 1WJ3A 2JJTC 1S7SA 4XNYH 1IJ9A 3QQ4A 2C3VA 2VXQH 3AS2A 5JHDE 3QNZB 1CDYA 4X6CF 1BFVH 1ZKAA 1ZT4B 1AFVH 2CXGA 3SDDD 3ILPB 3QI9A 5KAQF 2XN9E 1FYHB 3N50A 2J12B 5MERA 4YPGA 3TO4C 1RJZA 1NBQA 1A21A 1X5JA 1OGAA 2H3NA 1CDIA 3DO7A 1F6FB 2C4XA 1AY1L 3DUHA 5ICXB 3G6DL 2Q8AH 3OKLA 1CR9L 1IGIL 4XX1G 4TSCH 2VDLL 4F7MB 4NM4H 5GGRY 3UYRL 3QUXC 1NC2B 1YEHL 5JA9A 4X0KB 3H42H 4ONHB 2H41A 5FO7B 3QO1A 3MJ9H 2CKBA 1KULA 3OHXA 5FDWA 3K74B 1HQRA 1JGEB 1U58B 3UAJC 1T2JA 2CMRL 4KK9C 4IHOA 1FORH 1FAKT 3HI1A 5FDYA 1LK2A 4S11A 1HHGA 3NIGE 2DQTL 5D7KD 4WI7A 1EZVX 2IC2A 5EU7C 1FJ1A 3VGBA 1YEFL 5IUSA 4Z76A 4RA0C 4PLJD 1X5YA 4YFEA 4XPFH 1WIPA 1IILE 3EOAA 2F15A 4HK0B 4NN5B 5CBEB 2HN7A 2ZG2A 2B2XL 1OY3B 3DMMB 1C5DB 4PJXA 5F96L 3F7VB 3LKPB 4O2CB 5L0QB 3VFMB 4PJHB 2Y23A 3DJ9A 4ERSH 4G5ZL 1HH6A 3DUSA 2O5ZL 5AUMA 1NMAH 3SDXB 4HS3A 4X80L 1RZJH 3SDCB 1MWAA 3QQ9D 2X4NA 4P3CL 4YFDB 3ESVF 1FVDA 4YH6A 4XVUC 4YAQB 5GS2D 3RGHA 5J6HB 3ZYZA 1R0AL 3RJDA 2EDKA 1QG3A 5LXGL 1RJLA 2A77H 5D1XD 5EFIA 3BP4A 5HSFA 2EDNA 1LQSR 1RZFL 1UVQA 3WS3B 4D94A 2A2QT 4O4YH 1WCBA 1IC5L 5HYJA 3O3DA 5AZEH 5J13B 3S3SA 4NGHH 1T2XA 2YUWA 2XTJE 3TO4A 1L6XA 4O2EA 3VRJA 5B3JE 1TZGH 1OTUD 4WHTB 4I5BB 2EIBA 5IWLA 2F53B 2CLVA 3HCVB 4WY7L 3UC0H 2IPUK 4JB9H 2AK4B 1HDMB 4OFIA 1Y6NR 4WNQB 4DVBB 2F54A 2VLRD 4WU7A 5C09B 5C86A 3GZKA 4G6JL 4Z7WB 3T2NL 1B2WL 3BIKA 4BFIA 2EH8H 3WO4C 3FRPA 2VZTA 1DVFB 1R3HA 2B20A 1QVOA 2X89A 3CIQA 1KLUA 5JLZB 1CE1H 1MF2H 4LDEB 4HC1L 1F02I 4JM4H 4XWGH 4X6DE 2AEQH 5F7WC 4NFCA 3QUXA 2I07A 1GXEA 4EIGB 4PV8A 5I6XC 3ZTJH 4PJCA 3OKDB 4BKLB 2FLRT 5IMKB 1KN4L 2G5BA 1IGTB 1L7TH 4WGVB 4UQ3B 5DMKA 3OJMB 1QR1A 4WIQA 1CLOH 1XR9B 1B0RA 3RIAF 5DD0L 2E9WA 2IAMB 2Q3ZA 4ZDHB 2UZIH 4FZ8H 5EBMB 2R15A 3WN5B 5ETUA 4XCEA 3IXTB 2F53D 5EU6E 4WTZA 4JRXD 5C09D 3LN9A 3VWKB 5I1HL 1T22A 5K59F 4J8RB 4F57L 5ALBL 3BUYB 3NOIA 4GAJH 3ZKQD 4P57B 4M5YH 4MLSA 3RVVC 4RWYL 3DRQA 4I18A 1PY4A 2BY2A 3EOBB 2EE9A 1OAYL 4DEPB 1PEZA 4KK6D 1I1AD 4QXUL 1VPOH 4PGEA 2CRZA 5IEHA 2E8YA 5ESAA 2VYRE 1A6UL 3PWVA 5ITBL 1CDJA 4CKVX 1DQLL 3FJTA 3EUUA 2JELL 4JQXC 5F89B 4QRQB 5K9JH 2EIEA 4W6XB 1BIHA 1HSAA 5J56B 3LSOB 4JHAH 5DURD 1CVSC 3R8BB 5E2TH 3GSVB 35C8L 1RUQL 1U93A 5D96B 1AI1L 3CMOH 3KPLA 2YXMA 3VFGH 3HE6C 4L3ED 4XWOC 1EJOH 3VD3A 5IVZB 3Q2CA 3OGCB 1A4JA 2XY2A 1XGPB 4GQ9L 3PE9A 4HF5L 4PB9H 1PZUB 5FA3B 4OT1L 4XCNB 1FVCA 1OT1A 5AAWA 4GSDL 1S9YA 5DMIH 5DXWA 3L3DA 5BQ7B 4F8TA 4QO1A 2VWEC 5DRXA 3U0WH 1F3DJ 3G08A 3ARBD 1DUYA 1OGTA 1EEQA 2CSPA 2HMID 3MV7A 4ZFGH 1YN6A 1WFOA 3G9VA 1RU9H 3O6KH 3TT1L 3W2DH 2ADGA 1VEOA 5BW7C 2VABA 1CCZA 1T66D 1CXFA 1UWGL 5GISL 2FD6H 4OCYH 2FX9L 1A14H 4PS4L 4F7EA 2J5LC 1QSED 2VL5A 5C0GA 4Q9RL 4K3JL 4EI6A 5DF0A 4K7FB 4BK4A 2LTQC 4HZLB 1DL7H 4X6CA 5TF1H 5CSZB 3TO2B 4GW5B 3QSKB 4Y5VC 3X14B 3HRZA 1V3LA 4Z8FL 3NCBB 2CGRH 5HYSG 2IANA 1T0NB 4XB8A 1NANI 4OGZA 3OG4B 4LCWA 4P2QD 5MENA 4OD1L 4YGVB 1NDMA 3WS6C 1UYWL 1IZJA 5DVOA 3HC0A 4ZTPL 1UQSA 2NY2B 3BEVB 3MV8D 5CIPH 5GRZA 1VADB 2AJZB 2H1PL 3T0BA 2DYPA 3W5MA 2CK0H 3V95A 4ORGA 3JUZA 1JNLL 2A9NL 2OZ4A 1U8LA 3VXTB 3GMPB 3HFML 1NKRA 3CUPA 2R0WL 1A7OH 5C1MB 2VTFA 1F4AA 3KVQA 3C08L 3RNQA 4D9RD 1GPOH 1Q9WB 3AB0C 1LGVA 4JQXA 2BNQE 3DX8A 4FQJL 4RGMB 1UKSA 1CLZL 2CRYA 4M7LT 2HG5B 4LSUL 5BO1H 2EE2A 1A9EB 3KPQA 2DDQL 3H3PH 1M05B 1A7NH 1EX0A 5DMYA 3W9DB 1FL6A 4BQ8A 3Q6FA 3FTGA 1OSPL 3FONA 1OW0C 5C3TA 5JOPE 4P2RD 4G6FB 4BUGA 4L4VD 1BJ8A 1S7TB 3ARFB 5I2IB 3GJFH 2X6MA 3MBEB 5E6ID 2Z91A 3MLZH 3WNLA 1XGQB 3ZL4L 1ND0B 4KTDH 3W11C 3W9EA 3WIIH 1T0MB 3GK8L 1I9IL 3UPAA 2DJUA 2VIRB 1OP5K 4KV5E 3AS1A 3W39B 1UZ6F 4OCSL 3RX5A 4UIMA 1MFAH 1Q0XL 4X7DC 3I2CH 3VFNB 1ED3A 4X4YA 3K2UL 3VXSA 1G7LA 1AKJB 1RULH 2BY3A 5HGHA 3MUY1 5LBSL 2X4SA 2F8OA 4BELD 4HGMA 4MX7B 3HB3D 4JAMB 3RUGE 4POUB 5BW7A 5HBBA 2FATH 4TQEL 5D5MB 5ID0A 2X4QB 3KJ6H 2V7NA 2EDLA 3FO9A 4KAQL 1XGUB 2VDKH 4JFPB 2NW3A 1IGML 3BEWA 3CK0H 1F4YL 3AMLA 4UILL 3LQZA 1NFDB 5IIEB 3B2UC 4LSSH 3AREC 3MRFB 3ECBA 4Y89A 5FECA 4Y5VA 3ARFD 3WCYA 4XAKE 4C54A 4ONFH 5DYOA 1PG7H 1EHLL 4NKQB 4YNYA 4OZIF 3O6FD 4KQ3L 4LVOC 5JIIA 1FSKB 1KC5L 4QRRB 4ZAKC 4UDTA 3UBXG 2Z4QB 3OAUH 3WS6A 5L8KB 1N59A 1HINH 4JVUA 4J4PC 2R1WB 1Z5LA 1MCKA 3HI5H 2WBWB 2E7MA 1S5HA 2DQEL 3KG5A 3OQ3B 3D3VD 4LFHG 3QPXH 1KACB 3IDUA 1AKJD 3WEXA 5K9KB 3MRQA 3LRSA 5KN5B 1YMMB 3BD4A 4GXUN 5BVJA 3VGDA 1XGRA 1FNEB 5ADOH 2VL4A 4A6YA 3TNNB 5ISZB 4XCCL 1C5BL 2FEDC 1NCBL 4OF6A 4LCCC 3KHQA 3OXRB 1FE8L 5GZND 3RWEB 3PP4L 2E9IA 4LKCB 5I74C 4JFEB 3SKJL 3FHQA 1PKQA 1NJ9B 4RGOH 2Q86A 3MRLA 3O45A 3ZLQC 5GGTA 5EN2A 2Q8BL 3BPOC 5I8CB 1VEMA 2C1OB 3V0WH 3WL9B 4J12A 3RVTD 2HT3C 4TUOA 1NAML 3D9AL 1P84K 3P4OB 1R24B 1OW0A 4U6YA 4O51A 4HPYH 1N0XH 3QIWC 5E2UL 1J5OH 2F74A 3EFDL 3WFHB 4OZFA 1DEEA 5F6IC 1G9MH 4WI8A 3PGDB 3U30C 4PTUA 1QRNE 3VDAA 1UACH 1JIBA 2GK2A 2OL3B 4U6XB 4XBGB 3GB7A 3QNYB 4GXVL 2F5BH 4P23B 3JWDC 4MNQB 1KJ2A 3P9WB 4KHTL 4F8QA 3K81A 5ISZD 2AS5M 1J0KA 1AO7A 4GW4A 1X7QB 2CKNA 1I3GH 4G8IA 1KB5L 5E0QA 5GS0L 1KIRB 1VACA 5D7SH 5HYSB 1T4KB 4WWID 1T5XB 4X5LA 3DSNA 2L0DA 5I30L 1BGXH 2F58L 3L3OB 1MRCL 1IBGH 1YN7B 3CCHA 3DX9A 4L9LB 2QQKL 4RZCA 4WVRA 1YEKL 3ROOB 1BIIB 3KDMA 4QTHA 5HHVL 1MUJA 5KSBE 2EECA 2W9EH 2MNUA 3AREA 5CJXA 3PWNA 4XCYA 4YHZL 5A3ID 1NGXB 2D03L 5DQJB 3NFNA 5GS2H 1N8ZA 4JR9L 3VFVA 1YYLL 4NNPL 3O41B 4NQUA 3VD9A 1FYTA 5D9SA 3QFJE 4UTBH 4EDXA 4Y4HB 1JGUH 3BJ91 43CAA 5L2KB 3X13B 2X7LA 1A1NA 5C0IB 4J4PA 4CMHB 2P5EA 4KKLC 1PSKL 2JCCB 3BP5B 3V9FA 2GFBB 1UM6L 1T21A 1NLDH 1R5WA 3B83A 5D7JC 1OD7A 3FMGH 4CADB 1OAXL 3CXDH 4XVSH 1U8OB 3ZDYE 4LPYA 2C9AA 3G6JF 5F71A 4Y2DD 3DTXB 3QIUB 4WUUA 3GSQB 5DVKA 3BO8B 5I1DB 3DVNA 3VG0H 5E2WH 5JXED 4G7YL 3CC5B 3OKNB 2ESVA 2VDRH 3NCEB 2FBJL 1KCRL 4KKAC 1MCPL 5T1MA 1EMTH 4OLYH 3JV0A 2C4FU 5BJTB 2G75A 4I3GA 1D5ZA 5MHSD 1OGAE 1I7ZA 3EO1A 1KCSL 1SM3H 4NBXB 4Z7OE 3P3YA 2JJWA 5BV7L 3KJ4C 1HNFA 3QH3A 2NLJA 4OIBA 4OLZH 5ACZA 5BVPH 2DQIL 1UKQA 2MPAH 3QIWA 5JOFB 1LEKB 5SWSB 5GHWL 3F58L 1WISA 5GIRA 4CUCA 1LO2L 1JNNH 2DLGA 1INEH 3ZKMC 5GGVY 5GJTH 4DGVL 5GGUA 3D69B 3HKFA 4KQ4L 2IH1B 3CFBA 1ORSA 1E28B 4YK4B 2YMXL 4OFYD 3RTQD 3U9UA 5HPOA 3QDJD 4AY0A 1TVBA 3BH8B 4ENEC 1OF2B 3LKRA 1J87A 4BJLA 3EHBC 3GEWB 5I76A 1D9KD 1KPUA 4PRPB 3DHJA 1YUHB 1QBMH 2R4RL 2RJMA 3E6HA 5FCUL 1H15A 4MD0B 2R1XB 4QWWD 2WMPA 4J2XA 3BGMB 4PY8J 3HUJB 3VRLE 2B1AL 3SE4A 5T5NF 4ODTH 4LPTA 5DRZA 3UBXB 4PD4K 5JIKA 1J0ZA 3R8QA 1LD9A 3OX8A 1OCWH 4BZ1L 5FF6B 1XZ0B 1QD0A 4PJXE 2D7OA 5C0AB 4JG1L 1AHWC 1IKNA 3BIAX 4WFFD 1ONQB 4X7TA 2GTWA 3TVMB 4GUPB 1KJMA 4HWZB 3VXOA 3RKDC 3R4DA 3QEUB 4X5WB 3TC9A 3RWJA 3PDDA 5T5FH 5B8CC 1D6EB 2EKJA 3ILQD 3UP1A 2R0KL 5GGRB 3CMGA 1NBVH 4OIIH 1Q38A 2OQJA 4NO3A 3T0DA 2D7TL 4J7RA 4ZPTA 5LGKA 1DANU 4JZNA 3GMMB 4NQEA 5BRZD 1KPRA 3F7RA 4JRYB 4EUPH 5FB8A 1ZSDB 5CHNB 1RHFA 3CZFB 2WAHA 4U6HB 2VLKA 5HYJE 5KBNC 1T1YA 1YYMH 4FXGA 2VITB 2HTLD 3GSRA 3S96A 1ZGLB 1GGIH 2ZG1A 1EJ6A 4BFGA 2AKRA 4Y4FB 5BS0D 4X5XA 2WUCH 3BRGC 4J23A 1DE4B 5T3XH 2F54E 2YA2A 1MCRA 2H45A 4NSKB 4XH2A 2NX5B 3KLAB 2VLME 3FO2A 2R1YB 4OBRA 5D4QA 5F7UA 3MRJB 1H3XA 4ALAL 5EOQL 4OZIA 4LGPB 2FJFB 2FH6A 2Y5TA 4PP2A 4CU6A 1BD2B 3MLXH 4JDTL 4ZO7A 4MAYC 1DBKH 3KYNA 3F12B 5F1KC 4KRPD 5IESH 4ZOAA 4JFQA 1GJIA 2ADJB 4PJCE 2H32B 4AM0A 4RNRA 1QNZL 1AP2B 3FB8B 4OAWB 4Y5XB 3O6ML 3SKOB 4F3FB 1WBYA 4S1SL 5IROC 4OQTL 3QHZL 3CLEL 5C8JB 2VXTH 4YEEA 1MI5B 2DICA 4RRPA 1RUAH 4PJ9B 3S37H 3W0WD 4Y16C 4F58H 3CFEB 1LMKA 2X4PB 5C0RH 1TPXC 5JW4Q 5E2JA 4MCZA 1OAQL 2VH5H 4E41E 3DARA 5EA0L 1PLGH 1NSNL 2C7UA 4MSWB 4D0CA 4M7JL 1MCBA 3QR2A 1XCTA 4GW1B 4CMMB 1AHWA 4YXHL 3MYZA 5DLML 3UTTD 1M4KA 3D5OF 3DX6B 4P3WA 3D85D 3KXFB 2VDPL 2H8PA 1I3VA 3FCTA 1UGNA 2CDFB 3RP1A 2VE6A 1MVUB 4JO3L 3V6OC 4UT6L 4U1SA 3PIQB 3LB6D 4R96B 2DKUA 1RHHA 3SGKC 1LEGB 1OOAA 1ADQL 3MJ7B 5EO1B 1IAMA 2DIJA 2WBJA 4QNPF 4Y4KB 3GSWA 4DGYL 1MI5D 2HLFD 3L6FB 4PJ8B 4WW2C 1A8JH 4DFHA 4PJ9D 4NWTL 5J1TC 5DI8B 4JCMA 1QHPA 4OF5A 3VXUD 3AFLA 4F80A 2PXYC 1ZOXA 1AY1H 2XZQL 1XH3A 3G6DH 4OCXL 4XNUL 4YDLB 1CR9H 4DCQB 1CFSB 1IGIH 4BQBA 3E2HB 4WWKD 2VDLH 4NFDA 3UYRH 3FFCB 3M1BB 4PJGF 1YEHH 4FTVA 1UEYA 4ZSOA 3RWCA 3RPIB 2EYRA 4ZS7L 3LRGA 4N8VB 3IKCB 3MV7E 3UDWA 1Z9MA 1SY6L 2AV1B 1G6RB 2DQTH 4AJ0A 4MAYA 5C07B 5E7BA 4PJ8D 1YEFH 3S35H 4JY4B 2W07A 2VN7A 4XP5L 4RMUA 5CP7B 1O7SA 3VGEA 3ULUF 3V6FB 1EA9C 1Y6KR 1GAFL 1KTLB 4A2LA 2EDFA 3GSUA 4X6CE 1IAIM 1H9VA 1KLGA 5GS0D 1RQ5A 2IQAB 3VMPA 2B2XH 3G6JA 3OBAA 4NJ9L 5IB5A 4Z7VF 5F96H 1BVLB 1EO7A 2IANE 4Y16A 3GMQB 3TBTB 3WMSA 3HAEB 3C5JA 4LCWE 5MENE 5CEXB 3CFJB 2ENSA 2O5ZH 2EICA 2IPTL 5D93C 4X80H 1EEZA 5J12B 1WV7T 3O3AA 4P3CH 1R3JB 4NPYB 4DZ8A 3RVWC 5F9JB 5B22A 4R97B 1WFNA 2X10A 4HULB 1ZT1B 2YZ1A 4YDVA 3TH4T 5KSUB 1J12A 1R0AH 4L4TB 1DCLA 2FEEL 4PBVC 5LXGH 3DXAB 4OUUA 3B5TA 1IRAY 3S9DB 4JFFB 3WUWA 2FIKA 2QR0A 4AT6A 3L9RB 3LN5A 3ARGD 4BH7A 1V3JA 4P5TB 3ZKNC 3V6OA 1UC6A 1IC5H 3HS0B 4F15C 2Y72A 3KPTA 5DJZA 5KSAD 1ZHLB 1EBPA 3FFDB 2C5DC 3WFDH 4U1IA 2FYYA 2ZUYA 4RMTA 1G1YA 1P84J 2P7TB 2BNUB 1P7QD 3GSNL 4JREC 3VGAB 4WW2A 4KDTC 4WY7H 3SGDI 1UCBL 2YD9A 1H8NA 4N0CD 4HUVA 2GJ6D 1QO3B 3QULA 4OCMC 4M7LL 4NZJA 3GI9L 5LCVL 4OGAC 5IMMB 3D2UB 1G7IA 2P5WE 3QEGL 4G6JH 5TDNA 3T2NH 1B2WH 2R9HC 4NWUL 3MFFA 5J3HC 2WV3A 4UDUB 1SJHA 1B3JA 2JJUA 5D72L 1DP0A 1NUNB 1XF3A 4LCIH 4PJ7A 5E8NA 1ZA3A 4HW6A 4PFEA 1X5FA 4L4TD 3WJJC 1R5IA 1PDKA 4AIZA 3BP7A 3MCG1 4UMGA 3D0VB 4QT5B 1BECA 5F1IB 4J3OC 1KN4H 4PJDB 5HHMB 4WCYL 4XNZB 1T83C 3VXSE 1LE5B 5B38G 1I4FB 4HWBA 5DTFB 5DD0H 4EI5C 2EE6A 2PYFA 3BZEB 4HEME 2GY5A 4I0CC 4KHXL 4MHHG 2OP4L 4O5LL 1KCLA 1DQTA 1FZKB 1VENA 3UX9B 2CPCA 3WSQL 2COQA 2HVKB 1Q9LB 1UH4A 3JV4A 2WSKA 3QISA 3MRBB 5I1HH 1MVFA 1TVHA 3BWAA 4WJ5B 5F7LB 3ARDA 1M71A 1E4KC 4F57H 5JW4R 4JM2D 3U4AA 4RWYH 1LP9B 2QV2A 4P2YA 1CVRA 3C6LB 1WITA 1B0WA 1U8KA 3S5LA 3V5HA 5D6CB 4R0LC 1A6AB 1MCWW 1NKOA 2XWBB 4M4PA 4QXUH 4XPTL 4KKCC 2CRIA 3I6LE 5ITBH 4GG6B 3V5KB 1DQLH 3FQUA 2JELH 5HHMD 3V8OA 4JZJC 2P24B 2V5SA 4QRPB 2YD7A 3H0TA 5CJQL 5SWZB 3ZKXB 2X44D 35C8H 1RUQH 4HGKC 3BKCH 1AI1H 5JUEH 4HFWB 3L7FA 1J7VR 5JHLL 4IOFC 1I8IB 2ICEB 4ODHL 1ZA6B 2A6IB 3ELAT 5HYQB 2NTSP 5I75B 3H9ZA 3D25B 4GQ9H 4HF5H 4K7PX 4OT1H 1PKQE 4LQFL 5HPMB 1S9WB 1XF4A 3EIFA 5FOJA 4GSDH 4KDTA 3PJSA 2GT9A 3N85L 2EH7L 3U4BL 3Q5TA 2A73B 3ULUH 1JNHB 2ICWB 3VH8B 1J8HD 4HT1L 1NFIA 2HT2C 1ZGLP 1T20B 4N9OB 2P8LB 4KI5C 4GFTB 3KYMA 4MNGA 4IDJL 2RIKA 3TT1H 5E1AA 2BOCA 4M93B 4E9LA 3DYOA 5K59E 1Y18A 3WJJA 3MLRH 1MELA 4LBEB 4MWFA 5GISH 3TBWB 3DNKA 4FXLA 1OB1B 5H35A 3V7AG 4PS4H 5E99H 1FDLL 1AO7E 4QF1B 4Q9RH 4O02L 4FXKB 4WHDA 5EOCL 4PD4J 2BCKA 1TTUA 4UT9L 32C2A 4Q6YA 4Z8FH 5BOZG 3GJEA 2A6DB 5GS1C 2UZYB 4NRZA 1CXKA 4OD1H 4R7DB 1UYWH 4XHJD 5IW1A 4U1LA 5LVEA 4PREA 2P43B 2GSGB 3BD5A 3B5HA 3CPLB 1CXLA 4ZTPH 3PF2A 1EDQA 5EZIL 4Z7UF 2DTML 4HSQA 3EKCA 4D0BA 3GO1H 2APFA 4NKMB 1FYTE 1JNLH 5CSBA 1Q9OA 1S5IL 2A9NH 1BJ1J 2LVEA 1EXUB 2R0WH 1U3YA 2P5EE 5HGBB 1ORQA 3C08H 1ES0B 5FYJE 1FFOB 4APQC 4Z77B 4ZFFA 1U42A 4JFDD 3IDMB 1CLZH 1MFNA 2VLJB 1A6ZB 4LSUH 1U41A 4KUZL 1UB6B 3QUYD 1A1OA 4UUJA 4MJIB 4RX4A 2GTZA 3SDAA 3S34L 4WUUE 2VZVA 1OSPH 4AEHL 3TYFA 4KWUA 2ESVE 4HHAA 2JF1A 1QSFA 2VQ1A 2R56H 4O9HL 4YHNA 4U7MA 5E8DL 4F37K 4KDVA 1J18A 5BZWA 2QSVA 2ZCKH 4H0IA 3ZL4H 3PL6B 5D1ZA 1EGJL 1P4BL 4FQ2L 3QXWA 3GK8H 3KS0J 5I1JL 1HHIA 1K8DA 1ROWA 1GGBL 3F62A 4MA7H 5J8OA 4OCSH 2CR3A 4PRNB 5CGTA 4Z7VA 1ZVYA 3HC3L 1Q0XH 2CIKB 3LS4L 3IDGA 4D3CL 5B38B 3K2UH 4JZOA 1Q72L 4FA8A 5J9PB 2EXYD 2ZNXA 4N90E 4Y19A 5LBSH 3TWCL 1JZ3A 1BQHA 5FUCC 4JDZB 3AVEA 3MRHB 1JWSB 2VLJD 1XIWB 1W72B 4TQEH 5J6GB 4XNXL 4M1DL 4GS7B 4C56B 3U0TB 4MJID 4J6RL 3WIHA 4KAQH 4DN4L 2VISA 2X2YA 4JPIB 4P5KA 5CD5D 3LS5L 3U46A 3ROLA 1CFTB 3IAPA 4CNIB 1HHJB 5C0JA 3VE0A 2BVPA 4B0MM 4D0DB 4P9MH 2UUDH 1EHLH 3JTTA 2I9TA 3MRKA 5IG7B 4KQ3H 4RQQB 5JDSA 3P0GB 5DFVC 2ITCA 3U0PB 4YHIA 5EO0A 4XI5D 3S98A 3D18A 5DQ9A 3QHFL 2EC9U 4HX1B 5DVMA 1CD8A 2PW1B 4ODWA 3QDMA 4OFVA 1K6QL 1JZ8A 1HYSD 4XBPA 4IOIA 4RDQG 4WHCA 3RPKA 5JORA 4JM2F 5I66B 2P4AB 3GGWB 3WDJA 4BSVA 3GBML 4I48A 4PJEA 1B90A 3QJFA 1YJDL 1JZ7A 4HAGA 1C5BH 1XIWD 4MNHB 3RZCD 4HJJL 1ZS8B 4YE4L 1AQDB 1NCBH 5JQHC 1BX2B 4R4FL 3O9WB 1FE8H 5FYLH 4LVNB 5J11C 3FB5A 2BHUA 2YPLB 2GW5A 4F2MA 2C1PB 2D9CA 4NC1C 3SKJH 5DSCB 1UZ6E 3SBWA 3G5VA 3MRDA 2Q8BH 2VLKE 3F6IA 1WIUA 2HJKB 2AJ3B 3HNSL 1NAMH 1R5VA 5I1LB 2Y9RT 3MRNB 1QFWI 4NKOB 4EN3B 4JN2A 5E00B 3IFPA 1T2QL 5E2UH 2JE8A 3EFDH 3WO4B 3VXRB 5I1CL 3REWB 2XQYK 2AXJA 2QSCL 5AD0A 4NBYB 2V5RA 4OV5A 4P2OC 5D70L 2LAGB 5DJCA 3EOTL 1JZ2A 3LQAC 3PG2A 1UJ3C 2A6JB 3ETBF 2NY5H 1VFOA 4PGCA 4YHKH 2J8UB 2Y25A 1LEIB 4GXVH 1U8HA 1PVHA 2QQQA 2R0LL 5IP4A 4KHTH 3QIBC 2F9BT 2PYEB 5FGCB 3TH2T 4OZIE 1HOCB 3K2MC 4UB0L 2NY1D 3DETD 4M43H 3D0LA 4TVSa 3SQBA 3BPNB 5JR1L 4NNYB 1HHKB 2W9DL 3FQXA 4WV1C 4NO0B 1KB5H 3NMEA 4H1LG 4G9FA 5DJAA 4U49A 1X5AA 2AJVH 1X3DA 4GMTL 5I30H 4LHUA 2VR5A 1QFWH 2F58H 1KB9J 1MRCH 2QQKH 1YEKH 5HHVH 1F2XK 4R9HA 4LF3B 1BEYH 2YPKB 2EKSA 3FT4A 4C83A 4YHZH 5DHXB 4PG9A 1JGDA 1MCLA 3KPPB 2D03H 5DGQA 3IFNL 4JR9H 1YYLH 4NNPH 4WHYH 4HMCA 4G9DB 4NCC2 2XKNA 4U2YA 5JOEA 3VFPA 1OWRM 4JO4L 2NY4C 4NQVA 1PQZA 4L3CA 3O3UN 3VFWB 2XIDA 1PSKH 3HE7D 2PYED 1UM6H 2AEWA 3P30L 1GL4B 3QQNA 3BHBA 1AXTH 4KROB 5C7XH 5I1EL 1BVKA 3L3KA 1OAXH 2EYTB 1U91A 1ZWIA 1CL7L 3JWOL 4LGSB 3P9MA 4NC2B 4NQSB 5DC4B 4ETQB 4R7NB 1RY7B 3MSPA 1YNTA 4MD4A 2CLRB 5C9JA 1F6AA 3Q6FB 1I1RA 3HE6B 2YHGA 4G7YH 2I27N 3ARPA 2FBJH 1HH9B 4JLRA 1KCRH 5F3HB 3N9GL 1MCPH 3EJZC 4BUHA 4K94H 2DQUL 2OSLB 4FG6D 3SKMA 2CD0A 1Z9OA 4P4RA 3QEQA 1I7RA 4M7ZB 3DBXA 5BV7H 1CDBA 3K7UA 5GSRA 1AGBA 2IGFL 3FQTB 4G8GD 5TQ0L 3IF1B 2DQIH 4G43A 4I4WA 2X4UA 3GHEH 5GHWH 3TF7C 3F58H 1CICB 4FTVE 4PJIF 2PO6A 4P2OA 4DGVH 4ZSOE 3RWFB 4AIXA 4KQ4H 5C0BB 4HFUH 4OD2B 1MRDL 2YMXH 2HAZA 3OGOE 4Z7UA 5L8LB 5F3BA 4WGWB 3X11B 1F58L 1G7HA 1P5UA 1X5KA 2IJ0C 1O7VA 3GKWH 3P9LA 4JRWA 3WLBA 1FL5A 3MRIA 1UWEL 4WTXA 5HXMA 2J5LB 5DJ2B 1U3HD 2R4RH 4PRAB 3CVHL 5FCUH 4WV1A 4B50A 2CK2A 1N3NB 5IEKB 2B1AH 4LSDA 5FOBB 3RDTC 4PRHA 1FFNA 4PJHF 3WLWD 1MCOL 1X5ZA 3IDNB 1P7KA 5D8JL 5D7LB 1U0QA 2PW2A 1QBAA 4BZ1H 3MFGB 5MEOB 3SDXF 3G6JE 1AR1C 4JG1H 5JZ7C 5C0DA 4N0UB 1OPGL 2OI9C 3NAAL 3WFEL 1G7JB 1AD9B 2P45B 3QFDA 4GRLD 3UTSD 4IRSD 3NPSC 1IKFL 1TZHA 1FO0B 2R0KH 5I0DA 1RIVL 2BNRA 5B39G 2CXKA 4BA8A 1HEZA 2HT4C 4HKXA 3AB0B 3QB7C 3OAZH 3EYVB 3SDDC 1DDHB 2AGJL 2H26A 3I3EA 5E9DA 5IJVA 5DA4A 1HZHL 4HPOH 3V6OE 1P2CB 1PFCA 2OLDA 5JW4M 1S7RB 5E1HB 1A7BA 2DBLL 5D2LB 4YEFA 3PWPB 1NFKA 3IJHB 1N26A 3V6ZA 4WW1B 4RCAA 3PV7A 4NHUB 2ICWJ 1MLBB 2YWZA 5INCB 4X99A 2J6EH 1Q9KB 1LNUA 2VDML 3TBSB 5ERWA 3PP3K 3SN6N 4H20L 4XGZB 5IMOB 3IKKA 4MXWL 1A0QL 2D4FA 2NTFA 2VO5A 1UENA 4OV6F 4JHWL 2JIXD 2K1MA 3K8KA 1BZ7B 1U8PB 1E4WL 2YUVA 4PJ7E 4ALAH 2DWDA 5EOQH 5IHBA 4QHUA 4XC1L 1ZVHA 1TVDA 4JDTH 3TGXA 3SJVB 1YMHB 5JO5B 3T0VA 2FR4B 2VC2L 4I0PB 4LLYB 3MZTA 5FYKD 4F7CB 1QNZH 2LVCA 1G9MC 2B5IB 4H1LB 1EERB 3O6MH 4ZUUA 2XRAL 4JKKA 4S1SH 4HV8B 4P5MB 4OQTH 2DI8A 3QHZH 5TJWK 5I71B 4X8XA 4X6BA 4HBQA 4EQ3A 4OB5L 1QYGL 4PGDA 3L5WA 3QUMB 5ENWA 3QRFM 5A2KH 4ZUSB 4PLJC 3B5GA 2XN9D 2YA0A 3F7YA 3QCVL 5C0CB 3K4DA 3MGOA 5ICYB 1OAQH 3QPQD 3U2SA 4R8WH 3V4UH 5EA0H 5M7QA 4LVOB 1G0YR 2G60L 5K93A 1NSNH 1ZVSB 5MEPA 4ZAKB 4HGWB 2P8PB 4M7JH 2NNAB 5L2JA 1B0GA 4YXHH 4YGAB 1WZ1L 3RVXC 1TTGA 5DLMH 4BQ9A 1IM3B 1CGUA 1ZTXL 2Y06L 5DJ0A 2VDPH 2ZCLH 4QRSB 3DOSA 4S1QL 3Q3GB 4UT6H 4P2CG 1T3FB 1B9ZA 3RIFK 1ADQH 4I13B 1NAKL 5D1XC 4U4BA 1MAJA 3PQYA 4LCCB 3MO1A 4DGYH 2XV6B 2O93L 1QFUL 2CDEB 4NWTH 5I74B 5C0NC 1WTGT 2X4OB 3T0EA 3PWUB 3DRTA 3UTQB 4OZHB 2G75B 3BPOB 5C0FA 4PPTA 4UV7L 4XXDA 4QTIL 4ZO6A 3AY4C 2J6EA 3TFKD 2XZQH 3OKKB 5E6ZA 1IC7L 3EJYD 4OCXH 4TUKL 4XNUH 3TA3A 5KSVB 2FO4A 1CT8A 5EO9B 5KJRL 5L0QC 3QZWA 4NNXB 5I9QC 3U30B 1F11B 1F3JA 3C5ZA 4AENB 3PHQA 4ZS7H 3CH8A 4V1DB 2ICCA 2H9GA 4FQCL 5KS9F 1SY6H 3G5YB 4K55A 4MNGE 3WFZA 1N5AA 1M1SA 1JF6A 1YEDB 3E3QE 2CDGB 5A16B 3P11L 1MCDA 3QNZA 5FGSA 3SOBL 1Z0NA 3OMZA 4XP5H 1ZT4A 4OTXL 4HCRH 2GI7A 2DIAA 2BXZA 2Z31B 3ILPA 3DPBA 5L6YH 4JFXB 3VFOB 1GAFH 4PLKC 3K4ZA 5AZ2L 4W68A 5CZKA 3G04B 5FM5O 4NJ9H 4X4XB 2XTJD 3I6GB 2XTLA 3O4LB 2ATKB 1FV1B 2IPTH 9CGTA 5ICXA 2K9UA 5CZVL 3ARWA 1CGTA 3SE3C 3G5ZB 3O11B 2MQ0A 2YUZA 1EO8L 1U2HA 1RZ8B 5KVGH 2UY6A 4F7MA 2EXWC 5JNYB 1IAIL 2OR9L 1NC2A 4KK6C 1KLFA 1I1AC 4PY8I 4X0KA 4ONHA 5L88H 5FO7A 4OLUH 4FFVD 5D7JB 2RB8A 3QWQB 5IMLB 2IBZY 3NACL 1NEUA 2D2OA 1UWXK 3BT2L 1U58A 5IQ7H 2Z31D 1T1ZB 1RMFL 3GSNH 2EDWA 3T2QA 1IGCL 1ZT7B 2HKFL 1DQQB 4ZOCA 4G6KL 2ZOLB 1X4ZA 1VFAB 5LCVH 3GI9H 1S3KH 4LEXL 3VD7A 3QNXA 4WFHE 3AY4A 4TSBL 5CBEA 4HK0A 5EU6D 3QA3B 1QSFE 2J8HA 4P4KD 4KC3B 2VSCA 4CW1B 3ULUE 5D72H 5HI4D 3DMMA 1C5DA 3F7VA 3LKPA 4O2CA 3VFMA 5EBLB 4PJHA 3BYTA 4MXVF 3Q48A 4DEPC 1CG9B 4PJFB 1T5WB 4K8RL 1KJ3L 4G7VL 4LPXA 3SDXA 1N64L 3ARBC 4MQ7B 3SDCA 3TJHD 4Z7VE 2HMIC 4NRYB 1U3JA 4WCYH 1TJHL 5D5MF 4YAQA 3RRQA 4FABH 1DLFH 5J6HA 2P8MB 4Y19E 1RZIB 5AG9A 4HCRA 4OCRL 3DGCR 4KHXH 4JJ5B 5D96C 4O5LH 4U0QB 1NFDF 2BRQA 3WSQH 4Q97A 1GGUA 1RZKL 5DFWH 3WS3A 2YEZB 2DQJL 1BFSA 4QXGL 1YY9D 15C8L 1KTDB 2VKXA 4OF0A 1CQKA 1MQ8A 3RI5K 4WHTA 4I5BA 5CGMA 1NCDL 2F53A 3A0OA 3HCVA 2OM5A 4M4RA 2AK4A 1HDMA 4WNQA 3O8XD 4DVBA 4YO0B 2W0PA 5KOVC 5C09A 1ZHNB 5HI5D 1FH5L 4Z7WA 4XPTH 2NXZB 1V7ML 3QQ3B 1DVFA 5JLZA 3RGVD 4ODBD 3QDME 2V5TA 4M1GL 1EH9A 5B8CB 2CKBL 4YHPB 5CJQH 2DOCA 2GITB 1YA5A 3QXUA 3KPRB 4PJEE 1E27B 1H3UA 3OKDA 4BKLA 3D48R 5IMKA 5JHLH 4MJ5B 1IGTA 1FNGB 4UQ3A 4ODHH 3R1GL 1I1YB 1YNLL 2VERN 1OLZA 1XR9A 4UIKH 5HYIA 1NMBL 1CS6A 1K2DB 4BH8B 2IAMA 3ISWA 4ZDHA 4OIAA 1CDHA 4N8PA 4LQFH 3IDJB 3B9AA 4R2GB 5EBMA 1MFDL 3HTLX 3WN5A 2Q76B 3IXTA 5E5UB 5IVNA 4N5UA 3C2SA 2EH7H 3U4BH 1YY8B 4OKVB 1FBIH 3BIBX 4HT1H 3VWKA 2WUBL 4DKDC 2NY2C 4J8RA 1B4JL 5E5MB 3BUYA 3GNML 3MA9L 4P57A 4XP1L 2VZ1A 3O2DA 5IF0B 3EOBA 1MWAL 4NUJB 3MC0A 3HI6L 4XNYL 1JRHI 4DUWA 3A6OA 4PJAB 4ZFOB 2O26U 5GRUL 3DSFL 2FBOJ 4U3CA 1AFVL 4RAHA 5H37G 2DJSA 1FVEB 3JV5A 1GZQB 5CJOL 4RGMC 3HB3C 4QRQA 5F89A 4ELKB 1OTSD 2FLBT 3LSOA 5EOCH 3HZYB 3O81A 3GSVA 4UT9H 4MGXA 4G9FE 1A5FH 1OP3K 5IVXB 4KXZH 5L8JB 4MQXD 2E7BA 3H9HB 3IRPX 4Y8AA 1P1ZB 5IVZA 2WWKT 3OGCA 1S9VB 5KVFL 12E8H 1XGPA 4JJHA 2Q87A 3ARFC 5FA3A 4XCNA 1QFHA 2ADFL 3MQIA 4LL9A 4TSCL 2W59A 3FO1B 4DZ8B 4XAWL 5JOPD 3MBEC 5EZIH 1L4IA 2DTMH 1I8LC 5BQ7A 4KJYB 2AJXL 2R69L 2JCCF 4HH9B 4MLIA 5DJ6B 3UPCA 5INDB 3MUJA 1CN4A 1CFNB 3OR6B 1S5IH 1ZLUH 3IVKB 3TBVB 5GS3A 4U1JB 4ZUTB 2EDRA 7CGTA 1E4XI 4LRIC 1JN6B 2R2HB 4M9OA 3MLTB 4NC0B 3HR6A 4QHKI 1EPFA 4Q9QL 2YN5A 5CBAB 3NA4A 1RIUL 4C59B 2OS7A 4KUZH 5FYLE 5I19L 3VXMB 3FZUD 1G6VK 1GOHA 3S34H 3SHSA 5GZNC 1WT5A 4M6OH 2A83B 4AEHH 3AC0A 4GAGL 4FQXB 4QOKB 5D2NB 4K7FA 5D1QB 2PXYB 4HZLA 1N6UA 5CSZA 4N0YL 5D7IB 3TO2A 1X5GA 4GW5A 4O9HH 4YWGH 3KPNB 3QUZD 5E8DH 3X14A 3VD4A 3RVTC 4E0RB 1T0NA 1QLRB 1EGJH 5ID1B 3QEQE 1P4BH 1AGEB 4YGVA 5I1JH 4XAKD 4JG0L 4W6YB 1B4RA 3V4VH 1NMAL 4RFEB 4FQ1L 2H6PB 3HC3H 4XP6L 3BEVA 3LS4H 4CN6A 4D3CH 4DUXA 4JY6B 1Q72H 5F7MC 5DHVH 1UKTA 5GRJL 1VADA 2AJZA 1OQOA 2PYFB 2J4WH 1EFXD 4I3SL 3H6JA 3OF6D 4XNXH 3DI2B 2YD3A 3MRMB 3GMPA 4Z7UE 3VXTA 4G80B 1T04B 1OSZB 4J6RH 3BP6B 1MCQA 1Q9WA 3KPSB 5IGXH 3LS5H 5AZEL 4LP4A 5TFSL 3KLHD 5DT1H 5D1QD 3ALWA 2HG5A 1IEAA 1TZGL 3I02B 1A9EA 3EZJB 1M05A 4PRHE 1MIEL 3W9DA 1A1MB 1NCUA 3NA9L 2Q6WB 5JIPA 5BXFB 4GRWB 4UOJA 1CTOA 2CUMA 1S7TA 3ARFA 3QHFH 4DGIL 2XKUA 5I2IA 3MBEA 1K6QH 1I8LA 1XGQA 1B6DA 1ND0A 3FKUS 1Y0LB 1T0MA 2WW8A 3GBMH 2VIRA 4G6AD 1JGVL 2DQHL 3W39A 1YC7A 1YJDH 1QRND 4HJJH 3VFNA 4YE4H 2BNRE 4GBXD 3K1DA 2OL3H 1AKJA 2HRPL 4R4FH 2X42A 8FABB 1NLBL 4MX7A 2PUQT 4HJGB 4JAMA 1IEBB 5E9DE 2AK1H 1K3IA 4Y1AB 4S10A 5D5MA 2X4QA 1T03L 3HNSH 1AE6L 5HDOA 3ZTNH 5JXEC 2VSDA 2A9MH 1XGUA 4JFPA 1HIML 1T2QH 2FCBA 1NFDA 5IIEA 3A6CL 5DUML 5I1CH 2QSCH 1MHHB 2IBGA 2NR6D 5T1LB 2IPKB 3C60D 3BN9D 5D70H 3RL1B 2JJSA 1JHKL 3B9DA 3BZ4B 4OZ4B 4QRRA 2VLLB 2Z4QA 2N56A 4Y4HC 4RGNB 3C8KB 3ZHDA 1S7QB 2RFXB 3PDGA 1KENH 3DV6B 5HI3D 5CEZD 2R0LH 3MLSH 2R1WA 4LNRB 5DVLA 3QFJD 4UB0H 3KHOA 4L8DB 4NP4L 4K8RD 5JR1H 5K9KA 2OZ4L 2W9DH 4EI5B 5KN5A 1YMMA 3RTQC 3PDOB 3MUHL 4JHAL 4MJ6B 1FNEA 5E2TL 1T7WA 2UWEB 3TNNA 5ISZA 4GMTH 1G7PB 3QIUC 4MVBC 3OXRA 4V2BA 1URLA 3RWEA 4LKCA 4P9HC 4HWEH 2ZUXA 4JFEA 1G9NH 3ZTJG 4QWWC 4DW2L 1NJ9A 3NPZB 5I8CA 2C1OA 2BX5A 5FM5M 3IFNH 3WL9A 5T1LD 3NZ8B 3P4OA 3KYKH 2VXUL 1R24A 3IB4A 4R0LB 2BVEA 1OGAD 4RGND 1UXWB 3WFHA 3IDXL 2KQMA 3UBXI 3SCMB 3PGDA 4K71C 4ZFGL 5HHOB 3P30H 3ZO0A 3ORJA 5I1EH 4JZJB 1M7XA 1HXMB 1I3RB 3MXVL 1M6OB 2BRRL 2OL3A 4U6XA 1J1OL 4XBGA 1CL7H 2DI7A 3QNYA 1IT9L 1FRGL 3JWOH 4P23A 1QPPA 4MNQA 1VFBB 4B7LA 1EO5A 2VNCA 5I18L 2E6PA 1ZLSL 1MAKA 2KQNA 2DM7A 1VGKB 3PQYE 4HQQL 3OKMB 4OI9A 5KOMC 4XPGL 1BQUA 2AQ1A 4Z18A 4X98B 3ZYOA 3N9GH 1X7QA 1GOGA 4IEFB 3T0EE 1KIRA 4IRJB 2DQUH 4MA3B 5HYSA 1T4KA 1T5XA 3QDGB 2E6QA 1JUFB 2CGRL 1JTPA 2HTLC 2FDBP 3L3OA 1YN7A 4ZO8A 4L9LA 2A6KB 3ROOA 1BIIA 2IGFH 3BGFC 5TQ0H 2PR4H 2W0FA 5GGQL 5DWUL 3NABH 1SJXA 3RUGF 3CFDB 3T65B 1NGXA 5DRNB 5DQJA 2QTEA 3ARVA 1EAPB 4KJPC 5K9QG 3N1FC 5TE7H 3O41A 1MRDH 4PY7B 1QHOA 4H8WC 1R3KB 5E08L 2DIBA 4Y4HA 5FV1L 1BLNB 5L2KA 3X13A 5C0IA 3G5XB 3NCMA 1F58H 1FN4B 3WNPA 2JCCA 2YD2A 3BP5A 2XYCA 2GFBA 1IQDB 1UB5B 1UWEH 3W81A 4A6YL 1BAFH 4CADA 5FYKU 3CVHH 3NN8B 4LLAA 1U8OA 4OFYA 2C3XA 5TF0A 4Q7DA 4ZNEA 4IRJD 3H3PL 3DTXA 3QIUA 3WKNA 1MCOH 3GSQA 5I1DA 3BO8A 4GAFB 5D8JH 5GS1B 3RFZC 2DS4A 1WWCA 1CGSL 4G42B 4LCUB 4OI8A 3DVIA 3CC5A 1PJ9A 5GGTL 3OKNA 5HYJD 3EDDA 3KYAA 3H9SB 4M3JA 1F45A 1TNNA 5C6WH 5FEBA 1AC6A 1OPGH 3NAAH 3WFEH 1A6TB 5BJTA 2XZCL 4WI2A 3TO4D 4PV9B 2CO6B 1F97A 3LN4B 4OCNC 1KCKA 3D87B 4GH7B 4KTDL 5IB1B 4IMKA 3OSKA 3LZFL 1UH2A 4O2FB 2F54D 1IKFH 2NZIA 4NBZB 5T1KB 4E41B 1LEKA 5JOFA 5SWSA 3T4YB 1KELL 1MFAL 2VLMD 1RIVH 3U1SL 3RWGB 3P4NB 2X89D 3V4PL 4LKXB 2DMCA 3D69A 1KJ2L 4APQB 3MRRB 2IH1A 2SEBB 1E28A 3KS0H 3CH1B 2AGJH 2GIYA 3HNVL 1J9CT 3QUXD 2KL6A 3LB6C 1HZHH 2J88H 4KRMB 3TEUA 4KDWA 4LIQE 3BH8A 1BFOB 1OF2A 2DBLH 4X9FA 3BWUC 2K7PA 2Z8WC 5DEFB 4PRPA 1NCNA 1YUHA 4PJ9C 4PRBB 4MD0A 2R1XA 4OGXL 2VDMH 1EUUA 3BGMA 1IMHC 3HUJA 3STLB 1D3CA 4H20H 3PHSA 1A0QH 3UBXA 4WWKC 4NQCB 2RQ8A 4E42B 1HCVA 3OAUL 5FF6A 1XZ0A 1NMCB 1E4WH 5C0AA 2NMSA 2X05A 5FGBA 4PJDF 4E41D 4XC1H 4PJHE 4DAGL 1ONQA 3ARSA 3DHMA 1JYXA 3TVMA 2VC2H 4GUPA 5ESVB 5CEYB 3SDXE 4HWZA 5ANMB 3SGJC 3QEUA 4X5WA 4LHQB 1F4HA 2EC8A 2XRAH 5FYJL 4PJBB 7FABL 4W81A 2CQVA 2Z0BA 1D6EA 1A6VL 2MOVA 2NY3B 1R3IL 4LCYB 5GGRA 5EUOB 3TT3L 4Y4KC 4OB5H 3V5DB 1XF5B 4PJ8C 1QYGH 2P42B 3STZB 3GMMA 3BH9B 1FZMB 3ZMRA 4JRYA 3VXQB 1GCFA 1ZSDA 5CHNA 3CZFA 5AEAA 4U6HA 2XWTB 4P3DB 5KVMC 2XXMB 4QHNB 4AEIL 5IOPB 4PJ5B 3O2VL 1JF1B 1YDPB 1ZEAL 2VITA 3C87A 3PHOB 4YDLC 5GS0C 3E2HC 1ZGLA 4HPYL 5F9WC 4GQPH 1OQXA 5EPMB 2F53E 1PQZB 3FQNB 3DVGB 2AK4E 4Y4FA 4GG6F 1WZ1H 1DE4A 5C09E 2JTDA 4NSKA 4TN9A 1ZTXH 2NX5A 3KLAA 2WWMD 2B39A 2R1YA 2BSED 1QFWM 4S1QH 4KJWD 5GPRA 3MRJA 4KY1L 1JGLL 2IALB 4D9QE 2FJFA 4CVZB 1NAKH 3FN0L 1BD2A 4I77L 4OD3H 4DOHB 5F8QC 3G6AB 3MV7D 1QFUH 3F12A 4NUGL 4QLRA 3JWDL 4FQQB 2ADJA 5J11B 2H32A 1AP2A 3FB8A 1WUNT 4OAWA 4Y5XA 3SKOA 4U1KB 5KSAC 4F3FA 1RV6X 5D7SL 3C5SB 2FX7L 4UV7H 1FLTX 1H3PL 1JV5B 1IC7H 4Y2OA 5C8JA 4TUKH 5C92A 5I17B 1MI5A 1Q94B 4PJ9A 4IDLA 1AH1A 4N0CC 5KJRH 1I3UA 3CFEA 2X4PA 5DHYB 2IAND 3ZE0F 1T1WB 1YEIH 3HAEH 4LSPH 4L3AA 4J3WA 4MSWA 4PLOB 4LCWD 4FQCH 1J11A 1UJ3B 2P5WB 3EO9L 5MEND 4GW1A 3SO3B 4CMMA 1G84A 1LDPL 3RX8A 4YZFF 2WP3O 1RUKL 3K80A 1L0YA 4H0GA 3QIBB 5I1GL 1DSFH 4Z0BL 4TVPE 2DMBA 3P11H 2GQHA 3DX6A 2GUOB 4DKEL 3LV3B 3KXFA 5FK9B 1FFPB 1TJIL 5C3LD 2DYPD 3SGJA 3SOBH 2CDFA 4OTXH 1V8HA 5EU3B 5SWQB 4P5TC 1D5BB 1MVUA 2QADD 2P1YA 3PIQA 4MDIB 3Q5OA 4WU5B 4R96A 5FO9B 1MPAL 5AZ2H 1I1CA 1LEGA 2DWEB 5I8EB 3MJ7A 2XY1A 5EO1A 1LDSA 1I85A 4MA1B 3VGAC 4Y4KA 1CFBA 3L6FA 4PJ8A 5EIIB 2VDRL 1V7NL 4P49A 4BFEA 5DI8A 1FC1A 1V5JA 1SBSH 4S1DD 4ONGH 5EB9A 4M6ML 4PRIB 1T89C 5CZVH 4XX1E 3CDGB 4DCQA 1CFSA 3VWJB 3WDHA 2N4IA 3RVUD 1EO8H 5M95B 2P5WD 2MPAL 2H2PD 2NY4B 3BKML 4L4JA 3FFCA 2OR9H 3M1BA 4JEGB 2V2TB 2DI9A 1DLHB 3TIDB 4KVCL 2FRGP 2JKXA 1ZK9A 2HRLA 3RPIA 4N8VA 3IKCA 3NACH 3FAXA 4Z5RB 3BT2H 4WEBL 4XNZC 5CIPB 3H2WA 1MNUL 1CDUA 4RA3A 1RMFH 2AV1A 4NYLB 5C08B 1OHQA 1G6RA 1ZHBB 3VXSD 5C07A 1IGCH 1CU4H 2HKFH 3MPCA 1QBML 3O4OB 4G6KH 3MOAH 4JY4A 3L3JB 5CP7A 4F37F 4OLVL 1M7DB 5CINL 2GEEA 5E56A 2PF6A 5TGBB 3V6FA 3ZSSA 1KTLA 4TSBH 6FABL 2IQAA 3O6LL 3VWJD 5DD3L 2E9BA 4PJCF 1BVLA 3GMQA 4L1HA 3TBTA 2QQNH 3HAEA 4GLRI 2X9YA 5CEXA 3CFJA 1G7QB 1SMOA 5I1AB 1YECH 4K8RH 1KJ3H 4G7VH 1N64H 2YRLA 4M61B 3MV9B 4DWHA 2W91A 1R3JA 3GJFB 4NPYA 4YBLC 4YR6B 5F9JA 1TJHH 1ZT1A 2ICWI 5KSUA 4L4TA 2XG4A 3ZKXC 4OCRH 5F44A 5F93C 5GZOD 3DXAA 4FP8L 3NTCL 5C0EB 1GGCL 4JFFA 3AGVA 3BZDA 1RZKH 3L9RA 4LMQI 2DQJH 2BDNL 2LQRA 4P5TA 4HUXB 4HS6B 3HS0A 4QXGH 15C8H 1ZHLA 4M9PA 3FFDA 3QXVA 5EC2B 1J0HA 1JWMB 4ZUVB 2W65B 3RDTB 3REVB 5EZOL 2P7TA 3BMWA 1JK8B 1T80A 1WGOA 2BNUA 3D39B 1NCDH 4XNQB 1J8KA 1QO3A 3VXNB 1K5NB 2BSRB 3GKZA 5F8RC 4M02A 2OI9B 5IMMA 3EO0B 4WRLA 5T3ZE 3D2UA 4ZXBB 1FH5H 1T89A 1BFTA 3SKUD 3ALXA 4YHOL 2WANA 1V7MH 3ESUF 4JVWA 3QCUL 1ODAA 4UDUA 4XVTL 1MLCB 3NPSB 4MD5B 4M1GH 4PGZA 5GRVK 1D5MB 5TE6L 1DN2A 3VFSB 3S36L 4Z78B 2YD8A 5HHPB 1MJ7L 2VAJA 1CFQB 3QBTB 1DBKL 4YXLL 2Q7NA 5I8KL 3D0VA 4QT5A 3S3PA 1MJJB 5F1IA 2M26A 4PJDA 3SDDB 5LQBL 4MXVE 1LE5A 3R1GH 3S4SG 3SGEI 1YNLH 1I4FA 1NMBH 1KV3A 1NUDA 5DTFA 1S7WB 1HHHB 3BZEA 2Z8SA 5SX4H 1MFDH 1RUAL 1AO7D 1FZKA 5D5ME 3I75B 2ILLA 3W82A 5IFHL 2HVKA 2NCMA 4PR5B 1Q9LA 1IQWL 3MRBA 3NBNA 4WJ5A 1NFDE 2WUBH 4F9LC 2J8UF 4EUPG 3GNMH 3CU1A 3MA9H 4XC3H 3GIZL 2WIIB 1LP9A 4QHLB 1A3QA 3HR5B 2YZ8A 3C6LA 1DQDL 3X3FL 1CE6B 1MWAH 4QRRE 3ARED 5D6CA 3HI6H 2N7AA 1A6AA 3UZEA 2XWBA 2A74B 5GRUH 3DSFH 4GG6A 3Q1SL 3SY0B 3WO3B 2EXYC 1FYTD 3V5KA 3LAFA 4NT6B 5C70A 5CJ5A 3T77B 3ES6B 3PXJA 2P24A 5CJOH 4QRPA 1XCQB 5SWZA 1YMME 2P5ED 2UYLB 5FYJD 5HDBE 3OKOB 4HFWA 5ISZE 1RURL 1JVKA 1I8IA 2B4CL 3IT8D 2ICEA 4X9HA 1ZA6A 2A6IA 3BFOA 5HYQA 2V9TA 1JTOA 3LVEA 5KVFH 3D25A 4JFEE 5IFJB 3UZQA 4WUUD 5HPMA 2EE3A 1S9WA 1F5WA 2ADFH 1BHGA 4XAWH 1IGYB 3TNMB 4KKNA 2ESVD 5TPWL 3N1PC 3PL6C 2AJXH 2HFGH 2R69H 3UYPA 1TQCB 2A73A 2HKHL 1JNHA 2ICWA 4XI5C 3VH8A 3P0YL 1ULVA 2Z8RA 4S1RL 1T20A 2HT3D 1Y6MR 1PYWB 2FHFA 5ITFB 2P8LA 5CD3B 2X4TB 3VFTB 2E7LA 1VERA 3R0NA 1HYSC 4Q9QH 2G9HB 3HZMB 5D1XB 1RIUH 3QUKB 1T1XB 2XZAL 4LBEA 4CU7A 1XIWC 4MNQE 3TBWA 4N90D 1F90L 1OAZL 4GS7C 1XGTB 4HWBL 5I19H 5E94B 1OB1A 3S35L 1FZOB 1A3LL 5HYEA 3M45A 3FRUB 1I7UB 4X9BA 4QGYA 1QLFB 4QF1A 4GAGH 3QNXB 4FXKA 4N0YH 1JHTB 3ZDXE 4XP9L 4NZTL 5JTWA 3EYUL 1NL0L 2FGWL 2A6DA 1WZKA 2BJML 4CU8A 1CBVL 4HXBL 2VLRB 2I9LB 4R7DA 5I9QB 4JG0H 2X1XR 4RWHA 2GSGA 3CPLA 4FQ1H 4XP6H 4F9LA 3WKML 2HJFB 5GRJH 3FN9A 4MAUL 3LH2L 1ZANH 4NKMA 1H3VA 2YA1A 2ZJSL 2JJTA 3D1MC 1NEZG 4I3SH 5L2KE 2FJGB 4OCWL 3O2WH 3BI9X 3WYRA 4FQPA 2R2EB 1EXUA 5HGBA 4YIQB 3DETC 2JCCE 3O9WC 1ES0A 4LVNC 1FFOA 1V3KA 1P6FA 5TFSH 2UV3A 3GRWA 4Z77A 3WFDL 4AK1A 3ME0A 2HFEB 4HIIB 3IDMA 5T5NG 5H2BB 2YD1A 2VLJA 1A6ZA 1P53A 1UB6A 2IFGA 4ZNEE 4MJIA 1Z6JT 1MIEH 1IM9B 4JRXB 1J88A 2NXYB 4EN3C 3NA9H 3EJJX 3MRPB 2AV7B 2VLKD 5GQBA 5KG9B 4X6EB 2ARJB 5CGYD 1UADC 5JW5B 4DGIH 4XHQA 3CSGA 5IHZA 2BMKB 4LCIL 4EXKA 4ZPVB 3PL6A 4U2ZA 4H5SB 3UO1L 5DK3A 1BVZA 2AXFB 1I1AB 4K7PY 1JGVH 2DQHH 3CD4A 4PRNA 3HE7C 2VXSH 5SWSE 5H94B 1PG7X 2CIKA 3F7QA 2X40A 1C08B 5B38A 3S4SB 2HRPH 2DN7A 5IB4B 4XZUB 5J9PA 1DQML 2DD8H 3BPNC 5D2LF 2FJHB 1NLBH 5DURB 4LPUA 1U9KA 4JDZA 2A1WL 2PCPB 3MRHA 1NDGB 3ZKMD 1JWSA 3U6RB 1TENA 1JHLL 1W72A 1XIWA 5J6GA 1K4DB 4NCC1 1T03H 3K0WA 4U6VL 4C56A 1AE6H 3U0TA 3RU8L 5AG8A 4L3EB 1N4XL 3TLRA 1IM9D 5DK0A 1MSPA 4N9GB 3RAJL 2N1KA 4JPIA 4N1CA 4PRPE 2NXYD 1U95B 1HIMH 5I1IL 3KYOB 5JW3L 1CFTA 2RAMA 4CNIA 1HHJA 3A6CH 5DUMH 2BSTB 4EUPB 5EG6C 4LLMB 4HWUA 4XCFH 4MQSB 4FG6C 3ARYA 4KK5C 4D0DA 4FNLH 3HUJE 1JHKH 2H2SC 4RQQA 5IG7A 1TCRB 4D9LL 3U0PA 3MCKB 4LSRL 2NW2B 2ATPB 4R26L 2J1KA 4S2SB 3NZHL 3KPOB 5C0AE 3V2AR 3ARBB 4HX1A 3KR3L 4JQIL 2PW1A 2XPGB 2E7CA 5MEQB 4NP4H 4KROC 2OZ4H 2VB5A 3AROA 1EEYB 4EZMA 4L8SB 1SYSB 3UCRA 5I66A 3GGWA 2X5PA 5F72S 3BKCL 5JUEL 1JYWA 5DA0B 4MNHA 4NO5B 1ZS8A 3HPLB 1AQDA 4B41A 3VCLB 1QSEB 1BX2A 1U3HC 3O9WA 4X6FB 3MR9B 5A40E 2DQFB 4Y0GA 2YPLA 3PXHA 2C1PA 2O61B 4DW2H 5DSCA 4JRYE 4BSWB 2WQRA 3C8HA 5BOPA 2WBJD 2HJKA 2AJ3A 1RZ7L 1S78D 4LHJB 4M7ZC 4P2QB 5I1LA 2VXUH 3MRNA 4NKOA 4WDIB 4EN3A 5E00A 3ULUL 3NCYP 4Y7MA 1CICC 3VXRA 3MV8B 3REWA 3IDXH 4HDIB 3ALPA 4JO2L 5T3XD 3RIFF 1XF2B 2V6HA 2NX5E 4GRLC 2ZUQC 3MXVH 3VXPB 5A2JH 2A6JA 2BRRH 1J1OH 1LEIA 2J8UA 4FTVD 1IT9H 1FRGH 3MLRL 5EDXA 3N1MC 4X8JB 5I18H 3C6SB 1MRFL 2PYEA 5JQ6L 1ZLSH 4H0HB 1HOCA 4Y88A 5CILH 4FQIL 5HJ3B 4OZHF 1BD2E 1T0PB 4HQQH 5E99L 4XPGH 1G7MB 1U8IB 4R4NC 1N0LA 4NNYA 1HHKA 3BPCB 1TLKA 3FHAA 4NO0A 3LEYL 4ZS6D 3FQWB 3WIHL 4MAYD 5JPNB 1TETH 4LOUD 4WI9A 2NY0B 4N68A 3LDBC 4P2RB 1MI5E 4L4VB 4LF3A 5GGQH 2YPKA 4LAQH 5CKGA 3FB7B 3IJYB 5DWUH 3TJEL 3BSZL 2R8SL 5E6IB 3KPPA 3CZJA 1MCFA 3GO1L 2I24N 4NO2B 1VFUA 5E08H 4NCDA 1NEZB 4G9DA 3PV6B 5B21A 3CVIL 3WXVL 3VFWA 4EXPX 4A6YH 3BKJH 3KXFE 1I1FB 2EYTA 3ZE2F 2MHAB 4GKNB 4NDMB 3VI4F 1IEAB 4NQSA 3U7WL 4ETQA 1NANH 1TDQA 2ZNWA 1N7ML 4R7NA 3RX7A 2ED7A 2OJZL 3LEXB 2CLRA 1CGSH 2EYSB 3HE6A 5FO8B 5JW4N 1FG2B 2NY0D 3B4NA 5GGTH 5ESQB 4WI5A 1HH9A 5F3HA 1OP9A 4WI4A 3MBXL 4LRNL 1A9BB 2R56L 2XZCH 3P2TA 2OSLA 1BMGA 3OZ9L 3QPQC 1G9EA 2ZCKL 3O6FB 3MLYH 4TTDD 5IJKC 3GUTB 5DMGD 2V5YA 3DV4B 1JWUB 3PP3H 3LZFH 4OZFH 2BVYA 4NQDE 3FQTA 2AEPL 3IF1A 3LKOB 4MA7L 4UINL 4LP5A 1CICA 1WC7B 1KELH 4C58B 3FFCE 2R29L 3AM8C 3D3VB 3U1SH 3EBAA 4I0PC 2Z8VC 3V4PH 3UTPE 3WHXB 3RWFA 5DS8B 5A43C 5F88B 1KJ2H 5C0BA 4OM1L 4OD2A 2B5IC 3QO0B 4HWNA 3HRPA 3HNVH 3EAKA 1VHPA 4J3SA 3X11A 4RFNB 5I71C 1FIGL 4IS6B 1YJDC 5DJ2A 5C07E 1DTUA 5CMAB 4PRAA 4KRNA 3TPKA 4U1GC 2OR8A 4OGXH 2XA8H 3X12B 3HMXA 1S7VB 5ICZB 1N3NA 5IEKA 3TFKC 5FOBA 3LMJL 4P9ML 3X3GL 3IDNA 5FKPB 5D7LA 3QXTA 1BQLL 4XXCC 5MEOA 3N06B 1EVTC 3H3BC 1MOEA 3BESR 4XNMB 1NCWL 4JFYB 3ARDD 4N0UA 4DAGH 1FCCA 1G7JA 5I16B 3B8YA 1AD9A 4NM8L 3IRZA 4LLVB 5FYJH 3LCYA 7FABH 4KPHL 4JN1H 1A6VH 1FO0A 2C26A 1R3IH 2BC4B 3PGFL 3C9NB 1NCAL 3MV01 4L4TE 3TT3H 3T1WA 3DXAE 1F13A 5FYLL 3RY4A 3EYVA 4JFFE 3LKNB 2WINB 1F2QA 3RI5F 1T7YA 3T1FB 1DDHA 3DUUB 5CUSL 2DQCL 3HPJB 1P2CA 5EBWB 2ZSWB 4DKFL 1S7RA 5D2LA 4AEIH 1E6OL 3PWPA 3O2VH 3B43A 3IJHA 1ZEAH 4XP4H 2YN3A 1UA6L