4P57B

Mhc tcr peptide complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
197
Chain Sequence
QAFWIDLFETIGGGSLVPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 197
sequence length 212
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p57B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p57B01
5ICXB 1IGMH 4P2OD 5JZ7D 3CFJA 1NFIB 1L0QA 1NUGA 1Q9LB 2WIMA 4DVBA 1FORH 1BGXL 3IF1B 1YDPA 4LGSB 2W0FA 1I3GH 5DVLA 1A21A 5E5UB 3MX0A 3K7UA 4M6NH 5HGHB 5JORB 1GGBH 4QRSA 5ID1A 2H2PC 1ZHNA 3ROLB 1QSFD 1I7RA 3NIDE 1KC5H 2JCCB 1IEAA 3D48R 5FCUH 1FNEB 1GRWA 3GEWB 1Q9WA 1EGJL 4Q97A 3K46A 3PHQB 3MJGX 3VXMD 1WF5A 4GAJL 4RQQA 3SKNB 4LCIL 5HD8C 1F3DJ 3DJ9A 4QOKA 2VLME 3ABZA 1D9KD 2VLLB 2BSRA 5KZCD 4S0SD 3ARRA 2EDOA 4N0UA 5JPMA 1WVZA 1REIA 4LARH 4CNIA 1FAKT 1INQB 3IAQA 5C8JB 2GTZA 1JF1B 5JQ6L 4PGDA 5ADOL 5KN5B 3HG1A 2P5WE 3F5WB 1V05A 4L8SA 2RGSA 1N6VA 2JJVA 2XNAB 3QIWD 4LVOB 1KBGH 4PJHE 1S8DB 1R5IA 1WBYB 4OT1L 5T5FH 2BY3A 2IH1B 2DAVA 2MQ3A 3VFGL 2N7AA 3DX6A 3FMGL 5GIRB 2DICA 3GMRB 2DYPB 1BVKA 4LGRB 3L3GA 4X6DE 5I8OH 1FPTH 4Y4HA 3LPWA 4JM2B 4PD4K 5KVDH 2XTJD 5FO7B 3B2VH 1X4ZA 1EEZB 2DLEA 3VXRD 5CD5C 2CIKB 3HLAA 2JJWA 5I15H 2PR4H 3VXPA 4DN3H 3BZ4B 5I18L 5FGBC 3IJHB 4K3DL 4OD3H 1HCVA 3O3AB 3KLHD 1M71B 4R4BA 1VGKA 2NYYC 4QTHB 3QEQA 5DRWA 5IFHL 4ZD3L 5EOTA 2H32A 1TVDA 4PJDA 2MJWA 4IJ3C 3WHE1 2VLKE 1YMMB 3CFCH 4KXZI 4RA0C 1IKFL 1FZJA 3MJ6A 2N7BA 5C0AB 3O45A 3SGDH 3K2MC 4QRPA 5AYUH 3WFBL 5MHSE 3MYJB 4JFFD 3D18A 1R3IL 3DRQA 4DGYL 4O2EB 1FYTB 3C5SA 1GXEA 4ZUWB 2FD6L 1HI6A 2CGRL 3MJ7A 4PJFA 5DD5L 2D03L 3MR9B 1BLNB 5EBWA 5C0DA 2J2ZA 2Z91B 2W60A 1FFOA 1HH9B 1FH5H 5HTSA 2YA0A 1NBZA 1FNGB 1EGJA 4HJ0D 4GQ9H 4MCYA 4LLMB 3OL2A 5FYJD 1FL5B 3GK8H 3I6KA 5GS0D 1UWXH 1WWWX 3EO1A 5IKCB 4Z0XA 4S0TD 4FMFA 3GSVA 4P2OA 2HT2C 3NH7L 4KI5D 3U1SH 4JG0H 4F9PC 3IDGA 5JDJA 5F96L 1UJ3A 2XYCA 5CILL 4LSPH 2HG5B 1FL6B 1NGWA 3FOLA 2DLGA 4JHBA 4KZEH 4JQIH 5JOPD 2BNRD 2I60L 3EYOA 3BYYA 2NY3D 3PUCA 3HCVB 5E4IA 4KVNH 1QP1A 4Q2ZB 5AUMB 4FQCL 4RGND 4P2RB 3MMEB 4KH2A 4NWUL 1KIRB 3CSBA 3QBTB 5L2KB 3LHPL 4KMLB 2LV4A 1HKLL 1KJ2H 3DX9B 1FG2A 1IGCL 2D4DA 4ODXA 4PJEB 4XNUH 3UZQA 5HGBA 3OR7B 2DLHA 3GDBA 4JFOA 2DRUA 4KTEH 1HCFX 4JR9L 2JLLA 5EU6D 1A02N 1T1WA 3VXMA 3B9AA 1H5BC 5KSUB 4IRSB 5IF0B 5FYJL 1J0JA 1QBAA 1KCUL 1WBZA 5GS0L 1D9KA 1ZK9A 3SQBA 2Y06H 3KAAA 2NY6C 2VRAA 2A6IA 5JMRA 1AKJD 2CRZA 2VQTA 4PYGA 3I50L 4X5WA 3LRHA 3G04A 4MJ2A 5B3JF 4MD5A 5FUOL 3RVUC 3QIUD 4JE4B 5CBEA 2XG5A 1ACZA 4KJPC 3QIWA 3I6LD 2VC2L 3GJEA 4NNPL 1ES0B 1PAMA 1RJZA 3SJVD 1EFXB 5J1TC 4O9HH 4Y2DB 3NIGE 1IE5A 7FABH 2D7OA 2ZG2A 4CDHA 1U93B 2KUTA 3IDMA 3UDWC 6CGTA 2FYYA 3BUTA 4ZFOL 3VXRA 2FWOB 4Y5YC 5J9PA 4XMLL 1TJIL 2W9DL 4U6VL 1OP5H 1AFVH 3VMOA 1VGEH 5IB1A 4X9BA 4IRJA 3BGMB 5IEHB 1A1MB 1JK8A 1S7QA 2BC4A 3R1GH 1CFQB 1OP3K 1MFAL 1RI8A 2WW8A 1JI2A 7CGTA 5DFWH 4HXAL 5DRNB 3X11A 3SE9H 4N9GA 4U0RB 4EI5B 3OKKB 2VDQL 3UP1A 5EC1A 4OIIL 4QHUA 3NACL 1EDQA 3EDJA 5DR5H 1JWUA 1D5ZA 4YX2H 4JFFA 2VL4A 3DUSB 3WBDA 3S98A 5F6IB 4X6BB 2DQGL 1DEEB 1NKOA 4LU5L 1QA9B 4J7RA 2A6KA 3QCUH 4UBDD 5DC0A 5I1AB 1U8OB 1ZT1B 3O11A 3FFDA 3GKWH 2GQHA 3JUYA 4QXTA 1IGFH 1DBAH 5C0FB 3JV5A 3KPRB 1PFCA 3CUPB 5JHDD 4JRXA 4GKZB 1T03H 3TBVA 4EOWH 4M6AA 3KNBB 4FQXB 4HHAB 1I1AC 3HNSL 3ZKXC 3W39B 2YSSA 5DJ2B 3EHBC 5HDBF 3RNKB 3X3GL 2DI7A 1CTNA 2BNRA 1ADQL 1KN4L 1WZ1L 2Q86A 1FCCA 4F7TB 4DCQA 2ZUSA 4OCYH 1UADC 4EBQL 1Q0XL 4YC2C 4M1DH 1ZV5A 1OTTD 4G5ZL 3QEHB 3SY0A 2R2HA 1UM6H 1A6ZA 1CQKA 5C0RL 3ULVL 3MUY1 3VFWB 1UYWH 1IAIL 4JZJA 4ZFOA 4LAQL 4JDTH 4Y16B 5MEQB 4HKBB 2IJ0C 4PRAA 2H9GB 4TUOA 1Q1JH 5EU6A 5ESQA 5BV7L 1YEJL 3SE8H 5D2LF 1QKZL 1N26A 4N0UE 4YBQC 1A4KA 3X12A 5DK0B 3DYMA 1QEWA 1NGYA 3BZFB 4MAUL 1JYWA 4LHUD 1D6EA 4HD9A 3SDAC 5D1ZA 1AD0A 3EIFA 3DXAD 3PWPE 5HGDA 4X6CE 3O3UN 3HR5B 4GJTB 5IB4B 5IFAL 3QIUA 1G0XA 2DM7A 1N7MH 3OKEA 1K4CA 1BX2A 1P7QA 3SJVA 4P2QE 2XWBB 2KZ1B 3NZHH 5AEAA 1A7BA 1T1YB 5EC2A 1DBMH 3WSQH 5BMFL 4PPTA 4OJFL 3MLTB 1D5IH 2FX8H 3TPUA 1RZFH 5C71A 3AAZA 1OGTB 1MF2L 4ETQB 5I8CB 4KGJA 4WI9A 2YRLA 4XP5L 4YHKH 5GGUA 1MIMH 5I1IH 1P2CB 1I7UA 2B1HH 4LP4A 3WKNA 2V2TB 3WS6A 5IMKB 1CDHA 5DEZA 1IT9H 3X17A 4J3VA 4NO5B 4PJDE 1CFSB 4Q6IA 5DFVD 3WXWL 5TDOA 3GMNA 1MIEL 4LVEA 4NKIL 4LP5A 1JZ2A 4JRYD 1S78C 1ADQA 2APBA 3OJDA 5ERWB 5JOEA 4FFZL 5LXGH 3WUWA 1YQ2A 3BP7B 1YC7A 2BJML 4PY7B 1YYMH 4NKQB 1I8LC 3O2WL 1JWSB 1S5HB 5DD3H 3FZUD 3MXVL 1JIBA 3SGKA 1SVCP 3HAEB 5FM5O 1VADA 3ET9F 1DBKL 3I75A 1M05B 3RAJH 4U33A 5E2TL 3SO5A 3GMLA 4HUNB 4HXBH 4OLEA 3V9FA 4LVNC 4C54A 4LCUB 4PG9B 1WICA 4Y5XB 5IMOA 4MXWH 1QOKA 3HC0B 5JHDA 1OAUH 1OTUC 4XCEB 5ILTH 5JXAL 1IAOB 4G9FA 1U95A 4GRWE 1HQRA 4QGYA 3T4YA 4J3TA 4K23H 4L3ED 4OCSL 4UIMB 1CFVH 1CR9L 4NQED 4YUEL 4MS8D 1XCQA 3W9EB 4OZFA 4YHOL 2A1WL 1YNTB 4X6DF 4JRWA 1JTPA 4W68A 4RX4D 3O6FC 5DA4A 4U05A 1GZQB 1G6RB 1QSFE 4HWBL 4ZFFA 2EO1A 4R0LB 2BCKB 3IDJA 2DBLL 1RU9H 2VDPL 3BQUD 4M7LH 5ALBH 5IIEB 2BSSA 1JYVA 4P2YA 3VXME 3LB6C 1TZGH 4OKVB 5GS2D 4HUXB 5DDHB 3H9SA 5GRJH 5C0IA 4G8GD 1L4IA 5IMLA 2DQDH 1EBPA 1KACB 4ENED 4GAYA 1FNSH 4F7CA 5C0CD 1RPQA 3HE7C 3MO1A 4LHUA 3BPNB 1VA9A 2Q20A 2YOCA 5IROC 4P5TB 3DXAA 1UWEL 2IPTH 3QUZD 1TTGA 3FQRA 3RTQD 3QNYA 3CGTA 2VL5A 3CCHA 2B20A 1MCEA 3Q2CA 5DHXB 4G6KH 3VG9C 2DQIL 2YMXH 2UZIL 2D9QB 3PGFL 2XTJE 3ESVF 3VXRE 2P42B 1P4LB 2EDYA 4H0IA 2DQFA 5HJ3A 1S9VA 3KWWA 4O2CA 4ZTOH 1QFWL 3JVGC 3VXTB 4LSVL 5IK3B 5EZLA 4MJ5A 4IDJH 3HFML 4NN6C 2HLFC 5EFIA 1S7SB 4PRDA 5I1CL 3S35L 1AGCA 5F9WB 3I6GB 5LGJB 3HMWH 1YYLL 3P0VL 3IDNB 3NZ8A 4JRYA 3TV3L 1T2JA 4X8JA 1BOGA 4JFFE 1MHCA 1YNLH 1F6AB 1IGML 1G7MA 1P4BH 1S7WA 8FABA 5EWIL 3MV7E 1T1ZA 5GRVL 5FB8A 2NQCA 3DGGA 3O6ML 4HWBA 4JO2L 4JO4L 3QG7H 3UCRA 1GGIH 3HPJB 3PDGA 1YEEH 4RZCB 1QG3A 4LDLB 4Z77B 2A9ML 4CL7A 4H1LG 3DOSA 3B9KB 3S3PA 1KLGA 3I3DA 3ECBA 1NLDH 1M4KA 1R3LB 5FYJE 2C3XA 5C2BH 4DUXA 5J8OA 1GGBL 4M1GH 3B9EA 2QADC 2W38A 3HI1B 1NUFA 5C6PB 2PCPB 3TT3H 4KPHL 4JEGB 2A9NH 2ATPB 1NUDA 1X6NA 1HEZB 5D71L 5JOPE 2BNRE 3MLUH 3NIGF 4L3EA 4NQEA 2F19L 2FHCA 1Y0LA 3RZCB 1F4XL 4WUKH 4XBPB 3T65A 4RX4A 3MV9A 5DHYB 5T3XH 3MNWB 4XBGB 2JJSA 2EDRA 3M17A 1W0YT 4D0CA 1Y6NR 2B0SH 3BQUA 2Y5TB 2H2SC 4R26H 2HAZA 5D9SB 1E4KC 2YUVA 3BDYH 5EU6E 3QZWA 4WHYG 3RZWA 3LSOB 4MA7H 3BD4A 1OPGL 5I1LB 2J6EH 1HHHB 2GFBA 3S34L 1UWGH 3N1FC 5EU7E 2OCFD 4I18B 3DNKA 4PFEA 2VABA 3B2VL 3PJSB 3UBXB 5C0CA 1T83C 2XIDA 3WFEH 1S9WA 3QDAA 4HUWB 5I75B 3BP6B 5FKAB 3F7PC 4UINL 3U2SA 3ZT7A 4DN3L 5C07B 5DMKA 2XOTA 3IU3B 5LAXA 3I6LE 2B4CC 2R0WL 3KLSA 3QUZA 3S5LG 2LU4A 3RL2A 5ACZB 1CQYA 3IETA 2GTWB 5DUMH 3QYCA 5DQJB 2R56L 3RTQA 1KIQA 2Y9RT 3UBXI 3V2AR 4KKLC 2FEEL 4CMMA 4AMKL 1HHGA 1KNOA 1CDYA 5KSVA 5DRZB 3CXDL 3CFCL 1G9NH 3ZSTA 5EU4A 5FO8B 4XP4H 2FHBA 3H42L 4PRPB 3MOQA 5AYUL 5C0JB 4OGAC 1PKQE 4PB9L 3DPBA 3O3EB 4R97C 3RHWF 5F1KC 3NIFE 4BH8B 5HSFA 5F1IB 3BGAA 3NPZB 3QEGH 5HHVH 3TBWB 5HVHB 1BIHA 4PJ7E 5BQ7B 3LQAL 3ALPA 3OX8B 5SX5H 2NR6C 2V9RA 4NDMB 4GQ9L 2AJ3B 4YAQA 4MXQC 2H8PB 3OKNB 4KK8D 2BHYA 5CP3A 3GK8L 3UTQB 2WWKT 3EOBA 5E8NB 2DTMH 5H37H 4FXGA 3T2NH 3MLPA 1NAKL 1ROWA 3U1SL 1MLCB 3CLEL 4ODWA 4OLUL 3FQNA 3PL6B 5AD0B 1IKNA 3MROB 3NPSB 2Z93A 4TPRL 4GH7B 1NCBL 3HE6D 1N4XH 2IAND 2E5EA 3ALWA 3MRRB 1XGQB 3LQZB 2WBJB 3Q5TA 3O81A 5IOPB 5E7FA 4X6CF 1U8MA 2IAMC 3RX8A 2DLTA 4P46C 1KJ2L 1EAPB 3VD4A 2ICEB 3D25A 1A9BB 2EC8A 4KTEL 4HKJA 1P6FA 2PYEB 1MJJB 4R8WH 5DT1H 1I9IH 2LU3A 4GAGH 4WV1C 4ZPVB 2B2XL 3WEXB 1B0RA 4WW2B 4BKLB 2AJVH 4Y8AA 3KJ4C 3PE9A 1HXMA 5T5NF 1J05A 3QA3B 2ZOLA 4MJIB 3UJJH 5DUPL 1AJ7L 3KGRA 3DSFH 3QEUB 2HFGH 2JE8A 4PUBH 1EFQA 2X4NA 4P4RA 1VSCA 1MHEB 3SDYH 3Q5OA 5SWSE 3TO4C 2UUDH 4U7SA 2C1OA 4YWGH 1CXLA 7FABL 3ALXA 3MJ8A 3QRGH 5DJCA 3MGTA 3SDCB 1N3NB 4J8RB 3PABA 3CFDA 2KQMA 4NBXB 4MD4A 3DXAE 5EO0B 3MQIA 2A74B 4Z7VB 1LWRA 4E41D 3P9MA 4CBPA 1W72H 4ODUB 1T89C 4NBZB 2YWYA 4DW2L 5L7XL 1U8PB 4JKKA 3S36X 2Z0BA 2HFEA 1T0MB 4JVPA 1E4JA 1J18A 4HKZA 3P73A 3R8QA 2W07A 3RVWD 3P0YH 1OTSC 3FRPG 4JDVB 4PGEB 3SE9L 1OQOA 2OSLB 5E8PA 1DVFC 1LEIB 3QI9B 1JZ6A 3ARQA 1L6XA 5KS9E 3MLYH 4GRWF 4IEFB 3DRTA 5EIQA 4L3AA 1MPAH 1M7XA 1BD2D 3TYGL 1CK0L 3V6BR 4ZNCD 4X7SL 1KJ2A 3VH8B 2VIRA 4NHCH 2E6QA 3U36B 3PWVB 4FFWC 3QCUL 4JRYE 4PJBB 4DKFL 3QFDA 4WFFD 1OD9A 1ZVSA 4QF1A 3RKPA 4L9DA 1IGFL 4PJCA 2AK4B 1S7VA 2R2EA 5EBMB 3CK0L 3D85A 1GVIA 3DX7A 3C60B 2R0ZH 2HRPL 4FQ2L 4ISVB 1BJMA 3UC0H 4H0HB 1N0LA 3QUMB 5CJOL 1ZT7B 3GMPA 3U6RA 3HE6A 4LPWA 1CI5A 4WUUE 3TO2A 1YQVL 2IANA 4K9EH 2VZ1A 3KPMA 2K7PA 4L4TB 1Z9MA 1C08B 3IFOB 4M1DL 1RZJH 3T2OA 1OW0A 2AEWA 4AT6A 3EFFA 3ARTA 1UM6L 2FJHA 2D7TL 2AGJL 5I1EL 3RUGF 1MNUH 3CFEB 3U4BH 4XPBL 3B5TA 5IP4A 3HTLX 1UYWL 4HS8H 2JB5H 1G1YA 1FNHA 5E2UL 3T3ME 3OXRA 1I8IA 2AJXL 5IMMB 4L8CB 5D6CA 2PYFB 5DVNA 4APQC 3A6OA 4Z78A 2YZ1A 2FSEA 2YD4A 5GHWL 4BQCA 1F8TH 4Z5RB 3RPIB 2DB8A 3WDJA 3NAAL 1R24B 3MREB 1U3ZA 3UYRH 3AS3A 4XC3H 4PJGB 4ODSH 3OKYA 4UTBH 1JHLH 4KXZH 3RL1A 2Y1VA 3A67H 5F9OL 5IHUL 4K2UH 4K3EH 2IPKA 4PR5A 4G8GE 4RIRB 4PRHE 2W1NA 1N7ML 4L8BA 1GGCH 3AS1A 4U1MB 5CZXC 5HYQA 4LCWD 2D7NA 4M02A 3RWIA 1DBML 1T3FA 5C0CE 5FDWA 3P77A 4NKOB 1J0HA 1MIML 3O9WC 2R23B 4HKXA 4L4VD 1DDHB 3UTTB 3WYRA 2B1HL 5GGVL 4BSVA 4HW6A 5EUOA 4E41A 3C6LD 2C3WA 3TIDA 5E70A 5I30L 3ARGD 1IT9L 4AH2A 3RWCA 1NEZA 1RZGB 4ELMA 2CMRL 4JVWA 1MVUB 3SDDA 3C5JA 3RU8H 2IEPA 1NDGB 2VXVH 4JREC 3KYOB 4MWFB 5J1AA 3TVMC 4TVPD 5E1AA 2VAAB 1PZ5A 5LXGL 1XF4B 2GK0B 4M7KL 4ORGB 1S9KC 2YD8A 4J3WA 4CN4A 3FT2A 4IIQA 1BJ1J 1Z9LA 1NGPH 5H94A 4KHTL 3HUJB 2ZPKH 5A2LH 2WANA 1G7JA 3NFSH 3VFMA 1YUHB 5IR1B 1BJ8A 3RGHA 1BD2A 2R29H 3W2DH 3BAEL 3LZFL 3CH1A 1XF3A 5KBNC 2WSKA 1Q94B 4QWWD 2CLRB 2WK2A 3BXNA 3JTSA 3EDDA 3WLWD 3AREC 4HXBL 3W11C 3JWDC 4KJWD 3VCLB 3T0VA 1RK1A 1P84J 1NC2B 1FAIH 3IXTB 3MLVH 4P5MA 4GG6A 5ABDE 3C5ZB 3BPCB 3LEVH 4X4YA 2G2RA 1X4YA 4Y5VC 3QUKB 1CFVL 1HZHL 4QHLA 3WO4C 5DD6A 4PJ9C 4XXCC 1OB1A 3LKOA 2R15A 4ZNEE 4KK9C 4OZIF 3DV4A 5TQ2H 4IM8A 4WCYH 3WMSA 4TVPL 1FNLA 5E2WL 2W0KA 2QL1A 5KVMC 1X5GA 4OCWH 1UACH 3ZE0E 4XBEL 1ZLWH 1KPVA 4PJXE 4NN5C 5L8KB 2HJFA 3CVHL 4U2YA 4GRMB 3N06B 4M7LL 5ALBL 3U7AA 5ISZB 5IUSA 3L3KB 5CJXC 2BNQB 3T09A 2K3TA 3BPOB 4MVBD 3OR6B 1Q9OB 4QLRA 2Y25A 3OJMB 1NMBH 5D1QD 1W0WA 1KELH 2VOTA 4LRNL 1FNSL 1GJIA 4XNMB 1VENA 4QHKI 4P57A 4PJ5D 1Q38A 3TJHC 4ONHB 3WCYA 4UIKH 4Y4KB 2G5BA 2NXYB 3LKQA 1E6JH 3NIFF 3VFRA 1CDJA 3KYMA 3S37X 2FX7H 4WW1B 4PJ7F 1DFBH 1LE9B 3ARFC 1JGVH 4IOIA 4P3CH 4WI8A 1LD9B 4C56B 4LCWA 3KYKL 3G5XB 2YMXL 2CDFB 2NY5L 4FHBD 5F88A 5ICYA 4XVJL 1SM3H 3KPOB 3MJ9H 4JG1L 3LEXA 1DBJH 1XGPA 2ED9A 4L4VA 3TIEA 2CO6B 3UO1H 5EH1A 3WV0A 3C6LA 1G7PB 4O51B 5A16A 2YA1A 3W0WB 3ARGA 1XF5A 3O41A 4IDJL 2R0LH 5GGQH 1ZMYA 2J8UB 3EYSL 3L3OB 1Z5LB 3ES6A 3F12A 1AGFA 1R5VA 4MA8L 4F7PB 1MUJB 2AKRB 3HMWL 4NRZA 4F9LC 4BSWA 2DL2A 5BZWB 1TETH 1XF1A 2NW2B 4PJ8B 4I13B 3MYZA 5F3BB 1RJCA 1OSZB 3CX5K 3Q6FA 4AG4H 2Y07L 3ELAT 4JM2F 4MNQB 5FK9B 35C8L 3QG7L 1A1OB 4PLKC 2C3GA 3CVHA 1U8JB 5BS0D 1JE6A 4M48H 4LNRA 4XP6L 3MA7A 1NLDL 5DLML 4G7VH 4HUUA 4OF8A 1G9MH 3EOTH 4CKVX 1RQ5A 4HWZB 1IILE 2ADFH 1OARL 2EDKA 2A9NL 2Q7YA 2FLRT 2DLFL 1FG9C 4NFDA 5EULV 5B39G 3OKDA 4YDKL 4QTIL 5GGRB 3WNPA 4E5XB 1B2WH 3RWFB 1F3DH 2H2PD 5K9JH 3BVNB 3HRZA 3NA9H 1ZGLB 3V6OA 4G8IA 3FOMA 5T1LD 3T0BA 3RNQA 1XEDA 4DN4H 4MD0A 5HD8D 1PD6A 1CN4A 3QDGB 3BGFB 2B0SL 3L7FA 4KC3B 4YK4C 3ILPB 3H3PH 4R26L 5BVJA 1PZUB 3BDYL 3H9YA 3PP4H 1S7TB 2VLRD 3T04D 2COQA 5FA3A 5SWZB 4AK1A 3FO9B 5EU3A 4JVUA 5D1QA 4GBXB 4EIZC 4ZXBB 1ND0B 4N90D 1OVZA 1N6QL 1MREL 1NC4B 3G6JA 5KS9F 2KQNA 4F15B 1CF8L 5MERB 1MCSA 3K81A 1J8HA 1PQZB 1UQSA 5EIIA 1YEDB 3BFOA 3BEWB 4KRLB 1AHWA 3LOWA 5DUML 5CCKH 4HT1L 4HH9A 5JXED 1DQDH 5D1XB 4P23A 1C1EH 2BMKA 3IKCA 1HHJB 1J0KA 4QYOB 2V7NA 2E9BA 2FHFA 2Z8VC 3GB7B 5I1JH 4XP4L 4E41E 3I02B 2CIIA 3NCJH 2NYYD 3G5YB 5I74C 1ORSA 4JZOB 4ELME 2IQAB 4EDWH 2E9WA 1PYWB 1MHPH 3QEGL 5GSVB 4EVNB 1BQLL 3F58L 1WC7A 3TZVC 1ZHKB 2HN7A 1YJDH 3HAEH 1YEGL 1ORQA 3JV6A 4H25A 3FQXA 3V8CA 4RFEA 1JZ7A 4PLJC 3TN0C 1WFNA 4ERSH 1KB9K 1EVTC 4XCYB 2IGFH 3HS0A 2APVA 3H0TA 1MCIA 4TSCL 5HGAA 1MY7A 1FNFA 3NCMA 5D5MA 1LO2L 1BD2E 5KJRH 2X4TB 4JY5L 5IW1B 1RFDH 1OGAB 3EGSB 3GI9L 5BS0A 3NBNA 4N0FA 1AGEB 1KJ3L 5CSZB 1YC8A 4UDTA 2HKHH 4HGWB 3ULUH 1MH5B 2JJUA 1FZKA 2GSGB 3B5HA 3EO9L 4GG6E 2YD9A 2PKDA 4FFYL 1G6RH 1I1FB 2WP3O 3KS0J 4KUCF 3BKML 4EN3D 5D2NE 2Z4QB 1KGCE 2VXQL 3AU1A 5I1KH 3QDMB 1IJ9A 2XY2A 4U1KA 5TDPB 3JXAA 1I9IL 2R1WB 4NKMA 1EAJA 1DANU 2YUZA 5BOZG 4YXKH 5JPNA 4L3CA 4M9OA 5ENWB 1II4E 1QZ1A 2AJSH 3U83A 5T1LA 1HK6A 5D70H 1OM3L 3MNZA 3UJJL 2CLVB 4EI6A 2HFGL 2E7LC 2VISA 5I76A 4Z7UB 2ZUUA 3SDYL 3GNMH 2NY6D 3GSXA 4PJIB 2P46B 4NO0A 1QFOA 2VLRA 4Y4FC 1V8HA 2HVJB 5SX4I 4OD2A 3CDFA 1C16A 1U42A 3RVUD 2QQNH 1A22B 1IMHC 3JV0A 3MUHL 4XC1H 4POUB 5HDLA 4JQVA 1G6VK 3VXNB 3FCTA 3ARDC 4JFZH 2VXSH 1J88A 3MV8A 4KRNA 1H0DB 4JB9H 2QR0A 1DUYB 3VE0A 2AERT 1NPUA 3J7HA 3BIAX 4KVCH 3U7WH 3QNXB 3P0YL 2NY2C 5JXEA 1JFQH 3RGVD 4H5SA 4I9WD 2QSTA 4J4PC 4KUZH 5IEKA 3QCTH 3AMKA 4PRIB 2F74B 3CC5B 2OL3B 3G5VB 1L0YA 3T4AA 1I7ZB 3HHRB 2NTFA 3CH8A 5F3HA 3FTGB 4UNVA 2VZOA 4V2CB 1ZHLB 1B4JL 4LLQA 4LCCC 4NO2B 3RFZC 5J6HA 1HNFA 1LGVA 4LLYA 3HC4L 4N5ED 4KKNA 4NHCL 3RDTC 5E9DB 3B83A 3ZE0F 5CSBA 4TVPE 5F7DA 2VUYA 2RFXB 4FQPA 1YN7B 25C8H 3QNZA 4OGZA 2DYPD 4PBWD 3PIQA 1H3GA 4YHLH 1JUFB 4PBXA 2C7UB 3X13A 3CDGA 4EEEA 4TSBL 1H9VA 2R0ZL 1D5BA 2OM5A 3GHBH 4P3WA 1WTGT 1T5WB 5DVOA 4XP9H 4M6OH 3QJFA 3UC0L 2C5DC 1NCDH 3QPQC 1FCGA 1BFVH 1OAKH 4LEOA 2L7UA 1BQSA 2I07A 2QQKH 3RHWK 1DBBL 3ZLQC 1NQBA 2R2BB 3PWLA 5E8OB 3VFSB 1I1AD 2PO6B 2V2XB 4V1DB 1KTRL 3EYQC 1RHFA 1EO8L 4JKWA 3DX8B 3U4BL 3G6AB 4EN3A 2XQYK 1U91A 3MRMB 3MUGA 3BYTA 3K4ZA 4WGVB 2JB5L 4U1GC 3U4EA 1KPRB 4PGZA 4NIKB 4OZIA 3V6OE 5J13B 4HDIA 5ANMA 2MKWA 4RAVA 3BKYH 1DE4B 2EH7H 3ROOA 2P8LB 1MOEA 4ZMAT 4X98A 1X5IA 1ZE3C 1N8ZA 3MA9L 3PDOA 2VXTL 4X0KB 2X4SB 1NJ9B 2OP4L 3NGBB 2GAZA 1TPXC 2P48B 3P4MA 4HC1H 4XC3L 4ODSL 12E8H 2F54B 1JGEB 5HYFA 3PHOB 2NZIA 2X44D 4KDWA 1JHTB 2V7HB 1MRFL 4K2UL 4K3EL 2R8SL 3LH2L 2OTPA 2OX5A 5I1HH 1S7RB 1Q9LA 1RK0A 2APFA 2ENYA 4MHHG 3QCVH 4PJ5E 4OI8A 3NFNB 3H2WA 2ZUXA 1XGUA 2BVQB 4D0BB 1M7DB 4UT7L 3VFOA 3MPCA 3ZE2F 3ULUF 5JORA 1PY4A 1BQHA 1MAJA 3HZKB 3BMWA 1C7SA 4N0YL 4BFIA 5BRZB 1RHHB 1K6QH 3CZJA 2MHAB 3MRIB 2XQYG 5T33L 2JCCA 3RVTC 1MQ8A 2AK4E 4Y5YA 4PS4H 1LDSA 3E2HB 1A7PH 1MQKH 4YDLC 2MQ0A 5EZIH 3RGVA 3IGAB 5GZOD 5J06A 4OCMC 2VLLA 2VDLH 3MLZH 3T0EB 1XH3B 3KDMA 1QLRB 4WTWA 2E7BA 4BQ9A 4L4TE 5C8JA 1S78D 4RMQA 2ICWB 5BJTB 3OPZH 3W2DL 2R29L 4CJ0A 4NOBA 3T0AA 1Z9OA 3STLB 2XNAA 1UZ8B 3P3YA 4K7PL 3SPVB 1WBYA 3P4OB 2MFNA 1EFXD 4BA8A 5E2VH 1F45A 5GIRA 5I71B 3GBNH 2DYPA 4D9RE 2ZJSL 2ICWI 5CKGA 5J6GB 1B0GB 1EEZA 1XR8B 5BS0E 3QUYB 4K8RH 1A9EA 1QRNB 4I8DA 4OFKA 5L2JB 4MQXC 4LSRH 3DUUB 1S9XB 3ARYA 3IB4A 1OTUD 4PJGE 5T5NG 3O3AA 5EOCH 3L95A 2BDNH 4N8VG 4OQ1A 3SN6N 3RY5A 1I1AA 2QHRL 4QTHA 1A47A 1NCWH 4QNPF 4FZ8H 1WBXB 3L9RB 4ZS7H 4D0DA 5C0AA 2ED7A 5IFJB 3O6FD 1EMTH 1EIBA 4LVHC 5MP6L 5IJVB 1L7IH 1K8IA 4OCRH 2GHWB 1I1RA 4DAGH 5TGBA 5BO1H 1WV7T 4ZUWA 4M7JH 1UG9A 5H8DA 2YUWA 4Y4HC 5FECA 4HK0B 3S5LB 2PW2A 1BLNA 1IC5L 3LB6D 2YEZB 1KJMB 5C6WH 3D6GA 1HH9A 3MBEB 3Q48A 4UIKL 5ECJE 3WFZA 1AGBA 1WTLA 2XKNB 1FNGA 2Z92B 4HMEA 1E6JL 4QEGA 3OXSB 3FONA 1NAML 4JQXA 4LLMA 3UTSD 3OHXB 5IB2A 3FAWA 1K5NB 2FX7L 2FJGB 1FL5A 3TJEL 1SMOA 2ORBL 4OLVH 2VLRE 4F8TA 2BRRL 1JYXA 3L5JA 4LLDA 3HE7D 4XZUB 5E6IB 2EE6A 4N90E 2RJMA 2O61B 4GUPB 1HOCB 3VA2C 3CLFL 1YEKL 4LLUB 3HCVA 1KXQE 4O58H 3UO1L 1BBDH 5AUMA 1DANT 2OXHA 5GS1C 3VI4F 3MMEA 3DBXA 4OQTH 2PTTA 4IOFD 5L2KA 2R0LL 5GGQL 5SX5K 4C4KO 4JKLA 1CL7I 2OXGA 4KMQA 1A6VH 2A6DB 4PJEA 2WNGA 4YIQA 1ITBB 1I7TB 4NQDE 1D5XB 1TETL 5KSUA 5T1DH 2HLFD 3FB8A 4K7PY 3V0AC 4G6AC 4ZG1A 4P2OC 5JZ7C 1TJGH 5FYLH 2AXHA 4AG4L 2F8XC 4Y19B 1UJ3C 4GLRH 4HQQH 1LE5B 3AFLA 4NFCA 1FV1B 3UX9B 4M48L 2QQLH 3TA3B 1KTDB 3QUMH 1JZ3A 4C57C 1NL0H 5ISZE 1TNNA 1ES0A 4JFYB 3EOTL 1ZGLM 1EFXA 1I8LA 4Y2DA 5CBAB 3MLSH 4BYHA 5D7IB 2ADFL 1AXSB 3QWRD 1P4IH 4MQ7B 1U93A 2HWZL 1J7VR 1RUML 4LQFH 1JMXA 2EECA 4YO0B 4ZOBA 1B2WL 1K2DA 2QADD 1VFMA 1YY8B 2YC1B 4YDIL 5DVMA 2YKLL 2F5BH 5JW5B 3NA9L 3O2VL 3RA7H 4RCAA 1A1MA 2BOBB 3SKMB 1R3KB 4FXLA 2ZOKB 5B38B 1KXVC 2HA1A 3BSZH 2UYLB 5KSBB 1I9RH 2XZCH 2Z35B 3H7LA 1IRAY 4DN4L 4G7YL 1SJVA 3AROA 5DRNA 5F72S 4LRIC 2VDML 4NRYB 5DD0L 4EI5A 3IFLH 2CR3A 5IVXA 5F71A 4CVXB 4GW5A 3MJ9A 4HAGA 2UUDK 4RFOL 1MAMH 3O6FA 4NZRH 4QY8B 3TNNA 1XIWB 2VE6B 3SDXB 3IFPA 3DUSA 1ZS8B 1T66C 1GOHA 3DO7B 4X6BA 2H2SD 1DEEA 4OUUA 1QA9A 1KYOJ 4O02H 4JDZB 4C83B 2VKXA 2VH5H 1FLTX 2OJZH 1IZKA 4HAFA 1U8OA 3L6FB 1ZT1A 4HS3B 1OHQA 4R3SB 1MFEH 3UTSA 4IRJC 4HG4K 5C0FA 1HH6B 5FYJU 1P5VA 1CLZH 4JANB 3CUPA 3ZDYE 1ULVA 3L5WB 1A7RL 3X14A 4HIXL 3KNBA 3GSOB 3HE7A 5CCKL 3V7AG 4HHAA 4JHAL 3W39A 5DJ2A 5IROA 1C1EL 4YNYB 3GKZA 5EORL 1NKRA 4MNQE 5I1DB 4JPKL 3QDHA 5HY9B 4R7DA 4AQOA 5DF0A 1F6LL 1SJXA 4F7TA 4Q0XH 4UOW1 2VERN 5IW3A 5J89A 5FO9B 4EDWL 1MHPL 4H0GA 3FB6B 2FB4L 3WO3B 1NUNB 1QFPA 3IDXH 3GMMB 1G7HB 4OGAD 3BJLA 5IHLB 4Y16A 5MEQA 2H9GA 1GOGA 3FRUB 3DO3A 1MCJA 1MFDH 5GS0C 2NY0B 3B3IB 4LAJH 2Y36H 4YQXH 3N1PC 1FZOB 2Q8BH 4KI5C 4E0RB 2Q87A 2NR6D 2I9TA 5HHMD 4TUJB 3L1OL 4ALAL 2OMBA 2P5EB 5KJRL 4P0DA 1MCOH 4MXQD 5BCAA 3RWEB 3DTXB 4Z7VF 4JKPL 3BX7C 2Y4SA 4HJJL 5CJQH 5IB4A 2BHUA 1BHGA 2HTKC 4S1SH 5K59E 2DOCA 5DJAA 2VDKH 4RGNC 4GRLB 2HKHL 5KSAC 2RCSH 2C1PA 4EXPX 1BM3H 3GSNL 1UM4L 3THML 4BM7A 2PTVA 3QWRA 3RWDB 4U6XB 4EIGB 4ETQA 5I8CA 4LPUA 3ILQD 1P2CA 4X9FA 5I1KL 4P4KC 4XPGH 2V2TA 3PNWB 5IT2H 2IAMD 5IMKA 1I75A 4D8PB 2YWZA 4P46D 3B9VA 4J3XA 1CD0A 4NO5A 4YXKL 2CSPA 1VACB 3VFUB 3MRLB 1CFSA 5D1ZC 6FABL 4UAOB 5KVEL 4RDQF 1BOYA 3VXSD 2AJZB 5DO2C 5IB5A 1FJ1B 3QIUC 4KWUA 3WKML 3IFNL 4MNHB 4YE4L 4WDIA 1UXSB 3BP7A 4S10A 5HDQH 1A3LH 3ME0A 3OZ9L 2VDNH 5E56A 4F3FA 1GL4B 1F4YH 1VFAB 3QH3B 5CHNB 4ZUVB 2R4RH 3D0LB 3HAEA 3B9KD 1E4KA 5IV2B 1M05A 2MSPA 1CDGA 3VU2A 3WLBA 4LQ1A 1JV5B 1WIOA 5D7SH 3GBMH 4PG9A 2XV6B 1PEZA 2GJ6B 3ARZA 3FT4A 3JZ7A 2VXSL 4JFZL 4Q6IC 4Y5XA 3CFIC 3VGAB 4ZFZB 1IGJA 4MA1B 1T83A 1IAOA 4LIQH 4WU7A 4X4XA 4K07A 4MJ4A 4FS0A 1JFQL 5E00A 3W9EA 1YN6B 3D3VB 4MCZA 5DJ6B 3PGDA 3HI5H 1NGQH 15C8H 1YEFL 1O7VA 3BWUC 1GZQA 1MCCA 1OTSD 3PV6B 4OFIA 3BP4B 3SGKC 1I4FB 1QVOB 1T0PB 4R0LA 1DVFD 4KROB 3ULVC 4PJGF 5C0GB 3VXUB 4HCRH 5TF1H 4UBDC 4NHUA 4ETYA 4U6YB 5BV7C 4OKVA 2XRAH 4HUXA 4CVZB 5DDHA 4OCNC 2X4PA 3RWGB 5FGRA 4PRNA 4MZ2A 4H8WH 3QDME 3RVXC 1I9EA 1N59B 1MJUL 2YD5A 3GHBL 4LHUG 3IKKA 4ONFH 2IQ9H 5TFSL 3ZO0A 3Q6GH 4OLWL 4GG8B 5C07D 1NCDL 3UYOD 2WAHA 3WN5C 1J1PH 2DKSA 3QG6B 3VRJB 4NQSB 1ZLWK 3HKFA 1FSKB 1FE8L 5JO5B 3C9NA 4WO4B 3GMOB 2WP3T 4XPHH 1R0AH 1QHOA 3W5MA 1CICB 2GT9B 1A0QL 2IBZY 3RQ3A 1F6FB 2FL5B 4AEIL 5EPMA 4EUPG 3FB7B 3VXTA 1LDPH 3FO1A 2WUCH 1T04A 2IAMA 5IK3A 4TOYL 4P46A 3HUJF 4K94C 2P44B 1OWWA 1S7SA 4N0RA 2M1KA 1UKSA 2BHZA 5L0QB 3QO0B 3I6GA 3JWOC 4HC1L 5IVXE 3QXAB 3VXSA 5A2FA 1LMKA 1U8NB 4APQD 1QLEH 4TUKL 1WZMA 2ICCA 3I9GL 5EBLA 1ZT4A 2XQBH 5I1HL 2XWJB 4PRIE 1ONQB 5IBTH 2I26N 5HYIA 3JUZA 1MAKA 3HPJA 4UOJA 4RZCA 4Z77A 1JZ5A 5F7YC 5I2IB 3B9KA 5A43C 1AE6H 4GKSB 5IQ7H 5IVZB 4F80A 5CZXD 1T0NB 2F8VA 1A2YB 4OIAA 3ZE1E 1K6QL 4WWKB 3HI1A 1CGTA 4FQ1L 2PCPA 4QXUL 2VJXA 4JFEE 5AZEH 2PUQT 2V5SA 3S36H 1KXTB 3VFNB 4UU9A 1IQDA 1CFBA 3O9WD 4Y1AE 2AS5M 1X5FA 3DUHA 4K8RD 4RFNC 4LLVB 1A7PL 1MQKL 3VRIB 3L5HA 5EZIL 3P11H 2PYED 1H3PL 4ONOA 4HFUL 1VCAA 4HF5H 1FHGA 4NZDA 1JZ8A 4UV7H 3P4NB 2VDLL 4XBPA 2FATH 1NCCH 5D8JL 4NQVA 1BJ1H 4XBGA 4U6HA 2FO4A 2I25N 4G6MH 3D69B 4CADB 5C0EB 4W6YB 5D9SA 1CLCA 2XN9E 3BW9B 1A4JB 2VSDA 3AUVA 4YZFE 1ZSDB 4BZ1L 4DOHE 3ARBB 3QT2A 1HHHA 2ZCHL 4N8PA 5E2VL 4NZUL 1CFTA 4RMTA 5GPRA 3UMTA 3MACH 5C0BB 5MENE 1XGTA 4JFQB 5ACLA 3SDCD 3SCMC 3ZL4L 1O7SA 5CS7A 1BWWA 1GC1H 1Z0NA 3PJSA 5ESAB 3UBXA 3ARED 4K8RL 4HC1A 3VFPB 2YRPA 3W11D 3BP6A 4HIIA 3TGXA 2G5RA 5C07A 3IU3A 3QUXB 5C6TH 4BUHA 3HNTH 4LDOB 4ELKB 5ACZA 3V52L 1X6LA 5DQJA 2JJSC 5SX4H 2RAMA 2EDFA 3ULSA 4PJ9D 2E7CA 1S7UA 3AY4C 3U82B 1PX4A 3BQUC 1E6OH 2XT1B 4XNYL 3ZDYF 2ADGA 4OI7A 3GO1H 3C8KB 1DQMH 2LU7A 2JELL 1A14H 4J3UA 2YBRA 3SKOB 4HFWB 1NSNH 5AAMA 1H8OA 2BNUB 1L7IL 4NPYA 5GJTH 3VGEA 5CEXA 1SEBB 1WAAA 2E3VA 4DAGL 1QBML 3BD5A 4P5KA 5F1IA 4K3JH 4ENEC 5B8CC 2DQCL 4ONGH 1UB6B 5BQ7A 5GRWA 2AEIT 3M8OH 5DRXB 1FN4B 4LFHG 4GSDL 2ZNWA 3RY6C 4NDMA 4R90L 5ITBH 2AJ3A 2LTQC 2IH3B 2H8PA 3OKNA 1WITA 4APQA 5F8RC 3SO3C 2CRMA 4OLVL 3NCFB 1U3HC 3UTQA 5E8NA 1GSMA 1AO7B 2F53E 5FYLD 1UKQA 3LPFA 3TJHD 3RIAF 1ACYH 1WFOA 3DI3B 2OMNA 2E9IA 4MNGA 4HX1B 3MROA 4TTDC 1IGIL 4D3CL 1C5DB 5JLZB 1IM9D 3MRQB 4NUJA 3IAGC 5JUEL 3ARFD 3Q3GB 4O58L 5DC9B 1BBDL 2OL3H 2P5WB 4F57H 1J0IA 2ZUWA 2WBJA 5GRUH 1AR1C 5IOPA 3QO1B 4W4NA 5TE7H 4PJHB 3FAXA 1U8QB 1JNNL 1U8KB 4X7TA 1A6VL 3C08L 1EAPA 3EYFB 3O9WA 4FZEH 4M00A 4X6DB 1JGLL 4NNXA 3SKJH 4XCCL 1ZA3B 2BK8A 3HPLB 2PYEA 1MJJA 3VWKB 1MWAB 1RIVH 1CD8A 2PW1B 5T1DL 4EDXB 2Y7QB 2RQ8A 4I4WB 4Z7WA 4ZPVA 1TJGL 2H26B 5FYLL 2LVCA 1P1ZA 4TSAL 4NFBA 4WW2A 3WEXA 4BKLA 5E08H 1IKNC 4AM0B 5D7LE 4QRTA 3F7YB 4MJIA 5DJDB 1RZIB 1TQBC 3BD3A 4FTVD 4KRPB 1NL0L 5FA4A 1Q9KB 1Y18B 4PLKD 3QULB 4IMLB 2R4SH 5AG8A 1QR1A 1BBJB 2R1YB 5HHME 1BVLB 1P4IL 3K0WA 1N3NA 4NZTH 2DQHH 4J8RA 3SDCA 2VWEC 2R69H 1FQ9C 32C2B 5D93C 5EN2B 2ESVE 5EO0A 2MCPL 2A74A 3AREA 2VLJD 1DZBA 3VGHA 4ODUA 1PG7W 2F5BL 2X7LB 2HTLC 1LP9E 4OZGE 3AXLB 1U2CA 3B6SB 1EH9A 3QISA 4MAYC 3BSZL 5J12C 3QWQB 1U58A 4PJ9A 1T4KB 4JDVA 4RA3A 3LV3A 1MJ7H 1CZ8L 2NX5B 2OSLA 4S1RH 5FDYA 3IFLL 3QI9A 4JFDB 2X9WA 4LF3B 4PB0L 1MAML 4YDVB 4XP1H 1XMWA 4WHCA 1FDLH 4M61A 2WV3A 4PJAA 2AV1B 5CLTA 4L8DB 1U8IB 4H20L 4O02L 3VH8A 2G60H 4AY0A 4CN1A 2GI7A 5CJXA 3N9GL 3PWVA 5HPMB 4PJBA 5GGTL 3IRPX 4I0PC 1NCNA 3MRNB 1MFEL 5ITFA 3S37H 2HYMA 3BZDA 3GGWB 1M1SA 1SBSH 3R0MA 4A6YB 4QT5A 5EU5A 4JM4L 3C5ZD 1BQUA 3C60A 4TNWF 3U9PH 2R39A 3KPSD 4ISVA 4WI2A 4I48B 1TFHA 3QUMA 1B6DA 1ZT7A 4P59L 4RWHA 4FQIH 4P3DB 3ARFA 5CGYC 3A6BL 3ORJA 3CFKB 1VESA 4CMHB 3S9DB 4FQQB 1QYGL 2J8OA 1C08A 3IFOA 5ICZB 1HXYA 2FECI 3WL9B 1T80A 4C4KT 3IDXL 2H3NB 1A64A 4BJLA 1AI1H 2UV3A 2E27H 2QBWA 5DEFB 4KK8C 4O2FB 5IMMA 1EZVY 3G9AB 4I3SH 3NFPB 3TZVD 3TCXA 1FVEB 2PXYC 4IHOA 5AYQA 4I3RH 5LBSH 4LASH 5IESL 3NABL 4N9OB 4Y4KD 4PLJD 3IXAA 3RPIA 3TN0D 3U30C 1R24A 5IHZA 3O4LB 4WWID 3MLXH 1EX0A 3IS1X 4BZ2H 3U9UB 1MCWM 4FTVA 2D2OA 4ZO7A 4WHYH 4RIRA 4GXVH 1UXWA 5T1MB 2YPVL 4U1MA 5DSCB 5CEYA 4CU7A 4HZLA 2VITB 1BM3L 1NMCB 1B3JA 1SJEA 3O2DH 1SJHB 5I17B 4NKOA 5HYJD 1NBVH 4JFXB 5GGTA 4NT6B 3T77A 2VLJA 5JDSA 5CINH 1T20A 4RMRA 5HHOD 3WHXA 3RVVC 1YA5A 1X5LA 3GSQA 3MRPB 3S4SG 2HJKA 1MVUA 3CFJB 4AJ0A 4XMPL 2A77H 1CLOL 1NDGA 4PIRF 4DK6A 4DVBB 5KOMC 5ALCH 3KYOA 1YDPB 2VAAA 2HKFH 3BO8B 4PJ8D 1XF4A 3C2AL 3LVEA 5K9KB 3BI9X 5HDQL 4NCDA 4ORGA 1A3LL 5FCSH 2J4WH 1T1XB 1YPZE 1NGZB 4QRSB 4OKDA 1KENH 1KEML 3O8XC 1OAZL 5IR1A 2AK1H 5ID1B 1M6OB 1ZHNB 1I7RB 1CL7H 3UPAA 1JNHB 1EEYB 1J1XH 2AXGB 3K2UH 1NCTA 3W9DB 4Y4FD 3EZJB 2CLRA 2QKIB 4WNQA 1Q9WB 4F33A 2P24B 4AENA 1JL8A 4RQQB 2A73A 3GBML 4QOKB 5D7KE 3VCLA 4NM8H 1GHFH 3SDDC 3C5ZA 3V4PH 4M4PA 4KTYA 4YZFF 2ARJB 1VFBB 4N0UB 4KJYA 3RVWC 2XPGA 4UT9L 3QUKA 4OLXH 4CNIB 2K1MA 3KPSA 3OQ3B 2JKXA 2GTZB 1L6ZA 3NN8B 4G8FA 1ZANH 3HG1B 2YK1L 3FQTB 1NFDE 4ZQKB 2OBGA 3ARDD 4L8SB 3HI5L 1NGQL 3AB0C 2FGWL 3PWPB 3ZT6A 3HZVB 1MFBH 3BOVA 1R5IB 1TTUA 4FP8L 1E27A 3SE3A 3F8UB 3L3GB 3IDIB 4OSUH 4FQLL 2A38A 4HCRL 3CX2A 3L3KA 2YPKB 1Z9SA 3IDYB 5L88H 1MLBA 1JPSL 2NY1B 3B43A 4OF7A 1LO3H 1Q9OA 3PF2A 4Z7WE 1YMHA 4Y89A 4JPWL 3OAUH 4KRMB 1TQCC 2OTWA 5INCA 4XNMA 3RDTD 5C08D 5TE4H 2XA3A 1F4WH 4QHMB 4AL8H 3FQUA 3QEQB 5DRWB 2IQ9L 2ZUVA 1OLLA 4Y4KA 5EOTB 2H32B 4CVUA 4PJDB 3P9LA 3WIIL 4WW1A 4Y2OA 3FO0H 1J1PL 1FZJB 3TYFB 1LE9A 2XG4A 3O45B 1CG9B 4DZ8A 2YPLD 3OB0K 4JO3H 1MSPA 3K4DA 3G5XA 1Y6MR 4XPHL 5FV1L 2J7LA 3QPQD 1HI6B 3MJ7B 2Y72A 5EBWB 4KHXH 3LIZH 5C0DB 5HYJA 2W60B 3KPOA 1FFOB 3DURA 4N68A 5H2BA 1NBZB 4MCYB 1LDPL 1N0XH 2WUCL 4UT6H 3W0WA 5HHOA 4GKNB 3I6KB 4X80L 2A6JB 1IQWH 2EDJA 2J8UA 4Z0XB 4M93B 1V7NH 3MCLH 1IC7H 3IDGB 4JFHD 4F7PA 2AKRA 3O6KH 4HLJA 5HHNA 1NGWB 4GRWB 5BZWA 1QLEL 2YD7A 3ZTNH 4PJ8A 3PV7A 4U1LB 1TLKA 2XQBL 3RBSA 4LPTA 5CJ8A 3U46A 1A8JH 1R5WA 5FK9A 1FGVL 4YXHH 1U2HA 2E7LA 5ELIA 4IRZH 3OKLB 4JY4A 1QSFB 5DMGC 4CVWA 4HCRA 4UB0H 2Z9TA 5FKPA 4ODXB 4Y4FA 3G08A 4NJ9H 5HI4C 3VXMB 5D96C 2O93L 4HWZA 4N8CH 5GZNC 1UA6H 3LKSB 2F5AH 1FFPB 2ZSWB 1D9KB 1ZVHA 2X4OB 3TEUA 4JAMB 3HC3L 4YFLI 1D7FA 4RAUA 4J2XA 5F7KC 2A6IB 3S35X 3BUYA 2B5IB 4KK6D 4WEBL 1RMFL 4WU5B 4X5WB 3RBGA 4O4YH 5GGRA 3T0XA 2D31A 5DJYA 3RWFA 4S2SB 5I9QB 3AM8C 4KV5E 4HF5L 2EDTA 5CBEB 1FIEA 4UV7L 1ZGLA 3QIWB 2ZSVB 3GJEB 4YBLB 1RIUL 3BRGC 3UPCA 4Q9BA 1T5XA 3WIHL 4M1CD 3TNMA 3QDGA 4G6ML 2NY4C 3ILPA 5T3ZD 4OZGF 1ED3A 1SEQL 3IDMB 4FNLH 2XTJB 1CXKA 3VXRB 1CDCA 3STZA 2J5LC 1ZHBB 3FT3A 5SWZA 1D6VL 3UJTH 3HNVH 4GBXA 4TULH 1JN6A 3TLRA 2QTEA 2ERJB 1JK8B 1NC4A 5FHBH 3VXOA 5C08A 5MERA 5EDXA 4ZO6A 2C4FU 1PQZA 2OYPA 4K55A 4N9GB 5J57B 3U0TA 5EC1B 4QHUB 4N5UA 2VZUA 4JPIB 1SQ2N 1IZJA 4JFFB 3SOBL 1KIPB 4ESKA 4HBCH 5D1XA 2AXJA 5JW3H 1UM5H 3MV7B 2NMSA 4QYOA 4ZODA 3PWUB 3GB7A 3GO1L 5T3ZL 5MEPB 1PSKH 3FKUS 2VLJE 1NSNL 2FH8A 4MVBC 5GJTL 4DUWA 1P5UA 5D1QC 3FFDB 2IQAA 5IB3B 5T1KB 1ZKAA 3LKNA 5A40E 5FOJA 3QQ3A 5TDNA 4S1QL 4A2MA 1ZHKA 1A6UH 3M8OL 3PWJA 1A3RL 1YECH 1FFQA 3QIBC 3HMXH 4XAWH 2X1PA 3BPLC 4QXWA 3OAYK 1F11A 4XNZB 2EDNA 4KMTH 5LCVH 2WZPD 2MPAH 1AC0A 1AHWC 4XCYA 2BNRB 5BXFB 2P8PA 5IBLD 1QPPA 2NXZC 2NY3B 3TBTB 5D7IF 4WHDA 1CGSL 2P45B 3HI6H 2Q86B 4NGHL 4OF6A 1DSFH 4P23C 2ZUTA 3WIHA 1YEIH 4RNRA 2X4TA 1WZLA 3EGSA 1EJOL 4DGIL 1TVHB 1AGEA 4R96A 4JZJB 3QHTC 4ZFOB 5MI0B 2IADA 5GISH 4HGWA 3DARA 5GRUL 5EU6B 1HSAB 1NGXA 2HH0H 3FN0H 5ESQB 3ZYZA 3QFJD 5KSBF 1I1FA 2GITB 2HFTA 4OF3A 3W5NA 1NGYB 4PTUB 2WWMD 5DYOA 2EE3A 4FZEL 2X89D 2PTUA 3BESR 1AKJB 1D6EB 1V3LA 1AD0B 3CVIH 1GIGH 2ZKHH 5TDPA 4URTB 2R1WA 1EBAA 3QIUB 4QXGH 4MLIA 5E08L 1BX2B 3SJVB 5J7CC 3LDBB 1ZLSH 1WCQA 4BELD 4TRPH 4HEPG 2OI9B 3AC0A 4AYFA 3V95A 4TYUA 1KCRH 5E99L 5LQBH 4G6AD 3TPUB 1RUQH 3AAZB 3SGEI 4Z7UA 1A6AB 4PJIA 1T7WA 2R4SL 2VDRL 3QWOA 1PKQB 3M45A 3ARUA 2DQHL 2R69L 4Q9RH 3T3PE 1YPZF 4PJ7B 3LN4A 5TDOB 1YNKH 1QSEE 4GFTB 3QQ4B 4OCXH 4RSVA 1EV2E 1JP5A 3VWJC 4TTGA 4HLZG 1AO7E 1DUYA 4B7LA 3QNXA 5E4EB 1G9NC 2V17L 1L7TH 4KQ3H 2LFGA 4S1RL 4B41A 3O6LH 3OKOA 1VADB 3I75B 1U9KA 3A6CL 3PXHA 2F74A 4NP4H 1QQDA 1F58H 2HFFB 3G5VA 1F2QA 3T0ED 4XP1L 3FTGA 4G6JH 3IDUA 1FDLL 3GMLB 3UXFA 2P1YA 3QHFH 2IF7A 1ZHLA 2MOVA 5I6XC 3S88H 3M1BB 4NO2A 5J56B 3BWAB 4NO3A 3ZHKA 1I85C 1C5CL 1NCUA 3CNKA 5MEOA 2EE2A 3MLWL 4DKEL 5E9DA 4JQVC 1U95B 1IAII 4DEPC 4JN2B 2RFXA 2UWEE 4NRXA 1T66D 1XCQB 3SQOL 4X83A 3O4OB 2GEEA 1SBSL 2CKBH 1JUFA 1LO0H 5F7NC 3VJ6A 4RRPG 1QD0A 4P9MH 3H9HA 4ZSOA 3U9PL 5JXEC 1NEUA 3KLAB 3MZTA 2C3HA 2EO9A 4IRJD 5TQ0L 3ZDZE 2BSSB 4UILH 3MXWL 4YHYB 1MEXH 2R2BA 3KXFE 3ARWA 5E8OA 2PO6A 1CVSC 2V2XA 1DCLA 3V0WH 2W9EL 4NQXA 2M2DA 4F7MB 3QFJA 5IMLB 3K80A 5F89B 5SWSB 5K9QG 3MFFB 1NCAH 2XFXA 2DN7A 3VDCA 4F7CB 4I3GA 3D0VA 1PLGL 1QNZL 3MO1B 2X89A 4LHUB 5FFLA 2E27L 5GS1A 1HSBB 3TBSA 3DXAB 1SYVA 1SBBA 2FH6A 3CSYA 3RIAK 3BN9D 1YEHH 3QNYB 2VL5B 2X4SA 1HHKA 2IFFH 1CT8A 5I73C 2F54A 1JGEA 4JRXD 1DQJA 1KJVA 2ZCLH 4XWGL 3V4UL 4HWEH 2V7HA 5EZOH 5HYSG 2NX5E 1WK0A 5CUSL 1E4WH 3BIKA 4JFDE 1S7RA 4EUPB 4IBLT 5KS9B 2X1WL 4OZ4B 2EH8L 5EZLB 4EN3C 4V2BA 2HTKD 3O2DL 3NFNA 4PRDB 1NBVL 2BVQA 5KSAD 1AGCB 1CLYL 3E0GA 4OTXL 5BVPH 1JGDB 1F4AA 3HZKA 3WFDH 1EPFA 1GAFL 4O5LH 5CINL 1JGUH 4JRYB 1RHHA 1L0XA 2YPLE 3C8DA 1LO5B 1MHCB 1W0VA 4KQ4H 3QAZB 3WFCH 4CUCA 1C5BH 1KCVL 1Q8MA 2A77L 1T1ZB 5FB8B 4P4KD 4POYA 3IGAA 4H1LA 1Q72H 2Y6SD 4I5BA 1KLGB 3ZKSD 1XF2A 3ECBB 3GI8H 3U0WH 3N1MC 5D1ZD 3T0EA 2UZXB 4MXVE 1XH3A 2GKIA 4WUUB 2DQTH 1QLRA 4M3JA 1RVFH 4G43B 5DO2D 2AK1L 5CEZD 4LRIA 5BJTA 2E7HA 4ZAKB 1NFKA 1CL7L 2IBBA 4DGVH 3CSGA 1J1XL 4JFHE 3K2UL 1P7QD 1HINH 1UZ8A 4NN7B 1OSPH 1BZQK 4FQJL 5I19L 1IAKA 3BKJH 1VB9A 1OL0A 3F7QA 4FXKA 4NM8L 1GHFL 4OV5B 3WDHA 1F2XK 3V4PL 3T65B 5J6GA 5FUZH 4WFHD 2NNAA 1XR8A 3E8UH 2EXYD 4OLXL 2OQJA 1QRNA 4U2ZA 3RGVC 4X9HA 3M17B 3DUUA 4D0CB 5J0BA 1ZANL 2D0FA 4K9EC 4U1SA 1MWAH 4LSTH 2VDOH 3O4LE 3PWNA 2K7QA 3UTOA 4R2GB 4R7NA 2WLYA 2GFBB 4G8GB 3D9AL 4ORZC 1S5IH 4PRHB 2DQJH 5C86A 1A7QH 4N5EC 5E0QA 5CEZL 1J5OH 3IAPA 3O2DA 1AP2A 4XPTL 2HT3D 4LVOC 2YN3A 2VABB 4KTDL 3REVA 4XMKH 5C0CB 5L88L 5IFJA 4Z7QE 2WUBL 5KVFH 1LO3L 3VI3E 3REWA 2CO7B 1S9WB 3LRGA 5GGSA 4OZHA 3U2SB 5JNYB 3IT8D 1WZKA 1P84K 3ULVD 1UGNA 3WFHA 2N4IA 2ADJB 4HK0A 4JM2C 4TNWK 3S5LA 3QUZB 2ZCKH 3RL2B 4LNVA 2X4QA 3KPTA 3VD9A 3IETB 3GSWB 2YEZA 4I77H 5JIKA 3SE4A 3TESA 3RTQB 1KIQB 2XY1A 2Z92A 4OM0H 4CMMB 5T3ZE 3OXSA 1HHGB 1KNOB 1RUPL 1JHKL 3OHXA 5KSVB 3EJJX 1K5NA 1F90L 1FBIL 3RVXD 4RMUA 4IOSD 4ODTH 4YHZH 4G9FD 5GGSY 1WQVT 1CVRA 2DKUA 5FIEA 4NC1E 2H1PL 3MODL 1EUUA 4DFHA 2O61A 1BIIB 2IG2L 2DJ4A 3EDFA 1UVQB 1HOCA 4KHXL 4XVTH 2DF3A 4LLUA 2Q1EA 2ITDB 5KSAA 3C6SB 3QXWA 1KEGL 1WUNT 1X44A 2XZAH 1E4XI 4M6ML 4TNVF 3QPXL 1JNLH 3MUJA 2XKUA 2IALA 3EOBB 4FXGB 4QOKE 3H9SD 1WT5A 2A6DA 2DS4A 3D2UD 1H3XA 3JBG7 5I8KH 1WEJL 1IC7L 4JQXC 1U92B 4P4KA 3FQNB 1I7TA 1CD9B 1FFRA 1LEKB 3CAFA 4A6YH 4ODVH 1LK3L 4JJ5B 3HG1E 2VN7A 2P5ED 4BQ6A 4KAQL 4YXHL 1FV1A 3PDDA 4IRZL 1U8MB 2NTSP 4HK3N 5IWLA 3L3HB 3N85H 4PJXB 1KTDA 4OM1L 3S8WA 1BZ9A 3MC0A 3D25B 4NJ9L 5J11B 4HKJB 4JFYA 5CBAA 4WI6A 3IU4H 5EOQH 4N8CL 2O26U 1V7ML 4ZSOE 4MQ7A 3F65A 2OLDA 1B0RB 5FYKD 1QFUH 2EYRB 2DBJA 1J05B 2V5YA 2ZOLB 3ZYJA 4JLRB 2UVFA 1RZKH 3Q1SH 4IRSC 4YO0A 4OLYL 5JR1H 3QEQE 5GZOC 4LSUL 4N0CC 2YC1A 2X4NB 3K1KC 5BW7A 4P4RB 3BEVA 4K94L 4XPAH 4MDIA 4U7KA 4UQ2A 5M7QA 3WD5H 2ZOKA 4UI2A 3QFJE 3T3PF 3I85A 3CFBA 2UYLA 5J3HD 1ZGLP 5DMIH 2Z35A 3JWOL 4QRPE 1X4XA 5IM7B 3NIDF 2FEEI 3EDKA 4FFVC 3INUL 5DJCB 4XNQA 3MGTB 3RWJB 3GIZH 4M8QA 4F58H 4NRYA 1IM3B 2DMKA 1MI5D 2ZG3A 4QO1A 5AZ2L 4QRUA 4CVXA 1BAFL 4PJFE 5D72H 4Y2DC 3MRBB 4QY8A 3F6LA 5C09D 3IJSA 3P9MB 3SDXA 3ZTJG 4DZBB 2Q8AH 3UJTL 1MRCH 5DK2B 3KPLA 1PG7X 4TULL 3RP1A 3H3KA 5F70A 43C9A 3I84A 4MLSA 5DQDL 4D94A 3P73B 2AXFA 3EFDH 3O3DA 4C83A 5FYKL 4FOMA 2DWEA 2GSIA 2HRLA 1MCQA 4YXLH 1S9YB 1MJ8L 3FRPA 3L6FA 5CD3A 3D39D 4HS3A 4J1UA 1CE1L 5E8PB 2W92A 3SCMD 5LJYH 1FYHB 4PJHF 3WIFA 4B0MM 2Z8RA 2GJ6D 1AGDB 1CXEA 5B22A 3GSOA 1J87A 3DRTB 2UWEF 2VR5A 4HBCL 3ISWA 4OGXL 4YNYA 4U0RC 4PRBA 4EI5C 1UM5L 3D3VD 1OAYL 4ZUUB 3WN5A 4OD1H 1WFUA 5HY9A 3MV9D 2VIRB 2CJUH 3DWTA 1NDMA 2GUOA 3QSKB 2FNBA 3QFDB 2BRQA 1ZVSB 4FN0A 4QF1B 5F6IC 1N64L 3LEYH 5FO9A 2VR4A 3G6DH 3ZDZF 5A2IH 4YLQT 3FB6A 2Q76A 3ZSSA 3DV6B 3PGCA 4MDJA 3VXUD 3GMMA 2C4XA 5FHAL 3DX7B 3HMXL 4XCNB 4XAWL 3WHE0 4Q58C 3D2UA 3UTPD 3ZKMC 4YPJA 1I3RA 2FX9L 2ZUQB 3FRUA 3R06B 4G3YH 5LCVL 2SEBA 1HHIA 4HIHB 1LEGB 3U6RB 3HE6B 1I3UA 3V4VH 4UQ3A 4ZUSA 2IANB 4Z95L 4FQXC 4E0RA 4W6XB 1DSFL 4I2XA 5CIPA 3V5KB 5FOBA 2P5EA 5DQ9A 1I9JH 4LLWB 3MCKB 3RWEA 4AT6B 3EFFB 2FJHB 1FL3A 1U3HD 5DA0B 4NUGH 3U7YH 1G9MC 1GPOH 5FM4A 1AIFB 5ID0B 1T2QH 3OXRB 1FO0B 1I8IB 3FN0L 4IMKA 1OAXH 4WO4D 4ZDHB 4TTDD 4IOFC 4U3XA 5D6CB 4XNXL 3EDEA 4W4OA 3DGCR 2C26A 5CMAB 3RJDA 1CICD 1Z2KA 4U6XA 3QP3A 4Y16C 2W9LA 2Z31B 4M7ZB 3U0PA 4QHNB 4ODHL 1AR1D 1DUZB 5JW4R 4DVRH 1NLBH 1CFNB 3RL1B 2R2CA 1VPOH 4OFDA 4GMTH 3NCYS 2EYSB 2FIKA 2IPKB 4XPFL 1TCMA 3MRLA 1ZEAL 4QRQA 3IJYA 3RWIB 4LK4A 1ZOXA 3QDJD 1T3FB 1BGXH 5F7EH 2H32H 4Z8FH 1R3JA 2AJZA 1P7HL 5LQBL 1FJ1A 1RUQL 3P77B 1MI5A 1UXSA 1FORL 4HKXB 1X9QA 5CP7B 1PY9A 4BSVB 5EUOB 5C09A 3G9VA 4E41B 1U41A 1QACA 3TIDB 1I3GL 4Z18A 3QH3A 5CHNA 3RWCB 4ZUVA 4XWOC 3UPRA 4X7DC 2WM0A 3D0LA 3S4SB 4ELMB 4M6NL 3HMXA 1KPUB 1E28B 1YNKL 3NCYP 1SY6H 4JRXE 4FG6D 2HLAB 3D39A 2AQ3A 4KI5E 5HHPA 4LCIH 1KC5L 5E1AB 5FCUL 5F7LB 3SCMA 1PZ5B 1JF5A 3L3JA 2GJ6A 3V5HB 4CDGC 2XACC 3AB0B 3DYOA 1JPFA 3FT2B 4IIQB 3T08A 3LY6A 1L7TL 2OK0H 5ESVA 5E2JA 1G7JB 4RGNE 3BH8A 1YN6A 5JQ6H 1KTLA 1BD2B 1FVCA 3D3VA 4GRWH 2HTLD 2YRZA 4NP4L 4MAYD 1NH6A 1Z6JT 4LARL 5C70A 4OT1H 1MFCH 4JY6A 3AY4A 2WBWB 3VFGH 1UCBH 3BP4A 3S88L 1YJDC 4PGCB 2PN5A 1RK1B 3GMQA 1AQDA 3VD7A 4JKMA 1KBGL 4GG6B 3KYNA 4X4MA 5C0GA 3VXUA 5T5FL 4GKOA 3BT2H 4U6YA 1IC4H 5DD6B 5D2NB 1OB1B 3RWGA 2V2WB 5C0BD 5I8OL 1I1YA 5B8CA 3DV4B 1FPTL 5I18H 4Y5XC 5KVDL 1R3HA 1LO0L 3NVQA 4K3DH 4PLNC 3DMMB 4P9ML 4I0PD 2PR4L 3VI3F 5I15L 3RY6A 5JQHC 5FAAA 2DM2A 5IFHH 4ZD3H 1EEQA 3MRDA 4CGTA 2HJFB 2VQ1B 3SJVE 4OD3L 3QUXD 3OV6A 1U3HA 3ULUC 4XB7A 1WJ3A 1SMAA 4NQSA 4L9LB 2AV7B 1MEXL 3WFBH 1R3IH 4DGYH 4WO4A 3GMOA 4R0LC 4Q9CA 3F7VA 4WFHE 2CGRH 1W0WB 4A2LA 5DD5H 2D03H 5CGYD 1CICA 2GT9A 1J8KA 4F2MB 4RGMB 2FL5A 3LKQB 3VFRB 3BIBX 4UUJB 1GGUA 3FB7A 2DJSA 5GQBA 1C7TA 1FH5L 1PGRB 4HULB 4IOIB 3BPNC 4BUGA 2F9BT 2X10A 3NH7H 3NOIA 2BXYA 4LCWB 4P5TC 4YFEA 4XGZB 1H15A 3QDJA 5CILH 3R8BB 2PXYD 2ZCLL 1XZ0B 3D85D 5F88B 5ICYB 3I3EA 4JG0L 2HP4A 3LEXB 3FQWA 1FVDA 2VLMD 1A6WH 3ULVE 4U3HA 4LSPL 4KZEL 4JQIL 3C6LB 4NWUH 4WY7H 5A16B 3ARGB 1XF5B 2RIKA 2CDGA 3NMEA 3LHPH 4KVNL 5I2IA 3ILQC 2AJUH 1HKLH 4X7FC 1AGFB 4GKSA 1DLHB 1IGCH 5BOPA 2P5WD 5JHDE 1T0NA 5E5MA 1EERB 2FO1A 3SGJC 4G9FE 1A2YA 4GW4A 1JGUL 1BEYH 5FYJH 4XNUL 1KCUH 4KQ4L 2BY0A 3T8XA 1TZHB 1RJYA 5F9WC 5D7JB 1C5BL 1WLHA 3TBYB 4LLVA 3CVHB 3I50H 2NPLX 1A1NA 2Y06L 3VWKD 3MOAH 3RVVD 1JNJA 4LNRB 1Q72L 5E8EB 5FUOH 5H35B 1SHMA 3S3SA 1AD9A 3DECA 3MA7B 3P4NA 4MAYA 4EKXA 5DHVB 2VC2H 4NNPH 5C9JB 1N5AA 3OG4B 2DWDA 4OI9A 3VFVA 3LS4H 3H9SE 3B9KC 1JRHI 1HDMA 4J23A 4PJDF 4DGVL 3D69A 4CADA 5C0EA 5CSGA 5B38G 2Q7YB 1RZ8B 4X6FA 3T2PA 2VLKD 3BW9A 3OAZH 5D2LA 1A4JA 1OT1A 1XR9B 4KI1A 4O9HL 3ARBA 1IL1B 5B39A 3O8XD 3JV4A 4OF5A 4U6VH 5C0BA 5MHSD 4I2XE 2W59A 5GRZA 2EE9A 5DURD 4PJFF 4BQBA 5ESAA 4I0PA 1MFAH 1AFVL 1VGEL 3RNQB 4XCFH 3LN5B 4KDTA 2NCMA 3VFPA 3BP5B 1UC6A 4MD0B 3RZCC 1UH2A 4N1EA 4HXAH 3L7FB 3QUXA 1MWAL 3SGEH 3R1GL 5BVJB 3SDDD 5E03A 2CDEA 5FA3B 2QEJA 1S5IL 1UEMA 2DQJL 5EU3B 4GO6B 3VMPA 2DQGH 4LU5H 5DR5L 3AGVA 2FJFB 4YX2L 5I0DA 4HFWA 4PJ5B 4K7PX 3DHMA 2BNUA 1UQSB 5EIIB 2FR4B 1EVUA 4I18C 4U1HB 4E42B 3QQNA 5F9JA 1OCWH 4YFLF 5DRXA 3GKWL 4K71B 4HH9B 3K8KA 5I75C 2ED8A 4K7FA 1DBAL 2FZ3B 1JPTH 2IH3A 3IKCB 1T03L 2PXYA 4YHZL 4EOWL 5C09E 1KN4H 3G5ZB 2CIIB 4PY8J 4XI5C 1IFHH 1ORSB 4EBQH 5K93A 1Q0XH 2OS7A 3MRCA 4G9DB 5KANG 5SWQB 4G5ZH 1C5DA 3CXHJ 5JLZA 3WNOA 1WC7B 1HNGA 3MRQA 4JCMA 2HN7B 2V9TA 3C09B 4OCYL 1UH3A 5KAQF 1ORQB 3LQMA 1IAIH 3D39E 3JV6B 3Q3GA 4LAQH 2P5WA 2XZAL 4X6EB 4RFEB 4GLRI 5E8DH 2KPNA 3QO1A 1YEJH 5HVHC 4PJHA 3HS0B 4L3EE 1U8QA 4NQEE 2EIEA 4J6RH 3GM0A 3H0TB 4JDTL 5HBBA 4ZO9A 4HMDA 1Q1JL 1MCFA 5HGAB 3HN3A 3EYFA 4YPGA 5I8KL 4F7EA 3SE8L 4X6DA 3MV9E 2EXWC 1ZA3A 1BZ7A 5BS0B 3HPLA 3VWKA 1MWAA 3LD8B 3GSUA 1XGRB 1G7QA 4LMQE 4I4WA 2X4UB 5IFAH 1P7KA 3KR3H 5CJ5A 4UDTB 4MX7B 4HIEA 1T7VA 1VEPA 4H88H 3PL6C 4N1CA 4AM0A 3NPSC 3E6FA 5KOVC 4QCIB 5CWSB 5DJDA 5BMFH 4OJFH 1AXIB 3KPPA 5JA9A 1D5MA 2VLKA 2WBJC 3NZHL 4GAFB 4QRRD 1LK2B 5IBUB 3AU1B 1Q9KA 1Y18A 3WSQL 4IMLA 4U1KB 1JCKA 1TITA 1D5IL 2FX8L 3O8XA 1FGNH 1BBJA 3IU4L 4UDUB 5EOQL 1RZFL 4YH6A 3GIVB 5DMGD 2P47B 5I1IL 4YHKL 4L3CB 4K8RC 1QFUL 4JGJA 5EN2A 3BKCH 3WXWH 5HI4D 2X42A 5T1LB 3MNZB 1RZKL 4HUVB 4NKIH 4HZAA 4LGPB 4EI6B 5JR1L 5GZND 3RY4A 2VISB 4N1HB 2X7LA 4XTRC 4WW2C 5A2KH 3GSXB 2VZVA 3AXLA 3B6SA 1PDKA 2BJMH 2VLRB 3V6FB 5DMIL 3OF6D 4KI5F 3RIFF 3ZZ1A 4OD2B 4NQCD 1C16B 2V9QA 3O2WH 4F58L 4Q7DA 1DBKH 1YYML 4LF3A 5D72L 1N2RB 5IGXH 5DD3L 4EUPH 3SDCC 2NY4D 3FCTB 3RAJL 4RBPK 5HI5C 1U8IA 4NNYB 2VUOA 2LQRA 3QDJE 1KSRA 5JXAH 4YHNB 2QR0B 5HPMA 3AS2A 1TJHH 4OCSH 5AG9A 1CR9H 3MRNA 5JOFB 3MRHA 1VFOA 2JIXD 4MXWL 3JWNC 4U1NA 1OAUL 4WEUD 1P53A 4A6YA 5ILTL 5EUKA 1UEYA 4NQDB 4K23L 3T4AB 3PXJA 2NTFB 4Q74A 2DL9A 4HWBH 4IJ3B 5B3NA 2NLJA 1TZIB 2CPCA 3QI9C 4I48A 2DBLH 5J6HB 2VDPH 4LLYB 4OD1L 3V8OA 1I8MA 1YY9C 2XA8H 3L3DA 5EO1B 2DTSA 4FQQA 4U1JA 2VWEE 5F1NA 1ZA6B 3LEYL 4PP1D 1RU9L 5HDBE 5ICZA 2EDXA 3BH9A 3PIQB 4P2QD 1KYOK 1TZGL 2H3NA 3DETC 5GRJL 5KTEH 2NY1D 4KJQC 2DQDL 4G3YL 4O2FA 3QJFB 4I0CC 4XHQA 1FVEA 2BSTA 4LEOB 1J8HD 2I07B 3C60C 3QIBD 1KULA 4W6WB 4AEHH 2R1XB 3ZYOA 2DQIH 2IPTL 3S96A 5GGVY 2NXZD 1U91B 3U7YL 3MUGB 1HIMH 4G6KL 2W0LA 2ADIB 4TNVK 4P23D 4QRRA 5T1MA 1OAXL 5GS2H 4LSVH 2VITA 5HVWA 2BP3A 3HFMH 4GXUN 3ROOB 1SYSB 5K9QI 4ZTOL 5JIIA 5DJZB 3V0VA 3ULVF 5I1CH 3S35H 2JK5A 4YGVB 3DVNB 4DVRL 1KV3A 1NLBL 5IJKC 1YYLH 1H5BB 3P0VH 4U1IA 3UAJC 3TV3H 3HZYB 1VPOL 3MRPA 2VAJA 5HYSB 2NY6B 4WHTB 5HPOA 1H3UA 1GOFA 5EWIH 1RK0B 3VFTB 3OF6A 4JO2H 3O6MH 4JO4H 5LG1A 5F7EL 4Z8FL 2DQUH 1YNLL 2AEQH 4NQCA 3OKMB 2A9MH 3AM8A 1P4BL 3BO8A 5T3XD 5K9KA 1NBYA 1XGUB 2I9LB 1PJ9A 1E4XH 1GGIL 3VFOB 1T1XA 4BZYA 1BQHB 1YEEL 2YD6A 1NGZA 1A6PA 2D7PA 3F62A 4NC2B 3N0PB 4BFIB 5IW6A 4XX1E 1M6OA 3SBWA 3HZMA 1JNHA 4KPHH 1EEYA 4PJCE 5C2BL 2AXGA 3EUUA 4FQHB 2PF6A 4Y5YB 4M1GL 3W9DA 5GSRB 5D71H 1C8PA 1SY6L 2QKIA 4NBYB 1I8KB 4XXDA 5DJ8B 4BK5A 2P24A 3VXQB 2F19H 3RGVB 3TT3L 2JIXA 4O00A 2R0KH 5D4QA 1U8HA 4ZYKA 2BVUA 5CP3H 4ZO8A 1F4XH 3MLUL 2IPUK 2ARJA 1VFBA 1MVFA 4KKCC 2IANE 3KDMB 2D7MA 3E3QC 2IBZX 2EDLA 2OK0L 4W70A 4L29A 4WUKL 3WE6B 3NN8A 1CXHA 3FQTA 4ZQKA 3SHSA 3VWJD 3L7EA 5T3XL 2P7TA 3PWPA 4X6CA 3HZVA 5B4MC 3RRQA 1OPGH 4WI4A 3BZEA 1MFCL 4PY8I 3FFCD 1UCBL 4OFPA 3S34H 1Y6KR 3GJFK 4P2QA 5J1SC 3IDIA 4MA7L 4NO0D 1J86A 2J6EL 3H7BB 4QKXB 3BT2L 2YPKA 2BOCA 5K9OB 1IC4L 1ZLUH 1N5YH 1A9EB 1UWGL 2GW5A 2I27N 2X4RA 1KLUB 4UINH 2N1KA 5LWYH 3C5ZC 1DP0A 2R0WH 4JFPA 4R4FH 3L95B 3WFEL 3QIBA 4N8VA 1W8OA 3B4NA 2R56H 4QHMA 1I1AB 3ZKXB 2WIIA 3W81A 1BFOB 4DQOH 3DVIA 4AMKH 3H8NA 3B2UC 3CXDH 1A7OH 1HILA 1O0VA 3MV8D 3EOAB 4D0DB 4RWYH 2IPUG 1EXUA 3TYFA 3H42H 1CG9A 1PEWA 4HS6A 1KFAH 3TF7C 5CZVH 4PB9H 1K8IB 1HE7A 4YC2B 5TGBB 3MRJB 2MWCA 3CU1A 1G9NL 3JTTA 3SE3C 3B9DA 4JZNA 4LHJB 4MQTB 4WTZG 5DJ0B 5EUOE 1DN2A 2UVEA 3MV7D 5FECB 2PW2B 4PV8A 3LQAH 3P2TA 2EIZA 4J3SA 4Z76A 1CDUA 3BPOC 3RJQB 5F7UA 1SY6A 4XVSH 5CGTA 1AGBB 2X5PA 1TTFA 3FONB 5IVOA 5HHVL 2ARWA 5IB2B 1TNMA 5T1KD 4GKNA 2A6JA 5L9DH 4EZMA 4LLDB 2YD3A 4Y4KC 1NAKH 2NXYC 3SDAB 4RMVA 3CLEH 4OLUH 5EZJA 2DTML 4Y7MA 5DEGB 4TPRH 1B9ZA 3FHAA 3KJ6H 1NCBH 3T2NL 1RJLA 2CXKA 3BN3B 5B21A 4U1LA 3T3MF 4OFYD 4PGBB 1A6WL 1HN1A 3DBXB 4WY7L 1N4XL 2PTTB 4P99A 2FBJH 4WFFE 4WTXA 5E6YA 3OKLA 4ZPTB 5DI8A 2X9YA 1QSFA 2AJUL 1AXTH 2J6EA 4X7EC 1UH4A 3PQYD 5I8EA 1RD6A 4YIQB 3EYVA 1WSST 4GT7A 1BEYL 3LKSA 3FB8B 1FFPA 2ZSWA 1IGTB 2FDBP 2X4OA 4JAMA 2B2XH 2ZP0T 5DS8B 2Q6WB 4R8WL 5C7XH 4WU5A 5DT1L 4U3CA 2A2QT 2CLZA 4GAGL 1P69B 1AJ7H 3MOAL 5DUPH 4PJ8C 2VYRE 3FO2B 4S2SA 2AJVL 1FFNB 1OF2A 3VWJA 2ZSVA 2P4AB 3MRFB 3ZMRA 2EKSB 3DSFL 4JGMA 3RUGA 3FFCA 4PUBL 3LS4L 1O5DT 4CAGA 4XVUC 2ATKA 1GCFA 5CJBA 4YWGL 1ZHBA 1NAMB 3QRGL 4H8WC 1FO0H 1K2DB 3D5OF 4LVNB 4PTTB 1I85A 1ZWIA 4DW2H 4LSQH 5L7XH 1DN0A 2BY1A 3V6ZA 4I0KA 1W72L 4NYLA 1B0WA 4DK3A 1TCRB 4XCFL 1JF6A 4LCWE 3GHEH 4YHIB 4QRRE 5IVXB 4GW5B 4HIJA 4JPIA 3O6FB 3BHBA 4G42A 3TNNB 4WI3A 1KIPA 3IFPB 2I24N 4L4VE 3BGFC 2EYTA 2GJZA 3MV7A 3TYGH 1CK0H 4OUUB 4X5XA 3MLYL 3PWUA 4HV8B 4X7SH 5MEPA 5D6DA 5GJSH 4LDEB 1MPAL 4DKFH 5KG9B 4G80A 2R9HC 3UTSB 4GBXC 4PG2C 4YHMH 4ZXBC 4YHPA 5IB3A 5T1KA 2DI9A 2YA2A 3EO0B 2AJYH 2MKLC 4X7CC 4F15C 1OCWL 3CK0H 3X14B 2ID5A 4PJXF 4EJ1C 3HE7B 4NQCE 4JFEB 2HRPH 4TVSa 4FQ2H 1JPTL 1K4DB 2X70B 4UMGA 4Y1AB 3UTZB 3GBLA 2C9AA 4JM2D 5CJOH 5BXFA 3TBTA 1YQVH 4ODBD 4R7DB 4WI5A 4OFYA 1IFHL 5D1XC 3VG9B 1HWGB 5JW4N 1G7IB 2W65A 4MSWA 1HYRC 2HMID 3RKDC 2J3SA 4K9EL 2D7TH 2AGJH 2YS4A 5I1EH 1TVHA 1J0ZA 4XPBH 4LCYA 3PQYA 4BH7A 3QXDB 4UNUA 1RZJL 5E2UH 5E8DL 3FB5A 1C12B 1YMMD 2XN9B 1HSAA 2AJXH 1EK3A 2OTUB 4ZUTA 1MNUL 5HYEA 2GITA 1UB5B 5SWSD 4NN6B 4DOHB 3QHZH 4HS8L 4J6RL 1V3MA 4H26A 5C0AD 2JJTA 5MENB 4PTUA 4OBRA 2I9TB 1VKXB 1HQ4B 1W72A 5GHWH 1FYTD 1KLFA 4WFGD 3OBAA 1AKJA 3NCCB 4R4NC 1F3JB 3NAAH 4ZOEA 1DR9A 1HWHB 2O5YH 1J12A 5F9OH 5IHUH 3KR3L 1NANI 5DJAB 3NTCH 1F8TL 3ZDXE 3UYRL 5BZDA 4H88L 4UTBL 1JHLL 2C1PB 3OGCB 3A67L 4GW1A 2X40A 5ICXA 3WJLA 1GGCL 1CE6B 1NFIA 1A6AA 4OBSA 2VB5A 5GGVH 3IF1A 1J1OH 3G6JE 3BE1H 1OY3B 1LO4H 2X2YA 1FGNL 4KKBC 1J8HE 2QADB 1BFSA 2B8OT 1GGYA 5I30H 1PKQA 2KL6A 1GC1C 3VD3A 4KK6C 2CMRH 4P2RD 5HGHA 3BKCL 4PJ7A 3V5DB 4Z7NE 5L2KD 3CPLB 4G6FB 1X5AA 3ROLA 5IB5B 3QQ4A 1FNEA 4PJCF 3RU8L 4WDIB 4M7KH 1CWVA 4U7MA 2VXVL 2G9HB 3PHQA 4NWTH 2F53B 4M1CC 4WI7A 3SKNA 1IARB 4F3FB 2P8MB 4IRSD 4KHTH 4N0CD 2J8HA 1KUMA 3BAEH 3LZFH 1EZVX 2HFFA 2E8YA 1NGPL 3TH2T 5IGXL 2ZPKL 3WLBB 1INQA 3NFSL 4WUUD 3T1FB 4P48A 1JF1A 3L5IA 5KN5A 4FFVD 2N56A 3F5WA 3M1BA 3BWAA 4KK5C 4ZAKD 4X8XA 4P9HH 2Q3AA 3FT4B 1S8DA 1K3ZA 1IGJB 3RI5F 4YR6B 4Y2DD 2IH1A 4WU7B 2RR3A 4X4XB 3IRZA 1TJHL 4JN2A 1HZHH 3GMRA 1FAIL 5DGRA 5E00B 3MLVL 5T3XE 5D5ME 4MCZB 4JM2A 3LEVL 3PGDB 4TVPH 5FO7A 5EOCJ 1V5JA 5E2WH