1JXFA

Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone dynamics of plastocyanin in both oxidation states. Solution structure of the reduced form and comparison with the oxidized state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Proton transport
molecule keywords PLASTOCYANIN
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxfA00
1JZEA 1PAZA 3CZUB 1MZZA 4GP5B 2UXGA 1PLAA 1ASOA 4BK5C 1GY2A 4AI7A 4KNUA 3WKPA 3IE9A 3OD3A 2TSAA 4KO7A 2EIMB 3ABLB 4KNTA 3NJLA 2AZAA 4A2FA 2YAHA 3T6ZA 3FYIB 2HLEB 1ZPUA 3WNJA 2MRYA 1NIBA 3PAUA 3OMNB 4YSDA 3S8FB 1JVOA 4G71B 4YSUA 2AFNA 2HRHA 1OOWA 4A2GA 1CC3A 2XV3A 3WNIA 1KGYE 4CSZA 3C75A 1AIZA 1M57B 5I5MA 1A4AA 3ABKB 2XXGA 6PCYA 4WKXA 3MBWB 1DZ0A 4YSOA 1TEGA 1ILSA 2DV6A 4GXFA 4E9SA 1X9RA 4DPBX 5D4JA 5B1AB 1E5YA 3T71A 4PCYA 4M3HA 4KO5A 1A8ZA 5AKRA 5B1JC 1J5CA 2Y1AA 1ZDSA 3SBPA 1M56B 4N8UA 3SBQA 3D12B 3T9WA 3KW8A 2HXAA 4PAZA 4DP6X 5I5JA 2J56A 4W1TA 2CAKA 1AZNA 1L9RA 1J9QA 3BQVA 1A4CA 2ZOOA 2I7SA 2JXMA 1AZUA 2ZXWB 4UANA 2GHZA 1WA2X 4JHVA 2BHFA 4GP8B 3N2JA 4YSTA 1JZJA 1WA1X 2BZ7A 1NDTA 2QDWA 1I53A 3UAAA 2BZCA 2IH9A 4DP0X 1WAEA 4G7RB 1IKOP 3ASNB 3FT0A 3EH5B 4A68A 2H5UA 2OJ1A 2E86A 5B1BB 2YAFA 3FS9A 6PAZA 7PAZA 2DWTA 3G5WA 2CBPA 3AZUA 1W6LA 3CG8A 3AY2A 5AFAA 1OCRB 2PP9A 5B7EA 4A2EA 3IN0A 4MFHA 1CUOA 1KCBA 4E9QA 9PCYA 3GXUB 2X88A 4FAAB 3AG2B 1CURA 4F2EA 4AKPA 3FU9A 3FU7A 2Y69B 2FT6A 3PLYA 1JERA 3TA4D 2N0MA 4ZK8A 3WG7B 1AANA 2FJSA 2OV0A 2XX0A 3PAVA 4AX3A 4QLWA 3DIVA 3HB3B 2YAPA 1JXDA 3S3BB 3SQRA 1JXFA 3WI9A 1PLCA 3NP3A 4BDVA 4NERA 1KDIA 5IY5B 3FYEB 1SF3A 2PP8A 2H3XC 2HRGA 3NJIA 2VMJA 2YAEA 1ZDQA 1GS8A 2FNWA 3T6VA 5I6PA 4YL4A 1DYZA 4YSAA 1AS6A 2IWEA 4DPCX 1CYXA 1ASPA 1V54B 4WTQA 3X2QB 3FSAA 4YSSA 3UGEA 1XB3A 3OMAB 1ID2A 2XLLA 1PNDA 1E65A 3NJGA 3TBBA 2GB2A 1L9TA 1YLBB 2BP8B 2XV2A 3AG3B 2DYSB 4DP5X 1L9SA 4F2FA 4DPAX 2W88A 2LLNA 1SNRA 3QJTB 5E9NA 1F56A 3OMIB 3X1NA 3GDCA 5I5IA 4A2DA 2J57A 3NJHA 2BW4A 5PCYA 3NP4A 4E9WA 1PZCA 3WKQA 5B7MA 3NJNA 4HZ1A 1RZPA 1QNIA 2RACA 3EF4A 2UXFA 2GC7C 3V9EA 4F7KA 1JVLA 4DP4X 3RYMA 3SBRA 3FQ2A 3ZDWA 2XV0A 4BWUA 1BXVA 1SJMA 2YAOA 2MTAA 1HFUA 1BYPA 4A66A 2IDFA 2PP7A 4QKTA 1N70A 1OCCB 4G7SB 1KCWA 3NSYA 5I6LA 4KOCA 1NTDA 2CUAA 2J55A 2J5WA 3ABGA 2YXWA 2YQBA 1KV7A 3CVCA 2PPCA 1AAJA 2I85A 2IWFA 2VW4A 3WIAA 3BVDB 4KNSA 1T5KA 2BO0A 1QLEB 2CCWA 3PXLA 4DP9X 1GYCA 1HAWA 2JFCA 4GP4B 1GY1A 3CVBA 3QJQB 2AANA 3ASOB 3EHBB 2IDUA 1QHQA 2AVFA 5B1KA 4KO6A 4X4KA 3H4FA 2WSDA 2XUWA 1OE3A 3NJMA 4JHUA 5F7BA 1WS8A 1GS6X 3PPSA 3FU8A 3NJKA 1ASQA 1BYOA 1V55B 2WO3B 3DKHA 2PPFA 2IAAC 1KYAA 4E9YA 2BW5A 2JKWA 3CDZB 1E67A 1TU2A 3TU6A 3NSCA 2VSMB 2EILB 2EIKB 4E9TA 3NSFA 1BXUA 4YVNA 3ZX1A 2ZONA 2ZWNA 1IBYA 3AG4B 4P5SA 1CYWA 3QJVB 2IH8A 4HCIA 1ETJA 1J9TA 3T6XA 1BQRA 1BAWA 5I26A 1FWXA 4P5RA 1AACA 3S3CB 3OQRA 1W8EA 2PPAA 3CVDA 8PAZA 1JOIA 2A3TA 4NB7A 4AKQA 1XB8A 2VW6A 4DP2X 4K9JA 1WA0X 3UACA 4ENZA 1OCOB 2R7EB 2VW7A 1WS7A 1BQKA 1A4BA 3CDZA 3QQXA 4A67A 1JZHA 1L9QA 1V10A 2QPDB 1AS7A 5I6KA 1AZCA 1ET8A 1GR7A 3OM3B 4YSCA 1OE1A 1SHWA 1A65A 1PMYA 4FA7B 3X1FA 2UX7A 3ZBMA 4G7QB 3FU7B 3MX0B 2X87A 2PLTA 5B1JA 2FQDA 4G72B 3JT2A 4HALA 1TKWA 1RKRA 5ANHA 1ZV2A 4NAJA 3UABA 2DY2A 3FSWA 4HAKA 1NIAA 4HCFA 4BWWA 1PLBA 2TSBA 2GI0A 3AW5A 1PCSA 3FQYA 2CJ3A 1BQ5A 4A2HA 2B3IA 1J5DA 2CALA 5AZUA 2HX8A 4Q89A 1OCZB 3X1BA 1AOZA 3NJFA 2QDVA 2FQFA 4DP7X 4AZUA 1AQ8A 1SFHA 2WO2B 3HEIB 2BP0A 1TEFA 2VN3A 1PF3A 2QPEB 2PPEA 3X1GA 2XXFA 1JZGA 2YARA 3UAEA 3EH4B 1IC0A 4YSRA 1VLXA 5D4IA 2VM3A 4YSEA 3S8GB 3NSDA 1NWPA 1GS7A 1NIDA 1AG0A 3X1EA 3FSZA 3PAZA 5I6OA 4EF3A 3GYRA 1PZBA 1URIA 4KOBA 4Q8BA 2B08A 1PNCA 1ET7A 4M4RB 2DWSA 3T6WA 4UAHA 3JTBA 2XWZA 2AZUA 1J9SA 1JZFA 3EH3B 3QJSB 5B7FA 2PCYA 4AKOA 1R1CA 7PCYA 5I6MA 2IDTA 1FFTB 3NJJA 2FWLB 3N55A 2PPDA 3FSVA 2FQEA 1MDAA 3TBCA 2FT7A 2IWKA 1BEXA 4N4YB 2EINB 1PZAA 1JZIA 1E30A 2XU9A 3FPXA 4G70B 4HHGA 4YSPA 4CSPA 1AS8A 2HZHA 2IDSA 1XB6A 1L9OA 1KDJA 1OF0A 1UATA 2BWIA 2NRDA 4YSQA 3PCYA 3QJUB 4GY4A 1ZIAA 3ABMB 3L45A 4BXSV 1NZRA 1J9RA 1OE2A 4E9XA 2FT8A 2Q5BA 3QPKA 3ERXA 1SF5A 2FTAA 4E9VA 1OV8A 1MG3C 3IEAA 4JKNA 2GBAA 4BXVA 2I7OA 1MG2C 1NPNA 1PY0A 4HIPA 5I6NA 2P80A 1NIEA 2VSKB 3U25A 2GSMB 4E9RA 2YAQA 2XX1A 2XVBA 5LDUA 1A3ZA 2YXVA 1SFDA 4HCGA 1RZQA 1AG6A 2FQGA 1M9WA 4BDVB 1SDDA 2OCCB 2R7EA 3H4HA 5PAZA 3UADA 5TK2A 1ET5A 5D4HA 3S3DB 1B3IA 5A7EA 2VM4A 1HAUA 5B3SB 1ADWA 1AZBA 3ZIYA 5I28A 1IBZA 4YVUA 1SHXA 4BWTA 3DTUB 2UXTA 1IUZA 2HX7A 3IBOA 2H47C 2BP0B 1NWOA 3NYKA 4RH4A 3FQ1A 3AG1B 3IN2A 5FC9A 2GC4C 1GSKA 1NPJA 1RCYA 1W6WA 4HHWA 1NICA 2UX6A 1L9PA 4L0PB 1JXGA 3TASA 2YAMA 3KW7A 1ILUA 5EHFA 1KBWA 1NINA 5F7AA 1EZLA 2GIMA 1AZRA 3QJRB 2UXVA 2EIJB 1GW0A 4GYBA 1FA4A 3NT0A 1AR1B 3FPYA 2PCFA 1X9UA 2XYBA 4DP8X 2P80D 4UF7C 4W9ZA 2W8CA 2DYRB 1MZYA 4DP1X 4KO9A 3V9CA 2HX9A 1SDDB 3H56A 4TXVB 1KBVA 1EHKB 1BXAA 5TK4A 1XMEB 2Q9OA 1NIFA 1ZIBA 1E5ZA 2BP8A 1N68A 2IDQA 2BWDA 2QT6A
chains in the Genus database with same CATH superfamily
1BZ7B 2RMNA 4FQCL 1BHGA 4NQDE 4Z0BL 1FO0L 4PVBA 5FW8A 2YD5A 1IGFH 1S46A 2DQUH 1CLVA 4J6RL 1DJZA 1DQLH 3KH4A 4PREA 3NJLA 4A2FA 4RMWA 2ZIDA 3SPVB 3WNJA 2DQUL 4TUOA 2CNYA 1JVOA 2Q6WA 5I15L 2BERA 1H3XA 4MJ6B 3GUTB 2I26N 3RAJH 3PP3H 2XA3A 4HJJH 4X0KB 1BEYH 1MXDA 2KZ1B 3Q2NA 1KGYE 4P2AA 3FU3A 1BF2A 2IFFH 2QPUA 3MUZ1 3SGDI 3BVWA 2DV6A 3QSKB 2CD0A 4EDWL 5IQ9B 4P2QA 2ZX7A 1EVUA 5I1LB 1JAEA 2CDGA 3DMMA 4MTMA 1Q1PA 2WTRB 4ZG1A 4N2LA 4P9ML 5TJWK 4PCYA 1NJ9A 4R4ND 1DBMH 4FMFA 5M94B 1Z6JT 5HDBE 1YC8A 1I4FB 3NCFB 3I84A 1WYJA 4WSGA 4XNMB 5DD1L 3SBQA 4AV4A 4QHLA 3MRJB 2VDQH 4N1EA 4XMPL 3EOYG 4ODUB 1GGBH 4OF6A 3UDWA 5C0CA 1GC1L 2W80C 2CAKA 3GBNL 4NFCA 2HT2D 3TONA 4ZMWA 1KF9B 4C59B 2F53B 2XG4A 3G6JF 1NUDA 2AI0L 3QHZL 5TE4H 4UTBL 3BH8A 5IIEA 1NOAA 3BT2H 4YXLH 1VACB 1YNTB 3QJZA 2AEQH 5CJQL 4U1SB 3VD3A 1MCSA 2IQ9H 4FFYA 2AQQA 3LXCA 4DVRL 4WTXA 1FGVH 2V5SA 5HJBA 1N6UA 5DFVC 2LW3A 3HUJB 3VWKD 4W9FC 3QIWC 1ZEAH 4PJ5E 2A74A 3DGDA 2R27A 2ZUQC 4M61A 4AGNA 4BCXA 9PCYA 4OI7A 1MJJA 4L1BA 1ZTXH 4XWGL 1WD9A 2F53A 1CURA 1PZ5B 1G9MH 1IRAY 3R18A 4OKDA 4LHUA 3TA4D 2WLHA 4AX3A 2D3NA 1TTAA 5LGJA 5BCAA 4UQAA 1T0MA 3F7QA 1J0HA 1RIHH 4WW2B 4EI0A 2VDKL 4LQ1A 3S2CA 1IBGH 2XY2A 4JDZB 1FNGB 1NEPA 4JQIA 4L4VA 1YEDA 3P11L 2HKAA 3QJFA 4Y88A 4L1TA 5DVMA 2ICES 5BUPA 5IB4B 3VCLB 3NABL 1JGLL 3DUSA 3LEXA 4XP4H 1YYLH 3QCUH 2DJMA 3NZ8B 5EF2A 4LT7A 2ZWSA 4Y4KA 1PFOA 4NQCB 2W94A 2PW2A 1N0LB 1X7TA 4YS4A 1NKOA 2VDOH 4CC1A 4FG0A 5ADOL 4X6DF 1G1CA 4WTQA 2BVQA 5IJBC 5INCB 3IJYB 3MV7B 4LPXA 1UFGA 3QDJD 1QVOB 2JSFA 5HY9A 3SOBH 5IT2L 4UYPA 1NBYA 1GPOH 1LDSA 3MC0A 1PPIA 1T0NA 1L9SA 3QAZB 4MNHB 4EUPA 1IX2A 1FCCA 4PJ9C 4UT6L 4F15C 4RGOL 1YNKH 4PM1A 1J0ZA 3TO2A 1F56A 3CPUA 2P8LA 5AW4B 2IADA 2Q86B 2J8UB 2AV7A 4TNFA 1DFXA 4NLAA 5DJZA 4JZOB 3RL1A 3MUHL 3ARFC 2CLVA 4RX4A 5D7IF 1P4IL 5IEKA 3PV7A 4D94A 2HCZX 1GW6A 4HS8H 1VAHA 2X10A 4X6BA 4YHPA 5I8KH 3K6SB 1TTRA 1X7SA 1X5MA 4YDVB 5F71A 3EFDH 4MZIA 3VXUD 2CXKA 2IEPA 3VRJB 5F3FA 3WS3A 3ARXA 5HYSB 5EA0H 2MPAL 5TH2B 1MREL 2PP7A 3D4GA 3ZL4L 3OKOA 2NW3B 2HSIA 4DK5A 4KY2A 1SM3L 5E2VH 1LD9A 1NTDA 1WSST 3S5LB 2YA1A 3MV8D 1F3DJ 3TCLB 4OB5H 3BH9B 1TO5A 5IQ7L 1OT1A 5FB8B 4KI5E 1UT2A 1YMMA 3DTXA 2AMUA 2NY4B 4JCMA 1B4JH 2NY1C 4OQTL 3H3PL 3FJTA 3NAAH 4A7VA 2ZWLT 4DP9X 1BW8A 2X4NA 2AJZA 4PVNA 5EOCJ 2UZPA 5I1CH 1OP5H 2GY7B 4DKTA 1QYGL 1RZFH 3ASOB 1QHQA 5EC1A 3EYUH 2RA1A 4KWUA 1E8YA 2VGLM 5GJTH 4JFEB 4RCAA 4EI6B 4MD5B 3WFBH 3VXUB 4C55A 3KL3A 3QRGL 2VABB 2J21A 2LABA 2CDEA 3LNDA 1WFUA 2VLRE 4RFEB 3I6GA 2M83A 4D9LH 5HVHC 1BZ9A 2Z91A 4GS7B 3TZVC 3VTTA 3HUJE 5EDSA 5MENB 2IANB 5TDNA 4ONFH 2VXTH 2CMRH 5E24E 3ZT7A 3QUYD 4PJCA 4WO0A 2FBJL 1I3GL 1AJ7L 1F8TH 1SBSL 4OZFA 2DM7A 4Z7UF 3RZCC 5AG9A 3IGUA 3RVXC 3T77A 1CL7H 1ZT7B 1A1MA 2C26A 4X8CA 1FZKB 4WWKD 1LWJA 1H3TA 1I8KA 5LBSH 2ADFL 3W39A 5I1DB 2BVYA 1ETA1 3U4EA 1YA5A 3AUWB 2F53E 3OGCB 2ATKA 2VW7A 5DUMH 5B39G 5IB5B 3VFGH 2Y7QB 3MFGB 3M8OL 1ODUA 4RFEA 2A6KA 1EUUA 1OARL 5INDA 4EBQL 5F8RC 5IEHB 1XIWA 4ZI8A 1V10A 2ENSA 4S0TD 2NY2B 3RNKA 2CKBL 1AC6A 3DVGB 4RAUB 5KVEL 3JTTA 3GB7B 3D3VA 3FO1B 4JFDA 3JT0A 2DN7A 3QUZA 1V05A 5EC2B 3U9UB 2F5AH 3L2MA 4JFEA 4HJEA 4MDIB 3T4YA 5HPOA 4F2MA 4O00A 1AQDB 1IM3A 1UG9A 4OZGF 1WWCA 4UI2A 3KWWB 3KPOB 1PW3A 3MLWL 5D7IE 3TO4A 3G5VB 2A73A 1OSPH 4PWJA 2EAEA 4OFQA 1KENL 3TYGH 2W0LA 1R17A 4GBXA 3N0PB 3RTLA 4K9EH 4ICXA 2XJKA 3PG2A 3WIHH 1FHNA 4LU5H 1A9EB 4X6FB 4Y2DC 1MIEL 4OCMC 3VYPA 1REIA 1T7XA 1FGNH 3RIAF 1I8AA 1UM4H 4X5PA 4XXWC 3TFKC 5DRZA 1FYTA 2OW7A 5EU5B 3NBNA 2WB1A 3T4AC 3QQ9D 5HHOB 4WCYH 5IUSA 4WU5A 5HHXH 4Z1PA 3QIUC 1NMBH 3ATBA 3X1EA 1TCRA 2PABA 4ANKA 1WD8A 2G2NA 3GXPA 4BCYA 1EMTL 3DIFA 3HZMA 1H8OA 4P48A 5IVXE 4L4VD 4W6YB 1X6NA 4FQJH 3MOAL 3T6WA 4PB0L 5E5MB 4MMXB 4DGYH 5G55A 1UH3A 1SY6L 3DUUA 1YY9C 4DKEL 4EVNA 1IIIA 1RHFA 4NO3A 1X7QA 5DJ8A 1GSMA 2OZNA 4KGJA 1RFDL 4PUBH 4P5TA 3VNZA 3LRHA 4MWFB 3IMBA 1XGUA 3QDMD 3P3YA 4HX1B 3GQFA 1J8HD 2B14A 3VFSB 5T3ZD 2PPDA 2ZJSL 3ZRSA 3IS1X 5KYXA 2ARWA 3CPLB 1QFWH 5DT1L 5SWZD 2DH2A 5KYXB 3DX3A 1UB5B 4UINH 4CC4A 3WFCH 4HUMB 1YMME 2R23B 3N9GL 3BCDA 3B2XA 1R6VA 5AYQA 5LN4A 3WFEH 3OAZK 3ZZQA 4AEIH 5C8JB 3OR6B 4WLCA 4EVNB 4U6YB 4PJ7A 1NZRA 3KNBB 4HJ1A 3ZK0A 4MMXA 3C6EA 4J3OG 4G9FE 3U6XA 2CBQA 4GQZA 1I9RL 2AW2A 5SWSA 2YPLB 4Z8FL 4URTB 1WJ3A 1T1YA 1FNGA 3WXWL 2PW1B 4UQ2A 4KZDH 1A7RL 1DANT 1OAYL 1MFAH 2X1XR 3DI3B 4NGHL 3S4SB 5I6NA 3C09B 4MCZB 4M8QB 2AQ2A 2YAQA 4RGOH 3SPJA 4OZIB 1MKFA 4RA3A 5DTFA 4E41D 2DQ6A 2VLRA 1Q1JH 3V6ZB 5I1AB 4PGCA 1F58H 4UQCA 1RUQH 2NYYD 1XH2A 1J1XL 4TUJB 4ANWA 1Q1JL 1FN4B 5C7XL 3WELA 2WBWB 3QEUB 5LAXA 1A9EA 1VGEL 1MW3A 1WGOA 3UG3A 2XTJD 1B3IA 2EQDA 3QULB 4PP2A 3MUGA 4OLUH 4YXKH 3J7HA 5E2TH 2E7BA 2LTQB 3VWJA 5ACZA 4AQEB 4AGOA 5IW6A 1INQA 5K9JH 5I76B 4LVHC 4HS6B 1AY1H 4KK8C 4JFFB 5L6YL 4ZBJA 2XWBA 5AKSA 2VC2L 1OPGH 4I0KA 4JZNA 3IBOA 4NFBA 3T2QA 1UACL 2AF2A 2H4EA 3GKWH 2Z0UA 3JV4A 4KAQH 2FECI 5HD8C 5JPNC 3BRDA 3P77B 3L13A 3MLTA 3PV6B 1UZ8A 2J1ZA 4JY5L 5CNHA 4UILL 3G9AB 3EDFA 3QWRD 3LMJL 5KBDA 2WUCL 2EH8L 1Q9OA 4DK3A 2UXVA 4TPRH 5G2NA 4BFIA 4P5KB 3VSUA 1CN4A 3KLHD 4KK6C 1P4LA 3OLIA 3F7PC 2VM9A 1KXVA 1KUMA 2C3VB 4JM2A 4X5RA 4ZMPA 5DZOA 4KROC 5ITBH 2YWYA 2QVMA 3ULSB 2D3VA 3LAFA 1NM9A 4MA1B 4X0KA 1UXMA 5FYKU 1SDDB 3ZQ9A 2WNXA 3OLGA 5I1CL 3FO2A 3WSQH 2CM6A 1WEJH 5H94B 3JV6A 3S97C 4WCYL 2KZBA 3VXQB 1IGJB 5AAPA 2CUIA 3C6LD 4P2OA 1L9MA 2Z7UA 3CZLA 3QQ3B 3WKPA 2DKMA 1EUTA 3P40A 2L7JA 1BAFH 1K4CB 4N0YL 3JXAA 1X5ZA 5I1JL 3DJRA 3U1SH 2FNBA 1JPST 4ZUTA 2I25N 1RJLB 3SJVA 4K8RL 1KWKA 2YBRA 1TZHB 3NZHL 5EULV 1V7ML 4ISVB 4KQ4L 3BKJH 4RMQA 1XH1A 1K3ZA 4PRPB 4PWIA 4X5WB 2W9DH 4BH7A 3I9GL 1UTDA 3EG9B 3V5HB 4XCEB 3WLBA 4AEEA 4K7PL 3WEOA 1MRFH 2IADB 2Q86A 2P8LB 4Y19D 3BP4B 4Y2DD 5ABAA 3ZTNL 3HN3A 3K4DA 5J3HD 3R06A 2BDNL 4JKPL 5E0QA 1IGIL 4HFUL 3HS0A 2AEIT 2IMMA 3W5MA 2VLME 2ZUUA 5DHVA 4H13C 3NPZB 1QFPA 1P7QD 3SE4A 5FDYA 1XH3A 1J88A 4CNIA 3K5RA 4NM4H 4WW2F 3VQ2C 1N0LA 3VRJA 5LGHH 4ZFGL 5ICZB 2Q3XA 4M7LH 3IXAB 4YHNA 2VDLL 3UC0H 4YC2B 4X6EA 2WJ7A 3C9NA 2HKHH 3GSNB 4GG8A 4RSYA 4K5NA 3TIDB 3M17B 2KPWA 5EEZA 5E9AA 1I7ZB 1WAEA 4G7RB 3ZXAC 3MV9D 5HHOE 4IKIA 5C08E 4YC2C 2P47B 4BSWA 4PIRF 5D1XC 5D1QD 1OALA 2WZ6A 3FQTB 1I9JH 5KTEL 5A1AA 1NGYA 1KCKA 4M1CC 1EJFA 3LPWA 2I07A 3BKCL 3VA2C 2FGZA 4KRMB 5D2NB 5F7UA 1T7WA 1JSYA 5TGBA 3FRPB 2DTSA 4EOWL 4N2MA 4WI6A 2B2XL 3UIZA 1JFHA 1LTXA 1MF2H 4FFZL 4M61B 2WK2A 2ZYSA 1QSEE 4LRNH 2COQA 5EZJA 3EYSH 3WG7B 1MF2L 4FFZH 4FXGC 4XNQB 3RBSA 1NCJA 1A21A 1GGCL 3H53A 5IW3A 5I0WA 3OAZH 4LLWB 4LRNL 5DC4B 3DIVA 2A4ZA 3D06A 2P5WB 5CILL 2X6VA 5IB1A 2Q8BH 1M53A 5MEND 3MHZA 3KEDA 1PLCA 3BFOA 4ANUA 1AXSA 4JDZA 5E5LA 5IY5B 1IQDA 1WLHA 1U8LA 4Y9GA 2AV1B 3KL5A 4Z7QF 1KEMH 1KCUL 4LARL 2JJVA 2WBJB 2EXYC 3F7YA 3MLVH 3VA6A 2FNWA 1MCWM 3CDGA 3Q0HA 4HP5A 1R3HA 1T5XB 2DI8A 4IU2A 5AOLA 2D9QB 4NO0A 1LNUA 4OFKA 1A6WH 4LHUB 4AK2A 3TF7C 2EE3A 4A63A 3QP3A 3BZ5A 4IU2B 3POHA 3FSAA 4J3XA 1S5IL 3DSNA 4PJAB 1DJSA 5KYUA 4AV5A 3TBWB 1DSWA 5DD5H 1CG9B 1KCVH 2DLGA 5MEQA 5GGTA 1MCHA 2P8PB 4XPFH 1AXSB 2O4EA 3ZHLA 5C2BH 5L2KE 2EEFA 3U7YL 3K74B 5FWQA 2FEDC 1L7TL 3T3MF 1SN5A 2H2PD 2JTDA 2WSKA 1DJYA 2DYPA 5D1ZA 1UOKA 4KRLB 1S7SB 3ULUF 2OYMA 2ZTBA 2AITA 4JVPA 5I8KL 3S0PA 5BRZB 1IM9A 4XH2B 3HMWH 3T8VA 2JF1A 3ATAA 5F9JA 5AW7B 3SY6A 2MIZA 1UZ6E 1DCEA 1A1NA 4TUOB 1KXHA 3JWNH 3HHMA 1CTMA 1JIBA 4Y16C 3RYMA 1SJVA 5T3ZH 3I6LD 5J06A 5L88L 4TUUA 1OD9A 3KLDA 2JI3A 3UBGA 4JRYD 4HGWB 2WLYA 4G7YH 2TRYA 4XOBA 2VO8A 3K6IA 4AVJA 2D0FA 3A6CH 3NSYA 3GBML 1XR8A 4HCRA 4GFTB 4LEOA 1LK2A 2YD8A 4LOFA 3DIFB 2WPGA 4FLRA 5I1KL 1AP2B 3SDCB 3UAJA 1JI1A 4G9DA 1TMQA 4OFVA 1CB4A 2FB4L 1ZSHA 3QRGH 1ERNA 2YOCA 2WLZA 4LVHB 3HE7B 1FLRH 2FUQA 2V9TA 3DX8A 2XRAL 5DWPA 1IGTB 3ESOA 3V6OE 1IAIM 2Y24A 5GGVL 3O6FC 2DLHA 3MO1B 3Q1SL 1SOSA 4XXCC 5KAQG 5CZVL 2EC8A 5CINL 3N40F 5J6GB 1P84J 3O4OC 3QEQB 2RQEA 1QWUA 2ZQKA 3TN0C 3BSGA 4M1DL 4JL1A 2KC0A 3O11B 2DPKA 2OCFD 2A6IB 2F5BH 3G6DL 1J8SA 4AH2B 3M86A 4NQED 1F6LL 2DICA 3C09C 3TC9A 1V55B 2NSQA 5DUBB 5KSBA 2OFQA 4IRSB 3NEEA 3RI5K 1WZKA 4X5XB 2HT4C 5CHNA 2XWTB 4HVBA 2R51A 3K4AA 4K71B 3F6IA 5EDXA 2ZCKL 5KTEH 2ZWNA 4C83A 1AYRA 1XIWC 5BS0B 2OR9L 4P5SA 4BD4A 3M1OA 5EN3A 5BZZA 3BO8A 2DJUA 1YQVL 1IC7L 3OPUA 4ORGB 5IMOA 5KVMC 3SE3C 1GXEA 3H6AA 25C8L 4RSVA 1JD9A 1QRND 1P9MC 4H8WC 4WU7A 4HA1A 3HG1D 4YHYC 1QEWB 3VXOA 3H2PA 3FT9A 3UZQA 4NB7A 4OY9A 2W91A 5D1QE 4DP2X 3DLQR 1U9KA 1F0LA 3O4LD 2P1YA 1HWGB 3MROB 2Y6SD 3DHMA 4WK2B 5IZ7A 2PO6C 2VDPL 2Z7ZA 4OLWL 5K93A 3WKNA 4U3SA 4M9PA 3MLSL 2Y3NA 2VLJA 2ZOUA 4KV5E 2R0WH 1T89C 2Q7AA 3VYOA 1OE1A 5BV7L 5I0YA 5HGGS 3E6FB 5LGYA 3US1A 2UX7A 3II3A 3QFDB 2VMEA 5EO1A 1RUML 1C12A 2XN0A 4QRTA 3GSOB 3D52A 2AJVH 4KMQA 4EJ1C 1OSPL 2BSBA 5AAMA 1KPRA 3NQKA 3WENA 5EIVA 4A6YB 1AC0A 4HAKA 4R5TA 3VXUA 2W9DL 3CXDH 4LOUD 5CIPB 2CJUH 2YFOA 3RVXD 2JVUA 4LPWA 4A2HA 5SWZB 1HEJC 3FTYA 3QG6A 2VN4A 3Q5YA 4DGVL 1I1AC 2VE6A 4JO4L 4JBSA 3P73A 4XX1G 3VG9C 3O3AA 4OIFA 3V52H 3IETB 4J3OD 2Y3AA 2BMKB 2NTFB 5AVRB 2CJSA 3V4UH 2GBTA 5AAWA 3DHJA 4NUGL 3DO4A 3FCTA 1RZ7H 1G7MB 4ONFL 4QRSA 5FV1L 2ZE0A 1BFTA 2VM3A 3UBXG 1CXKA 2CGZA 1CD1B 3QUXA 4FQLL 4GLRI 4XMWA 4LP5A 4S1DC 1E4XH 3V0AC 1HHKB 3KPRA 5DT1H 4XXDA 5FYKD 4KJYB 2NW2A 3EOAB 3US0A 1BLNB 1ZANH 4O2FA 4KRPD 1I8MB 2QQKL 1DL7L 4ZUWA 3HLKA 4JFQB 1XGQA 3A21A 3X12A 4AL8L 1NUFA 4AKOA 1R1CA 5D71H 4IJ3C 1KJMB 2EH8H 2IAMA 5HDBB 5BS0A 2XCMC 4YHPB 3EW3B 3L5WB 4AL8H 3BD5A 1AGEB 4N4YB 5F9OH 4PI0A 4UT9L 1W9XA 3B7TA 3PWJA 1JWMA 1AQMA 2IXQA 3PWPD 1U8IA 5AZEL 5CCJA 1WISA 2HZHA 2NZ9C 3NAAL 2O5XH 1TQCB 3CH1B 2ICWI 2WTPA 3CH8A 2XA8H 1ZT1A 4IGBB 2HA1A 1BFOB 2QQQA 5CCKH 4OAWA 2NY3B 3OXRB 4KFZC 2QPFA 3RZCB 1OTUC 3OAYH 4LGSB 3MBEA 4XPTH 4K9EL 3NTCL 1I9IL 1SF5A 4XMZA 1ADQL 3CZFB 4RMVA 5K9KA 4YXKL 2FATH 1MWAB 1Q9WA 1KJ2A 1YMHB 5KSVB 4HSCX 2YGNA 5ISZA 1MWAH 2W1NA 4JY6A 5AOZA 2GSMB 5AENA 5I18L 2AGJH 5KSBE 3IU3A 3IFOA 1G6RB 1RV6X 4BFRA 4LSUL 2AABL 5I1IH 4ZW6A 1QSED 2PYEA 5E5MA 4WI9A 1D9KA 1CDIA 4PCSA 1DJIA 2GIXA 4PRHD 4QHUB 1ET5A 4ODTL 3PUUA 4JQXC 4MKMA 4ZUSB 4YK4B 4WY7L 2BC4A 3PWVA 4U0RC 2YMOA 2Y9RT 1AZBA 1MQKH 2BXZA 4WTWA 5HI4D 3ZDXB 1J7VR 2BDNH 4JKPH 3B7YA 3WIIH 2NY1B 3BP6B 1EFXD 1XF1A 2E9JA 3FN0L 1AVAA 3L5HA 5C09A 3T0EA 3VX1A 5EOTB 2WXFA 1INEH 3CMGA 4YDMA 2OP4H 1KULA 1TLMA 1IUZA 5M95B 3IJSB 3N06B 3NPSC 4LAJH 4QRQA 3N1PC 5I75B 1HZHL 2PO6A 3BUQA 1MRCL 4BH8A 1CD1A 3TJEH 4AQZA 1IIKA 1SYVB 1SVBA 4R4FL 3WTWA 2FYYA 4V11A 4W9HC 1NC4A 1L3NA 2YUWA 4ZMOA 5HYJB 1ZPLA 3WFCL 3QQ4B 4WI3A 2YGOA 1FH2A 3WNMA 2AERT 4WEBH 1H6FA 4HIIA 3JBG7 4HMEA 2XA8L 5CEZL 1VACA 1YNTA 5EHFA 3VGBA 3RWIB 1CU4L 4OD1H 2DI7A 4R5XA 5HGBA 1T04B 5EG6C 1YEGL 1WEJL 3LPOA 3WHXB 1Y1DA 2GTWB 4RQQB 5JORA 3QG6B 1HWHB 1U8HB 1E4KA 3DETD 3VNYA 3KXFD 2EIJB 1VPOL 4IEFA 2J3SA 3ZE1B 3NT0A 1DQQB 2E3VA 3WDIA 3QISA 3HS8A 2OMYA 1TTGA 5DVLA 1J0IA 4JFDB 5JHDB 2WXIA 1IAIH 1X9UA 1U8MA 2ZOLB 3ARFB 4WIQA 2BOLA 5EZOL 1MZYA 1HVXA 4KXCA 3MZGB 3CZSA 4YUEH 3VGEA 5A6MA 3VG0H 2FD6L 4WHTA 3VD9A 3UYPB 5SWSD 3QAZC 1CQKA 2CRMA 5F3BA 3BIKB 5H37G 2ATKB 2FD6H 4AUUA 3F6JA 4P2CG 1X3DA 5A2AA 1FZJA 2ICWA 3FO0H 5AKTA 1B6UA 3CGTA 3S36L 3QUXC 5AW1B 4AI7A 3D39D 2TSAA 3QT2A 4KNTA 3RB5A 1I7UB 3SPVA 3FUIA 4OZHB 5TGBB 3DECA 4YSDA 2K7QA 5J1TC 1KYFA 3PWUA 1VDGA 2OMVB 2VC2H 4NP4H 1GGBL 1OXYA 2PETA 4J6IA 4XHQA 4AYMC 4PJGB 3WTVA 3MI6A 3UERA 4TUKL 2F54B 4CSZA 3VWJD 4I48B 3LJ3A 3BO8B 1R33A 1XWVA 4KJPD 3MBWB 5KZCD 3SO5A 3TFBA 1ILSA 4QOKA 5G4OA 2OQJA 5ABDE 4GUQA 2HFTA 4LSPL 3S2AA 2G9HB 4G11A 1RQ5A 8CGTA 4J3OC 1R5VB 2OP4L 1N12A 4N8VB 5SV4A 1UA6H 5F1IA 1QUNB 4PPTA 3V6OC 3QIWB 2WAHA 1X4XA 2BNUA 3RWGB 1BSIA 2C9XA 1J9QA 1MUJA 4RMSA 5J13B 2R8SH 4ELMA 4PS3A 4UANA 5IVZB 4DFHA 5EPMB 4HSQA 2MFNA 3L3DA 3B8SA 4L4TD 2FJGB 4GNKB 3GI8H 3MCYA 1Z3GH 2G30A 1IT9H 4F1SA 4I3SL 1OTSC 3UZVB 3RILA 5T1KB 3CFKA 1JCKA 1KN2H 3Q44A 3OKOB 4FXTA 1AXTL 3R0NA 3UYRL 5BMFH 4G1MB 4YDJB 3QIUA 4GG6A 4G9DB 5DD3L 1LEIB 3QAQA 5H37A 4X7EC 3FUNA 4K94C 2YBRB 4NKOA 4YDVA 1TR7A 2X4QB 3CLFL 4P46C 3JYBA 2HT4D 4L5FE 3I3BA 4RZCB 3VXMB 2HUHA 1AANA 5DO2C 2F08A 4J4PD 4AYDC 4Q74A 3WXVL 1CFTB 2ED7A 2WHVA 1ZLVK 4DGIH 2YAPA 5FWRA 2DM3A 5EU6A 1HILA 5DFWH 1ZGLM 5A7BA 4BDVA 5DFTA 4X4ZA 4PRIB 3FB5B 4FYSA 3ZL2A 4YDIL 5CLYA 2WLKA 2HRGA 3H3PH 3BD3A 5DFAA 2DQHH 4ZTOH 3QYNA 3MBXL 1GS8A 5LBGA 5I6PA 3HFFA 3S5YA 1PQZA 1ZLSH 4NI6A 4OI9A 5E99L 1U93A 2HRLA 1OSZA 4DAGL 2X9XA 3RGVD 2RIKA 4KKBC 5KYUB 1MCCA 1QP1A 1F13A 4FNLH 1ORSB 4QRFA 1AI1H 2YSSA 2DMGA 3C60C 4K3EL 3MRFA 5BVPL 1NCTA 3OAWA 4MJIE 2CHDA 1TVBB 2Y07H 3QXDA 2LU3A 3KGSA 3OMIB 3QH3B 4CVXB 3A6CL 5IB2A 1WWBX 1T0MB 2NQ3A 5IJDC 1RZ8B 5PCYA 4I3SH 3D0LA 1T83A 2MNWA 4BFFA 3QH3A 2Y7OA 1PZCA 3LQAH 2ESVA 1CGVA 1IQDB 5FKAB 1NDMA 3QFJB 3R1GL 1WFNA 3FT4B 1EO5A 1YEIL 3S98A 2AQ1A 1I85A 3ZE2B 1G9HA 4PJCE 2N1TE 3UP6A 4N0FB 4ZNEE 4Y2NA 4OQTA 3GI8L 4ODTH 2IDFA 1A4JA 2ZYHA 2J8OA 4RGNB 4G7SB 2K45A 1A6AA 2QHLA 1W72B 4WY7H 5AVWB 2BJML 4UTBA 2EIDA 5E2WL 2CUHA 1HCZA 2WD0A 2XWRA 2Z4TA 3LV3B 2BJMH 5I6XB 3MV8A 5FHBH 2YN5A 5D2NA 1NBQA 2ZKYA 4LSUH 4YBQD 3AVEA 4EZKA 4PFEA 3LKNA 1YMMD 2P43B 4PJ8B 3RJQB 2AP2A 4RZKA 3BPLC 2OMTB 4E2OA 4OM0L 1KIQB 1NCDL 4MJ5B 4IRJD 1Y6KR 3KYAA 1A6VL 3EBHA 1AGBB 5GPRA 1DBAH 3C9NB 2PN5A 2OR9H 3MLPA 2D03H 4Q0XL 4HFWB 2CQVA 2LV4A 2X4RB 3H9HB 3JWOC 5D7IA 1I8LC 2PF6A 3G5YA 3TEUA 4JPVH 1WS8A 1HDMA 5IQ9A 1GS6X 3QNZB 3BPOB 2HJKA 1WH0A 4N8CL 3QPQC 3U30B 3ARDD 3HI5L 3K81A 3CFKB 4MJ4A 5JXED 1WK0A 1JK8B 1QBBA 4P3WA 2DBLH 1CFVL 1E67A 2OXGB 3SE8L 3TU6A 2WNKA 2DWYA 4CSTA 1JZ7A 2VXUH 3AG4B 2X2UA 4J3OF 5ES4B 2IH8A 5EORL 4N90E 5IWLA 4U1MB 4GG6E 2BZDA 4ZAKB 4Z77B 3O2DH 3K8LA 2P49B 4PJ8D 5HHPB 2YPVA 2YHGA 3T0DA 1O7DE 3X3FL 2FWOB 4Y4FB 3IVKA 2XFGB 3WXVH 4XMPH 4D9RD 4A67A 3VWKB 2R59A 3PHOB 5AAWC 4XO4A 2NT1A 4AVHA 2QPDB 4NO5B 4OH2A 3QEGL 4XVOA 2XZCL 3FSOA 5DEFA 4JFDD 3MLUL 4B7LA 1K4DB 5CO1A 5IFJB 4C56E 2DBJA 5ECJE 4RMUA 1TZGL 4JZJC 3BISA 4OZHA 5IVZA 4GSDH 3TGXA 2VTFA 5ANHA 1ZLWK 4AGMA 4UM9B 2WUBL 3R0MA 3PPEA 1D6EB 4OTXL 2ZOKA 4R6UA 3GD1C 3T1WA 3Q13A 3O8XD 3TVMD 1A7OH 2LU7A 3EOTL 2HMIC 3RBGA 2OXHB 4UDTA 5GS0D 3T4AA 1Q9OB 2ESVD 4OLVH 2D7PA 5HHNB 3FAXA 4MMZB 3KPTA 4XN2A 2JCCB 2XACC 1N0XL 1U3HB 4CN4A 5CEYA 3RFRA 3D3VB 4K23L 3QXTA 1PF3A 5H37H 3V5DB 2J1WA 4B60A 5F0MB 4EN3A 2X6UA 3FCSA 3HPLB 3L81A 3JTSA 2NCEA 1W0WA 2Y6TE 4Q6IC 4AMKL 4NQSB 4YDLB 3QI9B 3T1FA 4PJGA 3VH8B 2ZOLA 1DUZA 5IG7B 3OF6D 2EXSA 4PRNA 1KSRA 4JFZH 2CGRL 1CO1A 3EO0B 6FABL 5KSUB 2J8HA 2ORBL 1PZBA 2VR8A 4R0LB 3QXWA 1KB9J 3KH3A 3LZRA 4K3GA 1S7XB 4YN3A 4EKJA 1XGYL 5AWNL 1ET7A 3WHXA 1D3CA 2YPKB 3MPCA 1I8KB 3BXNB 3FT1A 1GYWA 4CJ1A 1Z2KA 2EDTA 4QT5A 1M71A 3ZE0B 2IF7A 3WMQA 5EZIL 4J8RA 5CUSL 3TPUB 2VITB 1KXTB 4NHCH 3QUXD 1WC7A 1YN7A 2N3JA 3EBGA 2NSMA 1NGQH 4PHZA 5TDNB 1FI8C 3GGWA 4QDGA 4ALAC 5IBTH 1DJWA 2BS8A 2YRZA 4WHTB 1E30A 1JNNL 4ZPVA 5AVXB 1JPGA 3KLQA 3ALXA 4M8QA 1BWWA 2WQSA 4MCZA 3MOAH 4I5BA 3VXRA 4P57B 5EU3A 4U1LB 3MRDB 4XNDA 3BN9D 2Y5EA 4QRUA 1G4MA 3CUPB 5EUOB 1NMAH 3SE6A 1MI5D 3VH8G 4ZD3L 2ZXQA 3KD4A 1SMDA 1DVXA 1DQVA 4KTGA 5LG6A 3JQOB 1PTZA 3SDCD 1EAPA 1T04A 2ZXAA 4DSYA 1E3ZA 2XT1B 4Z76A 3ZKXC 2GJ6B 2N59A 3VXSD 1RJYA 3MRNB 2B1AL 3K80A 2LQRA 4NXKA 1H9VA 1KACB 3U4KA 1CIUA 1SLXA 4P3CL 4N9GA 2YUVA 4R96B 3LRLA 4R8WH 1NC4B 3OL2A 4QO1B 1RP9A 3J2PA 1YMHA 1G7JA 2ZOTA 4JKMA 4YHZH 3VD4A 4KKPA 4PW9A 1R3JA 1M9WA 4LVOC 2E47A 1G6VK 4JEGB 5IJKC 2VLLA 1SMAA 1HXMB 3NGBC 5ALCH 2V2TA 1VHPA 4GQQA 3QEQE 1OP3H 4P59H 4QJ5B 4AWJC 4I3RL 4O58L 5EBLB 1N0XH 3BWZA 3WUZA 1EZSA 4KJQD 3T2OA 2WGXA 1GGTA 3GTVA 5DLML 2BC4B 3OXRA 3PWVB 5F1KC 4B9GA 1ADWA 3IGAB 4MNGB 3NSXA 1OAYH 4OJFL 3BVNB 3VI4B 3APCA 3K6SA 4PJIE 3HZKB 3DTUB 1JI2A 3M1BB 3QUYB 1U8NB 1U8IB 5FM5O 1LILA 1LEKB 3IFLH 3HNTL 4WU5B 4OJYA 4PRBA 2BFVH 3AS2A 3AT8A 4J2XA 4K3DH 4M1CD 5F0LB 4HHWA 3MLUH 4QCIB 2X4PA 3TEZA 1V3KA 1MEXH 3LIZA 4GMSL 4L0PB 1XGQB 1B2YA 1U8OA 4NHUA 4PGZA 5C0BD 5E8OB 2CG9X 1P9MA 5EBLA 4MXQD 1KTJA 2QADD 2BSDA 3EIFA 1NC2B 1MW0A 3VGAC 4IHOB 4G6KH 2FUTA 3U9PL 3ULVH 1G4RA 3P3RA 5HDRA 1GW0A 1R24A 2PXYB 5JOFA 3PQYB 4OKVA 3QJHA 4PJFE 3CFJA 4XCYB 1VFMA 1EFQA 4J3BA 4JFUA 1TYEB 1M42A 43C9A 2W0FB 3LD8C 4XGZB 1EHAA 1H6EA 4R8WL 4F2MB 5DHXB 1U30A 5L2KB 1D5BB 1CZ8L 2OTUA 1TFPA 5DHMC 1ODAA 3LZNA 3WUWA 3CMOH 3OJDA 3W2DL 4L8SA 2G0LA 2ITDB 3RNKB 4PJAE 5D71L 1HOEA 4LE8A 1S9VB 3VMNA 4O02H 5I16B 4KI1A 2VQUA 1OSYA 2A6KB 4JRXA 3C08L 3SBWC 2C8NA 2EIMB 3LKSB 4PJ7F 4XMKL 3ORJA 5IB5A 3T6ZA 2GTQA 4H40A 2XETA 3FO9A 4HKJB 2BVUA 1T03H 3EGSA 3MBXH 4QRTB 3DUHA 4MQXD 3VVVA 5DA0B 5DK0A 5TPWL 1UXWB 3L3OC 1CC3A 2WXOA 4LSRL 4Z7OF 5DCCA 5FO9B 4BKSC 5EV7A 4JRFA 2Z4QA 4GXFA 1L4IA 1MW1A 2ZXEB 3UEZA 2WQVA 4AQ1C 2PWEA 3O3AB 3QWRA 2VRAA 3ZHNA 1YPZF 1BFVL 4L3ED 3TPKA 5DQJB 4X0NA 1WFOA 3SBPA 1ZDSA 2GITA 4JJ5B 3UJTL 1KN2L 3FO9B 1SOQA 4HKJA 4PRHA 4PAZA 1A22B 4ENED 1DSFL 1KB9K 1HSAB 5EZLA 3WJMA 4DPRA 4PRAA 1FIGH 4XOAA 2AXWA 3VXPA 3FQXA 3EUDA 1AZNA 2F8OA 2WLIB 5JOFB 3UPRA 2ZG2A 1FHGA 2ATPB 2WXLA 3HPLA 5MP6L 2IVFC 1KFAL 2K8MA 2KQMA 3SQOH 2BHFA 3EXJA 4D0BA 1C12B 2WMPA 3F6LA 4G59C 2A6JA 3GRGA 4PJXF 2XI9A 4GINA 1LE9B 2CZNA 4LQFH 2CDGB 3VRIB 1IGIH 3L7EB 1TIUA 4HFUH 4JFFD 3P4NB 2XFXA 4M7ZB 4FG6C 4HEPA 1P4IH 1CICB 3HJEA 4U3SB 3B7RL 5GGSB 3DTXB 1BFSA 3PJLA 3N3EA 1YY8A 5FO7A 4OQ1A 3CFJB 4XCYA 1JMZA 5KG9A 4YHIB 2VZ3A 4Y4HA 3PQYA 4MFHA 4XNZB 4JRYE 3ARDC 3PP4L 4NZDA 4D0DA 3HZKA 2OK0L 2BOBB 3N9GH 1FVEA 1INDH 3C8DA 5FYKH 4G6AD 4MZ2A 4YHMH 1SPDA 4NLHA 3MZTA 1KBBA 2E6JA 4E41B 1HI6A 2CSPA 4PRIE 3WJJA 1T03L 2C9PA 2FJSA 3QFGA 2VNCA 5B1CA 2VDKH 3D1MC 3HB3B 1IC7H 4QGTA 4NQEB 2QKIC 4LSRH 3S3BB 3C5ZC 3MRGB 3BVVA 3CFDB 3HC0B 2WZPD 1IFHL 1AKJA 1G7IB 3IKKA 1S9XA 1ZMYA 2BRRL 3TOPA 2OSYA 2GSGB 3QYMA 3BPCA 3GK8L 4PTUB 1O75A 4R96A 4CADB 4PJBB 2IWEA 3BQUD 5CJ8A 4N2CA 3TBVA 3MRNA 4ZMNA 2QSQA 4U1MA 2WN2A 5H35A 1IAOB 1N59A 4M8RA 35C8L 2IQAB 4LOEA 3WFHB 3O3UN 2IOOA 5C7ZA 4Y9EA 1BP3B 2WXJA 2E7DA 4IK7A 1KLFB 4JMNA 4PJGF 3GNMH 2PO6D 1IAIL 1HKFA 1NH6A 4X98A 5D2LA 4A55A 4LLYB 3ZZ1A 3LKQA 4Y4FD 1UH4A 3FFCA 1X5FA 3NA4A 2DYPB 2Y7MA 2FJHA 2LVCA 3B9KB 3TWYA 4Z3JA 4QF1A 3ZY7A 4PJEE 4JRXD 1MAMH 3EO1A 2CPCA 4V1DA 3V0WH 1HDMB 5A6IA 4WO4C 5B39A 5KSBF 4Y1AA 4HZ1A 4DZ8B 4LO9A 4X6CB 5KN5B 1QNIA 4QYAA 4WW1A 1F4XL 2CO1A 5FUOL 3BKYH 3G6AB 4MLSA 5F9AC 5DS8B 2ENQA 3ARGC 4FKHA 1NCCH 5JW5A 1TTFA 3VFPB 5ITFA 1HL4A 3EKCA 1DQDL 3QE5A 2GK2A 1PZUB 2V2WB 2O5YH 3HRPA 4UNIA 4BZ1H 4HUUB 3VDBA 3EJCA 3ZYJA 5D7KE 4UQBA 2PR9A 1UURA 2QADC 5IV2B 2AAAA 4KQ0A 4N5EC 4UAOB 2ZP8A 1B3JA 1OGAA 2AV1A 1KIUA 4HJJL 4FCHA 4JO5A 3PP4H 3CVCA 3GWJA 4H8UA 4L4TA 3RG1C 1S7TB 3WIAA 1E5UI 1DUYA 2IWFA 3QO0A 4U6HA 3BVDB 2VLJE 3A67H 2E7LC 4EN3B 3MACH 4NC2B 3ECVA 3PXLA 3UGXA 5CBAA 2E7LA 1NBVH 3IU4L 1ESOA 2EP6A 3L9RB 1QASA 5CSBA 5CZXD 5IREA 3ZTDC 4JFYA 5JHAA 3QGVA 3EHBB 1LXMA 2NX5A 4IMLA 3AGVA 3NIDF 4B53A 1IGMH 3CSTA 3UTSD 4FFWD 3RTQA 3EO0A 5KSUA 2H32B 4PWKA 5EBWA 2YD2A 2XTJE 3RTQC 3ULVF 4ZTEA 1FAIH 1D6EA 1QAWA 1SXAA 4MQTB 1BD2D 3QIWD 4JHAL 3OV6A 4UM9A 1RZIB 5DRWB 5IMKA 1XEDA 4MCYB 4NCDA 3ZT6A 3K72A 3LH2L 4Q6IA 1UJTA 4TOYH 5IB2B 4BSWB 5JMRA 1J8HA 3MGOB 1FSKB 1WBXA 1U8LB 2A9ML 2BW5A 1XFPA 3CDZB 1QPPA 4FTVE 3V0WL 2JCCA 3ZE1E 3NSFA 1BXUA 3EH2A 3B4NA 2LU4A 2R1XB 4APQC 1L6PA 3Q06A 1ADQH 4H20L 4BEIA 4QRPA 1S7WA 5MI0C 3MLZH 1N2RA 3WKMH 2ENYA 5SWQB 1NLBL 2W65B 4XN9A 2VXTL 4HG4K 5T1DH 1O6SA 4TYUA 4P8QA 4OF5A 5FK9B 1A0QH 1YEJL 4FXKA 2YEVB 4O02L 1SXBA 2WXKA 3QORC 1QSFB 4JPIA 4PG9A 1FBIH 4Y5XA 5LN8A 2FWOA 5DHVB 3FRPG 3BLKA 3FH7A 4YJZL 4NNYB 1QWNA 2P26A 2OJEB 3B56A 3IFNH 3Q9PA 2I9LA 1YEFL 4P9HL 2JKIS 3Q01A 1IE4A 3WDHA 3ROOB 3IFNL 3ARGA 2HJLA 1BZ7A 1GR7A 3OM3B 4LLMB 2WY3B 2EE0A 5IFHH 1IEAA 2HFEB 4LKCA 2OXGA 3M17A 4NN7C 3S6CA 2EUWA 4W70A 1K8DB 4L8DB 3CE1A 4OD3H 5F6IC 3I75B 2GVYA 4NNXB 5GGQH 3U7AA 1ZT4B 5E2VL 4LCCC 1DCLA 3IDNB 4GOSA 1D5ZB 3B6SA 1HZHH 1N8ZB 4N2DA 1XZ0B 4MLIA 4MB4A 2Y7LA 4F58L 3D4ZA 2O5ZL 3MNZA 4K3HA 4NRYA 1P7HL 4FFZA 3UH8A 2JQAA 1QRKA 1H5BA 3VXQA 3F7KA 3MJ8A 1XH0A 2NY6C 1E2WA 2X1PA 3T3PE 1A1OB 3NJFA 1MQ8A 3ZOAA 1VKXB 1IT9L 5CJBA 4XNXH 3GMRA 4M5ZL 3E1F1 1H3UA 2BP0A 2ADYA 4XWOD 4LLMA 5JW4Q 4KNQA 1CE6A 3I02B 3QNXB 3RA7L 4EDXB 1RZKL 4GW4A 4JDEB 4S1QL 1VENA 4PJEA 3SQBB 1K72A 1DSFH 4LBAA 1GS7A 2B15A 1R0AL 4G6JH 3MJ7B 4XBMA 2GJ6D 1YEEL 3B9KD 3KE0A 3LV3A 3VXSB 1NCCL 3H9HA 5D7IB 1EJ8A 3Q5OA 3QHFH 4TNVF 4M4RB 2DWSA 3SYQA 2DWDB 1UWFA 4FXKB 3PP3K 1N5YH 4I18C 2E7CA 3FTGB 5IK3B 1J5OL 4G3YH 1JF1A 4A37A 5ADOH 3DK0A 3BZEB 1IV8A 3RWHB 2CMRL 3GSVB 5D8JH 3TWCH 4PJ8A 1LO5A 1XF3B 3L9YA 3OG6B 5DRXB 4KUZH 4Z7QB 3BVUA 4TSCH 3TT1H 4G6FB 1ZHKB 5DJCB 1JV5B 2R0ZL 2DQMA 4PGBA 4CSPA 1LE5B 2BY2A 1JMXA 2GJRA 2XWBB 5DZLA 3UTSA 2NSXA 2ILLA 2E6QA 5E99H 1A6AB 1N26A 5JIQA 4ZX5A 4PP2B 3QULA 1EEZB 3DDGA 5FFOA 3AREA 2NX5E 1W16A 2O72A 3THML 5E70A 4DETA 4QNPF 1QACA 2JCWA 4S1SH 4AVKA 3U2SB 1A6UL 1LO4H 3RWJB 1UD4A 3B2DC 4OLZH 2DTML 2BPBA 4OGQC 3VWJC 2E0PA 1T7ZA 3OPZH 1MVFA 3VFMB 1T83C 1JPFA 4WJ5B 2KUTA 3UTSB 4ODWB 1J8HE 5T3ZE 1AFVL 1OM3L 4HBQA 3F3HA 2D4FA 3WS6C 4JPQA 4BDVB 4LCUA 5IQ7H 5F7MC 2CHXA 4W9EC 1ORSA 2ENPA 1QFWI 4JG0H 5DGQA 5KSAB 4HXBL 1BD2E 2Y0SA 3IWVA 4WI8A 5J6HB 3TEYA 5D4HA 1F1AA 4XNYH 5ID0B 3VFWB 4TQIA 2HTLC 4FNTA 1NOFA 4YQXH 2BSEA 5B3SB 1UA3A 4NC1E 4OZGA 3K2UH 2APVA 3BGFB 2AQSA 5BMFL 1JNLL 2X4QA 3IFLL 3IDGA 4OF7A 3QCVH 4J1UB 5IBUB 4U33A 4PW4A 4R7LA 5EIIG 3OC8A 1I1CA 1OW0C 2EEXA 5F72S 4F7PB 4ZTPH 2F1AA 3GMMB 2K7PA 4G1EA 1XTLA 1MHEB 4AE1A 3MRQA 2A0LD 3CXFA 5HI3D 1JXGA 1X7QB 3A4AA 3JYCA 1NBCA 5B8CB 4H8PA 1PX8A 2FBRA 3V0GA 1V7NL 4OM1L 3EYOA 1KCSH 1YECH 4M7JH 5HGAB 3JWDH 1E5AA 1S8DB 4OIAA 1MFCL 4XP5L 2IMNA 2ITCA 3D25B 4NCC1 3KBEA 3KNBA 2RD0A 2NYZA 4BKLB 4TM9A 3C5XA 3KLKA 5LG1A 5FECB 2C3XA 3E38A 2XYCA 5D5MA 3WIFB 3UTOA 1AO7D 4DH2A 4AYFA 2YR3A 2IC2A 3WO3B 4IRZH 3U6RB 1Q9WB 4ZYKB 5TDOB 1ZXKA 1BXAA 2VWEE 4MSWB 5GS1B 3CFDA 2W60B 4DQOL 2BWDA 1F45A 2L3BA 3MBWA 2BSTA 4V2CB 3MBEB 4B9IA 4FYRA 3LNEA 4NO3B 1QLFA 5SX5K 1EDHA 4FP8H 3UBXB 1RU9L 4PJBA 3PHQA 3ABLB 1WWWX 4NZFA 4XXCA 1EHLH 3N42B 4LK4A 4RMRA 5B22A 4N8VA 5JQHC 5AB0A 3VD5A 2AK1H 3P2TA 4YBLC 4ZMQA 4HS3A 3LIUA 4G71B 2HRHA 3W9EA 4NJ9L 3D8MA 4RLDA 4AIXA 1E28B 4JVUA 4POYA 3OLEA 2DQJL 4LSDA 5D1XD 3D2UD 1NC4D 4UMGA 3UOAB 1RIUH 2EDXA 3IMTA 4WFHD 3U2IA 2HP4A 4RVBA 1IBHA 5I71C 1LP9B 1X9RA 2DYPD 4YDIH 3L4XA 4CDHA 5E9DA 2FH8A 4OIBA 3WEMA 4EE2A 2KL6A 1HYSC 1AY1L 5KUKA 1J8HB 4N0UE 1XGPA 3UTSE 5JHLA 3V4UL 1AH1A 4OGAD 2DIJA 4IBZA 2V7HA 3D12B 3KDMA 3T3PF 1CI5A 2ZWYA 5JHMA 3GKWL 5JHDA 1RERA 4PJ5B 3ILQD 4PRAB 2EIZA 5DD3H 5K33A 5C97A 4OT1H 5CU5A 3T77B 4W1TA 3APNA 1UGKA 4PRHB 1KYOK 1MHPL 5DJDA 3APFA 1F4WL 1WA2X 4TMPA 3CLFH 1ZXQA 3QQDA 4GRLC 3AU1A 4KI5D 5L88H 1ZCRA 2JIXD 2XTJC 1XF4B 4P4KB 3PJNA 4OLVL 5J12C 2XQBH 3R8BB 4PG2C 3HC3H 1QA9A 4AMKH 5F7WC 2K1MA 3QQ4A 1YUHB 2H5UA 4RISL 2WLLB 4L2LA 1KC5H 2Z31C 3HVNA 6PAZA 1OIOA 1W8NA 1MVUA 3AZUA 3AY2A 1AMYA 1AYOA 2EYTB 2PP9A 3ATDA 3PHAA 2EH7L 3OXSB 2ZXDA 4FG2A 1DQTA 3IN0A 3NCJL 4YWGL 4DOHB 4BSJA 5HYJD 4EIBA 3ZHDA 3SKMB 1CUOA 3L7FA 3IJSA 5I82A 1U8HA 4PLJC 4I4WB 4JJ5A 2LE9A 4W93A 3QRFM 1DJXA 2FT6A 2ADGA 2D3LA 2VDOL 3INUL 1AHWB 2UWEA 1BV8A 5ITFB 3VFPA 1D7CA 4OZFB 1JNLH 3MXVL 3P0VH 1F90L 4L3EE 1PYWB 1G6RH 4TULH 3P9LA 5FYJE 3SQRA 3P11H 5ESVA 5I17A 5D93B 1ZJAA 4JM2F 2HPTA 4KGLA 1OW0A 1UXSB 4HLZG 1SYSA 1RIVL 3TJHD 4ZFZA 3ZMNA 4M8UA 5DMGC 5EFIA 4HV8A 2WINB 1YY9D 2X53A 3SD2A 3VFTA 4H44C 4DPCX 4XPTL 3ESPA 9CGTA 5CLTA 1SLWA 2FR4A 5DWUH 4DNLA 2PNDA 4NI3A 4XVJH 1DEDA 1WF5A 3T3PB 1UZGA 4L9DA 5D7KD 1HX0A 4WUUD 5IMLB 2WCGA 1JP5A 3G6DH 5KVFE 3F58H 4UQ9A 3U36A 1G6RA 4ATTA 5ANMB 3E9UA 1ORQA 2OL3A 3M7FB 4XP1L 4CBZA 2GW5A 1NGWB 3IMWA 2V3DA 1BLIA 4QTIH 2OSWA 2GJPA 1FL5A 2K78A 4E68A 3BQUA 2GABA 4OZFG 1PG7L 4AY0A 3EAKA 4ES8A 4Q58C 3T2PA 1XGRA 2OW6A 2QVTA 2QPSA 4AH2A 5GGUB 4U1JB 1AGFB 4FF9A 2YD7A 1KG0A 3GPEA 3V4PB 4OSUL 5I1GL 3M1BA 4YAQB 3L3HB 2P5PA 3L6FA 3KPSD 4HJSA 2K70A 1XR9A 1T1ZA 1T2XA 1JHLH 3WCYA 1BIIB 3SBRA 2ZP9A 3PY9A 1XGZA 3OKEB 1OQXA 5HYSA 4OCRL 4JR9L 1HI6B 4E41A 1HHGB 4B0MM 1INEL 2EDDA 3DXAE 4X99A 1R46A 4QCIA 5HYIA 1ZT1B 2P28B 3MLRL 5F93C 5AVVB 1HXMA 4ELMF 1IJNA 3CQFA 1DVQA 4PY7B 1QSFE 4PJIF 4TQ8A 1UKSA 2IH1B 3C60A 4Y4HB 6FABH 4XBEH 1E2VA 4M6OH 3E80A 2VCOA 3EGXA 4NKIL 5GGUA 4B27A 2PYFA 1AAJA 4P04A 5ESVB 5I17B 3ME0B 4I8DA 1MEXL 2BO0A 1CE1L 2AV7B 4FERA 1VGEH 3D7PA 4TSAL 3VI4A 5B3JF 5GS0L 5KBKA 2UWEB 4ODXA 2JFCA 4QJ3B 4IIZA 1MFMA 5GGSY 4MRBA 5C0FA 3E6HB 3L3IA 2WMPB 1LE9A 3KPRD 4XVUC 5E2WH 2D31A 5I1EL 2AVFA 3EJPA 5B1KA 3BSZA 1EZVY 4UM8A 4QWWD 4LF3B 1UWYA 4E0RB 5SWZA 2ROYA 1G9NH 3JWDL 3V5KA 1CI3M 3AGWA 2VDKB 3IDMA 4CVZA 5HD8D 4ZW7A 5EUOA 4MNQB 3TIEB 3CFQA 2F8XC 5C0IB 2V7NB 2Z7WA 3LSOB 2WM0A 2G3NA 2UY7B 1R4XA 4ZFZB 1YUHA 4BK4A 4JN2B 2BMKA 2XQBL 1B6DA 1YEDB 3DPDA 3AS1A 1N6QH 5IOPB 4JFXB 4NP4L 3G08B 1N6VA 3NESA 2VSMB 3WUWG 4D7PA 3DRQB 4YVNA 1I3GH 2NNCA 2Z1PA 4QHKJ 1T5WB 5D70L 2VE6B 1WAAF 2D7OA 4P5TC 3KBHE 3P3TA 1KJVB 4IBYA 4P2OC 1KTLA 25C8H 3QS2A 3GLEA 4WNJA 5LGJB 1AHWA 1V27A 1FWXA 2J6WA 3L3JB 5C0CB 2JCCF 3ZDZF 5C07A 3SGEI 4A6YA 3ARQA 4JREC 2B59B 2WWMC 4HJUA 1G9ML 2DQIL 3H9SA 5CZKA 4UWQB 4XNMA 3PNWB 5JMOC 3O0RL 4B5ZA 4XMKH 5E1GA 4K9JA 4U1IB 5E9DB 4ZX6A 4R97B 1A02N 2FAUA 2WC7A 2EADA 2JB5H 1A7PH 3AMKA 4FQHB 2B5IC 4P2QB 3RDTA 5KJ7E 4XC3L 2CLRA 2K3TA 4OGYL 1YN7B 4IDJL 1DBKL 1L5GB 1HINL 3TPUA 4PJDF 4J2QA 1HQ4A 2ZCLH 3RY6C 5GS3A 5AYTA 4Q9RL 4XZ4A 2AXHA 2Q6WB 1MFBH 2VZUA 3L4TA 5TF1H 2ICEA 3UZQB 4EI5C 1MN4A 4OGXL 1MY7A 1YEGH 2VLMD 1DDHA 3ENEA 5DFVD 3P30H 5HDLA 3BKCH 1J1PH 1ZLDA 5GRUH 2HN7B 3BT2L 5AZUA 2EDBA 1I4FA 1KNOB 3KYOA 3O3DA 4C83B 3ULUD 1NJ9B 2V9UA 2AMGA 2NOYA 4WTZG 2OYKA 2ZKWA 1BREA 4TV3A 3K0YA 4UIMB 4JO4H 1KCLA 4G8IB 5FDWB 3RRQA 1MNNA 1N6QL 1ONQB 2ZSVB 2DLFH 3U46A 4KRNA 4G6KL 4G9FB 3MV9E 1GRWA 5DMIH 3EH4B 5HHOD 3V0VB 2Q3AA 3K8MA 5SX4I 2Q7YA 3C5ZA 3QO1B 1HEZB 4GAJL 4MJ6A 4NKMA 5JZ7D 3GUTA 1HZLA 5D7LD 1MCEA 2O26U 4GEIA 4KOBA 1CGXA 2ICEC 3UCRA 1EERB 3CFUA 1FC2D 1NC2D 1NLDH 1R3KB 5IHZB 3MRLB 4R7XA 3JTBA 3QVAA 2YO3A 3VJ6B 4F24A 3WIIL 3EH3B 3KPNB 4N2EA 5DEFB 3DXAA 5EH1A 4M5TA 4Y5YA 5CKGA 5BPPA 3D0AA 3OF6A 5HSFA 4OF8A 1WRFA 1YCSA 3RWCA 2ZPKL 4FQCH 4OV5B 3LDBC 1J5IA 2IBGA 2V9RA 2QR0A 2QSCL 4WO4A 4EAEA 2XWEA 1QKZL 3B2UD 4TL5A 1KGCE 5HI5D 3FTZA 5MEPB 1DQLL 1RIHL 3MLXH 4X9BA 2VR7A 4AZ8B 1TJXA 4YFEA 1TZHA 1T21A 3O9WA 2EUXA 3HFMH 2GCYB 2ITEA 4KJWC 1SMOA 4TSBH 5FV2A 5C0NC 5JUEH 4OLEA 3QUKB 5FYJH 1HQRB 4DAGH 1AFVH 3KVPA 4K7FB 4X9FA 1N3NB 2MTPA 3G5YB 3L95B 3NCXA 4LAQH 4YOKA 1A6ZB 5ID0A 1IFRA 3MCKB 2OL3L 1EAPB 1R75A 1KT2B 4OLZL 3KLAB 3ARTA 1OV8A 1EEYA 1IM9B 1M05A 3MNWA 4MA8L 2I7OA 2P24A 2OMTA 3WTSA 5J7CC 4YDZA 3B3IA 1UJ3B 4YDNA 5I0DA 1JPFB 3K6OA 5H2BA 1UM6H 2MNJB 5D7SL 1PY4A 2HLFD 3W0WE 1UOLA 2HKFH 2R2BA 4KTDL 1OF2A 5A6LA 2X4TB 2VXSH 5AW5B 4NJ9H 2PCPA 2CDFA 4PJHB 4HT1L 3GSNH 2VH5L 3WKML 3DETC 5C9KA 3NIGE 3TBWA 1AO7B 2ODHA 3LH8A 3HE6A 4F7TA 3F12B 1CXFA 2AJ3A 5CJQH 4M43L 2X0WA 1F3JB 1E40A 1TETH 4PJXB 1KPVA 2O30A 4DHLA 2UUDH 3MA9H 4AC2A 1R5WA 2UXTA 3ZL4H 3IB4A 1XSJA 5GS0C 3BGMA 1NWOA 1PFCA 4PGBB 3NACL 2DL9A 1M6UA 1JV5A 4P23D 1DUZB 1NFDB 3BAKA 4NQSA 1RCYA 1XBDA 1VFBB 2DQGH 2YC1B 3GFUA 1HTYA 2UX6A 1T80A 3CN4A 3UC0L 4EZLA 5HGHB 4L8CB 3QEQD 4XNUL 4P49A 5KZCB 2YAMA 2IG2L 3QBTB 3QUML 4MMZA 3HE6B 4G43B 2DWDA 5C0RH 4XRCB 3I2CL 4JFOA 5DURB 5HHQA 3NIFF 3QJRB 3LQAC 2G9KA 2IANE 1FIGL 2Z34A 3TCTA 3FT4A 4Z0BH 4W4NA 5KJRL 3I3DA 5AYUL 5IMMA 1FVCA 1G9NL 3LB6D 4S1DD 4QHMA 4GW4B 4JDEA 4XOEA 5BUGA 3B9AA 2BY0A 4KZEL 3AXLB 2ARJQ 1P7QB 3HA0A 3LY6A 4KQ4H 1KBVA 1EHKB 1LP9E 2EO1A 2B1HL 1BVKB 4DJMA 2R4SL 1E5ZA 5EU6B 4ZMZA 1EX0A 4ZUUA 1N9PA 3BEVA 4ABUA 1PCXA 3W9DB 1WITA 1I8LA 1NCIA 1HJCA 5D96C 3UZEC 1JF1B 3MNZB 5I1JH 3T0BA 4PS7A 4WWKA 3O6FA 4OFIA 3PL6D 1VFOA 4UOQA 3D69B 5E6RB 2R4RH 1RJLA 3ARED 3SJVB 1E3XA 3QUGA 2G4GA 2FYVA 1PAMA 4FQQA 1JYXA 2WGNB 4MNGE 4OCNC 3CPLA 3GMNB 3KYNA 1F4XH 5FUOH 4Z77A 4X9HA 1A7BA 4GUOA 1F1GA 2VL5A 1BDYA 4ZXBC 3HPJB 3RY5A 3FQNB 2CO6B 3SEPA 2OZ4H 4A7UA 5IROD 3FO2B 3F58L 2J6EA 5AKVA 1LO4L 1J86A 2OZ4L 3ML9A 1JGUL 4P05A 1HJBC 1CWVA 2FSEB 5AKRA 1USZA 1K5NB 4U6XA 1KEGL 3AROA 3D69A 4JM2B 3CWGA 3D2UA 4FQXB 4OCSH 3RIKA 1IBFA 2NY7H 1S7QB 4PJ7E 4E5XB 1QUNA 4FQPA 5C08A 4D8OA 2JXMA 4LNVA 3VGFA 4N5ED 4G9FA 1G9NC 3DOSB 3WIHL 4L8DA 3U0WH 1OTTC 1U3HD 3IDYC 4TVPL 3JWOH 2FHCA 1JWUA 1H0DB 5IQMA 1MDTA 4Z7OE 1I8IA 2XPZA 1UZ8B 3W5NA 1G7PA 1LO3H 4UNUA 1KFGA 4HWBL 4X6FA 5BRQA 4NAMA 3T5WA 2DLTA 3ZKQD 5GIRA 5E4EB 2EDJA 3F65A 1ITCA 1U8QA 3PABB 3RJDA 1KXQA 1YJDH 2C9QA 3SIKA 1PKQA 3CHOA 5E03A 2IAMC 4RAVB 4TVUA 1PX3A 3AS0A 1DLFH 1I7UA 1FG9C 3UTPE 3A23A 1VEPA 4JLRA 1OP4A 5I66A 1JWSB 3O4LA 3VMPA 4G8FA 4Y4KC 4UQEA 4YEFA 1IBDA 1Q0YL 3DTDA 1YNTF 1N5AB 3NFNA 4APXB 4P5TD 1PEWA 4GI8A 2DLFL 2WQAA 1GZHA 1OCWH 2ICWB 5AUMA 2ZNXA 3PQYD 1BD2B 5FW6A 4Z7VB 1N10A 1HNGA 5IKCA 1OAJA 3WI9A 3LKPA 3SCMA 4ZFOA 3U0TB 3FF7A 1JFQH 2Y7QA 3O2VH 5DJ6B 1C9SA 4GRLD 3S96A 4TRPH 4UIKL 2VMJA 4FQXD 4Z5RB 2EXTA 1ZDQA 1E4WH 2CLZA 3HRZB 4OD2A 5T3XE 7CGTA 4QHKI 1S5IH 2Z31D 1CYXA 2B3RA 2OMYB 5F97E 2OMNA 2XQYG 3HMXA 1FP5A 3VW3H 1I1RA 2X6CA 1KJVA 2NX5B 4IMLB 3AQXA 4HKZB 5DMKA 4BFGA 2BP8B 2FX9H 2X12A 4F8QA 1OB1B 2XVGA 2Y07L 3TO4C 2FWUA 2YPLD 1ACXA 5EWIH 2X4TA 3HE6D 3C2AL 4LPVA 2X2JA 4KDVA 5C8JA 5LXVA 1OM3H 4GKNB 3IGLA 3RLSA 5DJ0B 1GZQA 4KK8D 4IOIB 2I9TB 4YXHL 4E9WA 3TIEA 1KY6A 3FB6A 2B9BA 3MUJA 3ZIMA 3CD4A 2YQ3A 1WICA 5EOTA 4N87A 4OGYH 2A6DB 1ZK9A 2XZQH 4FTDA 2MTAA 2Y2YA 4A2MA 5IHUL 2F7OA 3MRMB 4R7NA 5BO0D 2K3HA 1P5UB 4P0DA 5HYJA 1ECYA 2VKXA 3IF1A 2NLJA 2XOTA 4XR8C 3ECBA 2HT3C 2CUAA 4KAQL 1MRDL 5DZNA 4ZFFB 3A47A 1E9PA 5GJSH 4GG6B 4YE4L 2I85A 5ESQB 2JJSA 2VRKA 4MQ7A 4JKKA 1QQDA 5LKNA 1IVTA 1UENA 1XGUB 2VDLH 3HCVB 4BQBA 5ESQA 2XDHA 1AIFA 1J5OH 3T2LA 3LPFA 4Y5YB 4PEEA 4XMUA 4JO3H 2KZWA 4FNQA 1C5DB 1MREH 1RUAH 3BE1L 2ZUSA 1N8OE 5FXCH 1EHXA 3ROLA 4GKSB 4LCYB 3V55A 5J89A 3FTSA 4J3WA 4LLAA 3LZFH 3HHRB 4U31A 4M62H 3GRBA 3SKJH 1D9KB 1OTSD 1P5UA 3DJTA 4KO6A 4OM1H 4X4KA 3H4FA 3WD5L 4NUGH 1IAOA 1N59B 5B38G 3MRMA 1OE3A 4R7NB 3TNMA 4M1GH 4GBXB 2VR9A 3O2VL 5JPMA 3RKPA 2B4CL 3HBZA 3UCQA 1OZTG 3GSQA 2WQUA 1UCBL 2E4FA 2WO3B 4F5CA 3U7YH 2YEQA 2HWZL 4ANVA 2WV3A 5DRZB 3HC3L 3VFGL 2G9HA 2CJTA 2YQGA 1I1YA 5CBEA 2NXZB 3FC8A 1LLAA 3QUMH 4QKXB 3CZKA 3MCG1 4E9TA 3QUZB 4IOIA 3EJJX 4PJAF 3P69A 1YHPA 3QUMB 3TCXA 5E08H 2R1WA 4NCC2 3VI4F 3UPRB 4AJYV 3LNGA 1SVCP 4A1RA 4UTCA 1BAWA 2H6PB 4W9DC 5E4OA 5BZDA 4ONHB 4HJ0D 2C1OB 2XN9D 5ICYA 3G5VA 4KDWA 5HJDA 3QDJA 5GGQL 2YD0A 3KPOA 1S3KL 1JOIA 4WUUB 3GMQA 4U1HB 4AKQA 1DVSA 2QMKA 1JGLH 4KJYA 1UCTA 3CLEL 2AJYH 3M6DA 4ENZA 1KB3A 1WS7A 2I5YH 2NYYC 2ZSWA 1QSEA 2PYED 3UTQB 1D9KD 3P30L 1R19A 2E75C 4I77H 1F4YL 4DCQB 2BHUA 2RCSL 3N44B 2VR4A 3BN3B 2CLRB 4RFOH 4YSCA 1RY7B 5MENA 4FTVB 1M7UA 4FNRA 4HHAA 3E8UH 2XC8A 2V33A 3TL5A 2NXYC 1VESA 1T1WB 2FQDA 4HALA 4B50A 4XBPB 3QZMA 5BXFA 5L9DH 5CCHE 5JYLA 4Z7VA 4QTIL 1BMWA 5DYFA 5C9JB 4KKCD 5CINH 4S1RH 5F7KC 4JQXA 3ARGD 3DV6B 5CN3A 3HKFA 1ZSDB 1FORL 1NIAA 3OXSA 2BNQA 2P5EA 1IAKB 2TSBA 3FT2A 4WGVB 1MVUB 3QHZH 4LHUG 4LSSL 1OLLA 3P54A 3ISWA 2B3IA 2CALA 4YIQA 4WGWB 3CIAA 2FBOJ 5LDSA 3QDAA 2NXZD 3CVIH 1ZANL 3DVNA 1HXYB 1PS3A 1T66C 3D39E 3DRQA 4H0IA 1SFHA 5BO1H 2WXQA 4HULB 1DO6A 4GI6A 2AJZB 2X4NB 1HXYA 1KTRL 5EO0B 5E95B 1TJIH 4OCWL 3HBGA 1N64L 2FVNA 4FQLH 3X1GA 2H6UA 1WPCA 3LXBA 2FYYB 3UG4A 4FMVA 1OOAA 4TQEH 1ZHLA 3DO7B 4MNQA 5H4YA 1UXWA 1BQHB 1KYOJ 1IM9D 4EF3A 2X42A 3U7WL 2AQ3A 2BCKA 3ISRA 2BFVL 2VZ1A 4L37A 1THCA 4KRPB 4Q8BA 1J9CT 3D0VA 3VXOB 5DQ9A 3FB7A 4G5ZL 4XP6L 2AZUA 5IJVA 1JZFA 3A24A 2MCMA 3SDYH 1Z3GL 3MREA 1XDTT 1MXGA 3GZKA 3RIFF 2NDGA 4WJG3 4MXVF 4D8PA 3RA7H 1ZD6A 2LHAA 5C0RL 3F83A 1ZGLP 5EU6D 1Q8MA 3DGCR 1GPOL 2EDWA 3AQZA 1C5CL 2MCPL 5T1LD 3IU3B 1H8NA 1K5WA 1JZIA 5GRZA 3W38A 2F58L 4LEEA 4HHGA 3AREC 3TV8A 3TNNA 1YPZE 1IILE 3TBTA 1L6XA 1XB6A 1NCHA 1J12A 1TITA 3DBSA 4IGBD 5E51A 1BFVH 2OZ4A 5HJ3B 4AMXA 5LNDA 2H2PC 3HAEA 1CVSC 5DA4A 2NY3D 5DQDH 4CU8A 4P2RE 1OAUH 2XQYK 3WEXB 4BRJA 4WHYH 4ZMYA 3MJ9L 2G60L 5JIIA 4X83A 2L7QA 4YGVB 4ZDHA 4TN9A 2EYSB 2Q5BA 3HG4A 3RWFB 5ISZE 1FNHA 2VLKD 1I31A 1MHPH 3HHSA 5AVSB 2FTAA 5C6WH 4YAQA 1FE8L 2BVQB 1JF5A 5C86A 3IDUA 3ULUE 1L7TH 2VXQA 4M43H 5EIQA 1JBJA 1F00I 1IGTA 4O2CB 4CMMA 1MLBA 3U0PA 5FS5A 3FQWB 5LCVA 2VSKB 1OAXL 1OK0A 1T7VA 4E9RA 4F92B 3J07A 3FXIC 4NSKB 4BZ2H 3WSQL 1AR1D 2XVBA 3CZEA 1UEMA 4N24A 5ANMA 1RURL 3L54A 4MD4A 3IJHB 3JUYA 4EUPB 2JKLA 4XNAA 2OCCB 5FEBA 4KH9A 2ZUYA 3OSKA 4WW2A 1Z32X 5F96H 3I6LE 3RIFK 4NQEE 5I8CA 3TTSA 4DN4H 1DBKH 2XY1A 4HIQA 2WKOF 2UZYB 4HIEA 1DL7H 1ZA6B 3RJOA 1NMCB 1MJUH 2FO1A 4Y4KB 4MQ7B 1A1NB 5GRWA 3V0FA 3V4VL 2G2RA 3O6KH 4Q52A 3SE9L 3B1TA 5F9JB 4AGPA 1YSOA 2A74B 3GO1L 3HC4H 1RMFH 5I74B 1Q9KB 1HNYA 3JWNC 2DJSA 3DURB 3ET9F 4CKVX 1QEXA 3ECBB 4OLYH 3ZU8A 2ZKHH 3CK0L 2YJLA 5CP3A 1NICA 3PFQA 4U4BA 3S5ZA 5C0AB 5HPMA 2P8PA 4R2GC 4YHOL 3SKOB 1KBWA 4Y5VB 3P73B 1QI5A 3P2BA 2IPUG 4QRAA 1AZRA 3DYOA 4MQXC 1Q4NX 3ZR5A 3C87A 4PWHA 3K5SA 4XN8A 3SHSA 5HVWA 1FA4A 2E9GA 4JCWA 1E4KC 2NY5L 2V2XA 3ARZA 1EVTC 4P9HC 1JXKA 3TJPA 4NO0B 4G6JL 3L9BA 4CMHC 4FQXC 4ZZKA 3HB3D 4ZODA 3PXJA 3T0EC 4A7QA 1HKLH 2DYRB 5CXPA 1ZS2A 4LFHD 3QXUA 3WE1A 3RVWD 2HX9A 2CDFB 2XWJA 2PCPB 3QB7C 3QFDA 3PJSA 1C08B 3C6LB 3DMMB 4DEUA 5MEQB 3IS0X 3VE0B 5E2UL 1JRHH 2BP8A 2MHAA 4TUKH 1NEZB 3PGDB 4UDTB 3T0XA 2BSCA 5BNXD 3BJLA 3CHQA 1B4TA 3RVUC 3SD5A 5C3LD 4QAWA 1DP0A 4NRXB 1NL0L 3C5JB 4KFMA 1XF5A 4N2AA 1WQVT 2KBGA 2UUDK 1R3LB 2X3AA 3KLAA 8FABA 2NXYD 2DW5A 4UZSA 1JUFA 4NKDA 3PAUA 1A3RL 4DERA 5A16A 3IJHA 1CGYA 2FJFB 2EZ0C 3OGOE 5D1XA 1UKTA 4XPBL 3JSSA 2IBZX 4OLYL 2BNRD 4X8GA 4LKXA 4APXA 3TEWA 2AJSH 1E50A 5D4JA 4Z3EA 3SDAB 5C0JA 1KIPA 1EEQA 5CHNB 1KEGH 2V6HA 4UU9A 3ILPB 2R39A 5B1JC 2F68X 2OXHA 2YGVA 4Y4FA 3SE9H 3FTVA 3VD0A 4ZUVA 3IVKB 1J5CA 2EYSA 1PD0A 4WDIA 3T9WA 3Q8AA 1MFBL 2N7BA 1E27A 4PJFB 2QVFB 2O93L 2VN5A 2J56A 2VDMB 3K6FA 4FULA 4KKRA 2H6OA 2VXSL 4M93B 4X8JA 2EO9A 3DHUA 2I7SA 3Q6GH 4AGLA 4EDXA 4NPYA 4Y19E 1DVZA 1GC1H 1XSOA 1OZUA 1UM4L 5D1ZC 5EEXA 1XL6A 5F7DA 4MD4B 4JUSA 2BZCA 1GC1C 2IH9A 4MAUH 1M6OB 3QI9D 4UTBH 3ASNB 1A8JH 3J27A 4I87A 3EH5B 3GKZA 1LEGB 5D8JL 3MRPA 3O8XA 2L7UA 4TS6A 3TVMA 2YAFA 3OKKA 4Y16A 3ZQXA 2XPGA 3BVXA 1FYHB 3ZRCC 1CMOA 3IRPX 1BXXA 1AZZC 3VWKA 4FL4C 3P1VA 5T3XD 3ZDYE 3D2UB 1J1OH 2P45B 2KDYA 3EFDL 3GXUB 1BMGA 5KVFH 2HKHL 1BAGA 2OMXA 2Y69B 5D6DC 4ZK8A 4HGWA 4AYBA 4XI5C 5KVGL 1JXJA 3QA3B 4MHHI 1XGTB 5TE7L 2X41A 4WJKB 3F7VA 5FCUH 1OARH 4ZXBA 2J7LA 3GMMA 1PG7W 2Q76A 2FL5B 3RUGE 5JTWA 4W68A 3BAYA 1IC5L 3FYEB 2BXYA 4UZGA 3KXFA 3MV8B 5CD5D 3RHWF 1CDUA 1TQBB 4LPTA 5CGYC 3DVNB 4K94H 2GSIB 4JDVA 1U8JB 2JWYA 5TD4A 3QZOA 4WI2A 4TKWA 1H3GA 3HG5A 3CX2A 1UJ3C 4PBXA 4NYLA 1ZA3A 4WWKC 1S2EA 3RAJL 4GAFB 4TNEA 3SDYL 4QI3A 1I9IH 5A16B 1F58L 3SYAA 3BVTA 3SYOA 3UGEA 3BRFA 3AQYA 2XLLA 4QRPB 4Z8FH 4HFWA 4I0PC 3TBBA 2GB2A 4P59L 4QTHA 4PWGA 4GXUN 5DEGB 3VRLE 4HUVA 2BVPB 4DP5X 3RVTD 3WN6A 4HGMA 2GKIA 1J8KA 5CFHA 4R83A 3JWOL 4GRWE 4EN3D 1G5GA 2NY2D 1MAML 1BBDH 1U8KB 4KI5F 5I5IA 1WV7T 5KWYC 1PZSA 2NQDA 4GSRA 4JKWA 3EFFA 4HIJB 5GSVA 2AC0A 3PREA 1LO3L 3G08A 4JFXA 3LKOA 4LNRA 2D8KA 2GI7A 4OZIF 2Q8AH 3V9EA 4FMKA 1OGPA 1T66D 1RJCA 1VGKA 2QL1A 3T8MA 1CPUA 4Q2ZB 4JFYB 4OGAC 2XKUA 5I2IB 2UY6A 3GSXB 4WV1A 4K4KA 1HFUA 1W15A 2QV2A 1MELA 3KL0A 4UQDA 5E8NB 5C07E 4NP9A 2H6PA 3U4BH 1RZKC 5C9JA 3IWUA 1ZVHA 3E7JA 5EEUA 1UXLA 1KBGH 2QLVB 3KJ4C 2J5WA 1ZGLB 1ZLEA 5MERB 1MI5E 3VQ1C 4XC3H 2OSLA 2I27N 3RNQB 2OI9C 4XP9L 3NJVA 3HUJF 4XPBH 3W3BA 1FRGH 1NGYB 1KB5L 4DKFL 3TT3H 1RK1A 4HS6A 3B34A 3QQ9C 2NNAB 1I3VA 1S78D 4G42B 2CA3A 4IIQA 5CJXC 3D3VE 4BHUA 3ZT5A 3H2WA 1NCWL 4L29A 5KJ4A 3Q2CA 1F2QA 2C4FT 5IW1A 2ZPKH 3CAFA 3GHBH 3MRBA 5I73C 1FUNA 2IDUA 4WUUA 3IXAA 2CJUL 1IARB 2W9LA 5DVOA 4ZO8A 5L0QB 5ICUA 3V6ZA 3JZ7A 1NCAL 3RUGB 3PPSA 4JFZL 3V4VA 1GZHC 1ASQA 3APMA 1G1Y