1JXFA

Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone dynamics of plastocyanin in both oxidation states. Solution structure of the reduced form and comparison with the oxidized state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Proton transport
molecule keywords PLASTOCYANIN
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxfA00
2DY2A 1SHWA 1SJMA 1OOWA 1A8ZA 2Y69B 2EINB 3S3BB 1L9TA 3EH4B 2BWDA 5F7BA 5B1BB 4E9YA 2FT7A 2YAOA 1HAUA 1QNIA 3QJTB 3T6WA 3ZX1A 2XV3A 1FFTB 3FQYA 3ZDWA 4YSCA 2BW5A 3NSCA 2J56A 2VSMB 1AR1B 5TK2A 2BW4A 4BK5C 2XV2A 3ABGA 1BQKA 1AZNA 2FNWA 2GHZA 4TXVB 4WKXA 2EIMB 2GC7C 1OE1A 4KOCA 4YSEA 1PAZA 2QDVA 2DYSB 3UACA 5TK4A 3WNJA 3ERXA 4DPBX 4YSPA 2BP0A 3QPKA 1UATA 1GY2A 2PPAA 3QJQB 1V10A 1L9PA 2J57A 2QDWA 3NJIA 4BDVB 3AG1B 1KV7A 2CALA 1A3ZA 3PCYA 1IBYA 2PP7A 5EHFA 2VM3A 4P5RA 4KNUA 4AI7A 1TEGA 4Q89A 1PY0A 1X9UA 3FYIB 2IAAC 4FAAB 1IUZA 5I28A 1JVLA 3NJMA 1KDJA 3NSYA 1ET7A 3T6VA 4UANA 1PNCA 4KNSA 2YAQA 4DP4X 2XWZA 3PPSA 1NINA 2BP8B 3CG8A 1ILSA 2W8CA 3FSVA 1JXGA 2UXFA 3JTBA 3NJLA 1PZCA 4E9TA 1PZBA 1R1CA 2H3XC 4HCGA 3WIAA 3NJJA 4BWUA 3FU7A 3DIVA 2VW6A 2IDTA 2MTAA 4QLWA 3UGEA 4ZK8A 3AG4B 4NAJA 3PAVA 2H5UA 3EH5B 4G72B 1NWPA 4DP8X 1AOZA 4AX3A 1L9OA 4N4YB 4Q8BA 2CAKA 3EH3B 4GP5B 2XV0A 2VW4A 2CBPA 1AZCA 2UXTA 4YSDA 4YSSA 1SHXA 4HIPA 3H56A 1ET5A 4AKOA 2HXAA 2DV6A 3L45A 3FSZA 1NIBA 3NJFA 3NSFA 3PAZA 5I6MA 2IDQA 2LLNA 1NIFA 3FT0A 2OV0A 3WI9A 3KW7A 3X1FA 1N68A 4KO5A 1JZJA 2IDUA 2WO2B 2UXVA 2ZOOA 1AACA 2EIJB 2IWEA 3WG7B 2R7EA 3IN2A 1M57B 4YSOA 1QHQA 1DYZA 1I53A 3X1EA 1JZGA 2J55A 4DP1X 3GXUB 3SQRA 4A67A 4N8UA 1XB3A 2YAHA 1GY1A 2AFNA 3N55A 5B1JC 3MBWB 1GS6X 3UABA 1WA2X 2I85A 5AKRA 3IE9A 1PF3A 2ZONA 1PLAA 3CVDA 1MG3C 5B3SB 1ASOA 1SF5A 1AS7A 2PCFA 4W9ZA 1BAWA 2FQEA 4NB7A 4QKTA 1IC0A 4DP7X 4GYBA 1KBVA 3FPXA 1MDAA 4PAZA 1TEFA 2HX8A 3S8FB 4RH4A 1E5YA 1OCCB 3IBOA 1BEXA 1BXUA 3X1BA 2CJ3A 1GS7A 2HRHA 1OCZB 4E9RA 1IKOP 5AFAA 4HHGA 1ID2A 4GP8B 3HB3B 1GW0A 2AANA 3CDZA 2GSMB 5IY5B 1ILUA 3AG3B 7PCYA 2BWIA 5ANHA 3T6ZA 2AVFA 1JZIA 3BQVA 1SFHA 4HCIA 3FU8A 1WAEA 1JVOA 1JXFA 1SDDA 2R7EB 3QJSB 3PXLA 4YSRA 1JZHA 3ABMB 3V9CA 1QLEB 2DWSA 4W1TA 2PP8A 3IN0A 3SBQA 1RZQA 3NYKA 6PCYA 1AANA 2FTAA 3ZBMA 4KNTA 3FYEB 1E30A 5I26A 3QJRB 2XXFA 4G70B 3CDZB 2XLLA 4BXSV 1PNDA 3OM3B 4KO7A 4E9XA 1AS6A 3N2JA 2PPCA 1EZLA 4YSTA 3NJNA 1MZYA 2BHFA 1NDTA 3OMNB 1ZIAA 5A7EA 8PAZA 2J5WA 4DPCX 2HRGA 2DYRB 1J9QA 2WSDA 3G5WA 3FQ1A 3TA4D 6PAZA 3OMAB 1MG2C 3SBPA 1ZV2A 1JOIA 1TU2A 5I5JA 2QT6A 4GXFA 2MRYA 1KCBA 4BWWA 3NSDA 2YARA 2UX7A 4BWTA 2XX1A 4BDVA 1F56A 4E9WA 4DP6X 1RCYA 1J9SA 3FSAA 4F7KA 2GB2A 3EHBB 1NPJA 4HCFA 1GYCA 2YAPA 2QPEB 3QJUB 1YLBB 1TKWA 2IH9A 3H4FA 3MX0B 5B1AB 2X88A 2I7SA 1AZUA 4AKQA 5B7FA 2Y1AA 4A68A 1PMYA 1CYWA 2VM4A 4G7RB 2XXGA 3BVDB 4PCYA 2VW7A 2YQBA 1KCWA 1CYXA 3ASOB 1JZFA 4UAHA 2B08A 4MFHA 3UAEA 1KDIA 2GBAA 1CURA 3FPYA 3SBRA 1BXVA 1FA4A 3H4HA 2PLTA 3DKHA 1ZDSA 4E9SA 1E67A 2UX6A 2H47C 3S3DB 2CUAA 1NPNA 1W6WA 1NIEA 1A4AA 2PPEA 2AZUA 3IEAA 2ZWNA 3NP3A 3TU6A 5B1JA 1WA0X 3QJVB 2CCWA 1OV8A 2N0MA 1OE3A 4G71B 4FA7B 3PLYA 3AW5A 1A4BA 4G7SB 3PAUA 4WTQA 4CSZA 5I6LA 3OMIB 1AZRA 1N70A 2EIKB 1OE2A 3FU7B 1PLBA 3S3CB 3S8GB 2XVBA 3WKQA 1J9RA 1XMEB 5E9NA 3ZIYA 1FWXA 3D12B 1A65A 1M9WA 5I6KA 4DP9X 1ASPA 2HX7A 2P80D 5LDUA 2P80A 2BP8A 1AAJA 1J9TA 1V54B 3QQXA 1NICA 1AG6A 5F7AA 5I5IA 1GSKA 1HFUA 5D4JA 1E65A 1W6LA 4YSUA 1NWOA 1ASQA 1HAWA 1WA1X 4HALA 2OJ1A 1BYPA 1CC3A 7PAZA 1ETJA 1IBZA 3AZUA 2PP9A 2IH8A 2YXVA 1M56B 1NIDA 2WO3B 3NJGA 3RYMA 5I5MA 1ADWA 1X9RA 4F2FA 4ENZA 1PLCA 5I6PA 1JZEA 2IWKA 2TSAA 9PCYA 4EF3A 4A66A 3UAAA 1BYOA 1BXAA 3NJKA 1SFDA 2FJSA 3WKPA 1VLXA 2BO0A 3NP4A 4KO9A 1JXDA 4G7QB 1OCOB 2XU9A 3T9WA 2XX0A 1E5ZA 2YAFA 2HLEB 2FT6A 4AZUA 1NIAA 2FQGA 3V9EA 5FC9A 1AS8A 2VSKB 1AG0A 2W88A 2FQFA 2FT8A 1URIA 2NRDA 2HZHA 3KW8A 1BQ5A 2HX9A 3WNIA 4KOBA 4P5SA 2UXGA 4HAKA 5PAZA 2GIMA 5I6OA 4L0PB 3X1GA 1ZIBA 2TSBA 1L9QA 1XB6A 4F2EA 1SNRA 4K9JA 1KGYE 1ZPUA 2EILB 1OCRB 4E9VA 3DTUB 2OCCB 4A2GA 1RZPA 1L9RA 4DP2X 1SF3A 2I7OA 1J5DA 1AIZA 4JHVA 4E9QA 3UADA 3OQRA 5I6NA 2GC4C 4BXVA 4AKPA 4DP5X 2YXWA 1B3IA 2RACA 3AG2B 1AQ8A 2QPDB 3AY2A 3FU9A 3TBBA 3ABLB 4CSPA 3X1NA 3NJHA 3FS9A 4KO6A 3NT0A 4A2FA 2XYBA 1MZZA 3EF4A 1L9SA 5B7MA 3FQ2A 3HEIB 3TASA 1GR7A 2PPFA 3ABKB 1W8EA 2DWTA 2IDFA 2JKWA 1XB8A 2YAEA 4X4KA 1KBWA 4GY4A 3ASNB 4M4RB 1JERA 1WS7A 2AZAA 3CVBA 4A2HA 4YSQA 1PCSA 3FSWA 2A3TA 2E86A 2PCYA 3T71A 1WS8A 2X87A 3JT2A 5D4IA 2VMJA 4M3HA 1SDDB 4JKNA 4YSAA 4HZ1A 1EHKB 3CZUB 5AZUA 4DP0X 4YVUA 1ZDQA 3C75A 4JHUA 4YVNA 1CUOA 2YAMA 2ZXWB 4A2EA 4UF7C 1J5CA 1BQRA 4GP4B 5D4HA 3U25A 4HHWA 2Q5BA 1OF0A 5B7EA 1DZ0A 3T6XA 1A4CA 2IWFA 3OD3A 3GDCA 3GYRA 1KYAA 1ET8A 2BZ7A 1GS8A 3TBCA 1PZAA 1AZBA 2FWLB 1NZRA 2XUWA 1T5KA 2JFCA 2B3IA 1RKRA 2IDSA 1NTDA 3X2QB 4YL4A 2GI0A 2Q9OA 2FQDA 2BP0B 1V55B 2JXMA 4NERA 2VN3A 5PCYA 3CVCA 2BZCA 4A2DA 4DPAX 2PPDA 5B1KA
chains in the Genus database with same CATH superfamily
1ZE3H 3MLVL 3LXUX 3OKMB 1YUKB 4K94L 1OOWA 2PNDA 2RB8A 1E8YA 4LCUA 1J0KA 3UP1A 4B6ZA 4H8UA 1CTMA 5IHZA 4O51A 5DTFA 2WTRA 3HHRB 4HP5A 3MYJA 3PXHA 1PQZB 1F90H 4M03A 4DT2A 4ZZFA 3L4TA 1FBIL 2VXTL 4OT1L 3O4LD 1W0WB 3PP3K 4PJBA 5I17A 5IMMB 1XFPA 2PO6D 3BVVA 4G9FE 4KRPB 2ENYA 4E9LA 4AV5A 1MXDA 3ABGA 3PL6D 1V7ML 2H32H 3TJEH 4FZ8H 1O6SB 4OCWH 4WKXA 3BEVA 4I0PD 1PAZA 1HC1A 4RWHA 1HX0A 5D7JD 5F70A 2O5XL 2Z8WC 4DWHA 3D48R 3T0BA 2I9LA 1F1DA 4PRHE 2PPAA 3PWPA 3GHPA 4XBPA 5C0JA 2J57A 4FXGA 2VZ3A 4OGAC 3RVTC 5J56B 3KYMA 4B5ZA 5D9SB 3COOA 3F7PC 3D87B 4NO3B 1NOFA 4JPKH 4ELKB 2BY0A 4WFHD 4GEJA 4Y1AD 5CSZB 2BNUA 4Z7VB 4OI8A 5JXEA 1LEKB 1DCEA 3UTZA 1IUZA 2OMTA 2QKIC 2WQ8A 3GO1L 3S35L 4MXVE 3FQTB 3PAYA 2R8SL 1T6WA 2DD8L 3ZYJA 2V2TB 3RL1B 1U8PB 4F93B 2RJMA 3L4CA 4HXBH 3HZYB 5I82A 3SO5A 5ICYB 5HD8C 1XIWA 1I1CA 1SJEB 3D34A 3GSUA 1WZMA 2H1PH 2K9FB 1FVDB 4RAHA 2W8CA 1JXGA 1UH3A 3MX0A 1MHCB 1PZBA 1WUNT 4HUVA 2YPKA 1TUPA 1QABA 5GZNC 5EEYA 2BVEA 4QXGH 5BJTB 3WTUA 1K72A 1IE4A 3S88L 3MC0A 4Z3EA 2KT6A 3U0PA 1F2XK 5CCHE 43C9B 3TOPA 4HJEA 4AX3A 5DVLA 2SEBA 1B4RA 1ZAGA 2NCMA 4GIAA 4XOCA 2CAKA 4DZBB 1HYSC 4ANXA 3L3DB 2F1AA 3K71B 5E1QA 4BCXA 4HIHA 4HIPA 1RJZB 4TTDC 3ESNA 4YXKH 3J7HA 4K3HA 3L9RA 1XXDC 4I9WD 1EBPA 1HT6A 4U4IA 2EIDA 3DNKA 3C5ZB 4NEHB 4OLYL 4R6UA 2A5UA 2VKXA 5HHVL 4WHYH 4ELMF 3IETB 3EFFB 4XAKE 5C9JA 2WAQA 3C60D 1SVCP 3GMNB 5FHAL 3SDCD 4F5CE 2IWEA 1OD9A 1XF5A 4AC2A 3G08B 2IH1B 3IN2A 4OD2B 4YSOA 1OAYH 4ODUB 4MMYA 4BZ1L 2LW3A 1GAFL 5JQIB 3FT9A 3EZJB 1HSBB 4L3CA 4PRPE 3L17A 12E8H 1T0OA 2VN7A 4QKXB 1A4KA 3HE7C 4NENA 4V1DA 2IQ9H 1R19A 4M61A 3QR2A 1AQMA 3BZFA 4XOBA 1MG3C 4LLMA 3BIBX 3QUYB 1AFVL 3E1F1 5ABDE 5HSFA 1SF5A 2ICEA 1XH3A 1EEYA 4PJIE 2ADJB 4QKTA 2FL5A 1IC0A 1JMXA 5JNYA 3D69B 1FZOA 3TIEB 4TQIA 1TEFA 1FZOB 2M1KA 4AVJA 1I8IA 3QQDB 4NN6C 4EOWL 5IZ7A 2GY5A 1BQHG 3SE8H 1RJYB 1VF5C 4Z23A 2MKWA 3FB5B 1YMHA 4FTVA 4HLZH 2R27A 5F0PB 5I1IH 1UXMA 3TEXA 4B9FA 1QRNB 3HB3B 3HZ3A 1N10A 1CBJA 1YPZA 3QDJA 5D1XB 1SLXA 4KGJA 5DS1A 1KIRA 4ANWA 4OFQA 1T2QH 4RMTA 2UV3A 3RVTD 4WEUD 3WTVA 4OZGF 1LD9B 3MRGB 3SY6A 1I1AA 3K5SA 2NMSA 5C8JA 1VZIA 2QJDA 1KTRL 5FYLH 1I9IH 3QSKB 3VRIB 2FSDA 2O6EA 2DQGH 1LTXA 3K2UH 3DVNA 3GS0A 4RX4D 4Q52A 3GTNA 2ETWA 3MA7A 1XX9C 3LRSB 2NY5H 1IAMA 4Z1PA 3RX7A 1WRFA 5JPNB 3UIZA 2X4OA 1MIEL 1ITBB 4RRPM 3BFWA 2NY1C 5L9DH 5D72L 2IPUK 5EU4A 4ZUUA 5A16B 1J9QA 5TE7L 4TM9A 1SLUA 2EICA 5HGDA 4GXFA 3ARGA 3FSOA 2HPTA 5L7XL 4IEFB 3TF4A 2KLSA 5IM7A 3HAEH 3FCTA 1JHKL 3BC9A 5KS9F 5E03A 2ICCA 5ADOH 3DX4A 4FQ1L 4OZGE 4LSVL 3HI1A 4JDEA 2V5MA 1R5WA 2XWRA 4PBXA 4N1CA 3WSQH 4OCLC 1ICTA 4CN4A 5FF6A 4JO3L 5KBPA 5C7ZA 1D5IL 3WBDA 3IDYB 4NCC2 5T3ZD 1KXVC 2IH9A 3WJMA 1SHSA 5JDSA 4LEOA 3MGOA 1N59B 1INEL 2VM4A 3UGXA 2DQIH 2HWZH 4N8VA 3TT1H 3EHBC 1M71B 4NCC1 5JOFB 4QGTA 3WO3B 2AK4A 4A7GF 1PAMA 1PL3A 5EORL 1J5IA 2AW2A 4M7KL 5HYSG 3PV6B 1CURA 3SBRA 2H3NA 2H26A 5DJYB 1E67A 1ZKAA 3W9DA 1NMBH 5ID0B 2CUAA 2WQRA 1J1OH 1BMZA 3U6XS 5A2FA 1RZKH 5I1DB 1MAJA 3RPBA 5TH2A 4NRXB 1Q9LB 4WW2F 1FORH 4Q4EA 5GJSL 4KROB 4AWJC 3JTSA 2WB1A 1OPGH 1BA9A 3BESR 5BZXA 3O11B 4PJ7A 4X0KA 5BRZE 3IS0X 2E8YA 3L1OL 4K9EC 4J3SA 3MUZ1 3QPXL 3FTXA 3TZVD 3LMJH 4LCWB 4LOEA 4YNYA 1T4KB 3HE7D 1A7NH 4HKZA 3GZPA 1NUGA 1YYMH 1UJ3A 3FU7B 3QDGB 3B5HA 2C9VA 2FBJH 2OZ4H 2FLBT 2H1LM 4LCWA 2A73B 4L9LC 3WIHH 1JNNL 2J8UE 1UWEH 4F7EA 1WAPA 5A2KH 1UB5A 1JPFB 1ZV5A 4GSDH 5DJDB 4WFHE 3R4RA 3RIFF 3FF7A 4IMKC 4NUQA 1EHLH 1PQZA 3QQXA 5DTFB 5KVGL 3EXJA 5IBLC 3AXHA 4ES8A 5IEHB 1NICA 5CCKH 1GMEA 3TBWB 2BSSA 3RAJH 3RTQD 4U7KA 1HNGA 2GCYA 1ASQA 1XGUA 1OAXH 2VT0A 3BUTA 2H32A 5C9KA 2WUBL 3LHPH 4Y4HD 2APBA 4DZ8A 7PAZA 1MEXL 4KQ0A 2JIXD 5KBDA 4KZDH 2Q7YA 3BPNB 3BWUC 2DKMA 4M5YH 2KYIA 2LU5A 3G6JF 2ZAHA 3KPMA 1I9JH 2XWDA 3OPZL 4RFEB 3DK2A 1JD9A 3ASWA 5GSVB 5CEZD 2WWMC 4IRJC 5HGHA 4U1HB 1BZ8A 3IJ7A 4NP4L 1BYOA 2VDLB 5CZKA 4M8UA 3HAEA 4G8IB 4K8RL 1FJ1A 2MHAA 1JYNA 5HVHC 4JDTH 1MCJA 3CU1A 2VZTA 4NP9A 4F9LA 3EDFA 4XAWH 5GJSH 4N2KA 4AZUA 2YRLA 2Z35A 4FQXD 4JY6B 2IOMA 1N0LA 4CL7A 2WZPA 1MNUH 3QNXA 2W0FB 4R4NC 4YX2H 5IM7B 2QGCA 4MNHA 3RFZC 1CGSL 3BDYH 2I69A 2IBZY 3FBKA 4POUB 3P9LA 3NSXA 4HC1H 3BLPX 5A2CA 2BNQA 4F7CB 1F4WH 3IDGB 1IC5H 4KOBA 1CLOL 4K73A 4RGNE 3AU0A 4HAKA 1CXHA 3I50H 4M7ZC 5T5NF 1O7DE 4LQFH 4EXKA 3BGMA 1E5AA 3T08A 1JI2A 5JA8B 1UM4H 3BGFB 3AWFA 2A1WL 2DLIA 3OQ3B 2WXGA 4GAAA 4GS7C 3RB7A 1SNRA 4LZKA 1KN4H 3FOMB 3Q9QA 4GRWB 5C97A 4U1JB 3JUYA 4HLJA 4CW1B 5AAMC 2C9PA 4HIXH 5CJBA 1F58H 3KPLB 3GXIA 5KSUA 3INOA 4DQAA 2GJ6B 3D25A 1MLBA 4HUMB 1NDGB 4U6YA 3WV0A 4TULH 4BH7A 5C6PB 4KK9D 4Y4HA 2BS8A 4LNRB 2ZXAA 1P7QA 3SJVE 4BRJA 1XQ4A 1NBCA 2Y25A 4DP5X 4HW6A 5DJ8A 3AG2B 3CLEL 3CQPA 2WBWB 4OFIA 1OAUL 3TBBA 1FC1A 3F04A 3ILPA 4KKLD 2K3TA 3VWJA 1MWOA 5T5NG 4RGOL 3QUKA 5I1GH 2O61B 1S3RA 1B2WL 1F6FB 2X44D 4UILL 2GUOB 3BAJA 2DWTA 4FXLA 3HNSL 2VXQA 3P11L 3QUGA 4PG2C 4HWZB 3HNVH 5FYJU 3GXMA 2E9WA 4HMDA 1JERA 5IVZB 5SX5K 1E4XH 2J8UF 1Y6NR 4Q6IA 1F3DJ 3N43B 1UYWL 3IDUA 2OSXA 3GHEL 2NLJB 4EI5B 1WS8A 3N50A 3MV8B 1LDPH 1REIA 1JNJA 1DTUA 1PZ5B 1R47A 1PG7L 2D73A 2W0KA 3MGTB 2F6AA 4MX7A 4UB0H 5F9JB 3PQYE 3UPCA 3FONA 1NCCH 1NDMB 3EXLA 2DI8A 4HGWB 1PZ2A 5GRUL 1DVFD 3X13A 4EQ2A 1S3KL 4YBQD 5IJKC 1CLVA 5EOCL 4WO4D 4A2EA 1XL6A 4HD9A 4ONHA 1AKJA 1WCQA 1YMMA 2WK2A 4HHWA 1H3XA 3IDJB 4K9EL 3JTTB 3TV8A 4AXWB 1NGZA 3LKPA 1BQUA 2OCJA 2BDNL 4ATWA 2BZ7A 1W0VB 2G2PA 4X98A 3S34L 2NTSP 1DQQA 2VXSL 1F58L 4IGBA 4WFED 4U3SA 3QCUH 4XMPL 4R2GB 2X89A 2JE8A 5D70H 5J13C 4LB8A 3EAKA 1YEKH 5DZ9A 3R7QA 2D3VA 3BUQA 1D6VH 4YL4A 2C3XA 3GMQB 3I2CH 4B3VA 3RFRA 2WLKA 3NBNA 4UTAH 2EXYC 4XPHH 1Y6MR 12E8L 1ZWIB 4POZD 1ZGLP 4RGNC 2GAZA 1LE9B 5B1KA 3VXSD 4KH9A 1KJMA 4NO5B 4ODBD 1XIWD 1KCUH 1Z66A 2Q76B 4BSJA 5EF2A 3B56A 4P23B 3DURA 1MHCA 2YMXL 4YH6A 3T0AA 1S9WB 3K6IA 5GZOD 4GG6E 1XGRB 4O5LL 3OX8A 4BKLB 3TIDA 1UT9A 5DS8A 4QRQA 2VE6B 1LEIA 3SDAD 4HS8H 2WTRB 5C0GB 1ZHLB 1XMWA 2XV3A 1OD7A 2PW2B 1MNUL 4P59H 1P6FA 2A74C 1TJHL 5D7KD 3KCPB 5HHMD 3G5YB 4NPKA 3HS0C 4WNQB 5EO0A 3OG4B 4NNXA 3VGHA 1JWUB 4KOCA 5MEPA 3QAZC 4K8RH 3DMMD 2W80C 4Z95H 2E5EA 5EZLA 2BS71 3QEGL 2VR8A 5JMRA 1MJ8L 4LGSB 1DHKA 3QJHA 4XBGB 5ITBL 2VC2B 1KGIA 4PJGE 4XE5B 2P8LA 2VDKL 2GUYA 1UB6A 2X0WA 3FB6A 5GHWL 4JR9L 3VFMA 3ZR5A 5BO1L 1UWYA 4G8GD 4OLEA 4HJUA 1HQRA 4FQ1H 3ZZ1A 1HCFX 3C5JA 4WFGE 1R3KA 4LPYA 1KF9B 5ABZA 3BPCB 4S1DC 1O7SA 4BZ2H 1YJDC 3BEVB 2C9XA 5ISZE 2C34A 3HS8A 1HVXA 2Y22A 3C5SA 4JQXA 3WKMH 4GXVL 4HUNB 4W9JC 5IMOA 2J12B 3DURB 1KFAH 1AHMA 2ITDB 4OCSH 4XH2A 1JNLL 1QUPA 1YC8A 4D94A 2ZAGA 5EWIL 3D2UB 3AS0A 4XTRD 3QPQC 1HL9A 4EZMA 3GXTA 1O5DT 4PRNB 1EFXD 2VZ1A 3ZHDA 1MHPL 1S7QA 4DO5A 3Q3GB 2ROXA 3K0YA 2EVHA 2VLLB 1G1YA 1EZVX 1VPOL 2YKKA 3WFCL 2VW6A 4DSYA 2IDTA 2P1YA 1MFAH 5DI8A 3QO1A 5CUSH 4X9HA 1TKWB 1K8IA 4F33A 3BVXA 5L4JA 1G1OA 1DVFC 4LFHG 5C0CB 1TJHH 4DOHB 1MI5B 3CFKB 2GJZB 1W72A 2ZCKH 3ISWA 4RAUB 4DVRL 1B2WH 3JTTA 4LSTH 3BFOA 1MCNA 3PJSA 2V37A 1L3NA 4UTCA 2J2ZA 1AGEB 3T4YB 1BSIA 4XCEB 2X4QA 1TQWA 4DKDC 1NEZB 1U8NA 3KLKA 1QATA 1KC5L 1OK8A 5FA4A 2P8MB 2XJLA 4WWKD 3S37X 1ED3A 1T1ZB 1FDLL 5ERWB 3IDIB 4P23D 2IDUA 1KGUA 3CDGA 3FUNA 4GG8B 1M7IA 1H3VA 1CICA 2R7EA 1W15A 5ACLA 1FH5L 1K8DB 4K7FB 3ZO9A 3O8XB 4UDUA 4P8QA 5BOZG 2J5LC 1B0GB 1JDCA 3POCA 3SQRA 3ZDYF 2XVGA 1C1EL 5AB1A 5IWLA 2AJYH 1D5RA 1E2VA 1MREL 3GF8A 3MBED 5F21B 4FI8A 3NRPA 5HBBA 4JFYB 3BVNA 3SEPA 3WSQL 1JF1A 2AJSL 3BYYA 3SDYL 3JV6B 1AS7A 1ZGLA 3B2UD 2D0GA 4NB7A 2YN5A 2P4AB 4U1IA 3EO9H 3UC0H 4BQCA 4DKEH 4ILDA 3QJFA 4AYGA 1MDAA 1F00I 5AW3B 1BVOA 2CR3A 4PJ5B 1CXKA 4ZNCD 1Z7JA 4FNLH 4FE9A 1FPTH 1BF2A 3FOLA 4G8GB 4X8JB 3ZKNC 4A04A 4QJ3B 5AFAA 1WAAF 2W65A 3W5NA 1C12A 5IFAH 3EYOB 3ET9F 3K2UL 4BQ8A 4AIOA 5CUSL 1S7TA 4Y2OA 3BKCH 3VM5A 4ES9A 2HH0H 2ZOKA 2VLRA 3QEQA 3V4LA 4R5VA 1Q0XH 3L48A 3O41B 2VLJA 3OTTA 1TDQA 2YJLA 2VH5H 3OKEB 2Y1ZA 4HPOL 2P8PB 3EYQC 3CVHH 3ZXAC 1X5AA 4PJHA 2R7EB 5CM1A 2OMXA 5D6DC 2DM2A 2K45A 2Q3ZA 2X3AA 3D85D 4L37A 3V9CA 2VABA 3CDGB 3IN0A 3OAYH 4GG8A 3SBWA 5K39B 1EJOL 4WEEA 3TYFA 6PCYA 4XHQA 2XG5B 3F84A 3ZBMA 5IB5A 3EUUA 4G6JL 4BK8A 4JKMA 4H20H 4M5SA 3QPXH 4I4WB 1I8AA 3QC6X 4FQIL 1ADQA 1R3IH 1CL7L 2QBWA 4PJFA 3VSUA 3QNXB 2ARJA 1DJGA 4PP2B 1JPTL 3FQWB 3K6OA 2HRGA 2NY5C 2F8XC 3T2OA 2YOCA 3NJXA 1FRGH 3MBEA 3RI5F 2DWDA 3N1PC 4S10A 5EF3A 4MBOA 3VGEA 3T4YA 1IKFL 1DBBH 3LY6A 1GJUA 4D8OA 3US1A 4QRSA 2AJUH 1BZDA 2DWEA 5LAXB 1X9QA 1OAUH 3BH4A 1AR1C 4OZFG 3WS3A 2UZXB 3HS0B 5D4QA 1S7QB 1S7XB 3MRDA 1QNZH 1AZVA 5CP7B 4J4PA 4OGQC 5MEOB 3BJLA 5IUSA 4PJXE 3RURA 4HIXL 3I9GL 4ZBJA 3KPPA 2BIQA 4PWKA 3DVGA 5ESVB 1TJGL 1I3RA 3CUPA 4LSQH 1ZK9A 2XN0A 3TF7C 5E9DD 2X4RB 3FUDA 2GBAA 2H6OA 2WCPA 5E99H 1SJHA 4BJLA 2VUKA 3H54A 1H3GA 3UEQA 1FL3A 1UB5B 3BE1L 4PRHA 2D03H 4N68A 1AIFA 4KXDA 4P2QD 3VXUB 1XTMA 2XCMC 3BWAB 3DHPA 3D85A 2XWCA 3WELA 2J6WA 4I3GA 3CHRA 2FH6A 4AUYA 1YUHB 1KCRL 5C08B 4CVZB 3WIIH 1ZLVH 4NLHA 3VACA 1OE3A 1I3UA 1ORQB 4FA7B 3EJRA 1PU0A 2HVKA 2E8ZA 3B8SA 1OB1B 3BSGA 3V0GA 4PJ7B 3MBEC 4E41E 4I48A 3U9UB 3PU7A 1WHPA 5KN5A 3N42B 4LIQL 4AYMC 1UD3A 3PABA 2X5PA 1LDPL 4YEEA 4KI5F 1OAXL 1FO0H 3ARWA 3KCPA 3KLLA 3L3HA 5DHXB 3ZQWA 1J8SA 4DP9X 1CE1L 5E2UH 1I31A 1KLGA 1T5XB 2J6EH 1SOSA 1BD2D 3X17A 1XGRA 4BKLA 1RZIB 2BY2A 2F1EA 5I73C 3D85B 4MNGA 3ZKND 2CIKA 1FV1A 4G6FB 3BPLB 3EGXB 2AKRA 3LRKA 4JFDA 4KBPA 5DZNA 3MV9A 2VN5A 2X4RA 1P4IL 4YLCA 4G1EA 1KJ3H 5JW3H 1BZOA 4XVUC 2APXA 1A1NA 2F5AL 4OZ4A 2JXMB 4OZIA 5ICUA 5ACZB 1X9RA 3BKCL 1HINL 2WBJA 3US9A 2E27H 3T0EE 5FKAB 1J0IA 1GGBH 5CKAA 2W9EL 1FORL 4X80L 4KK6C 1BXAA 5HHOA 1JPSL 4FNLL 3F7KA 3T3MB 2P26A 1N3NA 4KO9A 5H35B 5E7BA 2AP2A 3QEGH 1GZQA 3FN0H 1V7MH 2HLEB 2DEYX 1KCRH 1LO4H 4DKTA 5BS0A 3RUGF 3V9EA 4FQQA 2DWDB 5FC9A 2O6CA 3KCWA 1MFVA 3UAJD 2X28A 2CXKA 3MRKA 2WQSA 2F18A 1FVEA 1RUAL 3F6LA 5AUMB 4ZX4A 4UBDC 1JNHA 2VRAA 3ARGD 5DMKA 4E36A 5DYFA 1ZIBA 2F53A 4HXAL 1LD9A 3MRGA 4GO9A 4N0UA 4EUPH 4H1LH 4K15A 4HKXB 7TAAA 1DJYA 1V3MA 1M7DA 2L4OA 3DGGA 1A22B 4Y9CA 1NL0H 3VXRE 2EVGA 2ADIB 4XRCA 3G6JA 1NAMA 3HKZA 4L37B 3VGFA 2J73A 2VDQH 4FLRA 3UGUA 4HFWB 4ANUA 4RBPH 5IMLB 4HK0B 4RA0C 3I6KB 2ZUYA 5IKCB 4AE1A 3ZGHA 1K9TA 4FRWA 1BQSA 5EU7E 3VXMD 2EDHA 2ENJA 4LL9A 3ZE2F 4LAQH 4PW4A 5E1GA 4JCMA 2AJZB 5HYSA 4GAJH 4MNQA 4ISVA 5CU5A 4PLJC 1LNUA 3PG2A 1O7VA 5TFSL 1AXTH 3F05A 5I66B 1DVXA 2ERJC 3SKNA 5KYYA 4TVUA 4JDTL 3VXSA 1TPXB 2VNCA 3K1KC 2R39A 3IS1X 1A1OB 5I8KH 1NM9A 4NENB 5L2KD 1QBLL 4KROD 2YAEA 2OFQA 3L5IA 4TYUA 4B0MM 3BH8B 5FFLA 4O2EB 1X5YA 5C70A 4P5MA 4JUSA 3UG4A 1KWKA 4JFYA 2Q8BH 2YMOA 4DUXA 3D2TA 4RGMC 4X7DC 5DQDH 1ADQL 3UAJA 4ODTL 5DRWB 3MSPA 5BPPA 5AZUA 1MJUL 4AQ1A 3Q2LA 1ZDQA 4PB0L 2DIBA 2Z7ZA 2WXMA 3LH9A 3Q8CA 3W57A 4PB9H 3QHZL 3BKYL 1ZANL 5B38A 2V9TA 1JRHH 3NZUA 2XC8A 1VENA 5D1ZI 4Y19D 3VD1A 3EFOB 4OLUH 1TZGL 1RJZA 3INUL 4M7JH 2FLRT 2WC7A 4IQHA 2ZWSA 5D6CA 4DCQA 1BZEA 4WNSA 3NIGE 5ERWA 2IWFA 2JJVA 5HJDA 1CGWA 3MJ9L 3B6SB 2SEBB 2DQEH 1KCVH 2VLKB 4AYID 43C9A 4Z7AA 4ETYA 3WKYA 1I7TB 2E3VA 3KVPA 4LU5H 4N3UA 5IR1A 1XH0A 3CTTA 3D39B 3V0VB 3GBNH 4MWFA 5BUPA 1S4IA 1IAIH 1HXYB 1R17A 1TJXA 3H9HB 3HBZA 4YN3A 5L8LB 1Z5YD 4GPVA 4HUXA 3H3PL 2BSDA 5A6IA 3F7YB 4AUUA 4NKDB 4LHUG 3V55A 1DDHA 3DV4A 3EYUL 3GSOA 4WI2A 1CR9L 1IFHH 1ZSDA 1QFUL 1SJMA 3C2AH 5CZXC 1IBGH 4I2XE 4KKCC 4PFEA 5FHBL 3S3BB 5L2KA 1J8RA 2EDQA 2HKHH 4TUKH 3APDA 2HT2D 3LZOA 4TVPE 3RBSA 5D71H 2VZOA 3T6WA 1R3JA 3L3KB 3OKKB 5C7XH 5I0XA 5KYNA 3HG1D 4HX1A 4W93A 3WJJC 3U6RA 2XA8L 4QT5B 5I30H 4OGYL 5DUML 5MENE 1BFVL 2OI9C 4WI6A 4LSTL 2K4WA 3MRBB 1ZHBB 2B59B 3GJFK 5D9SA 2QDVA 4GNKB 3B7SA 1V3JA 2HFTA 2C5DC 4YNYB 5DT1L 2NY5L 2VITA 4PH8A 4LRIA 3ZYZA 2BP0A 4ODWA 1MRFL 4U2ZA 3LN5B 4NYLB 5F9OL 3SDXF 4Y88A 3OKNB 1PJ9A 1SUHA 1T80A 4YGVA 1X5XA 2FBOJ 4HUWB 3NJIA 4MQXD 4WDIA 5SWSE 4G9FA 4PG9B 4BCZA 2ZUQC 1F11A 3GTVA 4XBGA 1E28B 3EOAB 4PS7A 2P48B 4OCNC 4XR8C 3UC2A 3L1FA 4LIQE 3WFBH 2OTWB 3LXCA 5KOVC 1AQHA 1CDBA 3TPUB 1DDTA 4L1TA 4OJDH 1IKFH 1DBBL 1BLNB 3VD3A 1P4BL 3FU0A 3VSQA 1O6TA 5B3NA 2XHNA 4E41A 1ZTXE 3QNYA 1T5WB 4JQIL 2LAGB 4MD0A 4TNGA 4X42A 1HKFA 1F5WA 1PNCA 1A5FL 1G5GA 4QAMB 4AT6A 5DJYA 2G2RB 1KEMH 3RU8L 2OLDA 4L4VD 8CGTA 1RUML 2JELL 1ZA3A 2NPLX 4TLKA 5G2NA 4L9DA 4JJHA 5A2LH 4MXVF 2BP5M 3FO2A 3DWTA 4NT6A 3GRWA 3LD8C 3KPSA 1D6EB 1JDAA 5FF6B 1HILA 3TBSB 1KLFA 3WUWA 3AFLA 4DW2H 4UINH 3AG4B 4FZ8L 4OCWL 3ESPA 4HS6B 1TJIL 2XZCH 2KS0A 1JAEA 2VISA 3IDXH 2NY6D 4PS4L 2C4XA 5G4MA 2P42B 1T83C 3ZVVA 3O6KL 5D7JA 4X6DE 2IH3A 2DPKA 1BVKB 5BW7C 1CXIA 2YD3A 3ZKMC 4QRRB 2QZQA 4N2HA 4PJXB 4WO4B 3HZMB 3H6AA 1YEDA 3Q06A 1OO2A 3RGVD 1XSIA 1AKJD 1DR9A 4P46B 3I9IA 3SYPA 1KOAA 4AQ1B 3X1FA 5A2JH 4TSBH 2CHDA 4HUUA 5EU7C 4QRRE 2VMFA 2OCFD 2EDMA 2HTLD 3PQYB 2AEQL 5GJTL 2H2SC 4EVNB 3IAPA 4OZGA 4PY7B 5CO1A 3IMSA 3PNWB 3DX3A 2X89D 1CFQA 2J21A 4N0YL 2CO4A 2LT9A 3LQZB 5KAQG 1RIUH 1RIVL 3B1UA 2NXYD 2OTUA 1NBYB 3JV5A 2V7HB 2AFNA 3PHOB 1QFWM 3QQ3A 3TO2A 1GS6X 3I2CL 2VXQH 2YO3A 1AGBB 2WWOA 1AXIB 5B3SB 5KSBB 3QFGA 4X7FC 3VXSB 2NSMA 3B9KC 3L3GB 1MVFA 1OP4A 4NQCA 3X14A 2PCFA 5T3ZE 4HMEA 4HIIA 4YL9A 1UKTA 3LKNB 4P5TB 4Y1TA 3TEUA 3V0WL 1HOCA 4QHLB 4N2EA 4Q6IC 5FDWB 2BSTA 1DQLL 5FGBC 2EDYA 5IV2B 4AOFA 3DUUA 4FNQA 5DD5L 5AZEL 5AVXB 1JZ4A 3ARBA 4KZEL 5DUPH 2YGOA 1O0VA 1TJGH 3R1GL 3QEQD 3WNPA 1IM9A 2CO2A 4G7YL 3L2LA 4K7PY 4PI0A 1D9KB 2BWIA 4L3AA 1SFHA 2OQJB 3QUYA 2FYVA 2OYMA 4HKXA 4N0CC 1NBQA 2QADD 1CG9B 3GSQB 3QUMH 5C2UB 3NCYS 1QLEB 1X5KA 3CQFA 4U1JA 5C07E 4MJ6B 2FE0A 3L4UA 1E3FA 2QQLH 1DBAH 3EOBA 1NCUA 1D5MB 1IKNC 3FYEB 2AQTA 3ULSB 3B2VL 1GC1C 1QI5A 3PNWA 2WUCH 1EHLL 2GJRA 2VWEE 2XLLA 4GRLB 4E9XA 3OKOB 1BPVA 3GMNA 4Y1AE 3NJNA 1MZYA 3EFFA 1BREA 3FB8B 1F0LA 1U36A 5CN1A 1BM7A 3AVEA 4JRYD 3P9LB 3M07A 1QLEH 2J20A 4JKPL 5JPNC 1SLWA 1A3QA 1NEPA 1DBJH 2AQSA 2VDOH 2J4WH 4PJXA 4XVJL 4WHTB 5I76B 1MCHA 4K55A 5E6ID 5DQJA 4HIHB 1IQWL 4LHQB 2IFGA 5CP3H 3RWEA 4N20A 4B7LA 1GTFA 3QJZA 1GIGL 5T3XH 3RGVB 4DN4H 4EUPB 4B96A 1J0YA 5I5RA 2BCKA 3WMQA 4PREB 3KYOB 4QRPD 4W4OC 4AKQA 2XTJB 3LKRA 1IB5A 4M93B 2CR6A 2B1HH 2HFFB 2UWEF 3CSFA 3K46A 5F1KC 4F58H 3MRIB 4MMZC 3S9DB 2BNRD 5EOCJ 1ZY9A 3MZGB 1IGFL 3MN8A 1DVTA 1KB5A 3QUHA 5BCAA 1XD1A 1AQKL 4LARH 4L1BA 1M2OA 3FH8A 2W9DH 4O2CB 1BP3B 4RMVA 2Q7YB 4Y2DD 3FQTA 1IVLA 2AV1A 1B2YA 1CXLA 1P9MA 1TF4A 3H4HA 2P7TB 2Q7AA 4I18B 5T1MA 1TNNA 3VXNA 5HGBB 4ELKA 1RUAH 2BSSB 2J3SA 3GK8H 1NIEA 3P2BA 4FQQB 3MLWL 3M8OL 1LM8V 4G59C 4MYWB 4A1RA 2X09A 1C5BH 1NJ9B 1SY6H 3V8OA 1VFMA 3UTZB 2ZWNA 2NUTA 1PTZA 4JFFA 4A6YH 2R69L 4GW1A 3VGAB 2IOIA 2DMCA 3DVIA 3JBG7 5INDB 4P5TD 1MCOH 2A4ZA 1TQUA 2OTWA 4AJ0A 1A4BA 3ME0A 2BOBA 3A6OA 4NZRH 2GT9B 5JXED 5E8PA 5J11B 4PV8A 2CJSA 1PLBA 5DZVA 2Y2WA 4CA4A 5GRZA 4A2LA 3RJDA 4QIRA 3DO7B 2VZSA 2EDWA 2HX7A 1IGYA 3S5ZA 4MTMA 3PDOA 1CLOH 3UJJL 1J9TA 2YUXA 1R9FA 1EEUA 5J8OA 1KXTB 2B2XL 1CK0L 5HDOA 3HC0B 4K8RD 1W6LA 4JN2B 1AJ7L 4HX1B 4UIMB 1IGIL 1KTDB 5EDXA 3ZGIA 3IJ9A 4DGVH 4IU3A 4X9IA 4GRLD 1EMTL 3QNZB 4X7TB 4AW4A 2YQ3A 5CP7A 4JB9L 5B1CA 4M56A 2C1OB 3VWKD 4B9IA 4AQ1C 1ZMYA 5F6IB 2AK4B 3R7RA 3UTOA 4GRWH 5D1ZB 4YHLL 4ZQKA 1M71A 1KY7A 2NX5B 5E8OB 5JUEL 1PLCA 2UWEB 4O02A 4Y19E 1BF5A 5DDHB 3NGBB 2PWDA 2P5EA 2TSAA 1U8MB 3GSOB 2YBRA 9PCYA 4QYOA 3JYBA 3UAAA 3RWIB 1JPGB 4MLIA 1X4ZA 2IBZX 1LJMA 1MCWM 4PP1C 3GSNA 3NTCL 5B8CA 1NLDL 4J3VA 1E8WA 2QLVB 1ZVYA 3OAUL 4MWFB 5BS0D 4RFOL 1MLCA 4NRZA 1PG7X 2JKJA 3A23A 1X5FA 3G5ZA 5IG7A 4HG4J 1A0QH 1U8OB 4JM2D 3C6LC 3VXQB 1AYOA 5LQBH 5I1LB 2V5RA 4PJCE 2PO6B 5HGDB 3GUFA 3NAAL 3SD2A 4L3EB 5CCKL 4UMGA 5A16A 5IB4B 2ZUVA 2BNQD 5BNXD 5DHVA 1YY8A 5JR1L 3ULVH 5FV2A 5AW6B 1U8HB 1NKRA 4HV8B 1S6NA 3DUHA 4N6RB 5HY9A 4WY7H 4DJMA 1EEZA 3BAEL 3QZBA 3LZQA 1DQKA 2FECI 5EIIA 1ROWA 4QCIB 4DP2X 1UXWA 3L16A 2OULB 1G6RL 4NCDA 1E6JH 4P5MB 5AVYB 1Z5HA 4BUGA 1H5BB 3HOGA 4JQVA 3BRGC 2RA1A 3MRLA 2A77H 3U36A 1KG0A 2RACA 3QDMA 1TTUA 5B8CC 3HMXH 3KPSE 2QPDB 3KGSA 4U1NA 4CSPA 3IFPB 4Z7OE 2Y36H 4Z7QF 3SYOA 3MRPB 4R9HA 3TT1L 4FYQA 2G3MA 3MNVA 2NR6D 5B7MA 3BDYL 2EAEA 4MMXA 4IKJA 1GR7A 4F8TA 4ORGA 1XB8A 4OJYA 2DIEA 1XF1A 2V2WA 2BVUA 3IJYB 4F7PA 1IGFH 1NLDH 4AC4A 1D2PA 2L7EA 1GCFA 5CU9A 3BZFB 4Y7MA 3P4NA 4NHCH 2MJWA 4MDJB 3U4EA 1DANU 2IF7A 3ARZA 3V2AR 3TFBA 4L4TD 2EKJA 4N5EC 1QI3A 3PL6C 1JFHA 4BQ6A 4IBWA 4UOQA 4JFEB 2YAMA 2CUIA 4PJFE 7FABH 3LN4A 4OFPA 4M93C 3T0ED 1CF1A 3P0VL 5GS0H 1MJ7H 4M5ZL 2J2ZB 1FVEB 1JGEA 4PMFA 2BSED 2Q5BA 4E5XB 1PS3A 2VN6A 2DMGA 5C07A 1H6UA 3OKDA 4MJ2A 2BC4A 3FW6A 4OGAD 5GIRA 3FUHA 3ZRCC 4APQB 4G6FD 4WJ5A 1G0DA 1N6QH 1MHEA 2YUZA 5FM5O 1W72H 5AB0A 3U36B 2H3KA 5BS0B 1P4BH 1DBKL 2XICA 2N3JA 4LLVA 2VIRB 1XCTA 2HJLB 3QQ4A 1FNLA 4TNWF 1QBBA 2JKXA 3TYGH 5JIMA 2BOBB 1DQDH 1N3NB 3EH2A 5TQ2L 4QDGA 1PFCA 3F8UB 3ARTA 2XI9A 2WBXA 3VI4A 4A7VA 3BWSA 1FG2A 2F58L 4PP1D 3D2UA 3LEYL 3PGDA 1P1ZB 3H2PA 3PHAA 4Q7DA 4R4ND 4YHZL 1U30A 4JNXA 5HD8D 4F2ME 1FFRA 2IFFL 3A47A 3WN6A 3SPVA 1L9TA 5ESAB 2I9TB 1HQ4A 2VMDA 5IJBC 1XSJA 5CD5C 4ZOBA 1SJEA 3IWUA 3QFJE 4XC3H 2CLZA 3RY4A 2CRMA 5E2TH 5AD0A 4JFQA 3NSCA 4WV1C 4Y16A 2YPVH 3GHBH 5I1LA 1QX1A 3WEXB 4RVBA 5KTEL 5AW1B 4UQ2B 4FA8A 4Q9CA 2NY0D 2IDCA 2HFFA 1PY9A 3A0OA 2CU9A 4PJ6A 1WFJA 2DYSB 4G5ZL 3WNJA 1M05A 2X53A 1JZ7A 4YSPA 1Z9NA 1RP9A 1JIBA 1P2CA 4XCNB 3VJ6B 1EGJL 4B9ZA 1ORSA 2OJZH 4EUPA 1L9PA 3RGVA 5DI8B 1URZA 2DI9A 2YBRB 4RISH 1T22B 1NGWB 3DX1A 3KYMB 2NX5A 3N0AA 2VR9A 2QSCH 4JHWH 3WE6B 1GZPB 1T0MB 3W0WB 1OM9A 4IRZA 1KV7A 2OZNA 1V7NL 1MFDH 5BXFA 4I1PA 3MODH 3QUXD 2PW2A 5KSAC 1M3JA 4IU3B 4K3DH 2NXZC 2F0CA 5CGYD 4OCXH 3VCLB 4YDKH 2WOBA 3PGCA 3G5XA 1KCVL 1K6QL 1RD6A 3ZSTA 2R0KH 4X5WB 1ET7A 3T6VA 2DIJA 1QFWL 2H8PB 3SE4A 2PW1B 3T3ME 4PJ5E 4KNQA 4HIJB 2C1PA 3LZLA 4F80A 2VDRB 4O02L 1RZGB 5DXWA 1U8JB 1EFXA 3NIFF 4HJGA 5EU6A 5F72S 4AQAB 1TO5A 2ESVD 2Z92A 5SWZE 2K70A 3NA9H 5EUOF 4OIBA 3DIVA 2MNUA 2H9GB 1IE5A 4NAJA 4ZXBB 2QSQA 1LMIA 3VJ6A 1DLFH 3GS7A 3MOAH 5CLZA 5DGRA 4LHUB 5GHWH 1QPXA 4JQIA 3W39B 1URLA 3O6LL 3MUUA 4JFFE 5E56A 5MEQB 4JANA 1IGCL 1U2YA 4YPGA 4LBEA 4XP1H 1A7QL 4HH9A 4QF1A 5ICZA 3L45A 1CFNA 4NZDA 4H25B 1I7RA 1ZANH 4Y19A 4Y2LA 4W9DC 2H0FA 5DJ6B 4QAWA 4JVWA 3BIKA 3WAJA 5DS8B 3UZQA 2DJSA 2YC1B 4PP2A 4OZHE 4P2RE 5DEJA 1FFNB 1X6LA 2X12A 5JXAH 2CDGA 3K91A 3VD5A 3D4YA 4RQQA 3NQIA 1OTUD 3MRNA 4FQHB 2QTVA 1D2OA 3HUJA 3PGDB 3QH3B 1MIMH 2GAZB 1VFUA 3L1EA 1A6VH 2LABA 2VABB 3RL2A 1PIFA 3DIFB 1M6OB 4JO3H 4NZRL 3NOIA 3PP4H 3GFUA 1OGAD 3LV3A 4RSVA 5HDRA 4EVNA 3K8LA 5LGJB 2ZOTA 5DU7A 3I6LE 4WI9A 5AZEH 2MCMA 3VG0L 1XCTB 1DVSA 1OALA 3B1TA 3EFDH 3OKLA 4S1SL 2IBGA 3GBDA 2XNAA 4IS6A 1H9VA 1A9VA 1G84A 3O3AA 2GABA 3FPXA 4KY2A 4XNYH 1S9YA 3MLYL 4YDVB 3MJ9A 1NGZB 3LKPB 4OKDA 4ZS6C 5FOJA 1E5YA 3HBQA 5HHQB 3O2VH 1KN2H 1W16A 2G75A 2ZCKL 3NPSB 4GAFB 4Y4HB 5DK2B 2VKWA 3QUXB 2W9DL 1QYGH 2HT4C 3BZ4B 3HC3H 1JP5A 4TS6A 1GW0A 4Y9BA 2GSMB 3MCYA 5JTWA 3AG3B 3RNKA 1F4HA 7PCYA 1DVFA 3BQVA 4R4FL 3UL4A 1T66D 3EOTL 3VNYA 1ZJAA 3BKML 5K5YA 5A43C 2YKLH 1EGJH 1DUZB 1WCBA 3DSNB 3U83A 2FUQA 3BWZA 4WI7A 4XO9A 5GS0D 2PTTB 2M83A 4PWEA 4U2YA 1H19A 2NW2B 1G7IB 3AXIA 3OM3B 3QNYB 4MD0B 3O0RH 1MVUA 2XFXA 3RVXC 4HGKC 2KI6A 1JSYA 5JMOC 3HBGA 5LO7A 2Y6SC 3GI8H 3KPNB 4LPXA 4OLWH 3G5WA 1QACA 1MRDH 5IV2A 6PAZA 3OMAB 4MB1A 3CXFA 3ISRA 1NAKH 1G5AA 4NZJA 3ZDZF 2XTLA 4D9QD 5IW3A 5FS5A 1UEMA 3QVAA 2GK2A 3MMEB 1F56A 4BZYA 4XOEA 1JYWA 1P69B 3IF1B 3OXSA 3SE9H 2DJUA 3OKNA 2R2EA 1AD0A 1F4XH 3FTZA 5AVSB 3WNLA 5ISZD 3BUPA 1DJHA 2X05A 1TKWA 4F33B 4FXKB 1M7XA 3RJOA 4CKQA 4QCIA 1EO8L 4PWGA 4JFZH 4XMUA 1AXTL 3HPLB 3RVVC 2YRZA 3NEOA 4K94C 4R7XA 5FAAA 1O9WA 2JKTM 4H0GA 4L2YA 4DQOL 5K9QI 2J71A 4IJ3B 3FCUB 4LVNC 5F0MB 3DLQR 2AC0A 3LPPA 2EKSA 4Z3GA 4D9RD 1OZTG 1H0DA 2CRYA 2IALA 3IB4A 4PGCB 5D2NA 1KBPA 1KBBA 2B0SH 4WAFA 5DJ0B 4FEIA 1SEBB 4P2OC 1WBYA 4F15B 1WISA 3G6JE 1BQLL 2X2JA 1W6WA 1IV8A 3ETTA 2GK0A 2NXZB 3U1SH 2AJXL 2WGXA 5IVXE 3RZCB 5AVZB 2AI0H 3V4VH 2WLLA 5HHME 4P2QE 5D7JB 4A6YB 4HKZB 5IFJB 4UQ3B 1G7QA 1U8LB 3CZGA 5GRVL 2VLJE 2FO1A 4G7SB 3AJ7A 4PPTA 1A7BA 3S48A 2B4CL 2C3GA 3EJTA 5ANME 3FF8A 2P52A 4XT1C 3JWDL 4JLRB 1N6QL 3QR0A 3KPMB 1G6RA 4G2AA 1NL0L 3CBJB 3FT4B 5D2LE 4ZQKB 3VDAA 2HCZX 1J9RA 1S7WB 2XJKA 5BRQA 3IMWA 2HFEB 1FVCB 4Y1AB 1HNFA 2BIIA 3CZFA 2RALA 3GPEA 3MCG1 4QR7A 3A6CH 3B9VA 3H7LA 5LDUA 1XEDA 2X38A 4MHHI 5KVEE 3FO0H 3SCMA 5CNHA 3UROR 2Z91A 1V54B 3CPUA 2OMUB 1NC2A 3D07A 4OI9A 3STLB 2Y6TE 1CDHA 3G6AB 4P5KB 3VDBA 4Y5XA 5F9WC 3UO1L 1KGXA 2FJUB 5LBSL 4LCIL 2QR0A 3V6FA 4JFUA 4MB5A 1YN7B 1TZAA 4KK9C 3ZDZE 4YHIB 3LB6D 1OTSC 4YHZH 3RGBA 2W60A 3PL6A 4NS0A 2I60H 1B0RA 4JAMB 5DWUH 3QXAA 3OL2A 2A6KB 2Z1KA 2IPKB 2B1HL 4OD3L 3EGDA 1QSFD 1IL1A 5K9OB 3RIFK 1UURA 2BO0A 4WTWA 4KAQL 4FHJA 1OSZB 3KDMA 5JR1H 3FZUD 4JFFB 1E5BA 3INUH 1GVIA 1BBJA 4DGIH 4O58H 2OMZB 3SDAB 1NC4D 1FYTE 1I3GL 4ISVB 2ZX5A 1RZFH 4OSUL 3T3PB 3GMOA 1T7VA 2RH0A 3LRSA 4XPTL 1R3JB 1AR1D 2X6MA 3AITA 4ZMWA 5A6MA 5I1AB 3IKCB 2CKBL 2J43A 5AKVA 5EU5B 3LDBC 4RWYL 2VDMB 4OGXH 3HVDA 4EO5A 3VFWA 3Q48A 5LGJA 3MNWB 4PBDA 5ITBH 4TTGA 2YLKA 2F53D 3RL2B 3X13B 3FC8A 1F3DH 2X7LA 4U49A 2Q1EA 5MERB 3NFNB 3U82B 1BGXH 1MN4A 3VE0B 3WJMB 4GKSB 3MV8A 2DQCH 4I87A 1EO7A 3HNVL 4HLZG 3LKSA 5D55A 1FFNA 4JQIH 4Z7WB 2YC1A 3QJOA 5FW7A 3FUIA 2X70B 4MCZB 3O4OB 2PKDA 1EFQA 4I0PB 1TVHB 4J3WA 4ONGH 3IYLW 2HKAA 4H25A 4K71B 4HOMA 2VLRD 3T4AB 5ICZB 1IBFA 5C0BD 3APCA 1K2DA 1UWXK 1X5LA 4OCXL 3GSXB 4WK0B 1MQKL 3N06B 1OAZH 4M6ML 5I8OH 3RUGB 3D2UD 4JZJC 4LLMB 2DQFB 3IXAB 4Y0GA 5IBTL 2AABL 2X4OB 3PWVB 4MZ2A 1XVSA 1LO4L 3AGWA 3E8UL 4EDXA 1MSPA 2DQDL 3MU3A 2Q3AA 2Q8AH 4D9LL 4YSQA 4UAOB 4ZTPL 2WGNB 1SEQL 2VDPL 4FQXA 4ELMB 3KLQA 5B38G 1Y07A 2ENQA 3AAZB 3C12A 1NC4A 2MMXA 4CC1A 4PJDE 1A1NB 1Z3RA 4OZ4B 3D33A 2VMJA 2XWTA 1FZJB 3C87A 1IU1A 2F5BL 3JWNE 4XPFL 1X5HA 1OGPA 3NN8B 2MOQA 3IETA 2ZCHH 2FX9H 1RP8A 2QEJA 2HN7B 4TNVF 4A63A 4UU9B 4FXKC 5GGRB 2C9SA 3G6AA 5GGSB 1O5PA 3L9RB 3T3PF 5L2JB 1ZA6A 4LMQE 1QR4A 1UH4A 4YHKH 4FQLH 1NLBL 5CZRA 5E08L 3FKUS 1WHOA 3T6XA 1A2YA 4WI8A 5J57B 2JKIS 1HHHA 4LVNB 3SQOH 4YHYC 5IQMA 4AGPA 1IEAA 1JXKA 1EAPB 4L29A 3WKML 3HZKB 2W0FA 1ZS2A 5F7EH 2DQCL 5T1LA 3VXMA 1L0XA 2G3NA 4M7ZB 3FAXA 3RA7L 1XWVA 4HCRH 4F15C 1C5CH 3T8MA 5IKCA 4X6DA 5KG9B 3QCTH 2VSCA 1BDYA 5MENB 3ECVA 1JUFB 5FO9A 5GS1A 3VGBA 3QQ3B 3CVCA 1VFBA 2XN9D 3JQOB 1WICA 2BRQA 5CN2A 4HIQA 3LQZA 3AACA 5C08A 4RFEA 3Q5OA 4OFVA 5AOLA 1F41A 2C9QA 4HF5L 4E2OA 2DY2A 3RZCA 1P4UA 2E7DA 3VYPA 4OZGB 2F53B 2WUBH 3LHPL 4UILH 4W68A 3DARA 4N0RA 3U7WL 5IESL 5CEZH 1UKQA 3FH5A 5C9JB 4OQ1A 3GS4A 5GGUA 4TL5A 1LEKA 1PD6A 2CDEB 3KWTA 4FQJH 4MAYD 3WNMA 3LS5H 1BLIA 1I9RH 1UWGL 1HHJB 3LZFL 5BRZD 2X3BA 2BW5A 4ODTH 5H37H 2J56A 3W3BA 3DTDA 5AW4B 3KPPB 1G87A 1CFVH 5SX4H 3W9EA 2HFGL 2V9QA 3LZRA 1GGUA 4JGUA 4NFCA 5KVDL 1WWBX 3OAZK 3IMRA 2JKRM 1KGWA 1KJ2H 4LGRB 1Z6JT 3UZVB 2BHYA 5TK4A 5DK0A 3OAZH 1IX2A 2GHWB 3X3FL 4OFYD 4AIXA 4JO1L 1EQWA 4AEFA 5KBLA 5DMGD 3R0NA 4EZLA 3EGDB 4ODSL 1X5ZA 4ZW8A 4K23L 3S37H 2BY3A 4ZX6A 2JI1A 1R5IB 5ACZA 1X7QB 3C6SA 3KJ4B 4V11A 5DF0A 4YS4A 5I17B 3BN3B 2BC4B 4PJ8B 2PWGA 4JKWA 2VQ4A 3QCUL 4XMPH 5I28A 5SWQA 1HIMH 2ZUQB 1G7LB 1ZJBA 3NCMA 2OSWA 1GPOL 1JGDA 3D05A 3HMXL 1XBRA 3NSYA 1S7VA 1HZKA 1CMOA 2D7PA 2WBJD 4NN5C 1K5WA 1G0YR 2WQXA 1KLGB 1LE5B 2HKHL 5HYJD 3MQIA 3EYFA 3FSVA 4R2GC 5LCVH 1RVFH 3L08A 1FE8L 1T1YA 1X4XA 4UUJB 1J5OL 1N4XH 4ABVA 1R1CA 3CSPA 4HCGA 4DQOH 4ODXB 3V5KA 5MP6L 3CFDA 3WIAA 3EBHA 3LIZL 2HMIC 1A3RL 4YMPA 1N59A 4MAYA 5B3JF 1U93B 2JCCA 4JPKL 1TZ8A 1EO8H 1MWAB 3MXVH 3HR6A 1WBZA 3MR9B 5H2BB 2B16A 1J0JA 3JV4B 3UTQA 3WJJA 4WO0A 5EC1A 1WFIA 3E2HB 2CIIA 1KXVA 4O9HL 3EGSB 4ETQB 1CB4A 2MIZA 3WXWH 4C83B 7FABL 5IOPA 4GBXC 5DLML 5FK9B 1FL3B 5BV7L 3WIHL 3VYNA 1CCZA 2O1AA 1P7HL 1UWEL 1AGDB 3P3UA 3U30B 2A2QT 2UXVA 3RTQA 4G43A 4J5VA 2OMNA 1P7KA 4JFHE 4EEEA 1FNAA 3IK2A 4BSVA 4D0BA 1PZDA 3X1EA 1JG9A 4GI6A 1JZGA 5DFAA 5E6ZA 4BZ2A 5GGQL 3QDHA 3T5WA 2BVOB 1KPRA 5LBSH 4DF9A 5B1JC 4CGTA 4W9IC 3PUCA 4PRAA 2A0LC 3SYQA 1KCSL 3MLZL 3CVDA 1KN2L 5L0QB 5DJCB 5T3XD 2NY2D 3PWNA 5I1IL 2A6IB 3IF1A 2KDGA 4W9ZA 2C4FT 2CUHA 3WTTA 4POZC 5LCVL 2YQGA 2HX8A 1PZ3A 5E8DL 1FO0B 4KXBA 5SX5H 4NRZB 5KJRH 5I2IB 3E6HB 3S8FB 3PWPE 3IFLL 5KUKA 3IDMB 1AH1A 3X1BA 4ZO6A 1BEXA 3BGFC 1GS7A 3FQWA 5BRPA 4MCNA 1XTLA 4PG2A 2W07B 1ZT7A 3O4LA 4LHUA 3UCQA 5GZOC 5B38B 1N26A 4G9DB 5HGAB 1KCLA 1RZJH 4PJ8D 2CLRA 4MQXC 2UYLA 3HE6C 3VYOA 3HKFA 4DVRH 4NKOB 4XMLL 3ZDXF 2B39A 2ICEB 1P5VB 4WGVB 5D70L 5ALBH 1FGNH 4XNQB 1CQKA 4GSRA 2BLFA 1LP9F 5FKPA 3G6DL 3QJSB 1CQYA 1RK7A 4BSWB 3PWPD 4GQZA 4K5OA 5TQ0L 2AQPA 4W1TA 3RTQB 4H26A 1S7SA 4FLQA 4KI1A 1AKPA 1RZQA 4WWKA 2Z34A 1DVFB 4I85A 5DGQA 2VLRE 2G0KA 32C2B 3KVDD 3IJ8A 1KBKA 5I74C 3GJFA 1TETH 5KVDH 3AREB 2BJMH 4OLVL 1U8IB 3QUXA 4JFOB 5IHUL 1A1MB 4FQCL 3FMGL 3JUZA 3UH8A 2BVQB 4TV3A 3QG7H 3BZ5A 2ZD0A 2IG2H 5HHQA 5IHHA 1AO7B 4OCSL 3GDBA 4YE0A 2YUWA 4XNDA 2EDLA 3SBPA 1AP2A 5E95B 5DC2A 4WENB 3RIAF 4RMSA 4U3XA 3MTXA 5HI4D 3KJ6H 1VCAA 4G6AC 3VWJD 2LLGA 3HN8A 1S8DB 2X40A 4YFEA 1WWCA 4U1SA 1UB6B 3FB6B 1N64L 1J9SA 1R3LA 5HYIA 2EDNA 5JUEH 3GJEA 3A21A 3ZT7A 1JPEA 4WF7A 3LSOB 1LDSA 1IAIM 1YYLH 3ULUF 2HVBA 3PWJA 3OR7B 4X4XB 4XWOC 5F7NC 1OF2A 3UXFA 5B7FA 5JOPD 1D5ZA 2F08A 2YRPA 1JWUA 2KERA 2IGFL 4G7YH 3KYKH 4MLSA 4LRIC 3O8XA 3V4PL 1ZXQA 2JH2A 2DMBA 3QIBA 4KTDH 4WGWB 5EN2B 2COVD 3BAXA 1IGIH 2XFGB 5EPMA 4LHUD 1CYXA 3OGOE 1MW1A 3VI3E 2FJHA 2CPUA 4H8WH 2VL4A 3MXWL 2XTJC 1OPGL 3MLSL 3KR3H 4EXPX 5SWQB 3UZQB 2P44B 3RDJA 5ICYA 4AGOA 4BIKA 1FIGH 4PRID 5DD1L 5BZDA 5IIEA 2JI3A 2FWOA 2VJ0A 1T83A 3CSYB 4PJIB 2ZOUA 2Z64C 4Q9BA 5IBLD 4Q2ZA 1P6AB 5JO5A 3QIWC 4NX0A 3PJSB 5E6YA 3TBTA 1I85C 2G9HA 1QAWA 1XL4A 4ADIA 4G9FD 4JZNA 1WE5A 4W6XB 3RVWC 4PV1C 1F1AA 3EO0A 3BKMH 5CJQL 3AW5A 4ABUA 5GXBB 1Y7VA 4QHKJ 3PAUA 4HEPA 4IGBD 1RIVH 4IBSA 2ZYRA 3HPJB 2QVTA 2HJLA 4M8QA 2DQIL 5FKAA 5DD6B 2X2HA 1B6DA 4WFFE 4JGNA 3A3YB 3HNTL 4MNGE 4FTVE 1NCBL 4MCYB 5DQ9A 5E6UB 2NY3C 1KWGA 1NKOA 4V1DD 1CFTA 3K7UA 5FM4A 3VFGH 1UM4L 4HUCA 4L8SC 5ETUB 3VXME 3ZTNL 5A40E 4IRSC 3F65A 3ARRA 4OQTH 1YEHL 4LPCA 5D7EA 1T1XA 1CDUA 4YZWA 3T1WA 3B43A 2CMRL 2ZXQA 3B37A 5EU3B 1EV2E 4CU7A 1A6TB 1JGEB 2YMXH 4YDLB 1MQKH 2IAMD 3LN4B 4B97A 1IBBA 2RCSH 3Q6FA 4MNGB 4BFEA 1KCUL 3MV8D 1BQHA 4WWPA 3E80A 2OJ1A 1BYPA 1R5VB 1XF4B 2ZP0T 4L8DA 5DJZB 5AB2A 5CEZL 2PP9A 2Y7MA 4CC4A 4KX9A 5F9JA 3NG5A 2VDOB 1NIDA 4C58B 4MXQD 2XPGA 4Y2DA 1T03H 1J8HD 1T0MA 1ADWA 3CFQA 3W0WA 3K72B 3LH8A 4ZAKB 1R46A 1UFGA 2OQJA 5FUOL 4R0LB 4JFZL 5DUJA 5E7FA 4YQXL 3VB9A 1I1YA 3FUFA 3AMKA 4XC1H 4U4BA 2MNWA 3G5VA 2F7RA 1JGVL 1JK9B 4I3RL 1FC2D 5C0CD 1FFOA 2P45B 2WQAA 2V17L 3CSGA 4M48L 2ZX7A 1HH6B 4OZFA 4DAGH 4FXTA 4HXBL 4PCTA 2CWRA 4UT6L 5JHDA 1EDHA 3FFCE 3P2DA 2XOTA 4JFWA 1SOKA 1O9VA 1ZEAL 3MNDA 2WXJA 4N8VG 4L2LA 3U9PL 3L7FB 1ND0A 5DJ8B 25C8L 1T7ZA 3VXPA 3KW8A 3UBFA 2VERA 1E7VA 3RWHA 4M1GH 2AEOA 1KELH 1MCCA 3B34A 1XH2A 4XP9L 1EHNA 1NMCC 4OUUB 1PFOA 5CINL 4XN9A 1NCWL 2KLTA 1F3RB 2LOEA 2DRUA 4D9QE 3SB3A 2WXIA 4XMKH 4WU7B 4EDXB 3L9YA 3BISA 1KT2B 2CM6A 5EWIH 2VJXA 4PJAB 3MRDB 2I7OA 3II1A 3DX6A 3MJ8A 4Z6AT 2F7PA 3HS0A 1IRAY 4G43B 1DQJB 1RVFL 3SGDH 1NCNA 3WS3B 4QNPF 1HL4A 1QFWH 5CN3A 2PUQT 3QQNA 4IKLA 4IOIB 2I60L 2F19H 3FT2B 4J4PC 4X83A 2NYYD 2PO6A 4OJFH 4IGBB 4PJAE 4BXVA 1E4JA 2YXWA 3F62A 3V9FA 3MLRL 4U6VL 4C83A 1W0VA 4ZDHA 4UV4L 1AHWC 4UCFA 4I0PA 4KQ3L 4J6RH 3PYCA 3MJ6A 4MJ4A 2FGWL 2J8HA 4PWIA 4CRPA 4X4ME 1RSFA 3FQ2A 2JVUA 3HEIB 3CZNA 1QBAA 2Y7OA 2ZYIA 4J1UA 4YLBA 3WN5B 1PLGL 3RZCD 3VMNA 1BJ8A 3KGTA 5ALCL 2HVJB 3H42L 3RWCB 4M48H 2JCCB 4KRNA 5C0DB 1KN4L 4M4RB 1U8MA 2FAUA 3IFNH 4U7SA 4WEBL 2A6IA 2IAMB 3NEEA 1GYAA 4UT7L 5K9JL 4ODSH 4WY7L 4CVXB 1D6EA 1DQML 1U92B 1YQVH 4PRAB 3F7LA 3FT3A 1K5NA 1ZLEA 3VFWB 1SDDB 4ONFH 3M1CA 2DLHA 3GBNL 4YSAA 3GB7B 3NVQA 4DP0X 3ZDYB 3MNZB 5KTEH 1ML0A 5FB8B 1CF8L 3IRZA 3GMOB 4KKAD 4RNRB 5D7LD 2VXSH 1GGYA 5E6SB 1BAFL 5JXAL 1JYVA 1MCEA 3QFDB 4CKVX 3U4AA 5LUMA 3UJIL 3CHQA 1OF0A 4FF9A 5DK3A 3LCYA 2BOCA 1OGAE 4FFYA 5KVEL 4NZUH 2Q7NA 5CBEB 3CFIC 4MBRA 4BUHA 2DQHH 2XDHA 5DA4A 1ET8A 3C6SB 3J8F7 1E28A 3EOAA 1EUUA 1G7MA 2V7NB 2B3RA 2ZIDA 2Z8SA 2X6UA 2CQVA 2AQNA 4X7SH 4PLNC 1MW2A 4XP6H 2FBRA 1H5BA 1HL5A 4YZFF 3A67L 5D7IF 1CFBA 3QFJA 4HT1H 3DJTA 3JYCA 1J12A 2FQDA 3BOVA 2Y72A 4UB0L 5HPMA 1GGBL 2E0PA 1AGCA 5IJVA 1UWXH 2VH5L 2WNWA 5GGQH 3BP7B 1NOLA 2BZCA 5C08E 3CGTA 4P48A 4GW1B 4EN3C 3D4CA 2FH8A 2X1XR 1G7PA 2VR3A 3MJWA 2XKNA 4EOWH 4AQEA 4XX1E 2F54B 5I6XC 5CHNA 4Y5VA 1MCDA 1M53A 3IM1A 5E4AA 4ECNA 2CH8A 4JFFD 3ZKXC 1FZMA 1YECH 4KK6D 2B7DT 1IARB 2FJFA 4TLTA 4L3EA 3EO1B 5BV7H 2P8MA 1I3VA 2OW7A 3KPOB 5DUPL 4U6HB 1GXEA 1BFOA 1AR1B 1I3GH 3H1ZA 1BW8A 4YFLI 4L4TA 2CO7A 4BE6A 2Z35B 2NY6C 2HJFA 2H0EA 3F3HA 5HVWA 2R56L 3VI3A 5EZJA 5GS0L 1GAFH 4LOUC 1W72B 2UY7A 3NCWA 2E9GA 3NIDE 4Z7UF 1L6ZA 5CJ8A 3D1MC 4B3EA 1C08A 1XR8B 2OR9H 1PSKH 1RJLB 3SYAA 4EDWH 4X6DF 3MA9L 4ODHL 3MRMA 3O9WB 4GQRA 5EZJB 3WGUB 3F6IA 5CWSA 2EVFA 3RBGA 5L6YH 1C9SA 1DSYA 2VDLL 4X6CB 4X4MA 1R0AH 2CBOA 3MV9E 1AE6L 4J4PD 1EAPA 4L29B 4RETB 1OM3L 2CO6B 5CKGA 2EEBA 2NQ3A 2O5ZH 4I7ZC 1FNEB 1X9UA 3IMVA 4Q9QL 5FYJH 4S11A 4KHTH 3PUUA 3QDJD 3L5WB 1G1KA 3Q1EA 2OMBA 1ZGLM 1KDJA 4TQPA 2O93L 5E99L 5CZVL 5CLWA 1JGIA 2XWZA 4B9YA 3N04A 2FD6L 2FGWH 3PPSA 3SE4C 5E6IB 2BP8B 3VQMA 4BINA 5BVPH 3HUJF 3CBKB 4F7EB 3U2SB 1I9EA 4HETA 4FADA 3KPRD 2BK8A 2Q0ZX 3NJJA 5KBKA 1UCBL 4F20A 4HC1A 1UJ3B 1WIOA 3FU7A 3QDGA 3MRFA 4CN1A 1IC5L 3THML 3S2CA 2RMNA 5FR3A 2WVSA 3WMPA 2P5WB 3PWVA 1AOZA 1E7UA 1BF8A 2FATH 4F8QA 1IBDA 4KKAC 4ENED 5INDA 5JPMC 4K0OA 3NRFA 4NWUH 2Z7UA 2BOCB 1E9OA 1L0PA 5L9DL 3ZE0E 4C54A 5I15H 1I8IB 1JGLH 5FYJE 4QHLA 4UOW1 3MLSH 3ECBB 1DFXA 1MAKA 2J6EL 4LLYA 3PAZA 2FL5B 3V6OC 3MNZA 4MCZA 3GMRA 2PWHA 3PV7A 4L9LA 4UM9A 5F3BB 3EJUA 2E4FA 3TBYB 3RRQA 4HK0A 4CILA 5CEYA 3WG7B 3F58L 3OJVC 4HZLB 3GKWL 1M57B 1QEWA 1RY7B 2V7HA 4UZUA 4XRCB 2Z31C 4H0IA 3VM7A 3RNKB 4U3CA 5C0DA 3NN8A 4HJJH 3CMOH 4Y4KB 1JCVA 5JDSB 4OF8A 3H9SA 3MV7B 1P6WA 1XD0A 3NA9L 3R1GH 5KAQF 3LNHA 4DESA 4NJAL 2XN9B 1PF3A 5JZ7D 3P02A 1P1VA 4J3UA 4Y7OC 1L6PA 5KWYC 3HI1B 4JDEB 3NCJH 5I1KL 4LCIH 4BFIA 3C5ZA 3EBAA 4PJGB 4H5SA 4N8CH 4PAZA 4CADB 4XP6L 1YN6A 2ZSWB 1OAQH 4BFIB 4PGZA 1ZVSB 3ZO0A 4JRFA 3D39E 4CJ0A 4OGYH 5DUMH 2CJ3A 4KKCD 1ZVSA 1SXBA 4DEPB 3F00A 5GZNA 2EUZA 1WFTA 1NUDA 2ZG3A 5ADPH 4L1DA 3O2DL 2ATAA 1QW9A 2EYSA 2V17H 3U0PB 5I18L 3KPRE 4MHHG 1JFQL 4PJEF 1SXAA 3ZRFC 3LD8B 3DMMA 4H2CA 1FI8C 2VR5A 3L3JB 2K0RA 3RKPA 1JXFA 4RISL 1EAOA 3MGTA 4EI6A 3D0AA 1F1GA 1MCOL 5E4OA 4PJBF 5E1HB 4JY4A 1JZHA 1T7YA 3OLIA 3SBQA 2A6JB 2LTQC 3RKDD 5LNDA 5AW5B 5I30L 3CHSA 3FO0L 3AXLB 3CDZB 3B3IB 4HWZA 4YC2B 4Y19B 1QRNA 4ZFOA 2VDNB 4LMQI 2AEQH 3I6LD 2Q2LA 3KG5A 5DZJA 1RZIA 4BGDA 1P5UC 2WCGA 2ODIA 5D2NE 4FNSA 4KJYA 3OXRB 2WLIA 3EG9A 1H3UA 2QSVA 2NCEA 3OWEA 4YPGB 3FQ1A 1TTBA 4P2CG 3ILPB 1OGAA 4P4KC 3L5JA 4OF7A 1W0YT 4KXZH 3ZKXB 1FVCA 3M45A 2QKSA 1S7WA 4BWTA 4PJ9B 3U7YL 2ITCB 3I9GH 1NCCL 4HUWA 4UV4H 4WI4A 2VAJA 1XXFC 15C8H 1PVHA 4HCFA 2B20A 5J6GA 2RGSA 5I24A 3QJUB 3H4FA 3ZE2E 5KSBF 2FIKB 4B0MB 5EUKA 3IGUA 5FFGA 1FCCA 1A6VL 4WUKH 5EZOL 1JDDA 1RULH 1P4IH 1USQA 2E59A 1MCPH 2YD7A 1HSBA 3MRFB 4BKSC 4JPSA 5KSVA 4PRDB 3DV6B 3QXAB 2E9BA 4JN1L 3B9KB 4XPAL 3D3VB 3OKYA 1JZFA 2W60B 3VA2C 4D3CL 4YHIA 3S34H 3FAWA 2PN5A 3UIYA 3VU2A 4IBUA 3VCLA 1TNMA 4N2NA 1CS6A 1Z9OA 3IXTB 3FXIC 4TRPL 5DFTA 4D0DA 2N7AA 3O6FA 3G04B 1Y1UA 3CN3A 3GMLA 4FFYH 2WOYA 4Y5XB 2QQNL 4NM8H 4JFXB 4UI2A 2ATKB 4B9PA 1ZSDB 1M1XA 4MA1C 4QRRA 1YAIA 3CIQA 4XNUH 5K1NA 2UZIH 2EDBA 3AS2A 3K71A 3P9WB 3FMGH 5T1KB 3MRMB 4HJ0D 4UNTA 3V4PA 3G6DH 1CPUA 1CF8H 1QI4A 2VISB 2HFEA 4Y1AA 2E7HA 1F3JA 5DLLA 2XWJB 2A9CA 3QDGE 1QLFB 4LSSH 5D7HA 1JTTA 2XVBA 4L4TB 4PJDF 1A21A 1ECYA 4NWTH 5FWRA 2LV4A 3HR5B 1QFOA 4FFTA 4DO4A 1IGML 3D12B 2VL5A 2UY7B 1SBSL 1F4AA 1RUPH 4DUVA 1FZMB 2EDTA 5L8KB 4AT6B 2YJQA 5HHVH 5ISZA 1D7CA 4F57H 1U8PA 4MA7L 3R4DA 4I9XA 1HFUA 5EU6D 1XDTT 5CFHA 1HAWA 5IW6A 1U8KB 2ICWI 2P5EE 4L4VB 4U1MA 4KI5C 1ZLDA 2PETA 3S98A 2VXQL 1XV8A 2YXVA 3TPUA 2XY2A 3WYRA 4JW3A 3UPRB 1FNHA 3W11D 5F9WB 1HEHC 3BGAA 4TUUA 3QQ4B 4F2FA 4WDIB 5EDSA 3ULAB 1MAML 2DTMH 5DD3H 1LXMA 1E6OH 3FU6A 1HE8A 3PWPB 2XKUA 4XNBA 2Z31B 1EUTA 4KY1H 4OLYH 3SE6A 3WHXB 4MMZB 2FX8L 5JIHA 5IROD 5C6TL 3IMUA 5C09D 2VLKD 5TE4H 5GIRB 3QWRD 2CD0A 2XX0A 2HFGH 3RPIA 2FT6A 4N0CD 3QI9D 2BSCA 5FXCH 4YBHA 1CZ8L 3V52H 2DTSA 3LZPA 2JB5L 4JKPH 5HYSB 4KJPD 5F0LB 4HH8A 3ZDXE 3W9DB 4P49A 1V27A 4AH2A 5JW4Q 5KZCD 3OVUB 2ARWA 4ACPA 3WNIA 5L6YL 3A6BH 4W4NA 4YDMA 3TEWA 3VGAC 4MDJA 1BX2A 5PAZA 3FT3B 2AJVL 4F92B 3GLAA 2W0PA 6TAAA 1UD2A 3QO0B 1YJDH 2EQDA 4G6MH 1QHOA 4K9JA 2R29L 4NKQB 2K7PA 3DI2B 1C5CL 3PP3H 3V0HA 4E9VA 1RZPA 4N0UB 1MY7A 4X6FB 2D7MA 4LU5L 4GAYA 5TQ2H 1B0IA 3S35X 3HG1B 4HBCH 3L9EA 2FEJA 5TD4A 1R5WB 2G30A 3T6QC 4G8GE 1WF5A 1A14H 3P11H 5DEFA 4RFNB 3LTVA 3P3SA 3VFSA 4AKPA 1O9ZA 2XKSA 3C5XA 3MRQA 5FGCB 1U8NB 2X4UA 4H0HB 4WI0B 4NQDE 1VFOA 1U0QA 3M46A 1AGEA 3DSFL 3MUY1 4NN7B 4ZTOH 1MJJA 3X1NA 4Y2NA 4LLUB 3TJHC 2I24N 5D6CB 2OMVB 3UJTH 2RFXB 3MCLL 1CDIA 1MZZA 3WEOA 5LJYH 1I7ZA 3FUJA 1CIDA 5E51A 1JGUH 1HXMB 4Z7IA 4NJ9L 2YRBA 3N1GC 4XB3A 4X2UA 3VSVA 5IROA 1U91A 5I15L 2XVLA 2L04A 4GY4A 3BYTA 4YQXH 2Y3AA 1WS7A 5DJAB 1ROCA 5TE4L 4ZQTA 5D1ZC 4JZJB 4J3OC 2A3TA 1FIEA 4D0BB 3CFUA 5EU6B 2YD9A 2B77A 3DX6B 4AE0A 1BVNT 2EVJA 5EIIG 4CVUA 4X9BA 4O2EA 4P5TC 4ZFOL 1E8XA 4WSKA 1MFCL 2R0WH 4FG2A 4XN2A 1VHPA 3CFMA 5EUOA 4X0NA 5A3IC 3HFFA 4MYPA 1WBXB 5J1SC 1HK6A 1H8LA 1KCKA 3MODL 1U8CA 3T04D 1T89A 2CIIB 1CD1B 1FNGA 4HAFA 1N7MH 4HSAC 3GMRB 2Q3XA 3OD3A 4LBAA 4GUPB 4ATTA 3L3HB 4A7UA 4M6AA 3U2IA 3BQUD 1ZHNB 1GS8A 5C6WH 4WFEE 5JNYB 1UEYA 3BP6B 5HHPB 1FYHB 3WU1A 1DCLA 1L7IH 3DBXB 3QI9B 4JEGB 2JFCA 1U41A 1OPOA 2EEAA 3WFEH 3CK0H 3F7QA 1VPOH 3WFCH 5MEQA 1TQCC 3BHBB 3W39A 4HOZA 1ORSB 1R34A 4BZ1A 4Y5YB 3MRCA 1JWMA 4ZAKD 2C1OA 4PUBH 1M05B 1JK9A 5IHLB 4WW1A 2YGNA 4JO2H 4A2DA 3VFPA 4Z7NF 3L1GA 1XF2B 1L9NA 1XF4A 4C59B 5ENWA 2E27L 1Z2KA 1F4YH 4KK5C 4JX0A 3QARA 2DQJH 5DHEA 3CFEB 4B53A 1JFQH 1CFMA 5KW9L 2G60H 2IH1A 2Y69B 3TO4B 2XPGB 4Y2DB 5I9QC 3VH8B 4Y16B 3BAYA 2C3VB 4O9HH 2VZUA 3KPRA 2CE6A 5FCUL 4B60A 4CSSA 2BRRH 2W5PA 3O45A 2GW5A 5B1BB 4E9YA 1UT1A 1QA9B 4R26H 4AIZB 3KE0A 1U58A 4KJPC 5TPWH 1V3KA 3OX8B 3P2TA 3BP4B 3FCSA 4UDTB 1X7TA 5D93B 1IVTA 5AL0A 3OGCB 3HJEA 3P1VA 1JTOA 4BK5C 5JORB 4FHBD 5D1QB 4R3SA 2WVTA 4ZPVA 1A7RH 2WZAA 3L3DA 4YHKL 2R15A 5CIPH 4J3TA 3GJFH 3IPBA 1S7XA 5DR5L 4L4VE 3WE6A 4AVHA 5DQ9B 3SKMA 3B5GA 1VJSA 5C0CE 4BDVB 3FHEA 2OZ4A 1RJLA 3SJVD 4QRPA 1A3ZA 1LQBC 2FWOB 4UOW0 4BH8A 3OAYK 2K6ZA 3QORD 5AAWC 1TEGA 3VX1A 2XETA 1N5YL 4Q89A 2WXHA 5IVXF 2F8OA 4ABWA 2AKRB 1D9KD 1WTGT 3W0WE 4IM8A 2XIBA 3IDYC 3CN4A 3HFML 4AK2A 1E90A 3WEMA 5IBTH 2HT3C 1SHMA 4JM0A 1SQMA 2F61A 3TONA 2IC2A 4XP5L 3O2DA 4KMTH 1IC4L 2XIDA 5CMAA 1IZJA 1OP3K 4KKQA 3DBSA 3DOSB 5LVEA 2QKIA 3TTYA 1MCBA 3DHJA 1BOGA 3OKEA 3SDCA 4TSAH 3D6GA 3TA3D 4CMHC 3VAEA 1W8OA 3IJYA 3ATAA 3T09A 3CC5A 2MPVA 2OJEB 3UTTB 3V6ZB 1UACH 2E4TA 2QZ5A 5DVOA 1MCSA 4U1KA 4DP8X 2IVFC 4N90E 3B83A 3EJYD 2ADGB 3ISYA 1BOYA 3CC1A 2XV0A 3ZZSA 1TMQA 1P4LA 1TZHA 4U1SB 1FN4A 3MACH 1MXGA 5D7LB 1O6SA 3SO3C 1S8DA 4JM2B 3EBIA 1J48A 5GJTH 2APVA 1ZA6B 1OP9A 2WAHA 2PTUA 3CPLB 3OSKA 2OR8A 2Y06H 1T66C 1DO6A 1TQBC 2B4CC 4ZUVB 1FRGL 2LLNA 3GSWB 4JFPA 1GGIL 5I8EB 5F6IC 3E2HC 2IADA 4UOJA 4E5XA 3MYJB 5D7SH 4M02A 3HLAA 2EIJB 2HTKC 5F97E 3QXDB 3GIVA 4QXVA 5GS0C 1MCLA 4J3OF 1Q8MA 2OR9L 35C8H 1VB9A 3GSQA 4U0RB 4XXDB 4EIUA 2Y5TB 3IAQA 5KBNC 4ZSOE 4XNQA 2ZOLB 5AKSA 4JZJA 1H3PL 1RV6X 5ENWB 4ESKA 3FN0L 1RFDL 3BVWA 3BN9C 1JI1A 3WY2A 1MFEL 2XY1A 4YXLL 2VSDA 1S2EA 4WHYG 3DDFA 2ZONA 2BSRB 3FO9A 1YY8B 1HXMA 1A7OH 2RR3A 3WNOA 2AITA 1ED3B 1LWJA 1T1ZA 4G8AC 2BM3A 2DL2A 4P3CH 2NW3A 1ACXA 4H1LG 4GG6A 4ORGB 4Q74A 2E56A 5LLIC 1KENL 2YBGA 2JQAA 4IDLA 4B7IA 4JY6A 3T0WA 3BP5A 4RH4A 2GKIA 4HBQA 5AALA 1E3ZA 1S7UA 1JWSA 2D7QA 1BAGA 4XC1L 3IWVA 3EJJX 3FQ4A 1YNLH 1ID2