1JXFA

Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Backbone dynamics of plastocyanin in both oxidation states. Solution structure of the reduced form and comparison with the oxidized state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Proton transport
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxfA00
3OMAB 3X1NA 4JHVA 3QJTB 1AZCA 2YARA 1WS7A 2HXAA 2VN3A 5FC9A 2YAOA 1JZHA 3FPYA 3KW8A 4FA7B 4GP5B 4QLWA 4UANA 5B7EA 3GDCA 3IN2A 4DP6X 4KOBA 1NIEA 1J9SA 3FU9A 3S3BB 3G5WA 1WAEA 2NRDA 2QT6A 3BVDB 3AG4B 3ABGA 1AR1B 3CDZA 1M57B 2PPEA 1E67A 2FQEA 3AG3B 2XUWA 4HCIA 4UF7C 1TEGA 4YL4A 5I5IA 4FAAB 1IBZA 2EIJB 1ET5A 1J9TA 1W6LA 1AG6A 4KNUA 1ZDSA 2PPCA 2OJ1A 4P5RA 1X9RA 4YVUA 3KW7A 1PMYA 4DP0X 1TU2A 2AZAA 4A2FA 2IWFA 2N0MA 5B1BB 2CAKA 1ASQA 5I6PA 4P5SA 2CBPA 1RCYA 3ASOB 3S3CB 3TA4D 5D4IA 4BXSV 4DP8X 3GYRA 3T6XA 4HZ1A 3ZIYA 3QJQB 1BQ5A 1OE3A 3BQVA 4KNTA 1SF5A 3ABLB 4BWTA 5I6MA 2A3TA 1KV7A 2WO3B 3FQYA 3FS9A 2I85A 2BHFA 4DP7X 3OD3A 3QJVB 1PNDA 2I7OA 3NJNA 1QNIA 1HFUA 3H4HA 4A67A 3OQRA 4YSCA 5AFAA 3SBPA 2IDQA 2YAFA 4DPBX 3FQ1A 1TEFA 4YSQA 2QPDB 6PAZA 1BYOA 1L9TA 1FFTB 1PZBA 2GC4C 4YSTA 2FQFA 2BWDA 4BK5C 4DP9X 1NIAA 2VM4A 1YLBB 4BWUA 4DP1X 4UAHA 2IDFA 3NSFA 4E9VA 2RACA 1AS7A 2GIMA 3T9WA 3CG8A 3H4FA 1AZNA 2GSMB 4KNSA 1E5YA 2XXFA 1GS7A 1AAJA 3U25A 1JZEA 1M56B 2CCWA 3MBWB 1WS8A 2B08A 3HEIB 5TK4A 5I6LA 3AW5A 1AZUA 1MDAA 4M3HA 1W8EA 5B7MA 3C75A 4AI7A 4E9QA 2OCCB 1BAWA 1OE1A 2H3XC 2UX7A 4YSRA 3NSYA 3CDZB 4CSPA 1NTDA 2FQGA 2CALA 1AZBA 2UXVA 4DPCX 4WTQA 1NIBA 1BQKA 2BO0A 2GBAA 2PP8A 1ZPUA 2Y69B 1E30A 1F56A 2PP9A 1V54B 3FSWA 2UXTA 2WSDA 2PCYA 2YAEA 3AY2A 1AANA 2VW4A 1JZGA 2AVFA 3PLYA 3SQRA 3QJSB 2XLLA 1GS6X 4KO6A 3IEAA 4Q89A 2W8CA 4GY4A 1WA1X 1HAWA 1V55B 1XB3A 4BXVA 4GP8B 1AACA 2UXGA 1OCZB 2FQDA 2XWZA 1A3ZA 4PCYA 2FJSA 3PXLA 1OCOB 1RZPA 1N70A 1NIDA 2ZONA 2TSBA 4W1TA 4DPAX 8PAZA 3ASNB 3OMIB 3ERXA 4G71B 2J56A 2H47C 4Q8BA 4NB7A 3WIAA 4JKNA 3WKQA 3EHBB 1PY0A 3FYEB 3T71A 3UACA 4F2FA 3DTUB 1OV8A 2IWEA 2P80D 4L0PB 3V9CA 3FYIB 1GYCA 4AKQA 3HB3B 4YSEA 2XV0A 3ZX1A 2UX6A 2DYSB 3RYMA 1NICA 4X4KA 1X9UA 1AOZA 1PZAA 1WA0X 1JERA 2VW6A 2WO2B 4DP2X 2X87A 3FU7A 1BXAA 3NSDA 1A4AA 5B1JA 3TBBA 4YSAA 4A66A 4E9YA 2PPFA 4AZUA 1JVLA 1J9RA 1A65A 1ZIAA 1KYAA 3SBRA 3QPKA 1L9PA 1ET7A 4HAKA 2R7EA 1ILSA 4JHUA 4A2GA 1ZV2A 2BWIA 1EZLA 1NDTA 4G7SB 2EINB 3NP3A 4E9WA 1JXGA 1EHKB 5ANHA 3UAEA 4YSOA 5I5JA 3PCYA 1SDDA 4G70B 3T6VA 1PLAA 2EILB 1NIFA 3QJUB 4W9ZA 2AZUA 2J5WA 5I5MA 1AIZA 1IBYA 4ENZA 2GC7C 3FQ2A 1PAZA 1IUZA 2EIMB 4MFHA 4GYBA 3T6ZA 1MZZA 1XB8A 1J9QA 3FSVA 3QQXA 1OF0A 4NAJA 4AKOA 5I26A 3NJLA 5B1AB 4KO5A 4HCGA 2FWLB 2VSMB 2ZWNA 2XU9A 3EH5B 2UXFA 2HX7A 3EH4B 1A4CA 4G7RB 3EF4A 2ZOOA 3IN0A 3CVCA 1ADWA 1OCRB 2IWKA 2FT8A 1BYPA 2Y1AA 1FA4A 2FNWA 3X2QB 3DKHA 1ILUA 4E9XA 2HLEB 2DV6A 2HRHA 1KBVA 2JKWA 1JXFA 5I28A 3NJFA 2XYBA 2H5UA 1JOIA 3H56A 2HZHA 1PLBA 3CVDA 1MG2C 3JT2A 1FWXA 4HCFA 1JXDA 3NJGA 3NJIA 4QKTA 2GB2A 4AKPA 3SBQA 2AANA 5AKRA 1NPNA 1SHWA 2YQBA 3DIVA 2YXVA 3GXUB 3WI9A 2HX8A 2VSKB 1QHQA 2QPEB 1IKOP 1GY1A 3FU7B 5D4JA 4BDVA 2PPDA 3PPSA 2BZCA 3WKPA 3X1BA 3ZBMA 2DWSA 2XVBA 2HRGA 2PCFA 2PPAA 3OM3B 1PCSA 2XXGA 1MG3C 4A2HA 4AX3A 2IDSA 1PF3A 1ZDQA 4GP4B 2Q5BA 2BP8A 5IY5B 3NJKA 2X88A 1AZRA 4BWWA 1SDDB 1TKWA 4N8UA 3T6WA 3QJRB 3PAUA 3N55A 3NJHA 3V9EA 3EH3B 1SHXA 2GHZA 3CVBA 1JVOA 2BP0A 3NJJA 1OOWA 3S8FB 1E5ZA 1T5KA 1W6WA 5D4HA 4HHWA 5AZUA 1ETJA 2FT6A 1L9OA 2CUAA 2QDVA 3S3DB 5B7FA 2FT7A 1ID2A 4HHGA 4ZK8A 1KCBA 3UAAA 3TASA 2XX0A 1PNCA 2BW4A 2DYRB 4E9TA 2CJ3A 4YSSA 4YSUA 3AG1B 4A68A 2LLNA 2VM3A 1RZQA 2DWTA 2AFNA 4E9SA 5I6KA 4CSZA 4M4RB 3S8GB 1AG0A 4YSDA 1KDJA 7PAZA 3UABA 1NINA 4EF3A 1L9SA 1CURA 4K9JA 3JTBA 3MX0B 3NP4A 1CYXA 1OE2A 2HX9A 1RKRA 2FTAA 3UADA 3FPXA 1QLEB 3X1GA 5A7EA 3NT0A 1OCCB 3FSZA 3D12B 1NPJA 2PP7A 1VLXA 4A2EA 1WA2X 1BXUA 2ZXWB 1AS6A 1ET8A 3X1EA 3X1FA 3ZDWA 2P80A 1L9QA 5E9NA 1AQ8A 1ASPA 5I6OA 2E86A 3IBOA 3AZUA 5TK2A 1BXVA 3FT0A 2JFCA 1PZCA 2TSAA 3ABKB 3L45A 4DP4X 3FSAA 4HIPA 5LDUA 1KCWA 2YAQA 4G72B 4G7QB 4BDVB 2XV2A 4KOCA 4RH4A 3AG2B 2W88A 1AS8A 2QDWA 6PCYA 1CC3A 1SNRA 2IDTA 2JXMA 5F7BA 5B1KA 2VW7A 3NJMA 3NYKA 2BW5A 3PAVA 4HALA 1SF3A 4GXFA 1A8ZA 1DZ0A 1XMEB 2BP8B 3TU6A 1J5CA 3CZUB 3UGEA 2IAAC 1CUOA 4YSPA 5B1JC 1E65A 1MZYA 2J55A 4PAZA 5EHFA 2EIKB 1B3IA 1ASOA 3NSCA 1URIA 2BP0B 2MRYA 1SJMA 1BEXA 2DY2A 2YAPA 1KGYE 2B3IA 1JZIA 1L9RA 3FU8A 3TBCA 1DYZA 2GI0A 9PCYA 1KDIA 3WNIA 2BZ7A 2YAHA 3IE9A 1UATA 4N4YB 1JZFA 1NZRA 2PLTA 2Q9OA 1V10A 4WKXA 1GW0A 1I53A 5F7AA 1KBWA 5PAZA 4E9RA 2MTAA 1A4BA 7PCYA 1BQRA 1SFHA 3ABMB 1XB6A 1J5DA 1GR7A 3OMNB 4YVNA 2R7EB 3WNJA 1CYWA 2OV0A 2XV3A 2XX1A 4A2DA 4KO7A 2YXWA 4NERA 1HAUA 1PLCA 4TXVB 2YAMA 1JZJA 4F2EA 4F7KA 1SFDA 2I7SA 5B3SB 1GSKA 2IH9A 1ZIBA 1NWPA 1R1CA 1GS8A 2IDUA 5I6NA 3PAZA 1N68A 4DP5X 1M9WA 4KO9A 3N2JA 3WG7B 2J57A 1GY2A 5PCYA 1IC0A 1NWOA 2IH8A 2VMJA
chains in the Genus database with same CATH superfamily
1DJSA 4W68A 3QJTB 3PQYE 4MJ5B 1P4IL 3KWWA 4P2OD 2A74A 5DHMC 5IBUG 3WLWD 1GZQB 1F58L 2NYKA 3FQRB 4KQ4H 4NRYA 3T4YB 1FFQA 2K7PA 3BZFB 4NQDE 5BRZA 1FZMA 3PG2A 2O5YH 1OOAA 5ETUA 1UC6A 2ZKXA 4RMSA 3G5WA 1VKXB 2VLKB 4DQOH 1M7IA 1MF2H 4FXTA 1UXLA 4JHWH 1QX1A 5HY9A 1T7ZA 3UDWC 3HZVB 4KAQH 3S34L 1BZ7A 2VLJA 1IEBA 3ARED 4XB8A 1AZZC 2CHDA 3ILEA 1U8MA 3N41F 4OGZA 4ZTPL 2C9SA 1I9RL 5FYLL 1Q9WB 1J12A 4V11A 4OQTH 4EE2A 2XWEA 2Q0ZX 2WWKO 5DVLA 4EI5C 3F3HA 2P9RA 4Z7QB 4YGVA 3L9RA 5CM1A 2GFBA 1JP5A 1QASA 2VRKA 2BVPB 1T20A 3GYRA 4H26A 5JHLA 4B6ZA 2Q20A 4KRPD 4U6HA 3UYRL 3DX7B 3OF6A 2ZXCA 4OLYL 5FA3B 4DKEL 4LOUD 2QMJA 5F3BA 5I19L 1BDYA 2F15A 2PR4L 3NJNA 1SY6H 2YZ1A 4XN8A 1S9YB 1OWRM 1AR1D 3IMTA 3BFWA 2ENYA 5CJQL 2WINB 2Z8VC 5AVQB 3P2BA 2BXYA 5EOCJ 3K2IA 3MCG1 4DPBX 4F33A 4PYGA 1RUPH 3HC4L 4KK8D 1IGJB 5BRQA 2CIIB 4RMBA 3LNHA 2CK2A 3FUKA 1GGCH 5DTFB 2KERA 3KVQA 2CHXA 3FFDA 1VACA 3KYMA 3QCUH 5EU6D 3S35H 5L2KA 4ZW6A 1NIAA 2ORBH 5CEYA 1GJWA 2V2XA 5DJAA 4QGTA 3HC0B 2H32A 3QIUA 2I07B 3QNZB 3CG8A 3UJIL 2UYLB 5IOKA 1E5YA 2HFEB 2NNXA 4XBEL 5DWUL 1HYSC 3UZQA 1CLCA 1OHZA 1D6EB 4LB8A 5FYLE 3F7YB 3T0AA 3LKRA 2LAAA 1X5YA 3DTXB 3PF2A 2VN7A 1Z5LB 1KXVA 2XZZA 2CRIA 5J6HA 3SY0A 1HEJC 1L3NA 1ZEAH 2ARWA 2H3XC 3PFUA 3QRBA 4OKDA 4EI5D 4KROC 4CSPA 3WEXA 3RFZA 4N1EA 1BWWA 3CZEA 3M86A 5F7YC 2A6IA 4G3YH 1UT2A 1SZNA 2EUXA 3K91A 1KGXA 2G5UA 3QXAB 1AC0A 2Y69B 2YD8A 1YEHH 3CN0A 5EOCH 3MLWL 5BJTB 1MFBH 2R1WB 3BZ4B 3U4BL 1BF8A 3FO1A 3BH9B 1TU2B 2NNAA 1AANA 3OSVA 4GRWB 3VB8A 1J7VR 1JZGA 4F8PA 4P4KA 1QVOB 5D96C 4DK3A 2WZPA 1XGRB 1FZJB 1YNTA 3MCLL 4HF5H 4LSVH 3QXUA 4GP8B 2Y7OA 5BW7C 4J12A 4N1CA 4NNYB 1RK1A 2DWDB 2R69A 2ZONA 4DPAX 4UM8A 5I8EB 2AI0H 5JHDB 2H1PH 4MJ6A 4P5MB 1O6SA 2EXWD 3MA7B 4Q8BA 2BSSB 1VPOL 5KYXA 1TR7A 4UDTB 1I7TB 3TT3L 5F9JA 3U9PH 3KYNB 4Y2OB 1H8SA 2VXQH 3PHQB 3MODH 1FFRA 3LKOB 4K7PY 4GSDH 4L4JA 5H37G 3UYPA 1MNUL 1ORSA 3RVXC 5CKAA 1G1YA 1E40A 3RWIA 1HYSD 4I4WB 1AGBB 4NJAH 3FTUA 5HHMB 4X4YB 1NGZA 3CXDL 3VXUB 5FO7A 3BIKA 2PTVA 2VJ0A 5IT2H 5IWLC 4NT6A 1QRNB 5FECA 4QRTB 2QV2A 2Q8AH 3QPXH 2PPFA 4KROD 4ZUUB 3M1BA 3FO2A 3SYQA 1PD6A 2DL2A 2WGNB 3RIFK 4IRZL 1G4MA 4I9XA 3S36H 2AMGA 3X3GL 3EBGA 1A3RL 1A6ZA 2J6WA 3MUUA 4XWOD 4L2LA 5E6ZA 3RPIA 4YMPA 3PWVA 4G9DA 3HN8A 2ZD0A 4TUKL 2GSGB 4KZEL 1OM3H 4JCWA 2E6PA 5JDSB 2XKNB 2CPUA 4PLOB 2C34A 2X1XR 3MLVL 1IBYA 4OW6A 3D08A 2XETA 2XZQH 1PPIA 4F7MA 5J13B 1MJUH 4L4VA 3MRGB 1CGUA 4HSAC 4HDIB 3D3VE 4KMLB 5CINH 4LOEA 3GHPA 2IC2A 4QXUH 1TJIH 4B9KC 2BS71 4XAWL 5EF2A 2KYIA 2J5LC 1NANI 4KPHH 1MI5D 1N9PA 3DI3B 3QR1A 4LIQL 4P2RB 1A7QH 1SJVA 3O0LA 3ZU8A 3I74A 2EDJA 2CDEB 3X2QB 3NH7H 1E8WA 2VWEE 4R8WH 5F0JB 4ABUA 1R9FA 1U8NB 3C2AH 3PHAA 2FSDA 1F3RB 4TVPH 4B5ZA 1JZ2A 3L7FA 5BXFB 2HT2C 4GMSH 1U91B 1LO4L 1W2KT 2IAMB 3H56A 2HZHA 4XX1E 4ADJA 1JCVA 2LVCA 3NFNB 5GGUB 3JT2A 1Y6KR 4K7PH 3AT9A 5DF0A 2E27H 5A43C 3BWAB 4JRXE 4N2FA 1NDGB 2GEQA 2MMXA 2W59A 5D6CB 2AEQL 4IBSA 1QNZH 1T4WA 3DIVA 5AKSA 5ESVA 5D7EA 4D3CH 2PUQT 4GJTB 3QDJB 5HDRA 2Y07H 4ZW7A 2Y3AA 3WNPA 3LS5L 4XXWC 3MRRA 1S7UB 4KH2A 1JDAA 2YS4A 3K72A 8FABB 1R5VA 3BZEA 2ATPA 4R4FL 1T21B 3FTZA 3VJ6A 4A2HA 4H8WH 4KI5E 4NNXA 1IBHA 2AJ3A 1FC2D 1QA9B 2IDSA 2XWRA 3N85L 3O3DA 3DPDA 1IGCL 3MJ9L 2XBZA 4IBZA 4MCMA 5CSGA 4AYEC 3NCMA 4WFHD 5CWSA 1BGXL 5IVZA 1Q9OA 1J0ZA 5DFTA 3VXRD 1XH3A 3QH3B 3LKNB 1FNSH 4URTB 3UAJA 2Q8BL 2XA8L 2CLZA 3EH3B 3K6DA 3E2HB 1YEKH 4LIQE 2J1ZA 2ZZUT 3QNFA 5J3HD 4DCQA 3NJJA 1F02I 3MXVL 5ESQB 2OMTB 2WQSA 3QUZB 3MMEA 4XMKL 3DDFA 3S37H 1B4JL 4EOWH 5AB0A 1HN1A 4LRNH 1GHFL 3ZRCC 2H6PB 3P77A 3ROOB 4D0BA 5SWSB 3MQIA 5IHUL 1RZKH 1KN4H 1KELL 4L4TD 1JFQH 3P30L 4J1UA 2XX0A 1PNCA 2NXZC 1XIWA 2Z1KA 4Y4FB 1RZQA 1WLHA 2WM0A 5EUOA 1NL0H 4E9SA 2HT2D 1ACYL 2BNRE 5MENA 3H9HB 4MNHB 1IFGA 2Z93B 3DUHA 3NCYS 4V1DD 4GRLB 3TF7C 4ZMOA 4JFQA 3G5XA 4ZAKB 5D93C 4MQSB 4QRRE 5ITBL 1OP5K 3RVWC 3EFDH 1EZVX 3MNZB 5ERWB 2XZAL 2VDLB 3RGHA 1CD9B 3D85A 3LIUA 2JQMA 1AGDA 3ARDD 4XE0A 1KJ3L 1AS6A 1PJWA 5J56B 1CG9B 3KDPB 3LZFL 1KBPA 1IE5A 2OJEA 4BYHA 4Q9RH 1UKTA 1W72B 3B9KB 3FFOA 4ZNEE 3R0MA 2VDQB 4ZMVA 1OGSA 2D0HA 4LHUA 1UENA 3NGBB 5GHWL 1TT6A 1DQQB 3K0WA 4HIPA 3UP6A 1LE5B 3WMPA 2NZIA 1OTTC 1B6UA 3MJ7B 4MDIB 3V4VB 4D9QE 3CFDB 1D5IH 3K2UL 3VWJC 2VRAA 3WBDA 4YO0A 2XN2A 3HBZA 3UPAA 1UQSB 4HHAA 4J3UA 1FH5L 1CT8B 1FGVH 2J4WH 2XRAH 2R23B 3WJLA 5IVXA 3OKEA 1GJUA 5KOMC 2GW5A 3VQMA 5FK9A 1TJMA 5I71C 3CDYA 1F4XH 4IIQB 1MFVA 5DVMA 4N9OB 2CRMA 1OXYA 3V4UH 1CTNA 3F84A 2AQPA 2P5WA 2YR3A 3LKSB 4HFUL 3KWTA 1QG3A 1Q38A 3ZGHA 2F8XC 3ULUL 2WUBL 4YJZL 2NXZD 5L4MA 2BVUA 5D9SB 4GRWF 1CR9H 4A39A 3EGSA 1RULH 3OKNB 4AGOA 3FULA 2BIOA 3RU8L 1T89A 3HHSA 4QRQB 1VCAA 4YFLF 2NXYB 4ZFZB 4XPHH 1T0NA 1UATA 4UWQB 4BHUI 2X89D 1RL1A 1UA6L 3RVWD 3BGFB 3SZ6A 3RGVA 5E5RB 1XFPA 2HKFH 4PGEB 1J8KA 1J11A 1INQB 5A2KH 4ERSH 4WRLA 3KPLA 3L1OL 4OGXL 2QSTA 3KBPA 1BQRA 3MREA 4JFEB 3CMGA 2DQTH 1PKOA 4JUSA 1MWAL 1QWNA 3OQ3B 1J5DA 1GR7A 1TVHB 5ICXB 4YVNA 3QUML 2JI2A 3QVAA 2K8QA 2LHAA 1FHGA 3KPSB 4TTDC 5A6MA 2GTZA 2NQDA 2VZUA 4HS6B 5SWZA 1OTTD 1EDQA 2I24N 3O81A 4FNSA 3VWJD 1A1NA 3L5HA 1W15A 4S2SB 1A25A 5FM8A 3SZKC 2YD3A 3IJYB 4GS7B 4NRXA 4NQCA 1IC7L 3MV7A 1FL6B 1QUNB 1VFMA 1ZS2A 2QMKA 3QDMB 1HWWA 4MASA 5KANG 1JYNA 1V7NH 3KH3A 4CC0A 5C7XL 3IXAB 3AAZA 2VLLA 3NZHH 3NEEA 5C0AB 1R33A 3TBSA 2Y2YA 3WEOA 1PY4A 1FVCA 1Z3GL 4H8WC 1DBMH 3U30B 1XVSA 4I1RA 4LHQB 4PEEA 4PY7A 3GSQB 3N1QC 2P43B 5A2JH 4ZFGL 3DYOA 3JTTB 3MRKB 3EJPA 3VFVB 5CR1A 2F58L 5EU6E 4L8CA 3ECQA 2YMXH 2DWEA 2I60H 5DJ6A 2EXTA 4OCLC 4QLWA 5JPMA 3IFOB 2ZCKL 3GXNA 2ODIA 2UY7A 3ARBC 1ZT1B 2DMKA 2J6EA 4Z3TA 1DBBH 2XA3A 3GSRA 4HOMA 2EADA 3BVDB 4K07A 5FEBA 3EYSH 5C07D 3CVIL 1KGIA 3H42H 4HXAL 1TSHA 2FQEA 3VFRB 5D71H 3OLDA 4PGDA 2EO7A 2ZUSA 4FAAB 2Z34A 1IBZA 1JNJA 1RZKC 2UY6B 4FQHB 1AY1H 1MKFA 1YN6B 2ZXGA 4AZ8A 2PPCA 4FP8H 4K9EC 2PYEB 1X9RA 2JWYA 3OXSA 4U1MA 4TVPD 1HHIB 2BJMH 4POYA 2JMRA 3AITA 4XXCA 4MD4A 4MAYC 1RPKA 3GINA 3X3FL 3LHAA 3ZE0B 4P5SA 4TTDD 1KGUA 3FU5A 4FFYA 3MV9E 5CHNB 3W57A 3NZ8A 4JG1H 5CU9A 3MNWB 2WO3B 5DMJB 1MAML 1M1XB 2DLFL 4U0RC 3QHFL 2R2EB 4JVWA 1QLRA 4MNGE 5BS0B 3HVDA 1HFUA 3KVPA 3OJDB 4A67A 1RURL 3UBHA 4QRPA 5FHAL 4FLQA 2YKLH 4YSQA 3A6OA 3TNNB 4AH2B 5JHLH 1OKEA 3GXIA 1EEYB 5MEQA 4NM8L 5A40E 4MCZA 4N8CH 1FFTB 4ENED 2GC4C 1IGYB 5DGRA 2D7TL 1X7QB 4AIZB 1AMXA 1DSWA 1R6VA 1EVTC 3HG4A 1EFXA 4LLYB 1CLYH 3MJGX 1MFAL 4UT9L 3MRMB 3OAUH 1MHPH 3MLXL 1LO5B 2Y7SA 2EO9A 3EADA 4EDWH 2H45A 1QSFB 1GJIA 4JFXB 1VZHA 4RFOH 3ARBD 4DPRA 3MRBB 1THAA 4L1TA 3V95A 2LFEA 1WK0A 1DO5A 3I6LD 1FYHB 3LHPL 1KJ2L 3MX0A 5B22A 4AG4L 4B27A 2WP3T 1WT5A 3RY6C 3FQ4A 4J6IA 1KTRL 3K4DA 4GQ9H 2Q3XA 1DE4B 5JW4Q 1DVTA 2VM9A 1IAIM 5IREA 5EDSA 2H32H 4OI9A 3WAJA 2OI9C 3OPZL 3BP7B 2WNXA 3LRGA 4MAYD 3D2UD 4WY7L 5G5DB 4JJ5B 4NHCL 1I8MB 2PP8A 1CBVH 4DTGH 2FGWH 5JA9A 1C1EL 1D9KA 4HLZH 1K4DA 1T22A 3TJPA 4JW3A 2YPKB 2O5YL 3UTZA 4OJCA 1TPXC 5SX5K 3Q6GH 1LEGB 1DLFL 4DQOL 1CFQB 1IM3B 1EEUA 4DUVA 1WA1X 2QR0B 4O9HL 4XN9A 4ZUVA 3S97C 4JHWL 3TO4A 2OW6A 4LZKA 3VTTA 1UFUA 4KKCC 4ATWA 4BH8A 4X9GA 5T3XH 3H9ZA 5D1XB 4AV4A 1HXYA 1YQVH 1OZUA 4LLWB 5CFHA 3DUUB 4FNQA 5D5ME 3V6FB 4HIJA 3RIAF 3GSUB 4RGMC 3DO7A 4Z8FH 1YAZA 5E56A 3LN4A 4LVNB 3VFOB 2W81C 5ICYB 5BVPL 3QEQA 4JFDA 2XZCH 5I66B 4ANXA 1AGCA 2QGCA 4M3KB 3LPOA 1FL3B 5ICUA 4RFNC 2LLGA 1HH9B 3F01A 3IETA 4HWUA 2R69H 4Q6IA 4X8CA 2V5RA 2DYSB 1MCLA 4JY6A 5E8NA 4RA3A 4G8EB 2VQTA 1BFVL 1FVDB 3NACH 4FLSA 4DT2A 1MFMA 2Z7ZA 4PRHA 4F8QA 4ZG1A 4I8DA 3TF4A 3VXPB 2AK4A 5DC9B 2YRZA 2NY5C 5B1JA 2XI9A 1BSIA 1RUPL 4JDZA 4N5EC 1VADA 4H2CA 1ZIAA 4H25B 1CXKA 2WCSA 2E56A 1DJIA 2F54E 5HVGB 3O9WB 1NCDH 2HN7A 4RGOH 3GNMH 3S7GA 3QCUL 3HBGA 2BWIA 3JYBA 2ORBL 3E3QC 4YDJA 1RV6X 1EPFA 4J8QA 3GRBA 1SDDA 2A74C 3WO3B 2PCXA 2P47B 4FADA 4EZLA 3CN4A 1JK8B 2EILB 3SD5A 4MZ3A 5LCVL 1S3RA 3GJFB 4NIYE 1SHSA 3H3PH 4OGAC 3DX1A 4NN6C 4UCFA 5A6IA 2DI8A 4KKCD 4ADGA 4WFHE 1C12A 2HRPL 4X0KB 3RY4A 3VXRE 3QXTA 3ZDZE 3CX2A 2RMNA 3DMMA 3P02A 4WV1A 3LH2H 2MNUA 3SCMB 3NJLA 4NO5A 5HPMA 4N26A 1LWJA 5LN8A 3ZUNC 3TESA 1U92B 2D4FA 4RVBA 3LPPA 1U8HA 1D6VL 2GCYA 1MREH 3BAWA 1YA5A 3AT0A 4G3YL 4FZEH 4R7NA 4F7PA 4BE6A 3GBNH 3CFUA 3F6JA 3WLBB 4F15B 5GGRY 4MMXB 3TBYA 3I02A 1ZD6A 4YHYC 2DTSA 4X2UA 5CCJA 2OMXA 3EYUL 1R17A 1RP9A 4YR6B 4L4TE 1LE9B 2BRQA 4LNRB 5F89A 4PJCF 1Y07A 1NAKH 4APXA 1XZ0B 1N5YH 3EFFA 43CAA 4LF3A 1MHHA 5EFIA 2XACC 1BQLH 3DOSB 3L17A 4J3OG 3FCBA 4HF5L 4LKCA 4LSVL 4X98A 4OZ4A 2XFXA 1OQOA 1FWXA 1K2DA 1CGSL 1WH0A 5J3HC 2VXVH 2QLVB 4N5ED 2VQUA 4NXKA 3CIAA 1KYOK 2AI0L 3U46A 2JB5H 2YQ3A 2H1PL 3C6SB 4M48H 1XWVA 1TZHA 3RBGA 2XTLA 1K85A 1HQRB 3QZMA 4Y1SA 5IR1B 3ZE2E 5CEXB 3U9PL 5JHMA 4S0HA 1OPOA 5KVMC 2MPAH 4AEHH 2XWDA 3QO1B 3GB7B 4PY8I 3UJJL 4GSDL 4AITA 2EC9U 3VD2A 2VDPL 2VISA 5DHDA 3U2JA 4QHPA 3FSOA 4NJAL 2HA1A 3QIUC 3TFBA 4OGAD 5BRZD 4Y9GA 5DO2C 3S5ZA 3PIQA 3P9LA 4L1BA 3QO0B 1YEJH 2IIJA 2X88A 4JCMA 4BKLB 4F7TB 4BWWA 4FTDA 1QACA 4QCIA 5IT2L 1FYTE 1LNUB 5DUPL 4LL4A 3PGFH 4RNRB 2CU9A 4HIHA 2Q8AL 4D8PB 2VLJD 3DJTA 4R84A 4PBVC 1AZVA 2BP0A 2V5TA 4F2MB 1TYEB 3QWNA 2QJDA 5EEVA 3PDOB 3BPNB 1FVEA 3GHBH 3RFZC 5DJYB 3BESR 3DSNA 3EJZC 4N8VA 5AAWA 1JPSH 5EV7A 3LRHA 3ILDA 4P59H 5F7KC 4I0CC 5HGHA 3VXOA 3FQTA 3HS0B 1OM3L 1D5MB 2AFNA 2XQBL 1TZIB 4AQ8A 2KLTA 3EG9A 1IAKA 3OF6D 5J5EA 4U3SB 2XICA 1UWXH 4NCC1 4HUWB 5FGCE 1S8DB 5A2CA 4MXWL 5SWQB 4G1EA 2DKMA 4P4KC 1MJUL 1A7BA 4IKJA 3Q2WA 4M7KH 1IVLA 2HX9A 3OKKA 3WIIL 1BP3B 1SLXA 4AMXA 4BK5A 3QG7H 4A7GA 1PG7H 4HKZA 4QXUL 4WW1A 1ETZB 3K2MC 4GG6B 4HMEA 3MOBL 5JW4R 4YBQC 1T0PB 4KPHL 3CU7A 4U1LB 5T1JA 1TQSA 1IZKA 5I1DA 3DPBB 3BD3A 3BPCA 1WISA 1A7QL 2B5IC 1G5AA 3AZUA 3QFJA 5L2KD 4GQQA 5K33A 1PZCA 3NH7L 1Q9LB 3D4ZA 2BXZA 4R8WL 5IV2B 3C2AL 3QIUD 3MLRL 1T7WA 2XY1A 1PLGL 2QSCL 3Q43A 4MB3A 5DO2D 2Z4QB 1U3NA 4G7QB 4NPJA 4TVPL 1DBKL 4MS6A 4OM0H 2DBLL 1SXCA 2R0LL 2QDWA 4GMSL 4XPBH 2J8UA 3ZE1F 1XGPA 4JVPA 3IYLW 2HVJB 3WUWA 1UA3A 4FYRA 1JGEA 1FZKB 3GIZH 2OMVA 1J1XH 1J5CA 2V7NA 5F7HA 5F9AC 5GGTH 4D3CL 1MLCB 4HV8A 1IBGH 1HSBA 2Y07L 2O72A 2YEZB 1BVKA 3GKWH 5AAMC 4N1HB 3GSXB 1BOGA 3EJZD 4JG0H 2CXKA 4HJJH 1WP6A 2J25A 5J12B 2FJHA 4JFUA 1ZLVH 1RVFH 2ZXQA 3VG9C 1BZ9A 2IBZX 5T3XD 4CU7A 5C7ZA 2FX9L 4PLJC 4CADB 4O51B 5HHPA 4XNUL 2D7QA 3KPTA 4HEME 2JQZA 4P4KD 3VM7A 4OD3H 2X4PB 4OF7A 3QULB 5DXWA 1KDIA 1KPVB 1F11B 2YAHA 3D09A 5DFWH 2WZPD 3CHPA 4P0DA 4LSQH 5C07E 4QXWA 6TAAA 3HPJB 4HT1H 4DGUA 5C0DA 2X42A 1YEKL 1GW0A 5SX4H 3WJJA 4XT1C 4Z7OE 5AD0B 1BREA 2ADFL 4YBQD 1AKJB 2E7BA 4YWGL 1IKFH 3U7YH 4AQEA 3FHAA 3S37L 4U1NA 4LRNL 1U3ZA 1I9EA 1IGTA 3OMNB 1RSFA 2Y72A 4LO9A 4TVPE 5E7BA 5GGSA 5I8OH 3Q2VA 5L7XL 1A4JA 1KN4L 1RZKL 4JS7A 1LMIA 3V55A 1JPGB 2PABA 4EPSA 5BOZG 1NGWA 5IB3A 4HISA 1BVLB 3D69A 4ONHA 5F0PB 4F7KA 1KGJA 5EU4A 4D9RD 3OPUA 4ACPA 5ID1B 2WQXA 3T0EA 2EZ0D 4NDMA 1HQ4B 2EO1A 3FT3A 4BUHA 4Z76A 5IUSA 3EFDL 1WC7A 1WHPA 1EXGA 1V05A 3G7TA 2WKOA 3VXSE 2ADIB 1IC4L 3SO5A 3RPKA 5JR1H 1I3RB 4JO2H 4ZFFB 4X4MA 3P0YH 4HK0A 3C6LA 4QJ4B 4HS3A 4FABH 2ETWA 3N0PB 5TTRA 1N8ZA 3P4OB 4KX7A 5A2BA 4AEEA 2IQAA 4YDLB 5IEHA 3K6IA 3NN8A 5BZWB 4DP6X 1RHHB 5IVOA 3ZZSA 2FO1A 4LESA 2X3CA 1PX3A 1JPTH 1WHOA 3ZIMA 1PQZB 2EDQA 5M95B 1F1DA 3IRPX 3CH1A 3ESNA 2ZOKB 4YL4A 5F7EL 3I6LE 2MNWA 1FGVL 2XRAL 3DK0A 4F5CA 4ZMQA 2OSLB 3N40P 4L4VD 2FX8H 2WTRB 1ZVHA 1F4XL 2ZCZA 2XWXA 1R3LB 3ARUA 4AY0A 4TNWF 2B7DT 3L5XL 3T8XB 1N3NB 2MCPH 2J6EH 4LEOA 1YNKL 4JFOA 1IT9L 1J0IA 1SVCP 1CGVA 1X6NA 3QUGA 3WXVH 3WTXA 3QJQB 2W91A 4BSVB 3RKDC 4BWTA 2DS4A 1AQMA 2X70B 4ZDHA 4OI8A 2FL5B 2APFA 1GYVA 1WFJA 1V3JA 1RULL 3OD3A 2FRGP 1XIWC 2WYHA 3FCGA 3IU3B 4K23L 4PSPA 5CIPA 5A16B 5DYOB 3TCTA 1PYWB 4AYSA 4P2QA 3WKMH 4GUOA 1E7VA 3MRHB 4LVOC 4PVNA 4XPHL 5B4MC 2OS7A 1TOXA 3HN3A 2IDQA 3MOAL 4YXKH 5IESH 5ISZB 3HMWH 2C4FT 1NBCA 1YEDB 2F7IA 4FFYH 4GG8B 4KDVA 4XNQA 2V7HA 1IAII 3KLLA 3TVMA 1XR8A 1L5GA 3SDXE 3ZL2A 1MW0A 1IARB 1DUZA 2YGVA 2FYYB 2DQTL 2Y5EA 1EZUA 4U7MA 3VGAC 3TXAA 1LQBC 3HNVL 3V0WH 4AGLA 3SDDA 1OY3B 2R4SL 2EECA 1J0YA 1YAIA 3P73A 1QQDB 5HHOA 4ZO6A 4CAGA 4LARL 4MA1C 2O6FA 4MCYB 3DX9A 4JQIL 4BIKA 1NCOA 4AMWA 3EDFA 3RX7A 1NDMB 3TYFB 3M1OA 3OR6B 4WSGA 2R2BB 4DEUA 5IGXL 1JZEA 1T04B 2XTJB 3KPQB 4OV6F 4I18A 5TK4A 4EBQH 5IJKA 1E2WA 1LDPL 5TF1H 1V7NL 3FTGB 4UQCA 2QTVA 4YHZH 1JN6B 2BIPA 2NX5A 4AI7A 3JV4A 4GBXA 3MO1A 3NRQA 3UAJD 5DJ2B 4TQHA 3GJEB 3DSFH 1MDTA 5E6SB 5DSCB 2HLAA 4FKEA 4M6NH 2ENPA 3WJLC 1DBML 5D1ZA 5IHWA 2ZSVB 4L3EB 5LWYL 2GBAA 3EYOB 3IMVA 3LNFA 3STZA 4JEGB 5LXGH 2G5BB 35C8L 1JWSA 2E7DA 2P46B 3NCFB 5AYQA 3RKDD 3CE1A 2FBJL 3IDUA 3TBTB 3X14B 1U3HB 2APXA 4ICXA 2N7AA 3ECUA 5BZZA 1XIWD 3L2LA 5EZLA 2JKRM 1DBBL 1EAQA 2QGBA 4Q89A 1V27A 4GY4A 5EBGA 3H42L 5MEND 5B4MD 4XVTH 5EPMB 4R7XA 5I30L 4H88L 1OCOB 4UYPA 5LGHH 2AJYH 4W6WB 2HMIC 5LO7A 2Y7LA 1K8IA 1T89C 4AQZA 1ZGLM 1UZ8B 5EBWB 2Y1YA 4GG6F 2H47C 3RGVC 4MYPA 2OTUA 2VDOL 3GXPA 4PW4A 3D85D 7FABL 4XMVA 3CFMA 4EI6A 3DECA 1OTUC 2YWYA 3DTUB 3OXRB 3Q8AA 3M46A 5K69A 3AUVA 1FO0B 2JKIS 2PCPA 2FATH 2YHGA 2HKAA 4X6DE 4JG1L 1EEZB 1NBVH 4GI9A 4QHNB 5FGRA 3D07A 4LHUD 1W0WB 4NKOA 2VITA 4OV5A 3J27A 4DOHE 5CUSH 3V5HB 2Y06L 4X4KA 3VU2A 3P4NA 1AHWA 1QOKA 2O5ZH 1AOZA 2XJLA 3OAZH 5C09A 3NIDB 4JM4H 1MHCB 2WXNA 3BKYL 4TSCL 1YJDL 5KJRH 5I1HH 2Z7YA 2HAZA 1PFCA 2AQ3A 3TBBA 1P5VB 2YKLL 3OKDB 4IRJB 5JQ6L 1TVBA 3GDBA 3QEGH 4LOVA 4MX7A 4BZ2A 3U0PA 5ANMB 4J27A 3GTVA 2AKRA 4K15A 3C2SA 3MYJA 3ARRA 3IM1A 1TQVA 1FN4B 3CFKA 3DETC 4GQPH 3R06B 4YHIB 5DUBA 1D7FA 3REVA 3EHBD 2G30A 1CLYL 3VD4A 1AQDB 3OAUL 2Y2WA 4YSOA 3Q5OA 2P5WD 2YKKA 2GITB 1XF3B 2LQRA 2ATAA 5D7SL 3QJUB 3GBEA 3CSBA 4Y2LA 1FL5B 5JPMC 5BRZE 4JJHA 3UJTH 4ZQKA 2E7LA 3EJJX 3TV8A 2HMID 5LGJB 5CR8A 3WEAA 1XAKA 2NW3B 1FSKB 2FJFB 1F41A 5G2NA 3QQXA 3GO1H 5DQJA 1MIMH 1M2OA 3HPLA 5FA4B 3CLEH 3SDCA 4D9LH 1EHAA 2X0VA 3UTTB 3QI9A 5F9DC 2FWLB 3IDXH 3QNXA 4KVNL 3RGVD 4EN3A 5D2LE 5L88H 2VLJE 1ZHKB 4XOBA 5AEAA 1WITA 3KPNB 1OF2B 1OTUD 3O45B 2FWSA 3FK3A 4F37F 3HAEB 4DTGL 4PRBB 1DZBA 1B0RA 5EC2A 4EUPA 1G87A 2PKDA 1FA4A 4WWPA 4XXCC 3FOMB 5D7HA 1KPRA 2A73A 3GSNA 1GA2A 1I85C 2VN6A 1M6OA 1S9VA 1L7TH 2XYBA 2C9UA 3L9EA 5SWZD 1ZHLB 5I17B 1WUNT 3QYMA 5FUCC 3FFCA 4KMTH 1UT9A 4BA0A 2APSA 3ZZLA 3UPRB 1R3KA 1T3FB 1XXDC 3MV7D 3NJGA 4NQCD 4LASH 2JIXA 4U31A 5DS1A 5GRVK 1NFKA 1U58B 5E00B 1YQVL 5KEZA 1QLFA 5GGVL 4HJGB 1EFQA 2GPZA 3BXNA 2P1YA 3T65A 2E47A 3B8SA 3PREA 4AMKH 1UADC 3DETD 2QADB 4R2GB 3M07A 5F70A 1AMYA 2EDKA 2R56H 1Z9MA 3WKPA 2E59A 5FWRA 2XZCL 2XWBB 1PCSA 5MP6H 2ZXDA 5L2KE 4FF9A 3APDA 3PJSB 4ZJ9A 3AU0A 4MXQC 5KVDH 4K3EH 4PVBA 3S5LG 4L1DA 2NLJA 4OZHB 2OMBA 5C0BB 5FGSA 3ZN6A 3WTTA 5GIRB 2AXJA 1F00I 4HW6A 4HUUB 2IVFC 5CO1A 1B0WA 1WT5C 4AL8L 2R83A 5DK2A 2PTTB 1LO3L 1X9LA 3LEXB 4YE0A 1NCDL 4CU6A 1M53A 3PRZA 5IHZA 3GD1C 2NR6A 2R2HB 3HIZA 5E6UB 3QG6B 5FM5O 2V5YA 3QWQB 2JV6A 1WZKA 4KKLC 4I89A 3IDNA 3PWUB 3IFPB 1KCBA 4LPCA 4NUMA 3R8BB 2YXMA 2LLNA 4XP9L 4KU1A 2DWTA 5IG7B 1KLUA 2G60L 4UOZA 3BJLA 4HH8A 1D9KC 3BQUA 3H3PL 3SPVB 1KDJA 2WVSA 2G0LA 3D34A 1OAYH 2CG9X 4OCWL 4P49A 5ITFA 4GW5A 4U6TA 1EJOH 2BHZA 2BCKB 4ZRGA 5J6GB 4P57A 3TO4C 2B1HH 1LJMA 5K5YA 4C83B 2E5EA 2ZG2A 2MQCA 3LXCA 4QRPD 2OAAA 4WI5A 2E4FA 3HR5B 4CN4A 1IV8A 2ZKHH 5ENWA 2ICEC 2NY6C 1URZA 4XP4H 1UZGA 4ADIA 4E41B 2CO6A 4AK2A 4LL9A 5DZVA 5TK2A 5CD3A 3GMOA 3NEOA 4HKBB 2IFGA 2JFCA 5TGBA 1J8HA 1EFXD 1P6AB 1ZMYA 3BWSA 1EMTH 1Z6JT 4JB9H 5GGSY 3VFPB 3L45A 4MXQD 4Z7NE 4FRWA 4KHXL 1CICB 2EVGA 3Q06A 1C5CH 4BDVB 2ZYSA 4WQOA 2JCCB 3BEWB 3NIFE 4F58H 1FRGH 2YGOA 5C3IA 4X7CC 4RMRA 3LXBA 4Q6IC 2JXMA 1S5HB 4TPRH 4KGLA 2FZ3A 4G2AA 4RSVA 3D0VB 2VXVL 4D9RE 4MGXA 4HLEA 1TNMA 4GXFA 4DESA 4PJGA 2BH0A 7CGTA 3V8OA 2JB5L 1A47A 2ZOTA 3EJRA 4YK4C 1KTJA 1SDYA 1OSZA 4M48L 2HVKB 4ZFOA 2YLKA 2Y3NA 4PJFB 3N44F 2XG5B 5B1JC 3WNKA 2V2TB 3NDYE 2J55A 4JG9A 3NQIA 5GGQH 5LLIC 4TUOB 3FTVA 2XN0A 3NSCA 4KKLD 2FH8A 4NUGH 3L3HB 4NO0A 4ZOAA 1J5OL 3LEVH 1IBDA 1JI1A 1LMKA 1KWGA 3S8WA 2R0KH 3VH8A 4NO3A 1CU4L 1D9KD 4WCYH 4DEPC 1TZOA 3BDXA 4K3JH 1KFAL 3QXDB 4UQ3A 5FV1L 3S2AA 2EYSB 4PJBA 3ZKMC 1A3LH 4AVHA 1DYZA 1H0DA 1HI6B 2N0KA 3IRCA 4E5XB 1EAPA 3VO0A 3TO4D 3V7MA 3PGFL 4Z7VA 4K2UH 4N90D 2ARJB 1BX2B 1WZ1H 4KMQA 5E4EC 3CFBB 3F6IA 2UWEB 3B2VH 1KBWA 3I2CH 2VC2B 2NY6D 4JO1L 4TSBH 4L4VE 2EDYA 3MROB 4OCYH 3NAAH 3DMMC 3GM0A 4WV1C 1CFNA 4GRMB 5EBLB 3V4PL 3DX4A 4XH2A 2WBKA 2WWOA 4I5BA 4DJMA 4Q0XL 1JWMB 1JPSL 2D4DA 2SEBB 4P59L 1CE6A 1T1YB 4M6ML 2AEIT 3GXTA 3QEQD 4JFDD 5J1SC 4NERA 1FFOB 4ATTA 1YEEH 2HJLB 1PLCA 2OJZL 4J6RH 4Z5RB 3CV5A 1RU9L 4FZ8L 2CGRH 1GPOH 1LP9E 3NA4A 5B3SB 1MRFL 4ZBJA 3NIDF 3VXMB 3ZVVA 2GJJA 2IH9A 5GJTL 3B2DC 4L8SB 3VGDA 4PRHD 3GZKA 2Q7NA 1M9WA 3ISWA 1S7TA 1SJEA 3RVTC 3QG7L 3FQXA 3VQ1C 4LCVA 4DHLA 1OAXH 1UGNA 3RZCB 4ZXBA 2WAQA 2MOVA 4HMDA 1AE6H 1FFPA 5EO9A 1E27A 5BV7B 4LFHD 4RZKA 1Y18B 1ZT4B 2WXOA 1JS4A 3QPQD 4P48A 4I2XA 5FC9A 3CGTA 2OSWA 3NK3A 4J23A 2C9QA 3MBXL 2ALWA 3KXFB 3ZKMD 3EXLA 2WNWA 4XRCA 2QT6A 4XPBL 1MWOA 1X44A 4Y4HA 1WCBA 5FAAA 3K3QA 4CMMB 5GS3A 1SBBA 1I8IB 3BH8B 5D1QA 3O4LB 1J1XL 3FTXA 2A7BA 2XBTA 4U1JA 4X7DC 1ROCA 2CXGA 3C09B 3PQYB 4JR9H 5GGTL 3DMMD 1IBGL 5CBEA 1DQKA 4UAOC 5DHYA 5F0MB 3W39B 4CW1A 5TPWH 1VZIA 1L6XA 3L3OA 1T0MA 4HJJL 4NQDB 3PYCA 3ASOB 5I1KH 1RVFL 5CJXA 3IMSA 2XWCA 5IBLC 4L37B 2FWUA 2OR9L 1QFWL 3Q3GA 4WO0A 5DR5L 3H7BB 3A6CH 4XPGH 3LIZL 5AAWC 5FV2A 3N42F 3K8LA 2AW2A 1PNDA 5D55A 1RZJH 1DR9A 1YPZB 1MJJA 4QPEA 3PWPA 4OZIF 4AQ8C 5HHXL 5EUOE 3JUYA 3ZDXE 3EJQA 3WJMA 4H2AA 5EZPA 3EJTA 4LSQL 5KUMA 5MENE 4LAJH 3RVTD 4RA0C 5DMKA 1MCOH 3L3KA 5JIIA 3U7YL 4M7LL 2V3EA 1TJGL 1BD2A 4PQXA 1M7DA 5B21A 2FO8A 4A7QA 4BK5C 3C8KA 5FO9B 4CRPA 3VI3B 5HSFA 3LMJH 1N10A 4DP1X 3G6AA 4XXDB 2E8ZA 2DYPA 2EE0A 3S96B 2FD6H 4JVUA 1T66C 2P8MA 1W80A 3NCXA 3ML9A 1G9NH 2YN3A 1M2VB 5DS8B 1TVDA 1C5DB 3FQWB 4M93C 2PN5A 1E4WH 1BIHA 2VJ8A 3NPSC 2X4RB 3QQ9C 3ZTEA 1ICTA 1FV1A 2KPWA 3GLEA 2VDRH 2CDGB 4IKKA 3BP5A 1BIIA 1YHPA 1FGNL 2P8LA 4MQ7A 1DVFB 5E24E 4UYQA 1S9XA 4XVOA 4XMUA 4PCTA 1XAUA 1PU0A 1ZPLA 5CCHE 4HSCX 3N9GH 3CDZB 3D18A 5J1AB 4KY1H 3DIDA 1NAMA 4X0NA 2ED7A 5TDNB 3SDAC 5IVXE 3ML8A 2IWGA 4JO2L 2BO0A 4QHLB 1FNEA 3P0YL 2WIIB 2B20A 4P23B 3STBA 1JF1A 1XSKA 4FABL 2YEQA 5IBLD 3ESMA 3RKPA 3PV6A 2J7LA 4MA8L 5TF0A 2EDDA 4HOXA 3AY2A 5IMKA 3WY3A 4A6YA 2ZCHH 3ZRSA 3PL6A 2P5WE 1OPGH 2F7OA 4M03A 2D0GA 3TFKC 5F1NA 2VL5B 3CZSA 4HZAA 1I4FB 2WTPA 2BVQA 2AAAA 3UIYA 5E2WH 4JZNA 3Q5YA 2EAEA 1RZPA 5ADPH 4PW3A 4QY8B 4N24A 2G5RA 2MHAB 2NW2B 4CVUA 4XCCL 5AZEL 1L6ZA 4Y4KB 4Q4IA 1IZJA 2LABA 4G71B 4LLVA 4JLRA 4LXFA 2WXPA 3I6KB 4J5VA 3WJJC 3DIFA 3GLDA 2ZWZA 2MCPL 2J6EL 1SGKA 4NHUA 3Q9QA 3WXVL 1T66D 4Y2NA 3RIFF 3EDDA 5ES4B 5LKNA 4PS7A 4WWKB 3SJVA 1Y1DA 3QFJD 4JREB 4AKQA 2NY3C 3CDGA 4WW2F 3LB6C 2APTA 2JCCF 1HHJA 4N2GA 3BUIA 1JNHA 3QQ9D 4X9IA 3RUGF 4LCCB 2VW6A 3EYVB 2MQGA 5T1MB 3MVSA 5KYWA 1HILA 1EUTA 1R5WB 3LDBC 1VFBB 2BOCB 5EZJB 2H26B 3KEHA 4NQCE 3MV7E 4FFYL 1JVLA 5KYUA 3T0EC 1MCQA 5LQBH 4FGMA 4HC1L 2B9BA 3QORA 4C54A 4Y5XB 1PKQB 4TUJB 3TN0B 4H0IA 4PJFF 2CO3A 3NFSL 4PJDB 1E8XA 3ZYJA 2FIKA 4G7SB 1EZLA 4G59C 4RESB 4Y7OC 5JDSA 5C0GA 1FNGA 5IB4A 4FA6A 2RGSA 3WGVB 4G8IB 4JPSA 5ANHA 2IXQA 1WCQA 2CHNA 2IFFH 3PCYA 2C3WA 1SN5A 2EE9A 1XGTA 1UWYA 4G70B 2WJ5A 3ZKXB 2FSEA 1M71A 3WTWA 4DZBA 3C6LC 1N6VA 2JELH 3TFKD 4K4KA 1WWCA 2FUTA 3HLAB 4ONGL 2AEWA 4F92B 4JPIA 5HDBF 1YEGH 4BZ2H 2JTDA 2WXQA 4PRPB 2JI3A 3EO9H 1XCTB 4PR5A 4NZUH 3T3ME 2PF6A 2FHCA 3W0WE 2W0KA 3QWOB 4R7DA 3FTSA 4OLXH 4P5TC 4NAJA 4AKOA 2BC4B 1ESOA 4LSTH 1TCRB 3DSFL 1KIUA 1U93B 4M5ZH 3KLAB 4M6NL 3SGEI 3EH5B 2WLIB 3WS6A 3UBGA 3B2UC 1BVNP 1OCRB 3NUKA 4ZS7H 3EOTH 5IBUB 5ILTL 1I1AA 1KLGB 1OEZW 3LYRA 5FO8B 4PB9L 3GGWA 3HOGA 2CRYA 1GRWA 4J3BA 2NY3D 9CGTA 2AJVH 2Y9RT 3O6FB 4XWGH 2Z0BA 2Q7YB 3LB6D 2R1XA 1IE4A 2RIKA 1BPLB 1KBVA 1E90A 3F58H 1RQ5A 4M43L 5ESAB 5INCA 2D7NA 3FO9B 3B5GA 3GMQA 3KPMB 1UHVA 3C5SB 2ZOLA 1EO8H 2QV4A 3D3VB 3EOAA 3L48A 4XVTL 1HDMA 1HHKA 5I1LA 3O0RL 1RIHH 2AJYL 4G5ZH 4AGPA 5D6DA 4PMEA 5KSAB 4AKPA 5LGHL 4P4RB 3JZ7A 3T0ED 4EUPH 1NCAH 3F12B 1KXTB 1UXSA 1IL1A 5IQNA 5T3ZL 1G9NC 4OR1A 3OLEA 2CKNA 3GSNH 1T1WB 2VSKB 4KKRA 5B3JF 3BMWA 4XNZC 4N9GB 5KVFH 3TVMC 4PJAF 4PMFA 4HKJA 3HE6B 4KHTH 3ZBMA 4A7TA 4GFXA 2PCFA 3AS3A 1FAIH 3J7HA 4MMZB 3SDDC 3C6LD 4FQJH 3MLUL 4ODXB 3F7KA 3U36A 3CFEB 5I24A 4JGJA 3GSVA 4V2BA 5HD8C 1YUHB 2F5BH 5CUSL 5IMMB 1KFGA 2WOYA 3C12A 1AD0A 3QRLA 3FUJA 4BKSC 1NOLA 3MGOA 1G43A 3O2WH 5KJRL 4GAYB 2WN2A 4I18C 4QF1A 4MZRA 2P5EA 1EVUA 3TONA 5IJKC 2C3VA 3QEGL 1OOWA 3QCTH 3PWJB 3OAWA 1NCWL 3POHA 5DJ8B 2F19H 4GBXC 4DN4L 2G9HA 1KJVA 3B2UD 3WIHA 3O3EB 4X6BB 3S88H 4MSWA 1HK6A 1A6PA 3TIDA 2G3MA 1ZLSH 1BZDA 4RCAA 3FBKA 3LN5A 4LMQE 3B43A 4YSUA 1ZT7A 5J0BA 4H4NA 5EEXA 4EAEA 2ZT9C 3T1WA 1J5HA 3T2QA 4QJ5B 5CKGA 2UZIH 3UTOA 4LCUA 3ILPB 2R1YA 5EZOL 1L9SA 3UJTL 2H8PB 5KBLA 4AM0B 4K9JA 4QTHA 4NNPL 3CQQA 4P2QD 3MUGA 4PRIA 5LBSA 4D9LL 3GO1L 3NT0A 5D7LA 4NPKA 1RZ8A 4PGBB 3K74B 1T1XB 3IDXL 2JKXA 3QQ4B 4OLVH 4N90E 3WHXA 4A2EA 5L88L 1G7JB 5GGVY 2VRQA 3QZBA 4GKZB 4R90L 3TVMD 2DW5A 2DJUA 2W0PA 1U8LA 1L9QA 4OIFA 1AXSB 3LQAH 4FLOA 3EW3B 2FECL 4FQXA 4YFDB 2XC8A 4M00A 5TFSH 4AENA 3SDDD 3ZZ1A 5I0DA 3MJWA 4FJ6A 5EIIA 5HHOD 5HD8D 3CC5A 3N43B 4LLMB 3BVNA 1MCEA 2ZUQB 3ECVA 3VB9A 4GB9A 2YJLA 4NQSA 4PJ5A 4X5QA 4F8OA 2A6KA 3QEQE 4JFDE 4RH4A 5AG8A 2W88A 3QJHA 3C5ZC 1SOSA 5E08H 3FC8A 5D2NA 4ONOA 4JL2A 6PCYA 1UOKA 3IXTB 2JJSC 4JPQA 4U1GC 3REWA 2ZG1A 3QYCA 1L9MA 1AHWC 4WI7A 1E9QB 3Q8CA 4YFEA 4G8GE 5LGYA 4H8QA 3CBRA 1A8ZA 4LSPH 3S36X 1B2WL 1GZQA 1O7SA 2WWNA 3WAKA 3FQRA 2NX5D 4GBXD 3L5WB 5FM4A 3T4YA 1BAGA 3BZFA 2AK4E 5F9OH 3CTTA 2DEXX 2CCLA 4W9CC 1OZTG 2OZ4A 1ASOA 3RI5F 5D1ZD 3F7VB 2ZKWA 2R56L 5DURD 1RZFH 1VKXA 4NCC2 2VLKA 2OMUB 3V5KB 1ZJBA 3AT8A 5MP6L 3D33A 2AK1H 2JK5B 3HZVA 5DZAA 1EUUA 1KGYE 4G6FD 3UTSE 2YUVA 5KVDL 3VGEA 2AV1B 4OVUA 4BV1A 3NSJA 1NBYB 3KNBB 4W9DC 1IX2A 2LGNA 2EDLA 2UUDK 4PGZA 4JAMB 4JQXA 1QI4A 3DRQB 2EE2A 4EDXB 1UH2A 1EBPA 2VDNH 2W0LA 1N19A 2E7LC 4AGMA 2HCZX 2BVPA 4CDGC 1F6FB 15C8L 4QRUA 3Q44A 7PCYA 1A4BA 1KC5H 3SDCC 3DX7A 3HJ0A 1JUFB 4P2OB 4HMCA 3FB8B 5FA3A 5JZ7C 3QI9C 2WXRA 5F21B 5EC1B 1XSJA 4EN3C 3GLZA 4KX9A 3M1CA 2BFVH 1S9YA 4UDUB 5DQDL 1U4EA 3S3PA 3EJUA 1YNLL 4M8QA 1WWBX 3NCEB 3RWGA 1JZJA 2FO4B 4XP1L 4K7PX 1ZLVK 4IBYA 1IGJA 3ECBB 2CIIA 3OX8B 1OAYL 2O5XH 1HIMH 3ESPA 3D05A 5DTFA 2WVVB 2LTQC 5JORB 1EJOL 1UD5A 3FU3A 3C9NB 3LEYH 5IB5B 5C09D 1DCEA 1XX9C 2HJFB 3N2JA 1QFWM 3HC0A 4Z77B 2F1EA 2I07A 3QNZA 2JB6B 4ZX6A 1NMAL 4NGHH 1NGQH 3OMAB 2DIEA 1MCPH 1PJ9A 3LSOB 2UYLA 2OA9A 3W9EB 2HFEA 1KUMA 3DXAB 1RPQA 4G42B 5KVDE 5EH1A 1D6EA 2VUOA 3F7YA 1S7RB 2JJVA 2L3BA 3DTXA 1Z5LA 3EZJB 4JB9L 3SHSA 4GP5B 3T8MA 1I7UB 1QUPA 3ALXA 5DC0A 1M42A 1FRGL 3SE9L 2WANA 4WFGD 1CLZL 1AR1B 3N50A 2FK9A 5KZCD 1FPTH 3LZRA 4WAFA 4O02L 1W6LA 3QEUB 4BH7B 2FEEL 3UTQB 1EA9C 2X4SB 3QXAA 2X40A 4QLRA 3OLIA 5F7FA 5DRWB 2DEWX 3SDCD 5BJTA 3BZ4A 2R1WA 3WDHA 4DP0X 5JZ7D 1TU2A 3QI9D 1XF1A 1D5ZB 1YSOA 4EN3D 4M1GH 5GGQL 3AS2A 5EZIL 4MCNA 1RUAL 3P4LA 4P99A 1YC8A 1XGYL 3A6BL 1MEXH 2D7MA 4MJJA 1XGRA 1FZJA 2BOBB 2X1PA 3DX6B 2R0KL 2NR6C 1OE3A 5FOBB 2NY4B 5A2IH 1T4KB 4NNYA 5D72L 1ITBB 1X5MA 4K3JL 2DWDA 2JLPA 5E6IC 4F8NA 4XC1L 4X5LA 5I8EA 1A3LL 3P11L 1MWAB 4XBGB 5JHDA 3O6KH 4J28A 4P5MA 1X5AA 4J4PA 2H9GB 3BQUC 3FFCD 2BSSA 3QZPA 4QYOB 4RMTA 4UDTA 4OH2A 2F5AH 3BWUC 1I7TA 1WZ1L 2P24B 3FW6A 3IJSB 2JIXD 3A23A 3KYNA 2PWFA 4Y2OA 3B2VL 3FUHA 3I2CL 4TSBL 3PHQA 3LKOA 4OCYL 1FJ1B 3NAAL 2XWTB 1BJ1J 1WICA 1CL7I 3MV9B 4I4WA 1AGBA 4R4NC 3W9DB 4X4YA 3RFRA 3GBMH 5EO0B 2WXMA 3K6SB 4K3DH 3QIBB 4P9HL 1WV7T 3ETBF 1RIVH 4KJWC 5JIDA 3SPJA 1YEEL 1QRNA 4MNGB 3TWYA 3B3IB 4Z18A 3T0WA 3QFJE 4MLSA 2D3NA 4R4BB 1GPOL 4ZUUA 4ZO9A 4H8PA 3E9UA 3AWEA 2V5SA 3F05A 3KZ8A 1F0LA 4RZCB 4M3HA 1PAMA 3BJ91 1EJ6A 4HJTA 1NFIB 2IGFH 2J8UE 1J0HA 1UKSA 3IGAB 4RBPH 1JGLL 2ZYRA 2JKTM 3MUHL 1A7NH 2GSGA 1XHHA 3DX8B 3VU1A 4LP5A 4OF3A 1ODUA 2XKNA 3B7RL 3C87A 5ALBL 5DQ9B 3JWNH 1PTZA 5F2FA 3ZYZA 4KK9C 4KI5F 2V37A 1HL5A 5INDB 2NR6D 2A9ML 1C16B 4FQQA 1NEZB 2GJ6B 2UXTA 3JTSB 3BRGC 2A2QT 2J8HA 3MRGA 3QNYB 4EXKA 4ANVA 2GJRA 3PLYA 1ZWIB 4HDIA 4GW1B 2L0DA 2DQJL 4O2CB 1XXFC 4RMQA 4RGNE 3BQUD 3R4RA 5C6TL 5CLZA 1F3DH 3DROB 1SUHA 4FQIL 4Y19E 1VHPA 3DV6B 4JRLA 1ZV5A 2Z8SA 3W81A 5GS1A 4P2RA 2C4XA 5JYMA 2I9TA 3ERXA 3ZL4H 3VG0H 2CDEA 4A6YH 1PZ3A 4XMZA 4R4ND 4NB7A 1U8NA 5TPWL 3QRGH 1JJUA 5GS0L 5BZDB 1MQKH 1RPUA 4FNRA 2EKJA 4MHHG 5BXFA 5I1KL 2WSPA 2IWEA 3LZNA 4LK4A 5IW6B 2IAMA 2IG2L 1BF2A 4FG0A 4FNLH 3M88A 4KJWD 3V9CA 5TH2B 3SO3B 3NFNA 5GGUA 3HB3B 1G4RA 1HKLH 2BVTA 3N43F 4QHKI 1J8HD 4B9JA 3BWAA 1NDGA 1V3LA 4UT6A 2K6YA 1MVUB 1X9UA 1RZJL 3F7PC 4DO5A 1PZAA 4AW4A 3QDJA 3JUZA 4JGMA 3T0BA 1KIPB 3EGDB 2LV4A 2CPCA 1AHKA 1G7MB 3A3YB 4M7JH 4HEPG 2Z91B 2Q10A 1MCOL 3W37A 1J86A 5T5FL 1I8KB 3BD4A 3FQUB 3VX0A 2IALB 3GRWL 1T21A 3DBXB 1M3JA 1KJ2B 3SKMB 1QA9A 4KK9D 5A3ID 3LMJL 2JI1A 4IJ3C 4ZXBC 1HCZA 4P2YA 4WDIB 4NO0D 1F97A 3MHZA 1UWEL 3LKNA 2OW7A 3QH3A 4OIIL 3HS9A 3MOQA 2VNCA 3UC0L 1TQUA 1E4WL 1P5UB 2AZUA 4N2BA 4BFGA 5AW4B 5ESQA 4HFWB 4PU2A 3QFGA 5KYYB 3MV8B 4JFFB 4R5TA 2Q6WB 1IC5H 1II4E 1QRKA 2H6PA 3HMXH 1E8ZA 2F54B 1EDHA 3LX9A 4Y4HC 5SWSA 3ROOA 1MNNA 3CFCH 3OAZK 3N9GL 2GAZB 1F4YH 1I3GL 1ZHBB 2W65B 5D1QC 5C0EB 1VZGA 2PNDA 1Q4NX 4KY1L 1ZTXH 4F9PC 3IWUA 2QQLH 4Y4FA 4PTUA 5FKPB 1OGAB 3RGBA 3F7RA 2EDHA 3KD4A 1CIUA 4OM1H 4ODVL 3H9HA 1SQ2N 4MNHA 1A6AA 4IDJL 1KIQB 2Z93A 4Q56A 5KN5A 3L3OC 1IIIA 4GRLA 5KS9E 3CVHL 2QL1A 2ZCHL 1BQHA 4X9BA 2DKUA 2HRHA 4XP6H 4ZAKA 2JKWA 5CJXC 1JV5B 4R7VA 1A6TB 1EERB 3W5NA 2PXYB 2WB1A 2B59B 2Y0SA 1ZA6B 4DGYH 4LL1A 2DQGL 3MNZA 5ERWA 2IQ9L 2PO6B 1NLDH 2WCPA 3HNTH 4JFVA 1UOVA 3DVFA 2PW1B 5KJ7E 1K8DB 3BCDA 1NPNA 1W72A 4N0UB 4P2QE 1PX8A 5ICZB 1VGKB 1QFOA 2XKSA 1MCWM 1MQ8A 3L4TA 4OGYH 5TDOB 1DQQA 3ZW3A 1QLEH 1UB5B 4I3RL 2ZNWA 4ZXBD 4UM9B 2VERN 3MJ7A 4MDIA 5IB2B 2NNFA 1TZ8A 3CFDA 3V4VA 4PWFA 2YSSB 1MG3C 4YIQB 3MA9H 4TLKA 4HX1B 3LRKA 4PJ8B 4GMTH 1CT8A 1NSNH 2R23A 4MVBC 1SJXA 2MNJB 5HHOE 1TTGA 2XT1B 3N1PC 1KN2H 4C4BA 1EGJL 2P5PA 4IIQA 3VD7A 2JQAA 5EG6C 5ALCL 2D31B 3JWNC 4Y4HD 3X17A 5HYQB 1DN0A 1ZGLB 1E9OB 2JJUA 3LKSA 4KQ3H 4Q9BA 1HKFA 4R97B 5D1QD 5DO8A 5IFHL 3ARDB 1HCYA 4XTRC 5D9SA 3ZE2B 2WBJB 1HCVA 2NX5E 2VQ4A 4HUCA 1WGVA 1L9OA 2J71A 2RH0A 3D25B 3CSPA 3PWNB 3OKNA 1BM3L 4OTXL 4X7FC 1ID2A 3G08B 2IFFL 4QRQA 3GZOA 3CMOH 4ZFZA 1SEQH 3AG1B 3SGDI 3JYCA 3NK4A 2WIMA 2JELL 4TOYL 1FYTB 2YPLB 4PGEA 2Y7MA 4BZ2L 3SEPA 1INQA 3DUSB 3IBEA 3KVDD 3OKYA 5EIQA 3PL6C 2XQYG 5DRXB 3CZFB 3GBDA 3QCVH 3WIHH 3CQFA 4JPKH 4DO4A 3LZPA 3PWPD 5J6SA 1BLIA 5ICXA 3PP4H 4LSTL 3MLZH 4BQ6A 3D12B 5C0FB 5TE7H 3KPSA 2WYTA 4HZLB 5F7NC 2NZ1A 4HS6A 2PMZA 5I1GH 2J43A 3F85A 3BZDA 3SE8H 1BD2D 3T0VA 3BFOA 3IJYA 4X83A 3IDGB 4F24A 1FL6A 1QUNA 2A4EA 2QKIB 3QDMA 4B7IA 4BSWB 2DYPD 4YHNB 1G7QB 4MVBD 1X5FA 3O8XB 5LBSH 3F58L 4JJOA 2CK0H 1TFHA 4HH9B 3KBHE 4N87A 3IXAA 5C0AA 5E4OA 1E50A 2OYKA 4GW4B 4BQ9A 5LGKA 1EO8L 1LK3L 4PRNB 3ZDYE 1MW2A 1X5LA 5JHAA 1OT1A 1RIHL 3EF7A 5AQ0A 1ZLUH 3GSQA 1NCAL 2VDPB 3JTTA 2ZYHA 3MRKA 2X2JA 3NG5A 4IS6B 3VFVA 4MBOA 4XTRD 2H6OA 2DH2A 1BBJB 2DJSA 2RCSH 4PIBA 4YEFA 2YMTA 4Z3HA 3GSNL 3VVWA 4BQCA 4HBQA 3TV3L 3ZPDA 4TM9A 1A14H 1KB9K 3IFOA 4ZPVA 5IQLA 3UO1L 5KVFL 3QORC 4EZJA 4QR7A 4ANUA 1G9MC 4KHTL 1FAIL 5AB2A 5CZVH 4PV1C 3VFRA 1C08B 5KSBB 4LVHC 3ZSTA 2Y25A 3KBEA 4Q9QH 1F5WA 3HFML 1RUKL 5E2UH 2B9AA 2E7CA 4M29A 4NN5B 2UY6A 2F5BL 4FQHA 32C2B 5FYJH 2OPCA 1RIUL 1YN6A 3EO0A 1UOWA 3EJSA 1B3JA 1B4TA 3PL6D 3U2IA 1JXJA 2IGLA 2PYEA 3O2WL 2PETA 2BY3A 1HHIA 4KJQC 4M62H 5HDWA 2OZ4H 4NP9A 3BSZL 1H8NA 4OBRA 2OMWB 3EOBB 4OZFA 2Z64C 1JK9B 3QP3A 3WFBL 4Z3FA 5F7AA 4HWEL 3H0TA 3KLSA 5PAZA 4PJXE 1MSPA 1QFWI 3D9AH 3KEDA 2H2SC 2F19L 5BUPA 3CCHB 3MNWA 3EYFB 3SKNB 1LK2B 3UBXB 4KTDL 5CEZL 1M1XA 5CAYB 2R7EB 1AD9B 5C70A 1NFDA 1CYWA 1ZLSL 1WZMA 3WS6C 2OV0A 5FFOA 4S0SD 5F7LB 1XO8A 2EXSA 3OJDA 1I1AC 1FF5A 4JFZL 3SJVD 2UZIL 3TNNA 2VR4A 4AH2A 5HHVH 4KXZH 2BNQB 5H35B 3VFGL 4P5KB 1EEYA 1WAAF 3OAYH 4KC3B 4H20H 4WHYH 4Z7OB 1R1CA 1IGYA 1A6UH 4P46B 5B1CA 5KVFE 1X7QA 2Q87A 4AIZA 2CBMA 2DWXA 4KUCF 5IBTH 5GZOA 3FFCE 1P7HL 4LLYA 4EEEA 3MRMA 3C08H 2R29A 1LO5A 5D6DC 1NA8A 5IB1A 1QSFA 4JFXA 2V2WB 3JWDH 3QORD 4Y5YB 5F6HJ 5DJXB 3SPHA 4B53A 2XHNA 3MRBA 1WS7A 3BYTA 4H0LC 3LQAL 4JMXA 2CMRH 3BAEL 1U8OB 4P3DB 4LCIL 4DUXA 3PHSA 3UCRA 1DE4A 1HZHL 5E08L 3D8MA 1ONQB 1MY7A 5B38B 3AG4B 2X4NB 2GEEA 3BP7A 4KJQD 2XUWA 4ZPTB 1W8NA 3E80A 5DCCA 3S4SG 4APQB 3IAGC 5DK0B 4JJ5A 2UZPA 3UL4A 1I8MA 5EA0H 4KNUA 2Z1PA 2Y6SC 4I88A 4L1LA 4L8BB 3VXSB 3SODB 4L8DB 4JDVB 2HJKB 3ULVL 3EJCA 2H2SD 3AB0C 1B0GB 1Q1JL 4RFEB 4PW9A 2R9HC 5F9OL 4IEFA 2VLMD 1DCLA 1LEGA 5I6PA 4Q2ZB 5FCUH 2HWZH 3GXFA 3QT2A 3S3CB 1T5WB 3TA4D 1CFQA 1BM7A 2WN3A 4HZ1A 4OU3A 3HRPA 2XVKA 3R19A 2UZXB 3D5OF 1I1AD 4FE9A 2AK1L 1SF5A 1T83A 4F93B 4UMGA 4YBLC 2BHFA 5DHVB 3IT8D 1P7BA 3TCXA 3U7WL 4LLWA 4TQIA 3DUUA 2B3RA 2BSBA 4XHJC 3V6FA 3GSUA 4GRWH 1FIGH 2JF1A 1ZY9A 3EDKA 1OSEA 3R7RA 3SQOL 2R15A 2Y4SA 3PPEA 1BZ8A 1RUML 5ICYA 4QRFA 4X42A 1NCUA 4GT7A 5I66A 2QPDB 5DUMH 2JJWA 1JDDA 1FL3A 1KC5L 2OMZB 1HH9A 2FHFA 3TZVA 3IMBA 2F0CA 2BWDA 5IFJA 2ADGB 2VSDA 1WTGT 3DTDA 4G8EA 4HWBL 2BFVL 3FAWA 1FVDA 4GKNA 4OD1L 3H85A 4G9FE 3T2NH 3KGSA 4JQVC 4FQXC 3R1GH 4U0RB 5KVEH 4MNQB 3VXPA 1HZKA 1KENH 5IKCB 3WGUB 3MRQB 1F86A 4J3XA 4J7RA 1J8HE 2CJTA 3FZUC 4MJIE 4H25A 4MB1A 3P0VH 4PTTB 1YMHB 2A6DB 3CFNA 3O9WA 3OHMB 2VR8A 3HCVB 3QSKB 3UBFA 2Y6SD 3SDXB 2ESVB 5F96H 1Z9SB 5C2BH 3NSYA 4WEUD 5L6YL 3K71B 2R9HD 5E8PB 2P5ED 2QSQA 3E1ZA 1TTCA 3NQKA 4NGHL 1NGQL 3ZE2F 1DBJL 5J06A 3FUDA 5BO1L 1WYJA 1AGEB 3GJFA 4QWWC 5AW9B 4XOCA 5DVKA 1G84A 4HJEA 4JM2B 4N0FB 1R47A 5JIHA 3NESA 4X0KA 5H4YA 1T03H 4ODTH 3QJSB 2CM5A 4XHJD 3SCMA 3IEAA 3WDJA 3FRUB 1E2VA 4PBXA 5FS5A 5CGYC 3HZYB 1DQVA 1U92A 3MKKA 4H44C 4Q9CA 5C9JB 4NC1C 2D3JA 1FPTL 2IPTL 1N70A 4HJSA 2P28B 4PJBE 5T33L 4H40A 2BVEA 3WLBA 3MCKB 4MMXA 4PRID 2Z92B 2Y5TA 3T5WA 4X7SL 5D7LD 5KTEH 4YR6A 4Z7VE 3IGKA 1LE9A 4JE0A 4M1GL 1I9JL 3G9AB 1XZ0A 3T71A 3CC1A 5DJCB 1FH2A 4CKQA 1OV8A 4NQVB 3DOSA 4FQXD 3L3JB 3KLKA 3G5ZB 1QSEB 3NJXA 4XI5D 4FKKA 3U0WH 5I18H 1P6FA 3FZUD 1AFVH 1WFNA 4PJ5D 5IQ7L 3JWDC 1U41A 1UD4A 3DURA 5G4NA 1B9ZA 1HQRA 4YQXH 3ORJA 3RWJA 3NSDA 2B39A 1VIWA 3BW9B 5IR1A 2F5AL 5CEXA 1J9RA 1QO3A 3BC9A 3QO1A 3GB7A 5FYJD 2B14A 4PB0L 2GTWB 3AM8A 4UT6H 4QWWD 2IBBA 2J88H 4X6DB 2EINB 1AJ7L 3LRSB 3GBML 4GH7B 4BKLA 3QO0A 2ZX9A 1EHKB 1M4KA 4F7TA 1LEIB 4K3DL 3APCA 2IPUG 4DOHB 2VLKD 5KSBF 1RIVL 3H9SB 5E0QA 4RNRA 1E5BA 2JKJA 4KI1A 4O2FB 4D8PA 5CGYD 4I2XE 2XWJB 1WIPA 4CN1A 5B39A 1JMZA 5SV4A 2EIMB 4F2MA 4MFHA 1XB8A 1NOAA 2AJZB 3PDOA 5JW3H 1G7IB 1OF0A 4B5EA 5GQBA 2WXFA 1RD6A 2CDFB 5GSRB 4YXLH 3SD2A 5DC2A 4KO5A 1KT2B 1ML0A 4JY5H 3OWEA 3B6SB 1T5XB 3IB4A 5D1QE 2APVA 3HS0A 4GKSA 1D5MA 4IHOB 2AXGB 1TZIA 3CVCA 2A9NH 3SB3A 5K9JL 4IRSB 4Z7WE 4LCYB 1HEZB 3CXHK 4HUWA 3QZLA 1DSYA 5SWQA 3N04A 3APNA 4BE5A 1CD1B 1PVHA 5LBVA 5I28A 1K6QH 3LH9A 5EBMA 3OGCB 5ETUB 3EUUA 3OKOB 2VDOB 5F6HI 3V7AE 3TT1H 1ETZA 4NQEB 3CN1A 1M7IB 2G4EA 4QGYA 2O5NA 4Z7OF 5BW7A 3F7QA 5MI0B 4U1LA 3VFTB 4YAQB 5HY9B 5D2LB 3DPBA 5E8DL 2VLJB 1HESA 4J4PC 3MACL 3SGJA 3PWPE 4YFLI 3ZL4L 3VG0L 5K39A 3FTWA 2H2PC 4A6YL 1Q9LA 5IV2A 1QHQA 5AVWB 2W95A 3QRGL 2QGDA 3LS4L 5HGDB 1HJCA 4PI2A 2Z4QA 4ZQTA 1ZA3B 2BSCA 4N6QA 2Q86B 3BPLB 2VDLH 4XN2A 2XQ0A 4FNLL 3VD1A 4AC2A 1YYMH 2HVJA 5IMLB 1HKLL 2W07B 1FZKA 2EIZB 4DVRH 4UU9B 4GP4B 3PJLA 4XAKD 4O58H 3VSTA 1TUPA 4RRPG 2VDQH 3GEWB 4NJ9H 1MLCA 1MFCH 5F3BB 3KCPB 3HI6H 2EH8H 2YEZA 3PNRB 3N55A 4ELDA 1E6JL 2YC1B 3GSXA 3HA0A 3JWNE 5FYKH 3JV5A 3RX5A 4RDQG 3ZTJG 1O5DT 3BN3B 3BISA 4WO4B 3ET9F 3IMUA 4U1HA 4CADA 4LCWB 3BAXA 4O51A 4EIGB 4H7VA 3FFDB 4P07A 3S3DB 5L2KB 4GSUA 3LOWA 2Q76A 4NUJB 3GEFA 1IGMH 2X4PA 3M6DA 2BW4A 1A9EB 4DN3H 4E9TA 1F11A 4A68A 2VXTL 3VAEA 1IQDB 2C1OB 3HPJA 3VE0B 4LAQH 3K6OA 4OJFL 5AD0A 1IGIH 4ZO8A 5J13C 1QR1B 1AKJA 4N2EA 1BJ8A 3R4DA 3U6XA 3VXTB 4UOQA 4ZD3H 3HTLX 3LKRB 5JHDD 1PFOA 5KVGL 4TNGA 1RKRA 4J4PD 5J6HB 2CNYA 3HMXL 2CKBL 2H2PD 3GI9H 1S7QB 1JPGA 2K4AA 2N3JA 2Y6TE 3GMMA 1ZTXL 3J8F7 1NC4B 1BVLA 2DQMA 2QQLL 2F8IA 3CN2A 4TQEH 5GS1C 4OM1L 4LE8A 5F1OB 2F18A 3ZL1A 4NZ8A 4XX5A 1IMHC 5ID1A 4KKBC 2K1MA 1LQSR 1Q94A 4XP6L 1P1ZB 4OBSA 5LG6A 1HQ4A 2IAMC 2OL3L 2WZAA 1AS8A 1QRND 2V17H 4PRDB 4DGYL 4E0RB 5CFAA 1HHGB 2CHWA 1NLDL 1YNTB 2HFGH 4OVVA 2ADIA 3HNTL 5CN3A 1OCWL 4FG2A 2ZF9A 4FL4B 3WFDH 4Y89A 3QR0A 4AQAB 3SDXF 3V6ZB 4BUGA 2GK0B 4I1NB 4ZFFA 1BWMA 3OMZA 1UACH 2GBTA 3CSFA 4Q6YA 1JRHH 3BP6B 4UM8B 3P4OA 2ROYA 4OGYL 5DZLA 5BZWA 1RHHA 3UO8B 5KYXB 3EKCA 3EO1B 1S2EA 4TN9A 1PQZA 3NIFB 2X2HA 4WEEA 3EXJA 1DJHA 2ZOKA 2C9XA 1P2CB 2YAPA 3DVGB 5KVGE 4GMTL 3HUJA 1NSNL 4P2AA 2MH4A 3RWIB 3FU8A 4X6CB 3SPIA 3FQNA 5JXAH 1KN2L 1IKNA 1GYWA 2AABH 3II2A 1ZTXE 2P48B 3E2HC 5FO7B 1G0XA 4I85A 3UZEA 3T8XA 4X6FB 4UNVA 3QUZC 3QQDB 4FXGB 5JLZA 2OP4H 3T2OA 2YIHA 1UZ6E 3ZKSD 2MTAA 4A55A 4P2RD 5JO5B 4BSVA 2VH5H 1XB6A 3TP4A 4K8RH 4WHCA 3VRLE 5FB8B 2FL5A 2WUCH 1YY8B 5I2IB 2DJMA 4QAWA 4YEEA 5D7IB 3IU3A 2VLME 4IKNA 3OZKA 4KKBD 4Y4FC 5DYOA 5A16A 1PYWA 1JNNH 4LBAA 4E68A 3MRHA 3CMOL 3ARWA 2IAMD 4Q7DA 1HAUA 4OZFH 4X5PA 4O4YH 3RNKB 1GZPB 2K45A 5ISZA 1R3IL 2ITCB 3RG1C 4GG8A 4GRLC 2YN5A 1W0VA 2K70A 2EVFA 3R7QA 3KL3A 5E0FA 3HFFA 4ZAKC 4EIBA 2FYYA 1BBDL 4F7MB 3RVUD 1VGEL 1WE5A 3QDJD 4DP5X 4L4VB 3PV7A 4OAWB 4R5XA 3MLZL 1QQDA 1OB1B 2EC9T 1NWOA 3WY2A 2VMJA 4MCYA 2GT9B 4MRBA 5DDHB 4JHVA 3B9KC 1NDMA 5I1GL 4RQQB 2R2BA 5K93A 1OAKL 4JN2B 3SE8L 4EZKA 4X6DF 4IBUA 4GO6B 1T04A 3KPQA 3NGBC 1FG9C 2W9DL 5GRZA 5AKTA 1KCKA 3NFPB 1DTUA 4CU8A 1CGYA 3CPUA 1F8TH 1LP9B 4HUNB 2APBA 2C3HA 3FTGA 4HIXH 5F9WB 1JN6A 2CK0L 4RAUA 2P8PA 2R29H 5DJ2A 4D7BA 1ZLWH 3GJEA 5DSCA 2FWOB 3L7FB 5JIQA 2YK1L 2APWA 2R0ZH 2VDKL 2ILLA 1PL3A 3NJVA 2ZSVA 4GLRH 1N4XH 4L3EA 4Z95H 4TSAH 4IIQC 3U4KA 4PJIB 3F5WB 3WENA 3DC0A 4GKLA 3KCWA 4X80L 2RCSL 4K94H 5SWSD 1ORQB 1T6WA 5DD5H 1A14L 2IWFA 2NPLX 1FLRL 3O3BB 3TBTA 3X14A 3G6JB 5I82A 5I74B 4Y4FD 1EO7A 2R51A 4BXSV 1JI2A 3SIKA 4BHUA 5CZVL 1TMQA 3CN3A 3UMTA 4W70A 5EPMA 2ZAIA 4Q9QL 1U8QB 5KSVA 4GRLD 2NXYC 1UZ8A 2NUTB 4YE4H 4ZAKD 5EBWA 3V4PB 1Z3RA 3TX4A 4AEFA 4LPVA 5AW6B 5IVZB 3Q05A 3BGFC 4M62L 3OQRA 3BPOB 4YSCA 2OZ4L 5I73B 3WNOA 1GTNA 3OVUB 5D2LF 2P52A 2DQUH 1OGPA 2ZSWB 3DARA 2UZYB 4H8UA 5E5UB 3P40A 3OXRA 5IVNA 1FO0A 1PZBA 4B9PA 3N41B 4U7KA 1EEZA 2PYFB 4QHNA 4MLIA 4PIRF 4YC2B 3U1SH 4FXKB 1Z32X 3BOVA 4H1LH 5D7LE 5I8KH 5CJOL 3V5HA 5KBPA 1CFTB 1NLBH 3V5DB 3T9WA 2DLHA 3KL5A 3PGDB 1MHCA 4B50A 1HOCB 1WFTA 4GSQA 5FYKD 3SKOB 5DWPA 4KNSA 2QKSA 2VAAB 2HG0A 2IOOA 4GS7C 4QXGH 3U25A 5E2TH 5EEZA 5E9DE 1P5VA 4IRJA 5D70H 4UTAA 1H6EA 2B08A 3R18A 2EEFA 2V0AA 5CGMA 5ANMA 3KHOA 3MZGB 1UM5L 1W0YT 3TYGH 1CTMA 4H20L 1LVEA 3X13B 4PJ5E 3C75A 2EP6A 1IAOA 1FN4A 3TYFA 3VRJA 5IBTL 3R06A 4YHIA 5D2NE 3G5XB 1QYGH 2J72A 1A6WH 3U30C 4JKMA 1AQDA 1R19A 3C08L 5CILL 4P9MH 5E8EB 3U4EA 1JZ6A 3VFNB 2GITA 5E5MA 1XF3A 3JWDL 5F3FA 5HJ3B 1IIKA 1FCCA 2I27N 5FYJE 5LAXB 1OSYA 3PAYA 2PP9A 2TRYA 1FL5A 4PN6A 4X9FA 4KVCH 3KPOA 2CMRL 2ERJB 5LGJA 2VO5A 4LHUB 2F8OA 1SXSA 3WKYA 2NW3A 4DGVL 2FJFA 4JZJB 2NXYD 4XC3H 4YXHH 2VLKE 3KGTA 1GS6X 5FA4A 3I75B 3UTTA 1NMBL 1VEMA 2WLNA 5DD1H 4BXVA 2V5MA 3TL5A 1A3ZA 4K8RC 2FJSA 1ZHKA 2HKHH 1V5JA 3GJFH 4AYFB 2QQKH 4W1TA 1OF2A 3O45A 5EA0L 4XCNB 5BUAA 3JWOH 3HAEA 4M6OH 4PRBA 3RDTB 8PAZA 4M1DH 3CK0L 3K81A 4Z7QE 3WEMA 5EOTB 3FOMA 1IJ9A 3KPSD 5DLMH 4HPOH 1V8HA 3EHBB 3TOPA 1O6TA 1E9PB 2B1AH 2HWZL 4P06A 3ZR6A 3TH3T 4DKFH 5I17A 1ZHLA 4DSYA 4RBPK 2GIYA 3U9WA 3MR9B 4FFWC 2C9RA 1JNLH 1KBKA 4JY4B 1GYCA 1UKQA 2HUHA 4HGMA 1TYJA 3UPRA 1T3FA 2UX6A 3H9YA 3QDMD 1NICA 1U58A 2B4CL 4KK6C 5E00A 3RHWF 1HHHB 2HVBA 3MV11 3UG5A 2KZWA 1YN7B 2W38A 3JVFC 4HJGA 5EWIH 1CI3M 1VB9A 2A77L 4ZMNA 1FIGL 1VERA 1YNTF 5C0AD 1CZ8H 4L29B 3SBWA 1U33A 2WGXA 4ABWA 4MJHA 4A66A 1ITCA