1JXFA

Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport
molecule keywords PLASTOCYANIN
publication title Backbone dynamics of plastocyanin in both oxidation states. Solution structure of the reduced form and comparison with the oxidized state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxfA00
4A2DA 2Y1AA 2X87A 1PLCA 3T9WA 4AKOA 2VSKB 3NSFA 2VSMB 3NYKA 3UACA 2H5UA 2J56A 5B1JA 3AY2A 2BW4A 4P5SA 1GS8A 2OJ1A 3FSZA 2HZHA 4WTQA 3ABMB 2AANA 4BXSV 3NJMA 1BXVA 2NRDA 5I5JA 1ZDQA 2FQDA 1RZPA 1MG2C 1GYCA 4PCYA 4DPCX 4GXFA 1NIAA 1OE3A 4DP1X 4ENZA 4CSPA 5D4HA 2GBAA 2X88A 5B7MA 1MG3C 1HFUA 4JHUA 4YSAA 1AZNA 2J57A 4YSPA 5TK2A 3GYRA 2AZAA 2XLLA 4A68A 1GY2A 1X9UA 2Q9OA 1J9SA 2CAKA 3ERXA 1ZDSA 2XV2A 1E30A 4A66A 4X4KA 1BXAA 4G71B 1NDTA 1B3IA 1ZIBA 2BWDA 3S8FB 1PZBA 2FWLB 4QKTA 2P80A 2TSBA 2XWZA 4KNUA 1RCYA 3PPSA 4EF3A 5I5IA 3FPYA 4YSCA 1MZYA 1FA4A 4UANA 1V54B 1PF3A 2IDQA 1J9TA 1R1CA 3T71A 3T6WA 1SF3A 4W1TA 4KOCA 1HAUA 2R7EA 3NP3A 4A2FA 5I6OA 1XB3A 2EIJB 4A2EA 2EIMB 2FNWA 3FS9A 1NIDA 1JXFA 1PLBA 3QJVB 4AX3A 1AZUA 1ID2A 3QQXA 5B1JC 4YSEA 4NB7A 1E67A 1BXUA 2XYBA 1QLEB 5I5MA 3EF4A 4DP4X 1DYZA 3NJHA 2IWFA 4HCGA 3CVCA 1WA2X 3CVDA 1AR1B 5ANHA 2CCWA 3BQVA 4KO7A 1DZ0A 2PP7A 4UAHA 1TU2A 4DP6X 1NPJA 1PAZA 4E9QA 1AANA 3EH3B 5F7AA 2DYRB 1GY1A 2ZOOA 1AIZA 4AI7A 1L9SA 2UXTA 4TXVB 1ET7A 2XXFA 3PXLA 4YVNA 3SBQA 2LLNA 3X1FA 5PCYA 1ZIAA 1KV7A 2J55A 3ABLB 1ET5A 2YAFA 3OMNB 1WS8A 4ZK8A 1PZAA 2QDWA 2PPDA 1JXGA 2RACA 1NPNA 2IDTA 9PCYA 5AKRA 1L9RA 1MZZA 4KO5A 1JZIA 4GY4A 2JKWA 2YXWA 3FU9A 1WA1X 4F2FA 1ETJA 2XV0A 3CVBA 1AZRA 1N70A 1SF5A 2FQFA 2PPAA 2YQBA 4Q8BA 5D4IA 2VN3A 4KNSA 1OCRB 3NT0A 4HAKA 2YAHA 2WO2B 5I6MA 2B08A 1SDDB 3D12B 3X2QB 1GW0A 3UADA 1OE2A 3CDZA 3NJKA 4HALA 4L0PB 3CZUB 3JT2A 4KO9A 2MTAA 3ABKB 3RYMA 1SHWA 2Y69B 2BP8A 3KW8A 1I53A 2VM3A 4W9ZA 2VMJA 2FTAA 2PPCA 1A8ZA 2YAMA 2BP0B 3DKHA 3WKQA 2HX7A 4F2EA 2YAQA 4JKNA 2JFCA 2OV0A 3ZX1A 3U25A 1V10A 3AG2B 3QJQB 4G70B 2JXMA 2FJSA 1IUZA 3S3BB 3ZDWA 2DYSB 3NJGA 3S3DB 3IEAA 1PZCA 2HX9A 2CALA 4HCIA 2PP8A 3FSWA 1IBZA 1PNDA 1WA0X 3AG4B 2UXVA 4GP4B 1E65A 1A3ZA 2N0MA 3T6ZA 3TBCA 3SQRA 1JVOA 1HAWA 3FQYA 3IN2A 2UX6A 4RH4A 1J5DA 3ZBMA 4WKXA 1W6WA 1JERA 4E9RA 5IY5B 5F7BA 4FA7B 1GSKA 3NSYA 3ASNB 2UX7A 1FWXA 1OV8A 1ZV2A 1NINA 1OCCB 4AKQA 1BQKA 1W8EA 4GYBA 1PLAA 3GDCA 2AFNA 2XX0A 3TASA 3WNJA 1E5ZA 2EINB 3OMAB 4BDVB 4E9SA 4M4RB 1JZHA 1AZCA 3DIVA 3HEIB 4YSOA 3WIAA 1TEGA 3IE9A 2HXAA 3EHBB 3QPKA 2IH9A 2DWSA 2BZCA 1JZGA 1PY0A 4DP9X 1IKOP 2B3IA 4DPAX 4HIPA 1QHQA 2UXFA 1V55B 1SJMA 1PCSA 1IC0A 1CUOA 1WS7A 1M57B 4YSRA 4DPBX 2I7SA 2I7OA 2WO3B 2UXGA 3G5WA 5B1KA 4DP2X 4A2GA 1KDJA 1KCWA 2W88A 3S8GB 2CUAA 3PAZA 3NSCA 1MDAA 1BAWA 4PAZA 2FQGA 1ILSA 1NTDA 3PAUA 4A67A 2ZWNA 1XB6A 4YSDA 3AW5A 5LDUA 3NJIA 1M56B 3OM3B 5B7FA 4HHGA 4G7SB 2FQEA 1BEXA 1F56A 5A7EA 3DTUB 4G7RB 4YSUA 4MFHA 2EIKB 2GSMB 2VW4A 1NICA 3IBOA 3QJRB 4DP7X 3FYEB 2IAAC 4E9TA 1CYWA 4YSQA 2YAOA 1BYPA 1J5CA 2AZUA 4NAJA 4F7KA 3QJSB 2PCYA 1NZRA 2GB2A 3FSAA 3WKPA 2GIMA 1GR7A 1AAJA 3QJTB 2PP9A 3FU7B 3GXUB 4YVUA 3TBBA 1L9TA 4G72B 2VW7A 2W8CA 2GC7C 1RKRA 3AG3B 4DP5X 1OCOB 2E86A 2IWKA 1PMYA 1ASOA 3QJUB 3CG8A 1XMEB 1OF0A 3WI9A 1JZFA 1UATA 3FSVA 1L9OA 3UAAA 2XX1A 1EZLA 1ASQA 2ZONA 1SDDA 5AFAA 2IDFA 3NJNA 4BWUA 3X1NA 1SNRA 1J9RA 2CJ3A 3X1BA 1EHKB 3IN0A 3PCYA 1X9RA 4HCFA 3H56A 2HRGA 2BP0A 1AG6A 1KBWA 1SFHA 1BQ5A 1A4AA 1GS7A 3OD3A 3UGEA 4E9XA 4BWTA 1AACA 3T6VA 2GC4C 1ILUA 5I6LA 1JOIA 2VM4A 2XV3A 4CSZA 8PAZA 4JHVA 4E9YA 1NIEA 1ADWA 4FAAB 1JZJA 3V9EA 4E9WA 7PCYA 3NJFA 3UABA 3AG1B 5I6PA 4UF7C 1A65A 3FYIB 2IDSA 4DP8X 3PLYA 3MBWB 2I85A 4BK5C 2AVFA 4GP8B 1JZEA 1AZBA 1OE1A 5EHFA 4A2HA 2XU9A 2PPFA 1NIBA 3UAEA 1XB8A 1L9QA 1N68A 2TSAA 3WG7B 3OQRA 5D4JA 5FC9A 4BXVA 3ABGA 1ET8A 2Q5BA 3FU8A 1AS6A 3T6XA 1CURA 4BDVA 2FT7A 2HRHA 2IWEA 2YXVA 4KNTA 3FT0A 5I6NA 2P80D 1OOWA 2YAPA 1BYOA 1WAEA 1KBVA 2GHZA 4HZ1A 6PAZA 3X1GA 3FQ2A 1URIA 1A4BA 2BZ7A 4BWWA 3H4FA 2QDVA 3FQ1A 1QNIA 1AQ8A 1TEFA 1GS6X 2A3TA 1PNCA 2DY2A 4YSSA 4M3HA 3S3CB 4YL4A 3WNIA 5B3SB 5I28A 2VW6A 4Q89A 4P5RA 3X1EA 5I6KA 2PLTA 2PPEA 5B1AB 1KCBA 1AOZA 1KDIA 1W6LA 2MRYA 3MX0B 1IBYA 4QLWA 2BWIA 4G7QB 1A4CA 2XVBA 2OCCB 2XXGA 5B7EA 1CC3A 5I26A 2DV6A 3TA4D 3JTBA 2R7EB 3BVDB 1M9WA 1SFDA 3KW7A 2IDUA 2H3XC 3SBPA 2QT6A 1J9QA 5B1BB 5E9NA 1JVLA 1NIFA 3N55A 2IH8A 1L9PA 2BO0A 2XUWA 5PAZA 1NWPA 4N8UA 3N2JA 3ZIYA 2CBPA 3FU7A 2HLEB 3V9CA 3NJJA 3TU6A 3C75A 3PAVA 4KO6A 1CYXA 2QPDB 3FPXA 4AKPA 1AS8A 3EH5B 2DWTA 4DP0X 1FFTB 3NSDA 4GP5B 2J5WA 4AZUA 1YLBB 2BW5A 2H47C 3AZUA 1AG0A 1RZQA 1KGYE 2YAEA 3L45A 3NJLA 4HHWA 1SHXA 2EILB 2HX8A 1KYAA 2PCFA 5TK4A 1ASPA 1T5KA 4N4YB 1TKWA 1OCZB 3SBRA 3OMIB 7PAZA 1JXDA 2FT6A 3NP4A 2YARA 1NWOA 6PCYA 2WSDA 1AS7A 2BHFA 3HB3B 3ASOB 3EH4B 2QPEB 4KOBA 4NERA 1ZPUA 5AZUA 4E9VA 2ZXWB 3H4HA 1BQRA 1E5YA 1VLXA 4K9JA 2GI0A 2FT8A 3CDZB 4YSTA 2BP8B
chains in the Genus database with same CATH superfamily
1RZ7H 4XXWC 1KEGH 3F84A 3REVB 3MRPA 5FW8A 3TPUB 1YO4A 1AP2A 2FJHA 4KTEL 2EIEA 1CK0L 4OJAA 5FOJA 3QDJD 5HDLA 2P47B 3U46A 3K1KC 5GS1B 1RVFL 2WK2A 3SPIA 1H3GA 5TDOB 1A3QA 1AGFB 3L3DB 3DX2A 4IOFC 2CCLA 3PQYD 1G9HA 4TULH 2Y07H 2N3JA 5E51A 2NRDA 4YBQD 5DFVC 4B9GA 2W65A 3DO7B 3JWDL 1SOKA 5L2KD 4K3GA 2XA8H 2Y3NA 3WEXB 4PCYA 2IVFC 4GXFA 1J9CT 3WELA 1F1AA 4X7CC 5F7EL 4K3HA 3ETBF 3ECVA 2I24N 3TVMA 7FABL 4YHIB 4XWOC 3CZFB 2QV2A 2WWKO 3RFZC 2Z1KA 1FG9C 1FFRA 1NUNB 2J57A 5DJ6A 1I8MA 5E6ZA 3GYRA 2J8UE 4CVXB 5I0XA 4A68A 1CR9L 2VQUA 1WT5C 4LQFL 2WZPA 3QCVH 2ZD0A 2CKBL 1UWGL 5DK2B 4U1GC 5TH2B 3ARDA 2EXSA 5AOLA 4LSQH 4IRSA 4PGCA 1FNEB 4FTVE 1KLFB 1JK8A 5DJ2B 3TN0D 1U8LA 3TBTA 3QXDA 4L18A 1R47A 2JH2A 1T1WB 4IM8A 3O3EB 2LVCA 1PG7X 4Q9QH 2Y7LA 4L48A 2ZXDA 1ERNA 3ULUF 4OH2A 4OAWA 43C9A 2VO8A 2ZCKH 1F0LA 1NGQH 4RCAA 3GMLB 1LJMA 3IETB 5C6PB 1G0DA 2NCMA 2WSPA 4GG6E 1HAUA 3JVGC 2X4OB 3U36A 3VWKD 5LVEA 1PJWA 1TEYA 5B1JC 4YAQB 5I74C 1X9LA 3HAEB 3ARPA 3UO1L 3BAKA 4M8VA 4OT1H 4WJ5B 5GGUB 4JJ5B 4JFZH 2X0UA 4AM0B 1C8QA 2BRQA 3PWJB 3SKUD 4RGNC 2LLLA 4PRDA 3BPOB 3L13A 1JK9B 2HA1A 3NJHA 3QR1A 1HEZA 5CR1A 1BVNP 3TFBA 5ANMB 3WFCL 1AQKH 1TU2A 1Z9SB 1NGWB 3F7VA 3OR6B 4NQQA 4CADB 4Q74A 1TZGH 5C07A 2DI8A 4JPWL 2Y5EA 5TD4A 3ZPDA 3RIKA 4DPRA 2CR3A 4XC3L 1YMMA 4NPYB 1LWJA 1SMOA 3UOAB 5BZDB 4MCYB 4K3EH 3ZO9A 3PRZA 4TSCL 3DRQB 1KPUA 3RX7A 5J8OA 3J7HA 3FO0H 4WHCA 5I9QB 4PIRF 3QEUA 1CYGA 3MI6A 2N01B 4ZUTB 5AKRA 5TE6L 3RNQB 5LXGL 1KNOA 4F15B 3P73B 4Y1TA 1FO0B 3W1ZA 3BMWA 1OLZA 3I6KA 5ERWA 3SKMB 4C54A 2YQBA 1ETA1 1HVXA 1KG0B 1EXUB 1WK0A 3SOBH 4V1DD 2FJFB 1PFOA 1VZGA 1L6XA 3SDYL 2VMDA 4KX8A 1J87A 3VDBA 1SDDB 2E47A 2F7PA 3DOSA 5FYJE 5SWQB 4JPVL 4IW4C 1OE2A 2CIIB 2HFTA 3NJKA 3DA0A 1JDAA 2F53B 1RIHL 1JHTA 2FECL 2Q2LA 1JPSH 3BD5A 4AQZA 3VSTA 3TA3D 4HMCA 4HWNA 2VZ3A 3L08A 1H9DA 2D3NA 5E1GA 2D0HA 4PJFB 2WTRB 4RX4D 4XPGL 2HRPH 4BZ1H 4DERA 5C09E 4Y1AB 3HG1E 3QSKB 1E9QB 1RJCA 1AC0A 2WXIA 3U25A 1GYUA 3FCGA 3MLYH 3IKCA 5D8JL 4C47A 4C56A 1TQBC 1AO7B 1ZT7A 1NMCC 4U1KA 3WBDA 3U4KA 4FNSA 1ULVA 4D7PA 2XTJC 4FADA 3O6KH 3BZEA 3B9KA 1U9KA 1WA0X 2P45B 4JFWA 2D4DA 1MW0A 2C8NA 4KTGA 3KYMA 3QDME 5JLZB 4ZD3L 1WV7T 1ZAGA 4PP2B 5EUOF 4FG4A 4K9EH 2VDQB 4L29A 3SPVB 3CFUA 3HC0A 1F18A 1UUNA 4KKQA 2D8KA 4UT6L 5LBSA 5BMFH 4BEIA 2AXHA 1OZTG 1OB1A 4MKMA 5L88L 3MGOA 1O7DE 1JN6A 1W6WA 1UKTA 3APMA 3PWUA 3LY6A 4HUMB 1SZNA 4B6ZA 2WXJA 4HU2A 2MTPA 1TTFA 4DCQA 3MV8A 1T66C 3NGBB 5D1XD 1MJJB 1DEEA 5AVTB 3FUHA 4K71B 2ARWA 3ML9A 4BDVB 4G5ZL 4LSPH 1NBYA 1UWEH 3DIVA 3GB7A 3S6CA 2W9LA 1KT2A 1PZ3A 3ZYOA 4MXWH 3F00A 4ES9A 1S78D 4TNEA 1UACL 2BZCA 2I60L 3D3VB 4TVPL 4WO4D 5GRUL 4DP9X 3WHE0 4GT0A 3CSBA 3D69A 4BA0A 4HFUH 4DPAX 3WNLA 2Z0BA 4Z3JA 1DUZA 5E6YA 5MEND 5DTFB 2AV7B 3P77B 2I7SA 4ZFFA 3BUYB 1SYVA 5IROA 3QORD 4AYEC 5C0RH 3NIFF 2EKSB 3WTVA 3OC5A 1SN2A 1OARL 2ZT9C 3S35H 3K7UA 4PLJD 3SKJL 3RL2B 4PGDA 2R4RH 1H3WM 2ORBH 2PYEE 3QUHA 5BCAA 2VLJA 2H26A 4YE4L 1FSKB 5JOPD 4UV7H 1YG9A 3J2PA 5CAYB 5A7EA 3DTUB 4YZFE 4FKEA 4NO5A 3RX9A 3RB5A 1TNMA 5E8DH 1SRDA 3BZ4B 3W37A 4WWID 1YUHB 1MHPH 4E9TA 3RIFK 2LVEA 5I8EB 2DQDH 3FC8A 4GOSA 5AOKA 4LHQB 4OGXL 1UOVA 4NEHB 1IJNA 4ZMAT 1F86A 3OHMB 1VCBC 2JIXA 1J1OH 3RVTC 4PJ5D 3EBAA 2JJUA 2GTWA 4ZFOL 4BELD 1MH5B 1HTYA 1MJUL 1UD2A 2B4CL 2C9AA 2FD6L 4URKA 2NQDA 3N3EA 4OGAC 3MXVL 3KVQA 3GWJA 1NBQA 4YFDB 4M8UA 3QXUA 1HI6A 2VXSH 4N6QA 1IAOA 4N22A 1VIWA 5DI8B 3QW9A 3TEXA 4QJ4B 4BYHA 2O5NA 2CKBA 4X98B 5JOFB 3NQIA 5IF0A 5LHDA 4Z18A 4N2HA 4NKOA 5AENA 4JREC 4LLWA 3O9WB 3T04D 3NJNA 3ULUL 3X1NA 1WHOA 3DHJA 4UNVA 3JXAA 3PABB 4ZMZA 3PCYA 3ARVA 3HBPA 1X9RA 1TVBB 4P3CL 2HRGA 4PJBE 5IQLA 5K9KB 4GW4A 5FA3A 1SMDA 3KPPB 3VSQA 4N26A 2C1PA 1BJMA 3V4VL 4LLYA 5IFAL 4LLQB 2HH0L 4L3AA 1C1EL 1BDYA 4OJFL 5JW5A 4F2MA 4B96A 4CSZA 3CVHA 1Q4NX 4N28A 2HVKA 1QSFE 5D7SL 2X89D 4XMUA 4N86A 3F62A 4MNGE 3S8WA 1RUML 3FQXB 2ERJB 3EYVB 3D85A 3RGBA 3U2IA 3G6JF 3V9EA 2OXGB 4PJCE 4CC4A 2E7LA 1J5IA 3TLRA 4X6EA 3WIFB 2FGZA 5KVGL 5M95B 5BS0D 4OD1L 3FH8A 3BYTA 4X0KA 5F8RC 4KKLC 3B4NA 3GMPA 4A2HA 2XU9A 2DIEA 1FGNL 3SIKA 1E9PB 3CDGA 5L6YH 1YJDC 3MCLH 3HC4L 1ET8A 5IHZA 3KYKH 3FU8A 1IX2A 3H3PH 3LZOA 5IMKA 1JTTA 4HOZA 3ZU8A 2CO6A 4UM9A 3GJFA 1HNYA 4PB0H 4N0CD 4ELME 3RVUD 3SJVB 2J21A 4JKKA 3UH8A 1RP8A 1FFOA 2PWGA 4FLSA 4XNBA 4RRPA 2PR4L 3TPKA 3W9EB 1E0OB 3OKDB 4ZZFA 1MRCH 3HN5A 2IOMA 1PNCA 1SM3L 4N9GA 1MRFH 5ESVA 3OPZL 4W81A 3CX5K 3KYOB 4E41D 1S9XA 1R34A 2IALB 4PJHB 4X6DB 3V2AR 4E42A 5LGKA 4NLAA 4R0LC 1KCBA 4MD5A 1DQIA 3GSOB 2CLVA 3MX0B 1QBAA 3AITA 3IU4H 4TUJB 4QLWA 5BVJA 4ERSL 1NFDB 2ATPA 4NN6C 1A25A 3LIZH 5JHAA 2DMBA 1B0GA 3KPLA 4L8BB 5B3JE 4Z8FH 2VDPH 3VXPB 1FCCA 4N20A 3ZE0F 5AWNL 4WENB 4EBQH 2BOBB 3ZL4L 4M5ZL 4KQ3L 2VDQH 5DQDH 4I0PB 3EYUH 1JV5B 3BE1H 4DETA 3IAQA 3GBEA 5CJ8A 1QUNB 3ARFB 2K4AA 5ID1A 1JTOA 4YH6A 4HZLB 3GGWB 5GS3A 5GRVL 3ZUNC 2AK4E 2F5BL 4BFNA 2X1OA 4ZOBA 5ACLA 1QSEA 3Q0HA 1SEQH 2RA1A 2Y7OA 4XC1L 5JW4M 3FU7A 1OTSD 1R24B 3QS2A 3N1GC 5T3XH 3TESA 2LFEA 1BVOA 3C75A 4MMZA 4UT6A 5FYJU 1HYSC 3EH5B 3GSUB 1RLWA 1N0LB 1OT4A 4X8XA 4XPHH 3FHQA 3PHQA 1CBVL 2VDMH 3FTXA 3P9LA 1I7RA 2WXFA 5BO1H 5IK3A 5F7DB 2FJUB 5EFIB 2APBA 1WZMA 4PIBA 1G0YR 1ZLEA 4JO4L 4OZHB 1TTGA 2W91A 1V7MH 2ZCHH 4AYDC 2HWZH 1JD9A 3OKYA 3HB3B 4HPYH 5IG7B 3KPOB 4KOBA 2X53A 3FB6A 4GMSH 4E9VA 1E3XA 4BFIB 4J3OF 2GTQA 3RB7A 3MRNB 2WOYA 4BUGA 2IPUK 1WIPA 2MIZA 2CRZA 4G8IB 5I19L 3TCLB 3ZDZF 4FFZL 2DDQH 5F1NB 5ANME 4FF9A 2JJWA 4F58L 2HTKD 2VSKB 3QHZL 2E46A 5CHNB 1G9NH 1KN2L 3O2WL 5I5RA 5MHSE 3ARGD 2ODHA 3UACA 1U8QA 3MFFA 1K5WA 4HJJH 3C5ZD 3RY6C 1IBHA 2HZHA 3TJHD 4D0BB 2Z7ZA 3II3A 3BIKB 4N6RA 4XVSL 3QI9C 1IQWH 1XTLA 5F72S 3KLHD 4W6YB 2BVPA 1GC1L 4HYTB 3FH7A 3NCBB 4MB1A 1Z9MA 3N0AA 4TUUA 1RI8A 2J7LA 5SX5H 4AIXA 1V8HA 3TC9A 1TVHB 1T5WA 3FTGB 1C5CH 1CIUA 1DQMH 4LVHC 1ETB1 2GTZB 4ZFOA 5D7JB 5HI3D 4YSAA 5CIPA 3AFLA 5E5RB 2R0WL 5TK2A 3HNTH 4HKBB 3MACL 2ADJA 4Z7WF 4JO8A 3ZSSA 2XTLA 4ORZC 1T4WA 3TH2T 3VFSA 2D0GA 3FDWA 4PR5B 5C71A 3IJ7A 4UQBA 4R4FL 3HG3A 5ABAA 3LKNA 4JQXC 5E4OA 1B3IA 3NDYE 1ZIBA 5ICYB 2O61B 4FEMA 4LFHD 3S8FB 1MRDL 2I9TA 4OUOA 1NEZG 1LE5A 1C5DA 4FZEH 5D2LE 3AQDA 2N7AA 3CZNA 1F4HA 2VL4A 4WI7A 5A2FA 4KNUA 1U3JA 3EDFA 5HGGS 3C6EA 1G1CA 1RJZB 1Z0NA 3JWNG 1FL3B 2Q10A 1P4IH 4WHDA 4P23D 1S46A 4YHML 1MUJA 2Q8AL 4ELKA 3QQDA 3QR2A 2W38A 4BGDA 2Z35B 1JYNA 4LL1A 3EKCA 1IFHL 4D9QD 5IQ9B 4WUUB 1HHHA 4HS3B 4BA8A 3QRGL 3EF4A 4KX7A 4F7EB 2CDFA 4DO5A 2AJ3B 1AR1B 4YR6B 5GRJH 5T3XE 1ZHNA 1QLRB 2R0LL 4MXQC 2DQCH 5EOTB 3UIYA 2ZKXA 3U0TA 1QRNA 4OZ4A 4PWKA 3MNZB 1N9PA 3MGTA 1AIZA 5I0VA 2VDLL 4WWNA 4MCNA 1IJ9A 2OTUA 5MEPB 2NY4C 3ES6B 3MROA 5CGMA 2XXFA 2WB1A 1M1XB 3BH9B 3MV7E 3VXSB 4QRAA 3MCKB 5BJTA 1ZY9A 1MCLA 2J5LC 1DDHA 2B0SL 3QUMH 4GUOA 3X12A 1AGDA 4NUJA 5C0DA 3FO2B 2VABB 2HN7A 5DJAA 1D6EB 5DHEA 4NYLA 2VISA 2XPGA 4NSKB 4XMTA 1ETJA 1T3FB 4R5VA 32C2A 4RMRA 1AH1A 3C87A 4ZTOH 4YDJB 5D4IA 2XZAL 3FT4B 3ULSB 4XMWA 4OZFB 1YEGH 1DE4A 4MJIB 4WK4B 5AW3B 3LEVL 4LLMB 4PJ9D 2VLLA 1GW0A 3CDZA 2K70A 4G6KH 3K6NA 3FW6A 3E6HA 1K4DB 5C0ND 1X44A 5HXMA 1QSVA 2WLLB 1P4BL 4B9ZA 2JQAA 1G9MH 5B8CB 2FHFA 2AJUH 4L4VD 5D1QD 2A4EA 3BSHA 5TF0A 1RLBA 1BG1A 5EH1A 2AV1B 3ZDYE 4XVUC 4L8DB 2B59A 1XGQB 5CFHA 5I8CB 4Y4FC 1JNLL 2Q6WB 2D7TL 3OX8A 1RUQH 4HS8L 1ZANH 4G70B 5CM1A 3QIWB 3ZDWA 3GSQB 2DYSB 2K6ZA 1BFVL 1DCLA 1JHKH 2FIRT 2PO6A 4XN2A 5KVDH 4HCIA 1JZ8A 2NQ3A 2GY7B 1OPGL 2AQNA 4W93A 2BOCB 4OD2A 1P5VA 2N0MA 3INOA 5EUOA 3T3MB 1HXYA 5DVPA 3NEXA 4DEPB 2EUXA 1LLAA 2H1XA 1IRAY 3DYPA 1M1SA 1NANH 3EGXB 4KC3B 3V6OE 1DVQA 3STZB 3NSYA 2OI9C 3AADB 4LIQL 2CBTA 1FUNA 4UQ2A 1ZT4A 2JKNA 2YPLD 4UIMA 3SE4A 3ZKND 4EI5B 3RX5A 3GEWB 1HWWA 4IK7A 2ICCA 1W8OA 4FX5A 1F4WL 2NT1A 4OCSH 1D7DA 1P84K 3PJLA 4LKCB 4YGVA 5TTRA 4YHPB 1EAOA 1F11B 2BSEA 3WS6C 1TEGA 4JFFE 3D39E 4JFQA 3VFPB 5AG8A 5FEBA 2WZ5A 5LQBL 4JRYA 3B7YA 3M1BB 3ARED 3QRFM 1AD9B 2NY0D 1Y7VA 4TPRL 4YXHH 4LVOC 1QBLL 5M7QA 2X3BA 5EORL 1VA9A 1IC0A 1MCPH 3EOBB 3HZYB 3AUWB 3HZKA 3WNNA 1I9JL 3VTTA 2G2PA 1J05B 2V33A 3LS4L 4PG2A 2KS0A 3LEXB 1WC7A 5CKAA 3QZNA 1MCRA 3L6FA 1VEPA 4PRHD 4XXCA 4HIHB 4MSWA 1J11A 2AJVL 4HX1B 2G75A 1XIWA 3IYLW 3MRMB 5F9JB 1D5ZA 4MJJA 3V7AG 1R5VB 1M71A 2DZEA 1PX4A 1A14H 3KWVA 1U8KA 4JRXB 4MFHA 1TZ8A 2UY6B 3N44B 4DKEH 1U2YA 4LSRH 2NY5H 3WS3A 5HJBA 3ATDA 1UZ6E 2OQJA 5I17A 4J3TA 4MAYA 5FO9B 3MTXA 4CVUA 4HCRA 1O9VA 3RGHA 4AJ0A 2NUPA 3HI6L 2Z92B 4JFUA 4QRPB 3B3IB 1M3IA 3EO1A 2XT1B 4KXAA 4MQ7A 3G08B 4RGMC 2RFXB 1DBML 1DJZA 2BSCA 2TRYA 4PJAF 5B3NA 2R27A 3GMNA 4Y0GA 1AAJA 1LEKB 4TUOB 2ITCA 4JL1A 4Z77A 5TGBB 1KBGL 2WGNB 2WWKT 2X7LA 3VGBA 2W8CA 1OALA 4I3RH 1B9ZA 1X5ZA 4NQVA 5E99H 2J6EA 1FL5B 4NGHL 3O0RH 1XGYL 5B4MD 1YMHA 5EEYA 4PJEB 2H3NB 1T6VN 4Y9BA 5KSBB 3UAAA 2NXYD 1DHKA 2XX1A 4X4XB 2NW2B 4EN3C 2IDFA 2O1AA 4XOCA 2VXUH 3NAAL 3T2OA 2B1AL 4Y4KC 3IFOA 3G5ZA 1KPRB 2A6DA 2YBRB 5DQJA 1RZGB 1X5KA 3GK8H 5E9DD 1DVFB 1DJHA 2MPAL 2QSCH 3QNXB 4MD0B 4XODA 4NQCA 1FAIH 3B6SA 4JGUA 2YMOA 3SEPA 4RZKA 1H5BC 3B9VA 5DMKA 5DJYB 4H25B 1CVRA 1KFAL 5DMGD 1HN1A 1IC7H 3LVTA 4XZUA 1ORSA 3DYMA 2Y22A 5C0EA 4I0KA 3C8KB 2OSLB 2H1PH 3UTOA 1WGVA 5BRZA 5KVDE 2P7TB 3VD9A 5LUMA 3CMGA 5D5MB 1KB5H 3MRRB 1KIPB 1ADWA 2IANB 2O93L 1FP5A 2IPTH 2FEEI 3WTSA 4E9WA 3VGAC 3MRLA 4HWZA 4Z7UF 2H2SD 3FULA 4QDGA 1K4CA 3WNMA 4KJWC 2QV4A 2B15A 3D06A 1HSBA 5D6DC 5F6HI 5IEKA 4BK5C 1HESA 4HUVA 2WXOA 1JZEA 4RGOL 2AJSL 4OZHE 3MRFA 2DEWX 5AZEL 5EF1A 1GPOH 4MNQB 4QRSA 4AVIA 4G8GB 1N68A 3TZVD 1QPKA 1N3NB 1OAZH 2IGLA 2NYYC 2Y36L 3QXVA 2E9WA 2F19L 3ABGA 4P57B 3IS1X 1UWXH 4BFJA 5JPNA 5IGXL 1KXQE 1AS6A 4MYWB 3UTQB 5DF0A 2PYFB 4YHOL 4KAQH 5AVZB 3V6ZA 1ES0B 1I8IB 1IBGL 2FBJL 3PXJA 1E5UI 2NNAB 3GS7A 3O2DL 1CVSC 3KPQB 4M1DH 3S0PA 2XKUA 1H19A 1QQDB 2V2XB 4IU2B 3IFNH 3RVXD 2AEPH 3C2AH 3MNWB 5IM7B 4ZS6C 1DBJH 3D0LA 2WNGA 3O4LD 2GBVA 4FTDA 3ZR5A 2WUBL 2F7OA 5ISZB 3ZE2B 2XBDA 1HSAB 1JGVH 3ILQD 3AT9A 1NAMB 4NT6A 3ULVC 5B1AB 1NCCL 1W6LA 1OW0A 1WG3A 2J2ZB 3BKYL 4HUUB 3LQAL 1F4YL 3IAPA 1BHGA 2BWIA 3V5HB 3MJ9H 2W5PA 2UY7B 1I7UB 2XN2A 2DV6A 5KAQF 1K3IA 1SGKA 4ANKA 3M88A 2ZYHA 3FQUA 2NX5A 5LGHH 1YSOA 5JNYA 3IXAA 1M9WA 2OL3L 4K5LA 3T4AA 4DN3H 1LO2L 4FQXD 1TVDA 4K73A 2XBTA 1HH9A 2Z4QA 1NC4D 5EUKA 3SDAC 2QR0B 3L5XH 4IIQC 1CN4A 4K7PL 2FWOB 1BBJB 4LLUA 5DJDB 5JXED 1P4LB 5I0WA 5EEWA 4NO2A 4QOKA 2W94A 1BD2B 2BO0A 5FF6A 1IGFH 2FSEA 1J18A 2YLHA 3HC3H 3HTLX 4XBGA 4N8UA 4BK5A 1WZ1L 5FCUH 1XSIA 3DC0A 3E3QC 2HJKA 3PL6B 3LPWA 4R9HA 1OSZA 4NQDD 1HKLL 1D5BB 4L4TE 3GQFA 1RUKH 2IIJA 4KO6A 3KD4A 5GZNA 3MUGB 5T33L 2YXFA 1ZHKA 3N06B 1NMAH 1FYTA 1ZSDA 3VXRA 5T1JA 35C8H 3HMXH 3B2MA 5E5MB 1LK2B 1KJVA 4ELDA 4UOZA 4F27A 4XE0A 5SV4A 4JVUA 5HYSB 1ACYL 3CU1A 4APQA 3ARRA 8CGTA 1AFVL 1SLVA 2DIJA 5GGSA 5DHVH 4MXVF 2ESVB 4D9LH 4G3YL 4IOIA 1E6JH 1R3KA 4IYKA 1LO3L 5D9SA 1YEJL 1UKSA 2BHFA 3HJ0A 3OZ9L 5SX5K 5LJYH 1E3FA 4DIXA 1G5AA 2B5IC 4KKAC 1PD6A 3TX4A 5F6IC 3RDTC 2ZXWB 3WN5B 5MEOA 5F7HA 3VD7A 3UPCA 1BF5A 3VW3L 3PDGA 1D9KB 3DK0A 2WNKA 5HI5D 3IDNB 3RTQC 1FQ9C 1FVCB 5DFAA 2EO9A 2Y1AA 3U7WH 5F70A 4CVZA 3B7TA 3DRTA 3ZR6A 5IOKA 5E94A 5KTEL 4JFPA 5IMMB 4U6XB 3AY2A 3HVDA 3CK0H 5CILL 3OJ2C 1Q9OA 4NZ8A 4CN6A 5LG1A 4WTQA 5E1HB 1WRFA 2AHIA 2VLME 2DQ6A 2JXMB 4OKVA 3C6LA 4GS7B 1FRGL 5KBKA 2CBQA 2DLFL 4RRPG 3VYOA 4J23A 1NCAL 2QELA 5AKTA 5DHMC 2VH5L 3L3IA 4TTDD 1T04B 1MG2C 2FEEL 3GSVA 4HIJB 4HKZB 1XX9C 2DOCA 1FPTL 4DPCX 2EVIA 3EDJA 1TTBA 1CGUA 1BX2B 1XGPB 3CX5J 3KJ4B 4Y16B 4DP1X 5TQ2L 4PWGA 4HOWA 1AOHA 1R6VA 1CFTA 2KDGA 4CSPA 1JNNL 1O9WA 4G8AC 4PS3A 2GK0B 2YQ2A 3LMJL 1HFUA 1G43A 5EPMB 1AZNA 4PB9L 3FBKA 5DJ0A 1QOKA 3ZVVA 4Z7WA 1T03L 4AQ1A 5LN8A 2P52A 4DTGL 1X5JA 1I1YA 1GHFH 3HVNA 4I1NB 1CXLA 3HS0C 5IVXF 4CSTA 3VXUB 3LKOA 3KHOA 4FFYA 1BLNA 2ZP9A 2ICEB 1G6RA 4LESA 5I1LB 4GAGL 1YPZB 1T1ZA 4FXTA 3CNKA 5BZWA 3WLWC 1YYLL 3AXLA 2BC4B 1O6VA 5SWSA 1ZLWK 1YY8A 1BW8A 5CNHA 4AEIL 2C3VB 5IW6B 3REWB 4JAMB 4CNIB 4YWGL 1P7QB 1R3LA 1MW1A 1C5BH 2FO4A 4KGJA 3FU5A 5J56B 5DHYA 3QEHB 2XN9A 3RBSA 5K33A 1XH1A 2E74C 2LAGB 1RHFA 1N64H 2QKIA 4P2OA 5GZOA 3BGAA 3V0GA 5DRXA 3QNZA 5J9PB 3BGMB 1YEHH 3IDMA 4NB7A 3LDBC 4M48L 3HA0A 4FLOA 5IB4B 4YXLH 2AJYL 3TBWB 2WXGA 3LN4A 1KEML 1GMEA 1XMWA 1RZJL 1LK3L 5EF2A 4ILDA 1DYZA 5G5DB 4N0UB 2EXTA 2CJTA 2IBZX 3I9IA 4IOFD 4YEFA 2FRGP 3LKRA 3VI3F 5DFVD 2BVUA 4O00A 2NNXA 2PP7A 4DP6X 1QW9A 1PAZA 5IMOA 3EH3B 3CFBA 5HY9A 3ASWA 3WMSA 1IM9B 4G9FA 2ZCZA 1WFUA 1A4KB 4O2FA 4JQVC 4J5VA 1AGEB 3AMLA 1ET7A 1NUFA 4P2RB 2Q8BH 4FQCH 1TR7A 4NI3A 4M03A 1VERA 3IJSA 4GG8B 4IEFB 4HIEA 1NL0H 2J88L 4JNXA 4U1SB 3QDGB 2HTLD 4F7PA 1TO4A 3VTMA 2PWEA 3C5JA 5E8EA 4GRLC 3KR3L 1FFPA 1HE8A 2E5EA 4WGWB 5FUZH 4FXLA 3VD5A 2F53D 2XIBA 4BHUI 2XV0A 1S7RA 1ZA3B 3UJTH 2A74C 3UTZB 1NAMH 3O2DA 2YKLH 2EDFA 1OAKL 1NM4A 2Z8VC 3I2CH 3O6FA 1XV8A 4ZTPH 4O4YL 5LGJB 5FYKH 1MY7A 2NXZC 3KPSB 4M93B 4OLWH 5ACZA 3D12B 1JD7A 4ZS7L 2D03L 3BHBB 2VDNB 4KO9A 5DEFA 2G4GA 2MTAA 1HH6A 1EWHA 4Y1AD 5AUMB 4Z3HA 1WIUA 5D7IB 3F12A 3SYCA 2P5WE 3VB9A 3WD5L 2R23B 2PW2B 3EH2A 3G5VA 1AO7D 2OJEA 5AEAA 3BAWA 1RK7A 1JPEA 1MREL 2HX7A 5DSCB 1A1OA 3K6FA 5DWUH 2ZKWA 1J8SA 4GQ9L 2JKIS 4FQIH 3ZDXE 2MCAA 3BPNC 5J12C 4G83A 1OHQA 5F0MB 4IBZA 5DRZB 1N7MH 6TAAA 4FNLL 4FXGA 2C9QA 2DQUH 3QEQE 2BNUB 4XVTL 4LCWE 5DJ8A 3Q01A 3MC0A 3PIQB 2QEJA 3UTTB 1TXKA 3DHPA 1MI5D 4GG6F 4GAJH 4RFOL 4AM0Q 3GBMH 3N42F 3KBPA 3N43F 3KLAB 2CBOA 4NHCL 4AJVA 1WZAA 2EC9T 2XN0A 5JW4Q 1AYRA 4TRPH 3FQYA 2WBJB 3WFDH 4CBZA 3O4OC 2GCYB 2OXHA 3AU1B 1J5DA 4TSAL 3SE8H 5KSBE 4DNLA 1B0IA 4QCIB 5J1TC 2BIIA 5HHOA 1THCA 1KOAA 1GXEA 4FQHB 5J1SC 3I6LE 3LRMA 3VXOA 4WW2F 4G8FA 4GRLA 4PGEA 2D7PA 3NRQA 4Z0XB 3D3VD 4Z95H 1TITA 3ARBA 4TVSa 2IQAA 1TQCC 2AMUA 2VIRA 4HT1L 1VFBB 4OF3A 4GBXA 4LHUA 1Z5YD 4LF3B 2ZAHA 3LRSA 3GM0A 4XHJC 1MNUH 5KSUA 12E8L 1UT9A 4I88A 4PBVC 3T8VA 3EHBB 5KS9E 2C9XA 3ZK0A 1HIMH 1U6AH 4U7KA 2JKSA 3PREA 1QG3A 4MKTA 3NFPB 4MDJA 3QO0B 1IAIH 2A77H 2AEWA 4YSRA 3LS5H 5BPPA 1DVUA 4NQXA 1FZKB 1V7NL 2CKNA 3VXMA 3NSCA 1OD7A 1MDAA 3Q2WA 1TPXB 3GM8A 1XB6A 1NDMB 4OF5A 3WYRA 4ZPVA 3OM3B 5HDOA 3L2NA 4P2QB 5CZVL 1MCCA 1UD3A 2WLKA 4G7SB 4LT7A 3TO2B 1T4KB 4DZBA 3TM6A 1D5MB 2EIKB 2ARJB 3OLDA 4MNQE 4PPTA 2X4RB 3P02A 2ZSWA 1N4XL 5E6IC 2Z31B 2BNQB 1RV6X 2GIXA 3BP4A 2R0ZH 2YR3A 4Y19B 4B9YA 1MQKH 1NEZB 3T0EA 3K6SA 3TEYA 2A5UA 4JZOB 2HLFC 3QJSB 1R46A 4X80H 1AJ7L 4NZUH 4AL8L 1SLXA 3GPSA 4KH2A 1EGJH 3H0TA 1S7WB 4I77L 4RISL 4PJAA 1BFSA 5KN5B 5ESAB 2HKFH 1XF3B 3QJTB 3VFUB 4WLCA 4XCEB 2N7BA 2EXWC 1LHZA 1LVEA 1IILE 1MWAL 2JB5H 3BFOA 2VL5A 3HZMB 4X4ME 3Q2NA 1OP5K 2VW7A 4IS6B 4JY6A 1SJXA 4G7VL 3QYMA 3O9WD 3V55A 3ZE2E 4CMMB 3RZCA 2XVGA 1UQSA 2IWKA 3UZEA 2CR6A 1ASOA 4HJEA 5BXFB 4OZGB 4OW6A 2YZ1A 3R18A 4NNXB 1AQHA 3B1TA 4HUXA 3VGFA 1RJLA 4LSUL 5EZLA 5FYKE 1KCKA 2OMZA 3FCTB 1UH3A 4P9HH 3BUIA 3K46A 3TBVA 2VOTA 5H94B 4KUZH 3MCYA 3Q1SL 4QR7A 4PRPD 1SNRA 5CJXC 3FB7B 5HHXL 4XGZA 2X6AA 4Z76B 4JY4A 5E4EC 1T83C 4G11A 4JM4L 2BP0A 1IGCH 4EIBA 3PUCA 2R2BB 5ETUA 1M6OA 5KZCD 5GGTH 2XPYA 3G5YA 1P9MA 3TO4B 5ADOH 1XBDA 3D2TA 3DV6B 4R3SA 4WWKC 4XNDA 4FQJH 4RDBA 4TNVK 2GC4C 8FABA 3AB0C 4YOKA 1E8XA 2YD6A 1QSZA 3MRPB 1F58H 2E8ZA 1P5UA 2OA9A 3DXAA 3L9RA 1P84J 1AP2B 2WQUA 2FJHB 1GAFH 4L1HA 2VAAA 2VN6A 3OKOB 4WGKA 3U46B 1ADQL 1S3KH 1OAXH 3M86A 4HJ0C 5I1JH 3HE7C 5GJTL 4N90D 4KK8C 4Z7UA 5C3TA 2FIKA 4H1LA 4Z7QE 5FV1L 3Q6GL 5DT1H 3NFSL 3PWVB 2W65B 3IK2A 1VZIA 2R1YA 4WIQA 4YZFF 3B3BA 2AQSA 4CRPA 3RJQB 2XOTA 1ZWIA 4MAUL 1UM6H 5EU6E 3SJVD 1Q72H 1KIUA 5FC9A 1HWGB 3TVMB 4A6YH 3LH2L 4RA0C 2DW5A 1CURA 1IAKA 5DJ6B 1I8MB 3SHSA 4NZDA 2EH7L 2WTPA 4HZ1A 2VDNH 3INUH 4P8QA 1H6FA 3ARDB 2GEEA 4IRSB 4PGCB 1GL4B 4KJQC 2DJMA 4OLUL 4Y4HA 1JK8B 3WEBA 1U8LB 2DQEL 3TBTB 2VUOA 3QXDB 5CLXA 4NRYA 1PZDA 2LE9A 4PUBL 3ZZ1A 1ZVNA 3P3YA 1FLRL 4M9PA 3P11L 1XGUA 5A2IH 1KDIA 1NCTA 3AS2A 3K81A 5FB8A 4FEIA 4OAWB 43C9B 2R51A 1NC2A 1A4CA 4M43H 3ARFD 2ZUXA 4KRMB 1YUKB 1NFAA 1TOXA 2BS8A 1MIMH 4XCCL 3FUJA 5JUEH 4M7JH 4JLRA 1JZ4A 2HMIC 5HDRA 3P69A 4TN9A 5F96L 5LDSA 4LVNC 2LTQC 2X12A 2LLGA 3N55A 4XPAL 4FI8A 1WP6A 3QUGA 3G5XA 1S7SA 4PRDB 4GW1A 1GGIH 1W72H 1ZD6A 2C9PA 1I9IH 5JHMA 2UVEA 4RWYL 1Q9KA 3P0VL 4M7KL 5D1ZI 5L7XL 1HEZB 4JL2A 1VRSA 1IGML 2GQHA 5AVVB 1TU2B 3F7VB 1U3HA 2PKDA 4Q56A 5C07B 3S37L 3V0HA 4GP5B 4DP0X 1EXHA 2HB0A 4NC2B 3TF4A 4NZTH 1YMMB 3ECUA 4JKPH 4UT9H 2IV8A 5EOQH 1UOWA 3X3GH 2VWEC 2XWEA 3HB3D 4YPJA 4ETYA 2HX8A 1LTXA 1KPUB 4U6TA 3VQ2C 1QLFA 2PCFA 3DGCR 4K8RH 3QEUB 2Q3ZA 3DARA 3AAZA 3WDIA 1KNOB 5DD6B 4PREA 3U6RA 2WVSA 1CIDA 1MFBL 3I6KB 5ERWB 4QXUH 1TJMA 4M8QA 1JXJA 1NCUA 3EH4B 3WSQH 5DVOA 2MH4A 2BDNH 4IRJA 1KTJA 1AGCA 3C09C 2AJXL 5LG6A 1FC1A 4D94A 3DOSB 1AIFA 2WQ8A 2AK1L 3WJJC 5HHVH 3LB6C 1JHTB 3PWPA 4Y9CA 2EDLA 4CL7A 5FYJL 2KLSA 1EUUA 4OD3L 1T7ZA 4GAYA 2Z91A 1IEBA 3L4ZA 2P26A 1RZ7L 1KEGL 1LO0H 3BH8A 2WCPA 4JVPA 3U9PH 3VDAA 1CO1A 3IKCB 4DGUA 1ZT7B 3QDGE 2MEJB 3IGFA 4LP8A 3JWNH 5D7JD 3W5NA 4FLHA 1RZPA 1KTBA 1BA9A 1GYCA 3BZEB 1RY7B 3B9KB 4TTGA 4J2QA 4TULL 1NIAA 3TEUA 2Y07L 2JKXA 1BM3H 4L29B 1I1AA 3HC0B 4G6MH 1OB1B 1OQOA 3WFBH 3MGOB 3KPSE 1JN6B 2IC2A 2PF6A 3PWUB 5E8NA 3HBZA 5AOMA 1X9UA 2YUVA 2ZX5A 2F6AA 3FFDA 5DO8A 3GRBA 2O26U 1V3MA 2P5EB 2Y6SD 3MV8B 4DCQB 3X14A 5IVXA 5HHME 5E24E 4UCFA 1UADC 3RTLA 1DEEB 4NNYA 4LARH 3VWJC 2BWDA 3QCVL 2Y3AA 2I69A 1F90H 5GS0D 1NBYB 4XB7A 2DD8H 2ADIA 1CGXA 2G2RA 3GB7B 4LSQL 3X17A 1CZ8L 3II2A 1KT2B 4BHUA 4OLXH 4PS8A 2L3BA 1Z9LA 3I75A 4KUCF 4WUUD 1LD9A 2VN5A 3ZT5A 1DUZB 4Q9QL 1JGLH 1ROWA 4ZFFB 2BM3A 1SYVB 4FFVD 1G94A 2HCZX 5IEHA 2EXYC 2ZCKL 1NGQL 1AR1D 4MS8D 2YPKA 2XVLA 3BUTA 4PGDB 3L17A 4XNYH 1N6QH 2VLJB 5CZKA 2H26B 4PVLA 3W0WE 1GZHC 3UYRH 3DGGA 3WEAA 3PWNA 4NO5B 2KYIA 3QIUC 4IBWA 1FH2A 1GRWA 4QHLA 1U92A 4JHAL 4KJYA 4MAZA 4OQTH 4OT1L 5ANHA 4JFZL 3VXSD 4FKKA 5FYKU 3VI3A 5CEZE 1LEGA 1GOFA 2DYRB 3P30H 3L9BA 4ANWA 3D5OF 5I75B 1X4YA 4X9FA 3FQWA 4TLUA 1V5JA 2EVJA 4J3OG 2IXQA 2VTFA 2JIXB 2K78A 2GJZA 1AQKL 2GTWB 1KV7A 3T3PB 1ET5A 3D1MC 5A2AA 3SKNA 5KJRH 1TZGL 3WUWA 3R0MA 4MJID 2Y06H 2P46B 1T6WA 3US1A 3MKKA 3ZYZA 5C3IA 3KBHE 3MO1A 3QJZA 4K3EL 4KKBC 3FU9A 1HI6B 4OSUH 5TE4H 5CEYB 1IAOB 3PNWA 3U1QA 3CH1A 4WV1C 2EDTA 3FO0L 3CN1A 2CKBB 2ALWA 3HPJA 5IF0B 2WP3O 3KWWA 2EIBA 3GD1C 1AXIB 4NKOB 3B2DC 5I6MA 3RZWA 3FKUS 3PFUA 3OB8A 4LLWB 3IRCA 4XPTH 4DOHB 1KY7A 4JFEA 1YQVH 3ABKB 4OCNC 1OQXA 1XL4A 5T1LA 2BNQE 4KI5E 1USZA 1UM4H 4PBWD 4PYGA 4ZAKA 1TF4A 3SCMC 1HHGA 1L9MA 1P7KA 1A8ZA 1UC6A 2J4WH 3QIWD 4FTVA 4GW4B 1R33A 5FA3B 1A6UH 1KB3A 2V7HA 5D2LF 2JE8A 2BIQA 2C1PB 5JIQA 4LLYB 5BUGA 5FGBA 2FYYA 3CHSA 5JW5B 5I8KH 4F2MB 1MVFA 1V05A 2X4PA 3CVHB 2HVKB 1UZ8A 2HRPL 3JWNE 4BZ1L 2OW7A 2VDOB 3BQUA 1YNLH 3DX7A 4FG6C 2PP8A 5AW8B 1L5GA 4GG6A 1GIGH 3MLYL 3D85B 2FNBA 5ENWA 4X6EB 4OZGE 4Z23A 1G1OA 2YS4A 2WLJA 4TF4A 1M4KA 4ANVA 4X0KB 4AW4A 4EIZC 3IMBA 3NVQA 3QVAA 3ZYJA 5CLYA 1X5AA 3GMPB 3K4AA 1S2EA 3NN8A 3ZO0A 4I2XE 5BMFL 2XSKA 4WW2A 5FYLH 4AKQA 3WLBA 3ZHNA 3CDGB 1S4IA 3HRPA 2EP6A 3T6QC 2AFNA 1UTDA 2XPZA 1CFNA 1E6OH 1PZSA 5IHZB 5MI0B 4I9XA 3GXFA 2FEDD 3KE0A 5IMKB 3IBEA 2Q0ZX 1QEWA 3QNFA 4MBRA 4M6NH 3WIAA 2CO6B 5DFTA 3GJFB 3IE9A 4UM9B 2EEDA 1Y1UA 2IBGA 2C3WA 3WHE1 1A1NA 1FFOB 3CC5A 1KGUA 2QSQA 1DFBH 4LSPL 1UWEL 1XEUA 2VMEA 1SJMA 4OJCA 4N9GB 2ODIA 5ESVB 3AM8C 3B7UX 3PNRB 1YDPA 3H53A 4KGLA 1TSHA 4MXWL 1LWRA 5KSAA 4JRXD 3VQMA 4RETB 5HYFA 5KVEH 1S9XB 2DJUA 3MJ7A 4E42B 5IZ7A 1VEOA 5IBLC 4HFUL 2VR3A 1IO4C 4IMLA 1I9EA 4MD5B 3FUKA 2CLVB 3AW5A 3NJIA 5IT2H 2ZKMX 2X0VA 5BVJB 4QRPD 5C0RL 2ATPB 2VE6A 1F56A 3S35L 4XNXH 1OP9A 1B0GB 3KPLB 4CDHA 2R4RL 5CCGE 5F7FA 5KYXA 2VW4A 2WXRA 3R06A 3NPZB 3HRZC 2VN4A 3MBEC 4UV7L 3WDHA 1SDAB 5GGVH 3S34H 4Q4IA 3QQ3A 5ID1B 4NUGH 4Z3EA 5E8DL 3QC6X 4ODXA 4H0GA 3LJ3A 3ZDYF 4LSTL 2FAUA 1MHPL 1QSEB 2LU7A 1CQKA 4U6YA 3EZ8A 3HG1A 2Z7UA 1OKEA 1VEMA 5TF1H 2X3AA 3C60B 2R29H 3FU7B 2HUHA 4POZD 5KEZA 1EFXA 1DSFH 2COQA 1BWWA 3KGTA 4MMZB 2NY3C 1BQSA 1J1OL 2X4NA 4ZBJA 4MQTB 4GQQA 4KROB 3QDMA 1DVFD 3P9LB 3QZPA 1I7RB 1P6WA 1XT5A 3DJRA 5IK3B 4A7VA 5AB0A 4O58H 3QXAA 1UATA 3FSVA 4DKTA 1SDYA 1B2YA 4Y8DC 4BH8A 4A04A 1U8PA 2DPKA 5DZJA 4L3ED 1KJ2H 2VO5A 4C4KO 1X7SA 3GSNH 2GJJA 4GJTB 1ZA6A 1TSRA 4ZXBC 3X1BA 1XF2A 4DK6A 2Z7YA 1KBPA 2DKMA 3HUJE 3QC5X 5FM4A 2VQ4A 3FB6B 5EBLA 4OCRH 4XX1E 5BZXA 2D73A 2IAND 5TJWK 1PD1A 2NY1C 1MCNA 3LYRA 4OQ1A 4E68A 3FAWA 1KYUA 3WMQA 4L5FH 2VM4A 5AB9A 5FR3A 4DGVL 2K4WA 5JHDE 4LHUG 5C07E 3TBSA 4KX9A 1U8QB 1CLOH 3MFFB 2B9BA 2N7SA 3C2SA 4N2MA 4HAFA 1YMME 4G8GD 4LBAA 3QUYA 3SPGA 4YHYC 3UYOD 1C7SA 4NDMA 2IFFH 3DK2A 4K7FA 1WFNA 5AVYB 1MLBA 4BFFA 5J4MA 4N6RB 3MA7A 2L7UA 3V7AE 4MA7H 1AZBA 3UC2A 1NM9A 1UD5A 4UNTA 2BVPB 4YDVA 1GCYA 2DWDA 3EUDA 3UAEA 5FYLE 3FRPA 2XXMB 1WWWX 5HJ3A 1XR8A 4GRMA 3CFEA 1UZ6F 1T5WB 5EEUA 2ZNXA 4ZFOB 1S7UA 5E2TH 5CIPB 2X2YA 3E2HC 3L5IA 5E23A 3CSYA 2FT7A 2ADJB 1MN4A 5L6YL 4M7LT 3MCLL 3VFSB 5HJGA 5J06A 1J1XH 3KYKL 4EI0A 3M6DA 2ZUQC 4LDOB 4ODVH 2QVIA 1VENA 3H3PL 3LKNB 2OMVA 4U2YA 2OLDA 3GS0A 3FHAA 2VZVA 3EO9H 2QHLA 3O6MH 5J0BA 4M3HA 4PB0L 2I9TB 1Z0MA 1LE5B 1N67A 1C5DB 4Y4KD 4P5KA 3A4DA 4RMSA 1E40A 1DANU 4GFXA 1MRCL 4QKXB 2PPEA 1MRFL 2C9VA 3I9GH 2DM4A 4C56E 1QO3A 4RGNE 3CVHH 1XCTA 5FA4A 1HILA 2IJ0C 2F54E 4ZOEA 4YN3A 2RJMA 3RUGF 1BD2D 1MUJB 4ELKB 3QQDB 4DFIA 3S97C 4EVNA 2PXYC 1M7UA 4HK3J 1S5HB 3RWGA 3V9FA 1QX1A 2F7QA 4KXZH 3LIZL 4PJBA 2J1WA 1HHHB 2VDPL 5AVSB 4EBQL 4WFHD 2CCVA 3GKWH 4ZRGA 5LBGA 5HGBA 3MJ8A 4BZ1A 3K8MA 2VDQL 5DQDL 3EYUL 4WFFE 3BE1L 2CDFB 2GY5A 4XP9H 2IAMC 2XFGB 3DHUA 4KJWD 5J13C 2CBPA 5IBTH 4HF5H 1G7LA 3WTTA 1ZHNB 1QTPA 1QSFA 5E95B 4HK0A 2I26N 4I7ZC 3U0TB 4MA8H 1QRNB 4OZ4B 1SEQL 3MGTB 4MNGA 2OTUB 2ESVD 3K0YA 5T3XL 3N5AA 1PDKA 2H0FA 2WCSA 5BJTB 2YUZA 3NCJH 4XPHL 1UD8A 1DDHB 2N1KA 4N4YB 4QYAA 2VDML 3X12B 1AGDB 3ZN6A 4NUJB 1J5OH 5BO1L 2HN7B 4EKXA 5DJAB 4OVUA 2JCWA 4NYLB 7PAZA 4KHXH 1D9KD 2VISB 1U8JA 2FT6A 2OTWA 2W0PA 2XPGB 3NOIA 3K5RA 2DQHL 32C2B 3LXAA 4R8WH 2JKJA 2J1ZA 3LNEA 4AE1A 4H1LG 1EHXA 5AZUA 3KPRE 1V7ML 5E2JA 5GRZA 1TO5A 1DE4B 2R9HD 2XY2A 2ZCHL 4P5TC 2VLLB 5E9AA 3VFOA 3ZTCC 2F7IA 2HWZL 4K9JA 3CDZB 4OFYD 4YSTA 3ULVD 4HPYL 3EOTL 3OBAA 1ACZA 4JDEA 3E6HB 4L5FE 2XTJE 4GMSL 4PM1A 4U2ZA 1W0WA 4LLDA 2DF3A 3D33A 3K2IA 1UFGA 1ZCRA 4FQPA 3NYKA 4I48A 3MU3A 2VQ1A 2B59B 4XNAA 4X6BA 3OX8B 1TYJA 4Y16D 1XXFC 1G9NL 2BVQA 1SY6H 4X7SH 3NJMA 1Q0YH 3WAJA 4CU8A 2H6OA 1NGXA 2R15A 2PO6B 4L05A 4NENA 1CQYA 1YJDH 2MHAA 3CXFA 4EDWH 3FCBA 3PUUA 4OD2B 3T77A 1P5VB 1IQWL 1OOAA 4XAWH 1HXYB 3VXUD 3DVFA 3RVWC 3LZQA 4OZIE 4JHUA 1NANI 3LHPH 4Z7OE 2AZAA 1ODUA 1AQDA 1GY2A 2MKLC 4GUQA 4LASH 1J9SA 4NBYB 1C5CL 4UQ2B 4EEEA 1DQML 1ZT4B 2NMSA 1YEIH 3FUNA 4K23H 4PJGF 4A66A 1RUPH 5DO2C 4HULB 4X4KA 4HC1L 2YD3A 3HNTL 4HEME 1HC1A 1DLFH 1P7QD 3UL4A 4MCMA 1M53A 2IBZY 4QHMA 5DJXA 4MMXC 2P80A 3AT8A 4YGVB 2R1WA 2VZTA 3TP4A 4R2GC 4ZDHA 1COBA 4JFQB 1IVTA 3CN4A 1BJ1J 4JRYB 4UV4H 3OKEA 4F2ME 1E28A 4FZEL 1SPDA 5LNEA 3NESA 4ZYKA 2IOOA 1J9TA 3WGVB 5C0CD 5A43C 4NHUA 1SOQA 3HZKB 3D30A 3I3EA 2WLMA 4XBMA 4A2FA 2EIMB 7TAAA 5IVOA 4AEHH 4Y7MA 2P8PA 3RTQD 3NIFB 4AW7A 1WC7B 3CQFA 3MGAA 3F5WA 3L6FB 3B5TA 4I18A 4QAWA 5EZIH 4MSWB 1NLDH 5DQ9A 2V3DA 5AQ0A 2G75B 5GPRA 1XIWB 2WOBA 2Y9RT 1D5ZB 5IJBC 4ODTH 4L1SA 1M71B 3L7FB 1LE9A 1U8KB 3SGKA 4HCGA 4P0DA 4HKXA 4P2RD 4YBLC 2BNRE 3WS3B 1PAMA 3FT2A 4UYPA 5EN2A 2ZUSA 2OQJB 5I17B 3QYCA 4MAYB 3KGRA 2YRLA 4QIRA 3QR0A 1AANA 1FZOA 1OM9A 4JZJA 5DUML 2NUPB 5CIPH 5F7AA 2BS71 2ZOOA 3EO1B 4MQ7B 2AERT 3PP3K 1A3LH 5GRJL 4YVNA 1DCEA 2DQCL 3GMNB 2E0PA 1U93A 2ITCB 5AVQB 4LXFA 1UA3A 1DQQA 4N8VA 4Z77B 5K59E 1JXGA 5DC4B 2X7LB 2NTSP 3LSOA 4UTBH 5E4AA 1KPVA 2VLKD 4IK6A 4NQVB 5DRNA 3TYGH 3QPXL 4ZFZA 4XN5A 3HE6C 4FZ8H 5J57B 1YMHB 2YC1A 4TNVF 4RAHA 3W57A 5I1CH 4LSDA 1J8RA 3VXQA 4ZTOL 3IFOB 3G5ZB 3LD8B 2F74A 2A6DB 2NZ9C 3LXCA 5DQJB 4AQOA 4FKHA 2VZSA 4K5MA 2A38A 1YEGL 4FQQA 1WCQA 4ENEC 2VMJA 4U0RB 4NQCB 5A16A 5I18H 5IMLA 3B6SB 3BP5A 2BSDA 3JV0A 2YSSA 3QT2A 4G6KL 1GTNA 5F9WB 3UTTD 5LXVA 5DMKB 4JKNA 1ZHLA 1XGTA 5D2LA 15C8H 1E7VA 1A47A 1HZLA 1QSEE 4C59B 4HUKB 2DQGH 3NA9H 4MQSB 4YDIH 1G9ML 4XZUB 1ORSB 5I8OH 2AJUL 5C0EB 7CGTA 1QFUH 3SDDA 1ZGLP 5BRZB 4CMHB 4IGBA 4TQPA 3MREA 3LIZA 1UD4A 4P4KA 1RUQL 2APVA 3QUZA 4XO9A 5E08H 2ZAGA 4D3CH 2CGZA 3LNIA 3HKFA 1T0OA 3POHA 3MRLB 4H20H 4HWZB 4G80A 5KVDL 1JHKL 5JYMA 1K4CB 3IN2A 3WJMA 4ZSOE 1TMQA 2VR7A 1MF2H 3P1VA 1HSBB 4JQIA 3ZBMA 3SYOA 4C83A 5IEKB 4HUVB 1TJXA 1G5GA 5D55A 3MRFB 4DEUA 2QHRH 4P48A 1ZV2A 4QRSB 3EHBD 1ECYA 4RFNC 3BN9C 3DI3B 1PLAA 2VDLB 1F1DA 4KKPA 2XX0A 3TASA 1HINH 2C4FU 2M8XA 5JPNB 4FQ2H 3BIAX 2KZBA 4P59H 4MRBA 4UINL 4ALAC 5T3ZD 3P40A 3BJ91 4QGTA 3V6ZB 1B2WH 2OMUA 3VE0A 4X9BA 1E5CA 2WVVA 5F2FA 2WGXA 4OCSL 3ZXAC 1PW3A 5SWZD 4IOSD 2IPKA 3MV7A 3D4GA 3T08A 3CXDH 2UXFA 1U8OA 3D0LB 3P54A 4P2QD 3IKKA 2W95A 1R19A 4DW2H 2XWBA 2I7OA 3G5WA 3V0FA 3OVUB 5GS2H 1ZV9A 3LPGA 4YXHL 1SJHA 3S8GB 1DBAL 2J8HA 2NR6C 2Z31D 4NT6B 3GMOA 1MCPL 4Y19D 3WHXA 1CLCA 1I75A 3EO0A 2WN2A 1AKJA 2N1TE 3WUWG 4EQ2A 3U48A 2ZJSH 5FLVA 3GUTA 3FOMA 3BAEH 2W0KA 2NX5B 3DJSA 3FQUB 5JNYB 1ZPLA 4N85A 3IXAB 3QJRB 4OUUA 1U42A 3ZE0B 4DZ8A 4M02A 3T4AB 3VNYA 1TUPA 2ZXQA 3LZFH 2Z4QB 1HH9B 3HOGA 1YEEH 1J86A 5EUKB 1A14L 2D4FA 5K1JA 5D2NC 4LLUB 3QO1A 2NY5L 4LSRL 4NO2B 3ZDXF 3DDGA 4QOKB 5FF6B 4JB9L 2FSEB 3MLXH 1E4XH 1E43A 2GIMA 4XBGB 3COOA 4M6OH 3DVNA 4UQ3A 1OSZB 3AMKA 4W4OC 5HVHB 4KZEH 3CN0A 3IXTA 4ONHA 4IKJA 4BK8A 1ZHKB 3AXIA 4AT6A 2AS5M 4EZKA 3VXRB 1FYTB 1ZSDB 3FFCE 1DZBA 1I3UA 1QUPA 2WAHA 1JPTH 1KJVB 3WU1A 2VITA 1PSKH 2A4CA 3ZJAA 4I3RL 2A9DA 4NQEE 3HLKA 2E59A 4XHJD 4WU7A 1FNLA 3LV3A 4HH9A 4HGKC 3TO4D 3TN0C 4AGMA 4APQB 4UTAH 4W4NA 3SSGA 3O0RL 1M7DA 1KCVH 5CWSA 3MLRH 5GGSB 1ZLUH 1UCTA 4IOIB 3CFDA 4O5LH 4TQ8A 1R3KB 4YGAB 3IN0A 5FDWA 4LDCA 5D9SB 2CM6A 2BS9A 1FHNA 2VXUL 4G6FB 4FI7A 4WK0B 2HUEA 4APXB 5MEOB 2N0KA 5LAPA 2QSCL 2IDCA 4JFFA 3D39A 5KS9F 1E2WA 1M42A 3MLTA 1EQWA 3VWKC 3ZDZB 4WHTA 5D96B 3CFJA 5I0ZA 5ICZA 3E1ZA 5J1AA 4PVNA 3QDJA 1XR9A 4HCRH 4CVZB 4EO5A 3DRTB 1I8KA 1IC7L 5E94B 4JFPB 4PRNB 5L0QC 2CHWA 2EABA 3PQYA 2FWUA 2H1PL 5D2NA 3UABA 2CGYA 4UF7C 2BRRH 1KB5L 4OKVB 4PY7A 4MHHG 3C6LB 5EA0H 3TVMD 2I85A 1DJYA 2CIKA 2IPTL 4GEIA 3X13A 3L3IB 4OFVA 2YWYA 3GSVB 4NN5C 4QRFA 1SQMA 4Y9EA 3LN5A 4M5YH 5L2JA 4CJ0A 2WZPD 3CN3A 2V4LA 4LGRB 3WNOA 2J6EH 3MRBA 5DZVA 5EU7C 2E7MA 2F61A 1EUTA 4K2UH 1CFTB 4IRSD 4NPJA 3T6XA 1GKEA 3EGSA 4XNQA 1GPOL 5DJ0B 1EBPA 3O3DA 3NMEA 5J89A 1BG9A 2JLLA 2Q2EB 4AIZA 4OLZH 2XFXB 1OAZL 1P7BA 4QAMB 4AQ1B 1I1YB 2GBUA 4J8QA 5DEJA 2BZ7A 1AQ8A 1RUAH 4LDEB 4KAQL 2E7CA 4HIXH 1UB5A 1BLNB 2V5RA 4M1DL 2WP3T 5D7KD 1G6RB 2FUQA 3QUMA 5CXPA 5FHBH 1ZEAH 3P3TA 1EIBA 2LT9A 3THMH 3IFNL 2AEPL 4K94C 2ZX6A 1SN5A 3C2AL 4J3UA 5BZWB 5I6KA 1CT8A 3MXWH 1DBJL 3AXLB 3P3RA 4PJ7F 3X1EA 5SWSB 4FMKA 3ZL2A 1YY8B 1A6AA 1KF9B 2EIDA 3VUAA 4JBSA 5BOPA 1G7JA 1R3LB 5K9QG 2FO4B 3BSZH 1CC3A 5I2IA 2XN9B 3CJJA 4LOFA 3RUGA 5DZAA 3EH1A 2QKIB 4P2OB 4ZX6A 3GHPA 1YECH 3ARTA 3MJ9L 5DRXB 3CSFA 1RP9A 2WNWA 3QNZB 5D7EA 5EUOE 4F37K 3I9PA 3U2SA 1KJ3H 3IDMB 5D70H 2EDJA 5LGHL 5AYUH 4V2BA 1P1ZA 1SEBA 3TIDA 3LN4B 1F4AA 1OP3H 4M6MH 2DMKA 2E3VA 2IH8A 2IPUG 2X9WA 3BLPX 1L9PA 4QTHA 4LGSB 3EFDH 2MFNA 3N2JA 5F88A 5CBAA 3L5XL 5IWLC 5DA4A 1QEXA 3SZKC 3LKRB 2YMTA 3D2UD 3TV3H 4A7QA 3GMQA 3ZRFC 2ISDA 5HY9B 1IGFL 3CFBB 5IMOB 2XG5A 4A2MA 3IS0X 4G9FB 5FCUL 2XV6B 4O2FB 1MHCA 4IBTA 1NEUA 2C7UA 1RUKL 2DWEA 3IWUA 3FCSA 4JRYE 3TCTA 1BQLH 4Z7QF 3IJSB 2ENYA 4HIEB 4N2AA 2VXTH 1SOSA 4ODSH 4F7PB 1MCEA 1NMAL 3C5JB 5E8EB 4NCC2 2G0KA 3MDJA 3HMXL 3L1OH 4Q6IA 1B4TA 1FFPB 2F08A 1BOYA 4KDTA 2CDEA 4WW1A 4JHBA 2WYZA 3F85A 3NIFE 2YARA 2NLJA 4IJTA 1S7RB 5JIKA 3UFIA 3VFMA 4A37A 2ZICA 1MCSA 3O6FB 4NBZB 4AV0A 1S78C 1KXQA 1PYWA 4WO4C 3PGDA 3OHXC 2UUDH 4XZ4A 4D9LL 3TJEH 5EOCJ 5ACZB 1E6JL 4H4NA 4WEBH 2JCCE 5DEFB 3TA3A 1HH6B 3QORC 4ZW5A 2BHUA 2P44B 2YUXA 3FRPG 3F12B 4A2DA 2JJSC 5CSZA 2QBWA 1OM3H 3G5VB 2OJEB 4RX4A 3DMMA 1QI4A 3M45A 1A1OB 4H5SB 5KOVC 3MV9E 3L4WA 1V27A 4N2KA 1ZLVH 3OAUH 4QYOA 1GS8A 3B9KD 1D5IH 3U7WL 4PFEA 1NFIA 2CJSA 3RPBA 4FXGB 5DJ8B 5E8PA 4Y5XA 4M3JA 4A1RA 3MBWA 1DJWA 2X6MA 4WGVB 3CK0L 4Y9FA 2FQDA 2K45A 3NEEA 1MAMH 3QCTH 3CFQA 4Q7DA 2EO7A 1RFDH 4H8WC 3HC2A 4N2DA 4XOBA 1JNHA 4ZW3A 2Z8RA 2P5ED 1F3DH 3MV8D 2HKHH 1F2XK 3S5ZA 4XXDA 3P2BA 2CQVA 2OXHB 2EDRA 3OKNA 3NCFB 4N2EA 5HHOB 3H54A 1FGVH 2ZG2A 1IKNA 5EC1A 1QPPA 1FVEA 3VXOB 5I1IH 1DLHB 4G8FB 5D1XA 2X05A 1B3JA 4PGEB 4PJGA 5B21A 4YK4C 2HYMA 3BJLA 4NQCE 4JFDD 2OZNA 2E4TA 3ARBB 1CL7H 1RK1A 2IQAB 2VIRB 4L4TA 4GBXB 4LHUB 5TPWH 3LRSB 1GHFL 5KSUB 2XWZA 4C4KT 4TQHA 3K74B 3FQ4A 4WTZA 4S11A 4R97C 3TT3L 5KOMC 1NLBH 2Q86A 4J3WA 4H8VA 1GGBH 1IAII 4WNQA 3UTPE 5BRZE 1WEJH 4MDJB 2VLJD 3BKJH 2KZWA 1XGZA 1RIVH 5EN3A 3QH3A 2H1LM 4XMLL 1JXFA 1YN6A 4NQXB 3L54A 1WWBX 3VXMB 3G6JE 2YD2A 2K3HA 3QQXA 1QFPA 3W39A 1C5BL 4JFXA 3U6XA 4ZPVB 3CZKA 4IBYA 2BVYA 3LRGA 1E2VA 1N64L 2ICWI 3WXWL 4LPCA 4B9KC 4DZBB 1N59A 3UZVA 1YEHL 3T2PA 2YN3A 3U1PA 3HS8A 1P2CB 1CF8L 2JIXD 4YE0A 5DD3H 3QZWA 4YXLL 2ZSWB 4W70A 4Y2DA 2KBGA 4FL4B 1GTFA 3KLSA 3BP4B 2HG5A 2DS4A 1A7NH 3T0EB 1U8IA 3TYFA 1E4HA 3K6SB 2ZKHH 1KB5A 4LDLB 5F3HA 5AVWB 5TQ0H 2AKRA 1BAGA 1C16A 4JFHD 3H0TB 3OV6A 1I9RH 4PJAB 1MPAH 1N19A 2JLPA 1EDQA 1JF6A 3E7JA 3R19A 4JFOA 5F7MC 2QLYA 3D0VA 3LKSA 4WU5A 4FFYH 4CW1A 3WO4C 2VL5B 2XQBL 2AW2A 4JPQA 1G6RH 2Q8BL 4HBQA 4JY6B 4FQCL 4QXTB 2JKWA 3RZCB 1UQSB 1WA1X 4RDQF 3WKYA 3VWJD 4S1SH 3SE3C 1MCWM 4ZUWA 1A0QL 4HUXB 1RJLB 5EZLB 3RY5A 5FUZL 2JB6A 2OMZB 5F21B 5DR5H 4X7FC 5F3BA 3B37A 5HYQA 5I0DA 3UADA 3UJTL 4F8NA 1UEMA 1NAML 4KDWA 4NM8H 2GJRA 4P07A 1CGVA 3JT2A 2YKLL 4LLAA 3I2CL 1E4WH 3FN3A 4PJXF 4XGZB 4ZTPL 4JY4B 3FHEA 5FYKL 1HQ4A 5ECJE 2VLRE 2BP0B 4JANA 3ZHKA 1RPUA 5ETUB 1M6OB 4GT7A 3B34A 3G5YB 5ADPH 3WXVH 4R3SB 1QATA 1W0VA 2EXYD 8FABB 2WV3A 5HYJD 1V10A 3EYSH 1ITCA 1G87A 5DWUL 4ZT1A 4FQIL 3MJ9A 3IDUA 4HGWA 3ZT7A 4FMFA 2W59A 4EIGB 1F4XH 3UERA 1P5UB 1F2QA 1DQLH 2AQPA 3DXAB 3GF8A 3L9RB 2PABA 3MOBH 1N7ML 3QQ9D 1AXSA 4IMKA 2DQUL 2VAAB 4GP4B 3VXRE 4A63A 3CHOA 5C0AE 3ZE1E 2EYRA 2OFQA 4MWFA 3H2WA 4O51A 4Z7UB 2FIKB 4H1LB 4MRCA 2UX6A 2LU3A 4Y5YA 4GAJL 1OTSC 5E4IA 4X5XA 3GBML 1K5NA 1KSRA 2DYPA 2R1YB 3TH4T 5L8LB 4S0HA 1TZAA 1EJFA 2Q3XA 4TRPL 1OV8A 3DX1A 3RG1C 3WFDL 5F7UA 2ATAA 2G2NA 4I87A 1ZWIB 2DM3A 4TUKH 5C0BD 2UVFA 3SE8L 1KIUB 3OSVA 1WF5A 1FNFA 2NSXA 2E27H 5BW7C 1F8TH 1QA9A 3IPFA 1A7BA 3D52A 1IAKB 3UZQA 4N87A 4S10A 4QRQA 4YXKH 2BFVH 2WLZA 3ESMA 4KKBD 4L4JA 3WNPA 1AHWA 2C3HA 2ED9A 3DSFH 4JPKH 4Z95L 2EZ0C 5IOPA 3HMXA 3V95A 5IQNA 3U30B 2JKTM 1MNUL 1V55B 4Y4HB 4K0OA 2PW1A 4WAFA 1YC8A 2KQMA 3MOAH 1KCSL 4NRYB 1MKFA 1HIML 1U6AL 2W07A 4HSAC 3DSNA 5DHVA 3VD0A 3UEZA 1XGUB 3SCMD 1IAIL 1NTDA 5IQOA 3B1UA 2A77L 2N59A 3LS5L 1FDLH 5FB8B 4QRRB 2I9LA 4UOW0 1NC2B 3QYNA 3E3QE 1XL6A 4N24A 1JWSA 2OSYA 3HHMA 3VSVA 1MFMA 2AQ1A 3ARGC 3D4YA 3MV01 1RULH 1DQJA 1XTMA 4KI5F 3SDCC 3C60D 2N4IA 3C5ZC 2P5WA 5EZOH 4LEBA 4JLRB 4AL8C 3RI5K 1D6VH 3TJHC 2EDKA 1BYPA 4H44C 4JM2A 4F7KA 3UBHA 4ZW8A 4Z7WE 5JQ6H 3KLHC 1J1PH 2R0ZL 3G5XB 1S7SB 3A6CH 1MQKL 4GW1B 5G4NA 4KROD 4F7CA 3H42H 4ODBD 3B9AA 1Q9KB 4YL9A 4OI7A 4OFDA 1PY4A 1JPGA 3A6OA 2VDRH 3QEQA 4LCWA 3RRQA 4GO6B 4QHKJ 4X80L 2H9GA 4NZUL 1MWOA 1L6PA 3DTXA 1EGJL 1U3HB 4LCIH 5HI3C 2HKFL 2WQVA 1OPOA 4FLQA 1R3IH 4ZNCD 3AXHA 1A7QH 2JB5L 3BLBA 3RWIA 2WHVA 3UBXA 4AQEA 2R56L 5AAMA 2KZKA 1QLFB 4KV5F 1T89C 4TVPD 3OAYK 1EERB 2XN9E 3QIBC 4LB8A 1UXSA 3AAZB 4BWUA 2ENSA 4Q14A 4P05A 5CMAA 4NQTA 3OB0K 3U6RB 3C8DA 3LZRA 1NCNA 1UA6H 1ZK9A 4P9HL 4ZMYA 4M8QB 5BOZG 5FAAA 3BSGA 3GRWH 3Q6FA 1Z6JT 6CGTA 1EZVX 4IRJB 1KGWA 1A4AA 1AGCB 1AIFB 2X1XR 5EO9A 1A1MA 3T6VA 3WKMH 4WF7A 4P23C 1IGCL 5C08D 5KS9A 3PWPB 2W9DL 1FORH 5GGTL 2AQ2A 3N04A 5T1DH 5ADOL 3IDIA 2CJUH 1CFVL 2H6PA 3ALPA 4FQJL 4E9YA 4GAYB 2Z91B 4X7TA 1SVZA 3QG6A 2X1PA 5ABZA 1IEBB 4I8DA 2BY3A 4XMKH 3O11A 3HIZA 4N5EC 5I16A 1HKFA 3BH8B 3AG1B 4GSXA 1F58L 3MRKA 3EADA 3IJ8A 3VFRB 5IB5A 1GAFL 5F9AC 2VRQA 3OXSA 1S3KL 4FRWA 2K0RA 1D3CA 5I1JL 4U1IA 1XB8A 1XF4A 4Y5VC 4ZUUA 4U1MA 5DT1L 1CDUA 4W9FC 4WFED 5D4JA 4EUPA 2G0LA 1I1AB 3AT0A 1ORQA 2NY3D 1EX0A 1TQUA 1OSEA 1CICC 5J6HB 4HXAH 5E8NB 3UTSE 5IJVA 1UM6L 1MWAB 4KY1H 1Q72L 1KBVA 5EBMA 1KGCD 3FFDB 3A6BH 1IBDA 4A6YL 1URIA 1Z9PA 3NZSA 4HIQA 1QACA 1RPQA 3QNYA 1CI5A 3I50H 1F41A 3X14B 5IVXB 3ULUD 4PW3A 3Q5YA 4NNYB 2DY2A 4X4MA 1Y1DA 3W82A 2VDNL 4L9LC 1BMWA 3VXTA 5DD0H 1IGYA 2ADIB 4RMTA 1AQMA 3UMTA 2PLTA 4QXGH 1A5FH 3PE9A 3D9AH 3IDYB 3Q3GA 3I75B 1WWAX 4B27A 4YS4A 4UQEA 3O81A 1CF1A 5E70A 4HJTA 1LD9B 1TIUA 5I26A 3TA4D 1ZLSH 1AMXA 4GRWH 5D1QC 2IQ9H 1IZJA 1SFDA 2A6IA 1MFAH 1R3HA 5IEHB 2YPKB 3HUJF 3Q2VA 4XX5A 4H1LH 2NW3B 3WCYA 4AENA 3CZJA 1PQZA 2YD7A 1A7OH 3ROLA 1MIML 3H9YA 1QRND 1J0HA 5HHOE 5JUEL 4M7JL 2QLVB 3DGGB 2OCFD 1JI2A 3PWNB 1JCVA 2XA3A 2UUDK 3ZIYA 4QHLB 5DYOA 4KJYB 5CO1A 3CC1A 5IFJA 4MZ2A 2VJXA 3VI3B 3GHEH 1LEGB 3ZMRA 1GGIL 1W72L 3QJFA 1ZLDA 1I9IL 3FQWB 4F9PC 1FIGH 2IXQB 4PI0A 3RGVA 3D18A 1FNSH 4KY2A 2GJZB 4NPKA 5CEZL 3VNZA 3OMZA 1QMUA 5DGQA 1ZLVK 4KPHH 1ESOA 2QKSA 2K6WA 1CGWA 4GMTL 5T1KD 3SKNB 4OV5A 4Z0BH 3SDXE 5AB1A 3WUWB 4U1LA 3QPQD 4NZTL 3TIEA 4K15A 4YBHA 2WQWA 2X4SA 3H85A 4JKPL 2ITDA 4UT9L 3FTWA 5EOQL 3WY3A 4DO6A 4DGYH 4HD9A 3MO1B 3X3GL 4F33A 5K93A 2HPOA 5IW1A 1OGPA 3ZKXC 1RQ5A 2MWCA 3CH1B 3PNWB 4FG0A 5EU6A 1T21A 4JPIA 4BSWA 5EEZA 4K8RL 1QHOA 5FM5M 2XWXA 3HPJB 2Y5TA 4PJ9A 2AEIT 1YNKL 3AREC 3KWWB 1AGBA 4YX2L 1Q8MA 1LMKA 4WJKB 3AABA 3HNSH 2HT4C 4QXUL 1PZ5B 2KUTA 4JFEB 3WSQL 2EDDA 5T1LB 2BDNL 3UG3A 4ZAKB 3CPLA 3HNVH 4L8SC 1HHGB 4JX0A 3T9WA 4AKOA 4P46C 4FTVB 2AXJA 4N0FA 3H9SD 2VSMB 3UXFA 2X1QA 5HHVL 2V7HB 2E8YA 2D2OA 2PXYD 4L9DA 4G82A 1OD9A 2FYYB 4ZW6A 5E8OA 4XBPB 3O8XA 2X4PB 3M1CA 2ZSVA 4P04A 5H37H 5C2UB 4KQ0A 2IG2H 3BZ5A 2W92A 1WQVT 1Q1JL 3BQUB 3DX7B 3FMGL 1GCFA 3F04A 1LO0L 5CD3A 2ICWA 2PWHA 3GEFA 1L5GB 1T7XA 2YFOA 3U9PL 4GG6B 1G1KA 3N42B 1FH5H 1AMYA 1OK8A 2K8MA 1IE5A 5ENWB 4ENZA 2CO7A 4B0MB 3FZUC 1A3RH 2D7OA 2XLLA 3VD1A 4AV5A 2YPLA 5D7LE 1JGUH 1O7DC 4AWJC 3IFLH 3NN8B 3ERXA 4G6ML 2BERA 2AI0L 2RB8A 4WW2B 4ZW7A 1HCFX 3WLBB 3WFBL 4GUPA 1CFNB 5GGRB 5B4MC 1NBVH 1UT1A 3H3BC 5FDYA 4X6CE 2E7BA 1IT9H 5HVGB 1QEWB 4KZDH 3WFEH 3K6IA 5C97A 1A9EA 1ZV5A 2WM0A 1Z66A 4LARL 3N6YA 1A1NB 3CFCH 4W68A 3OWRA 3CC5B 3KL3A 1F90L 2OR9H 2FR4A 1I85C 4NO3A 3OLEA 4P5TD 1R1CA 2DD8L 3SE9H 1ZS8A 5HI4D 1YDPB 3T6WA 3ILDA 4OLXL 3NPSB 1E27A 1XB3A 4GRWE 3BFWA 2FNWA 4NC1E 4PRHA 5KSAB 1OLLA 4XN9A 5LO7A 3MJ7B 1EFQA 2OMTA 4IMLB 3VXNA 4YSEA 5DMGC 1XSOA 2ZYSA 1SXCA 1ZGLA 3L5WA 3P0YH 1JGLL 3QAZC 4MAYD 3HMWH 4YHLH 3HFMH 3PWLA 5GGTA 2Z9TA 3BKCH 2DBJA 2VE6B 5HYEA 4OI8A 5KYXB 3CVDA 4XNYL 1N6QL 4M7ZC 5EMYA 4MNHA 3RURA 4KO7A 1MCBA 3L4VA 4J3BA 4X0NA 1MHHA 5D1ZC 2ITFA 3U4EA 3QQ3B 4JMNA 4ODXB 4TXVB 4JFVA 5LNGA 1FL6A 4M29A 4U6YB 4UZGA 5C09B 3HG1B 3OQ3B 3P30L 4FXKA 4IRZA 4AYBA 1EFXB 3AQYA 3TZVC 3N85H 5C2BH 1ANUA 4AQAA 1FFNA 4AC4A 2X4NB 4OM0H 4ZTEA 1M7XA 5A2KH 5KJRL 1FJ1A 3AWEA 3QDMB 1AHMA 1G9EA 2XWCA 5CEXA 1I8LC 3VAEA 2Y06L 4A6YA 3QXAB 4KNSA 4XPBL 4OZIF 4KVNH 4Q2ZA 4Z7OF 5TE4L 4BH8B 1U8PB 5E9DA 4L3FA 4X5RA 3SQBA 5JZ7D 4LQ1A 1CB4A 5L4JA 1FHGA 1ZA6B 3RYMA 3D0AA 1L4IA 3ALXA 1XF2B 4PJXA 3VG0H 2WWOA 3ILQC 4ZI8A 3QFJE 5IQ7H 5EBLB 4XPTL 4F2EA 3BDYH 1YQVL 2HFGH 4EN2A 4WCYH 3MLVH 4KXDA 1HNFA 1UM4L 4N5UA 3BRGC 5CN3A 4FQLH 1RZFH 2DIBA 5A6IA 3GLDA 2J4WL 3VMNA 1SOXA 1CPUA 4XVJH 4NO0D 5JHBA 2FJSA 4H13C 2ZWYA 1A6UL 4FQXC 3JSSA 3EJSA 3DIFA 2NNFA 4CKQA 3H9ZA 3L3OC 1UJTA 2QGEA 3TBSB 2NZ1A 3L4UA 2ZOTA 3JVFC 3NIGF 5DK3A 5I8KL 3CZGA 3EJPA 3UEQA 3S36X 5KYYA 2Q7YA 3M46A 2PN5A 3QUYB 3ARZA 4WTZG 1YNLL 4NDMB 2V3EA 3I84A 3OXRA 4X50A 4Q9BA 3MA7B 5IY5B 3PPEA 1GIGL 3NH7H 3OLGA 4L23A 2VJ0A 3W0WA 4DKAA 3C8HA 1F00I 4YDVB 1MCHA 2VR9A 5GHWH 1W72A 3FRPB 4ANUA 1KTLA 4MLIA 5H8DA 2Z7WA 2AAVA 1XR8B 1AVAA 2JI1A 3CFEB 3L1FA 4GRMB 1UJ3C 4YHNA 3UC0H 3DO4A 1S7UB 3OMAB 3NG5A 1CGSH 4PJHF 4X6DF 3CSYB 5FYLL