1JXFA

Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Backbone dynamics of plastocyanin in both oxidation states. Solution structure of the reduced form and comparison with the oxidized state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Proton transport
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2001-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jxfA00
1J9QA 3FSZA 3X1GA 4UF7C 2EINB 3JTBA 5D4JA 3PXLA 1BAWA 1PCSA 1V54B 4QLWA 2R7EA 3FPYA 3ABKB 1MZYA 1OCOB 1W6LA 5AKRA 2RACA 1BEXA 1CYXA 2FTAA 3FQ2A 4A67A 2IWKA 3H4HA 1XMEB 2BW4A 3WIAA 1GYCA 4KO9A 1IC0A 3UADA 1PLBA 1RZPA 4L0PB 2IDFA 2XWZA 4YSUA 2CCWA 3UAEA 2GSMB 3C75A 4A2EA 4M4RB 1OOWA 1EHKB 1WA0X 4DPAX 1AZCA 1AZNA 1SDDA 3T71A 4X4KA 2OV0A 3KW8A 2GC4C 4BK5C 1AOZA 1F56A 3ASOB 4HHWA 2IDQA 4A2DA 2PPCA 2PCFA 1E67A 3FSAA 5I6NA 2UX6A 1NWOA 3NSCA 3CVDA 2QDWA 1TEFA 1J9TA 3WKPA 4A2HA 1AS7A 4E9RA 1QHQA 3T6VA 3OMNB 1YLBB 5TK2A 1OCCB 5AZUA 1J9SA 1PNDA 2Y69B 8PAZA 1WS7A 1N68A 4WTQA 1ZIAA 2HXAA 4CSZA 2CAKA 2VW6A 2B08A 1GS8A 2J57A 4A68A 2N0MA 2AFNA 2DYSB 4DP7X 1SF5A 3WNJA 4F2EA 2PPEA 4M3HA 5I5JA 1QNIA 4BWTA 4FAAB 4E9XA 4E9SA 3NJNA 2EILB 3MX0B 1FFTB 3FS9A 4KOBA 4Q8BA 1OE3A 1KYAA 1L9TA 1MG3C 3ZBMA 1SHWA 1JVLA 4BDVB 3DKHA 3UAAA 3T6ZA 2H5UA 1XB8A 2HRGA 3EH4B 3X1NA 2DWSA 3KW7A 1AR1B 1J5CA 3OMAB 4G72B 4BWWA 4KNTA 2I7SA 1AAJA 1RZQA 1W8EA 4E9TA 1JXFA 2BP0A 4YSSA 1QLEB 4HALA 3NJMA 3X1BA 3AG4B 2GI0A 4HZ1A 4YVUA 3OQRA 2IDUA 1XB3A 1PF3A 4G70B 3EF4A 3CG8A 4W1TA 1MG2C 2B3IA 4UAHA 4BDVA 2FJSA 2ZWNA 2WO3B 2FT8A 5B1JA 3FPXA 5F7AA 2CALA 2BO0A 3AG3B 5I5IA 2XUWA 5F7BA 1E30A 4YSAA 3OM3B 2GHZA 2ZXWB 3NYKA 1BXAA 1A4BA 2UXVA 2YAPA 3WG7B 2HX7A 4G7SB 1DZ0A 1SJMA 5A7EA 1MZZA 1PY0A 4DPBX 4AZUA 9PCYA 4YVNA 1KV7A 4F2FA 2YAOA 3RYMA 1PMYA 4EF3A 1E65A 3ABLB 5PCYA 4ENZA 2Y1AA 3L45A 2VW7A 2DY2A 3IEAA 1BXUA 4GY4A 4TXVB 4YSPA 4DPCX 3S8GB 1WAEA 3EH5B 1ILUA 4YSDA 5TK4A 2OJ1A 2OCCB 2E86A 3CDZB 3QJVB 3IE9A 1E5YA 2XXFA 3S3CB 1GS6X 4YSQA 1IBYA 2YAFA 2MTAA 2XLLA 3PAZA 1UATA 3NJKA 4DP1X 3BQVA 1HAWA 1NIDA 5B1KA 2CBPA 2IH9A 2FWLB 2TSBA 1J5DA 1NPNA 1BQ5A 3GXUB 5I28A 4HAKA 4GXFA 2XXGA 1SHXA 3X2QB 1AIZA 1IUZA 1V55B 4CSPA 1GSKA 1ASOA 1GS7A 2EIKB 1JVOA 2PCYA 2QPDB 3CDZA 1KCBA 4F7KA 4P5RA 1NICA 2P80A 3V9EA 1PNCA 2PP9A 3QJUB 2VSMB 1ZIBA 1RKRA 2HX9A 2W88A 4UANA 3BVDB 2YAQA 3X1FA 3PCYA 2DYRB 3ABGA 4A66A 5B3SB 1ET5A 2I7OA 6PCYA 1JXGA 2XV0A 1ASQA 3ASNB 4AKPA 1JZGA 1T5KA 1L9OA 1V10A 4YSCA 1SFHA 4DP8X 4N4YB 4DP5X 4KO6A 3IN2A 4NERA 3CVBA 2AZAA 1ZDQA 2XV2A 2PPAA 3JT2A 4W9ZA 5I6LA 4E9QA 3FQ1A 2FT7A 4QKTA 2J55A 2FQDA 3WKQA 3FYEB 4DP2X 5B7FA 2HLEB 2XX0A 1WA1X 3FU7B 4GP5B 1PZCA 3N2JA 5B1AB 7PAZA 4AKOA 2BWDA 2VM3A 1PLCA 2I85A 2FNWA 5I6PA 3TU6A 4RH4A 4MFHA 3GYRA 2YXWA 2PP7A 1A3ZA 1KBWA 3SBPA 2XV3A 3NJLA 2GBAA 3QPKA 5I6OA 2BZCA 2XX1A 3AG2B 1PAZA 3FSVA 2X87A 5I6MA 4HIPA 1E5ZA 2VN3A 2QPEB 1TU2A 5FC9A 5I26A 3ZX1A 2PP8A 1GY1A 1EZLA 2IDSA 3TBBA 3OD3A 4DP4X 1W6WA 2WSDA 4GP8B 2FQGA 3FU7A 3QJQB 1OV8A 5IY5B 1AZRA 2MRYA 3QJTB 3SBQA 3H4FA 1WA2X 3OMIB 3NJJA 3H56A 1CC3A 1ZDSA 3PAUA 2LLNA 2HRHA 3SQRA 2YQBA 1VLXA 2QDVA 1I53A 1WS8A 3IBOA 1ETJA 3TA4D 5I5MA 3DTUB 1IKOP 1KGYE 2BWIA 2EIMB 2R7EB 3PLYA 2UXTA 1ID2A 4ZK8A 2XVBA 1AACA 4JHUA 3UGEA 1AANA 1FWXA 1B3IA 1CUOA 1BYOA 2H47C 3ABMB 4N8UA 1JZIA 4BXVA 1BQRA 1OCZB 1X9RA 2AANA 2EIJB 4HCFA 3WNIA 3PPSA 4A2FA 4G7QB 2BHFA 3G5WA 5D4HA 1ILSA 2BZ7A 3QJRB 3FYIB 1SDDB 1JOIA 5D4IA 2J5WA 4NB7A 4YSOA 2JXMA 1A4CA 4AKQA 4KO5A 1KDJA 3T6XA 1X9UA 2VW4A 1J9RA 1AZBA 2CJ3A 1BQKA 1HAUA 3ZIYA 1L9SA 4WKXA 4PAZA 3NJIA 1AG6A 2BP8B 2UX7A 1PZBA 6PAZA 5AFAA 3S3DB 4YL4A 3EHBB 1XB6A 4DP9X 3UACA 1BYPA 1L9RA 2YXVA 4HHGA 1M9WA 1AQ8A 3HB3B 2X88A 4AX3A 2YAEA 4E9YA 2PPDA 3EH3B 3FU9A 4KNSA 2Q9OA 3NJGA 3V9CA 7PCYA 2Q5BA 1SNRA 5I6KA 2P80D 1JERA 1SF3A 2FT6A 1NIEA 4G7RB 3NJFA 3AG1B 1KCWA 4A2GA 5EHFA 2J56A 2WO2B 1NDTA 2FQFA 2FQEA 3FT0A 2VSKB 4PCYA 4FA7B 1NTDA 4AI7A 3X1EA 1NZRA 4JKNA 3IN0A 2GC7C 3NT0A 2BP8A 1L9QA 4K9JA 1NIAA 5PAZA 4JHVA 1ZPUA 5B7MA 1OE1A 1JZHA 3CVCA 5E9NA 1R1CA 5ANHA 3S8FB 3PAVA 3NP3A 1KDIA 3DIVA 1CYWA 3NJHA 3S3BB 1JZFA 3FSWA 2YAMA 3GDCA 2JKWA 3AW5A 1ET8A 1HFUA 1AG0A 1M56B 1TKWA 2CUAA 1GW0A 2XU9A 1PZAA 1AS6A 3AZUA 3NSFA 2ZONA 2H3XC 2BP0B 2YARA 3QJSB 2IWEA 1TEGA 3ZDWA 1GY2A 2DWTA 2PLTA 3WI9A 4HCGA 1NIBA 3T6WA 1OCRB 1FA4A 3NSYA 2IH8A 2AVFA 1JZJA 1GR7A 4DP0X 3TASA 1ZV2A 1AZUA 1NWPA 2VMJA 1A4AA 2YAHA 1A65A 3HEIB 1N70A 4BWUA 1CURA 4G71B 3ERXA 2TSAA 3CZUB 1AS8A 2GIMA 3FU8A 2IDTA 1M57B 1NPJA 5B1JC 1JXDA 1A8ZA 2BW5A 3NP4A 1NINA 1PLAA 1URIA 2AZUA 3T9WA 4DP6X 1SFDA 2IWFA 2VM4A 2W8CA 4YSEA 3MBWB 3TBCA 3UABA 1MDAA 2ZOOA 1KBVA 1IBZA 4E9WA 2IAAC 1OF0A 5B1BB 5B7EA 3U25A 1L9PA 4KO7A 4Q89A 2XYBA 1RCYA 3AY2A 4NAJA 2A3TA 2PPFA 4P5SA 2DV6A 3FQYA 2HZHA 4GP4B 4GYBA 4BXSV 3N55A 2HX8A 2UXFA 3D12B 1ASPA 1BXVA 1DYZA 1NIFA 1OE2A 1JZEA 4KOCA 2UXGA 1ADWA 4YSRA 5LDUA 2QT6A 3SBRA 4E9VA 3QQXA 2JFCA 4HCIA 1ET7A 4KNUA 3NSDA 4YSTA 2GB2A 2NRDA
chains in the Genus database with same CATH superfamily
1WCBA 5HVWA 1LO2H 3BZEB 2ALAA 4NP4H 3DGGB 2PWHA 3CFCH 4FQHB 4S1QH 5EZIL 2JVUA 1MWOA 1INQB 4X5XB 4LU5H 2KZBA 4I4WB 2RACA 4G6MH 2NY4B 1YEHH 3BSHA 3S37L 4LLUA 3N40F 4BE6A 1KFAH 4M1CD 4LL4A 3GLEA 4YSUA 3MRCB 2J8UF 1DLHA 4JHWH 3X3FL 4GIPD 4TSCH 3DRTB 3UTTA 4TSAH 2J21A 2BIOA 5L6YH 1QG3A 1WITA 3O6KH 5DS8B 5H94A 4G42A 3WO4C 2J8HA 3RDTB 3WIHL 1CXIA 1A6VL 1GOHA 1HL4A 2BDNL 2IH3A 1T21B 3HVNA 4NQED 4ZXBB 4ENED 1A1OA 4JFQB 1J9TA 4YDVB 4A2HA 2WBXA 1FPTL 5GISL 4BGLA 5JR1H 3EG9B 1E6OH 1WO2A 2AABL 2W81C 2P52A 1KCUL 5F1NA 5DQ9B 4QHLA 4XAWH 3O6FD 1G1KA 4XO3A 4D9QD 3O2DH 3SO3B 2VLKB 2HH0L 3DURB 2WLJA 5HJ3A 8PAZA 5GRVL 1WS7A 3I3BA 4BM7A 5D1XB 1CS6A 3BMWA 2CKBB 3S5LG 1Z6JT 4M6OL 3B3IA 1JNNL 3C5JB 5I0DA 5IJKA 1PLGL 3EJRA 3V8OA 2WJ5A 5CD3A 3O3UN 1EHNA 4CBPA 4Z3HA 4M9OA 1E8YA 3N1QC 1BM3L 4MD4A 2Q86B 2HVBA 4XPTH 4B9JA 3QXVA 3HCVA 5K9OA 3EXJA 5AW5B 3U9UA 4Z5RB 4OJEH 2ZCHH 3EJZC 2AQSA 3KPRD 3GPEA 1KTJA 4U49A 4IRSC 5A16B 3LKRB 5T1MA 1EVTC 1CDUA 1A22B 2MEJB 5JW4R 2DQTH 2WAQA 4ZAKA 1QRNE 5E1AB 5LWYH 4NZRL 2FB4H 5CAYB 3QUZC 4Z7QF 5C86A 3P0VH 4PRHE 1GYWA 4D8PA 2DLEA 1A64A 1W8EA 1JP5A 1S9XB 4X80H 1MI5D 2ZKHL 4PIRF 5AB2A 2HWZH 3ARDB 4H13C 5I1GH 2XACC 2X3CA 2GI0A 4LIQL 2ITEA 4C59B 1U8PA 3RVXD 1FFNA 1XF1A 2LOEA 2FR4B 2R9HD 3BKMH 3VTAA 1EMTH 2FT8A 5DUBA 2K3TA 5EUOA 4YBLB 5C07E 2OI9B 1A4KB 3UMTA 1ZSDA 3TVMD 3K0WA 3PGDA 4U6HB 3NCFB 3PFUA 1BAFL 1YC8A 3D25B 4YSAA 2BH0A 3O9WD 3GMOA 1BXAA 4MMYB 4N1EA 2UXVA 1XF5B 4O02B 2JXMB 1RIVL 3KR3H 4N0UB 4OLEA 5TQ0H 5ESQB 1XSOA 2DQMA 3DXAA 4Q0XL 5DUMH 1HCZA 3AXLA 3QUYC 4NOBA 1QFHA 1LXMA 1WQVT 1XGTA 4AYBA 1IBBA 4OR1A 4MJ5B 4YVNA 3UYRL 4RGOH 2Q1EA 1C16B 5E00B 3GKZA 4EF3A 1DR9A 2HTKC 2Y7QA 4XCYA 4FQPA 3QEQE 3OJDA 5KUKA 4TXVB 5D7SL 2BVPB 5J6GB 4YSDA 3MUUA 4PRAB 5DGQA 1CLZL 3QJVB 4XCEA 4M3KB 1RURL 3I02A 5ABAA 4JB9H 4U6XA 2AQ3A 3MJ9L 1GKEA 1YEJL 3LKOA 2BNUA 2J8UB 4RDQG 4GI8A 1F4AA 5DJ8A 1VACB 2XWTA 3CHRA 1QBMH 3MV01 4MLIA 4TVPE 5D9SB 1ZJBA 2ZPKL 3BUQA 3L9RA 3GXIA 3BAKA 4FZEL 3UYPB 5T33L 2FK9A 1AGCB 2KDGA 1LO3H 1VFBA 3KBEA 1DQML 3LPPA 4GXFA 2JCCE 1HHJB 2R83A 3WYRA 3D4YA 3ESVF 5EEZA 1D9KB 1JVOA 2VRQA 4A6YB 3G6JA 3CDZA 5BZDA 4F37F 2GTZA 1T6BX 4G6KH 4P99A 1KLFA 4FQQB 5E5UB 1DVTA 4FADA 1KXHA 2VB5A 3OXRA 3P9WB 4W9EC 4ERSL 5C09A 3HNVH 2DWDB 1D2OA 1IJNA 5K9QG 3GRGA 3T0WA 5J1SC 4JREB 2VDLB 3VMNA 4ADIA 4GO9A 2ZUWA 3VVWA 4S2SB 2NY1D 2EIEA 4GAGH 4AKPA 3MRLB 3O3EA 3DX2A 3WGVB 1U3HC 3CFEA 5SWSD 2DYPD 4WUUA 1U6AL 1KGXA 2YEQA 1DZBA 3B7SA 3KWVA 2C1PA 4DP5X 4JG1L 2BNRE 3CVBA 1KBPA 1CFSB 2PPAA 1IGIH 1HH6B 1ZT4A 2VMDA 3JT2A 2OZ4A 2WBJA 4Q58C 2J55A 4DP2X 4X9YA 1SY6A 3Q2NA 2PCPB 4GSRA 5EU6D 5T5FA 4ZS6C 4AWJC 4PW3A 2PTTB 1E5BA 1IC5H 1UJ3C 3DTXB 4OFKA 5B39G 1P4LA 3T65B 1C9SA 3L5XL 1J87A 4PJIF 5MEPB 4LBAA 1MI5B 2JJUA 5IESL 2JIXA 1MY5A 3DX9A 1KBWA 1JK8A 4O51A 2GBAA 2XN9A 1AYOA 5I6OA 1BZ9B 3VI3E 2ZJSL 5I66B 3C2SA 1PAZA 4R5TA 5F8RC 3RWCB 1KELL 1N0XH 5HGDB 1SJEA 3VXNA 5I26A 5TE4L 3KCWA 2H8PA 1E9QA 1GAFL 1H0DB 3F85A 3MLVH 3EGXA 3NIFE 3TVMB 4I0CC 5KVEL 4JPKH 1J1PH 4CU7A 3QJQB 3VXUE 1I3GH 1OV8A 3CBKB 1KB5A 3SBQA 2XFXA 4Y2DB 2KZ1B 4O2CB 1CFQA 1SVZA 3N1GC 4KMTL 1CG9A 5JQIB 3V4PL 5HYJA 4H8WC 1S78D 4MQXD 4OZ4B 5F7WC 3RVWC 1MJ7L 2H7WA 1KEMH 1HEHC 1H6EA 4FG0A 4PGZA 5ERWB 3W39B 2DEWX 1MHHB 2EICA 3KPPA 4NQDA 2WQ8A 1PZ3A 4RMRA 4N8UA 3GJFH 3QUGA 3FO0H 2A74A 2V7HA 4LSPH 3ZHLA 3LKSA 1A6TA 1RZGB 3MKKA 3ZXAC 3T3ME 1FGNH 2C3GA 2IADB 1SOKA 3FH7A 2XHNA 4UTAA 4M7ZB 1I7TB 4WI3A 3FYIB 1G9NC 4DN4L 3HAEG 5CSGA 4MZ3A 5JHLL 4GUOA 4L2YA 3LN9A 4N5UA 3VFWA 4G9DB 4HJUA 4OLXL 4XE0A 2GUYA 1MHEB 2NT0A 1RV6X 1EK3A 3M7OA 1XR9B 4L4TB 3WKML 2P47B 3MLWH 4PJ8C 4OV5B 5D7LB 3B5HA 5D7EA 5CJBA 4HWEL 3BUIA 1E4XH 1USZA 1ZE3C 4HPHA 3VJ6A 4FOMA 4Y4HA 3SGDI 4KPHL 4BBWA 1ZHKB 5IMOB 7PCYA 5HI4D 4M5YH 1FNGA 2UVFA 3L9EA 4ZODA 3WE1A 1SNRA 1RSFA 3DRQA 1O6TA 4F2ME 3NSXA 4WJG3 4LAQL 4PJCF 1TKWB 1Q9OB 5KS9A 4E36A 1JS4A 4I77L 4KV5F 4YIQB 1DVQA 5I71C 2EDRA 4PCYA 5EU7C 4UQIM 2NY1B 3AGWA 3RL2A 1ZVNA 1NZRA 3LS5L 4YPJA 4N2MA 5SWSB 2DYPB 2A4ZA 4FXGB 4XO8A 4AQ1B 4K9JA 3BWZA 4F27A 3A67L 3INUL 2VYRE 1NEZG 5C09E 2EE3A 1ZPUA 2BHUA 3INOA 3N91A 1R3LB 4FQLH 5D1QE 3MJ7A 3N5AA 1KDIA 3CCHB 3H2PA 5HHVH 5CBAA 1I8MB 3BHBB 4FKHA 4XI5C 4YFLF 4FQIH 2OR8A 2VDQH 5EPMB 5EU6B 2OX5B 3P9LB 3DJRA 5BV7C 1LDPL 3S36X 4X0NA 5FA3A 2ZXQA 4G80A 3LN4B 4F58H 4KKNA 5AW4B 3S97C 1NGZB 1F58L 3W0WE 2EXYC 4G43A 4P46B 4PJIB 2C1OA 2CXGA 2OMUB 2H3XC 1MUJB 3MZTA 3ZL4H 5LNEA 4QNPE 1TPXB 3ML9A 3WFBL 3O41B 2F5BL 3RWFB 1KY6A 2F8IA 4HUNB 4KI5E 3U7YH 3W5NA 3ZUNC 1CR9H 1RZJL 4M7JH 4N2EA 4XPAH 4L8SA 4RMBA 4LLDA 5B38B 3FFCB 3AU1A 2VR5A 2ISDA 2IIJA 3IXTA 1X5FA 1AJ7L 4U1MA 2JKIS 2RQEA 5FK9A 3NK4A 4OB5H 3TASA 4APQC 4Q4IA 2AHIA 1CIUA 2GK0B 3KLAB 1A4AA 2DQCH 4WY7L 1NBQA 5FUZH 5KYWB 2R51A 3CZUB 5IFJB 1AS8A 2YRZA 4L3CB 3F7PC 3QWQB 3BFOA 5AVYB 1B4RA 4YDKH 3CSTA 1W0VB 3L2NA 4G6FD 1B3JA 1EHAA 3D4ZA 4PLOB 1JTTA 2WINA 3D4GA 1QI3A 2VDRH 3QFJD 3O4LA 4BSWB 3KPNA 4AUJA 4JRFA 2VH5L 3IVKB 1ICTA 1LO4H 2IWFA 3G5YA 3ZE2F 4MTMA 3KYNB 3Q05A 3U4EB 5DD1H 2YZ8A 2CDEA 4KRPD 4YSEA 4AQOA 4H25B 1C08A 2PO6B 4AM0B 4QRQA 1IBZA 4MMZC 2IAAC 1OCWH 3HA0A 3MRKA 4RRPA 4MAYB 2AF2A 2IVFC 3BKJH 4PJDE 4S1SH 4DGIH 5CJ5A 3EDFA 2CDGA 4AJWA 4Q89A 5C0BD 1DO6A 1I8LC 1P7KA 4OFYD 4QRPD 4Y4KA 1NCAL 3RFZB 1ZSHA 1PU0A 5AWNH 1KXTB 2JLLA 1L7TL 5IF0A 1NGXB 5EBMB 1WFTA 1SXZA 1IM3A 4QAWA 4Y9GA 3BDYH 1DJXA 3N55A 5IROD 5IM7A 2J88H 5K39A 2ERJB 3DECA 4P23A 4KJPD 2EDKA 4GG8B 4KTDH 2X70A 1YNKL 2OL3H 3CLEL 4MNGA 3O45A 4R0LC 1TTRA 4W6WB 4JNXA 4K3HA 3ZTDC 5J12C 1ZV5A 2OMYB 2CBMA 2DJUA 5JXEA 3Q48A 4I0PC 5DJ0A 3US0A 3H2WA 5EC1A 1EA9C 4QLWA 2R7EA 3F5WB 3CFJB 3B2UC 1INDL 4U31A 4CKVX 2WIIA 5L8JB 4HLJA 4H0IA 4AQEA 1T2QH 3MCKB 3WN5B 2FGWH 1BEYL 1I4FA 1I85C 1IC0A 1V7ML 3FQXA 4WI4A 5CINL 1PEZA 4UB0L 5CBEA 2QQLL 5FFGA 3WN6A 2Q7AA 1Y6KR 4R4NC 4RAVA 2WQRA 3K5SA 4DPAX 1F8TL 5IMKB 3JV4B 3V95A 4CVXA 3K72B 5AVQB 4B50A 2NX5A 2FIKB 1L4IA 4UTCA 1N5YL 2ZOUA 5GJSL 4HHWA 5T5NF 2CE6A 3O6LL 1T03L 4KHTL 1VEPA 3MRRB 1WBZA 2VDKL 3VWJC 2UUDH 1XCQA 1TEFA 3KHQA 4NQCE 1F1DA 2X1PA 1YLBB 1BOGA 5EOCH 1EJFA 1Q0XH 3L1EA 2OSXA 4RBPH 4BQ9A 4F5CE 2OMTA 3OXSA 4F8OA 3OF6D 3FJTA 5MEND 4AENA 5DRZA 4BZ2H 1A47A 1MJ8L 3ESOA 4N26A 2B16A 2VW6A 3BUYB 2GTWB 4F7EB 2GT9A 4ZFZB 4PJXA 3BP4B 1F13A 1I7ZB 4FQXD 4P2YA 4A68A 4AW4A 2DYSB 4D9RD 3D09A 4FERA 4JANB 2H32A 5E5MA 1B9KA 2QELA 3VFSB 1P1ZA 5F0JB 1SUJA 4OLZL 5F8QC 5EU7E 3KYAA 2P8PA 2R1XA 4ZUSB 4F7TA 3NJNA 2DDQH 2X40A 1KGCE 4QT5A 1CIDA 1QRND 5L8LB 4MB3A 4QTIL 5ETUA 5H8DA 3TZVD 1QNZH 5F9OL 3QG7L 3L3IB 1AO7B 4MSWB 1BLNA 5K9JL 2FSEB 2ZNWA 1AIFB 2NY0D 5FF6A 1C8PA 4PRHD 1FJ1B 4HSQA 4NM4L 4P2AA 2UYLA 4G6FB 2KLTA 3SDCB 3T6ZA 1BFOA 3GI8L 5IB5A 2CO1A 3QFJB 4OCSL 5B22A 5KZCB 3MGOA 1F4WH 4XNMB 4XH2B 3IAPA 3KLDA 3L08A 4K73A 3LQAC 3WSQL 5T1KD 3EOAB 1NBYA 3GEWB 3MRDA 1M2VA 1SDYA 4LVNC 4KRPB 1NM4A 1H3VA 4HJIA 3RPIB 4BCZA 3BUPA 3L3DB 2HJFB 4HIHB 4XVTH 1ORQB 5IMMB 5DD0L 5ACZA 4R3SA 3ZE2B 4MS6A 1QUNA 4RMWA 2QSQA 4HUXA 1DQKA 4AC2A 1C1EL 1CVRA 2RFXB 5HHMB 1QLEL 4Z3TA 1JPTH 1T1WB 5BS0B 1UFGA 5EEXA 1PG7L 4IOIA 4HEME 1ZKAA 4TUJB 2K6YA 1CF8H 2GJJA 2CR6A 1UM4H 4IRZA 5JYLA 5AVSB 5KVFH 3S34L 2J5LC 3QDJA 5DRXB 3BH4A 1UACL 3HUJE 4R8WH 5H37A 1OM3H 3UJJL 3V4PB 4X8CA 3PIQA 3J27A 4NIYE 2J25A 5ICZA 4N22A 3CVHA 2LU4A 4XCNA 3SQBA 4HJGB 3P2TA 1O6VA 1J88A 4WQOA 3QEQD 3V4LA 1YEIH 3KPMA 4KJWD 5ABDE 2GBTA 5GS3A 4DPBX 5F6IB 2X4PA 3FN0L 1FZJB 4M6AA 2Y1AA 3L45A 4MNGE 3GJEB 3F00A 2OTUB 1JPFA 1BXUA 2Y25A 4KKBD 5ANMB 1RUKH 4MA1C 4AJYV 3AAZB 2A6DA 4IBLT 3GI9L 4FQCH 3ALPA 25C8H 2PMZA 3HKFA 4KUCD 5CEXB 1JZ3A 4MCZA 5DFVD 1OF2B 5GSRB 3L3GB 5FLUA 2K78A 5IGXL 4A7SA 2IQ9H 3BDBA 3BUDA 2PUQT 4QWWC 3UTTD 2JE8A 5DRWB 4JGNA 1O7DC 1Y6MR 4L0YA 3AREB 3VNYA 5T3XE 3QQ9C 4ALAC 3SYPA 5D2LB 4DP1X 5ADPL 1RMFH 3BQVA 3QC5X 5B1KA 5C0JA 2X6AA 5ESVA 5IBTL 5KAQF 1E3FA 1BVNP 3P3TA 1BQ5A 1IB5A 4HAKA 3HHSA 3OAUH 4FABL 2XYCA 1F5WA 1E5CA 1SN2A 4S11A 1VF5C 1J0YA 2J1YA 3EHBD 1QEWA 1GMEA 2CLVA 2MQCA 3NCYS 2PCYA 5I76A 4JKWA 5MENB 4UV7H 3ARWA 1XF3A 4M8QA 3PFQA 1EJOL 5C2BL 3N41F 2YSSA 2VDPH 1NICA 2OZ4L 2Z35A 4LNRB 3QCUH 1HHKB 2G4EA 1U8IB 2DQFB 3ARUA 1SY6L 2A7BA 2VSMB 3JTSA 3N9GH 1S9VA 4ZW8A 1RKRA 5T5FL 2R15A 4LDOB 2NYKA 2ADJA 3FF8A 3WENA 1DP0A 1UA6L 2W94A 3QRBA 1OAYH 5JIHA 1ET5A 2IGFL 4EOWL 5MI0C 3QFDB 3Q6GL 3RPKA 4GAJH 1D7DA 2XV0A 3ASNB 2PXYC 5LKNA 1UYWH 1MFAH 5DHEA 3BW9B 4RIRA 1L9OA 1BHGA 1QACA 3H53A 2KUTA 4NENA 1DN0B 3DSFL 3TZVB 3GSQB 1T6VN 2C9QA 3MUJA 3UTQA 5I1JL 4E9QA 1FSKB 3ZE0E 1GJWA 4AQZA 1GIGH 1KPVA 4XMPL 4AYFB 2WLZA 3R19A 1BMZA 4DUXA 2DLIA 1MRDH 2WK2A 4ZAKD 4L9LC 1PZCA 2R0LL 4ODBD 2NR6C 5B1AB 3BDXA 2C4FU 3QR1A 1RP8A 1HL8A 2ICEB 5FW6A 4AQ8C 4U4BA 5DO2D 2HRPH 1KB5L 1EUUA 3L7EB 5JOFB 1XVSA 4IIZA 5FGCB 4NUPA 3L1OH 3T8XB 4PJ9A 3DA0A 4FCHA 5L2JA 4PRPE 3KZ8A 2C26A 4IEFB 1ZD6A 2V2WB 2ADIA 3GO1H 5IW1A 2Z7ZA 3PWUA 2XX1A 4MJ6A 4GAYB 2MKWA 2J72A 1M7XA 2A0LD 3CHSA 2L7QA 2QPEB 5EUOF 3Q8FA 1U91B 2VABB 5HI5C 1H8SA 2NY5L 1GY1A 4GBXC 1DQIA 2YK1H 3EDKA 5SWQB 3LNDA 4MYWB 4NQXB 2K0RA 2I26N 5JDSA 4GSUA 4EVNB 1CBVH 4X0KA 2ZOKA 5KYXA 2QPFA 4H88L 3SE3C 1NOAA 1Q1JH 2EXSA 1UJTA 4F33B 2IV8A 4IYKA 3V2AR 5ID0A 5K5YA 1Q0YL 4UTAL 4KQ3H 1NGQH 3NRFA 1WCBB 1BFSA 2BCKA 4LCIH 1I53A 3UBXB 3DXAD 1SN0A 2B1AH 2FJHA 3M88A 3NCYP 4P2QE 4XX1E 2K4WA 35C8H 2D3VA 2XVBA 1EO8L 3QE5A 4PJ5A 3BPOC 4NRXA 4LSDA 4LLUB 2F1EA 1KGUA 4YFDB 1BQRA 1WBXA 4G8GB 2NW2A 1JVKA 4NC0B 4HWBA 3U9PH 4LLAA 3L95A 3G5WA 1S7VA 3UTTB 4LCYA 4Q4EA 1Y18A 5C08E 1EIBA 3QJRB 4IBTA 1P0SE 1JXJA 1LK3L 1BZEA 1KJVA 2J5WA 2EUXA 4NGHH 2EH8H 5KW9L 5BUAA 4Y7MA 1NCBL 4QGTA 4N0FA 5EORH 2IG2H 3NA9L 4WKXA 4NN7C 2AJUL 3NJIA 2RAMA 5FKPA 1HL5A 4OCWH 4XP4H 2P26A 1A1OB 1TQCB 2P5EA 3I9IA 3IDXL 3EHBB 3G6JF 5D2NB 2YC1A 2NXZC 3GHBL 1QFWH 5EIIG 3EBHA 3G6DH 1OAKL 5F1NB 3WS3A 5JXAL 4QHLB 4GG6A 1KJ2H 4PBXA 4NO5A 2RBLA 1FNFA 2EEBA 3I2CL 5GS2D 3E38A 1TETL 2APVA 2YBGA 1S8DB 5DR5H 4TQHA 4NXSA 1F6AA 3BH9A 2CQVA 3N41B 3WFDH 4PJHE 3ZOAA 5HVHC 1YN6B 3L4VA 1MJJA 5E9DA 3B9DA 3B3IB 5DC0A 3VFGL 1AQHA 2A83B 5JHDE 2D3LA 1F41A 5C09D 1ECYA 1MW1A 3MRHA 3S5YA 2Z3FA 3SGKA 4B7IA 4X7TB 5D4QA 5D1QD 5CD3B 1XIWC 2RHEA 2W38A 5E56A 2B4CH 2MKLC 4AGLA 4RESB 3SYAA 1X6NA 1QYGH 1K4CA 2JQAA 2H0FA 3F7YA 3U9UB 1OE1A 3FT2A 1ZVYA 1R1CA 4WUUD 5DD5H 3HZVB 4JPQA 3VUAA 2EH7H 3BGFB 1F02I 1JJUA 5T1MB 2ZCKL 3NJHA 3LQMA 2VQ1A 2Y36H 2BRRL 4HOMA 4I0KA 2WBJD 1IRAY 2XZAH 3SGEI 2JKWA 4MLSA 2Z34A 3U0TA 1LP9A 1QI5A 2I5YH 3ULAB 5FA4A 1TTUA 3AB0B 1N59A 4K15A 3IPBA 1BF2A 4XN7A 2VXQA 1JGEB 4D8PB 1W16A 1ZMYA 3IJSA 3JTTA 2K4AA 4OM1L 4PIBA 4Z7VA 4LQ1A 1CE1H 3IDJA 2JIXD 4KK6C 1H5BC 1UCBH 1RUAL 5T8IA 2HJLA 3QS3A 2XN9D 3ARFA 3NSYA 3QXAA 2OM5A 1DQLH 4CAGA 4K7PL 5F7LB 1FFNB 1T0PB 2Z4TA 3BP6B 5GRUH 1U8HA 4MRCA 4RISH 4JO3H 3D30A 3ZO9A 4OTXL 5DUBB 2Y3AA 3H7BA 5EUOB 4MA7H 2MPAL 4ICXA 2E6QA 3PGDB 2VC2B 3VFUA 1J11A 2EDLA 3EFFA 1HYSD 1LNUA 3QQNA 4XNDA 3V52L 1EV2E 4H1LA 4ONFH 4HWZA 4XODA 3ZYOA 5HYJD 5FM8A 3DXAB 1IKFH 2ZWZA 2XSKA 3AXLB 2E0PA 4FZ8H 1XGTB 4P9HL 2NNAA 2R4SH 4OIBA 3X13A 4U1NA 2D3NA 3MUY1 2Y7QB 2O61A 4PG9A 3L16A 2Q10A 5HDWA 3OJDB 4H40A 4NQDD 3KH3A 4OW6A 2VDNH 1RCYA 2CPCA 4Y8AA 5KWYC 4QLRA 4XCEB 1JHLL 2QHRH 1YJDC 2OJZH 3I02B 2IAMA 4ORGA 1MLBA 3EIFA 4U6XB 5ENWA 5T3XL 2DMKA 3NH7H 4FMVA 1E9PA 2E7HA 2BNUB 2H3NB 2HPOA 2NTFA 3LKOB 4PJ5E 3ZTEA 1ED3A 5EZLA 4PJFA 2XWTB 1ACXA 1VZIA 3CQPA 4ES9A 4GW1A 3Q06A 3C8KA 1F2XK 3A6CH 1OAXH 2HT4C 4M93C 4EN3B 3CUPA 1RFDL 3OB8A 4TNVF 3MV11 5JZ7D 5FYJE 2V8LA 3N1PC 3RZCB 2EINB 3LS4H 2Z7UA 4L8BA 4U6VL 5HHQB 5AG9A 1CK0H 1VFBB 4OFIA 4ZQTA 5I23A 2O5ZH 3ECWA 3FPYA 1YEEH 1AXIB 2OSLB 5A1AA 1HSAA 3JWNH 3DPBA 1OWRM 3G6JB 4UBDC 2R2HA 2VZSA 5I9QC 1SVBA 3FU0A 1HTYA 1NM9A 3IJ9A 4IHBA 2F74A 4KZCA 2GTZB 3BVVA 3PHSA 1GYCA 2ADGA 4I5BA 4M48H 4Y4HD 2Y7SA 3RWGA 1KLFB 3W2DL 1DBBH 5KS9F 3T5WA 2ZTBA 2C9UA 1P4BH 2VUYA 4F3FA 3BSGA 1RAMA 1SLUA 2R56L 5EBGA 5TH2B 3FCUB 2F68X 3B2XA 4BFRA 4ODHH 3BJLA 4JRYA 4PU2A 2GC4C 2WN3A 1LQSR 3UDWA 3KJ6H 3TIDA 2YKLL 3ASOB 2JKTM 3MO1A 3O3EB 2PPCA 3IT8D 3CFEB 4H5SB 5C0ND 4WUUB 3TPUA 2BIHA 2C9XA 2HFFA 4U3XA 2C1PB 1EXHA 4JPVH 2KT6A 1ZT4B 1QHQA 4KZDL 5I74B 3TT3L 4XB8A 2WBJB 1VB9A 5K1NA 2XRAL 5FYLH 3IBEA 4WU7B 1B6UA 2WXGA 2LLGA 1NDGA 4IKIA 1KCRH 1NSNL 2YD6A 3F83A 3I9PA 2JKNA 1P4LB 2IPKA 3UAJA 2CAKA 4OZFH 2MQGA 3KE0A 4LAJH 1XTLA 2ZYIA 3WCYA 3QRGL 2PYFA 3DX9B 4YHIA 3V0WL 1JK8B 1KIQA 4O51B 4PWGA 1C5BH 4JFSA 5BW7A 2CRMA 3EYUL 1U36A 1KTRL 1KIRB 4GRMA 5E1QA 2G3XA 4AEHH 2V2TB 3QCTL 1SJEB 4M7LT 4AMKL 1Q9KB 3VXNB 5KVMC 3WUWG 1ZANH 3PJNA 2H8PB 2V9RA 4MZ2A 4Z7VE 5DHYA 4Y16A 1WDAA 3P30H 4KFZC 2EVJA 3M8OH 4QRSB 1WBYB 5HP5A 2NY2D 4UT7L 1S4IA 5B3NA 2XFXB 4IRZL 1CFQB 4YHPA 1CG9B 1HZHL 5HYJB 3CX5J 4J12A 5LBSA 4GKOA 3WXVL 3O4LD 4KNTA 4ESKA 3DWTA 5F96L 3FTUA 3WE6A 4PW9A 1EZVY 2OZNA 3CVHL 4JMNA 3RX5A 3GMLB 3RTQC 3BQUA 3GK8L 4ODUA 1ZV9A 5GGTA 3RQ3A 1SMDA 4CN1A 2BSTB 3NJMA 2WW8A 3KPPB 4NQDB 3CFBA 4GMTH 4FYRA 5D96C 5DFAA 3NAAL 1VGEL 3FK3A 4LCWE 3F65A 4Y7OC 3RY5A 4Y4KD 2ESVA 4BDVA 2A74B 2V7HB 3ILEA 3LKSB 1A6TB 3FUFA 3PWJA 3F7QA 5F3BB 2C7UA 3DO3A 3RY6A 3AG3B 1T66D 3PABA 3D85A 5J57B 4XP1L 1EXGA 4J27A 3L4YA 3NA4A 5E2UH 3T2OA 4BZYA 4LP4A 4ZPVA 4P23D 1TZHA 5H2BB 1A4BA 1XF4A 1AQDA 3QPXL 2PWDA 1J0KA 2E27H 2Z92A 3VAEA 1UXWA 4O4YH 3ZJAA 2ATAA 4EI5C 5JXED 3TN0A 5JNYA 1V3JA 4ZTPL 3RI5K 3RYMA 2XPYA 1A6ZA 5IHLB 1FORH 1CQKA 1Z0NA 3LIZH 3U2SA 5GS0C 1XGYL 3L3OC 3MRBA 3MUZ1 4H0LC 4N3TA 2PYEE 3VJ6B 1TYJA 3QPQC 1YYLH 4I2XE 4Y4HB 5AOMA 5BRZA 1T3FB 3NPSB 4HMEA 2VLME 5T3XD 3GNML 1FNGB 1NMBL 1ZHBB 4GT7A 5E23A 3DRQB 3MBED 4HHAA 3ZDZE 1TZIA 3CDGA 5GJTH 4OF6A 1CYGA 4NN5B 4FEIA 1N19A 5KS9B 5ISZB 1AKPA 5FEBA 2V5MA 3ET9F 4R2GB 4HD5A 5DWUL 2XNAA 4IOSA 4ZQKA 5C0RL 1MCWW 2NX5D 3PAZA 3H42L 1EGJH 5FV2A 3RWJA 4MXQD 2CBPA 2IH9A 1A7PH 2G5BA 1L6PA 4JDZA 1NPNA 2IDCA 1CDYA 1MF2H 4AH2A 4KY2A 4FJZA 3MJ7B 5AZ2H 2XXGA 4LLYB 2JJWA 2R29A 5D5ME 3AQZA 2DD8H 1GSKA 3FRPA 5GS1C 4QXTA 3QFGA 1HKLL 3GBEA 5I1LB 2D31A 2Q7NA 4F7KA 2GITA 2JJTA 3H9HA 5FA3B 1IL1A 4G80B 4ACPA 4X4YA 2DTMH 4PJXF 5AZEH 4P9ML 5J0BA 1Z7JA 4HSAC 2JTYA 2MNWA 4FL4C 4QUOA 3UJIH 1YEDA 2FX8L 4ISVA 4G43B 4M4RA 1SXAA 3ZE0F 1S7WB 4RZCA 5B8CA 4XHJD 5CKGA 4AC4A 2IOIA 1N4XH 4OLYL 2KHAA 3U1SH 4N25A 4IBYA 1XCTA 4XMLL 3GKWH 2N0KA 3QUMB 1UQSA 5FK9B 1U95A 2WLNA 2X4OB 3B2MA 1HWWA 1WAAA 1X5JA 3MFGB 4XMXA 2VZVA 3HHRB 5D7IE 3WIFA 3NIDE 3PQYE 4GLRI 2ENYA 1TSHA 2ARJQ 4KVNL 4P3WA 1IBFA 2LABA 2W5PA 3V0FA 3O4LB 3KPNB 3U2JA 3MOQA 2XKNA 4KNQA 4JFZH 3KS0H 4HS6B 1U8KA 3G5YB 4N2AA 5ABZA 3ML8A 2VLRE 3H3PH 5I8OL 1FCCA 1OM9A 4QRQB 5IOPA 3IMWA 1GGTA 4ZMAT 1OSZA 3QPKA 1W0WA 2CKBH 4N90D 5E2TH 2RCSL 2CDGB 5DVLA 4XBMA 1P7KB 4HWNA 5E6ZA 2XZCL 3QGVA 2FECI 1MSPA 4PYGA 5FOJA 5JPNB 1YMMA 2WVUA 2PP8A 4L1HA 3BVUA 3VD9A 1IM3B 4KH2A 2I9LA 1BPVA 3QDJD 3S96A 2XI9A 4Q56A 5IM7B 5K39B 4HJ0D 3GD1C 1WRFA 4P23B 1AZRA 4ZNCD 2D8KA 2R8SH 4HWBL 1E5AA 3BAEL 1CLOL 1IV8A 1BD2A 2X70B 3HPJA 4R7NB 2OYKA 2N7BA 5IZ7A 3H56A 1AOHA 3QDMB 4PI0A 2B2XH 4K94L 2OK0H 1UM6L 3BEWA 4HK0A 3NG5A 2J6WA 4MDRA 4M8VA 5IVZA 5DJ0B 4PI2A 5I5MA 1CGTA 2JJSC 4OIIL 3L4UA 5EC1B 4HIIA 2R7EB 4DAGL 2XTJC 4KXAA 2XQYG 2V5TA 3A0OA 1ADQA 3I3DA 2DQUL 1QSEE 2CZNA 3CDFA 4JDTL 1I4FB 3FQXB 2YZ1A 3QO0A 2ZWSA 4GMSH 1KXVA 2A9NH 2E4TA 4OD2A 1ZT7A 4QRBA 1EAQA 1A3RL 3L4ZA 4JE0A 1WSST 2W59A 5JOPE 3T0BA 2IANE 5IFAH 4CVXB 2WOYA 2NX5B 1KDJA 4PBVC 5K93A 4YPGA 3UTPE 3LEXB 2CJ3A 3MV7E 4PV1C 2CO7A 4TTDC 5BMFL 1WBZB 2GYSA 2HFGL 3TJEH 1NFAA 2YPLE 3HRZB 1GHFL 3MLUL 5DI8B 3H9ZA 3TT1L 4ZTOL 4JHAH 4ZNEA 4CVUA 2Q8AH 1KCVL 3S3DB 4YL4A 1BFVL 1DVUA 1BOGB 1IQWH 3HN5A 4HSCX 3EJUA 2XWEA 4Q9CA 1EHXA 4HH8A 3D0VA 3EXLA 2J1WA 2OMTB 3OXSB 5A2IH 5LGKA 5JHDD 2NW3A 5CD5C 4N1CA 4AENB 5IK3A 1UD4A 4KNSA 5LGHH 3N1FC 4YHKL 3IDNA 4PWHA 4ANWA 2NY6B 2LU3A 3H9SA 4DEPB 4CGTA 4YHNA 4ETQA 1SF3A 2BSBA 2GT9B 3VXQB 1JHKH 4PJXB 4PLJC 3WL9A 4X9FA 3HG1A 2EYSB 5IG7A 2W1NA 2H32B 4J3OC 4LEOA 5E5MB 3UZEA 5EZOH 1P1ZB 2VXQL 1QAWA 3QUXC 5TDPA 4PRIE 5F7FA 1JNLH 2P8PB 4UAOB 3ZKNC 4N85A 2F19H 3TYFA 4F7TB 1L9QA 2WUCH 4QT5B 3TCXA 1RUQL 1GC1C 3F84A 3L1GA 1FLTX 3Q2VA 4I1NB 3S8FB 2ENQA 1X5HA 1BLNB 1MFUA 3LNGA 1S5HA 3DIVA 3UC0L 4R96B 3S3BB 2OMNA 2R27A 1Q4NX 3WXWH 3QNYA 1IFHH 3F3HA 4FQ2L 3NESA 1IE5A 1PD1A 4N8CH 2L4OA 4MHHG 1GGUA 1H9VA 2AJXL 3GB7B 3MGOB 3P9MA 1URZA 2G0KA 4K8RC 1NBYB 3WOVA 3MRDB 1IZJA 1M2VB 1N3NB 2KERA 1PZAA 1JGDA 2EEXA 2WYHA 3TBSA 3HZ3A 1FL3B 2YQ2A 3MJ6A 3C60C 4C56A 2YARA 1U42A 1QUNB 5FXCH 5JQHC 1JMZA 4HUXB 3HC3L 3FUIA 4WKZB 3WMSA 5ADOL 3FT9A 4P8QA 4Y19E 2A9MH 4X5RA 4IOIB 1CD1A 1R5VA 3V0EA 3VO0A 2IC2A 2EIZA 2VDLH 1KUMA 4IRSA 2WXIA 4BWUA 1BJ1H 4G71B 1Z5HA 3KAAA 4HEPA 3PIQB 2GIMA 4BKLA 4HK3J 1NPJA 1CFVL 2Z64C 2ZF8A 3HC4L 3QR2A 5B1JC 2WP3T 3RUGE 4ZW3A 2VM9A 1G9MH 4XCNB 3CVHB 2QLYA 3QUZA 1QBLH 1U92A 2EVIA 5HDBF 2C4FT 3SQBB 3QXDA 3WJLA 2JKRM 1SFDA 1RP9A 4YBQC 3KPMB 1DLFH 1NA8A 3WS6A 4LGRB 2DLTA 2X4PB 4WJKB 5AVWB 4P2OD 5AVRB 4MAUH 3AUVA 3LAFA 5FHAH 1JPFB 1UWGL 4N9OB 4X9IA 4U33A 4EMZA 3TBTA 3BCDA 2NY7H 4PJ5D 2R2CA 1NBVH 1DBJL 2VO5A 1PPIA 1UT1A 2YGOA 1MW2A 3MRIA 5T1JA 4MCZB 4DFHA 1GW6A 3HS9A 3C9NA 3FB5A 1E8XA 1R46A 5GGTL 1XDTT 2NLJA 5TF1H 1T5WA 3UO8B 2HT3D 2FEJA 1E0OB 4Z23A 3S35L 3NBNA 1OXYA 3WKYA 4QO1A 1I8UA 4ZMNA 3SE9H 4FHJA 2ICWA 3QEGH 4NJ9L 4ZX5A 2WVVA 2AS5M 3EO1B 1XO8A 3FSZA 5C0JB 3O81A 3ZYZA 2E47A 3FXIC 5DLMH 1BAWA 4NJAL 1AI1H 5I6XB 3I9GH 3HHSB 4MQTB 4H20H 4GG6F 3CFTA 2P5ED 3D33A 3TTSA 1QEWB 4JJHA 2CLVB 5I76B 2QFPA 3C6SB 2Q76A 1XF3B 1RHHA 1RZIA 2DL9A 2F15A 2BW4A 2YSSB 3X14A 4EUPA 1DQDL 3FUDA 5ALBH 1A14H 1UKTA 2JNZA 2YUVA 3CXDL 5IQMA 3UTSB 3QUHA 1XGUA 1Z66A 1S9VB 5I30H 5AVXB 2V7NA 3GZOA 5T1DL 4Z78A 1HJBC 1AZNA 4YGVB 3V0JA 3CZJA 4G82A 2ZNXA 4ODVL 2XQBL 1P6AB 4Y5YC 2FH6A 4JO5A 2CCVA 4PP1D 3KH4A 4RIRB 3GMQA 3HE7B 1KSRA 4NENB 4HD9A 4JCWA 1HH9A 2YSTA 3HG1E 2A6KA 2EABA 1X5AA 5J4MA 1GZHA 4KK5C 3CH1B 3UGXA 1LP9F 1KPVB 1YPZA 3ZL1A 2YRLA 3N3EA 2CIKA 3S37H 1J9SA 1BQUA 1FNEB 4X5LA 3TWCL 4YR6A 4J3VA 1UADC 5F7HA 3T0DA 4MBRA 2HXAA 4B9PA 4OJAA 5KOMC 4XNXL 2XIDA 1KGIA 1KLGA 4TLTA 1ZLVH 3W11C 4FNQA 1D5RA 4ZMPA 4PJ9B 5LBSL 1N64L 2AEPL 3PP3H 3KL0A 2BJML 2ADIB 1BFTA 4RGNC 5IW1B 3VYOA 4ANVA 4BWTA 4E9XA 4MJ6B 1OSPL 3TNNA 3QORC 1U3HA 1WTGT 3ARFD 2K8MA 3FZUD 5FCUH 5C0FA 2YPVH 4L37A 5LCVH 5HGHA 4M62L 2WQWA 4JY5L 4GUCA 4IMLA 3QIBC 3AT8A 2B59B 3UAAA 5HPMA 4P2RE 1XB8A 4W9HC 5IB1B 5JDSB 2XN0A 5DJXB 4JFOA 5KYXB 4L48A 2BSED 2HH0H 1PIFA 2VUOA 4XWOC 1JWSB 3QZLA 4U1LA 4Y1AB 2JI1A 3NEXA 4H0HB 4DZBB 3KLHD 2AEWA 1RJLA 4UQ2A 2ZOLB 4YZFF 3HC0B 4QRTB 5HDBB 3S36L 3IFLL 2BCKB 3L7FA 2J3SA 3WHXA 4X4ZA 4DGYH 4A7GA 1SRDA 1ETA1 2FJHB 1IGCL 4DT2A 2KMWA 1PLGH 3UXFA 3REWA 5DQDL 1UEYA 2DM3A 2ZYRA 4KROC 1U4EA 4HFWA 3OQRA 2VXSH 1VSCA 4OZGE 1OK8A 4NRXB 1XB3A 1BM3H 1JZ2A 1HEZB 1BPLB 1G0XA 1GGCH 4Y9EA 1HI6A 1WBXB 3RPBA 2NW2B 3EUUA 2PN5A 4FC3E 2Q20A 3FPXA 2XTSA 3L5IA 3L95B 4JQIL 4DK6A 1S7VB 5EULV 4PJFF 2BO0A 3LZPA 2IAMD 1Y18B 2C3XA 1AGEA 2PCXA 3MZGB 5EEUA 2J4WH 3BCFA 1S6NA 5F7BA 1L0XA 3BN9C 1JZ6A 3GSRA 4OIFA 4L5FH 4OI9A 1KJVB 4WGKA 1NCGA 2N7AA 4M7LL 4NZRH 3NGBB 3P11H 3PWLA 2AQPA 1YY9D 3NIGE 3JWDL 1HXYA 2V3EA 3BSZH 3MTXA 1H15B 2BOLA 1PY0A 5FKPB 1YA5A 2EDNA 1LJMA 4V2CB 3DC0A 2E3VA 2P5EB 2VXVL 5IKCA 1HC1A 2ZUXA 3APMA 4YDIL 3QWOB 3GS7A 1JL8A 3FOLA 3WS3B 4OI8A 2CUHA 1QKZL 4GG6B 4NO5B 4H0GA 3T4AA 2R29L 2HFEA 2QGDA 5DZNA 1FYHB 1WH0A 3VH8A 4LSUL 1F6AB 3PDOA 3BH9B 5I1DA 1UZ6E 1CTMA 5DMGC 5E9DB 4HIQA 4ICWA 2V3DA 1FIGL 4OT1H 3V8CA 3MRHB 1IILE 4Z76A 5AKSA 3ZMNA 5KYNA 4JRYD 3QT2A 1BQHA 1JGLH 1MFBL 1UATA 5KSUB 2AJ3B 3NFNA 4JM0A 2FWLB 3F7YB 1J5DA 4JFTA 2O4EA 3D6GA 3UYRH 5I28A 4Q2ZA 4I9WE 3DNKA 3X2QB 3VSUA 4G9FB 5I1KL 1A6AA 4X7FC 2X9XA 1FE8L 2CK0L 2VQ1B 4OIAA 1QPPA 3J2PA 3VRLE 1T4KA 1LP9B 4OF5A 5CJ8A 3MRNA 4D0BA 3HB3D 4LKXA 1CDIA 1ZLUK 1NCDH 3WEMA 4DUVA 5L8KB 4LOUC 1N59B 1RURH 1AY1H 1TQTA 1PJWA 3VU2A 3MJ9H 1YEJH 3IJSB 5GGVY 3O0RL 1DSWA 4GUQA 4D9LH 4G3YL 1XGRA 2YGQA 3IDJB 4HP5A 3V5HB 2NZ9D 4NXKA 2EDTA 2WY3B 3ARTA 3QZPA 4OU3A 1KFGA 3LOWA 5CGYD 1U8HB 1J8RA 4LSRH 1PQZA 2WQXA 4FZEH 3ME0B 2J8OA 2X7LB 2AZAA 1BJMA 1DQMH 1IBHA 1ZDQA 5I6LA 3H7BB 4MJIA 4Y16D 4A7UA 4CDGC 2FT7A 4JHBA 2QGBA 2V2XA 1HKFA 3FYEB 2XX0A 1Z9LA 5TFSH 1LNUB 5HDOA 5DA0B 1HSBA 1U3NA 4H1LB 3RL1A 3GXMA 5T5NG 4XB7A 3HG3A 2WTRA 3NCEB 4ERSH 3K6NA 4PJEE 2P5PA 3ZDXF 4MASA 1A3ZA 2NQ3A 5IVXF 3PAYA 4GRWF 2D7TH 3X13B 2AKRB 4U1NB 12E8L 1AXSA 2R59A 3BQUD 3D8MA 4J6RL 4PG9B 1G7PA 4GRLA 2OMWA 1HVXA 5I6MA 3SKNB 1J1OH 4PB0H 4RGNE 1HESA 3ZKMC 4JG1H 4MS8C 2OQJA 2ESVD 3OPZH 4ORGB 1MLBB 3F01A 1UKSA 1ADQL 5ENWB 2WSDA 1JTPA 2E9JA 1E9PB 4GIOA 4XWGL 1ED3B 1CFNA 3D85D 4IIQC 4PJFB 4KITB 5CJOL 5GGUA 1E4XI 3DYPA 3OMIB 3JYCA 4GW1B 1BVNT 3O8XC 5I75C 1XV8A 1NCWH 4NP4L 2I25N 3L5XH 2FATL 1QFOA 3CFCL 4BUQA 2DPKA 4YEEA 4Z7NE 3C08H 2QDVA 4C54A 2Z6FA 4LU5L 3IBOA 1KULA 4L8BB 3PHQA 4V2BA 3CIQA 4X83A 4MMXC 3TN0D 4MMZA 5IT2L 3IJ7A 2DMBA 3HG0A 5I0YA 4W6YB 3MGTA 1AACA 2CU9A 3IMUA 1KFAL 1I8LA 4IRJA 3C6LA 1G6RB 1HSAB 4FFZH 3DPBB 1NAKH 4PW4A 4APXA 5HHOB 5MERA 1A9VA 2R2HB 4R97B 1JZIA 2VSDA 1CLYH 3KVQA 2HCZX 4JHWL 1EZUA 4OGYH 2F74B 5I2IB 5BRZD 3RWGB 2ADGB 4I5BB 4TSAL 1UWYA 5I16B 3U0WL 4EO5A 4LXFA 4AIEA 4E5XA 5ICYA 3L2MA 1XH2A 1UD2A 4F3FB 1VDGA 4HKXB 2CSPA 3P73A 1SQ2N 3G9VA 4R0LA 1F18A 4KMTH 3T08A 3V4PH 3TIDB 4PJGA 3MUGB 3S88L 4QJ5B 3MO1B 4TQEH 3FCTA 5JR1L 4KKAC 1AHWC 3ZGHA 1CDJA 3TPUB 5FDWB 2A9DA 4NRZA 4YDJA 5L4MA 3RWDA 5G4NA 4IKLA 4N2FA 3JVGC 6PAZA 4XAWL 4KX8A 3O2DL 3RJDA 3MRFA 2HKFH 3BAJA 1L9RA 4HHGA 2RMNA 5HD8C 3HB3B 1UB5B 2X88A 2CJSA 3N43F 3EH3B 1I85A 3LVTA 3MV8A 1NDGB 3PHAA 4YXLH 4OLWL 5G4OA 1NC4A 1DN2A 4ONGL 4FYQA 3FT4A 3CSYB 2IPKB 5C9JB 1BXXA 1RUMH 1UC6A 3DETC 2WO2B 4HXBH 4OFQA 2PYFB 4YHIB 3REVB 1KIQB 1WV7T 4XPTL 1QW8A 3QJFA 2HN7A 3T0VA 5JHLH 1KTKE 4PJBB 4R5XA 2FIRT 2ZUYA 2VKXA 3NCMA 4OLXH 2MHAB 3L3JB 3VWJA 5EO9B 2ZCHL 4I1PA 3UGEA 4BZ2A 1R3JB 1WAAF 2IO5A 1Z9PA 1XGZA 3LH2H 4K9EC 2E7DA 1P69B 5LWYL 4CU8A 2LVCA 3FSWA 3JWOH 2FB4L 4HWEH 4RZKA 1MCHA 2YLHA 5CP7A 3HZKA 4YHPB 1M56B 4NNXB 5D6CA 2E7LA 2BHYA 4KK9C 4OCXL 3ZE1E 1K4DA 5KAQG 2HWZL 3QAQA 5I1GL 3CTTA 3HS0A 2WZ5A 1SXCA 2XCMC 3WE6B 4JZOA 1FL5A 1MREL 1WT5C 3BPNC 3FB6A 5E9AA 4ODUB 1P9MC 2DWTA 3DX3A 1OCRB 4UV4H 3CFBB 3LS5H 5IVXB 1RLBA 2G75A 5I82A 4PJAF 5C0EA 3QIUC 2AJZA 1EMTL 5C7ZA 4R7VA 4BFFA 1VKXA 2ESVB 3BEVA 3DIFA 4YHZH 1CXFA 2IMNA 1YMMD 2R4RL 1YC7A 4HIXH 1G9EA 3NVQA 2C7UB 5IQLA 3PNWA 3D85B 4XXCA 5F3FA 4G6AC 5TQ0L 3KR3L 4M00A 1DE4A 1LDPH 4ZPVB 5K59F 1TZHB 2P4AB 5DUML 5AW2B 1SOXA 5DT1L 1AQDB 5DK0A 2Z92B 2CR0A 1F58H 1UXWB 4RGOL 5SX5K 3S3JA 3KVDD 5IWLC 2NZ1A 4N0CD 4TNWK 3TN0B 5JNYB 1A7NL 3RKDD 1WWWX 2NUTA 1O75A 1AGBA 4JUTA 3SYCA 1RUPH 4K5PA 3U2SB 3GM0A 3MRBB 1KGWA 2WWKT 3L2LA 4DNLA 2VL5A 2I60H 1T5XA 4POZD 2I69A 1MCSA 2BVOA 4RMVA 1E6JL 1U8NA 4JB9L 1DUYA 3DVFA 3LH9A 4JM2C 3CXHJ 2VZOA 3B56A 4PD4J 3IM1A 4NPKA 1NDMA 4WY7H 1TZIB 3CDGB 4ZW6A 2QSCH 5AB0A 1QBML 1UGKA 3M7FB 3P02A 2VXUL 1KZYA 4ZI8A 2ODIA 4B9GA 4ZQKB 4ONHA 3VD5A 4Q52A 2VH5H 3BOVA 4KU1A 1LO3L 2YQGA 3EYOB 3VM5A 2ZXBA 4XP6H 4GUPB 2G5BB 4JDZB 1PCSA 1MVUA 4ETYA 5HXMA 4AH2B 1NCHA 1J12A 1EPFA 1O5DT 3MROB 1BJ1J 3GSOA 2HVKB 3GMMA 1U93A 3FN3A 2UZPA 3FRPB 2CIIA 4QXTB 4G6KL 3FQ2A 3KGTA 5CIPB 2GITB 4PJ7E 4TL5A 3WIAA 1IL1B 1L7TH 1ZWIA 3HNVL 4X4YB 1XHHA 1BF8A 2EE9A 4UZUA 1NLBH 2K9UA 2HTLD 1YEDB 3H9SD 4ISVB 4HIJA 3ISYA 3WY4A 3T2QA 3Q3GB 4M4RB 1VCBC 3VD4A 5I8KL 1VADA 5B8CB 4BQ6A 1OGPA 5FV1L 3HG1D 4MA8H 1YNKH 5J13C 2Y9RT 1M3JA 3QQ4A 4H44C 1U8MA 6FABH 4XBPA 1XCTB 4XNQA 3RY4A 1IGIL 1JAEA 1U95B 3QNXA 4ZMLA 5KG9A 1QOKA 5TK2A 3Q44A 1INDH 3H54A 3WIFB 4F9LA 4U0RB 3U6RA 1IC5L 4XVOA 4PLKC 1XEDA 1W72A 1V8HA 1MCQA 3BZ4A 5CINH 2XKNB 4WAFA 1V3MA 1PJ9A 1U8KB 2J57A 3V0HA 3LCYA 1RH8A 5GZNC 3ARGA 4JN1L 5IOPB 1F8TH 5EH1A 4C56D 1OSZB 1N0XL 1W0WB 3QZOA 3FTSA 1N5YH 2X12A 5A6LA 2DI8A 5GJSH 3FSOA 2ROYA 4NAQA 3LXCA 1JK9A 1RZKH 1MFCH 1YMMB 3ATFA 4PJAB 4Q8BA 3T2LA 3F58H 2OXHA 1SHWA 3WELA 3EJZD 4JFDA 4Y5XC 4QXGL 5HHXL 2I9LB 1LILA 4IRSD 3S96B 1BREA 2H5UA 3FBKA 3X1NA 5KBPA 1AR2A 1G1OA 2DM7A 4FLSA 2NR6A 1GMIA 1BD2B 4Y4FC 3TYGH 2AMGA 3QUZD 4AQ8A 4MCMA 3BEWB 3CLFH 4HK0B 4BFGA 2Y0SA 5IVZB 4L1LA 5KYYA 3NCBB 4HIIB 5LXGH 3AS1A 4KTYA 1ZK5A 4LOFA 3D18B 1CDBA 2G5UA 4YVUA 3O6MH 3K4ZA 5IUSA 1T0NA 4PCSA 4K3JH 1H6UA 3FO0L 4LSPL 1TQBB 3LD8C 3STBA 3PS6A 1G7HA 1S5IH 1FGNL 3PWNA 2Y2TA 3OSVA 1ROWA 3QG7H 4TLKA 5KVFE 1IEAB 4JCMA 1TTGA 3BUTA 4TQIA 4V33A 4OD2B 1ZT7B 3DOSA 4NM4H 3KGUA 3U46B 4U05A 1RJYB 4OZHE 3SE3A 3QAZB 1RHFA 1JV5A 2BP5M 1YQVL 3NYKA 1FNAA 3CZFB 1WIUA 2WYTA 2MWCA 5TE7L 3RWHA 4L05A 3S37X 1QSVA 2VR4A 2VC2H 2CO7B 1G9NL 3CZGA 1HZLA 2YGNA 1NGPH 4FTVE 1KJMA 5BUGA 1E4XL 2W9EH 3B1TA 3CSFA 4NCDA 4M5YL 4AV5A 1XH0A 1LM8V 3WY2A 3ARSA 5IK3B 3IDNB 4DGWC 3C5SA 5C71A 5DC2A 3H9SB 3TA3C 1M42A 5CMAA 5HPOA 3S34H 4YHNB 4ETQB 3TJPA 4Q9QL 3H6JA 3UJJH 1SEQH 3BRFA 3DGCR 3QNZA 3S4SA 3FTGA 1ZEAL 4JAMB 3WL9B 4FP8H 3BRGC 1G1CA 4LLQB 3IFPA 1IBYA 2FUQA 4LEOB 4E0RA 4HKZB 3WO4B 4G11A 5TDPB 2MTAA 3L4XA 3TYFB 3RBGA 1OHZA 3BIKA 4QHNA 3B43A 5KUMA 1R3HB 1NBCA 3KBFA 3DX8A 3FW6A 1DVYA 3ZYJA 5AW7B 4FNPA 4FQIL 1RIUL 2VDQL 1YPZF 1S5HB 1DJHA 3FN0H 4JDVA 3QQDA 2EVHA 4X5WB 2VR8A 3QNYB 1JRHH 1GZQA 1BA9A 4YS4A 1GZPB 2GCYB 3K4DA 4WWNA 1IAKA 2F7IA 3P9MB 5EDSA 4GJTB 2X4RA 2E9BA 5GSVB 3FC8A 4BH8A 2GY7B 5JMRA 1C7SA 1JGDB 2ZD0A 3TBSB 5IGXH 2GBVA 3U7YL 4LESA 3VI3B 1CR9L 4OFDA 3NQKA 1X5KA 4LOEA 4WO4C 3X1FA 2NCEA 2HB0A 1DQJA 4TM9A 3U79A 3L13A 3V4VA 4PRNA 4OB5L 4Q6IC 3P0GB 1ND0A 1XL6A 3RI5F 2CNZA 1CD1B 2DQCL 1U3HD 4CGUB 1IGML 5IBTH 2FYYA 4DP8X 2H1XA 3PYCA 4I13B 3VXUB 2E5EA 1F90H 4IRSB 4YDKL 4G1EA 4FABH 1VPOL 2MQ3A 3P77B 4OLUL 4W9KC 3UPRA 4Z95L 3K8LA 4AQAA 2VDRL 5MEOA 2R0KH 3BP5A 4JKMA 1P4IL 5E8EA 5HVGB 1EJOH 4GP5B 5C2BH 5ITBH 1LO4L 1Z5LB 3QUZB 5F1KC 1DQQA 1U92B 4XNYL 2BWDA 4G1MA 5J7CC 2OZ4H 3QXDB 4FG2A 2FNWA 3FCGA 1JF5A 3VXTB 4A7GF 4XXDA 1OAUH 2GPZA 5DQJB 4MFHA 2FHBA 1T7XA 3ZDYE 4GO6B 4PTUB 1OCWL 1W8OA 2I9TB 1RK1A 5A2AA 1ZVHA 3L3HA 4S1SL 4DGIL 1H5BA 2XV3A 4O00A 4WTXA 4X99A 1UA6H 4XGZA 5KJRH 4EOWH 2IGFH 4UYPA 1JN6A 3Q6GH 4OAWA 6CGTA 3ZTCC 1KOAA 3CFNA 3TBTB 3T3PF 3DSFH 3I6GA 3BDYL 5D7KE 2OPCA 4Z7WA 2J88L 2BSSA 3MRIB 3I84A 4DP4X 1T83C 1HNFA 5I1JH 3C9NB 3FB5B 3IDIB 3SJVA 1QATA 2HFTA 2NLJB 2LAGB 1T5WB 1QFWI 3NEEA 4HVBA 4E42B 2EDWA 1AR1D 2N4IA 2WNWA 3GWJA 3T0EC 1AP2B 2R0LH 4HS3A 4QO1B 4AE0A 1AYRA 2XA3A 2ICWB 2V8MA 4LLMA 1EUTA 3V0GA 2WVVB 1HILA 2G9HB 3PAUA 3QUYB 5KOVC 2QGEA 2ROXA 4JG0L 1WPCA 2VWEC 4JL1A 3SDAA 1S7UA 1T7VA 4XPHH 3N44F 1T2QL 2X09A 3L6FB 3GZQA 4FFTA 1RHHB 1KEGL 4HDIA 4RWHA 4Q7DA 4HAGA 3X14B 5BQ7B 5JHBA 4EUPB 2UZIL 1FI8C 2BHFA 4PS3A 1XGUB 1HHHA 2H41A 3MNWA 1P6WA 2YMOA 4Z78B 5LG1A 1JOIA 2W60A 4H88H 4WHDA 4ZZFA 4YSOA 1ONQB 1JG9A 3LB6C 3TV8A 1Q0YH 3GMQB 4OBSA 3ZKXC 4NKQB 5EOCL 1R24A 3MNDA 2EC9U 1IU1A 2DM2A 2UX7A 3GXDA 2A6KB 4ZUVA 3S2CA 3Q9QA 1NUFA 4BZ2L 1YPZB 3IETB 3SPIA 4DP9X 4HOXA 2PR4L 1AQ8A 2CIKB 2VUKA 5AL0A 3T77B 1TMQA 3U1QA 5DMKA 4YR6B 3W0WB 2WQAA 1RZFL 3IDGA 3SODB 5I6KA 5DJCB 4B9CA 2C3WA 4A63A 1KLGB 1ZA3A 4GB9A 2CM6A 1HL9A 3EO0A 1IBGH 2FQFA 3EAKA 3FT0A 5DRNA 4QY8A 4Z3EA 1NTDA 4AI7A 2DDQL 3BLKA 4XCFH 2ZQKA 4JKNA 4JRXA 1NCBH 4P5TC 2X6MA 4UQ3B 1GYUA 4CNIA 1PSKH 1TVBA 3TNNB 1U3HB 3MCYA 3NA9H 3VI4E 2P28B 1AH1A 4BYHA 5HGHB 1KBGH 1IEHA 3LV3B 3Q13A 4JFWA 1QQDA 4IMLB 2CRYA 5INCA 4LVHC 1OAJA 3ES6B 3QHFH 5HPMB 3GHBH 1QD0A 1E8WA 4MJID 1OAKH 4XI5D 1M7IA 2AEQH 2RTTA 1HFUA 2QMKA 4WHCA 2XJLA 4XVTL 5E95B 1TETH 2WXMA 5F44A 4UQ2B 1RJLB 4XN1A 1FVEA 3KWTA 4AVIA 1NCNA 4GT0A 5I1IH 4JFFE 4OGZA 2KS0A 3L7FB 1A66A 3LQAL 1JPTL 4XBEH 2NTSP 1F11A 3E6FA 3SKMA 3ZDWA 2UY6A 3REWB 4HCGA 2BX5A 3QNFA 3QHZH 1FYTE 4LASL 1CF8L 2NY3C 2X0UA 1UM4L 5EO0B 4N86A 1BBDL 4GRLD 1HI6B 4N24A 1B88A 4R8WL 1SBSH 1OM3L 2YKKA 4JN2A 2QSVA 1NWPA 1NOFA 1C12A 3D48R 3ERXA 4BFIA 1HIMH 1OPGH 1TO5A 2IDTA 3QUMH 1AGEB 4DSYA 2I07B 3VTTA 4X6DE 1W9XA 1JXDA 3NCJH 3TIEA 3GSRB 1YEIL 4XNZC 2Z93A 1OTSC 3PWLB 4HV8A 3OVUB 3FTWA 4FXKC 5DUPL 5L0QC 4OM1H 3RTQA 4GKZA 4E9LA 4M4PA 2ZOOA 5IKCB 5B1BB 2E8YA 3U25A 1RUKL 1KTBA 1PKQA 1X7TA 3FOLB 4AMWA 4WDIA 3HVDA 1C5CH 4FQCL 4IRJD 1SEBA 3C6LD 2ZX8A 3N44B 4NC2B 4NQSA 4YDNA 1QR4A 5ALCH 5C0AE 1AMXA 1XSKA 2HFEB 4WF7A 2IQ9L 3QWRA 5I1DB 4OJDH 3CK0H 1PCXA 4WWKC 2VLJE 3LNFA 4W9IC 4Z76B 4PJGF 3EJQA 3V52H 3KD4A 5D7HA 3SBRA 3SKJL 3LIZA 1V5JA 2OKMA 5H4YA 4G5AA 3V6OC 3V55A 1PKOA 5F6HI 4RNRA 4NBXB 4GS7C 4YHYC 1J9QA 5JTWA 3AFLA 2B1HL 4LSTH 4PJ8B 3ROOA 4HLZG 4Q2ZB 4XX1G 4UV7L 5HY9B 2VWEE 3DMMA 3L3OA 2APWA 3W37A 5FECA 3X3GH 2FTAA 2XQ0A 3R7QA 3VM7A 1T4KB 3QCUL 4UIMB 4Q14A 3QJZA 4D0BB 1IGTA 4LKXB 4WZ9A 1EO7A 3RRQA 3MV8D 4L0PB 3E80A 4S1DC 5SWZA 2UVEA 1JHLH 1EGJA 1NC4D 4HZAA 4LEEA 5D1ZI 2GSMB 3FTYA 5A6MA 1EDQA 2WLIA 2BIMA 4JR9H 5B3JF 4WIQA 1W72L 4R4ND 5I71B 2CA3A 1ES0B 1L9NA 3KPLA 1XGRB 1UYWL 1F3RB 2VDQB 4EEEA 2WO4A 2AQ2A 3DGGA 1F3DJ 1NCIA 3KPOA 3VWJD 1PQZB 1S9YA 2WWMD 1HE8A 1GIGL 1U8JB 3OMNB 4MJIB 4L0ZA 3ISRA 5FFLA 1MRDL 2V2XB 2F1AA 2LT9A 5FYLE 5BV7B 3ULUC 2EXWD 3SQOH 4ZO8A 2XXCB 3MRCA 1HSBB 3TFKC 2HRPL 1GA2A 3RL1B 3MLYH 3FT3A 4MXVE 3W2DH 4AUYA 5AENA 5E08H 2WTRB 5B4MC 3L1OL 4K7FB 1GS8A 3IKCA 2CXKA 4GNKB 5DS8A 1MRFH 1KF9B 1TOXA 2N0MA 2R56H 2X5PA 3ALWA 3GO1L 1P84J 4I7ZC 2TRHA 4F2EA 3STLA 5C9KA 3RDTA 4LARH 3ULVC 1NANI 4M3HA 1AXSB 4LVOC 2CUMA 1G7PB 4MB5A 5DZ9A 3VDCA 4JFQA 4APQB 4PWFA 1VRSA 2YK1L 1U8CA 2H26B 2VDRB 1IC7L 2H32H 1MG3C 2OQJB 4BRJA 1CBVL 5EIVA 3DURA 4L18A 2VTFA 3DK0A 2DWSA 3B8SA 4AYMC 5GGUB 4LE8A 1O9WA 3P54A 4YNYA 4KQ3L 4Z1PA 2FGZA 3OAZK 3RLSA 4LCIL 2DWEA 3E2HC 1XZ0A 1DJWA 3C5JA 1A6UH 2B1AL 3MV9A 3OMAB 3B4NA 3ARYA 1UOLA 3QRGH 3B7RL 3UBFA 3PHQB 2CG9X 5L4IA 2Q8BH 4YSSA 3Q01A 4MMZB 1DFBH 2AQTA 2Q86A 2YGPA 4FMFA 2ZYHA 2ZOTA 3A47A 2K1MA 3AG4B 1TSRA 3MGTB 4WCYH 3EYUH 3C6LB 3ARDC 2F53A 3BGMB 3QCTH 4AMKH 1MG2C 4FMKA 3LKRA 3B83A 2E6JA 1DUZB 4P06A 2UWEE 5J11C 3P1VA 2AGJH 2CJUL 3BZDA 4E5XB 5ICYB 2X9YA 2ORBH 5E1AA 2OMZA 2GJ6E 2VN4A 2EH8L 4ABUA 4FTVD 5E24E 3P73B 4X6CA 3UERA 4IRZH 5EORL 4N8VA 5DEFA 2OI9C 3O2WH 4R0LB 2ATPB 5CCGE 2IG2L 3WG7B 4OCNC 5H37H 4PJGB 4J8RB 4I0PB 1MPAH 4OCWL 2FUTA 4XP4L 3FCTB 4OZIA 4HAFA 2JJSA 3OGCA 4NRZB 4YDJB 5FYKH 3B37A 1ZGLA 3IWUA 3G6DL 2ZWYA 3GK8H 2BMKA 1G0YR 3ABLB 4ENZA 3CD4A 2FR4A 1Z3GL 4ZOCA 3MRFB 3QK0A 1P2CA 4N2KA 4UT9A 1ESOA 2CLZA 5DXWA 2OULB 2PR9A 4DESA 3NAAH 1F2QA 1VGEH 1KIUA 3EH1A 4NCC1 5F7DA 4ECNA 2OJ1A 3MV8B 5KJ7E 1NC4B 1WC7A 1PW3A 3FT4B 4M1CC 4CUCA 4U6HA 3EFOA 2NT1A 1QFWM 4KDWA 3SKOB 4XP1H 5I15L 4WFEE 3EZJB 2F58L 6TAAA 3VWKC 3IGAA 3S3CB 2BVUA 5ESQA 1GS6X 5HJDA 3QJFB 1FAIH 2H2PD 2HN7B 3ZHKA 2EVGA 3QPXH 2E59A 4J6IA 4MJ5A 4NI3A 2V3FA 3VWJB 3JZYA 2AP2A 3MGAA 5F9WC 1HCVA 2EH7L 3BH8B 2Y36L 3V4VL 1MHPL 4ZTPH 3U30C 2VDMB 4ENEC 2XZAL 5LLIC 5CWSA 5CUSH 2D2CC 1V55B 5J6GA 2I5YL 3A6BH 3I6KA 3D1MC 1OGSA 1KCBA 3EDJA 4N2HA 5CP7B 3HZKB 2WJ7A 3BT2L 3O6FC 3SOTA 5BNXD 3MA7B 1MFNA 5D6CB 1QZNA 5MP6H 4QTFA 3GLAA 3S3PA 1K4DB 1CE1L 3UOAB 1VACA 5CKAA 1KV3A 5AW9B 3TF7C 4NZUH 1XMWA 2YAQA 5SV4A 1FL5B 3FB6B 3LPFA 1DQLL 4O58H 1KWKA 3QUXA 2WV3A 3ARGD 1T6WA 5GRUL 5FWQA 3U36A 1ZLEA 4RISL 1OD9A 2VT0A 4XCCH 1AGCA 2AJZB 4XVJH 4IK6A 5KSBA 4HBQA 2CCLA 4MA7L 1S2EA 4ZMWA 3BEVB 1K3IA 3PJLA 4JFPA 4OUOA 4R90H 1D9KA 1AGFA 3TESA 2HLFC 3TTYA 3VD2A 2ARWA 4A39A 4JFDD 3T6QC 4QOKA 1HKLH 1LGVA 3B3BA 3CX5K 4FQQA 1OO2A 4LDLB 4KXBA 4OV6F 1KTLB 3MR9A 5EOTA 3R8BB 1IKFL 3KEDA 4N1HB 4B9FA 4FZ8L 2YRBA 1J7VR 2NR6D 2DWDA 4JJOA 4LVNB 4ATWA 1SJXA 1YY8B 1HS6A 4P2QB 1UD6A 2R4SL 1PG7X 3CU1A 5HI3D 2FX8H 1YNTA 2J43A 5TPWL 4ZX6A 3S0PA 2VLKE 3PHOB 3F64A 4HC1A 3ZPDA 4S2SA 3CN4A 1JBJA 1N6UA 2NUTB 3M17A 3OLEA 4TUUA 2W95A 5D1XE 5IBUB 4UOJA 1AGBB 2GJRA 2VDNL 1MHCA 3LNEA 2Y5QA 4FJ6A 1JNHA 3ULVE 1D6VH 2VL5B 1V05A 3RVXC 2BVOB 4XMLH 2QHRL 3FUKA 4WTZA 1DUYB 3LXUX 4DQAA 4XC3H 2J5LB 5HI5D 3VXME 4Q6YA 3OD3A 1NDMB 2Z8SA 4YUEL 2PCPA 3A6CL 3AT0A 1OAXL 4BELD 5L2KE 3DTXA 4NC1C 1YYMH 4KVNH 4FXTA 3M07A 3O9WC 1JCVA 1X6LA 3LS4L 4X7SH 3FQ4A 4B60A 2YQBA 2O5ZL 5I8OH 1BZ9A 1MVUB 2ATKB 3WNPA 5CFHA 5A43C 2B3RA 3RWCA 2ADYA 3GSOB 2X28A 4LCUA 1OP4A 1U93B 1N7MH 3MA9H 2X1QA 5T3ZH 2CIIB 4M48L 1OAZH 4QKXB 1BYOA 2H47C 1PZ2A 2A1WL 2YXMA 1DBBL 3ABMB 4WV1C 5KSAC 1OCZB 5FO2A 1P4BL 3AS0A 1IGFH 3I75B 1K3ZA 1ZWIB 4KRMB 4Y2DA 4HIJB 4ODHL 1I3RA 1QSFA 3TV3H 1HJCA 4KDTC 1EHLH 1VADB 5FS5A 2DKUA 5HBBA 4OZ4A 5D4IA 1CLOH 3IMBA 5E8DL 4PSPA 3DDGA 5AD0A 1N0LB 5DJYB 3QQ4B 2LR4A 1U8MB 4JPVL 4XBPB 2GUOA 2VISB 5JIPA 4XNQB 5INDA 3UPCA 4JUSA 2ZXDA 2AMUA 2HSIA 3QNXB 3GT6A 2P3YA 3PV6A 4N0UE 4PGEB 4B9KC 2X4QA 2DL2A 4DAGH 2O5XH 5I75B 3E0GA 2P5WA 3EO9H 1S7QA 1KCRL 2YXVA 3GQFA 3MXVH 1BW8A 4PGDA 3RB5A 2DQUH 2X4UA 1E4KC 4R7DB 3UG4A 1W72B 3FQUA 2IADA 1VCAA 1A6PA 4TS6A 5IEHA 5J1AB 3D87B 4RFNC 1YRKA 2X6UA 4UNUA 1A3RH 1N12A 2X38A 3O3DA 2FQEA 3VU1A 4G9DA 4Y5YA 3AY4A 5CCKL 2PXYB 3KL5A 1UVQA 2WVTA 1XR9A 1U3YA 2J8UE 2NY1C 4L4TA 5BMFH 3BLPX 4OV5A 3D4CA 3P30L 4IGBC 5D7LA 2NQCA 3X11B 1GHFH 3KWUA 4ZTOH 5AKVA 3BKYH 2Y2WA 2EKSA 5ANHA 3TT1H 3L8QA 2OXHB 1KCVH 3NP3A 2CJTA 1VFOA 3V5DB 2CK2A 4JFDB 5E8NB 1BFVH 3ATBA 1MIEL 1ZHKA 4JFFD 1SOQA 3GDCA 4NT6A 3JUYA 2Z8VC 3LHPH 4L9LB 4WU5A 3SGJC 2YWZA 2ZP8A 4YHKH 1TKWA 3WEXA 4D9QE 3QVAA 2YPVA 2MMXA 1RY7B 2G2NA 5HGBA 5LCVA 2DJMA 3FBQA 1L7IH 5DLLA 1MFDH 2VL4A 3ILDA 4GMTL 4ZMQA 3ZT5A 4Y2LA 1T89C 1EBPA 2FL5A 2VZ1A 3H6AA 4RMTA 2VXQH 4OM0L 4AQ1A 8FABB 1T0NB 5KVGH 1R3LA 4NAMA 4Z7WF 2NPLX 4KMLB 3VQ2C 3BHBA 2OXGA 3QIBA 4GBXB 5EPMA 2YAHA 5F89B 1IGJB 2OX5A 3P9LA 3PGCB 2E4FA 3DOSB 2FJFB 2VIRA 3KDMB 3KPTA 3SJVD 3LN4A 3PDGA 4FQ2H 1JV5B 4QEGA 1OWWA 4O4YL 3FL7A 2YD5A 4AYGA 4D7PA 4P46A 1MUJA 4MQXC 3ABZA 4QRFA 5LO7A 1NEPA 1FORL 1KJMB 5C0AD 4H1LH 3LIZL 3L9YA 1OF0A 4FLHA 3SDAD 1YYLL 3OL2A 5E03A 3BPOB 4Z7QE 1MI5E 3N42B 4TOYH 4HJSA 4I3SH 5CZRA 4NAJA 3CWGA 2CHWA 2JV6A 3C5SB 3E8UH 5GS0L 1BVOA 1DCLA 2IALB 4M5ZL 5IFJA 4PS4L 4LGSB 5CMAB 2HZHA 3RFZC 2X6CA 1W0VA 3BSZA 1A1NB 3A4FA 2MOGA 3S4SB 1WZ1L 2NUPA 4XMWA 4BSWA 1TJXA 3KLLA 2CHXA 3IFPB 4C4BA 4E0RB 1EGJL 1OT1A 3KYNA 1NAMA 2BSRB 2JFCA 3VSTA 2HT4D 1U8LA 4H25A 2PO6A 3G08A 4NN7B 3BIKB 1MF2L 1FO0B 5AZ2L 1JYXA 3KEHA 3WDIA 3DX8B 2DD8L 3NOIA 4TPRH 3GUFA 4UNIA 1D3CA 1ODUA 2NXZB 3ABKB 3LQZA 5AKRA 5I8EB 4JDVB 3QQDB 1TTFA 1JZDC 3CBRA 3OKYA 5TF0A 5C1MB 2DTML 5AZEL 4F8NA 4ELMA 1OW0A 4XO4A 1DBJH 1GGIL 1IAKB 1ZOXA 2P8LB 4L4VB 4UMSA 3UJIL 4AOFA 5AB9A 2X4RB 1LVEA 2XWZA 4KI1A 5HVHB 4E41B 1G6RH 1I1CA 4BH8B 4XNUH 1IAOA 2NCMA 3C12A 1WA0X 5GGTH 2FE0A 3EYVA 3RNQA 2P7TA 1DQJB 1XIWB 2ZUSA 3HE6A 4NDMA 3V4VB 1OARH 3GKWL 5TTRA 3JZ7A 4NWTH 4NJ9H 1JF1A 1ND0B 4JRXD 4NOFA 3DUUB 4Q74A 1E9OB 2GTQA 2FYYB 4AITA 2O5YL 4KVPA 1CO1A 1PDKA 4W4OA 4KKQA 3DX4A 3QRFM 2PW1A 2CRZA 4G1EB 2EQDA 4DUWA 4JZJC 1MH5B 4PN6A 1Y7VA 3X17A 2ZSVA 4L4TE 4IOFC 1QVOA 2QKIC 1DQQB 5C7XL 2VSCA 2W9DH 2E56A 3H3PL 4G1MB 1DQDH 3SY6A 3DHUA 1B2YA 1WLHA 4LPVA 1TQSA 3ZK0A 3K72A 4IBWA 2CKBL 4N2CA 3UTOA 1RK1B 4BFEA 4DP7X 1LHZA 1H5BB 5D1ZD 1MVFA 2PKDA 1CZ8H 4KXCA 4ODVH 1DCEA 4PRDA 1JN6B 4FAAB 4QIRA 2D7QA 3WHE0 3LEVH 3I6GB 3VRJB 4Z7WB 2QBWA 1NGYA 5SWSE 3HZYB 3SJVB 4W9CC 1X7SA 2V33A 3NTCH 1UZ8A 2HRGA 4XHQA 2YQ3A 1RULL 3QCVL 1WJ3A 2RR3A 4FFYH 4HS3B 3BP4A 1I7ZA 1B9ZA 4U3SA 1HILB 5EU6E 2VDNB 3LRHA 3PWPA 1G4RA 3UZQA 3VFSA 3S7GA 1K5WA 4KRPC 3SDAB 2EDHA 3B5TA 3RTQD 2PYEB 2VCOA 3CAFA 3OAYK 3OZ9L 2GI7A 3DHMA 3B9KC 4PJIE 2J1XA 1AO7A 3L3IA 3ZDZB 4W1TA 2A9NL 1AIFA 3FUMA 3HAEA 3SIKA 2WXFA 5AL8A 3SDCA 1V3LA 1I9RH 4YHLL 5IFAL 3FFCE 4NZFA 4BKSC 1HHHB 4IIQA 3MNWB 2YHGA 5IROC 2MCPL 4XH2A 4RVBA 1E30A 4UDTA 4M93B 4U1GC 1QTPA 3L3DA 1TR7A 4HIHA 3TJEL 5BVJA 4FFZA 2A9CA 1G4MA 4JHAL 2EO7A 2Q8AL 4HCRH 3H3KA 2YO3A 5D5MB 1KN2H 4LO9A 1KV7A 2XPGB 5BS0A 3RX9A 2IBZY 2E9IA 5GXBB 4TUJA 4H4NA 1G7LA 4EIUA 5GS0D 3DMMD 3TP4A 5I9QB 3R8QA 1IGYB 5TK4A 3VRIB 5DMKB 3LRKA 1P7BA 2ZUQC 1JHKL 2ITCA 4EI0A 4FFVD 5IP4A 4MA3A 5AAMC 4M61A 1GSMA