2GC7C

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 26
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc7C00
2ZOOA 3CVCA 2IWKA 1AZBA 1WAEA 2J56A 1NWOA 1NZRA 3UADA 1J9TA 3QJQB 1X9UA 1IUZA 1ZDQA 2P80A 2VM4A 3T6ZA 5I5IA 1IBZA 4YSDA 1L9QA 1PLAA 1AACA 3NP3A 4W1TA 5I5MA 2YAPA 3X1GA 2DYSB 3DKHA 2YARA 3CDZB 1GS6X 1TU2A 3CG8A 3NJNA 4DP7X 1PMYA 1E65A 2VSMB 1TKWA 4L0PB 1BQRA 4F2EA 2IDSA 1ZDSA 4EF3A 2N0MA 3WG7B 3NSCA 4A2FA 6PAZA 1NIBA 4KO9A 1ET5A 2J5WA 2BWDA 2XLLA 4PAZA 3QJRB 1XB3A 1DYZA 2AFNA 2UXGA 3WIAA 4GP4B 1QHQA 1KDJA 5D4HA 4BXVA 1N68A 4YSUA 1NIFA 1SJMA 2UXVA 3TASA 1CURA 5I6MA 2TSBA 1AR1B 3UACA 2HX9A 4FA7B 2CALA 3OD3A 2HRHA 2IDUA 2GIMA 5B7EA 1XB8A 4GXFA 2AVFA 4BDVA 1AS8A 1BAWA 1OV8A 6PCYA 7PCYA 2BP0A 1JZEA 2OCCB 1L9TA 2HLEB 1AG0A 1ADWA 2BZCA 1AAJA 4HAKA 3T9WA 3BVDB 1E5ZA 2HRGA 4GYBA 1JXGA 4RH4A 1PZCA 3PAZA 3TU6A 1GY2A 3WI9A 3NSDA 1JZFA 1OCCB 2XYBA 3KW8A 1AS7A 5B3SB 1GR7A 3JTBA 2PLTA 1W6LA 1ASQA 4YSTA 3FQ2A 2PPCA 2X88A 4F2FA 4QLWA 1OCRB 2B3IA 3ABKB 1PY0A 3UAEA 1M9WA 3FQYA 1NICA 1JERA 2EIMB 3KW7A 2W88A 3RYMA 1BXUA 2FT6A 2WSDA 3IBOA 1EHKB 2H5UA 2QDVA 1SF5A 1ASOA 4YSSA 1NDTA 1ZIBA 1TEGA 3D12B 8PAZA 1PZAA 2FT8A 3H4FA 4HCFA 4TXVB 2FNWA 3CZUB 2WO3B 2JXMA 3T6WA 3HEIB 1KDIA 1MZYA 3UAAA 2QPEB 4AX3A 2IH9A 3FU8A 1PCSA 2XUWA 4HCGA 3SBPA 1ET7A 3WKQA 1QLEB 3NSYA 3DTUB 4E9SA 3IN0A 2Q5BA 1CYXA 1ZIAA 4AKOA 1FFTB 1OCOB 1GW0A 5PAZA 1KBWA 4Q89A 4E9TA 4AI7A 5F7AA 4BK5C 2XV3A 2DWTA 3NJGA 4G72B 4WKXA 3PXLA 3N55A 4YSOA 2EIJB 2W8CA 1RKRA 1SDDB 5D4IA 3OMAB 1OCZB 3FT0A 2A3TA 3S8FB 1ETJA 1V10A 5I6KA 1L9SA 4DPBX 4G7RB 4HALA 2ZONA 1JZHA 1V54B 3NYKA 4HZ1A 4E9YA 4K9JA 2BW4A 1A4AA 4A2HA 4AZUA 4A68A 2XU9A 1I53A 1J5DA 4KO5A 1J9RA 4W9ZA 4JKNA 2WO2B 2BP8B 4HHGA 5B7MA 1XB6A 4YVUA 1WS8A 1PAZA 1ASPA 3AG2B 3ZIYA 3MBWB 1A8ZA 3OMIB 3AW5A 2HX7A 3DIVA 3EF4A 2VM3A 2GHZA 1M56B 3AG1B 1ET8A 4YL4A 4GP8B 3CVDA 2XX1A 4E9XA 2XXGA 3X1NA 2DWSA 2E86A 2VSKB 1NIDA 1NTDA 3WKPA 3AG4B 5AZUA 2XV0A 5F7BA 1J9SA 1BQKA 4E9QA 1AANA 1J9QA 1EZLA 2FQGA 2R7EA 4UF7C 2BWIA 5I6PA 2AZUA 3NJKA 1L9OA 5AKRA 1KV7A 3FU7A 1A4CA 1WA0X 2UXTA 5IY5B 1PNCA 1SFDA 2UXFA 3FQ1A 1PLCA 1IC0A 2GI0A 1RCYA 3GDCA 2CJ3A 1OE1A 1A65A 5AFAA 1GYCA 2QDWA 2YAOA 1SF3A 4DP1X 4YSQA 4YSRA 2GB2A 2YAFA 2QT6A 4KNSA 3TA4D 1OE2A 1BXVA 2OJ1A 4JHVA 2BZ7A 2CCWA 1KCWA 2GC7C 3IE9A 2GSMB 4QKTA 4P5RA 2DY2A 1OF0A 3QJTB 3S8GB 1FWXA 1UATA 2ZXWB 3S3BB 3QJSB 1TEFA 3V9EA 3PLYA 4G7SB 2LLNA 4M3HA 1A3ZA 1R1CA 4F7KA 5I6OA 2QPDB 1HAWA 1B3IA 2Q9OA 1J5CA 1JXFA 3NT0A 3EH4B 4NB7A 2PCYA 1SFHA 1FA4A 2FTAA 2J57A 2VMJA 1PF3A 4CSZA 4DP9X 3QQXA 3QJUB 2XX0A 1HFUA 1KBVA 4NAJA 3FYEB 5I28A 1GSKA 4ZK8A 3BQVA 1YLBB 5PCYA 1URIA 1DZ0A 2YQBA 1E67A 3X2QB 2Y1AA 1JVOA 1CC3A 2HXAA 4HIPA 2XXFA 4A2EA 4DP0X 4DPAX 1BEXA 4BDVB 1ID2A 2UX6A 1ZV2A 1OE3A 2VN3A 2BP0B 5EHFA 4A2DA 4N4YB 4ENZA 1T5KA 2FQEA 2FQFA 3ABMB 2H3XC 2DV6A 3CDZA 4DP5X 1GY1A 3IEAA 4Q8BA 3NJMA 1CYWA 4DP4X 3AY2A 1AQ8A 2FJSA 4KO6A 2BHFA 3NSFA 2IDQA 1JXDA 1AIZA 3FSWA 3OM3B 3PPSA 3QPKA 5TK4A 2FWLB 3ZDWA 3L45A 3NJHA 2PPEA 3HB3B 2BW5A 2YXWA 9PCYA 2XVBA 1WS7A 4BWWA 3NJIA 2PP9A 4KOBA 2UX7A 1AZCA 1BYPA 4G7QB 4A67A 1JZJA 2GBAA 5I5JA 3T71A 2EILB 4DP8X 1NIEA 3X1FA 2FT7A 2H47C 1RZQA 4P5SA 1MG2C 3ZX1A 3PAUA 3G5WA 4JHUA 5I26A 2HZHA 1WA2X 4A2GA 4GY4A 1AS6A 2PP8A 5B1AB 4KOCA 1NINA 1AZRA 3ASOB 4CSPA 2PP7A 1SHWA 1BXAA 1NPJA 4YSEA 2HX8A 2XV2A 2Y69B 3H4HA 1BQ5A 1RZPA 3T6XA 2X87A 3FS9A 3NP4A 5A7EA 2AANA 1AZNA 3NJJA 3OQRA 4HCIA 2IWEA 4PCYA 2IWFA 4UANA 2JFCA 4YSPA 1QNIA 2VW4A 3T6VA 2VW7A 3GYRA 1KCBA 3SBQA 2ZWNA 2MRYA 3CVBA 2PCFA 1IKOP 1XMEB 5D4JA 4BXSV 3OMNB 1WA1X 3FSZA 1X9RA 1V55B 2EINB 1MDAA 3MX0B 4FAAB 1PLBA 3EH3B 3TBCA 1ILUA 1JVLA 3S3DB 5I6LA 1JZGA 1ILSA 2YAMA 1VLXA 1HAUA 1N70A 1W8EA 3SBRA 5B1KA 2I7OA 4AKQA 4BWTA 1L9PA 3AZUA 4G71B 1M57B 3NJFA 4YSCA 3FPXA 4UAHA 5B1JA 5ANHA 2TSAA 4HHWA 5E9NA 2GC4C 2PPFA 3WNJA 1A4BA 3X1EA 4YVNA 2NRDA 4X4KA 3V9CA 4E9VA 2IDFA 3GXUB 3TBBA 1F56A 1W6WA 1KYAA 3FPYA 1OOWA 1E5YA 1PZBA 3EHBB 3H56A 2I85A 4WTQA 4A66A 4GP5B 1E30A 2PPDA 3UABA 2YAEA 1ZPUA 4KNUA 2R7EB 4NERA 4DP2X 1GS8A 4M4RB 2IDTA 2P80D 7PAZA 1GS7A 1JOIA 3PCYA 1SDDA 3ZBMA 2I7SA 3FU7B 5I6NA 4KO7A 1NPNA 1NIAA 4DP6X 3PAVA 2XWZA 3C75A 5FC9A 2PPAA 4E9RA 3ERXA 2YAQA 5TK2A 2CUAA 4G70B 3X1BA 1NWPA 2EIKB 2IAAC 1SHXA 2YAHA 3NJLA 5B1BB 2BP8A 4N8UA 4MFHA 3EH5B 2RACA 5LDUA 2CBPA 1AOZA 2MTAA 1AZUA 1MZZA 3IN2A 1JZIA 5B1JC 3SQRA 3S3CB 1L9RA 3FYIB 1SNRA 4YSAA 3ABGA 2B08A 4BWUA 3FU9A 2VW6A 1KGYE 1PNDA 4AKPA 1BYOA 3ASNB 2JKWA 2BO0A 2OV0A 3UGEA 2J55A 3WNIA 2FQDA 3ABLB 2IH8A 3U25A 1IBYA 1CUOA 1MG3C 1AG6A 2DYRB 2AZAA 3FSVA 3FSAA 2YXVA 3QJVB 4E9WA 4KNTA 2CAKA 3JT2A 3N2JA 5B7FA 3AG3B 4DPCX
chains in the Genus database with same CATH superfamily
3CVCA 2NNXA 3T3PB 4DF9A 5KVGH 3GHPA 2WZ6A 1XF3B 2E7LC 3ZY7A 1LJMA 5AVZB 5FCUL 4YZFE 4B9YA 4X9GA 4QI3A 2BINA 4M6OH 1L9QA 1GOHA 4AQZA 2DQDL 1AACA 2D7QA 1I31A 3O9WA 4TVSa 1NL0H 2YFNA 4XPAH 3EBIA 3QIWD 4LVOC 4LLQB 5AB0A 1J11A 1OTSD 3RWJB 1TYEB 4E42B 5FEBA 2OW7A 1JWSB 4FXKB 4NZRH 5E6ID 5GRUL 3BPNB 3PNWB 4AGLA 1SOQA 1F8TL 4KQ4H 2I60H 3MRGA 5KS9B 4K7PX 3RVXC 1JNHA 4X99B 5MP6H 5IW1A 2FO1A 3ULSB 1QEWA 3FQ4A 5MERB 1F6FB 3GK8L 1BZ9B 5JHLH 3HZMA 1DDHB 1RI8A 4QPEA 5I82A 1DZBA 5I6XC 4F33B 2EE3A 2WNKA 4GP4B 3AGVA 1SOSA 4OI9A 4Z3JA 2K70A 4OIBA 3VVWA 3R06B 1T1ZB 3D9AL 2F9BT 1U9KA 1UWYA 4L1BA 1LO4L 4F57H 3NCCB 1DQDL 1OLZA 2HJLA 2YGNA 3PJSA 4XAWL 3J07A 4M48L 2EDMA 2WQWA 1R5WB 5IF0B 2VO5A 3APDA 1KELH 4TQPA 5E2VL 2MCG1 1P1VA 5CZVL 2W9EH 2XQYK 4LARH 4QRPD 4OD1H 1JFQL 2PW2B 3O6FD 1NCBH 1U33A 4JO3L 2KDGA 4Z77A 5I1LA 5FXCH 5I8OH 5LXGH 1YEHH 3REVB 1LP9E 3BIKA 4POUB 4Q0XL 2B9BA 2HLEB 4MAUL 4TNWF 5FCUH 4XXCA 2E9WA 1T0MA 4Y4FB 1UM4L 2YMXH 2N7BA 3U2JA 1BAFL 2DQDH 4R7XA 3MLYH 4XC3L 4OGAD 2DD8L 2A6JB 1GJIA 1CT8B 1KYUA 3F62A 3P9MB 3HG0A 2PWGA 4IK7A 4X6DB 3JTBA 3QZPA 2BNRE 1E4HA 4X8CA 2X88A 1LEIB 3AXLA 1UTDA 3QIWA 1F8TH 4PP1C 5FO9B 2BP5M 1NICA 1DVQA 2W88A 2G9KA 4XPHL 5E6IA 4WJKB 3QULB 1EO8L 1PEZA 3T8XA 5J6HA 3Q7JA 1I8IA 3CFEA 1YMHA 4KRPD 1A6AB 1P5VA 5ENWA 2VLJB 2AW2A 5JNYB 1JF6A 3HG1D 3S34L 3D9AH 1DLHB 1Q0EA 3QUZA 1DQDH 1CGSH 4XAWH 1U8NB 2GW5A 4M48H 3UTQA 4KMQA 5E2VH 3SPVA 2FSEB 5EIIA 5KSAC 5CZVH 3EBGA 2AK4D 1CYXA 1UT2A 3FQUA 4JO3H 1YJDC 4MRBA 4XO9A 2ATKB 2K6YA 4P3DA 5GSRA 4RETB 2HP4A 5H35B 1FHNA 2HFFA 4P9HC 1NAMB 2DRUA 2CHNA 4OF7A 4QKXB 4QRPA 1LD9B 2ZKYA 3MLRL 3NG5A 4MAUH 3O6FA 1VEOA 2WTRB 1UM4H 4AI7A 1UVQB 2BVOA 4Y9FA 3G6JF 1CD1A 1BAFH 2E6PA 2HA1A 5D72L 5DVPA 1AE6L 1IAKB 2QKIA 3HB3C 4Q7DA 4KKAC 1HQ4A 1XL4A 1K72A 1TMQA 4N0CD 4JJ5B 5H94B 4D0DA 1SJHA 2VL5A 4KAQL 1JPSL 2BVYA 2W0FA 3EOAB 3JWOL 3MJ9L 5SX4H 1I8LC 4LRIA 3S5LG 5FB8A 1DBAL 1N0LA 5F6HI 3N42F 3ISWA 4KZ0A 4XPHH 4PREB 3RWIA 3LZNA 1JNNH 3KLSA 4NWTL 4L8DA 2CCLA 2WNXA 4W9ZA 4NENB 4FE9A 3CZLA 4OGQC 3HZKB 4RAVA 4HHGA 2B5IC 4JDZA 4MJ5B 4M61B 2P3YA 3DX2A 1ROCA 1CXEA 4IBQA 1AKJB 1SEQL 3W9EA 4UZGA 2KZKA 3RQ3A 3S34H 3VRIA 2J21A 1D2OA 3I6LD 1I3UA 2I07A 3PAYA 4LCWD 4GRWH 4Z7UB 4ISVB 2YD1A 5FKAB 3VFGH 1IZKA 3G5YA 3BEVB 2WXHA 2FECI 3HG1A 3M8OH 5ADOL 1LEGA 5E4AA 5TQ0L 4HOMA 4NBYB 4XO4A 4BKTC 1Z66A 2GITB 2JCCB 2PMZA 2FQGA 3II2A 4AQ1A 4BCYA 4UF7C 4LSTL 4YDLC 4XGZA 2YUWA 3MLRH 2AK4A 4Z18A 3ZDZF 1KFGA 2M8XA 1QBLL 2AABL 5D6DC 3BUDA 1LO0L 4YR6A 2BCMA 2ZWZA 2EZ0C 4QF1B 4BFIA 1CWVA 4JY6B 4P57B 1AE6H 2DJ4A 4IMKA 5D1QD 3ETBF 2JWYA 3S3JA 5JMOC 2W65A 3D0LA 2CIKA 2QT6A 1XD1A 4KAQH 2XG4A 1JPSH 3VXPA 3JWOH 3MJ9H 4F80A 5I30L 4ZNCD 2WLNA 4R2GB 4F27A 3O9WB 1DBAH 4Y4HD 3LVTA 4X4YB 1IT9L 4OM1H 4ZUSB 4BBWA 1YAZA 3LHAA 2QMJA 5E7FA 1R9FA 2F0CA 3DV6A 3LDBB 1HDMA 3GC3A 3ULUE 1HEJC 2QPDB 3MRGB 1SEQH 4XODA 1JNHB 1U3HC 1QEWB 1A8JH 2J1XA 3FF7A 3HZMB 4HJEA 2CO2A 3V95A 2ED9A 4HBCL 3BDBA 5ADOH 3UGUA 4LCWA 3SDAC 1TEYA 1FGVL 4BIKA 3DYOA 3I3EA 3ASWA 4LSTH 1J8KA 3PJSB 2HJLB 4B97A 2AABH 2WTOA 1LO0H 3DX1A 1E2VA 1TQBC 2CMRL 3QDJD 2P26A 5CR1A 1NCWL 5FLUA 5G55A 3IF1A 1QSFE 4JG0L 4Z77B 2IPKA 2V2XA 5I1LB 3AY4C 1U6AL 4HUVA 4EI5D 1T5KA 3FB8A 5D55A 5GZOC 4C4KO 3BIKB 3FUDA 5EA0L 1VKXA 2NUTA 2CXKA 3ETTA 1GGUA 1T0MB 1T0NA 5D1QA 1DQKA 4N8VA 4P2YA 5I30H 3O4OB 3GXTA 1IARB 1ZCRA 4LSUL 4WENB 1IT9H 1UADC 4NN6C 1KTKE 3RVUD 4XTRC 1X5FA 5T5NG 4FXGC 3O2DL 2BW5A 4Y4HA 3TEZA 3AXLB 3U9UA 3QIWB 4MWFA 4FTDA 5EBMA 4A67A 2Z93A 3ISYA 5FPIA 3MZTA 1I7ZB 1NGYA 3NRFA 2WXLA 4GJTB 5E6IB 2EILB 5AW0B 3SIKA 4R7NA 5KANI 3BP5A 2A1WH 3PJNA 4L1TA 3T8XB 1TO4A 1I8IB 3N1FC 3CVHB 4GFTB 1DCLA 3CFEB 1YMHB 4JHUA 4HBCH 2YZ8A 5ENWB 1OPGL 1FGVH 3BZEB 3G6JA 1TTFA 2N7AA 3ZU8A 2ZZUT 1BXAA 2QGBA 3UZEC 4I9WE 4MA7L 4MD5A 4AJVA 2WWMC 3H4HA 5GQBA 3QC6X 4DK6A 3UTQB 3IT8D 1G7MB 3L9RA 3SPVB 5EIIB 4MVBC 1NCWH 4UYQA 3JQOB 1J8RA 4LSPL 4JG0H 2NY6C 3FQUB 3KZ8A 1S46A 3EXJA 4P3DB 5HDWA 5GSRB 3BD5A 4F2MA 2HFFB 2FHCA 5EA0H 3O2DA 1JCVA 4QRPB 4GXUN 3O6FB 1XCWA 2BVOB 2GBUA 2WANA 1CD1B 2MKWA 3IJSA 2QADC 3H2WA 2CLVB 3ARBD 4EI5A 4HK0A 4NO3A 2MCAA 1KCKA 4JRFA 3V0DA 3DDGA 2JSFA 4J6IA 1NGQH 2QKIB 3X12A 1HQ4B 1A14L 4WHTB 3DVNB 1K6QL 4TPRL 5D7JC 4D0DB 5GGUB 3B2DC 2A4CA 1X9LA 1SJHB 2A0LD 5DFAA 2K0RA 5F9WC 3EH3B 2VL5B 4HV8A 5I6LA 5B39B 3PWVA 4HUCA 1ILSA 4X50A 2W0FB 5DHVH 3CHPA 5EBWA 4OI8A 1OF2A 2CRIA 1JCKA 1O7SA 4PJ8C 1KUMA 5FB8B 5I1GH 1N0LB 3GXPA 5B1KA 2YD0A 5IOPA 3RWIB 4L8DB 1X4XA 4G71B 4KKPA 2A6KB 2P8LB 4IIQC 4RAVB 4UWQB 3PYCA 3O4LD 1UFGA 4S1RH 1G4MA 4JDZB 5ANHA 2OK0L 2PPFA 4FFWD 1OPGH 3KPMB 1TZOA 5HPOA 3DO7A 2C9VA 3W9EB 2IOIA 2V3FA 3VRIB 3V9CA 3OB0K 1GPOL 4KRPB 2B39A 2WWKO 4LP4A 2C4FT 4KKZA 3RG1C 4MA7H 3G5YB 1E4JA 3HG1B 1QPPA 5T3ZD 3Q05A 4LSPH 1LEGB 1JTTA 2EABA 2GCYA 3LS5L 4Y0GA 2LOEA 2YAEA 1SN5A 2FH6A 4HEME 3L81A 4X8XA 5DYFA 4AQ1B 2VLRE 4JZJA 1E8XA 4I13B 1Z5LA 3O2WH 4XGZB 2G4EA 2AK4B 4GT0A 3IPFA 4JM4L 2RAMA 3LRLA 1YY9C 4H1LA 4YR6B 4BFIB 5TPWL 1NCUA 3GZOA 1TENA 1A14H 5I16A 4KXDA 1K6QH 4TPRH 4WWKC 3ARBA 4CBZA 3MQIA 2DN7A 1Q9KA 5T3ZL 4Z7NF 2K7QA 5FW6A 2W65B 3D0LB 3FO9A 4MZ2A 2CIKB 5B1BB 2XG4B 3AMKA 3BGAA 4A7UA 3ZL2A 2WLLA 1KT2A 3DV6B 4N5ED 1EX0A 1MW2A 3NCBB 3CLWA 4YSAA 1HDMB 1G5AA 3GHBL 2OK0H 4PJIE 1EZUA 1KGYE 3CPLA 1GPOH 3O4LA 5DUML 4RX4D 1A7NH 2C4XA 2FQDA 1QHOA 4L8SC 4M3JA 3CIQA 4M7ZC 5FA4A 1MG3C 1USQA 4U0RC 5DRZA 3B83A 3OKNA 2A73A 3JSSA 4LCWB 4G6FD 3K1KC 3IDNA 3RHWF 5DHXB 5FYJU 4NXSA 3BPLC 4MS8D 2C9QA 3KLHC 1MEXH 5JHBA 4IRSD 3FB7B 4YFEA 1THAA 4JM4H 4NGHL 4F9LA 1R0AL 3PP4H 4WEMB 4IHOA 2X44D 1VFAA 4KTEL 3ORJA 2Z7YA 3JBG7 3F7YB 5TPWH 2Z91A 3IF1B 2BSRA 2BY3A 3BPOB 1DO6A 4PV8A 2IPKB 2V2XB 4XWOC 3UGXA 1Y1UA 5BXFB 4HUVB 1H3UA 3FB8B 3PFQA 1ZHNA 2VCOA 5AZ2L 5T3ZH 5DSCA 1ZVYA 2FK9A 4W9DC 5LKNA 1VKXB 2V5SA 2NUTB 1P84J 3B3IA 1T0NB 5D1QB 3MKGA 4N8VB 2BIPA 4Q6IA 1GCYA 3FTVA 1QTPA 2WK2A 3DK0A 3WFBL 3LKNA 3VJ6A 1PZ2A 1YNTF 2NY2D 1XWVA 3NA4A 3WG7B 3ZTCC 3GHBH 4U33A 4Y4HB 2H0EA 3U9UB 1U93A 2XLLA 4MWFB 5EBMB 2Z93B 4WI3A 1FLRL 1BV8A 2IG2L 1MCHA 1QHQA 1G0DA 1NGYB 2AP2A 2EDEA 5DUMH 5HD8D 1NCGA 2PWHA 4GAGL 4R7NB 3BP5B 3NPSB 1NLDL 1A1NA 2ZCLL 3AADB 4ONGL 4RX4A 2IGTA 3QI9C 3EJSA 3IJEA 4H2CA 3UACA 1WWAX 3G6JB 4OZFA 2IDCA 4XNZC 1OV8A 3KGUA 4MD5B 2I24N 1D5RA 4NGHH 1SN0A 5KBNC 4NP9A 4GKOA 3V6ZA 4JE0A 3L9RB 4KTEH 2QSVA 1YEJL 4IRSA 1H6FA 1F97A 4Y1SA 4PGJA 1TNMA 2H2PC 1CE6A 4GYBA 4F2MB 2VERN 5AZ2H 3QDJB 1JPTH 3UAJC 3N42B 1D9KD 1JZFA 1OCCB 3K6IA 1YPZE 2MCPL 2EICA 3SO3C 2CO7A 3AS1A 3AAZA 3IJSB 2HRPL 4QHNB 1W6LA 1ASQA 4CA4A 4EI5B 3JZYA 4HK0B 4H13C 3DC0A 5I1KL 3KL0A 4MDJA 3WFBH 2B3IA 2GIXA 3HI1A 5J56B 3AWGA 4UYPA 3X12B 4WUUD 4PWHA 4LP5A 2EIMB 4R96A 5GGVY 3BE1L 1BXXA 3CQFA 1XIWD 5INCA 3KYOA 1OF2B 3V0VB 1PDKB 2IG2H 5CM1A 1FNSL 3IYLW 3CIAA 4WI6A 2ZXGA 5IOPB 4GAGH 2WV3A 1NLDH 4AEFA 1XO8A 2WO3B 4DPRA 1XGPA 2ZKXA 4J27A 5D93C 3VGDA 1LEKA 1U36A 3MKKA 3D87B 3NRQA 2DL9A 2PWEA 3ZDZB 4R8WL 4E5XG 2XUWA 2M26A 2WBJD 1PZ5A 3DO7B 3GXIA 3DTUB 1VESA 1NKOA 1VEPA 2DWYA 1KJMA 1U8IA 4Z78B 2CPCA 3GJEA 4LFHD 3WNPA 4L37A 5DI8A 1JMXA 4L1LA 5DVLA 1MY7A 1FZKA 4YO0B 5I0WA 4ZMZA 1OTUC 2V3EA 3B5GA 2OR7A 5EMYA 4W4OA 2GCYB 1CGWA 1MLBA 1H15A 4JZJB 4MZIA 5AB9A 5CEXB 1Z5LB 4WNSA 2G0KA 3E0GA 4UAOC 4KJQC 1IQWL 4U1MA 4XP5L 2E7BA 2A3TA 2HRPH 3EJJX 4H1LB 2FO4A 3GSWA 4ZTEA 4FFYH 3SGKA 5I1KH 1TTUA 3RY6C 1WJ3A 1JWMA 3FKUS 4FQ1L 5H37G 3DJ9A 3OGCA 3ARBB 5EF0A 4HHAA 1Q9KB 1SQMA 1JHKL 1I53A 3FO9B 2EAEA 3VGFA 2C3GA 2CIIA 2NDGA 1GGTA 2BSED 3DTDA 3UYOD 2GSIA 2WLLB 3DNKA 1FNSH 1KT2B 4MZ3A 4JFZH 5MEOA 1XIWA 5FYKD 4DQOL 1BQLL 3LRHA 3L2NA 3CVDA 1U8PA 4RRPG 5KYXA 3ATEA 4MMYA 3UDWC 1NLBL 4R8WH 2A99A 4IM8A 5HJ3A 1K4CA 2DWEA 3CPLB 2ARJA 3O4LB 4IKNA 1JI1A 3VXUE 3ZR6A 1FVEA 1SDYA 4M62L 2WBJA 4ZXBD 2X7LA 3K6OA 2YXMA 4P49A 3SGJC 5FA4B 1XCQA 5FDWA 5DRZB 1VAHA 1D7FA 2MFNA 3OKNB 1CDJA 2A73B 1EO7A 4I3RH 3IDNB 4QO1A 4PH8A 2KZWA 2OMZA 3DHPA 3LXCA 5ID1A 1CFMA 2CQVA 4F3FA 1H9VA 1ZTMA 1BZDA 4TQ8A 3HC3L 2BSTA 4Z7QF 5IJKC 3CZKA 5C0ND 4YBLB 5FHAH 1IQWH 2LW3A 4XP5H 1SF3A 4IHOB 3JV6A 1YNTA 2EACA 4JQVA 1VFAB 3EJYD 1ZT1A 4M8QB 1NKGA 3GNML 4YSRA 1KGCD 2ORBL 3K72A 3AMLA 3BWUC 4TMPA 2VQUA 2Z91B 4FQ1H 2BSRB 1NFDE 1NMCB 4PV8B 5JW3L 1THCA 1ZHNB 1OAXL 5DEZA 4LL4A 4P5RA 1OF0A 5DSCB 1JHKH 5IHUL 3B3IB 2XBDA 1QOKA 4QTHA 4LBAA 4OCMC 5IROC 1IEAA 2OTWA 4Q6IB 2HFEA 4JVPA 5L9DH 2Z6FA 1HIMH 1A3ZA 4WFGE 1ZLEA 3VXRA 4M6NL 3LKNB 2GTZA 1C5CL 3NA9L 1X5XA 1YUHA 2BSEA 4N25A 2NSXA 4E41E 3UTTE 5LG1A 4AGMA 1YECL 2UZIL 1U93B 3IDGA 5F9OL 1RZ7L 1GKEA 1HFUA 4I18A 2H0JA 3ZIMA 3ARWA 2XG5A 5E4EB 2ADGA 3LSOA 4M62H 3ZKMD 1QWNA 4KITB 1A1NB 4D9RD 1Z3RA 1IAII 2WXIA 3L9BA 4XVUC 3IJEB 2CPUA 1U3NA 2FJUB 3QH3A 3SYQA 1UD3A 2AITA 4LIQE 4DPAX 4ZXBA 5ACLA 2WQAA 4OZFB 3IDXL 1W80A 1I4FA 4XBEL 3HC3H 5BRPA 5L0QB 4JPWL 4G6FB 1VACA 2BNQD 5F7LB 2D3LA 2V33A 1CDCA 4HUXA 3V6ZB 5AW6B 1ZLWH 5DFVD 4IJ3B 1T7WA 5KYWA 2ORBH 5EU7C 3K2IA 4IRSB 2NR6D 5JW3H 1KIQA 3B4NA 4WU7A 3IB4A 1CE6B 1M7IA 3PDDA 5BO1L 1CYWA 1OAXH 2DIJA 2WN3A 5JXAL 3WTXA 3NSFA 3FSWA 3BXNA 5KEZA 4RDQF 3WE1A 5GHWL 5GS2H 2NSQA 3NJHA 2CO7B 5L9DL 3AAZB 2YQ3A 1QLRA 1H3TA 1WS7A 4BWWA 4IKJA 2ETWA 4M6NH 4AVHA 4MDJB 3HI1B 4YDNA 3BZDA 1EXGA 5KG9A 1JZJA 5FFLA 3NA9H 3VU1A 5CU9A 5DU7A 3MNZA 4DUVA 3DA0A 5DLLA 3RUGE 4F8PA 4R96B 1MHEA 3QFGA 4KTGA 5SX5H 1PSKL 1IL1A 1YECH 5EB9A 2UZIH 4L3AA 5INCB 2XTJD 4PJFA 4PD4K 5I9QB 2NY2B 1RZ7H 1S3KL 1UB6B 2EDWA 2K8MA 3SKNA 4GY4A 3I50L 2PP8A 5DMGC 3MXWH 1OP3K 3UCRA 5IREA 4HA1A 1HE7A 1NPJA 2FWUA 2WIMA 4O2CA 4QRUB 4Y7OC 5AYUL 1XGPB 3QNXA 4K7PL 1RUAL 1VHPA 3VYOA 2FATL 3UJJL 1M7DA 5EEUA 1PZ5B 3GXFA 4DO4A 1WFIA 3IDXH 2VDOH 1IGIH 2WYIA 1KJMB 4JPWH 4B50A 3GSUA 1BQUA 3SDXE 2R29L 1KPRA 4L37B 1INDL 5DI8B 3RTLA 1CL7I 3W9DA 2WUBL 1FZKB 2WWKT 4QXGH 4Z7NB 3EYOA 2VW4A 3F58L 1YJDL 1MI5D 4X5WB 2BNQA 2WLZA 2C26A 3FMGL 3NQKA 3Q8CA 5BO1H 1R3LA 1H15B 4NSKA 2JTYA 1FRGL 3CTTA 3HG5A 4AIOA 4PJCE 3BVUA 2NR6A 1EFQA 3PXHA 4U1MB 5GHWH 4J8RA 1FFQA 1X9RA 4U2ZA 1IIIA 2FO4B 3GSWB 3AQYA 2WXOA 3DRTA 1J9CT 1A9EB 2D9QB 5BQDA 5BQ7A 3HJEA 1D9KB 3TOPA 2MWCA 4OW6A 1IB5A 3RB5A 1W8EA 3OGCB 4JFQA 1L0PA 4XMVA 1FH2A 4HHAB 3AT8A 1GJWA 3I6GA 4ENEC 1QZ1A 2CIIB 4WUUB 5IBTL 1G7HA 1G5GA 3VD7A 2JQAA 2QPUA 1S3KH 2GSIB 3I50H 4KGLA 4J3XA 4TL4A 5MEOB 1ZVHA 2W9LA 1XIWB 2Y2YA 4TNGA 5DWUL 3LXAA 4ZX4A 5IQOA 3F65A 4DK3A 2WYTA 4PMEA 2J7LA 2E8YA 5D1ZA 1U8PB 2VZTA 4PYHA 5AYUH 5KYXB 4Z8FL 3TV8A 4K7PH 1RUAH 3UEZA 2FATH 5FCSH 1C12A 3NFNA 4MMYB 4OB5L 3UJJH 4A66A 3RGVD 5HJ3B 1WBZA 1K4CB 2DWEB 3SYOA 4DIXA 1RZFL 1KJVA 2ARJB 3SKOB 3ARGC 2HTKC 4CGTA 3US9A 1FVEB 2R29H 3PGFL 2WBJB 1INDH 4DP2X 2X7LB 4JL2A 4MTMA 5FDWB 1TZIA 1UZ6E 2WUBH 4ZFOB 5AAMA 3IDYC 5SWQA 3ZKND 1AMXA 1P6WA 4RBPH 5I23A 3F58H 1YJDH 3GBLA 4Q9RL 4QO1B 4MAZA 2IGLA 2YMOA 3IGKA 2OMZB 4P9HH 3FMGH 5ID1B 2A4ZA 4K5OA 1RVFL 4NOFA 3CHOA 1BLIA 2BSTB 4ZW6A 4U7MA 2CR3A 1MI5A 1IVLA 3OXRB 3ZQ9A 4WJG3 5KWYC 1TQCB 2MOQA 3JV6B 1YNTB 4AGOA 5F6IB 1CCZA 1ZT1B 2VSCA 1EDYA 5DJ0A 3E7JA 5K9OA 3MV9A 1RPUA 2VR4A 1G9EA 1X5GA 1UWFA 4HUKB 4P2QD 2RACA 1KBGL 2F54D 1MCPL 4DTGL 1WBXA 4RZCA 4QTHB 5DZAA 4RGMC 2IMMA 3FZUD 5IBTH 2QZQA 5FYJE 4F37F 1IEAB 2OTWB 3QUYC 1V05A 2HFEB 1NFAA 4NEHB 4PY8J 5ICZA 3DX9A 3T0ED 5HYJE 1T7ZA 2GTZB 1YUHB 3L4CA 3V4PL 4Z8FH 4G6KL 1CTMA 2DQEH 1W9XA 1IFRA 4OB5H 4LSRL 3IDGB 4PWGA 5J4MA 4OV5A 2AZAA 2FR4A 4I18B 1X7QA 3PREA 5D96B 1YN6A 2NQCA 4GI8A 2ADGB 3LSOB 3RGVA 3PGFH 3CN2A 4G7VH 1NM9A 1UOWA 5ABDE 4AW4A 4ZMTA 4KY2A 3WFDL 3U2SA 3QH3B 4Q9RH 4I0PC 4H8HA 4F8NA 1ZGLM 3ESVF 4WQOA 4ZXBB 3OZLA 4NX0A 1RVFH 4YSDA 1PLAA 2QJDA 4PBWD 2P43B 5ILTL 1VACB 1OP5H 4JMXA 4JUTA 5B21A 1IGYA 4HUXB 4AV0A 2YK1L 5F9JA 3CFCL 1P6AB 1E50A 1U8HA 1KIQB 1KBGH 4WU7B 5D7IE 1R33A 5JORA 1DJXA 1M7IB 3K1DA 1MCPH 4DTGH 1YMMD 3DETD 2XN9D 1SGKA 2O6EA 3BXNB 3UBXA 4P2QA 2QQNL 3QZMA 3TCXA 3JV5A 1QR1A 3F04A 2F54A 3DJRA 1QLRB 3VXOB 3HS8A 2J5WA 1X5AA 3S4SG 5KG9B 1T5WA 4JX0A 4M8RA 3B6SB 4D8PA 2QGEA 3MNZB 3HAEA 3QZWA 3V4PH 3T0EA 4G6KH 2EVJA 1SJMA 1IL1B 3L5JA 1DVYA 4P23C 1RAMA 1X7SA 4P3CL 4PJFB 1VFBB 3Q2NA 4OTXL 3S97C 5TE4L 4YHPA 3QPXL 1QP1A 2OCFD 1Z9MA 4HWZB 1CQYA 4P2OD 4O2CB 3VXSE 5JOFA 2ZXCA 1KOAA 3HAEH 5ITBL 4WO4D 3QNXB 4LASL 5CKGA 1M7DB 3KPTA 1GGCL 1JP5A 2WB7A 2ZG2A 5FOBA 5BVPH 2VM9A 3NCFB 1NQBA 4OU3A 4BSJA 4PR5A 3HPJA 4K4KA 3T9WA 3L4XA 5ILTH 3GSUB 1KPRB 3W5NA 5CILL 3W9DB 2YK1H 1XVSA 4S11A 3CFCH 2V9QA 4Q14A 5KYNA 4AMXA 2BNQB 4F2FA 3ZN6A 4F7CA 1OD9A 1R3LB 2R83A 2Y7SA 4NSKB 2EDOA 1PY0A 3DX8A 4W9GC 2NTFA 3D33A 4U1LA 4J8RB 1BJMA 3VI4E 2WLKA 1BXUA 2EEDA 1E4KA 1YMMA 3DRTB 1RPQA 2XN9A 2J25A 5BQ7B 3LZFH 4NNXA 4BFJA 5ES4B 2JKRM 4ZZKA 4JFQB 4N87A 5AVUB 2DMCA 3WLWD 1EA9C 2G9HA 1K3ZA 2XIIA 4P3CH 3HEIB 4MRCA 2E7CA 4OTXH 1JSYA 3QPXH 1U8CA 1BWMA 3TYGL 3BYYA 2Z64C 2XTJB 3HCVA 4JY5L 3HLAA 4G8EA 2AJSL 4NNYA 4HKBA 3T8VA 2CO6A 5ITBH 4Z7QB 1GW0A 1SQ2N 4LASH 1C12B 3NFNB 4XI5D 4JQXA 1P9MC 3I3DA 4HJSA 3GLAA 4P2OA 2JE8A 1BD2E 1A64A 3EADA 1KJVB 4WO4A 3V55A 3PGCA 5KUKA 3OAWA 4G80B 2F7PA 1LDPL 4O58H 1WT5C 5LB1A 5CILH 1Y0LA 5KVDL 1TZIB 3PXLA 1IJNA 3RIKA 5E2TL 2C3WA 2DH2A 3VX1A 3OV6A 1JJUA 3LYRA 3U48A 4ADIA 4AIXA 5DT1L 4Z76A 3SE8L 4KXBA 4AV5A 3VMOA 2P42B 1JZHA 3VDAA 2EECA 4XBGA 3QRFM 3NYKA 4PGZA 1B9KA 1MI5B 1M3JA 1HYSC 2BSSB 2OJZL 4LQFL 3TFKD 1GZPB 1J5DA 4OJFL 5DJ0B 5HHVL 5JHDA 5K9OB 3J7HA 4WI2A 3CSFA 4JKNA 1LO5B 3MSPA 2FLRT 2CR0A 2B0SL 1AXIB 5IJDC 3UIYA 1WBXB 3BVXA 4RZCB 4FFVD 5DJCB 2F58L 4KJPD 4JFVA 1S7TA 4XZ4A 1OAJA 2VABA 3X1NA 5ICZB 3DX9B 1UWEL 3EBHA 3TYGH 4ZPVA 4HOWA 4JY5H 2AJSH 5ERWA 4H8PA 3E1ZA 2CRZA 3ZRFC 1U91A 4GNKB 3TLRA 4JFUA 4OV5B 3FU7A 2FR4B 3FTUA 2BVTA 2GK0A 1A66A 1X7QB 2AJVL 1LDPH 1DHKA 1YN6B 4HIHB 4NFDA 5KVDH 2CRMA 3GPEA 3U2SB 3FT4A 3MCLL 1XR8A 1OARL 5DT1H 1XSIA 3SE8H 3BT0A 3QEUA 4H44C 5ECGA 1CFNB 1PBYA 2YSTA 1H8NA 2LV4A 1IGYB 4EDXA 4LQFH 2OJZH 3NIGF 5F9JB 5HHVH 3A22A 1BFTA 1R24B 2ZWKA 1U8HB 5DMIL 1DL7H 3PLYA 1I1RA 2FBOJ 2B0SH 4XHQA 3EFFA 3QQ9C 4PLKD 5JORB 1EEUA 3E3QE 3E6FA 4M6ML 3W38A 1HAWA 4TNEA 4PJXE 2WO4A 2Q9OA 2HH0L 4ZAKC 2F58H 3UBXB 1BW8A 4P2QB 1AR1D 2YD7A 5E2UL 1QR1B 3UC2A 2F54B 1PZ3A 3GLDA 1SFHA 2D7MA 5JA8B 2J57A 4G42A 3UFIA 2J12B 3O0LA 3QJUB 4EZKA 1T5WB 2XX0A 2Y7QA 4D8PB 3ARZA 3HAEB 3QZWB 3T0EB 5PCYA 1A7PL 4O02L 1URIA 2BHYA 3UYRL 5EO9A 2AXJA 3FRPG 1I8UA 4R90L 1MAKA 4YHPB 2AJVH 4DP0X 3V4LA 1S6NA 1RZGA 1IBGL 4HPOH 5GS1A 5JOFB 5KJ7E 2VITA 3IJYA 3TYFB 2G4GA 2C9AA 4WWPA 3I74A 1KY7A 4GSDL 1EGJA 3MCLH 4ZO8A 1CXLA 1EHLL 1OARH 4BUGA 5FOBB 3GKZA 4NN7C 4GT7A 4K0OA 2OCJA 4LVEA 4LQ1A 4PR5B 3HPJB 4BSVA 1SXSA 3D18A 2RCSL 5FYLL 4TUOA 2FJSA 1AD9A 2IDQA 4TVUA 3DARA 2EQDA 1ZJBA 4RISL 4F7CB 4RDBA 5L2KD 1V3LA 3GMNA 4M6MH 4G7QB 1A9BA 4JZNA 3MUHL 1CLVA 3DX8B 4O02A 4BZ1L 2NTFB 3SZ6A 2HH0H 4U1LB 1AYRA 1A6UL 1DQJB 3MA9L 5E2UH 3VTMA 4L05A 1YMMB 1TZ8A 3B9KC 1U2HA 2XN9B 4XMKL 3ILQC 4OCWL 4NNXB 2Z0UA 3P4LA 4KK9D 1XQ4A 1CGVA 3T4AC 2Q8BH 3RDTD 1Z9OA 2WVVA 1NINA 3P40A 4NZTL 1SYSA 1RXLA 3B1TA 4O02H 3BLPX 4PWJA 3UYRH 1G9MC 5A2AA 5FGCB 4PJ7A 1UXMA 2LR4A 2Y2WA 4R90H 1SLXA 5C0BD 3H54A 3K46A 1FFPA 5F3HA 3TONA 3T6XA 1U8CB 3CPUA 1X5MA 3NMEA 5F7WC 3WUWG 2G2NA 5BNXD 3HCVB 4WHYH 1IBGH 2AEPH 2APXA 3HLAB 1JAEA 3L4YA 4G8EB 4JGMA 4JRXD 4YDIL 2AEWA 4HKBB 3RPBA 2CO6B 3Q5YA 3KMDA 1XSOA 4PCYA 2QLYA 3SGEH 4GSDH 1GTNA 4M7LT 3HC4L 3KCPA 3GEFA 2JFCA 4KZEL 3KL5A 1N10A 4P2OB 1WFUA 3QXAB 4WO4B 4LDCA 1UM5L 3PGCB 2WTPA 3WEXA 1MCBA 4BZ1A 1J7VR 1TZGL 1IKOP 2RCSH 2D4DA 5FYLH 5C7XL 1Y0LB 3QUMB 5AVSB 3LH2L 1GYUA 1FORL 3K74B 5CS7A 4RISH 1AZVA 4WTXA 3TBSA 4Z76B 5JIKA 1MHCA 4LPXA 2QPSA 1N64H 1XCTA 4XBGB 3WLBA 4B9KC 2BNUA 2Q0ZX 2YKLL 2D3VA 3EGSA 1UD4A 4GRLC 4L4TD 3VGAB 5A2FA 5L2KA 3WFCH 2VNCA 1MCCA 4AGPA 3F84A 5B1JA 4XMKH 4OCWH 1KBKA 1MREL 2IQAA 4WW2F 3WNJA 4A63A 2DBLH 4HOXA 4NZTH 2VR3A 5E1AA 4ZW8A 1TYRA 2DLHA 4PG9A 1W6WA 1S7TB 4KVPA 3RDTA 2VABB 1PZBA 4LOEA 2YA1A 1XR9A 3QZNA 1E8ZA 5IOKA 3FK3A 4ZPVB 3L4UA 1BVLA 3VRLF 4YDIH 5T8IA 1B0GB 5ERWB 5C0BA 1ZPUA 3AWFA 4P5KA 1CDYA 4PY8I 3HC4H 1U91B 3D4ZA 4EXKA 4KZEH 4RMVA 3ZTJH 4XP4L 4JRXA 3FU7B 5IJCC 5EEXA 3INUL 1ZVNA 1UM5H 3Q0HA 3L9EA 3CMOL 3WN5A 4NFCA 5C7XH 4AMKH 3T6QC 4XN9A 5HYEA 1RQ5A 1S7VA 2RMNA 3LH2H 3NESA 5DMKA 1FG2A 1XR8B 4JHZA 4KMTL 4MXWL 4NO5A 4HCRL 5AOZA 4XX1E 5K59F 3QEUB 5DZOA 1RHFA 3CN0A 2BP8A 1HEZA 2CDGA 1OB1A 2BRRH 2ODHA 4EXPX 2ED8A 2YKLH 3MBWA 4EDXB 2GAZA 3GWJA 1SMDA 3FYIB 2NT0A 3UPAA 1DJIA 3H9SD 1QSEE 4N90E 2EXWD 3EFFB 4L4TA 1MREH 1ZD6A 1OGPA 2MIZA 3FQRA 4PWEA 4UQ9A 3E6FB 1I7UA 5AOMA 4AKPA 3ASNB 4Y5XC 1A7OL 1Z0MA 2BWQA 3OC5A 3I9IA 2C9SA 5F1KC 4C58B 2ZUVA 4GG8A 2ZT9C 4G42B 1KTDA 1ACYL 2XN2A 2Y7QB 2Q76A 3WTSA 3IRCA 4HPYL 3MRLB 5T5NF 4F1SA 3S2CA 3GO1L 1OQOA 1H8OA 5EO9B 1SY6L 3AG3B 1J87A 4K71B 4WGVB 1YC7A 5I0XA 1AOHA 2BS9A 4ZYKA 4PIRF 3BC9A 1FYTD 2CKNA 5KBMA 1TTCA 4PW9A 1IUZA 1UZ8A 1D5IL 3RNQA 1RZGB 4B96A 3CMOH 3BGFB 3PNRB 5I5IA 1FNGA 5GS1B 1TVHA 2VITB 4LDLB 3HC2A 3IJYB 4X6BB 5DRWA 3LKSA 3SPGA 3Q06A 3GMQA 1HL4A 3GZPA 1GGBH 2YARA 5EZIH 3S35X 3K0WA 4KMTH 4MXWH 3QFJD 4HCRH 1EHNA 2E9JA 5D4QA 5CGBA 1OSEA 1RLWA 1DSFH 3EGDA 1V27A 4BSVB 5EN3A 1J0KA 5DLML 4P5MA 4MAYD 4LCCC 3CFIC 3UTOA 4TUOB 3WIIL 1AD9B 3AM8A 4XVSL 1RURL 2WHVA 5IWLA 1RULL 2FLBT 3GMNB 4UQ2A 1CO1A 4JZNB 4NP4L 1A7OH 3H9SA 4O02B 3S5LA 1KDJA 4XNMA 1SY6A 3VFWB 5HVWA 2NYYC 2WQRA 5BW7C 3P3UA 4J39A 1YQVL 4LVHB 3WKYA 1OGTA 4GIOA 2LU3A 3VI3E 1ACYH 1AR1B 5L2JA 2ZG1A 2WVVB 4A6YA 3FH8A 4IBWA 1SYSB 4NUGL 1XB8A 3GO1H 2AVFA 2X2IA 3DMMD 3QORA 5CBEB 1LLAA 4PJ7B 3WEOA 2AGJH 3RWFA 5HPMA 1PD1A 3MTXA 1FFPB 5F3HB 4ZTPL 3VD0A 2NQ3A 1ZT7A 3MRDA 1D5IH 3CFJB 3MNVA 2V8LA 4BJLA 2AMGA 3WEMA 1FYTA 5DJ8A 3O3BA 4KJWD 1JXGA 4BZ2L 1SXAA 1XF4A 3KCPB 3MJ8A 1ACXA 1IM9D 4KROD 3VSTA 1O5DT 3ZHKA 2IFFH 4B5ZA 5KSBE 1KB5L 3WEXB 3EH1A 3WO4B 3BN9C 2ZUTA 4KI1A 3L3DA 5DLMH 3QFJA 1QWHA 4WW2A 2YN5A 1Q72L 3WIIH 1TTBA 4FQHB 4XVSH 2JKTM 1HQRB 2IF7A 3DOIA 4KRNA 4O2EB 1A6TA 3SO5A 3Q6GL 1RULH 4WO0A 1JWUA 1OXYA 2WSDA 4MAYA 5E5UB 3TC9A 5A7BA 3TBSB 3KE0A 4MJ2A 2YBGA 1XCTB 4LCUA 4NP4H 3WLBB 4ETQA 2APWA 2BNUB 4FMVA 1LILA 1DBBL 1DVFD 3EGSB 3FN9A 2FT8A 5L2KB 3CFBB 4LSDA 4U05A 4ELKB 2KYIA 2QQKL 5IM7A 1KENL 4P2CG 1JI2A 4NQTA 1MZYA 2IQAB 3PWPD 5TF0A 2CJTA 1OTTD 1PCSA 5DD3L 4ZD3L 3SBPA 1WITA 5I1DA 2IOMA 5E1AB 4PJGE 5E8PA 3V6BR 3IN0A 4NUGH 4AGQA 4BZ2A 2FIKA 5CP7A 4KDVA 4G9FD 4UQBA 4PG9B 4DKEL 4W68A 1F4WL 4UOQA 3RDTB 2XZQL 1Q9WA 5FW7A 2YC1A 4Q89A 5F7MC 1XR9B 1KTBA 3DMMA 4HIIA 4R26H 5F7AA 1XTLA 1BVLB 3CVIH 5C0BB 2GK2A 1TQWA 4OZHE 2DWTA 2F5AL 5JXED 2NX5E 4P5KB 2VJ0A 5LAPA 3ZHFA 5IFAL 2W8CA 3RJOA 3TN0D 5DHMC 5JR1L 4JRXB 3NIGB 3NIFF 3TZVD 3HJ0A 3DUSA 3TO2A 1KB5H 2ZWYA 2YN3A 4LF3A 2D03L 3RY4A 4AZ8A 4BQCA 4MS6A 3WN5B 3BVTA 4V1DE 5C92A 3SPJA 3ENEA 1S7VB 5DMKB 1FG2B 3Q6GH 2FL5A 4NO5B 3KPSE 5DDHA 4BCZA 4PYGA 1DP0A 1MCLA 2BP8B 4OZIF 3BAJA 1HEZB 2PNDA 1BP3B 2CDGB 1OB1B 4XN2A 3T1WA 1F3JA 3Q9QA 1DBBH 3MBWB 4FTVD 1MFEL 3H6JA 2GAZB 3DIVA 5B4MD 4K2UL 4F9PC 2KPNA 1ET8A 4YL4A 4EPSA 3KPRE 1KENH 2EO9A 2ICEA 3SKUD 2PETA 2CNZA 4L4TB 1YNLH 3FQRB 3L7FA 1NIDA 4PSRA 5FDYA 1I7UB 1IGML 1NEUA 1DJGA 3IVKB 4NJ9L 4GKNA 3FU3A 3PWPA 4N2GA 3L9YA 4DKEH 1F4WH 4GG8B 2R7EA 3K4AA 4M4RA 2CO4A 2XKSA 4PJ9C 2BXYA 5AG9A 1F1GA 1BJ1J 2GJ6D 2MSPA 1KTDB 3DV4A 4G9FA 4XNYL 2J1WA 4C4BA 4L29A 3FTGA 4NQCA 2Q76B 3KWUA 3GDCA 2A9CA 2J8UE 4UIMA 4K3EL 3WGVB 5I75B 5IFAH 2P5WD 4PHXA 2ITFA 4RZKA 3RWEA 3UC0L 3CZFA 5EEYA 4RFNC 5JXEA 2PO6D 2D03H 2VMCA 4GI9A 1UZ8B 3RNQB 3TN0A 4H40A 1FNGB 4JHVA 3TZVA 4HH9A 5C6TH 1TVHB 4U6YA 1RSYA 5DRWB 1RD6A 1WSST 3IE9A 3LKSB 4PRID 3GMQB 2OLDA 2Q86A 4L0ZA 4JJHA 2RQ8A 4KC3B 4X0KA 3FT9A 4B9FA 1T2JA 3RPIA 1LQSR 5DK0B 2R2EA 4HMEA 3UTPD 3EGDB 4FQCH 1S7QA 4P5MB 1MFEH 3LHPL 3C09C 3LQZA 4KDTC 4IOFC 4MQ7A 3TWCL 2GVYA 3ZE1E 3P3RA 5A2KH 3EH4B 4FTVA 4IMLA 2ED7A 5IQ9A 3HFML 5JDSA 2VMJA 3L3KA 4UQ2B 2H0FA 4IS6A 3H9SB 3S5LB 4ZX6A 1HHJA 4NJ9H 4IBYA 5C0AE 1GSKA 2CDEA 3MV11 5A2LH 1BIIA 3GDBA 5TJWK 1SVZA 1OGTB 1UWXK 2R69L 4UV7H 4NQEE 3UXFA 4HJJH 4XNYH 2WAQA 1J48A 3GSRA 3DYMA 3TS8A 2YSSA 2P44B 4A6YB 3HUJE 2YFOA 3HOGA 4JDEA 3QWNA 5EULV 1ITCA 1OP3H 3GJFA 1D5XA 1QTSA 2F53E 4OBRA 4K3EH 5EHFA 3UTZA 4JREC 3RWFB 3UC0H 1FSKC 4FLHA 3SPHA 5HPMB 1R5IB 4GG6F 2RFXA 4WUKL 1ZT7B 2EH8H 2ZIDA 3MRDB 3ZE0F 4BEIA 3RB7A 1INEL 1WVZA 2P5WA 4JFFD 3MNVB 4HIEA 4YDZA 5HYQA 1FYTB 5DJ8B 2PO6A 3CHXA 3O3BB 2VDNL 3OKEA 3MJ8B 1XF4B 2WXGA 4FCAA 5LBSA 5TK4A 1DJSA 2OSLA 3S36X 3VFTA 4HPHA 4AENA 4CNIA 2AERT 1L5GA 5DYOA 4PRIA 4GO6B 2XVBA 4C55A 4NUMA 2PP9A 3L3DB 2E74C 4DN3L 3QFJB 1NFKA 4WW2B 3LHPH 5KVEL 4Q52A 3CXDL 4AWJC 5MHSD 3TWCH 4W9CC 1CQKA 4R4FL 2O6DA 1AXTH 4M5ZL 1A6TB 5EZOL 3EO1A 3WAKA 1YEEL 1JWUB 2Y72A 4MAYB 4G82A 1RZQA 4WGKA 1UD8A 4H20L 2E75C 3HFMH 4OZ4A 4ODHL 4J4PD 3P73A 4LCUB 4F7TA 4ETQB 4G2AA 2BIOA 1AS6A 4IBSA 5GZNC 1JPFB 3Q8AA 1SZNA 4PJAF 2OXHA 1AZRA 1JZ8A 4CSPA 5JDJA 4PJ6A 2R69H 5IM7B 3RKDD 2HX8A 1K9TA 4LZKA 3KGSA 3R4RA 3TT1L 4PG2C 4G9DA 2CUMA 1O7VA 4KK5C 4Y4KD 2EDJA 1CI3M 4PS7A 5I1DB 3U6XA 3ATFA 5E8PB 1GXEA 1AZNA 2FIKB 5CP7B 1P7KA 5J12C 4DO5A 2APTA 1F02I 3GM8A 3FTXA 4R7VA 5SWSA 1Q9WB 2YC1B 2IWFA 3HHSA 2WYHA 1ZJAA 4A7GF 4HIIB 4H5SA 4WUKH 2XBTA 5BS0A 3L1OL 1INEH 1NUDA 5HI4D 4UI2A 2W59A 1WAAE 2QL1A 4OZIA 1RZ8A 5FFOA 3QIUD 2IAMC 2VDNH 1XMEB 4N8PA 2BRQA 4JFFA 3B2XA 2QQLL 2FCBA 3DUSB 3TO2B 4LF3B 2GJRA 3LTVA 2FDBP 1IM9B 3LD8C 4DN3H 4KROB 1M53A 1SXZA 5KVEH 3CXDH 1QI3A 4R4FH 5EZOH 4M5ZH 3T08A 3UIZA 1H8SA 5J57B 1YEEH 2FL5B 5DDHB 3O0RL 4H20H 4HKZA 4YBHA 3QQDA 4YSCA 5JPMC 2LABA 4ODHH 4YGVA 1G9NC 2HJKA 4S1DD 4TM9A 2BDNL 1P4IL 4F92B 5G4MA 3OG6B 1OM3L 1JV2A 4IYKA 1ORSA 4X4KA 4ADJA 4J4PA 1LE5B 1N4XL 1WPCA 3EO9L 2WKOF 1F56A 2ICEB 3TT1H 1DVFB 3AB0C 2IXQA 1MCKA 5FA3A 4XXDA 2WIIA 3L7FB 4BUQA 1DQQA 2BVUA 5DHYA 1Q38A 1ZS8A 4GKNB 3PWPB 4ZQKA 5C0FB 2BMKA 4Y4KA 2R7EB 5IBUG 4M4RB 5F21B 3MUUA 2WGXA 1BBJA 4YHKL 3PCYA 3DV4B 4G9FB 1JPST 3L1OH 2VXVH 3ULAB 1T2QH 4L29B 4OF8A 3FTGB 5DVMA 4ZMAT 2F5BL 1BBDL 4P99A 1QFOA 1U8OA 4UIMB 2OYPA 2V5RA 3FN0L 4WW1A 1HINL 3RWEB 2QQLH 3CZFB 5I74C 1HSBA 3HRZA 3QIUA 3WN6A 1A9VA 1OW0A 2R1YB 1J18A 2IAAC 4DZBA 3TN0B 3NJLA 1I8AA 3N43F 3TZVB 4H26A 3EH5B 4HH9B 1ONQA 3HR5A 4U6YB 3BP4A 3IN2A 2H3KA 2MKLC 5DQ9A 2Q86B 2OMBA 3O0RH 2BFGA 2ZX8A 2R2EB 3MO1A 3CUPA 3FU9A 1S7QB 1PNDA 2ZAHA 5IEHA 5CD3A 2BDNH 1YNKH 3SQOL 2OMWA 2FBJL 3MRQA 3LQZB 1UCTA 3ARQA 1OM3H 4MQ7B 3STLA 4F15B 2CNYA 1N4XH 3EO9H 3UGEA 2J55A 2VUYA 3WNIA 1FH5H 2DF3A 4FTVB 4IMLB 5IQ9B 4Y19D 1CXFA 3U25A 4R7DA 5JDSB 3L3KB 4U1GC 5D1XC 3II1A 4GG6A 3CHQA 3CV5A 4CMHB 1HHJB 2RBLA 4IRJD 4LGPB 3HN8A 3HNVL 4ZMPA 2CDEB 3F7PC 1BIIB 3N50A 2XSKA 4CC4A 4PGEA 1YEWA 2Z7WA 2BERA 4MMXA 3VTTA 4YHKH 3ILEA 1WAEA 4E5XA 3GSRB 3WNOA 2WPGA 2YSSB 2F5BH 3QUKA 4JDEB 1NC4D 2GJ6B 1D5XB 1CBJA 3GJFB 4R4BA 3FN0H 5GS0C 3UTZB 1JDCA 2R9HC 3NCYS 1JYNA 1HINH 3PHAA 3OTTA 5D7LD 3QDME 4N2HA 5C0RL 1SVCP 2RFXB 2QELA 1E3FA 3DPDA 2MQ3A 2P5WB 5A3IC 4HIEB 2WNWA 3V0AC 1B4LA 4AY0A 1MCNA 4RVBA 4GBXA 3F5WA 4KNQA 1DVUA 4MNQE 1MCDA 2PO6B 5E9DD 1ZE3C 5FO8A 2AVGA 3OKEB 2XWEA 3C5JA 1ML0A 2OSLB 2J6EL 4XNAA 3VFTB 4AENB 4CNIB 5KUMA 4RAUA 5DYOB 1L5GB 4PRIB 4EJ1C 5EO0A 4LEEA 3TJHD 2X09A 1FFNA 1KXHA 5H37A 3RVWC 2F19L 3SQOH 2FBJH 5F1OB 1KGWA 3VD4A 3UJTL 3EO1B 1QUNA 4WV1C 1TF4A 5CLXA 2HJFA 4OZ4B 4HQQH 1BX2A 1QRND 4FJZA 4F7TB 3CE1A 3L16A 4LGSB 4Y19A 3HNVH 4Y9GA 2GABA 4GMTL 1A3RH 2IDUA 2OXHB 3TJPA 2X0WA 3W37A 6PCYA 4KKLC 4RRPA 4XOEA 4IRJA 4BGDA 5C0EA 1PKQB 6CGTA 4G9DB 4DERA 1AQHA 3NIFB 3FCUB 3O6KL 3U9PL 2IAND 1ADWA 2XQBL 2VDNB 3NUKA 1RJZA 1P7KB 4QRBA 5F0JB 1A7QH 3RILA 4V2CB 4RH4A 5C0RH 3HHSB 3OJ2C 1NC4A 1OHQA 4NN5C 4H5SB 2HT4C 5IVXE 2XA3A 2ZD0A 1U2YA 2OULB 5D7LA 4OZIB 1RZ8B 2BXZA 1FG9C 1A25A 2R4SL 4HS6A 2NY5C 4JFFB 2I26N 2J6EH 1KLGA 3NAAL 2DQHL 2WKGA 5CIPA 5E9DA 2WKOA 3CJJA 5FX3A 2QDVA 4EUPG 1SF5A 4O2FB 2HLFD 3BQUC 2F19H 4K9EC 5JUEL 3UJTH 1BZOA 1JE6A 2E9BA 2YGVA 2ZP9A 5E1QA 4TXVB 4S0TD 5F3BA 1S5HA 3CZUB 1UGNA 4HKZB 3QQDB 2A4EA 2JXMA 5KSVA 4TVPD 5IBLC 4QTIL 3V5KA 4Z5RA 5SV3A 1G94A 5C7ZA 2HJKB 5FLVA 1B88A 2D0FA 2OMVB 1OIOA 2H9GA 2VL4A 3Q6FA 4GMTH 4ABVA 1QRNA 1JV2B 1ORSB 1BFSA 2P1YA 1L7IL 1LP9F 5DK3A 4RMQA 1LE9A 1A1OA 5FA3B 1PGRB 1DVXA 4XXDB 2WIIB 5AVXB 1I1CA 1SLVA 3CXHK 3O6KH 3U9PH 1G9MH 1DQQB 2BJML 2XQBH 3RIAF 9CGTA 5DHYB 1ZS8B 3CFQA 5KSAD 4ZQKB 2BMKB 2Y6SC 3KR3L 4Y4KB 1F2QA 1KTCA 2IANA 4TVPL 1VSCA 1BBJB 4BINA 2ZYRA 4AM0A 2NY3C 2O4EA 4CC1A 3CZEA 4K8RC 3ALXA 4YIQA 1MN4A 4OFKA 3ABZA 4Z9KB 4EKXA 1KEGL 1EJ8A 2EDDA 1U8OB 4G7RB 2PF6A 4HALA 3SDDD 2R4SH 3TIEA 3VQMA 4Q9QL 1U58A 4WW1B 1JDAA 4LESA 1AFVL 4A2HA 3C8DA 3BSZL 3NAAH 2DQHH 4UT7H 5T3XD 1HSBB 3HRZB 2WLHA 1RUQL 3QIUB 4OJDH 4XMXA 5F7KC 1XAUA 3IK2A 4DZBB 3SCMC 4RIRA 2VDKH 1XB6A 4H26B 4ELDA 4HJ0D 1ONQB 3HR5B 3OHXB 3BP4B 5KYYA 1FLTX 1UA6L 2VLME 3C12A 5F1NA 3FHAA 2IV9A 4CMMA 3AG1B 3PP3K 3WKML 3L3JB 3EOTH 1HT6A 1URLA 2EDLA 3P54A 4AT6A 1V3KA 3MO1B 3CUPB 3RIFK 3A6BL 4ACPA 3SBWC 5IEHB 1J5OL 5CD3B 5FIEA 3AG4B 5G4NA 5JPNC 2OMWB 3STLB 1YEKH 3MRQB 2DBJA 1PX3A 3VGHA 5FV2A 3EXLA 3O3EA 1CDBA 2H7WA 5HVGB 5AEAA 4MXQD 2AJ3A 4R7DB 1VGEL 2AZUA 4Q97A 1AMYA 1KV7A 3RTQA 1OAYH 4GG6B 5IY5B 5DEFA 1D7DA 5J1AA 3ZE0B 4MKTA 1XXDC 2GI0A 1FPTL 3KR3H 4NC2B 1UH4A 2CJ3A 4MMXB 3OWRA 4TVPH 5AFAA 2X0UA 1GYCA 2WQSA 5F3FA 2WWOA 1UUSA 1DJZA 4DP1X 4E5XB 3LV3A 2GB2A 2YAFA 5KW9L 1QO3A 4R4BB 2ZE0A 2Z8VC 4Y8AA 4Q9QH 2CCWA 3V9FA 2GY7B 3O41A 1AFVH 4M00A 4LPVA 4QKTA 2Z9TA 4O5LH 3BSZH 5HYSG 3S8GB 3ZYZA 3SDDA 1XHHA 3QJSB 1RUQH 2LAAA 2IPUG 1N59A 4L3FA 4QOKE 4UT9A 5I1HH 1NUGA 5FO8B 3RVTD 5TF1L 1UA6H 2IQ9L 15C8L 4J23A 3D0VA 1LVEA 3C5JB 3WKMH 1WE5A 2NPLX 1J0YA 1YA5A 1HH9A 1KZQA 4RAUB 5FUZL 2EVFA 2X42A 1S9YA 2NXZD 3A6BH 2FTAA 3NH7L 4MQSB 5EO0B 1FFNB 3SJVD 2QQQA 5DD6A 3P2DA 2VC2B 4X6DE 2DL2A 1SXNA 2LFEA 3ATBA 1QUNB 1XH0A 1PVHA 4M1DL 1IFGA 3PUUA 2BNRD 2HCZX 5C97A 1E67A 2B7DT 2HJFB 3VXMD 2OZ4L 4EEEA 1BX2B 1LNUB 1IM3D 3V0FA 1CLOL 4Y19B 4NWUH 3PABB 1BEXA 1E9PA 3TNMA 2CGRH 2RB8A 4IRJB 4Y9EA 5C0EB 2G0LA 2VR9A 2JJVA 2EC9T 1RJZB 3JWNE 3BFOA 3N0PB 1P4BL 2JCWA 3E1F1 2ILLA 3VO0A 3GI8L 3M1OA 1NC4B 5IFJA 4X98A 4I8DA 5GZOD 1YEGL 5E8NA 5KTEL 1TJXA 3MR9A 3ULUF 5BOJA 4AC2A 2NY7L 3NJIA 3MUGA 4XP6L 5TF1H 3QNYA 2IQ9H 2P45B 4AQ8A 1Z9LA 4HS6B 3WDJA 15C8H 5KYUA 1UASA 1KLGB 3NZUA 5CIPB 5E9DB 1KJ2A 3FONA 5FUZH 1JF1A 1LP9A 3FJTA 4XTRD 5IHWA 1K3IA 5I26A 3S35L 3H85A 4UOJA 2V7HA 2ED6A 2APFA 5B1AB 3GI9L 4L5FE 4M1DH 3SJVA 5F3BB 2H3NA 2OZ4H 4JDVA 1ORQA 4DKAA 3V5KB 4Z5RB 3PQYA 1CLOH 5CEZE 4MQXC 2BNRA 2B4CL 3VXMA 2H9GB 3Q6FB 1IM3A 1QRNB 2IADB 2AANA 1A4JA 3D48R 5DO2C 1ES0A 2X1OA 4POZC 2G3NA 3EOBA 2CZNA 2DLEA 1A1OB 1QUPA 4H8WC 2OJEA 1PIFA 3BPNC 2WWMD 1UCBL 2NY4D 5BRZE 2A9ML 4K3GA 3SBQA 3N43B 4QT5B 1P4BH 2DQMA 2IANB 2NY6D 3GI8H 2XWXA 1R34A 1WA1X 3N40F 4AM0B 2X9ZA 1IBFA 2R51A 1YEGH 4MCYA 5LBGA 2JCCE 5KVGE 3GSVA 3OWEA 1MDAA 4FHJA 1CGXA 5HDBE 4DVRL 2Y0SA 5BUPA 3DGGA 3S3DB 3MYZA 2J1ZA 2OMNA 2YAMA 4XP6H 3TIEB 5GZOA 2CM5A 2B1AL 4IEFB 5DF0A 1ODAA 1FL5A 3KL3A 3IM1A 3UL4A 4K94C 2VR5A 3QARA 4RIRB 3S35H 4F5CE 3FB6A 4U6XB 2KERA 3LNIA 2FIRT 3LMJL 4AG4L 2XWJA 3N0AA 5KYYB 3GI9H 3JUYA 3D6GA 4Z7IA 2X10A 4TTDC 4FXGA 4J1UB 1GL4B 4CMMB 1C1EL 4M9PA 4AVJA 3TEYA 2D8KA 4Y4FC 4AT6B 4BM7A 4DOHE 1HE8A 2O5XL 1E5YA 1CBVL 3CSYA 5T1LD 1TETL 3S4SA 4AOFA 2B4CH 1UJTA 2GYSA 2XWDA 3V4UL 5ABAA 4ABQA 1T03L 2ALWA 4HUUA 3UABA 3O3EB 1MW0A 4BFKA 2GUOB 4OKVA 3ARUA 7TAAA 2UUDK 2AJ3B 2VLKD 3JVGA 3ULUD 4GUPA 3CC1A 3FTYA 3ZMNA 4BA8A 1S5IL 1UCBH 2XRAL 1A2YA 1NPNA 3BH9A 4FN0A 2A9MH 3UO1L 5J1AB 5CCHE 2DB8A 4U1IA 5HHXL 4E9RA 4B95C 2ZX7A 3AREA 3IGAA 2YRPA 4WI0A 3P9WB 4WAFA 3W11C 2YD5A 1PFCA 5KSAB 2CUAA 3LV3B 2ICCA 4DVRH 1BVNP 2W0LA 4HG4J 2EIKB 4BQ6A 1QO3B 5C9JA 2MH4A 3SGEI 1N7ML 2L7UA 2CD0A 3OVUB 1HK6A 3B5HA 5LDUA 4YHNB 1REIA 4ZUVA 1Q0YL 1AZUA 2B1AH 3O41B 4FHBD 4XPGH 3ULUL 1BJ8A 2JJTA 3MLSL 2CE6A 4AL8C 2DYPD 3ZHLA 1L9RA 4FXTA 3SDDB 3MV7A 1N59B 5JLZA 1EAOA 1E4XI 2F1AA 4LSVL 5BV7C 3ABGA 2B08A 1QSFD 5E0FA 1Y7VA 3AGWA 4AG4H 4F7MA 4YDJA 1TTRA 3DJZA 3V10A 3UYPA 1E43A 4ANXA 1FQ9C 3HR6A 2XPGA 4AGNA 2NNAA 5ICYA 1C1EH 3D0VB 1HH9B 2WVUA 4I4WA 4J3OG 4U1HB 4Y1AE 2IH8A 4U7SA 2KDYA 4EO5A 1S9YB 2O5XH 2MPVA 3GQFA 3OXSA 4CILA 5C8JA 1TETH 3FT1A 2DYRB 4OIIL 5DD6B 4B3VA 2X89D 1H6EA 3V4UH 5FR3A 3APCA 1T03H 2AXWA 2DM3A 5KANG 3T04D 3VD1A 4IIQA 5T1LA 8CGTA 2B5IB 4QGYA 1XGTB 3HN3A 2ZOOA 3EJTA 1E6JL 4OCXH 1J1OL 1MPAL 2BSDA 1S5IH 1CFSA 1A7RH 2XRAH 2CGYA 1NDMB 2L3BA 2QGCA 2X5PA 4XAKE 3A24A 2VLKA 4LLVB 4P46D 3WMSA 1E9PB 4NI3A 1IBZA 2OAAA 3TNMB 4BKSC 3IFOB 4A38A 1RIHH 1CDIA 1AHWA 3DROA 4JMNA 1M6OB 2GPZA 4X4XA 1ZGLP 4Q74A 3TBTA 4QAMB 4XO3A 1GS6X 4LPYA 4NQXA 1N7MH 1XH3A 1AZZC 1U3JA 4KU1A 1Q0YH 3MLSH 4DW2L 1GMIA 1CXHA 2H4EA 5IFJB 1YN7A 4WU5A 4X98B 4LAQH 5E8NB 2AXHA 4LSVH 3MR9B 1Y07A 5TQ2L 3MUGB 4MXVE 3LQAC 1S7UA 3HA0A 2UXGA 3K6NA 3QNYB 4KI5C 3TTSA 1IJ9A 3FT3A 5KYUB 1HJCA 1NKRA 3KYMA 4ODTL 1KJ2B 2VDML 3FONB 1JF1B 1LP9B 1RZIA 4I88A 1KSRA 5EUOE 2YRZA 2XI9A 3BIBX 4OIIH 5ACMA 2CALA 2V7HB 2NXZB 4KV5E 1IO4C 2GIMA 3SJVB 1WAPA 4G6AC 4GXFA 2H3NB 2X89A 4M8UA 4Z3TA 1ORQB 1LWRA 3WOVA 1EEZA 1E6JH 4BFOA 1J1OH 1MPAH 4GRWE 1B0IA 5AW2B 4YXLL 1OT4A 2BNRB 1AG0A 3VXMB 4LHJB 25C8H 4ZFFA 1IM3B 1CK0L 2BVPA 2R23A 1A4JB 4L8SA 4XE5B 4M4PA 43C9A 3AVEA 3BVDB 1S3RA 1ES0B 4WSJA 2HLAA 3PU7A 2QHRH 1FL3A 3UPCA 1PZCA 2FJGA 3LDBC 4P46A 2OJEB 4M93B 1LO2L 4AYBA 2ZUWA 4FYRA 2CHDA 3QAZB 1IQDA 2PLTA 5GGTH 4S10A 3DX7A 4DUXA 1MFAL 3FBKA 3P3TA 1MXDA 3GB7A 4AQOA 2H2SD 5CU5A 4NHCL 1I9JL 3GSVB 1BM7A 2FT6A 2APVA 3S6CA 3FUKA 5DQJA 5TQ2H 3DGGB 3V6OE 5FM5M 2OSXA 1ASOA 3BSHA 2JELL 2VLRD 3GSNL 1XD0A 4UTAL 3QNZA 1MUJA 1I85A 2X4OA 4N2CA 3VUAA 1FL5B 1OEZW 4ODTH 2VDMH 3HZ3A 1S78C 3KGRA 1UHVA 1WWCA 5EORH 5AAWA 4PN6A 3FB6B 2ZNXA 1S4IA 4J3WA 3TBYA 3UAAA 2B1HH 2XWJB 3FU8A 3S36L 3VA6A 4FEIA 2X9YA 4F8OA 4WNJA 4FXGB 4ONFL 2NTSP 4XXCC 3ML8A 1UD6A 4HC1L 4EVNA 4YXLH 3OF6A 3CSYB 4ZPTA 3O4OC 3S4SB 1OGAD 5CN2A 1CK0H 3EKCA 2E9IA 2YGOA 2J1KA 4HUUB 1ESOA 4BK5C 1JGIA 4OKVB 3BISA 5LNDA 1HESA 4GUPB 4KZCA 3FRPA 1PX4A 1YPZF 1FN4A 1LO2H 1L9NA 4NOBA 2VE6A 2Q3AA 1A2YB 4UTAA 2CR6A 1OTSC 2D2CC 1R75A 3R4DA 1ZLVK 4U1IB 1MFAH 2G5BA 5E6IC 4ICWA 4OH2A 2FAUA 2NY4B 3OJMB 3ZRSA 3IGAB 4WI0B 1BOYA 1JXJA 3DUUA 4NHCH 1I9JH 4TN9A 2IH3A 2NY6B 3IXAA 4Z7VA 3GSNH 2JELH 2O30A 5C9JB 4K23L 2WD0A 1T5XA 1R47A 2VXQH 4RMWA 4TNWK 4ZUVB 1KULA 3QUZC 1A8ZA 3DBSA 3AW5A 4PB9L 4HEMA 2VLRA 5LGHL 3TURA 4ZODA 2V17L 1NCNA 3EJPA 5JLZB 1PKOA 4H25A 1KBPA 1MCOL 4F7MB 4ZX3A 4YDJB 3UYPB 3S36H 4KKBD 5FECA 3EYFA 5D1QE 1WQVT 2XPGB 4I89A 5F7BA 1A7BA 1GSMA 2WZ0A 4ONFH 1QLEL 1C7SA 1G9NH 5H8DA 3MJGX 3O6FC 4I4WB 5EUKA 4FJ6A 4HC1H 4N1CA 3OXSB 4K3JL 5C8JB 2FNBA 4NCC2 3D25A 2QKIC 3RZCD 1UKSA 1IC5L 1VIWA 4IIQB 3FCTA 4M3KB 5DJ2A 5EU6E 2K9FB 5T1LB 3T2QA 2F08A 4JR9L 4OGAC 1OGAA 4N2EA 3VG9B 4BQBA 1CN4A 1UWXH 1CFSB 3LRSA 2MOVA 3O2VL 5HP5A 3FQWA 5LNEA 4FLSA 4YSQA 2G3ZA 4LRIC 2VLKB 2HT2D 3WUWA 2ZAIA 1OE2A 3BN3B 5E8DL 1F1DA 1K5NA 4FI8A 1BF5A 1AHWB 5HY9A 1GKOA 3DROB 4F7EA 4X4XB 2IV8A 3TBTB 2Z31D 2EIEA 4A7VA 4QHUA 3WJJA 1SOXA 4NQXB 1DANU 4MX7A 3BLKA 5EOCH 3H3PL 1XH3B 4M5TA 1WP6A 4KGJA 5FM4A 4KRPC 2VZUA 5K33A 3L3GA 5LQBL 4PB9H 1T1XA 1B3IA 4FG4A 1YN7B 4WU5B 5LGHH 4K3HA 4HWUA 2V17H 2XPYA 1BVKB 4F2ME 4NB7A 3K2KA 5JW5A 1MCOH 1KV3A 3U36A 2DYPB 1IKFL 4Y16D 1KN2L 3R8QA 1S7UB 3SOBH 1PG7X 3FT3B 1HZHL 1RMFL 2QV2A 1QSFB 1YG9A 1QLEH 2WCGA 2XIDA 1NOFA 3P0GB 3V6OC 3VG0L 4NIYE 4ZOCA 1YLBB 2IFGA 4AE0A 2EDRA 1RZIB 4LPWA 2EVIA 2G3XA 2KT6A 4K3JH 3X2QB 1NBYA 3BAIA 1RUKL 2HXAA 3OZ9L 1AGBA 4IMKC 3OAUL 1KPUA 1IC5H 3KH4A 1XGUA 1NSNL 3TJEH 3BFQG 5AAPA 4JR9H 1ZV2A 1OE3A 3HI6L 4TUKL 2EEBA 2OI9C 4N4YB 5HJDA 1EEZB 2QFPA 3RGHA 4G6JL 3RZCA 1CD9B 2Z1PA 4N0CC 1OAKH 4A55A 4L3EE 1MHPL 5LAXA 3F05A 3SE4A 4GSRA 4XVUD 2BVPB 2R23B 4TS6A 2WOBA 43C9B 4L8SB 4HKXB 1BEYL 5E8DH 1C8QA 3VB9A 3ZDZE 5AKVA 2N01B 2HLAB 5EEVA 4U0RB 1TT6A 1FL3B 5BZXA 2BIMA 4P46B 2I32A 2OPCA 4JO4H 4NKOA 5GS0H 2GJZA 3WDHA 1NGZA 2BIIA 1IQDB 3H3PH 3KLKA 4BFEA 2YPVL 2DKSA 4OLVH 2Z31A 4WFFE 5LQBH 2WW8A 5J8OA 2VDMB 1H19A 3GB7B 4JL1A 4IOIA 1JPGA 3N04A 2ZXAA 4YQXL 5DQJB 3T0DA 1IKFH 3WHXA 2NY5L 1KN2H 2Q8AL 3QNZB 1MUJB 1MJJA 2X4OB 1I1YA 3B9EA 3VG0H 3V4VL 4Y16A 4JM2F 4CJ0A 4UQCA 4YSEA 1HI6A 2J4WL 3E38A 2Y69B 3BDYL 1WWWX 2OTPA 1RUKH 3TBYB 2B2XL 4APQD 3BPOC 3MLUL 3OAUH 4ZS6D 3EYVB 4JRWA 3K6SB 1LMIA 1NSNH 1FE8L 2H1LM 1MJ8L 4B53A 3HI6H 4TUKH 1NGWA 5D1QC 5F97E 4G6JH 5HDRA 2BK8A 4EVNB 4ZPTB 4KXZI 2YPVA 1QNIA 3O8XD 3W1ZA 2HSIA 3BAWA 1TSHA 1BEYH 3K5RA 4U49A 1VENA 1H3GA 3MLXL 3FRPB 4Y4HC 2ATAA 3O4LE 4I3GA 4ZUTA 1FN4B 1WGVA 2LHAA 4U4IA 3MRKA 1YYLL 3WMPA 3CX2A 3VXUD 4L23A 4C8XA 3V4VA 2LTQB 2D7PA 3WSQL 1HYRC 1UENA 1HAUA 2V3DA 2X2UA 3NPSC 4K8RL 4N0RA 4XC1L 5AALA 1CGYA 3V7MA 4JGUA 2E47A 3DUUB 5FKPB 1BF8A 4N24A 4RMRA 5T3ZE 3EIFA 2DEXX 4JFHD 2IH3B 3IXAB 1N6QL 3M7FB 4PEEA 2ICES 2NY5H 2HRLA 2YPKA 4I85A 1G0XA 2XA8L 2Q8AH 1T5XB 3ECBA 1VA9A 3V4VH 3AABA 4XH2A 2VLRB 4BFNA 1TJHL 5LHDA 5I0VA 4H25B 3F7QA 1YHPA 1U4FA 4N22A 5E56A 2JJSC 3MLUH 5FECB 3EYFB 1FE8H 4QRFA 2WXPA 1G4RA 4W6XB 1ZAGA 3SDXF 4APQA 1WIOA 1F4YL 2OYMA 3DHMA 5EUKB 4EI5C 2ZTBA 2JB5L 3MVSA 3EDFA 1S7XA 4WK4B 3D25B 4O4YH 1O9WA 4D3CL 3IWUA 1BQHG 4P05A 4E41D 3UTTD 3FCTB 3FUHA 4PJCF 5DJ2B 4B0MB 1I7RA 3O8XA 1CVRA 3ERXA 2F74A 4HXBL 1OGAB 3MLXH 4GH7B 5D93B 1H6UA 2DM7A 4NAQA 1FGNL 1ID5I 1YYLH 5AVVB 3RVUC 3LRSB 5ID0A 4BRJA 3FQWB 4PGCA 3X1BA 3WUWB 4Z7OE 3F12A 2X2HA 3GFUA 3H9YA 4MFHA 3RX8A 4K8RH 4JM2D 1K5NB 2CBPA 4XC1H 4MD0B 2FX8L 5EV7A 4F7EB 5HY9B 3BKJH 3VXUA 3ARXA 2YGQA 4BE6A 3NEXA 3THML 4QHUB 1N6QH 4H88L 2D7TL 4MX7B 3V0EA 2XA8H 4BWUA 2H8PA 2J3SA 5JYMA 3AWEA 4JKLA 3OX8A 3L3GB 4UQEA 4Z95L 3FRUA 1T1XB 4O00A 2ZXBA 2HG5B 4HU2A 2A38A 3PL6D 2X12A 1MIEH 1S7SA 1COBA 3D85D 4I48A 3FULA 3U36B 4BA0A 2DQFA 3QUYD 4FYQA 4JZJC 4JAMA 4HYTB 2WQVA 4YS4A 1NCIA 2Q2LA 3S98A 4ZSOE 1F4YH 2R1WA 5HGDA 3W5MA 1UZ6F 1KC5L 2QSTA 3PHQA 3RFZA 2JB5H 2C3VA 4G59C 1NBYB 4UTCA 1QFHA 2NYKA 1AGBB 4QHLA 3MRFA 1KPUB 2X2JA 5CCKL 1P7HL 4BUHA 2W81C 2ICWA 5J06A 3WV0A 5IW1B 4HXBH 1G6RA 1TMCB 2E6JA 3RZCB 1FGNH 3UTTA 4PRPA 1RIVL 5LAXB 4CJ1A 4HJTA 2A0LC 4DP7X 3MBXL 1QVOB 2HVJB 1MHHA 2FX8H 3CC5A 4LAJH 2ZP0T 2GJZB 4JM2A 2EUXA 1I9RL 1NGZB 3QRBA 6PAZA 5FGRA 3PFUA 5DS1A 5FOJA 1PL3A 4DGYL 3EGXA 2Z31B 2RA1A 4FFWC 4Z95H 4C56A 1JGUL 4HLZH 4IOIB 2Y07L 1JPGB 1II4E 3BIAX 1QR4A 4LCVA 1NA8A 1QFPA 2J5LC 3X3GL 3TASA 4G8FA 3T4YB 3WHXB 2VAAA 4L4VE 2J20A 1B9ZA 3PL6A 4KVCL 3WE6A 1MJJB 3D85A 4JKWA 1M71A 1I1YB 4YBLC 3SDCD 1U3YA 3U6XS 4Y16B 4F9LC 1KC5H 1BAWA 5DHDA 3QUYA 1FZMA 3L1FA 1HI6B 3TX4A 1NMCC 5GRYA 5F71A 2BZCA 2NQDA 5CCKH 3AU1A 1V7NL 5F7NC 1NGWB 1I3VA 4OIFA 3RPKA 3B9DA 3PAZA 1A6VL 1IKNA 1RIVH 2BX5A 4Q6IC 5BVJA 3NSDA 4DCQA 2EUZA 2FH8A 3V0WL 2X4SA 5D7IF 3VACA 3MBXH 3TH4T 4XB7A 4R7LA 3ABKB 3EHBC 3G5VA 5DZJA 2BHZA 3RHWK 1BREA 3MRKB 3NACL 1I9RH 3IWVA 1BPLB 4N5EC 2JLPA 3TBVA 1PYWA 1EHKB 3U30B 4DGYH 1F13A 3V4VB 4CSSA 2CK0L 4DNLA 1JGUH 1KBBA 4EQ2A 4M03A 1T89A 2Y07H 3H4FA 2KLTA 1E4WH 3MV8D 1P7BA 3SDXA 3U2IA 3X3GH 2J1YA 4S0SD 2J8HA 3RY5A 2YPKB 3T6WA 3RWHA 4KVCH 3D4CA 3ECBB 2QPEB 2QR0A 3UH8A 5L0QC 2FRGP 3DO3A 3NK4A 4LOUD 3WKQA 4XH2B 1E3ZA 5AW3B 1OANA 4MS8C 3PP3H 4IJ3C 1SBBA 3VX0A 2MNUA 2LE9A 5PAZA 1PY9A 1RJLA 2ENQA 3SDCA 1QBBA 3RWJA 1DJYA 2A9DA 1G43A 4FXKA 4YK4C 3VCLB 2WXNA 1L7TL 4XHJD 1Q9LA 1V7NH 4ZNEE 2PTUA 3ESOA 3VXRE 5FYJD 4APQB 4EIBA 4JKKA 1Z9PA 1P53A 4PRHD 4GLRH 1A6VH 1WHPA 2OL3L 2WBXA 5HYJD 3KCWA 1MW1A 3KPQA 5D4IA 1S7XB 2C5DC 2Y22A 5IGXL 1ETJA 1LWHA 3VD9A 1V7ML 2C9XA 5B38G 1BZEA 4QHKJ 2ZONA 1QFWL 3AU0A 1YVLA 3NCEB 3O8XB 3QR2A 3CX5J 2F74B 3C5ZD 2BOBA 3DLQR 3GRWL 3CFUA 4FFTA 2BOLA 3RI5F 3VI4F 4AZUA 2WN2A 3NACH 1KF9B 2I25N 3NQIA 4KO5A 3PWNA 2J2ZA 3CZJA 3FCSA 2DQ6A 4UT6H 3A4AA 2CK0H 4XCNA 1EUUA 1Z0NA 4HSAC 1J8HE 5E4IA 2Z7ZA 3JWNG 5HD8C 2MTPA 3VXUB 1GJUA 3ZL1A 2JKSA 2GTWA 1JYXA 2ZUXA 3STZA 5K9KB 1BVOA 2XXGA 2H8PB