2GC7C

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 26
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc7C00
1AAJA 1BEXA 1BYOA 3OMIB 1MDAA 2BP8A 1GY2A 2WSDA 4JHUA 2AANA 3FQ2A 3JT2A 2I7SA 4NB7A 2XX1A 4E9RA 4GP8B 1ZIBA 1NZRA 2BWDA 1XMEB 5A7EA 1NIBA 4WKXA 2BZCA 3EHBB 1SNRA 2PCYA 4HHWA 2R7EB 5I5JA 3UAAA 5B3SB 1JOIA 2XV0A 5I6OA 1NTDA 5PCYA 1GY1A 3OMAB 3AG2B 5F7BA 1A3ZA 1PF3A 3FU8A 1AS6A 3ASOB 1KDJA 3UACA 2GC7C 4BWUA 1AZBA 2Q9OA 3NP4A 4N4YB 2IWEA 2MRYA 3UAEA 2XLLA 1JZEA 3AZUA 1WS7A 1SJMA 4YSRA 1KDIA 2BO0A 2VSMB 3OM3B 2GHZA 2PPDA 3AY2A 1ZV2A 1J9SA 1WS8A 1AACA 4BWWA 3HB3B 1E67A 1CC3A 1NIAA 1PZAA 1ILSA 2CCWA 4YSQA 3H4HA 3EH4B 3NT0A 2QPDB 4AKPA 3FYIB 2BW4A 5E9NA 3NJGA 2HRGA 3ABMB 4N8UA 4A2GA 2PP7A 3OQRA 5F7AA 2HX8A 1NDTA 2W88A 1M56B 5D4IA 4YSOA 1QLEB 2DYSB 4DPCX 1AQ8A 4MFHA 3PXLA 3N55A 3WNIA 3ZDWA 1T5KA 5TK2A 3ABGA 3SBRA 1OE1A 2JXMA 4A2EA 1PAZA 2OCCB 2FQEA 2XV3A 4A67A 2PPAA 3QJQB 4E9TA 2I7OA 1BQRA 2IH9A 4KNUA 4HZ1A 9PCYA 3NP3A 2AVFA 2GSMB 3AG1B 3MBWB 3PAZA 3IE9A 1DZ0A 3ZIYA 4GP4B 2IAAC 1SF3A 5I6MA 1HFUA 1RZQA 3NJMA 4DP0X 1NWPA 3BQVA 5D4HA 3S8GB 1ET7A 3FSWA 2IDUA 1KBWA 3TBCA 1N68A 2RACA 3RYMA 2CJ3A 2YARA 3DKHA 4RH4A 1IC0A 3UADA 5I5MA 3QJUB 2IWFA 3KW7A 1AANA 4DP4X 1DYZA 2BP0A 2AFNA 2AZUA 4KO7A 3NYKA 1EZLA 2JKWA 1OCOB 1NWOA 1CYXA 2AZAA 5IY5B 1BXUA 3CZUB 2BW5A 3NJLA 1W6LA 4UF7C 4E9SA 3ERXA 1AS8A 2CALA 5D4JA 1PNCA 4DP9X 2UX7A 4BDVB 1TEGA 4GP5B 5TK4A 3BVDB 4AZUA 4JHVA 3FPYA 3FQYA 1E30A 1A65A 1AOZA 1MG2C 3T71A 5AZUA 4HHGA 1X9UA 1SHXA 3FSZA 1A8ZA 1PMYA 1V10A 5B1AB 3UABA 2P80D 1IKOP 4G70B 1ASOA 4W1TA 1PLCA 4HAKA 1RKRA 2FWLB 2GBAA 2QDVA 2FT7A 2PPFA 4DP5X 2YXWA 3MX0B 4HCGA 1PZCA 2DY2A 1UATA 2BHFA 3ABLB 3QJSB 1SFHA 3X2QB 4QKTA 2YAPA 1CURA 2IH8A 2HXAA 3GXUB 4YSCA 1OCZB 1BQKA 3EF4A 2CAKA 3AW5A 3NJFA 5B1KA 4DPBX 4BXVA 1OV8A 3OD3A 4G7SB 3X1EA 1ZIAA 3JTBA 1MG3C 2GI0A 3TBBA 1MZZA 2VM4A 1AZRA 1BQ5A 1AZNA 1B3IA 2XU9A 1JZHA 2VW7A 2BWIA 4KNTA 4A66A 3SBPA 3SQRA 4BK5C 1L9OA 1PNDA 3V9EA 1VLXA 2TSBA 4AKOA 4HALA 2HRHA 4DP1X 2WO2B 4YSAA 4YSUA 3X1FA 1WA2X 4G72B 4W9ZA 1YLBB 2DWTA 3QJTB 2P80A 1JXGA 3CDZB 2YQBA 4WTQA 2Y69B 2IDFA 1V54B 5AFAA 4E9QA 3NJJA 2FQFA 2Y1AA 1AG6A 4F7KA 1M9WA 3WIAA 4E9VA 1J9RA 2VN3A 3QQXA 3NSFA 5B7FA 7PCYA 1WA1X 3G5WA 1PLBA 3CVBA 1KYAA 1L9QA 2H5UA 3T6WA 1SFDA 1CYWA 2I85A 3FU7A 3CVCA 4G7QB 3AG4B 2UXVA 2XXGA 1ZDSA 2Q5BA 3NJKA 1NIEA 1W8EA 4UANA 2FQDA 4YSTA 1WAEA 1GS7A 1ILUA 1BXVA 2HLEB 1TKWA 4Q8BA 1SDDB 1BXAA 4QLWA 2VW4A 4AX3A 1GR7A 1J9TA 3UGEA 3ZX1A 4F2FA 2EIJB 3U25A 3ABKB 5AKRA 3IEAA 4L0PB 3FS9A 2BZ7A 2XYBA 3NJHA 3S8FB 1A4BA 5B1JC 5LDUA 1JERA 2H47C 1A4AA 2YAQA 4DP7X 2PCFA 3WKPA 2QDWA 2HZHA 2VW6A 1OCCB 3FYEB 4CSZA 1OOWA 4KOBA 1J5CA 3ZBMA 1V55B 3QJVB 3TU6A 2IWKA 2BP8B 5B1JA 2PPEA 7PAZA 3S3DB 3TASA 2YXVA 3WKQA 4KOCA 4KO5A 4A68A 5PAZA 1GS8A 1QNIA 2YAOA 3CVDA 1KBVA 2ZXWB 8PAZA 5I5IA 4YVUA 4FA7B 2JFCA 1JXFA 1L9PA 4A2HA 4DPAX 3FPXA 1PZBA 3TA4D 1SF5A 2VM3A 1BYPA 1GS6X 2E86A 1URIA 2XUWA 2J5WA 6PCYA 3NSYA 3WG7B 4KO9A 3H4FA 4A2DA 4GYBA 3S3BB 1XB6A 3T6ZA 1AZCA 1BAWA 2YAHA 3D12B 4AI7A 3FQ1A 3EH3B 1ASQA 1IBZA 3PPSA 2B3IA 4EF3A 2XXFA 2QT6A 2MTAA 2X87A 1XB8A 4GXFA 3NJNA 1AZUA 2EILB 1PCSA 2NRDA 4A2FA 1XB3A 4E9WA 3PAUA 1OE2A 2PLTA 3GYRA 2ZOOA 1ADWA 1RCYA 2EINB 2B08A 1M57B 1F56A 2DYRB 3OMNB 4BDVA 3T6XA 4YSEA 3PCYA 2GC4C 2IDQA 1NIDA 5I26A 1NPJA 3PAVA 3V9CA 1KGYE 2GIMA 1N70A 5EHFA 2ZONA 3EH5B 3FT0A 3WNJA 4E9YA 3S3CB 1AG0A 1PLAA 3NSDA 4TXVB 1NINA 1FFTB 1IBYA 4YL4A 4HIPA 4ZK8A 1I53A 4E9XA 1IUZA 1FWXA 3DIVA 4P5RA 3X1NA 3X1GA 1R1CA 1ET5A 2OV0A 1JZFA 1JXDA 2A3TA 2QPEB 4KNSA 1EHKB 3IN0A 3X1BA 4BXSV 1OE3A 2R7EA 1J9QA 6PAZA 5FC9A 4YSSA 1QHQA 5I28A 2XX0A 5B7MA 2J57A 2IDTA 2UXGA 2HX7A 1JZIA 2HX9A 4DP2X 1WA0X 1NIFA 3H56A 4K9JA 1JVLA 3HEIB 4BWTA 3N2JA 2H3XC 1KV7A 4CSPA 2ZWNA 3FU7B 3L45A 3KW8A 1GSKA 4YSDA 2DWSA 1TEFA 4KO6A 2FNWA 1NPNA 2GB2A 1ID2A 2WO3B 5I6PA 1MZYA 1PY0A 4FAAB 2YAEA 2UXFA 4NAJA 1ET8A 2EIKB 4PCYA 2FJSA 3IBOA 4HCIA 2VMJA 3NSCA 4YVNA 3QJRB 1JVOA 2XVBA 4GY4A 3PLYA 5I6NA 2N0MA 1AIZA 1TU2A 4JKNA 1HAUA 1KCWA 1X9RA 4UAHA 4G7RB 2YAFA 2CUAA 2J55A 3WI9A 1KCBA 1ASPA 1JZGA 1W6WA 2BP0B 3CDZA 2LLNA 1J5DA 1GW0A 2FTAA 1OCRB 3QPKA 5I6KA 3C75A 4X4KA 3DTUB 3T9WA 2EIMB 1OF0A 2FT6A 1ETJA 2X88A 1JZJA 2XV2A 4HCFA 4Q89A 2UX6A 2FQGA 5B1BB 5I6LA 2DV6A 1RZPA 3AG3B 2OJ1A 2PP8A 4DP8X 1CUOA 3FSVA 1L9RA 1L9SA 1AS7A 3NJIA 3GDCA 1SHWA 4M4RB 4PAZA 1L9TA 4AKQA 1HAWA 1SDDA 1E5YA 4M3HA 1A4CA 4P5SA 4ENZA 3FSAA 1FA4A 3ASNB 2VSKB 2PP9A 3IN2A 3FU9A 5B7EA 1GYCA 3SBQA 2W8CA 2J56A 4YSPA 2CBPA 4G71B 2XWZA 2YAMA 1NICA 4NERA 4F2EA 1AR1B 2FT8A 2IDSA 1E5ZA 2UXTA 2PPCA 1ZDQA 2TSAA 3CG8A 3T6VA 4DP6X 1ZPUA 5ANHA 1E65A
chains in the Genus database with same CATH superfamily
4HQQH 1U3YA 4QT5B 4W9KC 3B2VH 3AU1A 3QCTH 4Z95L 3GO1L 1KWKA 1T04A 2VN7A 5DK3A 5IQ7H 1JTPA 3IDNA 1EEYB 4JCMA 5CJXC 1B6UA 2CDGA 5B8CC 3CQQA 3DX6A 5FEBA 1AD0B 43CAA 5F9OH 3LEYL 4N5ED 1TJIL 3QO0A 4BGLA 5T1KB 2ADIA 1UZGA 1WZKA 2GTZA 2RH0A 2XG5B 3PWNB 2MIZA 3EUDA 5E99L 5A7EA 3ZYJA 3BKYH 1BZQK 3MV7D 1KJMB 2CRIA 3TBYB 4O58L 1UJ3A 1NGWA 2ED6A 5IJKA 5L2KD 4PJGB 2DI8A 4DGUA 3VWKA 3I6GB 3UEZA 1WO2A 4QHUA 4TNFA 2WMPB 3OMAB 4KXZI 1PF3A 2GT9B 3Q48A 3QQDB 4BKLA 3O2VL 2IPTL 4OFIA 3D2TA 1EZSA 3R06A 4XB8A 1ETZA 1KTBA 1NCHA 4JL1A 2BO0A 4IU3A 5DJDA 4ODWB 1F4XH 3PWJA 3BUDA 4GXVL 4LDLB 1MQKL 3B2UC 4GPVA 5IHHA 2VC2B 4L4TE 5DMIL 3ZDXB 4NQEA 4DT2A 3GSNL 1DBJH 4Q74A 1MY7A 1NANI 5JUEL 4N86A 2FO8A 4PSRA 2PR4H 4NQCA 4KAQL 3IU4H 5D7JB 2I5YH 1QRNA 2G5BA 2WXQA 1I3GL 3GWJA 3C5ZD 1KPUA 2ZE0A 1BA9A 3LQAC 4L1HA 2IPUG 1NFDE 2ZUXA 5EZPA 3K3QA 2B4CC 1PBYA 1LEGB 1QTYT 2TAAA 1I7TA 2B4CH 4TQEL 1AE6H 4WEEA 1XR9B 1Q9WA 1T7ZA 4K3DL 4ANXA 1USZA 1N4XL 1JUFB 3AU0A 1SLXA 2NY6D 2CZNA 2K9FB 4LCWA 4MFHA 5C0BA 3NCXA 4E5XB 5KSBB 5I18H 3FHAA 1A6TA 1NEZA 1YEIL 2JXMA 1U8OB 4BE5A 1M05A 2W1NA 1UD4A 3L9RA 3BHBA 3MODH 1TUPA 1S9VA 1NMCB 4O00A 4JZJC 1CG9A 4TMPA 4YZFF 4AEIL 2HTKD 1UENA 1ND0B 1JPTL 4KK5C 4IBQA 3UBXI 3TH4T 1BOGA 1E3ZA 4CVZB 4DP0X 2BVOB 3L3KA 1S5HA 4WFFE 4FMKA 3R8QA 3ZE1F 1A6AB 3WU1A 4LFHD 2ZCKH 2EXSA 4ZX3A 1FVEB 3F58H 4ETYA 1L3NA 3FQUA 3UADA 5EEUA 5F96L 5I5MA 3QJUB 2D2CC 2XN1A 5HHOD 1N6QH 4HFUL 3X17A 1NCAH 2QVIA 1K4CA 4AVJA 1U8CB 4Y2OB 2LLGA 3DGGA 4JHWL 1W6LA 4W9JC 2W91A 1BQSA 3BLKA 3GMNA 1UKSA 4XBPA 2ODHA 4S1SH 4W93A 4QRPE 4YIQA 3OLIA 4G8GB 3O4LB 1QFUL 3VNZA 5AB1A 4XNXL 4XWGL 3EHBD 1A6ZA 1IM3B 4NFBA 2L7UA 2ZUWA 1QFWH 1OGAB 3ARFB 3MXWL 1KEML 5AW9B 1S7WB 3NH7H 1IBDA 4CJ0A 2OAAA 1R24A 4PVLA 4FXLA 1H3PL 3LJ3A 2VJ8A 3QXAA 4WTXA 1OM3L 3LTVA 5HDBE 1HXMA 1P4LA 3TYGL 3REWA 3ZRCC 4BFIB 1T89A 5IGXL 4L4VE 1G7PB 5IB2A 2VR6A 4R26L 5EU5B 5LN4A 4C55A 3PF2A 4HKJB 4FQIL 2MH4A 3ILQC 3LEXB 4D0BB 3HG1B 1KTDB 1SFHA 4EN3B 4MMZC 5D6DC 1C16B 5DMJB 1J7VR 4P2OB 1RUAH 1BQLH 4FNLH 1MAMH 2WQ8A 4Y4KD 4XPBL 5ALCH 3D87B 3IMRA 1ZTXH 5KYUB 5ADPH 3ULVD 2X9XA 3KCPA 1HZKA 2WLIA 2VDLB 3ZZLA 4ZOCA 2BY3A 2ZPKL 3N40P 2VLME 1HHJB 1IGTB 2CDEB 4RSYA 5ERWB 1FPTH 1YEGH 4LLVB 2ZQKA 1B3IA 4AYGA 3LPPA 5J3HC 3L3OC 4F7CA 2BK8A 5I1JH 2RCSH 3MJ8A 4HJ0C 1ID5I 4XXCC 1RK0B 1P7QA 4WENB 4FQCH 3KJ6L 5L2KB 4XO5A 4ZFGL 1JD7A 3U36B 4AKOA 2P4AB 2CKBH 4XX1E 4DOHB 1EX0A 4R0LB 2FBJL 4FF9A 4DF9A 4JGJA 4MS8D 3VSQA 1WFOA 1ZSHA 1YLBB 1ODUA 2P80A 3HZ3A 3KPMA 5A7BA 1AY1H 2NNFA 1CN4A 2YUXA 2QVMA 2FQFA 2BCKB 2DF3A 4LMQI 3W5MA 4WI0A 1KENL 4JO1H 4XT1C 4XVOA 4R97C 3OKEB 5J4MA 1UVQA 4IBZA 3K4AA 4MB3A 2Q2LA 5DFVD 2VLJA 1L9QA 1QACA 2J8HA 3T6WA 3BVVA 4P4RB 4YO0A 5F9JA 4PHZA 4L3EB 3QIBC 4ATTA 4KZDH 1AGEB 3V6OA 4EIGB 5L8JB 1S7QA 1UOWA 5MEQA 2C9AA 1VGKA 2EUVA 5DLMH 4LSPL 2R83A 3P2BA 1BXVA 4LP4A 4DO4A 5I71B 2UZYA 1YHPA 1ADQA 3C5ZB 4FJYA 4UM8B 3IVKB 2CO7B 3VW3H 1CGTA 4WSJA 2BZ7A 1SYSB 4ELMF 3S8FB 2LABA 3KYKL 1M7XA 3MRIA 3BP4B 1AR1D 4NRXA 1Z66A 4AM0Q 4DPRA 4W9LC 4XODA 1WFJA 1N5AA 2IGFL 3ARBD 3HS8A 5HXMA 2NY6B 2E6JA 1ZGLM 3MLWL 1JZ7A 4GRLD 1JYNA 3ZBMA 4QRSA 1CTOA 3BP5A 3RWDA 3NCYS 2P8MA 5GS2H 2PPEA 4HH9B 5TDOA 3QZWB 2QHRH 2ED8A 3BIKB 3HNSL 4PRNA 4PGBA 5F89A 3V52H 4KO5A 1WFMA 3SDXB 5GRWA 5C9JB 1AXTH 1QNIA 1XCTA 1CI5A 4HF5L 4PG9B 2AQ2A 3UPRA 2ZXWB 4LPCA 1QKZL 3QW9A 1OHZA 3PPEA 2IMMA 4FA7B 4MNQE 2E74C 4A2HA 4Q6YA 3IPFA 3EJZC 1CU4H 5IMOB 2H9GA 1GS6X 5GRJH 4HULB 4JO3L 5E1QA 5BZWA 3V79C 1KNOA 2D0HA 2OMVB 4M4RA 5DURD 4K94H 4O9HL 1OARH 5KEZA 1BFTA 2J88L 2IQAB 4LSUL 5GQBA 1XGPB 3DBXA 5TE7L 1NFIB 1SOQA 4FQQA 4DH2A 1N64L 1E3FA 2F19H 2NX5E 2Z7UA 4FYRA 4LXFA 1BVLA 2XN9A 4G6FD 1R5IA 2IO5A 4MDRA 4OLXH 4XRCB 2H45A 3B56A 4CSTA 3HUJE 1SXNA 4WWOA 4G8EA 5FYJU 2Z31D 4M1DH 4LNRA 3VFTA 5CU5A 2OFQA 5L0QB 1RZIA 1ZHBB 1YMMA 5IVNA 1RH8A 5IW1B 4HV8A 5IEHA 1F56A 1CGUA 1AQKL 2A4EA 1IAIL 4WFHD 2N7BA 3VACA 5I2IB 3WO4C 3FZUD 2G30A 4XOAA 4E36A 1NGPH 2J21A 2JCCA 4C56A 5TGBA 5EHFA 1K3ZA 5DRNB 2APFA 5IV2A 1CFNB 3ZZ1A 2ZG1A 1DQIA 1ZTMA 3GJFA 1M3IA 2NMSA 1E4XL 1MLCA 4X6BA 4XVJL 2NCMA 3IXTA 5IB1A 2H1XA 4LRNH 3L6FA 4UUJB 1MHCB 1TFPA 3DMMD 1HQ4A 1MKFA 5BZXA 3QWRA 2NZ9C 3S4SB 1FGNH 3BPNC 3FCBA 3QRGH 1U3ZA 5DZPA 5J89A 2TRHA 4ODXB 4TL4A 1WA0X 2E0PA 2JV6A 2CJUH 1RJZB 4RRPG 3TN0B 5LG6A 4O2FB 1MOEA 1Q9LA 2P5PA 1BFSA 3GBLA 1NDMB 2EDNA 3MJ9H 1KCSH 4GIOA 1RZFL 5CLXA 2MKWA 5IHUH 1LYQA 5IESL 1KTRL 5H4ZA 5C1MB 3VGBA 4Y4KB 5I1GH 2MCAA 3H0TB 4ZJ9A 1LJMA 3KLAB 4QTFA 5B4MD 2AJUH 2YK1L 2W0KA 4I88A 4XP1H 3VFWA 2R0ZL 4Z76B 4U6VH 2CH8A 4YGVB 1I9EA 5D1XA 3VFNB 3QRFM 3BFOA 2EDQA 3HE7D 3D3VB 3U2SB 1INQB 3PWVB 1KB9J 5FKAA 1KCVL 1CF8L 2VQ1B 2UUDK 1S4IA 2D9QB 3QULA 5AL8A 4HZLB 4WO4C 4HKXA 2C9UA 3DETC 3ELAT 4JY4A 4ODBD 4XPGH 5L2JA 4HQQL 1HX0A 3RHWF 4D9RE 4ZUSB 5CSBA 2XYCA 3B2VL 5DQJB 2Y5TB 3VTTA 4TTDD 5E5UB 1N0XL 4L1BA 1NBCA 5D6CA 5IQ7L 3ECBB 2YAFA 2JJWA 4Z1PA 1V3LA 2DQCH 1SQMA 1ZLEA 5DK2B 2BP0B 1W6WA 4N8CH 4YDJA 2X9WA 5C97A 2DBLH 3E8UH 5F9OL 1EEQA 4JFDA 3PREA 2QLYA 4JG5A 3T3PB 5FM8A 5CSZA 2EIMB 1U8IA 3MREA 4LPTA 1TLMA 3BKYL 5DTFB 2FT6A 1ETJA 1JNHA 4P2QB 3DV6B 4M5SA 2ZXGA 4JVUA 1KPVA 3OKLA 4XMWA 3RTLA 5EUKB 2JI2A 3CPUA 2OK0L 1LD9B 1JXKA 1CQKA 3K71A 3G3LA 1CB4A 2FGWH 3SPGA 1L9SA 5CFHA 5FDWA 3SPJA 4LU5L 3BDYH 1SDDA 3DVNB 2NUPA 3HN8A 3BMWA 4O2CA 2GY7B 3MBEA 2JI3A 4FG6C 4HBQA 2KC0A 5F0MB 5HI3D 3BZEB 2IH3A 2F2HA 3GI9H 1ES0B 1YUHA 3JV6B 4UQ2A 5ANME 4U33A 4I9WD 1UZ8A 3FB8B 3Q1EA 4Y5YC 5BRZB 4C83B 3OXRA 2VABB 2O5XL 4XNQB 3EADA 1AR1B 5JLZA 1ACZA 2OSLB 2ZOLB 3IF1B 1J11A 2EDRA 4PVMA 3L9EA 2HB0A 3K2KA 4P2OD 4S1QH 2NY7H 5CEZL 5AWNH 3ARBB 2PR4L 4PGCA 2HVKB 3HHRB 3B9AA 2NNXA 3Q3GB 4GRLB 4JM2D 1FFNB 2I5YL 1XH3A 4XXWC 5ICUA 4JHUA 4JX0A 2FJFB 4GO8A 1S7XA 3EDJA 4ZPVB 3HLKA 3MV8D 3CFBB 1AE6L 2QPUA 4Y19E 3CDYA 5EFIA 5GZOD 3EO1A 5D1QD 5CBAB 2WTOA 4F7PB 4DZBB 1IU1A 3C6SB 1Z3GH 5I18L 3P11L 1D5RA 3T65A 1QW9A 4IBTA 5I75C 3TEYA 3IFNH 5FO9A 1GY1A 2HRPH 2G3XA 2N01B 3AG2B 2FJUB 2QKIC 3AREC 3MODL 4I3RL 4POZC 3IFOA 5EU6A 3M1OA 1Y6KR 4R96A 1KDJA 1WZMA 4M1CC 4JHZA 4FI7A 1TQWA 1JK9A 4L8SC 3L2LA 5IMMB 4U2YA 3LH8A 4HS6B 1Z3RA 5JHDA 2ADYA 1ZS8B 5FLVA 1JGLH 1DJIA 3WTUA 3MLVH 2GHZA 4XB7A 5D9SA 2BLFA 4NWTH 2ICWA 1F6AA 4MX7B 1CZ8H 4CW1A 5SWQA 1D2PA 2ZCKL 2A9CA 2HUHA 2EDFA 2XRAH 1PG7W 5HGDB 5T1JA 1PG7H 5EUOB 1F1AA 1SN0A 1TOXA 3TA3C 2WLMA 5FUOH 4QOKA 1G7IA 1T5WA 4FQHB 3QFJA 4JFFE 5J12B 2B9BA 3CC1A 4BUGA 1QYGH 2OMTB 5C0FA 3RPBA 2QPDB 2W07B 5I1AA 3FN9A 3I6KA 1E4WL 2PYED 1DFBL 4KMTL 4OCNC 2WAQA 1A6VL 2VRAA 3UZVB 3T1WA 2CD0A 2FHFA 4R90L 3DMMB 1NOAA 4BUQA 4HXBH 4S1SL 1I1YB 2V3EA 1EHNA 2ZXCA 4PJ9D 3WAJA 4DKFH 1Q0EA 3QUKB 4HFWB 4HGWB 3VAEA 3V0IA 3EH2A 4IOIB 3FFCA 1KXTB 1AQ8A 3BFQG 3QR1A 3QI9C 4Z7WB 2ZYHA 3ECWA 3FT2A 3L1GA 3N55A 5AOIA 4XHJC 1PAZA 4NO0D 2XY1A 2CO1A 1U4EA 3H3KA 1XVSA 1H5BA 3T0WA 4AIEA 1XF3A 3U2JA 1TCRB 4IOFC 3UZQB 5CWSB 4Z77B 3F7YA 3IE9A 2EE6A 3CXDH 2YEQA 5C0IB 5I73B 5IEKA 2EDBA 3HE7B 5CZVH 1MCFA 3K8MA 3LZFL 4D9QE 3R7RA 4ODUA 4Z3JA 2YEZA 2VLRE 2W80C 3DDGA 3KEDA 2BS8A 1CK0H 4AL8C 5IJCC 1OAJA 4JFYB 3IWVA 3P4NA 3NIGE 3MGTB 4FNLL 1BQLL 1DFXA 3SPIA 5JW4R 3QISA 5ALCL 4KROB 4U31A 1ZTXL 2WWKO 3DKHA 5ADPL 2OW6A 3KGRA 4WI9A 4E42B 4FTVB 3KW7A 1EDHA 1M7IA 4U1JA 2BH0A 3QUZD 4HUXA 2OXGA 2Y1YA 4I48B 1OCOB 3MJ7B 4XMKH 4GT0A 4BFKA 2B2XL 1CXEA 5GGVY 3U4AA 2E8ZA 5EEWA 4CA4A 4CBZA 5I1JL 5EZIH 5IB4A 4P2RE 3VXQA 1OCWL 1YNTF 2BOBA 5D4JA 3RUGE 3RNKA 2VLKA 4AYMC 4DGWC 1CLOH 2VR4A 1XIWA 1I8MA 5DGQA 1YEFL 5MEND 1Q9KB 4PJFA 2GK0A 4MNHA 3OKMA 1AY1L 1A25A 4FFYL 1A7NL 4Y4FD 1ETA1 1BMZA 1TVBB 1S46A 2F53D 5HI5C 4JO1L 3SE3C 3BAWA 2WUBL 4N3TA 4F2MA 3BAXA 1JGUH 2BSDA 3DOIA 5DVOA 1IBBA 3SB3A 1QHOA 4FOMA 4KZDL 2E27L 1N0LB 2X05A 1QFPA 4N28A 2AJZA 5IKCA 1HKLL 3L3GA 1KIUB 1F02I 2X89D 4F24A 2B15A 2P5EE 3AQYA 2QQNL 1JNNH 2KUTA 3GUFA 4JY6B 5HVWA 3NG5A 5JXEA 4JM2B 5TPWH 1EEZB 1S7SB 1K4DB 1SBBA 4XNDA 2CQVA 4FE9A 5KN5A 2ZX6A 1R33A 1TZAA 1OV8A 1RZ8B 3CFJA 4KPHH 3GSRB 2QGEA 4WCYH 3VW3L 1VSCA 5D1ZI 3JTBA 5CNHA 2C9PA 3MV8B 2C3HA 4KVNH 3BEVA 1NKOA 5L4MA 1CXFA 3SY0B 1RZGA 5JDSB 1R9FA 1E5CA 4B6ZA 2DI7A 5EMYA 1WC7B 1L9OA 1TTBA 3BUPA 5SV3A 3V9EA 3ARDC 2HFFB 2HUEA 1S9WB 1OO2A 2AXFA 3X3FH 4YHNB 2YJQA 2GY5A 4TN9A 2WO2B 1IKFL 2QHRL 3LOWA 2JJUA 1W72L 2OCJA 4I18C 1AXTL 5CSGA 4I13B 1GCFA 4Q58C 2Q87A 2ATKA 4NZFA 4UQIM 4PGDB 1M9SA 4BFNA 4N0CD 3SYOA 3F7KA 3H9HA 3NJJA 5DEJA 5EEZA 3HFML 4KX7A 2ZYSA 3T4YB 1CU4L 5HHPA 3WELA 2VZTA 3LS4L 4I3GA 1BQHA 4UTBH 5GRJL 1OOAA 3X3GH 1SFDA 1CYWA 1LMIA 3CN3A 5AOJA 2UXVA 2OJEA 5KVGE 5DJCB 4K94L 1OARL 1ORSA 4WFGD 3VI3A 2CNYA 4JANB 1REIA 3LDBC 4BK8A 1A47A 4UT7H 1GS7A 2H0EA 4Q8BA 3N3EA 4ZQKA 3RB5A 3GBML 1DLHA 3UAJD 2N4IA 5T1DH 4AX3A 1PIGA 1ROCA 2F7PA 3F2LA 3UTSD 2PYEB 2WY3B 3DI3B 3QARA 3BXNB 1K2DA 4L0PB 3DV4B 4M1DL 4N6QA 5DWUH 4HVBA 1MW3A 4MYWB 3NJHA 1PS3A 3LRHA 1GRWA 1Q90A 1EVTC 2ERJC 4WU5B 2GCYA 3IJHA 4HDIA 3KNBA 4UBDD 4ES8A 4GG8A 5DJ2B 1F4HA 2KT6A 4PJ9B 3ZE2B 3HMXA 4OFYA 3MXVH 3VE0B 4EEEA 1NGPL 1E43A 4NN5B 3SGKC 3IGUA 4KOBA 4HWBH 2IWKA 2HWZH 2ENSA 2V2WB 2XPGB 4HK3N 2NY3C 1HKFA 3T2OA 5EN2A 3S3DB 4NO0B 1UYWH 5FGCB 4LRNL 2DQFB 5CD5D 1KBVA 4X42A 4R4BA 3C8DA 2KLSA 1FGNL 5SWSD 3JWNG 3TOPA 4A7SA 1ITBB 2CA4A 5FW8A 1E27A 2WJ5A 5IMKB 5LN8A 5AVZB 3DOSA 5GS0L 4Q6IB 1G9NC 3GUTB 3NFSH 2BDNH 5E5MB 1KCSL 5IHUL 3REVB 3FNKA 3FAWA 5F9DC 2VL5B 2AJUL 2K8MA 3L4WA 4U6VL 5BO1H 1U93A 5KAQG 3QUZB 5DHVB 1F13A 3P4MA 1G7LB 2MTAA 1Z9SB 2F8OA 1VFUA 1KFAH 1EHXA 5HDWA 2YPLD 4X4MA 1LO0H 4RAUA 3IXAA 5EO9B 1E9PB 2DIEA 2QELA 5HD8D 1QA9A 4P5MB 3SDDC 4B60A 5F7UA 4IJTA 3JV4B 3L4CA 2DM2A 1T83A 4ZS6C 1JHTA 2E9GA 1RUQH 1DEEB 2BOCB 1UQSB 2DQCL 2A74B 1NBZB 4HK0A 5HPOA 4IK6A 1P4BL 1GGTA 5SX4I 3E8UL 3FCTA 5CILL 3FRPG 1SEQH 1MHPH 2VSCA 4KUCD 1SOXA 4Y4FB 3KWWB 3M6DA 1E6JH 2F53B 4P5RA 1WV7T 4WTZA 2DIAA 1KGIA 4O02L 2QPEB 1EHKB 3M45A 2R7EA 4U1NB 3W2DL 2MCG1 1U8LB 2HH0L 2VDKB 5HGBA 3N42F 2O5YH 4ZPTA 5D5MA 1GHFH 4OKVA 4CL7A 2FWOB 4U1IA 4W81A 5ENWB 2IFFH 1FZJB 3NTCL 3PDGA 4HPYH 4Y9CA 5ISZE 4OD2B 3GIVB 4LP5A 4M3JA 1UWYA 2F58H 4FTDA 4BUHA 4J39A 3I2CH 1YG9A 4YS4A 2IANE 4NI6A 2WO3B 1KB5B 4TM9A 1XZWA 5JR1H 1EJFA 3LS5H 5DRZB 4PCTA 1WWAX 2R1YA 2Y2YA 1P5VA 4YHPB 1T03H 1UUNA 4NQVB 3LD8B 3ILPA 2FUTA 3ARGD 3RIAK 5A2KH 4S1QL 4Y1AD 5AWNL 5GZNA 4LDCA 2ARJA 3VVVA 3AAZA 5FXCH 4RX4A 2OQJB 3TO4A 1L0PA 2VAAB 2LV4A 4KUZH 3O6ML 2EJ1A 1DVFC 5HJ3B 2IOIA 2J55A 1N7ML 1FV1B 2VIRA 1E5UI 2AXHA 2GSGB 3D30A 4LOVA 1DQQB 4P3CL 2XIBA 3LMJL 3CLWA 3HPJA 1YMHA 1T1YB 4P4KD 2OMXA 1IAII 3LH9A 5KBMA 3VFUA 4I2XA 3MC0A 5C07D 3RDJA 3RTQA 3IFPB 4R2GD 3ZR5A 4QAMB 2X4QB 2OMWB 2E9BA 2Z0UA 5JXAH 1MRDH 2CR6A 4HU8A 5H2BA 4PP2A 5FECB 1Z3GL 3APDA 4PJ6A 1FRGH 1E4XI 3TVMA 5FA4B 2HVBA 3IFNL 5F1NA 1JWUB 4EZJA 2HRPL 2RA1A 5AW6B 4DP8X 1FCGA 3SE4A 5JXAL 1S9YA 1FO0A 2H7WA 1ZY9A 4ZUVA 4BSVB 4N90E 5C08D 3P9WB 5J8OA 2XZCH 4XNMB 2MNWA 4PWIA 5D70L 2D3LA 3K0YA 3RZCD 2BOLA 4OGYH 3WXVH 3ASNB 1UOVA 1WAAF 3HG3A 3QUXD 4L1DA 1L5GB 5EEYA 4KFMA 1HOEA 4BFJA 4NWTL 1CXHA 2YD5A 4MXWL 4JW3A 3HHMA 2EIEA 1DBBH 5A6LA 3D4YA 1A14H 2XWCA 3HLAB 1UWFA 1PG7L 1NUNB 2AAAA 3WJLC 5ICYB 1G1OA 4N2HA 4NQUA 5FUOL 4YHYC 3QNXA 5E23A 2GI7A 2VDRL 3L8QA 2JI1A 1QYGL 1C9SA 3CXHJ 4J3OC 4PRAA 1GY2A 1YNKH 1HI6A 3H3BC 4JPWH 4LCCB 4XE5B 4JQVC 3MACH 4ZW6A 1QMUA 4DAGH 5FO8A 3SOTA 4XWOC 2WLZA 4AWJC 3H6AA 4U1SA 2PNDA 4KKBD 3UL4A 5ICXA 1NZRA 4HXBL 4NRYB 5EWIL 3VFSA 5SWSB 2YPKB 4PV8A 5KJ4A 3HZKA 4DKFL 1BJMA 5DI8A 5JHMA 3T2LA 4J2XA 4ZAKC 3U46A 5CJXA 2DKMA 5B8CA 3RL1B 4G11A 3FCSB 3FH7A 2DH2A 4X4ZA 2EDHA 3JVFC 1NTDA 5G4MA 4Y4HC 5I6OA 2UWEA 5K9QI 2P8LA 2EE3A 4J3BA 2RMNA 4Y2DC 3FU8A 5F7EH 4GW1B 1AZBA 1N2RA 5FYKH 2V2XB 2A1WL 4LLDB 1NGZB 4AEEA 3LIZA 5JQ6L 3NP4A 2EIZB 1U33A 1XF5A 1CT8B 1MH5A 3V0VA 4YSRA 2DEYX 2YPLB 1IM9A 5AUMA 5KBLA 5CEYA 4PJ7E 1YPZE 4MHHI 2X7LB 3KEHA 1CK0L 1D2OA 1NFDA 4LQFH 1UWGH 2R69L 3WJMB 3MLUL 1D5ZA 4NZRL 4WQOA 4XE0A 1MSPA 1F90H 3IGAA 1UA7A 4DETA 4LOUC 2P1YA 3OSVA 1Z2KA 2L8AA 3OR7B 4YDZA 3W11C 4S0HA 1M4KA 2B1AH 2X38A 1A8JH 3TNMA 3UIYA 1WCBA 1B88A 3EH4B 1C5BH 3O3UN 4FP8L 4ZO6A 1LO4H 1AQHA 2RAMA 2W9EH 2IADA 4XMKL 4Q0XH 5E6ID 3OKYA 5CP3A 1YJDH 2RJMA 1B0RB 3ABMB 2NTSP 4WJ5A 5E8OB 1J10A 5FYKE 5EZIL 2QSQA 3TF4A 1BD2D 3VI4F 1TCMA 2YZ8A 2X6UA 4IRZA 2UYLA 1PG7X 2AQNA 1CLOL 1DUZA 4NN6C 5E24E 4NIYE 1ACYH 3W9DA 4Z7QE 3VNYA 1X7SA 1FZMB 3QEQB 1QP1A 1SPDA 5JW5B 3NZ8A 2H32H 3WS6C 1YUKB 1AXSB 1OXYA 2C3WA 3CPLB 3GI8H 4YFDB 5IVZA 1T2JA 3ZHLA 4BH8B 3WIHH 1JGUL 3SE6A 1N12A 3MNDA 2V5SA 4N0FA 5C0BD 3UTZA 1SJHA 1QRKA 3RFZB 1J87A 1UM4H 2BSCA 3D85A 4RMWA 2XFXA 3HC2A 4C4KO 2ATAA 3WTYA 3ARGB 1ZLVH 3S35X 4CRPA 2IFGA 4Y1AB 1JNNL 2D7TH 2E5EA 3L17A 3DRQA 4BZ2L 2WC7A 4WNQB 2IDUA 3L5HA 4JREC 4OB5H 4JZJA 4QRPA 4QRRD 4YDMA 3BQUD 1MXGA 3OXSA 2IGLA 4XP5H 4FABH 2BIHA 3QG6A 3VXUE 1Z9LA 4XP4L 2Z7YA 4KVNL 4P4KB 4LKXB 1HSBB 3UP6A 3CZUB 4YDIH 3BJLA 3CVHA 4L3FA 3H9SE 2LU3A 4Y2NA 3LZRA 1KGCD 3T3MB 3NEEA 2VITB 3H2PA 4L4VA 2LGNA 4MS6A 3HG4A 4GP5B 4OLWL 1BVOA 5EA0H 3EFFA 4AV0A 5K9KB 4HISA 1OTTD 1PTZA 3TX4A 1KC5H 4EI5C 5IVXE 4KGJA 3RY4A 2AEPH 4WFEE 3RFRA 4RISH 4RNRB 5C08B 4YDKH 1HEHC 3BJ91 2ID5A 3RZCB 1Y6NR 4NOBA 1NLDL 3R0MA 1IO4C 3UYRH 4FC3E 1TNNA 3KPPA 1UADC 3OLEA 1JV2A 5I16B 3QUXB 5T3XH 1OGTA 1T5XA 3GZKA 4NC2B 4UTBL 4K7FA 2M83A 3X3GL 2FWLB 2GBAA 1RFDL 3SKNA 1EXUA 4GT7A 4KKRA 3V4LA 1Z5LB 3MX0B 3FN0L 3QUMA 2UVEA 2MQGA 4HG4J 5C0DB 1DQJB 3X2QB 4UT7L 1KZYA 4AQAA 3PWLB 3ARUA 2X4TB 3MV9E 1X5JA 2DQDH 2Z93B 5I1EL 2ZOKB 3WLBA 2XQ0A 5T1DL 1VGEH 4K5LA 3V4VA 3RGHA 4DPBX 2GITA 3CBJB 3WEXB 5DD5L 4BXVA 4IS6B 4TULL 2VMFA 2EECA 1BG9A 3NCJH 5DWUL 1IC4H 1ZIAA 3HJ0A 3F5WA 4MMZA 5D6DA 4PM1A 1HL4A 3MBXH 3SKOA 1AH1A 4XN1A 4NQDD 3VA6A 1AZNA 5T3XE 1HHIB 3KPLA 4AVKA 2Q7AA 5JW4N 1A1NA 2PTUA 3BVWA 5H35B 3QXDB 3OPUA 4PJDF 1EGJH 2GUOA 4OD1H 3MXVL 3MRMA 4Q56A 1H15B 5IF0B 4YPJA 3F7QA 4M56A 3PIQA 3TIDB 2LQRA 1YY9C 2HWZL 4HALA 3RIFK 4YAQB 1HE7A 3S3JA 3L3OA 2JLLA 2Z4QA 4PRPD 2BWQA 3D39B 4JPKH 5T5FH 4PJBA 3OHXB 3X13B 4XXCA 1DJSA 3P69A 1VADA 3QJHB 4XAKE 1YN6B 5D7IE 3NZHL 3U4EB 1ZGLA 4JFTA 5TJWK 2CO6A 3G5WA 1VHPA 2WJ7A 3P3TA 3WHXA 4ZW7A 2VQ4A 1VF5C 2BDNL 4IRSD 1O9VA 2XXGA 1F4WH 2Q5BA 4X8CA 4ZXBB 2WCGA 3T5WA 3ATBA 1G7QB 5D7LD 4KKPA 4HX1B 5E51A 3F12B 5BO1L 3TCLB 3T2QA 2VDPL 1QBMH 1CF1A 4NIKB 3QIBA 2EIJB 3MNVA 1KFAL 2HJKA 4JJOA 5E6IB 4RMSA 4QTHA 2X10A 3IS1X 3ZXAC 1DVXA 1R4XA 1X5FA 3VFPB 3VMPA 1BD2B 1RU9H 4LPUA 4PJCE 2WN2A 4IKIA 1MVYA 4WNJA 4MNQA 4CILA 1IGYB 2XBTA 4KRPC 2LTQC 3BLPX 1UM6H 1S9KC 3RIKA 1J5CA 3QJVB 1B90A 3F7VA 5IIEB 4XCFL 3AU1B 1QFOA 4QXUH 4B0MM 1SEQL 1T04B 1MHPL 3UTTD 4UIMA 2G9KA 3LPFA 4LBEA 5I30H 3MN8A 5J7CC 1UD2A 1GS8A 4RFOH 2YAOA 2X9YA 3NJVA 1UZ6F 2VDOB 2HKFH 1MXDA 3HAEB 43CAB 5CM1A 3KXFA 3WFHA 1QSEA 5HYJE 1MAJA 4GW4B 3ECVA 5DHXB 5C0BB 2NX5A 4K8RL 4S1RH 1WYJA 1KTJA 3JXAA 2NUTA 3HUJA 2R2BA 4XNUH 2IFFL 5HSFA 4ZD3H 3P0YH 1URIA 2EC8A 1NGWB 3KDMB 3PNWB 4HPYL 5CEXA 3BDXA 3VWKB 4UQ3A 1QD0A 3C5SA 2F58L 2WANA 3GSWA 3I2CL 4K3EH 2CMRH 4QRRB 1TENA 1HZHH 1M71A 1E4HA 2PW1B 4RGND 1ZLSH 3WKYA 2FE0A 1BM3H 2OR9L 4LLMA 5JR1L 2DIBA 3ZHFA 4QF1A 1JPFA 2Y0SA 5D7HA 3GM0A 5F7MC 1XB8A 3HPLB 3R06B 5AW7B 1T03L 4AYEC 5DJXB 2EILB 4IGBD 4PJHE 5DJ6A 4IU3B 5JDJA 1PW3A 1Q9OA 3WY1A 3PWJB 4NPYA 4P04A 2IOOA 4Z7VE 5M95B 2Z0BA 1RCYA 4NQEB 1XWVA 2DYRB 3D0LA 3PWPD 3RY6C 3CAFA 4X7SH 1MIMH 2IDQA 3MCKA 4KUZL 4UU9A 1J5OH 1YC7A 3UYPA 4NQCB 1HZLA 1PY9A 3HBQA 4JFQA 3UP1A 4B9FA 2G5BB 4N0YH 2D3NA 5FR3A 5KYWB 4X6DE 2JWYA 1CFTA 1I53A 1IUZA 1OQXA 1RULH 4PJAE 1S7VA 1IIKA 3CVIH 3N1QC 1T1XA 3PV6A 5FC9A 1FFOA 1FRGL 1KYFA 1QHQA 4LP8A 1NL0H 1Q9WB 5CU9A 5DMGD 4FNUA 3GHBL 4PRHE 2WXNA 3FTUA 3N0AA 3N1GC 4LCWB 1KWGA 2CIKA 5DRWA 1KEGH 2AF2A 1A6TB 2XZCL 3GNML 5J9PB 4OIIL 4OI9A 2JXMB 3W0WE 3KPQA 3TFKC 4B96A 4OGYL 3L9RB 3WXVL 5I1IH 4HK3J 3IMVA 1HCZA 3B5TA 3EW3B 3D52A 3CN2A 3MJ9A 1CG9B 1ZA3A 1JRHL 4N8VA 4POYA 1ED3A 4NQDB 3EO0A 5AOKA 1H9VA 1QNZH 1M2OA 1QBLH 1TQVA 1IL1A 3L3KB 2LVCA 1ZCRA 2AKRB 5INDB 1H8OA 2WLHA 4K5PA 5IVOA 1D6VH 5AKVA 3G5YA 1XGQA 4NO3B 1B3JA 1T22B 3D18A 4P9ML 5K1JA 3QRBA 3ROOB 3I9GL 4C58B 5G55A 3OKKA 1YNKL 4PJEE 4L8BA 1UUSA 3WS3A 3UBXA 4DAGL 4RDQG 1HILA 5HHQA 1SOKA 4WO4A 1TO5A 2XN9D 1GZQA 5KZCD 2K6WA 3Q1SH 3EYVB 4FNPA 5BZDB 1A9EB 3NSJA 1T66D 3HG0A 4O5LH 1OF0A 3DGGB 4JM4H 3GMNB 1NAMA 4B7LA 2QSCL 4J3SA 5ANMA 1YMMD 3LHPH 1BZ7A 4YIQB 4WDIA 1FN4B 3MA9L 4X6CE 2C1OB 4ZMXA 3LVTA 4IRSB 2IIJA 1ETB1 3ZRSA 2DV6A 4XB3A 3W38A 1AQMA 5F97E 2X41A 3ZSTA 4PI0A 1AS7A 1AYRA 5D7LB 3NJIA 1MFMA 3FT4A 3IB4A 3O4OB 2A6IA 3QPQC 2Q6WA 5GGSA 2GG1A 2VDMB 2Q2EB 3RG1C 2VSKB 4NKOA 3FH5A 4I1RA 1P4LB 3REWB 8CGTA 3VU1A 4ADGA 4LVHB 3DJ9A 2YAMA 1TQCB 3BAIA 3QK0A 4NX0A 4Z18A 3RWEA 2R8SL 5I8KL 1XGUB 3QDGE 2NXYC 2Q8BH 2A4ZA 1F90L 4MAYC 3PQYE 4Y19A 1KJ3H 4EDWH 1IEBA 4GRWB 4A7GA 2B1AL 3WFEH 1AAJA 1EO7A 1G0XA 3U1SH 1RZKC 1C5BL 4Y5YA 1LO4L 4JR9L 1Q1JH 1T21A 2A77H 4B9JA 1RZKH 1RURH 4NLHA 3WFBL 4Q0XL 4DK3A 3MJGX 5F2FA 3UTTB 1YJDL 1WZ1H 3OG4B 4S10A 1N5YH 3IDIA 3FO0H 1KLFA 2IGTA 2Q7YA 1PKQE 3NFPA 4PYHA 3RKPA 1ZT1A 4PTUA 3WIIH 5C0JB 5CKGA 4FDWA 3ZKND 3WMSA 3RX7A 1CXLA 5L8KB 2EUXA 4UTAL 4J12A 1MELA 1IT9H 2DMKA 2DLFH 4OF6A 2J4WL 4RGOH 4XXWA 3RUGF 3U6XA 3VFOA 3OZLA 1T0MA 2OCFD 3GIZH 1MEXL 2BIIA 1P7QB 3HZVB 4UT9H 1CICD 3ARQA 3LKNB 5KSVA 4OZ4B 3FC8A 4JZOA 3KPMB 4WI3A 1NEZG 4RGNB 2B14A 3CIQA 3WIHL 2VZ1A 3LB6C 1A3RL 4TNVK 2OSWA 4L1TA 3OAWA 1MJJA 1UM4L 1JFHA 4IGBB 5E5RB 4Q52A 4ZW5A 4XGZA 3H7BB 5DD3L 3AREA 5F9JB 2QKIA 2D7TL 2Y25A 2YRZA 3HB3B 3O2DA 3D33A 5AG9A 4L8SA 1Z5HA 3PWPB 2OYMA 4BHUA 1VGKB 3ZTEA 4XMPH 5J6HB 4WW2F 4HETA 4H7VA 4CADA 4FABL 1PLGH 4J4PD 4AKPA 4BFGA 1PQZB 4E2OA 5E5LA 5JIKA 2H2SC 3QFGA 3N40F 1O6SB 4YDIL 4F15C 3D1MC 1C7TA 4Q2ZA 3TA3A 3B3IA 2JKTM 3EDEA 3L3JA 4A7UA 3WY3A 3GSQB 1NBQA 2JQZA 1C7SA 3SGDH 5EA0L 5FV1L 1N8ZA 3OC5A 2D31B 4DN3L 1KC5L 3QIWD 3RWJA 4YX2H 4FFZA 4QRSB 1KYOJ 2Y6SD 3BP5B 3RWDB 1PZ2A 2VLRA 1MCPH 4RISL 3ZT5A 4OFPA 4YDKL 3C8KB 1P5UC 4KKAD 5E1AA 2JB5H 4PRNB 4QRQB 5F89B 4PGBB 2ZWSA 4A67A 2NY1C 2KZBA 3SCMC 1QSFA 1IEAA 5T3XL 1ZLWH 3S37X 1P7KB 4NNPH 3ZKMD 4ZUWB 1FVCA 1DZ0A 3VTMA 1I9RH 4KH2A 4PLOB 4LKCA 3QI9A 4NNXA 1KBBA 5LKNA 2CXGA 1WBYA 2H9GB 1HNFA 3C08H 5E9AA 4FYSA 4M02A 1FLTX 3QYCA 5BZWB 2F5AH 1KNOB 2BIOA 4KXBA 2P52A 2DICA 1MFUA 3UTPD 1JWSA 2PCPA 1VGEL 1RJLB 3RUGA 1G87A 2H0FA 4JAMB 4NHUA 3F04A 2PKDA 3Q2NA 1F0LA 4Z78A 5CIPB 1DYZA 3CFCH 4IBSA 2NY0D 3NYKA 3EYFA 2XN9B 2Y07H 3KMDA 2JKWA 2FBRA 3G6DH 3KS0H 5LGYA 4AE0A 3MLPA 1LE5B 5EBWA 2ZP8A 1CGYA 1TTFA 3KWUA 2XT1B 4XN4A 3VFTB 4OD1L 4PJXE 2FO4A 3Q06A 1YMMB 3T4AC 5TTRA 4DP9X 2UX7A 1RK1A 4HV8B 4AQ8C 3O0RH 5IEHB 1PJ9A 1DE4A 2NPLX 4O51A 1OT2A 1SM3H 2NW3B 5JPNC 4PN6A 3FPYA 1VFBB 3MNZB 2OKMA 1QX1A 3DX9A 2VDLL 1E30A 1GC1H 2JCCB 3DSFH 3FH8A 3GSUB 5EC2B 1C08A 5JIQA 5F7WC 4ZX4A 4JPKL 5T5FL 1SHXA 3FSZA 4MA1C 5C7ZA 2P5EA 3GJFB 1QEXA 5IOPA 1U3NA 1MLCB 4HIJA 4X6BB 3I02A 1TZIA 5IB1B 5E1IA 2FB4H 3HVDA 3OGCA 2E59A 2X3AA 1EH9A 3AMLA 3FUJA 2O6FA 4P46C 4G3YL 4FQXC 1CJYA 1F4WL 2DY2A 2FJHA 1UATA 3RHWK 3G5VB 3WTVA 1G7HA 1JF5A 3KL3A 5ELIA 5DD0H 1Q9LB 5CN2A 1U4FA 2AJYH 3SE3A 2UY7A 2ZSWB 4ENED 3GXUB 4K71C 1OCZB 5GS1B 3T1FA 4ZG1A 3QYNA 3JWNH 3GXTA 1FYTA 5GS0C 2LR4A 2KYIA 2J1WA 2CIIA 4I4WA 1DBML 3VXTB 5IK3A 1IAKA 4YK4B 2XZQL 1MG3C 5I1LB 3NCEB 1RU9L 4BQCA 2MQ0A 4D0CB 3QULB 1LWRA 1BIIB 1OK8A 2ITCA 3E6FB 4HKXB 1URLA 2K3TA 2P8PA 3FRUB 5ID0A 2EH7H 4JY4B 1I8UA 5DR5H 3SDCC 3SBPA 4OI8A 2YIHA 2B77A 1JHLH 1Y07A 2RIKA 4KQ3H 4QXUL 1RZ7H 5D55A 5D6CB 1U8MA 3GLEA 5GGQH 4DW2L 3BT2H 5I30L 5G5DB 1MFVA 3BH8A 4RFOL 1IKNC 5DS8A 3RVWD 5AENA 2HKFL 1BQUA 2Y69B 4UILH 5DUJA 3JWNE 4CKVX 1AG6A 3OSKA 3ARDA 5GHWH 4Y16D 1VACA 4S1RL 3TT1H 1U8IB 4ZUTA 3TJPA 1J9RA 3VTAA 7PCYA 1BG1A 4XCEB 1WA1X 3WENA 3CVBA 1T1ZA 3EOBA 4OLVH 5GRYA 3P0YL 4ZD3L 1HHKA 1JNHB 3QZLA 4GXUN 4ZNCD 2HJLB 2EABA 3FU7A 4I18A 4NP4H 4XVSH 1HK6A 2ZOWA 2VLKD 1KPVB 3OKLB 5LBSA 3VXME 4NO2A 1W8EA 4KDWA 3K2MC 2B5IC 2HT4D 2HPOA 1G5GA 1HZHL 5BUAA 3ZSSA 5FDWB 1ZLSL 5CMAA 1BM3L 2YOCA 1SDDB 5B1CA 3Q8AA 3T09A 4JO4H 4W68A 1SXAA 3C5XA 2DLHA 4NUGH 1A2YB 4OCYH 3PGFH 1OLZA 2FATH 3GMOA 4HP5A 1OTUC 3OXRB 2ADFH 3QP3A 1R3IH 3SIKA 5C0RH 1SYVB 2WHVA 3QJFA 2AMUA 1IC7H 1F18A 4G6JL 3TF7C 4BZ1H 3EGDA 3FMGH 3O45B 4X7SL 4CSSA 1MIML 4ONHA 2W94A 2XC8A 3ESNA 3O6KH 1U91A 2VGLM 3QIWB 4M61A 4WWKD 3TPUA 2D03H 1M2VA 1B6DA 2AI0H 5T1MA 5KS9E 1SY6A 1XH3B 4N0YL 2NW2A 1DLFL 2E46A 4FEIA 2C3XA 2V9TA 1HYRC 3RWCA 4TLTA 3C6EA 4FXKC 1RULL 3CVIL 3VSVA 1MHHA 3L7EB 5EBLA 5EZLB 3Q2LA 1XO8A 5LAPA 3VDAA 2CUIA 4HWBA 3SGKA 3BDBA 3IDXL 2WZ5A 1UEYA 2OTUB 4DPAX 1NL0L 3EO1B 1R47A 3HTLX 1G5AA 4AG4H 4UYQA 1WBZA 1E2WA 1S7TA 3FO2B 5ABZA 3ECUA 2P44B 1KEGL 3VB9A 1Z9PA 4X83A 3C6LD 3MGAA 3TZVC 4QYAA 1ZA6A 4XBEL 1IGCH 4K5NA 5E00B 5I1DB 5EU6B 4R96B 4QRTA 5TDNB 1FZOA 2KZKA 4XVTL 1KCUL 4CUCA 1F8TH 1JK9B 4J1UA 2NY0B 2ZUQC 2EEFA 4YLBA 3NZSA 3SQOH 3MOAH 3HKZA 5CD3A 3ZIMA 1QNZL 4IOSD 4OZFA 4A7QA 3NCBB 1QBLL 5D9SB 4F92B 1J9CT 2ICWB 2DQEH 1F6AB 3BP7B 2BNRD 3BUQA 3DX0A 4CW1B 5SWQB 2Z34A 3H53A 1D6VL 1GMEA 3V6FA 5JYLA 1FGVH 3PCYA 5DJAA 3Q8FA 2A7BA 3AFLA 3FQTA 4QOKB 1G7IB 1N70A 1OGPA 4R7DA 4HUKB 4HJUA 5DHVH 3CFTA 1U3HD 5C0FB 4E9YA 1HWHB 5ISZA 3SDDA 3VRIA 4E9XA 3DIVA 2YOAA 4MNGB 1OSPH 4F57H 5CXPA 2IANA 3E1ZA 3QJZA 2VXQA 4AXWB 1NSNH 3G9VA 3X1BA 4L8CA 4U0QB 5E4EC 3A67H 2J57A 4DP2X 1JZIA 2DQGH 3ULUH 3FFCB 4JMXA 4P2CG 3N2JA 1AVAA 4CSPA 1E90A 2A6KB 5JYMA 2LU7A 3FT2B 1B2YA 4E41E 1F4AA 4CVXA 3LQZA 5K59F 1JZ6A 5ICZA 3ESVF 1MWAB 3CE1A 3MDJA 2DTMH 2P7TA 2V6HA 3K6FA 3KYMA 4ONGH 2UXFA 3F7YB 3IMTA 3EJUA 4X5RA 2Q8BL 5I66A 4KQ4L 5J13C 1YPZF 4ODUB 1NCNA 3TYFA 3L1FA 1MRFH 3KLDA 1KJ3L 4EDWL 1BX2B 2AJ3A 3G08B 4YDNA 1J48A 3LX9A 5E8PB 3P4NB 3PABB 3WFEL 5HJDA 3U1SL 3QJOA 3SGEI 1YN7A 3ZKXB 3H8NA 3VFMB 1UHVA 5CP7B 2M26A 1AIZA 1Q1JL 1UA3A 2TRYA 3EJSA 1RURL 3GSXB 4Y89A 4JG0H 4LVOC 1ZLUH 1JZ4A 4FL4C 1N5YL 4EUPA 1M7IB 4U1JB 3HZMB 3TIEA 4HUXB 2OXGB 2YQ2A 3AXIA 4PJ5E 5IBUB 3WIIL 3EJRA 1D5IH 1HSAB 3ARVA 5EV7A 5D93C 4HHAA 4OZGE 1HCYA 3QQ3A 4O4YH 3HI5H 4FJ6A 1F11B 4Y16B 4GJTB 3QIUD 1FG9C 3VXQB 3U7AA 2R29H 1DVFA 2A0LD 2CUHA 3GIZL 1JPGA 4W9DC 2VLKB 4TVPH 3GSNA 4GUCA 3L4ZA 2IH1B 4HC1A 1WWWX 1BMGA 2ADJB 2FEEL 5CBEA 2GK0B 2YR3A 3LZPA 5BV7C 4M3HA 2PUQT 1CR9H 4JFWA 2VSDA 2P3YA 3BESR 1NC2D 1NKRA 2EXTA 5CN3A 3B9KD 3LNIA 2W8CA 3HE6C 1X6LA 4K9EC 5SWZE 3FTZA 1BVNP 4XMTA 3APFA 3M7OA 1QHPA 1P84J 3L3GB 4ETQA 3ZDXF 4ZFOB 5C09A 2BRRH 2TSAA 4NYLA 5EZJB 4TNWF 5I82A 4WKZA 2VUYA 4XMPL 5IJDC 3I6LE 2RD0A 1BEXA 2GJ6D 1KV3A 1JRHI 3KLLA 4NXSA 4XN9A 1EA9C 1RLBA 4LEXH 5DT1H 1FBIH 4D94A 4MJID 4MB5A 5C0CD 1CTMA 4OV5B 3FOLA 1T7XA 3B43A 2NXZC 2R0LL 3WJLA 2IPKA 3GD1C 3BEVB 4TLSA 1RZGB 4JRWA 1OEZW 3PJNA 4YXLH 1HE8A 2MHAA 4LSRL 1F00I 2VE6B 4NGHL 4JQVA 4YX2L 3A5VA 2P43B 1EDYA 2JJTC 3OJDA 5I5JA 4KMLB 4K23H 3WFCH 1MCPL 3U6XS 1N9PA 4PJ7A 3LPWA 4ELDA 5JW3H 4ISVB 3JZYA 5IVXF 5A1AA 2HVJA 5DGRA 3GPSA 3WEOA 2JB5L 3C6LB 4D3CH 5DLLA 3GZOA 1EXGA 1E8ZA 2VKXA 2XFGB 3A4EA 1E5AA 5FK9A 4NNPL 4A04A 4YLCA 3VFGH 1BBDH 1AFVH 4ZAKA 5IROC 1W0VA 5DHDA 1R3HB 3RWFA 1C8QA 4J3UA 4F9LC 2VXVL 1QO3B 3FFDA 2YSTA 4WSKA 4DERA 4YHOH 1KDIA 3OM3B 4Y4HA 3L3IA 4M7LT 1UGKA 4RLDA 3CLEL 3C08L 3UDWC 3DC0A 4Y2DA 2MOQA 4XPHH 2BNRB 2F5AL 3FB5A 2OJEB 1NGYA 5C2BL 1ORSB 1U21A 2DS4A 3T2NH 2OLDA 2IF7A 4U05A 5JOFA 1WBXB 5DZ9A 1LEIB 1YNTB 4G42B 3NIFE 4TSAL 2EEDA 4Z7OB 3CZEA 3MROB 3IJSB 3CFCL 3F6LA 1DLHB 3KPTA 1U3HB 1CLVA 2ESVA 3P0VH 3NPSB 4NPJA 4AM0B 1K2DB 5KG9A 2PP7A 4GAGH 1E4KC 3RVUD 3ZZSA 2GCYB 2Z35A 2PN5A 1MFEH 2EXYD 4GG8B 1EHAA 3AXLB 3O0RL 4OCMC 2ATPB 1SM3L 4HEPA 4M29A 2DYSB 3DSFL 3MLXH 1GC1L 1R46A 4X4YA 1NC4D 3O3AB 5KUKA 3KD4A 1A6PA 2YPVL 1X7QA 3ABGA 4XVUD 4KU1A 3WYRA 2YUZA 4GG6F 2X42A 4PP1C 1QR4A 4WHCA 5A2LH 2X4NB 2DQTH 3OX8A 2Y6TE 2AVFA 4R4BB 2FB4L 3U79A 3L4XA 3TONA 2GJPA 2OPCA 2X09A 5KWYC 3O6FC 3OB0K 3WS6A 1E0OB 3DOSB 5ESVA 2YO3A 2FIRT 5DD0L 1KOAA 3H9SA 3TO2A 4L4TD 2PW2A 1M1XA 5JA8B 5C86A 3TBCA 4OZHE 3Q7JA 2Q86B 4LPYA 2IWFA 3CK0H 4LLAA 2P45B 4IU2A 1HEZA 4WEMB 1CYXA 4QI3A 4B3VA 3KPRD 1BXUA 5AOMA 2JJVA 5AYUH 4JL2A 4RBPK 3IXAB 4PJCF 4G5ZH 4ZO9A 3QIUB 2EH7L 4FKEA 15C8H 2GTWA 4W9HC 3JUZA 4X80H 1HOCA 1JHLL 1P2CA 2J43A 4HS3A 1A7PH 3AWFA 1T4KA 5AW2B 3WKML 4KQ3L 1RZ7L 1JHTB 1HIML 1KIPA 2V7NA 5GGQL 2A9BA 3BT2L 4UM9A 1AOZA 4PWGA 1JGVH 2WXOA 3CSGA 3F83A 3LV3B 4HK0B 4JHAH 5IM7B 1QPKA 3FCTB 2WKOA 1A8ZA 5E2TH 3MV9A 3GK8H 4W70A 1BLNA 5GHWL 4C54A 3P9MB 1IVTA 4QLRA 1NC2B 3DROA 4QXGH 2F54D 3B9KB 3DX7A 5FFGA 4OLVL 3V4PH 1PLCA 5I0WA 3M17A 4EI5A 1RKRA 1D7FA 4MA3A 2ETWA 4DP5X 3RI5F 4Z7NE 3CGTA 3WE1A 4JDEB 5C6PB 1BQHG 3U4BL 5I76A 4R4NC 4OU3A 2JH2A 2VERA 2EUZA 3BH9A 4GH7B 3U83A 5LNGA 1ZK9A 4AGPA 4JG1L 4OV6F 2GJ6B 4K8RC 1OSEA 4BQ9A 1IAOB 5DJ0A 1U30A 1X9LA 3UGUA 1FE8H 4NUGL 3CH1A 3EJJX 4OCYL 1MF2H 5ACZA 3PGFL 4NT6A 3CJJA 5BVJB 3B2MA 1FYHB 5C0RL 2ADFL 2R1YB 3KYNA 4M48H 1IC7L 3OKDA 1BQ5A 2JK5A 2DB8A 5DVNA 3TBSA 4BZ1L 3ILPB 4U6TA 3GSVB 5D7IA 4OVVA 1M6OA 3BP6B 3O6KL 2ARJB 1KJ2B 3CC5A 4ANWA 4NJ9H 3ZLQC 2D03L 2HCZX 5F1SA 3U48A 4FFWC 4NQQA 3U30C 3TT3L 3WJJC 4U7MA 5IT2H 2VIRB 4YXKH 3GLZA 3BGMA 2Z8RA 4RIRB 5AOZA 1I7ZA 1YZZA 1DJGA 2DQ6A 4G9FE 5BS0E 3FBKA 5CAYB 3QJXA 1IBHA 1ZT7A 2FLRT 3G04A 4EOWH 4FI6A 4UZGA 3NSFA 1L7TH 1CGSH 1UFUA 4AG4L 4JPSA 4KXDA 3S2AA 4QHKJ 4PY8J 4G7QB 2UY6A 3TVMB 5MEPA 1KGXA 4Z3EA 1KELH 5F1NB 1JP5A 5HHVH 3LXUX 1H3XA 4DSYA 5D72H 1IGCL 1S9YB 1FO0B 4HCRH 1DSWA 4ZUVB 4PB9H 4W9CC 1A7OH 1WAEA 1BZ8A 1ZS2A 4U6YA 1TKWA 4M93B 3BPOC 2NQDA 1F8TL 9CGTA 2ED7A 2VW4A 3CZKA 3UCQA 2VQTA 2B8OT 3SQOL 1ORQA 3P40A 3MOAL 1A1MA 3JWDH 2HG0A 3CTTA 2XYBA 4B97A 2DQEL 5F6IB 5TQ2H 1KB9K 4ADJA 4X5XA 3B6SB 3AADB 1NGQH 2XQYA 3NN8A 1KTKE 4AGOA 5HYJA 1FGVL 1MFAH 3UC0H 4L05A 4FQ1H 4XH2B 4CSZA 1EJOL 1K72A 5IB5A 1I82A 3G6JE 1X5ZA 3OAUL 3SDAC 1V55B 3P54A 4OZIA 1KCRH 3TU6A 4PJEF 2CHNA 3MLZL 4GQPH 2VJ0A 3NFNA 1HI6B 5IJVA 4GKNA 1SJEA 3WUWA 5FO8B 3U9PH 1A7QH 1KXHA 1OSPL 2CHZA 3TWCL 3J27A 5ICXB 1NSNL 2DJSA 3MTXA 5H37H 5E0FA 1O7SA 2MQ3A 3VFSB 4PV8B 4WTZG 1D6EB 1VZGA 3A67L 4IMLA 1N6UA 1THCA 3HZKB 2DQGL 4AT6A 4TUUA 4PJHA 3ULUL 3U46B 3EYSH 5GGTA 5B8CB 3BIBX 4ZMOA 5KYYA 4NQTA 1RUPH 2WQXA 4HT1H 4Z7VA 3CFDA 1HINH 4L4TB 4ZW3A 4KRLB 3T6ZA 2Q20A 3FW6A 4AI7A 2XV6B 1FHGA 2D7OA 4PI2A 4W4OA 1IBZA 3VXNA 3VXRA 5KJRH 1W15A 2DTML 4ONGL 2R15A 4P9HH 4QUOA 5JOPD 3LRSB 2X87A 4IKLA 2VDKL 1FVDA 1XF5B 1MH5B 3EOTL 4RGMB 3KPRB 1GPOL 2WXFA 4HIHA 3WAKA 1WD9A 4X6DA 2X4RB 3S5LA 2NRDA 4Y7OC 5DA0B 5CEYB 1EVUA 2J1ZA 4MJ6A 4PJAA 3RGVD 4R7LA 1NFDB 1K6QH 2ZOOA 1FNSH 2QZQA 3ZE0E 1H9DA 2YRPA 4NP9A 3U9WA 4B9PA 3MZGB 3D2UA 4JG0L 3IRCA 1KB5L 3EIFA 3FQWA 1HJCA 4TVUA 5E2WH 4PRHA 1WCBB 1M7UA 3WMPA 4JFXA 2JE8A 3VM7A 4YL4A 2IADB 2R2EA 1D5IL 2WWMC 2AK1H 3W0WA 5I0XA 1IZKA 2G2RA 3HI5L 4U7KA 3T3PF 2YD4A 4F93B 1U36A 3BW9A 4JRFA 4MKMA 2V17L 2R29L 4BXSV 2HN7B 2BP3A 4GAJH 4L3CB 5DS2A 2UYLB 4TVPL 4PMEA 4EMZA 1GOGA 1DUZB 4P5TC 1QEWB 3KE0A 4J2QA 4BKSC 3E80A 5EC1A 4CDHA 5EB9A 3VQLA 3HOGA 1FP5A 3NZ8B 5BPPA 1KGUA 2FNWA 2MQCA 3FHEA 4MJ2A 5I6PA 1ZV5A 4HUCA 1A6WH 1MZYA 4MDJA 4PJEA 1T80A 5D7JC 2K7PA 4S0TD 3TBTA 1U6AH 1WFUA 4BYHA 4N0FB 5GS2D 3UTZB 2FJSA 2OBGA 4LSTL 3D85B 2L04A 4PD4K 1RHFA 3ZOAA 3KHQA 3GM8A 1DUYB 1OSZA 2ITDB 1AO7A 2XVBA 3DRQB 4N2AA 1XCWA 4ELKA 4X9HA 3C2AL 3MRGB 3MRDA 3N0PB 4QRPB 1DVUA 3I84A 4JRYD 4X6CA 5DT1L 1FBIL 4XXDB 1JFQH 2R9HD 4G7RB 3LZOA 3C60A 5KSAD 3GSOB 2QBWA 4HSCX 3PL6D 1UC6A 3Q6GL 3WI9A 3QG6B 3CQFA 1UWEH 4G1MA 5DMYA 4X9YA 4B5ZA 3UJIH 4HUVB 1MI5E 3K0WA 2GBTA 5DK0A 1YEKH 1KTLA 4OF7A 3LN5A 1MHEB 4L4VB 3MUZ1 4WHTA 2QVTA 1A66A 3DIFA 1MQ8A 2YUVA 4K23L 4Q89A 5D71H 3WFCL 1ACCA 4MQSB 5JW3L 2EVGA 5GPRA 2WBKA 4YJZL 3M8OH 3QDGA 4X98A 3QZOA 4H0HB 5D8JH 3VXOB 3B5GA 1VZIA 1F58H 4LLYB 4EBQH 3PQYA 3RPIA 4PAZA 1F6LL 1BBDL 2YC1A 5HDRA 1AFVL 4F3FA 4NM4H 1DJZA 4ZYKA 3IN2A 3KPPB 1EEUA 1PAMA 1JV2B 2MFNA 3PHOA 4NZTH 1XV8A 2DWEA 4YHOL 1RJYA 4K7FB 3N9GH 5CLYA 43C9A 1E28A 1FG2B 1TDQA 2JQMA 2WXPA 4FERA 4GRMB 4P2YA 4XPHL 3SKNB 1PKQA 2BVPA 1U8KB 3QUMB 3O8XD 1M3JA 4PV9A 3T2NL 4KJWD 2EDXA 1TETH 4JFED 4RFEA 1I9IL 5E9DA 3TV3L 4AQAB 3KGSA 1E65A 3UMNA 1D5XB 2WPGA 3ZDZE 3WLBB 2CJSA 5A2JH 4D9RD 3SBWC 1FH5H 3UG5A 3V4VB 3P0VL 4GEJA 3JT2A 1YO4A 4MAYA 4KBPA 4GAGL 3HS0B 5C2UB 4LLUA 3NK4A 2VXSL 4HJ1A 1MFEL 3EUUA 1NCTA 4PJXF 4OCXL 3GRWA 1GYUA 1A1NB 4R83A 5K39A 2GUOB 3MRMB 4GRWH 3MLXL 1QQDA 3HC0B 3IAPA 4M4PA 2BNUB 5T1LD 3UBFA 1K5NA 2YGPA 1BZEA 2HRLA 1OP4A 1HHHB 1X4XA 4WLCA 4A6YA 4ZFFA 4Z7WF 3HRZB 4GO9A 1RPQA 4EN3C 2I60H 4HLJA 5TF1H 4W9IC 2N3JA 2DJUA 3AGWA 1D7DA 3L3OB 2DQTL 4P2OC 4JFOA 1FC2D 2G5UA 4UT9A 1JDDA 2B20A 2IJ0C 2CKBB 2L7QA 2XLLA 5AYQA 5E70A 1DO6A 4KK9D 4TQHA 2FEEI 3DLQR 2AITA 3CMGA 4QRUB 4XCYA 4YHIA 5GGRB 3ESMA 3WHXB 4ICXA 1QOKA 4WIQA 4N5EC 1QLFA 4R7VA 3RGVB 4JZNA 4ZX6A 3TS8A 5H94A 2Z92B 1PZAA 2Y5EA 4EDXA 4XHQA 3VU2A 3PWUA 5ILTH 3CK0L 4PWJA 3CUPA 4ZODA 4R5VA 5E7BA 3V4UH 3WIFA 3GBNL 4X7TA 5H4YA 1O9ZA 1J8HA 4BQ6A 4R0LC 3D06A 1GIGH 1KY6A 3QIBB 4J28A 2VZ3A 1ZLDA 3DYOA 3MNVB 2HJKB 2WYIA 3MSPA 4TNEA 2QQLL 3WNLA 1SRDA 4QTHB 1NMBH 1ESOA 2JKRM 5AYUL 1KG0A 4NNYA 4G5ZL 4A2LA 4D7PA 1GA2A 1XR8A 2UZXA 3QFDB 3W9EB 15C8L 2F1EA 1GGYA 4FLHA 3NA4A 4MNQB 3VA2C 1O7DC 4GO6B 3R0NA 1OT1A 2Q3ZA 1JGVL 3IBEA 3PXLA 2WVVA 4JHAL 4QNPF 1OLLA 3JWOC 1ADQH 1I8KA 2X4SA 2AV7A 4AYDC 3GK8L 3VGHA 4OFDA 4YFLF 3MV7E 4K4KA 3NP3A 4QXGL 3SDYH 4KX9A 5BQ7A 5I71C 3U9UA 3TBWB 4PW3A 2XKNB 3WTSA 1LM8V 5HYEA 1TVDA 4CAGA 3MNWA 5D4QA 2NUTB 3HUJB 3X14A 4PQXA 1P5UA 2OTWA 3ME0B 3D4CA 4LCUB 1C8PA 3SCMA 5CEXB 4ZZKA 1YYLL 4Z5RB 5KVEL 4UQ3B 1UEMA 2YMOA 4PJDB 1E7VA 5KAQF 3AROA 1FE8L 2ZKWA 2QGBA 2NY6C 3PHQA 4TRPL 3VGAB 1MF2L 2GYSA 3B1TA 1W72A 1L7IH 3UOAB 5KSAB 3B9EA 3PL6B 4JFFD 4QF1B 2XI9A 4B9KC 4M48L 4XX1G 5DJ6B 2L3BA 5IY5B 1NCBH 5DZJA 3CHQA 1Q9OB 4NPYB 4C8XA 1JG9A 4RQQA 3AM8C 2HTKC 2D0FA 1OGSA 4E68A 4B5EA 3GMLA 3BVDB 1JF1A 3MCKB 2RFXB 4UU9B 1Q72H 3R7QA 4UINH 5FA3A 3DUUA 3UYPB 3KPNA 4A39A 4AMKH 2I24N 3KZ8A 1PFOA 1Y0LB 2ZUSA 2CRMA 1YYML 2ZWLT 4YXKL 5IT2L 3RJDA 4Z0XA 1MFNA 1OD9A 3BYYA 3T4AA 1CFTB 3T0BA 4AQ8A 4AOFA 4JB9L 1KJVA 2EAEA 4M8QB 1L7TL 1CGSL 1S7VB 2QLVB 3WO4B 5JPNA 4L9LC 4X6FB 1T1XB 4JKWA 3THMH 5EZOL 3K8LA 4X9BA 4KTGA 2PPFA 3V95A 3ZYZA 1KELL 2PABA 2X6BA 4ZDHB 4I5BB 1J1XH 5AZEH 5L0QC 5D72L 3JZ7A 4HCRL 3QDJD 4W9FC 2PO6D 3RDTD 1H8LA 2HXAA 3ZW3A 1CLYL 4EIBA 1H8NA 3KPQB 4HIIA 3ZL2A 4B53A 2YWZA 2WTRB 2Y3AA 3OKOB 4X0KB 5FAAA 4JDTH 4P46A 3EHBC 2EDTA 2JB6A 1HL8A 4FQXA 4KZEH 3JWDL 3MLSH 3OR6A 5DYOA 3IAGC 5TQ2L 1L6ZA 2Y24A 3GTVA 1J0KA 1NGQL 3TBBA 2VM4A 3EO0B 4XHJD 3VD7A 3ZHKA 4PR5B 1I9JH 5DC2A 1MFAL 1MRCH 1V7MH 5HHOE 3LXBA 3QS3A 4U6XA 3S5ZA 1AD9B 3O2WH 4P2RD 5T1LB 1KCRL 3G5YB 5HGAB 2P24B 3CWGA 2WZPA 3D18B 4GQ9L 1EHLH 4O2EB 3G6AA 3OKKB 3H85A 4C56E 1UGNA 4L8BB 3WS3B 4KY2A 1HILB 1INDL 1S9XA 4WO4B 1KN2H 2OA9A 4QCIA 1GZQB 3LAFA 1JPSH 3SDCA 3A3YB 4YHLH 3ULVC 5DO8A 4BK4A 4GI8A 5B7FA 1PLBA 5BVPL 2H5UA 4GMTL 5ANMB 4U1GB 3EYSL 1JCKA 5GRXG 4B9ZA 1DBAH 1RUPL 1IKNA 4AJ0A 4HT1L 1I3RA 1PD6A 1UM5H 4WI8A 1HINL 4P57A 1JYXA 2J8UF 2C5DC 3AABA 4URKA 1OB1A 2AQRA 3A6BH 3AT8A 5T33L 4M62H 5KJRL 2VDOL 1CFQB 1JI2A 2WLYA 4B9CA 3FT4B 2GQHA 3BAYA 2A6IB 2Q6WB 4P9HL 4XBGA 4QLWA 4TQIA 1JWMA 4MS8C 5KS9A 3OC8A 4HMEA 3U4KA 3UH8A 3VG9C 1SEBA 1A4BA 3NSXA 1K6QL 1A4AA 3FSOA 1D7BA 1T20A 2FHBA 1KIRA 3ULVE 1V7NL 2J25A 4XI5D 5A16A 3F05A 3QQ4B 4BFRA 5DFVC 2ALAA 1IEBB 1AMXA 12E8H 4DEWA 1WZLA 5E2WL 1Z5YD 2WINB 3ULUF 5SX5K 4Y5YB 4C57C 3MRKA 5D96C 1T21B 3KBEA 1P7BA 1MW1A 2DMHA 2J12B 2ZP0T 5F72S 2CO2A 3LKPB 3FJTA 2ZX8A 1KLFB 1E8YA 2Q7YB 3K4ZA 4AW4A 4JFDE 1ZT1B 4PTUB 5LHDA 4OKDA 4TUJB 1G9EA 5LO7A 3GMQA 3HBPA 3S2CA 4ZX5A 1T0MB 3JVGC 4W4NA 5GGRY 2BZDA 2J5WA 3KLHC 1AR1C 1BZOA 2HTLD 4GYBA 3EF7A 3EGXB 3VFVB 3CBRA 4BQBA 4D9LH 1LILA 2RHEA 2IXQA 3I3DA 3C09C 3FB6A 1EFXA 1A6WL 2B3IA 3WTWA 4ZZFA 3QEHA 4JFFB 3UC2A 1JGEA 4U3SA 4OCSL 1S7UA 5I75B 1MJJB 6FABH 2CGZA 2XKSA 4NC0B 4XGZB 2ISDA 3DO7B 2VXUH 1JAEA 5HPMA 3B2PA 3FONB 2QKIB 3QCUH 1TJMA 3LZQA 4N8VG 3N6YA 3SKMB 2ZCHH 1DDHA 3QQNA 4L8SB 4HD5A 1Q0YH 2MCPH 4NRZA 4WJG3 1ZWIA 1JFQL 3O41A 3CXHK 3IJ9A 2KDGA 4N2OA 1TZGH 1UWEL 5IFHL 2R1XA 1F2QA 1PSKH 3ARWA 3MRQA 1NINA 1FFTB 3O6LH 2HA1A 4H8WC 3UJIL 3UBXG 3QORD 3OV6A 4AIOA 4V2CB 1YEKL 1HN1A 4QO1B 5L9DH 1PGRB 1BECA 4Q2ZB 3B3IB 4S2SB 3L3JB 5D71L 3P30L 1SLVA 2Z31C 3KPSD 2HX7A 4NBYB 3M8OL 5D8JL 4S1DD 3RWJB 4M3KB 5FX3A 1F58L 3QDJB 4EBQL 1IFHL 2VLRB 2PO6B 3RDTB 1C5CH 32C2A 2A9MH 4IBYA 3SQBA 5JW4M 1GSKA 5E1AB 2DWSA 3NIGB 2GB2A 3FZUC 3GMRB 3BD3A 3K74B 1IEAB 4NZTL 2UUDH 4RMBA 3A4AA 2O30A 3N9GL 3FQNA 4WRLA 7FABH 1MW2A 3HR6A 4LKCB 3BN9C 4H0IA 4PJ5A 1Q94B 3SJVA 5DZNA 4ILDA 3S96A 4OZGA 3DMMC 1JVOA 5KTEH 3FUIA 2WNWA 2W5PA 5EOQH 4BH7A 2XTJC 4UNVA 3IM1A 4P2RB 4WUUA 4DKDC 1JWSB 1AQDB 2E6PA 2VDML 3NIFF 3RUGB 1FH5L 4NHUB 3QFJE 3MLYH 4XNAA 3ZGHA 3ILDA 4JEGB 3SSGA 4Z78B 3D4ZA 2DQUH 3CDZA 1MW0A 4I1NB 4PBWD 3EYFB 4JG9A 4WFHE 5EBWB 5B4MC 2Y7MA 2NYYD 4N2EA 4WWID 1JTTA 4APXA 5FGRA 3BAJA 1WVZA 3MLTB 2FO4B 3OLDA 5FS5A 4HJGA 1RK1B 5SWZA 2R69A 3WL9A 2FQGA 4DJMA 2CM5A 3PJSB 3DX9B 3QWOA 5C0GA 4LLQA 2I60L 3HCVB 4ODTH 3SPVB 3EBHA 3FTGA 4QHKI 4UTCA 4PY8I 5GSRA 5B21A 3GDCA 5CHNB 2XTJE 2ZKMX 2P5EB 4TLKA 2AJVL 5IOPB 4TTDC 4LHUD 4JKPH 2XA8H 1F3DJ 3I02B 3RJQB 1TZIB 4WW2B 4ES9A 1GYCA 4JFSA 5CN1A 1VFAB 3DK0A 2DJ4A 2J56A 3OGOE 4JFZH 4Y1SA 5EIIB 1I75A 2PCXA 1ZEAH 1FNHA 5IQMA 2Z8SA 1FFPB 3LSOA 5HVHB 1DZBA 1X5GA 3P77A 4ZO7A 4F2EA 1IZJA 1WSST 2FT8A 2ZSVB 4OBRA 2JF1A 2FJHB 1JIBA 1P1ZA 1VCAA 5HHXH 4G8IA 4PJ8D 1OW0C 1ZPUA 4KI5E 4N2FA 5A3ID 4OZHF 2ITFA 5TDPA 3V4UL 5HYQA 1G4MA 1BYOA 3HE6A 3OMIB 4PWKA 5B38B 1MDAA 3STZB 1GIGL 35C8H 2WSDA 3A6CL 4HIXH 1FC1A 2NNAB 5FYLH 3AQZA 1NMBL 4NQSA 3I3BA 2W65B 3ZRFC 4DK5A 2BVTA 1IAKB 2WLKA 3P73A 5JORB 1ZIBA 2W92A 2BWDA 2JIXA 3MOQA 2EKSB 5HI3C 1PJWA 5LB1A 4ONFH 1KMGA 1R3KB 2ITCB 4NUPA 4ALAL 1VKXA 4NI3A 2BM3A 5ID0B 2PCYA 2H1LM 1OT4A 4YC2C 5E08H 5CLTA 4BZ2A 1BF8A 4LVEA 2WCPA 2D7PA 3RX5A 3O9WC 1ADQL 5T3ZH 5FO7A 4PJFE 2BNQD 1AP2B 3ISWA 3BH8B 1RZJC 2CGYA 3UACA 2GC7C 4JM2C 4N90D 4OBSA 2JJTA 4MSWB 3ARDB 5GGSY 4ZUTB 1PX3A 1T1WB 2VSMB 3HS9A 1T1ZB 4MCYA 1IBGH 1HHKB 1WUNT 3GLDA 1Z0NA 2CK0H 4DGIH 4HG4K 4JQIA 1LE9A 4OGXL 5GZOC 1CTNA 5I74B 4MBOA 1UXWA 2K7QA 5IROA 5D1QC 4LHJB 2BVQB 4F9LA 3QNFA 2XZAH 4NN7B 5E1HB 1DQLL 4IHOB 1L7IL 2AGJL 5CMAB 2E9IA 3RVXD 4DGVH 1NGXA 3UDWA 4U3XA 3V2AR 5T3ZE 2B59B 3NCWA 3L5WA 5LLIC 1JYVA 4MCMA 3EYQC 3QORB 1PX4A 3LDBB 3GMOB 2A5UA 4IRJD 2HX8A 4P5KA 4GLRI 3TPKA 1HCVA 5GRZA 2X3BA 3ZYIA 4MDIA 1PZDA 4P8QA 3EGDB 3KPSB 4ONHB 2OS7A 4IIQB 1UACL 2F18A 4UINL 3WBDA 5CJ5A 2Y9RT 5DJ8B 4UQBA 5IOKA 1E4KA 1F3JA 1M2VB 1QATA 2Y5QA 2VMDA 5T1MB 5TK2A 3ULSA 3NJXA 2ERJB 1FNGB 3RWCB 1HWGB 3QB7C 5D1QE 4AC2A 2G9HB 3BAKA 4HZ1A 3DJTA 5LCVA 1F3RB 1MHHB 5F88A 4DUVA 3E1F1 2W95A 4UOW0 3ZIYA 1ZGLP 3THML 4FQPA 1HCFX 4G59C 1HFUA 4OLUH 1BVKB 2YMXH 3IDJA 4OT1H 2CLVA 1N6VA 3HMXH 3QGVA 2NY3B 3I75B 1ZANH 1J1XL 1WBZB 5FF6A 3QA3B 2QPSA 1CBVL 3W3BA 3G9AB 2E76C 5GGUA 2NLJB 1INEH 2C7UB 2F08A 2FX9H 4LQ1A 2YARA 4QHMA 3O6FA 4JDTL 2VH5H 4OGZA 2AK4D 3BZ5A 4KZEL 4W6WB 1FZOB 3MLSL 1U58A 4CN6A 3GS4A 1I1FA 3C5JB 2JKJA 2WZ6A 5HY9B 2VL4A 1I9JL 5B3NA 1MRCL 3IE4A 4X9IA 1V7ML 3UYOD 4ESKA 4MQ7A 5FYKD 4LGSB 2I26N 4YHZL 3O2WL 3V6FB 2X0WA 4JY5H 3SKJL 1EHLL 1EUUA 1GGIH 2XWTB 3GB7A 5DJAB 1NCOA 1XFPA 2PYFA 3N43F 1ZT4B 3G6JF 4LIQH 3PFUA 3B9VA 3FQTB 1BZ9B 1MG2C 4IJ3C 4R7DB 1KN2L 1LP9E 2BMKB 3RVTD 4GAYB 1JPSL 4YHLL 1B0WA 4LHUB 3VRIB 1JDCA 2PWGA 2P49B 2IANB 1TF4A 5J6GA 3KWVA 2ICWJ 3UTOA 3W11D 4L8CB 1PY4A 2QHLA 5E6RB 2EDKA 3AS3A 1DBAL 2CKNA 3OB8A 2VISA 3FQXB 4U1KA 4N22A 1UM5L 2C4FT 3BUIA 3CU1A 3QSKB 2VMEA 2YGNA 3U6RA 3FT3A 3VCLA 3A6BL 4Z7AA 5JNYA 4PJ8B 2CXKA 3NEXA 3Q8EA 3D6GA 4PPTA 4LIQE 3D34A 3E0GA 3LYRA 2XVLA 5B1KA 2YEVB 1UH2A 2V9QA 3SYQA 3WNKA 2A74C 2VDQH 3QR2A 5L88H 3VXUD 2ICEC