2GC7C

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 26
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc7C00
2IDUA 1PZCA 1AIZA 2GBAA 2E86A 2Y69B 2QDWA 2R7EA 2VW4A 2VW7A 2BHFA 3UACA 1HFUA 1OE3A 1PAZA 2XUWA 5TK4A 1SFDA 5FC9A 3ABGA 3CVCA 1PF3A 4DP4X 3NJMA 1SDDB 2EIJB 1F56A 1BYPA 2ZWNA 3TA4D 1E67A 4RH4A 1OCRB 1QLEB 3CDZA 3WG7B 4BWWA 5D4JA 2IH9A 3GXUB 5I28A 2J55A 5I5IA 2GSMB 4JHUA 1AG0A 1RCYA 2XV3A 1OCOB 1ILSA 1PMYA 2HZHA 2YAOA 5TK2A 1NINA 1JVOA 1GY2A 3FT0A 2JFCA 2VSMB 3FQ2A 3WKPA 2DY2A 4WKXA 3KW7A 3G5WA 2IWEA 4E9XA 1PCSA 2H5UA 4A66A 3AZUA 3EHBB 4YVUA 1BYOA 1M56B 5B1BB 3NJLA 3TASA 1GW0A 2PCFA 1JZJA 2VW6A 2XV0A 3UABA 5I5JA 5PCYA 2BP0B 3V9EA 3FPYA 2W8CA 3QJTB 2IWKA 3D12B 4JKNA 3QQXA 4KO7A 1CUOA 1J9TA 6PCYA 1NIEA 6PAZA 2XLLA 1AS8A 3AG4B 1PZBA 4ZK8A 3S3BB 3NYKA 1AZCA 1J9QA 2IDQA 2DWSA 2J56A 3S3DB 2CCWA 3NSYA 1IKOP 1AR1B 1JZIA 4G7SB 2CAKA 5F7AA 2BO0A 2PPEA 3EH5B 3NJGA 1DYZA 3IE9A 1T5KA 1EHKB 4P5RA 1X9RA 5I6LA 1MZZA 2RACA 3PAVA 2OV0A 2XWZA 4UF7C 3EF4A 2UXTA 3FPXA 1AZBA 1M9WA 2GB2A 3QJUB 4M4RB 1E30A 3WKQA 4AKPA 1KYAA 4BXSV 1WAEA 3T71A 2GIMA 1KCBA 3PXLA 4YSDA 3WI9A 1W6LA 1NICA 3QPKA 2PPCA 4G70B 4E9SA 4BXVA 4CSZA 1KCWA 4E9RA 3ABMB 1CYXA 4A2GA 3OQRA 2HLEB 5EHFA 2QPDB 1SFHA 3IN2A 4KNTA 1A4CA 3X1NA 3NP4A 3ZDWA 3AG2B 5IY5B 1L9OA 3QJSB 4YSAA 5I6KA 1AANA 3N2JA 2AZUA 2VM3A 4HCFA 1WA2X 5B7EA 2I85A 1WS8A 2R7EB 2PP9A 3FYEB 4G7RB 1XMEB 2IAAC 3OMNB 4A2HA 2HX9A 2BW5A 1E5ZA 1JZFA 1NIAA 4YSEA 2J57A 4E9YA 2BZCA 3NT0A 4DP9X 2QT6A 3NSCA 4E9WA 1QNIA 3X2QB 2P80A 1ZV2A 2OJ1A 3PPSA 3CDZB 1PZAA 3NJJA 3HB3B 4KNSA 3UAAA 5AZUA 1ID2A 4YSTA 1XB6A 2CALA 3BVDB 3PLYA 3T6VA 4HAKA 2JXMA 3ZX1A 3QJVB 1OE2A 2P80D 3WNJA 1FWXA 5B1KA 2EIMB 3FSZA 1OCCB 9PCYA 5I26A 7PCYA 4K9JA 1PY0A 1FA4A 3NSFA 5I6PA 4E9QA 1J9RA 2YAFA 3AY2A 2I7OA 1GS6X 4HIPA 4FA7B 4GP4B 3N55A 1A3ZA 1HAUA 2CBPA 2YXWA 2BWIA 2YAPA 4HCIA 2XV2A 1RKRA 1BXUA 2FNWA 1SHXA 1L9RA 4DPCX 3CVDA 2FQGA 3DKHA 4N8UA 1NTDA 2XXGA 2J5WA 2X88A 3FSWA 3ZIYA 1I53A 2TSAA 1ET8A 3FS9A 1NIBA 2EIKB 3NJKA 4YVNA 1X9UA 1BQRA 1CC3A 3UGEA 1SJMA 3JT2A 1L9TA 1BXAA 2HRHA 1MZYA 4DP8X 2B08A 2WO3B 2FTAA 2FT7A 4G7QB 1J9SA 5AKRA 3FU7A 2B3IA 4A68A 4BDVA 1ZDSA 5AFAA 3GYRA 2UXFA 4A2FA 2CUAA 1M57B 1V10A 1ZIAA 4KO9A 3HEIB 2WO2B 4GP5B 2IWFA 3KW8A 5D4HA 1CYWA 4AI7A 1PLCA 5I6NA 2BZ7A 4TXVB 4HHWA 1AQ8A 1PLAA 4QLWA 2GI0A 4HZ1A 3NJIA 2H47C 2BW4A 1L9PA 2FT6A 4GY4A 2YAHA 3T6XA 2BP0A 5I6MA 3FQ1A 2NRDA 2YAQA 2BP8A 1NIFA 1A65A 4QKTA 2VM4A 4ENZA 1AZNA 5B7FA 1PNCA 1GS7A 5B1JC 2FWLB 2Q5BA 4AZUA 1TEFA 3OD3A 2OCCB 2PP8A 2FQDA 1V55B 4M3HA 4YSOA 2AVFA 1W8EA 2YXVA 4DP5X 4W1TA 3IEAA 3CZUB 1UATA 1B3IA 4F7KA 1SF3A 4DP2X 8PAZA 1NPJA 2Q9OA 2DV6A 4EF3A 1IBYA 2PP7A 1TKWA 3T6WA 4YSUA 2PPDA 3MBWB 2MTAA 3AW5A 4NAJA 4DP6X 1BAWA 1JXDA 1MG2C 1AOZA 3U25A 3FU8A 1JZHA 2GC7C 1JOIA 4F2FA 1A4AA 2QDVA 4L0PB 2AFNA 3UAEA 1V54B 2AANA 3H4FA 4PAZA 1DZ0A 1BEXA 2PPFA 3FSVA 2ZOOA 1NIDA 2UXVA 2GHZA 1KDIA 3X1EA 3X1BA 1SF5A 5E9NA 4P5SA 4KO5A 1NPNA 1KBVA 1IBZA 4Q89A 3FQYA 3X1GA 4GYBA 4KO6A 4X4KA 2VMJA 4N4YB 1WA0X 1J5CA 1JXFA 2XU9A 1N68A 5B3SB 1RZQA 2TSBA 1ETJA 1PNDA 4MFHA 1JVLA 4W9ZA 1QHQA 3BQVA 2X87A 4KNUA 5PAZA 4F2EA 1YLBB 2DWTA 1AACA 3OMIB 3ZBMA 1XB3A 2HRGA 2IDSA 3WIAA 1IUZA 1GR7A 1WS7A 2A3TA 3TBCA 2FT8A 2WSDA 4DPBX 5LDUA 4DP0X 1EZLA 2BWDA 3PAZA 4KOCA 3PCYA 1OCZB 4DP7X 3NP3A 2LLNA 1W6WA 1GY1A 1NWPA 4AKQA 1JZGA 2PPAA 1HAWA 3ASOB 5I6OA 1L9SA 2VSKB 2YAEA 1OOWA 1L9QA 1OF0A 1WA1X 3QJQB 2IDFA 4WTQA 5D4IA 3H4HA 1ADWA 3ASNB 1BXVA 3ABKB 3QJRB 4G71B 1KDJA 1KBWA 3TU6A 3AG3B 1A8ZA 1SDDA 1OE1A 3PAUA 2ZXWB 4CSPA 1GYCA 1RZPA 2N0MA 1ILUA 3X1FA 3FU7B 2EINB 1URIA 4Q8BA 4BDVB 2HXAA 2XXFA 3H56A 4NB7A 1AZRA 1NZRA 1JZEA 2XYBA 1BQKA 1MG3C 3C75A 3FSAA 4PCYA 1AAJA 5I5MA 2MRYA 2YARA 3S8FB 4E9TA 1GS8A 2DYRB 2YQBA 3FU9A 2H3XC 1E5YA 4BK5C 2UX6A 4UANA 1ZPUA 1ZDQA 3DIVA 2VN3A 4FAAB 1KV7A 3V9CA 4A67A 2PLTA 1ASOA 2BP8B 1AZUA 1AS6A 4BWTA 4NERA 1XB8A 3IN0A 1IC0A 1TEGA 2FQFA 3OM3B 1TU2A 5ANHA 1ASQA 4YSPA 2AZAA 1AS7A 2QPEB 4A2EA 4GXFA 3NJFA 3S3CB 3MX0B 2PCYA 2UX7A 1N70A 1ZIBA 3SQRA 4G72B 1BQ5A 1JERA 2ZONA 1FFTB 5B7MA 3T6ZA 3UADA 4YSQA 3JTBA 2FJSA 1SNRA 4GP8B 3GDCA 3IBOA 4HHGA 3TBBA 3ABLB 2XVBA 1GSKA 4A2DA 4YSSA 2UXGA 3EH4B 4HCGA 1A4BA 2HX7A 4YL4A 4YSCA 3NJNA 2FQEA 2Y1AA 2DYSB 1ET5A 1OV8A 3FYIB 4DPAX 1SHWA 2EILB 1VLXA 1ET7A 4DP1X 1AG6A 3EH3B 3WNIA 3RYMA 2IH8A 3ERXA 5A7EA 2YAMA 3S8GB 4JHVA 5F7BA 3SBRA 5B1JA 3AG1B 1PLBA 1R1CA 3SBQA 3CG8A 1KGYE 3NSDA 1CURA 3T9WA 1ASPA 1NWOA 7PAZA 1JXGA 3NJHA 2I7SA 2XX0A 2HX8A 3SBPA 2GC4C 2JKWA 2XX1A 2CJ3A 3L45A 4YSRA 4BWUA 4HALA 1J5DA 4AKOA 3OMAB 5B1AB 3DTUB 4KOBA 2IDTA 2W88A 3CVBA 4AX3A 4UAHA 1MDAA 1E65A 1NDTA 4E9VA
chains in the Genus database with same CATH superfamily
1EERB 4J1UA 3BMWA 3SGJA 2EXYC 3IXTA 3D69A 1GZHC 3L6FB 4W6YB 4HD5A 3RX8A 4HLZH 2NUPB 2DQTH 2XXCB 4BQCA 3TWCL 3VD3A 1KLGA 2EEFA 2X0VA 5HJDA 3UP6A 1MJ8H 1LP9A 5I8OH 1MI5B 1U8JB 3NJMA 4KUCD 4ODUA 5E1IA 1N64H 4JANA 1BYPA 2AJUH 2O5NA 3N40F 2F9BT 4E41D 3QK0A 2AABH 5I5IA 3IFPA 2AITA 5C9JA 1OM3H 4K8RD 1VCBC 4LQ1A 2CDFA 1DQJB 3SKMA 4JG5A 1QI3A 1UM5H 1T22A 3RI5K 4MB5A 4RMUA 2H3NA 4L3AA 3RDTD 5D1ZA 2HRPL 1CICA 2DB8A 4R97B 1DL7H 2Q8BL 4H8WH 1O6TA 1PCSA 4FYTA 1QBML 5F7EH 4NO3B 2WKOA 2BZDA 4YVUA 4YFLI 4E42B 5DZVA 1NCCH 4LHUG 4HWBA 3MBEB 1X9QA 4UDUA 3ULUC 4X6EA 4LSSL 5DA4A 2BP0B 3CV5A 4GH7B 2ODHA 3MDJA 3K6DA 5I8CA 2VR4A 5EPMB 2XWEA 1F11A 3F7PC 3FQNA 2PYFB 3QUZD 4G7VL 4GUPB 3GJEB 4NO2B 4ZMOA 5J6HB 4JJ5A 1J9TA 1NIEA 3MRQB 4M5ZL 3T65A 3ETSA 4KI5D 4AQ1A 1Q0YH 4AYFA 4E2OA 2R4SH 3B43A 1RZGB 3QZWB 2DL9A 4N2GA 2E7LA 2WWOA 3M07A 3Q3GB 3QIUD 1XEDA 4MKTA 3SDAB 3ZU8A 3AXLB 3QZBA 2ZOLB 4HBCL 4HQQL 2VMDA 2DI8A 5IFHL 2K6WA 2HWZH 1VEPA 4PRDB 3RWGA 2HUHA 4LSVL 1I7ZA 2QV2A 4N9GA 1KGXA 3D09A 1YJDC 4YHOL 3NJGA 4I77L 2UUDK 4B3VA 4MB3A 1FGNH 3H9ZA 1URLA 3VGDA 1QRKA 4R0LC 4U6VL 4A63A 1NCBL 3WIFA 2HG0A 3BAKA 4QHNA 3T6QC 3HE6D 5GGSB 1JGUL 4WUKL 4CW1B 3MV8B 1EAPB 1WGOA 2JQAA 1NCWL 2W0LA 4Y5VC 1EHLH 1ETB1 3NFSL 4G42B 4P5TC 2EDDA 4G70B 4XNBA 5BPPA 3H3PL 1OQXA 3T04D 2NXYB 4M48L 5BVJB 3LKNB 5CBAA 3OQRA 2HLEB 3EGSA 4HC1H 4EZLA 5DMIH 4AMKL 1QA9B 2H0PA 5D1XD 1G9NL 2C1OB 1CL7L 3A23A 3BIKA 1R33A 1XF3B 4G9FE 4KNTA 5J9PA 2C9SA 5FGBA 2IWGA 3BI9X 1SJEA 3FDWA 3NP4A 2J1YA 4FD0A 3WN5C 3WO4B 1IAOA 2NY0D 1F18A 3T2LA 2H6OA 2MEJB 4XO8A 1FI8C 4K5MA 3CMOH 4BQ9A 4LEXL 3R0MA 2XPGA 4MMZC 1YNLL 1LNUB 1LO4H 3CX2A 4BZ2H 2MWCA 3HR6A 3U0TA 3GINA 4I3RH 5DO2D 4OD1L 5H94B 2EKSB 3QFDB 4OJFH 4OIIL 2R2CA 1HCZA 4P5MB 1QNIA 1ZXKA 3H6JA 2YEVB 3R1GH 3DHJA 4GKSA 1G0YR 3G5ZA 5D55A 5GXBB 1BP3B 2OX5B 4ZX6A 3CDGB 1F1DA 4M7KH 2BHUA 4BFRA 3VFVA 1ID2A 3DYOA 2R2HB 4DN4H 2JXMA 4KQ0A 2D7QA 2P80D 2V3FA 1CFSB 4MMXA 3WNJA 1FWXA 2YA0A 1QQDB 3FSZA 3V52H 1QFHA 3ZTNH 1DBMH 4Y16C 4U6HB 3QIWD 4NQCD 4YFEA 4LOUD 2E7HA 1FA4A 3D9AH 1T0NA 3KLDA 4PJDA 4U6XA 2YAFA 1WWAX 1CDCA 3FFDB 4CDGC 4LLVB 4NRXA 4X9IA 5BRZD 1EBAA 1M7UA 2HPOA 3HB3D 2DAVA 3MOAH 3D0VA 3FT3A 4QRPA 5CSGA 4Z77B 1MFBH 4WLCA 2GAZB 2EEAA 2FX8H 2QSCH 1RKRA 1NMAH 5E00B 5GRUH 2FUQA 4WNQB 3KPPB 4OLWL 3V5DB 3W9DB 5FS5A 5AVZB 3MLSL 3FSWA 3ZDZE 2VLJB 1OIOA 8FABA 5DFAA 4CKQA 1K8DA 1TQCC 4NRYB 2XY1A 3P4MA 1O9VA 3FFCE 1T04A 3AMKA 1T21B 4D0BA 2DQCL 3GXDA 1KTBA 3P30H 1DFBL 2K3HA 1FLRL 3OZ9L 4ES9A 2DYPD 4N0UB 5AKRA 2JJWA 2H7WA 3LPPA 3QNXB 4JFXB 4XNAA 2QTVA 1RJLB 1XZ0A 2IDCA 2CUAA 1LWHA 1QYGL 2KZ1B 3ROLB 2Z31C 5FX3A 1OK8A 4OCLC 5AW4B 4KC3B 2EVIA 3EYFB 1D9KA 1Q9WA 4GP5B 4ODVL 4PJFE 5MP6H 5C0DA 3T0BA 4PY7B 2KHAA 5I1HL 3VRIA 1PLCA 5DJXB 4JNXA 1SOQA 3NACH 3M1BA 1EPFA 2WUBL 3QEHA 4FCAA 5C6TL 4ETQA 1UD5A 3LQAL 3MXWL 4NQDE 2H47C 3N41B 3N43F 2CZNA 4HFUL 2A73A 4CADB 5C08B 1AYOA 2BC4A 4EUPB 4AOFA 2H3KA 3FB6B 3LEYL 2DKUA 5I1LA 3AVEA 3ZHDA 2VDMH 1ZHLA 3SPGA 3QULA 5EU6D 4TL5A 3QDGB 1AMYA 4O9HH 3WTSA 4ODHL 5FLVA 2EICA 4RRPA 3CFBA 4PP1C 5C2UB 1UATA 3IKCB 2X05A 4EI6A 2NSMA 1KLFB 3NGBC 5GJSH 3IMUA 4JFYA 4L4VA 5I66A 1JNNL 5C0AA 3GMLA 4N90E 4XTRC 5LWYL 1NMBH 1ONQB 2HG5B 3IMTA 4K23H 4IJ3B 1UXLA 1EFXD 3PJNA 4D3CH 4NP9A 1Y1UA 4PCTA 2OMTB 4PRPA 4H26B 5DUBA 5T5FA 5EDSA 3BEWB 3RWCA 4NRZB 3T0EC 1OTTC 4GAFB 5F70A 1S7VA 1KXVC 4L0PB 3T4AA 2ESVE 1O7SA 4YHIA 4PI2A 2CUIA 5I16B 3P73A 2F7PA 2V9QA 2CIIA 4HMCA 1EO7A 3IU4L 4XH2B 4X9HA 1RUKH 4FKEA 3VVWA 3T3PF 4K2UL 5F89B 1KTDB 1ULVA 4PRBA 3DOIA 1XR9A 1XCTB 4H25A 2CRIA 4HOZA 2OZ4L 4PGZA 4TSBL 4ZXBA 3DJSA 4TQ8A 1ETJA 1IFHH 1PNDA 4LQFH 3U2JA 4FLHA 1NGZA 3QZPA 4G8IA 4P5TD 1PLGH 1GHFH 3IETB 1TVBA 2KKQA 5KBNC 5IEHA 2YPLD 4DOHE 4PB0H 5LDUA 4N2BA 4NYLA 3FCGA 2BVTA 2WZ0A 4E5XG 1HH9A 5DQ9B 5FYLL 4B3EA 1TTRA 3U0WH 4Y89A 5JORA 3WMPA 1D5MB 1SJXA 3UXFA 1JZGA 3KXFD 1HAWA 2CLVA 2A6DA 2Z4TA 2SEBB 3QPXH 5DD0H 2WLIA 5IB5A 3RIAF 3DPBA 2J43A 4FADA 1QSFE 4P5KB 3ILQD 3QFJE 2KLRA 2X9ZA 4F58L 5A6MA 3ZDYF 5HHNB 2B9BA 4AV4A 4HLEA 4U6YA 5CGTA 4U1GC 4PCKA 3KYKH 4M3JA 2CBQA 5FO9A 2PO6D 2RIKA 1RZPA 3RX5A 1U91B 1GMEA 4ELME 5CEYA 3FTGA 1XBDA 5CN3A 3MODH 3BT2H 3EAKA 3ARFC 2Q6WB 1E42A 2V5SA 5I5MA 4HJ0C 2ZCLH 2QGDA 4OLXH 1S7WA 3K2UH 2L0DA 1MELA 4BFKA 3L08A 3X14B 1E5YA 4DGWC 1RZFH 4DVBA 3IGAB 4JY6B 1OVZA 2AJ3A 2WUCL 3DIVA 2CR6A 2J8UE 5I82A 1RVFL 2ZNXA 3HMXH 5JTWA 1RLWA 5ITFB 1YDPB 4Y16D 3UZVA 4JO1L 3FRPA 35C8H 3CZLA 5IFAL 5EWIH 4G8EA 4JFUA 3V55A 1G0XA 1DVXA 2VISA 5EZLB 1G9NC 1M3IA 3KLHC 5CR8A 1DBJL 3QEUA 4AQOA 3UBXA 2NX5D 3SQRA 3PWJB 3FUIA 4OFYA 3EJSA 3GS0A 3C12A 3GI9L 5G4NA 2RA1A 3CVHH 1WBYB 2UWEE 3I02B 3U6XA 3GDCA 3S37L 2ED9A 1E4WH 3B7SA 2E7DA 4RGNC 3ESVF 4EN3C 4QRQA 3D30A 4X42A 2DQUH 1G5GA 2DQJL 3TTSA 3ZE0F 1S9YA 3E6HB 4HKXB 4WF7A 4GKNB 1HHIA 1W72A 4GAJL 4Z0BL 3WENA 4FG2A 2W9LA 1MAKA 2NYKA 3GGWA 1R3IL 2N1KA 4TKWA 2Z31D 4WI9A 4DZBB 1XDTT 2HJKA 4J3OH 3C6LB 4PB9H 4WUUE 1H8OA 1B0WA 2ETWA 1NAML 5ADOL 5JZ7D 4R2GB 4WHCA 3S8GB 4W9FC 3APMA 5CFAA 4M1GL 5HYQB 4OZHB 1NBQA 3HN3A 4GO9A 3I6GB 3QNFA 3BFQG 2HH0L 3CBJB 4WFHD 4M6MH 4J8QA 4AEIL 5C86A 2EVJA 3FN9A 3MRJA 2VR8A 4J4PA 5KSBF 2HVKA 2HLAB 3DGDA 1LEGA 2ICEA 3QGVA 5D72H 2Q7YB 4GW1A 3STZA 1CK0H 2B16A 4G6ML 3L45A 3GI8H 1Q1PA 1FG2A 3QI9B 2WQUA 2EDMA 3F7KA 4JFVA 3VG0L 3PIQA 2IBGA 3RLSA 3P0YH 3ZE2F 3SZ6A 5EEWA 1M7IA 1DCEA 4PP1D 1ZVSA 2RGSA 3FRUA 4U1NA 2E75C 1YHPA 2AXFA 4QHPA 4UNVA 3NEEA 2A74A 3II1A 3N1PC 3HRZC 5A43C 1UG9A 1YMHA 4D8PB 2C3HA 2BHFA 4TOYH 3KHOA 5BS0E 4Z7QB 2WAHA 4ZUSA 5CD5C 5FC9A 4QYOB 4LSPL 1S8DB 5TDPB 5FO7A 4DP4X 4XXDA 1G4MA 1P4UA 5LNDA 3T0ED 1XGYL 3NIFB 4UBDC 4RH4A 4U6TA 4GRMA 3HS9A 3L5WB 3GXUB 3U0PA 2DWEA 5EC2A 3W0WA 5JHDB 3D2UB 4TUKL 4ABWA 2XKNB 4BKLB 1MJJB 4NDMA 5GGTA 3VNZA 3LXBA 1HI6B 3G5XA 4Y4KB 4DGVL 3MJ6A 4OKVB 3PWLB 1SQ2N 2BSED 3LQAC 2VSMB 3LS5H 2EC9T 2GT9B 3U48A 4NPYA 5T5FH 5T3XE 3A6OA 2R1WB 4OT1L 4WKXA 4L23A 4PJEA 1K85A 1XGUB 3N42F 2VTFA 4DN3H 1FL3B 2APVA 2V8LA 5FGSA 5DWUL 3AQDA 2C8NA 3ARGA 1I4FA 4JJOA 4GG6A 4QHLB 2QVFB 2WLHA 4NJ9H 5G2NA 4PBXA 4GSQA 4G8GB 4Y5YA 3X3GH 4IDJH 3AXIA 4W81A 1ZGLB 2AC0A 1A4KA 3AUWB 3FPYA 5IB3A 3FT1A 1SLWA 3WTWA 2YJQA 4XMKH 2VITB 3HBGA 3RNQA 4UQ2A 5DMGC 3ZRCC 3IDJB 5T3ZE 3S35X 5HGHB 3BQUA 4S0HA 2AI0L 3CC1A 1CUOA 4P2QD 4HWZA 3HHMA 1N5AB 2XLLA 4BFEA 2IEPA 3RGVB 4WTZG 4IBUA 4P46C 4PLKC 1X3DA 2BIHA 1PZBA 4KTDH 4ZK8A 3VM5A 5ID0A 1J9QA 2ADFH 2YOAA 3AM8A 1DQTA 1MCOL 3MU3A 4K94H 2P5WB 1ZA3B 1DFXA 1QFUL 4PV8A 5F7AA 5C0FA 2WBJA 1DHKA 4AEHH 5L4MA 1OAZL 1DYZA 2FHBA 1U36A 1OARH 1OD7A 2YSSB 3PGCA 3ARFD 3KPSB 1JCVA 1R3JA 1CQYA 3PP4H 4RMWA 1FUNA 3MUGA 4AW4A 5KVEH 2DQFA 1FL5A 1HKLL 3MACH 3FPXA 3LKPB 5I9QC 4Y19D 1E30A 2VLKA 3GBNH 3T71A 3D06A 3UTSE 4HOXA 2DTMH 3U30B 3KBHE 1S6NA 3UG3A 3IK2A 4TNVF 5SWZA 1GSMA 1F6FB 3PDDA 4UT6A 43C9B 4AL8H 3SCMB 3O8XC 4IEFB 2YFNA 1YN6A 3FU3A 3GWJA 3KLHD 2A9NH 1QI5A 3IPEA 1SM3H 3CH1B 1G4RA 4XOEA 2VM9A 1THAA 2J2ZB 3TO4C 1L7TH 2W0PA 4MB1A 3G6JB 4EEEA 2QHRH 3ZL2A 1KJMB 1SBBA 1N3NA 4QDGA 5HGBB 4MJ6A 5I8KL 1PYWB 4RGND 4EN3D 1HSAA 2B1AH 2Z1KA 4KXZH 5DTFA 2CHZA 3LHPL 4LL9A 1N59A 3IMWA 3ESUF 3U4BL 3X2QB 4JQVC 2W92A 1A1NB 1WAAA 2OJ1A 4ZW8A 4MA7L 1Z9MA 2C7UA 1W0VA 1W16A 2E7CA 4H1LG 5AW8B 4A7VA 3O9WB 1CD9B 5G5DB 1IM9D 2P48B 3U9PH 5E6SB 1FIGL 2IPTH 4N0UE 4QXTB 1ZT1B 2LVEA 3ARTA 1W0WA 1JGVL 1IGIH 4LT7A 4R3SA 2VMFA 4MQSB 3P69A 4BH8A 1OCCB 5E6UB 1PFCA 3D85B 1WZAA 2CGRH 4WHTA 4Y4FB 4XPTL 3TL5A 3WJJA 3AQYA 4L4TE 1K2DB 2BY3A 3BEVA 4PV9B 4NZUL 3MNWA 4NLAA 3NFNB 4AZ8A 3GRGA 1ORQB 2YAPA 3Q2VA 1KIRB 5SWSD 4WWKB 5D7IA 3QUMH 4LVNC 3DBXB 3KGRA 4F15B 3FTYA 4ZQKB 1J0ZA 3CD4A 1NTDA 4DKEL 2O1AA 5KEZA 2ZSVA 1AHWB 2G2NA 2XXGA 2CK0H 3KPRA 4NWUH 1X7QA 1CYGA 2YZ8A 3MFFA 1I53A 5H35A 3F12B 2BOLA 4KK9C 2OR7A 3DX7A 3L4XA 2UY6A 5JUEL 1G9ML 2Y7QB 1DUYA 2H6UA 1L0XA 4IIQA 3JWNH 4UNIA 1QBLH 3D3VB 1UCBL 3A4DA 3IGLA 4BE5A 1WCQA 4NI6A 4FYQA 4U1SB 3BXNA 2JKNA 2DMBA 4KZEL 1V10A 3NZ8A 5T33H 3VFPA 1JHTA 3IDIB 1S7UB 4MHHI 4XPFL 3SY0A 2ZP8A 3RWDB 4HV8A 4L8SC 1I85A 4L29B 3U2IA 4QGYA 3E9UA 1AQ8A 1AGBA 2F19H 3PXJA 5DJYA 3VMOA 1JZ4A 3SPVB 4LCWB 3VWKB 1OP3K 2IPUK 4FF9A 1MPAH 4LKCB 4Z0XB 2IBZY 5KSAA 3OKKB 2F54D 3ZQXA 4QKTA 3FQTB 2YN3A 1YC7A 2R69H 5B3JE 2OMBA 2WN2A 1OSPH 5HHPA 2WOBA 1UB5B 3FO2B 1W8EA 5GGTH 3S5YA 5AOMA 4ZZFA 4HWEH 1DEDA 3SODB 3E80A 2HTLC 3MRIA 4HU2A 4IKKA 5IBTL 3MAWA 2DV6A 5DMGD 1A6AB 4LDEB 4P99A 1P9MA 2XRAL 4MJIB 4NZRH 2ZICA 4ZPTA 3SO5A 1IGCL 2I5YL 2IQAA 4DFIA 4P46D 4IDLA 4JRLA 4PLKD 3U25A 4FTVD 1TQWA 3FT2B 3UERA 3WY2A 2XA8L 3QR2A 4FEIA 3CIAA 4L1TA 5AVUB 5C0CB 1WCBA 1R5VB 1F4YL 4PGJA 4UM9D 2I9TB 4O4YH 3EO9H 2DQEL 2CPCA 2QDVA 4HFWB 1UWEL 4M7ZC 3GBML 4PJ5B 3MRDB 3LRHA 4IRSB 1DSFH 1T3FA 5L2JB 2HYMA 3L3JA 3GUTB 3GMQA 1GC1L 5CMAB 2DF3A 4KI5E 3HE7A 1JFQH 1HKFA 4IRJC 4WJ5B 5B1CA 4KO5A 1U8HB 4OR1A 3Q43A 1S5HA 4C56B 5J6GA 3BN9D 4FN0A 4PREA 2XBZA 5CHNA 3SPIA 4ZFFA 3SDXE 4ESKA 3BP5A 1ZHBA 3S5LB 5GRWA 1XQ4A 3SE3A 4QRBA 1MWAB 1XGTA 2A9CA 1VEOA 1INQA 4QD2E 4OTXL 1BGXL 4JFED 2Y22A 5KVFL 3HVNA 1A66A 4GUOA 2EEDA 1XT5A 4A6YA 4AG4L 5C6WH 4IBVA 1O6VA 1LWJA 4WO4B 3GBLA 1TLMA 1UEMA 5D1ZC 3V0WH 4EXKA 4HJJL 1CICC 1IEHA 1J1XH 1UZ6E 3SE8H 3TTYA 2EDLA 5D7JA 5BJTA 1XSOA 2NOYA 1JPSH 4KWUA 4X8XA 1A9BA 1NDMA 3O8XD 3VXUB 3WMSA 2C3GA 5G55A 1FVDB 5KS9F 5I6XC 4KV5F 2ED7A 3PPEA 3LZRA 2YZ1A 4R97C 5INDB 4ZFGL 4L3EB 3HUJA 1UUSA 4KROD 3BUYA 4EPSA 1U8KB 3P3TA 3ARBA 3TV3H 3NMEA 2YBRA 4MJ4A 5KYUA 1MF2L 1ADWA 1Z3GH 1EUUA 2DQMA 2XG5A 4HH8A 4R4NC 3U46B 1OOAA 1XD0A 1SDDA 4JPIA 4PR5A 4TN9A 1IO4C 3VW3H 5CJBA 4UTAL 1N0LA 3QJXA 1OAUH 4X5QA 1D5IH 1A7RL 2KUTA 4TTDC 1C5CH 4EI5A 4FX5A 2VC2L 1E0OB 1TTBA 1AAJA 1BQHB 1UD2A 5AYUH 3X13B 2VDOH 5KYXA 4L5FH 2VDNB 3SQOL 3EFFA 4KKBC 3OKNB 1MHEA 4OB5H 3PF2A 4UV7L 4CN6A 3SDAC 3NCEB 1RI8A 2RB8A 5AVTB 4JM0A 3OTTA 3K74B 3RB5A 2RR3A 5ANMB 4DT2A 5C0GA 3TPUA 1KCVL 5IBUB 2B3RA 1A7NH 1KY7A 1QSVA 2ZAHA 4ZMYA 2VDQH 2XCMC 5AAPA 2BP8B 3TYGL 1MHCB 1J5HA 3EYOA 2OMVA 1DBBH 4Y2NA 5EIIB 2Q7AA 2WM0A 3CNKA 3RNKA 1ZCRA 5CF3A 2OW6A 4N0YL 1P6WA 1DBKH 4PN6A 3G04A 2IPKA 4KKNA 3QORB 2MNJB 2VWEC 3U1PA 2PCYA 1KGIA 1YEGH 4P2CG 3FF8A 4M1DH 3EO1B 1Z6JT 1KB3A 4OV5A 1JNHB 5ITBH 4IBTA 1QRND 1G94A 2OTUA 2HFGH 2GHWB 3MUY1 1YECL 3DROB 1BBDL 1VKXA 4KK9D 4LIQH 3GO1H 1IFGA 2X70A 4TQIA 4PJIB 4UTBA 4X7SL 3OKLB 4WSKA 1H3XA 1P4IH 3GEFA 4MAYB 3O6KL 3G6DL 4W6WB 4HUCA 4YHNA 5IVZB 2ZQKA 3ZE1B 2EILB 1CGTA 4PS7A 1WK0A 2APFA 2XSKA 3L7EB 4I4WB 1A6TA 3ZPDA 5IMLA 3AS3A 6TAAA 4AH2B 3POCA 4O02A 2Q7NA 4WQOA 1W72L 4JPSA 3VXRD 5FDWA 4TRPL 1JWSA 2Z92A 2LTQB 5DEFB 3OF6D 1G7MB 3OKDB 1WISA 4XXCA 4DERA 1J11A 2L4OA 3GS4A 2DLFL 5DSCB 2R0KL 2WXNA 1QSZA 5FUOH 3DVGA 5DQDL 5BVPH 5KBLA 4K15A 5E70A 4MMXC 2AQNA 3AU1B 1J0KA 1VFAB 4LMQI 4S2SB 12E8H 5AD0B 3V4PA 3EGXA 5CKGA 1GYAA 4ODSL 2YD7A 1NGYB 2ITDA 1OAXH 2BCKB 4LKXB 1YEDA 4KXCA 2F5AL 5I2IA 4FP8L 2XWTA 4AENB 2HTLD 2VUKA 2D0FA 2B20A 2D3LA 3WSQH 2DWDA 1AIZA 4M6AA 4C57C 3FBQA 2P8LB 5K9OB 1RJCA 2VW4A 1H5BB 1G9MC 4Y5XA 1PD1A 5CEZL 4X8JB 4NN5C 4M7LH 3PP3H 4Q74A 5KYYA 3OPUA 4P4KD 5IKCB 3N44F 5LUMA 3CVCA 1PF3A 2WVVB 3H0TB 5TE7L 4HKJB 3DX3A 1P1VA 5ERWB 3QRGL 4W70A 4WTXA 2Y06H 2ZYSA 2WN3A 2BX5A 1BLNA 4JN2B 5I19L 4HAFA 4Q4EA 2Z0BA 5DURB 4ACPA 2VIRB 3BP4A 1T03H 2GSMB 3HAEH 4HUMB 4Q9RH 3DK0A 3D4CA 3CSTA 4PCSA 2YKKA 4XAWH 2CKNA 3MRHB 4IRJD 4XBPA 3VI3B 1HEZB 1TJXA 3IJSB 1OO2A 1QLRB 4YHPA 4XWGL 2OR9L 4FCHA 3WE6A 4Z7WF 1EX0A 4G5ZL 1AGFB 1QO3B 3QIBB 1BQHG 3OQ3B 3NN8A 5FDYA 4FNLL 2AEOA 1HH6B 3SDDA 3T3MF 1YEKL 4QNPE 3B9AA 2VAAA 4IIZA 3GLEA 3OKOA 4D9QE 2IALA 1KEGL 3NJLA 5D1ZD 3QXAB 1XEUA 1CICD 1ACYL 3D48R 4XMXA 4YL9A 1JTPA 1Q9LA 4QTFA 5AAMA 2FWOB 2VDRL 2WSPA 1LWRA 4L1HA 5E6IA 1QWUA 4NC2B 4JO5A 3SZKC 2XVKA 1SEBB 1MH5A 4KO7A 3BIAX 4GRLB 1J1PL 4AM0A 2PWFA 2J88L 5EC1B 4O2FA 3DOSA 4AJVA 1K4DA 4GAYB 1U42A 2A0LC 3VX0A 4R4ND 1AP2A 1QTSA 3HS8A 3ILEA 3GSOB 4X5XA 3LKOA 1I8IA 1IBGH 3O2DL 3ULVL 2CCWA 1EMTH 2ARJB 2CJUH 3VQ2C 1IKOP 3N85L 3LEXB 1P1ZA 3KXFE 1KENL 2YRZA 4NNYA 2AV7B 4K3DL 3FKUS 4PVMA 4XR8C 5MI0B 1GC1C 3CN2A 3KD4A 3KYMA 4TTDD 5EOTA 5JW5B 1G9HA 4JPVL 4J7RA 3T4AC 5I6LA 5BNXD 3EF4A 2VN5A 2XZAL 3GT6A 1HN1A 4ODWA 4Z95L 4KKBD 4ONFH 1DUZA 3SDAD 4Z3JA 4NHUB 4NNXA 3VXMA 5D6CB 1T89C 2JK5B 1KCBA 5AVYB 4WFFE 1M2VB 3FMGL 4PHXA 1DJWA 5BOPA 3WNLA 1ECYA 4E9RA 4G3YH 5AVRB 3QJFA 3QBTB 4M6OH 1A9VA 4QI3A 5F88B 3QR0A 1G87A 1QKZH 1MFEL 2YUVA 3QZMA 4JM2F 3CDCA 5AG8A 2PYEA 4HJGB 1OGPA 2WLNA 4HIJB 4MNHA 4UT6L 1U8LA 4KMTL 1J8HB 1R24B 5D5MF 4GUCA 3WD5L 5JIPA 3D18A 3V4VH 2PTVA 3QRLA 1ZTXE 4B7IA 4KDWA 3CFDA 4I8DA 3KR3H 5JPMA 1KCUH 4M62L 5I0WA 2O6DA 2A83B 4ZFZB 1XXDC 2WGNB 1F58L 2BW5A 2GCYA 2NX5E 3RY6A 1JZFA 1J8KA 2J57A 3NT0A 3LRSA 4LPXA 3VD0A 3MLUL 2NY7L 4HEPG 3TESA 1CT8B 2ENSA 1U0QA 3BC9A 3S4SG 1I9RH 1ZSHA 2VKWA 3FQRA 4Z1PA 4PS3A 4ONOA 1AE6L 5F7NC 4JRXE 1SN2A 2MOVA 3KPLA 4ZDHA 2V2XB 1TZGH 4GB9A 2HMIC 3L5JA 1AOHA 4RSVA 3ALXA 1R34A 4LLYA 2RQEA 1AJ7H 4WK4B 3LPOA 4YK4B 3EJZC 3ZKQD 9PCYA 2X4TB 4UTBH 5EBWB 3SQBB 1CG9A 1XF5A 4OVUA 4B7LA 1H3WM 5L0QB 4Y1AA 5EZJA 2Q87A 5TQ0H 2J5LC 1VFOA 2DQHH 3MLVL 2Q2LA 1N6QL 2EAEA 5IM7B 3KL0A 1E2ZA 2E9GA 2BSRA 2L8AA 2XZQH 1TEYA 3B83A 3BFOA 3LCYA 3IFNL 5DR5L 5CD3A 1SUHA 4UINH 2RMNA 1SHXA 3ARXA 3NZHH 4RFNB 3THML 2I32A 3ILPA 3VFNB 3ATFA 3DSNA 1NCJA 2OJEA 4IGBB 2NY2B 1BM3H 2CDEA 3GM8A 1B9KA 5ESQB 4N68A 1JGLL 3EG9A 3MKGA 2J5WA 1XH3B 3KWXA 5DLLA 1MXDA 1S9WB 4U4IA 2QEJA 1T1ZA 1DLHB 4QRPD 3TBWB 2FR4A 4AVIA 3D05A 1X5KA 4HLZG 3NAAH 5EFIA 1JRHL 3MC0A 2QSTA 4N5UA 4N2HA 3QQ3B 3LSOA 4OI8A 4JG0H 3ZKMC 3MUHL 4GAGL 4ODXB 1G9EA 1BSIA 2WO3B 4XOAA 3WS6A 1UACH 2B3IA 3ATAA 2OS7A 2WLLB 5FYKH 3GUFA 4YN3A 1QVOA 3BGFC 4WWPA 5FCUL 1KN4L 5GGUB 3RWHA 4B27A 2IH1A 1RUMH 3EYSL 4RMQA 1R4XA 4K07A 3SE4A 3DX2A 4JRWA 4QOKB 2EDNA 5IR1B 2YWZA 1NGPH 2EDYA 1YPZA 4PJ5E 3B9EA 1A7BA 2MQ0A 3OAUL 1XL4A 1MRCH 4NUQA 1V7ML 2P47B 4Z7VF 3P4OB 1N5YL 4GQPH 3TFBA 1NIFA 4ZOEA 5JHLA 5LG1A 1PNCA 1IEBA 5FW7A 2NZ1A 5T8IA 3MREA 2UVEA 1ZT4B 2J72A 1IQWL 4C59B 2XTLA 4LOVA 2D03H 1RFDH 2X53A 4JPKL 3VA6A 5F72S 2BOCA 3K72B 3RI5F 2ICEC 5J1SC 4QRSA 1A5FL 1RZ7H 1HNYA 1S2EA 1QNZH 5GRZA 2DICA 3P2DA 4X0KB 1NPJA 4X6CB 2Q9OA 1DN0A 3ZIMA 1MVUB 1P6AB 4ZW6A 3MBWB 4GO6B 3MOBH 1J1OH 4HKZB 3K46A 1S9XA 1XGQA 5CU5A 3T8XA 4IMLB 4FEMA 1PZSA 4Z3FA 3FU8A 4L4VD 3CFEA 1E4KA 5CCGE 2CU9A 5C0AD 2A0LD 5JO5A 2ZWLT 1FZKA 3QHTC 3H4FA 4PAZA 4WEEA 2FBRA 3HNTL 3Q8CA 1NEPA 2E6QA 4P2QE 3TEXA 4C83B 5CJOL 4XP1L 2VLLA 5ID1A 1NGXA 2EIZA 4L8DB 4ZUWA 4UOW1 2WWKO 4ZUVA 3UTZB 4RNRA 1IL1A 1D2OA 1LP9B 4KO6A 5FAAA 5MENB 2CUMA 3GXPA 2PABA 1NLDH 4KRLB 1H8SA 4GKLA 2WNWA 2VDMB 4ZX4A 4OIBA 5F1NA 4F2EA 1T2QL 3UAJA 3BSZH 4MSWA 4HPHA 3DURB 5C9JB 4D8OA 3A0OA 4TLUA 1A64A 1XGPB 4GBXA 3L7FA 3LQZA 4MAUH 5DD3L 4ALAL 2AK1H 2H3NB 4RVBA 4CNIB 1DZBA 3U9UB 4Y19E 4K3JL 4A6YL 1OCZB 4MQTB 4WK0B 3ZTJH 1MOEA 5A3IC 1MWAL 3ARGC 5D7EA 4HYTB 1JPGB 5CP3A 1B0GB 1NGQL 3GSXA 4M43H 3FCSA 5IV2A 3EDKA 4JGMA 4MA8H 4KXDA 1GYVA 2NY6B 1WA1X 2OSWA 4XNQB 1MY7A 2A4CA 4OF6A 5IHBA 4MZIA 1VPOH 4JRYB 1SPDA 3SKJH 5I1DA 3QJRB 1I1AB 4HZLB 3FONA 4OCYL 3MRMB 3ULVC 1RZKH 2YXFA 4CL7A 4AE1A 1E6OL 5DJCB 3FAXA 2EINB 2P8PA 1CXLA 3APCA 4YHLL 4YHMH 4AYFB 2EYSA 3RPKA 5L9DL 3RGVC 4HJTA 3QO0B 4PWKA 4X50A 4PCYA 5CZXC 1JGEA 3WKYA 4PJIE 1NSNH 2DYRB 1U33A 2H3XC 2JTDA 4XCEA 2GJ6B 2DM7A 2UX6A 1JN6A 4NFDA 2FIRT 2B4CL 2HMID 4NN6C 4F7TA 3ZE1E 1ZS8B 3KDMA 4TMPA 2VDLH 5DF0A 4FAAB 4EZKA 3NCJH 1YN7A 5GGVH 3EOBA 3OSVA 1Q94A 3HR5A 2W0FB 2ZUQB 4YLBA 4JFFA 5EF0A 5BUGA 3QEGL 4KTYA 5F0PB 3DXAE 5DUMH 4J27A 4ILDA 4WI0A 3SOBL 1AS7A 2VDNL 3Q44A 2IFFL 2A4EA 4KAQL 2QKIA 3NESA 3GKWH 2P49B 4D0DB 3A5VA 4Y8DC 4B96A 3D08A 3TCLB 2QQNL 4AXWB 5KN5B 4YSQA 1WWBX 3TNMB 2MMXA 1N12A 4FHJA 1HHJB 1WIUA 4U7SA 2X4PA 3A4AA 1BOGB 4OFIA 4F3FA 4ZMQA 2EYRA 3V6BR 5B39A 5J9PB 2X9WA 5E8DL 1ZWIB 2ADIA 3AQZA 4PGDA 4PRHA 3BRDA 3RL1B 4HCGA 1ZT7A 5SWSE 1KXTA 3ZKMD 1XR8B 3I9GL 4POYA 4UNUA 5L7XL 1EVTC 5F3BA 4PWEA 3EFOA 5EU3B 2DYSB 5EZIH 2D4DA 1OGAA 1Z7JA 4WY7H 5E9DA 2YOCA 1IM3A 2ORBL 2JCCF 3EJRA 1AG6A 2HJLB 3F85A 1A0QH 4W9CC 3FCUB 4IU3A 4QJ3B 1HZLA 3OZLA 4ONGL 1I7UB 1CDUA 2X4NA 4HF5L 1TCRB 4LOFA 5DD5L 3TBTA 1LK2A 2CCLA 3KJ6L 5HTSA 5I8EA 4JGJA 1ASPA 4O02L 1E4XL 4RMSA 2FD6H 4LBEB 2ZG3A 3RBSA 1JWMB 3P54A 3T1FA 3GSVA 1MFCH 3BJLA 4KVNH 2AJVH 1MFDL 4F33A 2VL5A 2JXMB 1YO4A 3WUZA 1Y0LA 3UJIH 3UTTA 5IW6B 1FHGA 3DGGB 3O3DA 3VO0A 3CVHB 3WJJC 3HRPA 3UJJL 3EYVB 4PJDB 4E9VA 1UWGH 2W5PA 3D50A 2CKBH 3IT8D 4G7YH 4PSRA 3TYFA 3WFCH 1CBVL 1TYJA 3V4PL 2Y69B 2QDWA 4U49A 1WZMA 3K4DA 5SX5K 1ANUA 4YWGH 5CEZD 4EDXA 4ZUUA 4Q6IA 1IAIL 1GGBH 4I3SH 2C4FT 5M7QA 3BZFA 3HBPA 4X4XB 4FFZL 1FFOA 3P9LB 5IB2B 2NUTB 3DV4A 2GFBB 4Z3GA 2X0WA 2ILLA 1C08A 3QCTH 4O51B 4YH6A 3CU7A 4EIGB 5E4AA 1F2QA 1FPTH 4I48B 1RCYA 4RGOH 4NQVA 1HCYA 2CMRH 2GVYA 4IBZA 5GS3A 3WAJA 1FNGA 2OMYB 1GZQB 2EEXA 2ITCB 3W0WD 1L9NA 1HHHA 1XZ0B 5E99L 2EP6A 4JN1H 1WF5A 2YRPA 3GMPB 3O6MH 3N43B 4ZX5A 3VXNA 2BNRA 2QSVA 4L8CA 1CLZH 1I7TA 2O5XH 2ZCZA 1DQDH 3DK2A 5EULV 1P2CB 2X9XA 5F71A 5LGYA 4EE2A 1WT5A 3E9TA 3M1BB 1KJ2H 3QEHB 3TASA 2ERJC 4XPHH 1CXFA 4PMEA 4O5LL 5KSAC 2VW6A 1JZJA 4AYBA 3TBVA 2ZKHH 3VACA 4NP4L 1WFIA 2FO4A 4PD4K 1QG3A 1NUNB 1AKJB 1XFPA 4PGEA 3JWOL 4JFQB 3L3KB 3QXTA 1FAIH 1E9PB 3ARGD 4UM8B 4QHMA 5A3ID 3TM6A 3S96A 1M1XB 4PG9A 4DGIL 3IJEA 3QULB 3V7MA 1M53A 1FN4A 3BYTA 3S3BB 4P2RB 3S9DB 1F1AA 3NYKA 4LPUA 4WI2A 3WEXA 2KYIA 1AZCA 4ZTPH 1D2PA 3HHSA 3Q01A 5IT2H 2Q10A 2DIEA 2X6BA 3BQUD 4G8GD 2VERA 4NQQA 1P9MC 5SWQA 3RKPA 4EI6B 5C2BH 3ULVD 2YK1H 3GMLB 3R06B 2DQTL 3EFDL 4KKCD 2H32A 3CH8A 4WW2F 4WZ9A 4ISVB 2XJKA 1LEIB 1EAQA 4PRPB 1MJ8L 1LO0H 3O4OB 5CIPH 3RX9A 1RIUL 3RGVD 3LD8B 1OPGH 4KVCL 2AJUL 2GJRA 5CZXD 4G8AC 2FATH 2EO9A 4OJDH 3T3PB 2WBJD 3DRQB 4AKPA 2WINA 5TPWH 1Z9SA 4MLSA 1UD6A 2JKSA 5CWSA 2G60H 5EO1A 4HEME 2WYIA 2JI3A 2P5WD 1GXEA 3P73B 2OJZH 1BDYA 2CIIB 4IRSC 2V9UA 3R4DA 1A6PA 5TDNB 1TR7A 4IK6A 4F9PC 3ZGHA 2CHNA 2VLKD 3I75A 4ALAC 2D7OA 2UYLB 3MRBA 4ZXBB 1XV8A 1F3RB 5FYKU 4HJIA 5EBLA 2P5EA 1JIBA 5J57B 3CPUA 4F7EB 5K39A 4I88A 5ECGA 4QHUA 1TTGA 4KRPB 3CN3A 4UTCA 5D7JC 4AV5A 1DVYA 4YSAA 2ZF8A 4JL1A 1U92B 1UYWH 1KZQA 1FCGA 4NYLB 1WA2X 5EUOE 1QD0A 3GFUA 3LS4L 3IGKA 3QYCA 2P8MB 1KG0A 1XIWB 4JEGB 5FYJL 5K5YA 3G3LA 1YSOA 1PQZA 3HG1A 4C4KT 5F7HA 2AEPL 1A21A 4PEEA 4EAEA 3P1VA 3UZQA 4KHTH 3EYQC 2CQVA 3U1SH 3WBDA 1MQ8A 2B1HH 3F6LA 1QRNE 1G7JA 4PU2A 3HHRB 3VFOB 2Z91B 2HWZL 1BG1A 4J3OG 3L54A 4XVJL 3KNBA 3GJFH 5JXEA 2XWJB 3OJDA 2VR3A 3GM0A 4ONHA 2B4CC 5AVVB 2R51A 5CEYB 3QCVL 4I0PA 4RA3A 2NDGA 2AXHA 2EDTA 4MJ5B 1P0SE 3SEPA 3OJVC 4V1DE 3UTQA 1HEJC 2FX7L 4JFOA 2G9HA 4GT0A 1KIUA 4NGHL 5E23A 3RWFA 2YMTA 3JTTB 4GP4B 4FJZA 4DVBB 4FMKA 3T4YA 3ZN6A 2V7HB 3NCYS 3DJTA 1AO7B 2AJ3B 2ITFA 4LRNH 4O2CA 3APDA 1UZ8B 4OUUA 5DJ8B 4HCIA 1RJYA 3MQIA 4MS6A 2OI9B 4XP5H 1LO3H 3FRPB 4EQ2A 1HIML 2ADGA 2F53B 2OQJB 5DMIL 4Y2DA 1JFHA 4B9KC 3QQ4A 5TDOB 4DSYA 2VISB 2D73A 1G7PB 4OZFA 1U95A 5HI4C 2R23A 3ZYOA 5CAYB 5DEGA 4AMWA 4CAGA 1I3VA 2AEQH 3F5WB 3IDUA 4DP8X 1FYTB 3KPRD 3QORC 5C1MB 3MCLH 1ORSA 3TURA 2ZOKA 2FT7A 4J3WA 4RIRB 4S0TD 1P7QA 3CMOL 3RTQB 4A68A 4FQIH 3ZE0B 3PNRB 4QRFA 4RRPG 1KTJA 1QBAA 3H9YA 2NY1B 3V4UH 5AW2B 3MUUA 4X9BA 4QRQB 1KBGH 1D5XA 2H9GA 2XICA 5DK0A 4BA0A 1U8IA 3UO1H 1PZDA 4TNGA 3MLPA 3M8OH 5I1AB 4QIRA 2GSIA 1FRGH 2K3TA 4ZNCD 3M17B 1HHIB 2GI0A 5F7DA 3WUWA 1T20B 1MQKH 1N7ML 2X4RB 1MFMA 2BW4A 1SUJA 4PLJC 1BFVH 5ALBL 2FT6A 3GGWB 5I6MA 4J6RH 1OXYA 5GRJL 1LQBC 4RDQG 3OKMA 3ZRFC 3LYRA 4HPOH 4JDVB 5ICXA 2ODIA 3L4ZA 1DQVA 1LP9E 3V6FA 4AQEA 3EJQA 1F4XH 2J73A 2Q5BA 2DQGH 3QUMB 4HD9A 4XXCC 3WEAA 1DANT 1UT9A 2HN7B 3ZTNL 4EZMA 5IMKB 4NKOB 4YSOA 1KGCD 1IBDA 5KSAD 3D9AL 3MX0A 3QAQA 6FABH 1AGEA 2YXVA 4NOFA 5JHLL 4Z6AT 1FC1A 2CXKA 4ZTEA 1INEH 1VGKA 3MV9B 1JUFB 3PHOA 4XPBL 3T8MA 1DVFB 5HY9B 3P77A 1S9VB 1S7SB 3ZE2B 3OGOE 2MTAA 2EABA 1QTYT 2K7QA 5AALA 2FX8L 1C12B 3UC2A 1BIIB 4JK0D 2EE6A 3PIQB 1IGJA 3IU3A 3NH7H 4C4BA 3ZVVA 4XCNA 4ABUA 4JFZL 1ZVSB 3AJ7A 3JWDH 4EBQH 3Q6GL 5T1DH 1A4JB 2WIIB 1FNEB 5CLWA 3IRZA 3PG2A 1G43A 2A74B 5HYJA 5F2FA 1PZ5B 2ZUVA 5KTEH 2ZOOA 2R0ZH 3K71A 3P30L 4GW5A 5DI8B 3X1EA 4JRYE 2ZNWA 3MRGB 1CVRA 3TGXA 5GS0D 1OSEA 3D39B 1HVXA 3O6FA 5I1CL 2UY7A 1LE9B 1H5BC 4HVBA 1CFQB 3ZDZF 2FSEB 3MHZA 5C0CD 5F9WB 5DRNA 4ACTA 5EO9B 1NAKH 4A1RA 4MD4B 4PYGA 5CNHA 5DZPA 3PAYA 4NX0A 2DWEB 2X87A 3WHXA 4D7PA 3EBHA 3DBSA 4L1SA 2X10A 1RZJL 3G5VA 2BMKB 4H2CA 5K9JH 1WV7T 3WIAA 2EXTA 3N42B 4G6KH 2H32H 1U58B 2FT8A 2X3BA 2M1KA 2ZD0A 1T7VA 4YBQC 4DPBX 5ACZB 1CPUA 5F7KC 2WMPB 3NK4A 5FB8B 3HG2A 2A38A 4LAQH 4G83A 4PJFF 1J5OL 3JWOC 3HFMH 5D2NB 3H1ZA 3QIBC 4XCYA 4YGAB 1D7CA 4F1SA 1NBZB 5D7JD 4O9HL 1PSKH 3C08L 4YIQA 3SY6A 3QXDB 5E6IC 3U9WA 2EYTB 4HIEA 1JK8B 5CCJA 4OSUH 3H4HA 5AUMA 5GJSL 1BXVA 4G71B 5TGBB 3FRPG 5FA3B 5J7CC 5J1AB 1SYSA 1KN2H 5JDJA 1TPXB 1WHPA 3ARBD 2VWEE 1Z5LA 1EEYB 3L13A 4N6RB 1S7QB 4PJ9A 3UBXG 1OEZW 1EJ8A 4NZTH 2FYYA 1RHHA 1BQKA 3I3EA 4X7EC 1TETL 4ADJA 1EBPA 4FABL 5F6HI 4PV8B 4PRID 3BAJA 2VUOA 2H6PB 1RUKL 5FWRA 3O3EB 3PJSA 1KV7A 3LRKA 4YNYB 5GS1A 5D7SH 4NN7B 4LEOA 3PGCB 2X4OA 2NW3A 1ASOA 5MI0C 4I87A 1R3JB 3GMNA 1TVHA 2RTTA 5KJ7E 3S98A 3WFEH 5D2LA 2H0FA 3ARUA 4N26A 1R46A 2XN0A 3HN8A 4QTHA 3WDIA 4KHXH 2KQMA 2ZPKH 1PLGL 2ALWA 5GRVK 1JF5A 3K6SB 1ZIBA 1UT2A 2CNYA 2ZONA 1FFTB 3ZQ9A 4AQAA 4HUVA 2A9MH 3TX4A 4XRCB 4RESB 1V3MA 3NUKA 4HHGA 1YCSA 4PVNA 1G7HA 4G1EB 4JDEA 1OW0C 2I60H 1E8XA 3HZVB 5HP5A 1K5WA 3KPQA 3RU8L 4PJDE 1XVSA 2YLHA 3CN4A 5C0BA 3VM7A 2K9FB 4JFHD 3QORD 1EIBA 2VDOB 2F68X 3GSWA 4LARH 5JPMC 1MIEH 2HKHH 2B15A 3ZHKA 1ZEAH 2AF2A 4F57L 4AYMC 2XV6B 1M71B 4QRPE 2R8SH 2C3VA 5DC4B 2UZYA 1N0XL 3QDMA 2WB7A 4I2XA 5DTFB 1MFAL 3RY6C 4A55A 5KVMC 4KX7A 2VDQB 1QLEH 3V0VA 3JZ7A 4DK5A 2COVD 4AQZA 4KTEL 3PE9A 3ZT5A 1LK3H 4OLXL 5FR3A 1CDHA 5BO0D 4QRRA 4JQXA 4L1BA 2I7SA 1MW0A 1RZFL 3QAZC 5DZNA 3I85A 3FCTB 4ELMF 4JR9L 5IUCA 3KWWB 4MNQA 2FEEL 3GRWH 3P0GB 5IOPA 4XP9L 2IOOA 1UVQA 3OMAB 1ZAGA 1UUNA 1D6VL 1YEHL 2QPFA 35C8L 3N91A 4U1HA 2I26N 1MJ7H 4FQPA 4YK4C 2FB4L 5IVXB 5K93A 5BRPA 3BZ4B 4U0QB 2DQIH 4HW6A 3AY4A 2CLZA 2MIZA 2Z4QB 3J7HA 2J8UF 4OZIB 1K8IB 4HZAA 3ZL4H 2TAAA 3H3KA 2RQ8A 2QZQA 5ABZA 1UJ3B 4CVZB 4XMLL 3T0VA 5DK2A 4RGMC 2ZWNA 3BDYL 2AMGA 5KSUA 1OCRB 2AQTA 2D31B 2DQUL 3K4AA 4JCWA 5AVXB 3F7YB 1HT6A 2IGLA 2UY6B 1JI2A 4JHUA 4NQTA 1AG0A 5CINL 3WS6C 1ILSA 3QQNA 4N24A 3V6ZB 4G43A 1WFMA 5TK2A 5TQ2H 4L4VE 4OJYA 3QS3A 4Z78B 5J11B 2UWEF 5C0AE 5D1QA 2IMMA 3IPFA 1DQLH 1R5IA 1H15A 4F80A 1LYQA 4HHAB 1YMMA 2F8VA 4PRPE 1U3HA 1JHTB 5E6YA 3SE4C 4F37K 4RMBA 3SY0B 3VFWB 1C1EL 4KZDL 3MNZA 1BAGA 2E76C 1LO2L 3I6KB 3CWGA 1SGKA 3IJYA 4I18A 2FIKB 4TUJA 2E59A 2XKUA 5ILTL 2XV0A 1S78C 3C60B 4RQQA 4YBQD 1YEIH 2YMOA 2X1XR 3FJTA 3SDDD 1E3FA 1XGZA 3WTUA 3W57A 3KAAA 2PETA 3D12B 1ND0B 1KJVA 1V3LA 2BVOB 3QQXA 5DFWH 3QIBD 6PCYA 1ZTMA 2EH8L 2A9DA 2FGWH 3NZUA 3L9BA 4YC2B 2ATKB 3P0YL 5KYWA 3O11A 5E6ID 5IIEA 3AG4B 3EOTH 5T1LD 4L8BA 2Z93B 4FZ8H 2R2BA 4R5VA 4XVOA 5E8NB 4YDMA 3HI5H 3QQ9D 3HAEB 3QNZB 4DEUA 5C3IA 2NY3D 4NQEB 4XN9A 5E4EC 1NFIA 4TSCH 4CILA 3CZSA 1F6AA 4OGYL 4IKLA 4EDWH 1E4KC 5JOFA 1ZS2A 3P3YA 5EBGA 5I75C 1DTUA 2Z35A 5EU4A 5HHMB 2A6KB 4UF7C 3SPHA 5C0IA 4MB4A 2ZOUA 2WD0A 4JO4L 2B0SL 4LGSB 4HJUA 3HKFA 1NA8A 2VRAA 2Z7ZA 4WFED 3OJ2C 1KYAA 3S3PA 1YEEL 5F3HA 1RZIA 1IGFL 3KYOB 1NICA 1RZJC 4M93B 1PL3A 4I3GA 5J6GB 1IAMA 1E28B 3CK0H 1DQMH 2HKFH 2F7OA 1VADA 4WI5A 2C3WA 5IROC 1S7XA 2WVTA 4JO2H 3VXMD 4J2QA 1MREL 1AZZC 1T1YA 3F2LA 3UAJC 1E50A 4G8FB 3LMJH 3L4VA 1CFTB 3DX8B 3A67H 2NTFA 3FTUA 5KS9B 4JMXA 3K6OA 1U2YA 1EJOL 3FOMB 4NJ9L 3D25A 4J2XA 2ZJSH 5BOZG 4LLWA 3PL6B 4NCDA 3KYAA 1TCMA 3DX0A 4XNXL 1J9CT 2ZX8A 4N3TA 5FYJD 4AYSA 4DCQB 3BPNC 1FG9C 3DX1A 1KXQA 1LVEA 3Q05A 3LZFH 5J0BA 2FL5A 2JIXD 4YX2L 1E5ZA 4OIAA 3NSCA 2YPKB 2NY6C 2XNAA 5TF1L 3TEYA 3Q06A 1J8HD 1ED3A 5CZVL 2BFVL 4B97A 4X7TA 3D07A 1VFBB 2HLFC 3KGSA 4AUYA 4HUXA 5EBMB 1OGTA 3UAAA 1NEZB 3TBSB 4JFWA 1J0HA 1VEMA 3ZX1A 4R84A 5JMRA 2RCSH 5EA0L 3U7YH 3WEMA 2HAZA 4LLDA 1GGYA 3K2IA 1KLUA 2ATPA 2R56H 3PP4L 3PGFL 3RA7L 3VCLB 5MEQA 4EI5B 3FUMA 5KVEL 3PHQB 4GXVH 1T1XB 4G9DB 3I9PA 5IJDC 1GS6X 2Y6SD 1IZJA 3VDCA 5DRWB 3EHBC 3PWPB 2V9TA 3SDYL 1MNNA 3V4VB 4FZEL 1ACZA 2VXQH 4OM0H 4MCZB 5EMYA 1FLTX 2OM5A 4PY8I 5CZRA 3CFKB 1EHNA 3UZEC 3IAGC 5IQ7L 2ZUQC 3RNKB 1HS6A 2A9NL 2BHZA 1T4KA 3CDFA 5KBPA 1H8LA 1OP3H 1SMOA 4LLQA 1SJMA 5HHOA 5AAWC 4FQCL 3O81A 2FX9H 3UBGA 1J9SA 1RURH 5IESL 4W9HC 5HJGA 1IC7L 3GTNA 5JIKA 1C16B 5CBEA 3BLPX 1M57B 3KDPB 4P04A 1AR1C 3HEIB 4LCCA 2LOEA 3IDXL 4P4RA 5DK3A 1UH4A 3WIIL 3PABA 2OMUB 4MXVE 3D7PA 2KPWA 4HH9B 5CEZE 4CUCA 3KCWA 1JBJA 2JVUA 1BVLA 1JAEA 1PLAA 5GGRB 2VMCA 4QRTB 1L9PA 2JJSA 4GY4A 3QUHA 4ZMNA 3U9PL 5B3NA 5IMLB 1A65A 2KI6A 4QTIL 2IADA 3DVFA 3PDOA 3WXVL 1KTCA 1NDGB 3KL3A 3GMMB 5CUSH 3GSUA 2P7TB 1OP9A 2XWXA 1RP9A 3M45A 4M3HA 2UZXA 4NNPL 4NQXB 4IHOB 4M9OA 1S78D 2KZKA 3NTCL 2GJZA 3ET9F 3I50H 4GNKB 3W0WE 1E5BA 3RZCA 4HIHB 4DKDC 3IFOA 1EO8L 2GK0B 1C5DA 3F01A 3IMSA 3C6EA 4N0FA 4YPGB 5IK3B 1J88A 3RL2B 1DBAL 2BJMH 4K9EH 4RLDA 4UB0H 4WVRA 4K5LA 1AOZA 3RFZA 2DEXX 4GQRA 3L9RB 5DD1H 3T2OA 1OT2A 4BCZA 4PJEE 4HCRH 4U1LA 4QMEA 1T7YA 4NWUL 1DEEA 1F90H 2V5MA 1CDGA 2FJFB 3N44B 1A1OA 4GG6E 2DWDB 3N41F 1ACCA 5E8OB 4Q6IC 5ISZB 1S3KH 1NIDA 2DQ6A 3CXDL 4Y5XB 1QBLL 2H26B 4ENEC 4GRWH 3IGUA 2YMXH 4P5SA 4GFTB 5CFHA 2O61A 3GZKA 4TQHA 4XB7A 5HDOA 4X4KA 2DM4A 2XG4A 3QRBA 3ULVE 3D8MA 3US9A 5C0RH 4APXB 5I18H 1M05B 1Q0EA 4F2MB 2CIKA 2JQMA 3BHBA 2YGOA 1A6ZA 4HXBL 3U7WH 4Z7WB 2G2PA 1OCWL 1FZMA 1W9XA 3S35L 1IUZA 2F19L 1LDPL 1PD0A 3CPLA 1KEML 4ZYKA 3QQDA 5A2KH 1E3ZA 2HFFA 1MFNA 4DVRH 2J1ZA 3S36L 3II2A 5F7YC 4ECNA 5IROD 4OM1H 5IQNA 4G82A 1CZ8L 4HOMA 2DIAA 2R59A 4NUPA 3UAJD 1IKFL 4E41A 1NWPA 1V7NH 4MCYA 3AT0A 4HIIB 2HVBA 2LHAA 2MJWA 4KUCF 3B7TA 1QUNB 2OMZA 2OL3H 1ZKAA 3QJQB 3UC0H 3OGCB 2VLKE 2DI9A 2Y36L 4JCMA 4R26L 1Q9LB 4NAQA 1P6FA 3ABKB 1Z1WA 3RDTA 4H40A 1M2OA 1AD0B 5B3JF 3BKMH 1OE1A 2WZ5A 3AC0A 3AREB 5SWZE 2Z8RA 2FECI 1R3HB 4K3EL 2DEYX 1D5BA 2X44D 4H0GA 4P59L 4PGBB 5DVKA 3MR9B 4DKFL 4EI0A 1KT2A 4BDVB 1HWGB 5TE4L 5AVSB 2OYMA 1VB9A 3DDFA 4Y2OA 5ABAA 2NY6D 5C0EA 1NCDH 3C75A 2LW3A 3S8FB 1I1RA 5LNGA 1CI3M 2R2EA 4XMTA 3TO2A 3RIKA 4NPJA 4NIYE 1SN5A 3HC0A 1P1ZB 2EDJA 3GS7A 2F6AA 2GUOB 2ALAA 2IANB 3QEQD 2XWBB 3L3HA 5T3ZH 1NFDA 2B2XH 1L7IH 4LCIL 2NLJA 4BWTA 3CMGA 3JTSA 2K6ZA 2ZT9C 4F7CA 4FL4C 2YD9A 4KGLA 4ODWB 1JPFB 1G7IA 1QFWL 5I30H 1OAQH 1DUZB 4KI5F 3AS0A 5F1IA 7FABL 2EKJA 3EHBD 2EE2A 1RMFL 1WAAE 5KZCB 2CXGA 3HI1B 4U1KA 2ZIDA 3SDXF 4GEIA 1Q9KA 1JERA 4JM2B 3D2TA 5CJQH 3MZTA 1N8ZA 4ZMVA 3MRLA 1HU8A 4P2YA 1BEYH 3E6FA 2EH7L 3QP3A 1CF1A 4OLYL 5D5MB 2Z8VC 3CQPA 3HE6A 1WWWX 4BKSC 4DPRA 5F7MC 1PKQB 5BMFH 3C09B 5CJ5A 2PYEB 3VFSB 2DLGA 3GHPA 4LIQE 5IVXE 1UZ6F 2VH5L 2WYZA 3MROA 3GHBL 3FN0H 5DRXA 4BK4A 4N85A 5BQDA 4RAUA 1Y18B 4OZIE 5DYOA 4OLUL 5HDLA 1DQKA 1A7OL 2Z7UA 1U8MB 1Q72L 5D8JL 4PRHD 1BA9A 1Z0MA 1AR1D 1N67A 1YEWA 2QADB 2VDLB 4JPWH 3QJHA 4W4NA 1KJ3L 5D7IE 1ES0A 4WENB 1OAUL 5DUJA 5HPMB 5E24E 2LE9A 4JFSA 3KPRE 3BVNB 3LVTA 1OGAD 3RIAK 4D2NA 5B1JA 5E9DD 2C5DC 1IM3D 3SBQA 5AYUL 3P11H 5JXEC 1X5IA 2VRQA 3LRLA 3FQRB 2IO5A 3MJ9H 5CS7A 5KUKA 1NC2B 1I9JL 1P7HL 4OD2A 4ZSOB 3OC8A 4I0PC 5GIRA 2VXSL 5EN2A 5BQ7B 1A7NL 4NHCL 5DD6B 2Y1ZA 2ZTBA 3Q2NA 4M6NL 1JSYA 1TZHA 5B1AB 4JFDB 4BSWB 1BD2D 3TJEL 1P4BH 1SHSA 2ROYA 5MEOA 1XF5B 4L4JA 1QTPA 3JUZA 4U33A 3VFTB 4ZAKB 4IYKA 2E56A 1QW8A 3VQLA 1PZCA 1JYVA 4AQ8A 4Z3HA 2GBAA 5FF6A 4X5WA 4P07A 4PJ8B 3I2CH 2GTZB 1U9KA 3VSVA 5LGJA 3TA3A 3ZHLA 4PTUB 4M1DL 3ZK0A 2CO6B 1KGCE 3RDJA 1K9TA 1HCVA 2X4SA 1SFDA 3WKML 5KWYC 1ZHNB 4ZJ9A 4R7NB 3CBRA 3TLRA 3LRGA 1SDYA 2F2HA 1QX1A 5E1AB 5C0NC 4ICXA 3ZHNA 2VQ1B 1MAJA 2CM5A 3ATDA 3GIVA 5JLZB 5KG9B 5L2KB 4UWQB 3BKJL 4YEEA 1I3RB 5LBSH 1ZGLM 1G6VK 5BRZA 1JZ3A 3IDNA 5GPRA 2XQBL 4ENED 2A9AA 3K1KC 1G6RB 5KYNA 3X11B 4NQEE 1FZJA 1AGCA 1GGIL 15C8H 3MYJA 3S34H 4IM8A 4F91B 32C2B 5LAXA 5C07A 2BP3A 5EO0A 3GB7B 3RTQC 4U4BA 4PI0A 3UX9B 1MRFL 1QVOB 2I07B 1CXKA 3ESNA 2YGNA 5LGHL 3P40A 4X5LA 4KZ0A 1NL0L 4XMUA 4A66A 3MBXH 4X83A 1MAML 4JX0A 1M56B 1BVNP 3L3DB 5I0YA 3KHQA 1LO5B 3IWVA 2BSTB 1SYVA 2CKBB 2PCFA 2MPAL 1UURA 4Z7VA 1T5WA 5HVGB 2BNRD 4PJGA 4OGQC 1T6WA 5IGXL 1JHKL 2UZIL 3FC8A 4LNRA 2F5BH 4NWTH 3ZR6A 4PJBA 2COQA 12E8L 2VLRA 2OK0L 3MLWH 1VA9A 4JKMA 4QR7A 3H9SB 4TVSa 3DTXB 1X5XA 1OAXL 4BGDA 1GA2A 4F7PA 3KBPA 4Q58C 1FNFA 5B38B 2FNBA 5HI5D 1P5VB 2P46B 4G80B 1ITCA 4NUMA 4WCYL 2YPVH 3VWJB 3L1FA 4HIXH 4RISH 5EORL 5TH2A 1I1YA 1AKJD 5KVGH 1DVFC 3KJ4B 4W4OC 1FNSH 1SRDA 4Z7NF 3BP6B 3JWNC 3UPRA 3OKEA 1HINH 1MUJA 1RP8A 1ZY9A 4JAMB 3OXSA 2AJZA 5EU6A 5GSVB 3ECBB 4K8RH 5FA4B 4RFOH 3L5XL 1FZKB 3VD4A 4WW1A 1EH9A 4QT5A 3VRIB 4U1IB 1RERA 3HUJE 1EEZB 5EOQH 4M4RB 1UM4H 2F1AA 1JWUA 3GPEA 3MRCB 4MCMA 4GKZA 1KJ2B 4R6UA 1CFNB 1JK9A 5BZWB 5TJWK 5A2CA 1TJIH 4ZUVB 3JV6A 4BXVA 1RPKA 1NFKA 3NABL 2WOYA 1K5NA 2H4EA 4MD5A 3SHSA 3WFHA 2ZYRA 3KBEA 3D51A 2X6UA 2DMGA 3QJOA 1FDLH 3MLRL 5F9WC 4MXWH 1MVFA 3B9KB 4RZCB 4F7MA 3P9MB 3B9DA 2H41A 5C7XL 4GPVA 1L9OA 3GBDA 4Z8FH 4FTDA 4ZO9A 3TT1H 3HPJA 3DX9A 4P0DA 4R0LA 3PWPE 4QNPF 5HBBA 3FCBA 3JVGA 5FGCB 1RY7B 5CSZA 1LL1A 3OB0H 4HWUA 4YXHL 5CIPB 3MRFB 1HE8A 1UWXH 2N1TE 2DEWX 4YFDB 5D2NC 2HTKC 2J44A 1MY5A 3C5JA 3GNMH 5HHVH 1N6UA 2BVQB 1FNAA 2CRMA 1I9IH 1DE4B 3BAEH 4YE4L 1EHXA 4JO3L 1J0JA 2YPLA 3T77B 2PTTB 1IBGL 4FQLH 1B0IA 2WXKA 2ZCHH 4OQTH 2CJUL 3ZUCA 4XPGH 1X6LA 3GMOB 2FH6A 1A6VH 1NGWA 1W80A 4HSAC 1KYFA 3T6VA 2ZZUT 1CF8L 1B4RA 3FTXA 1OE2A 1HESA 3B37A 3W39A 4JFHE 1TPXC 3ZGIA 3GXIA 4XC1H 3WN5A 1WZKA 3A6BH 4UYPA 1MCDA 1B90A 1N8OE 1MCNA 5L88H 3MCKB 4XO3A 2NNAA 4BQ6A 5JXED 2HP4A 4MMZA 4GSDL 4LLMB 5GS1C 2FO1A 4B9GA 5GISH 4I0PD 1CLYH 5B8CB 1E6JL 1YUHB 4APQC 4F93B 2WLZA 3G6AA 1CDJA 5DJ6A 5DJDB 4EXPX 3TH4T 4G5AA 3DKHA 1G1KA 4UAOC 3QHFL 3GIZL 4RX4A 4UU9A 1KCSH 3F58L 2WCGA 3ZIYA 5B4MC 3BZEA 1GGCH 4LGRB 1A2YA 4J28A 5FHAL 3JUYA 4AIOA 4U1MB 3II3A 4M8QB 3SJVB 4YVNA 3W11C 3WXWL 1C5BH 5IHZA 4JDZB 4PWIA 4TNVK 4QJ4B 2EIBA 4UT7H 1X5GA 3QDJB 1R3LB 1L3NA 4Z3IA 1QLFB 2FEDC 4Y2DD 4JG1H 4G7QB 4Y16A 4H7VA 1ZDSA 3IFLH 3FB7A 5C0ND 3GJFB 1GPOH 2BNQA 3AFLA 1WZLA 4HS3A 2XYCA 3DO7A 1MLBB 3EYUH 2F53D 3K6IA 4M5YL 2E47A 2EYRB 4AEFA 4CVUA 5FYKE 4ZMPA 2AGJH 4XVTL 1ERNA 4R96B 3K6FA 1CJYA 4XN7A 5D4HA 5H37H 1P7QD 2R29H 2OTWB 1B4JH 4S1QH 3RWIB 3VYPA 2QQKL 1WAPA 5F3BB 5LBGA 1HXMB 3RPIB 4ANXA 4CU6A 4YO0A 4U3SB 3DV6A 2MQGA 2JKJA 4HPYH 1NOAA 4K3GA 2YO3A 1QR1A 4QCIA 3ARRA 1I3GL 4FXGB 4XN8A 1GS7A 3MV7A 5FV1L 1T5XA 5E8EA 2FJGA 1H8NA 3JV4A 2OCCB 5EF2A 2WQ8A 4R8WH 2X4NB 1B0RB 4X0NA 3KVQA 3GXFA 3O4LA 4YBLB 1RL1A 5AW6B 3IEAA 1H6UA 4PTTB 3QZNA 4Z7WE 1M6OB 4MWFA 4AUUA 3EGDA 4UV4H 5DVNA 2Y7OA 2VXTL 3FQXB 2D7TL 2IH3A 3FH7A 3DARA 3GSVB 3PNWB 4K71B 4NM8L 1XF2B 1UXSB 1BECA 3HC4H 2BVPA 2VGLM 4F33B 2YC1A 2AV1A 4UINL 3F7QA 3CUPB 3UTTB 4PJCA 3G5YA 3O3DB 3NA9H 4LPYA 4QF1A 4D94A 3ARQA 4XBGB 3VI4F 3BPOB 4H1LH 4WRLA 3X3FH 4ERSL 4S1RL 3DNKA 4LSRL 3EDDA 4YR6B 1BCIA 5IF0B 3MO1B 2VZVA 3MV9D 3R7QA 1FVCA 2F58H 4JY5H 2C9RA 1DVFD 4P2OB 3MV01 4DK3A 3QH3B 2J6EH 2GITA 1SF5A 3ETTA 4Z7UA 2ZUSA 4F27A 4EKJA 5HYJD 3BO8B 4G11A 2J21A 1N6VA 2TSBA 2APBA 2EDRA 1THCA 2KL6A 1Y1DA 3EUDA 3FTSA 4JL2A 1NKGA 2DWTA 3ZBMA 2D7NA 1FNLA 1XB3A 1NGPL 1IC5L 4FXLA 4I1RA 5BZDB 1WS7A 4DEPB 2ADJA 1G7QA 3BE1H 1E5AA 4P3DA 3V8OA 4Q97A 1HDMA 3IRCA 2XPZA 5J11C 2BWDA 4WFEE 3NSXA 1H3TA 2RFXA 3QCUL 4KOCA 4X6BA 4DP7X 2G5UA 3HPLB 2CG9X 5DDHB 5HYEA 3MRPA 4WEBH 3VXNB 1CU4H 1ZLWH 4LCUA 1BWWA 4I18C 4OIFA 1OQOA 4CSSA 2Y2YA 5CU9A 4MD0A 2VSKB 4OBRA 4OFDA 1OOWA 3BOVA 3KPOB 5I73B 1F4WL 5KAQG 4LO9A 1N26A 4ZUTB 4WWNA 3V6OC 4C58B 1PG7X 1QACA 1FV1B 5I1IL 5AZEL 3RWJB 3TBVB 2AJXL 3VXME 2Y5TA 1DJHA 1TQBB 2V2WA 2VJ8A 3PQYA 1KC5L 2BRRL 2IOMA 3MJ8A 3MOBL 4B95C 4C4UA 4MMYA 1R5WB 2XVLA 2ATAA 1EV2E 2PUQT 5K9KA 4K7PL 3DIFB 2MFNA 1FN4B 1JE6A 4YC2C 1WLHA 3FSOA 1NZRA 3WEXB 3PP3K 4WW2B 5C09B 1D5ZA 4U3CA 5IUSA 2PYEE 4NKDB 5FYJE 1P7KB 3ZMEA 2H8PA 5CSBA 2JB5L 1A9EA 1FVEA 3WYRA 4PJ9D 2H32B 5CCKL 5AW3B 4EIUA 4QXWA 5B39G 1CL7I 3GD1C 2R15A 3I3DA 2NNCA 4AK2A 2K4WA 3NCYP 3LV3B 1AFVL 4P06A 1K4CB 4N8VB 4WNSA 1HCFX 1ASQA 4ZMTA 3FTZA 2AZAA 4YZFE 4LASH 2VZ3A 3B3IA 4APQD 1TJHH 1TTFA 3INUH 3M7FB 1OAYL 1SEQH 5H8DA 1A25A 2NTSP 4G72B 5LXGH 1BVOA 1TZIB 5DMKA 2WQXA 4ZSOE 5AYTA 1BMWA 2PCPA 5B4MD 1OZTG 3BH9A 3OHXB 3I9AA 5I1KH 1EFQA 4MA3B 5K39B 1AQHA 3RIFF 1XF4A 3W11D 4GIPD 2CK2A 2HX7A 4Y1AE 5ALCH 4PQXA 1B88A 3DMMB 2FEDD 3HI6H 3P4NB 5HDQH 5DMYA 5L6YH 1DO6A 4LE8A 4YLCA 3HKZA 1CE1H 2HPTA 4Y8AA 2G5BA 4FQQB 5FKPA 2Q2EB 2AJYH 3MFGB 3PL6C 3HZKA 1NBVL 1MWOA 3A22A 4TULL 4ZW3A 5C0BD 2J3SA 4FQ1H 4LSUL 1X5AA 4J8RA 3B2VH 5F7BA 5H4YA 3FULA 4XGZA 3DVNB 2OSXA 3LKSB 4JQIA 4OVVA 5L2KE 1O6SA 1T4WA 2WZ6A 3QDMD 1CB4A 1W0YT 4YHZH 4OUOA 3L3GB 2XN9A 2CSPA 5E2UH 5B21A 1IILE 4CVXA 4HSQA 5D7LD 4EN3A 5ICYB 2DM2A 2G3MA 3OJDB 1VENA 3HG3A 4JZOA 1NCGA 5GGVL 4B41A 1AQDA 2XZCH 3DTUB 3AABA 3TV8A 5A2FA 3ME0A 3JQOB 3RZWA 4MCNA 4PJIF 5LN8A 3T0WA 2IDTA 3G08B 5IZ7A 5DUML 5DHDA 1BVKA 1JHLL 1A7PL 4MNQD 5I1JH 3H85A 3RWFB 1IM9A 1JPEA 3ZE1F 1TITA 1YPZE 2ZXEB 3H7BB 4XMWA 5JQ6L 2W9EH 3LOWA 1X9LA 3PWUB 2R7EA 5JDSA 4QO1A 4ZOBA 2JI1A 1KZYA 3HS0B 3LKQB 4X4YA 5CEXA 1GKOA 2AK4D 3MA7B 4AJWA 1WFNA 5D71H 1FH5L 2DKMA 3QQ4B 5F3FA 2ZG1A 1QLEB 1D6EB 3IVKB 5HHQA 2IH9A 4JDTL 2FK9A 1DN2A 3QG6A 5FO8A 3BLKA 3ENEA 1RUQL 4G9FB 1KPVA 3VH8B 2APTA 2YAOA 1U93B 2VDKL 3FT0A 2ZOKB 4N2CA 5JQHC 1NC4A 2QSQA 4FNTA 3P0VL 2HFEB 4LCCC 4M7JL 5DZJA 5DU7A 1JGDA 2ENJA 2J12B 1PG7H 3KGTA 2BSCA 1U8IB 4UILH 5F96L 2VDPH 3FL7A 1IC1A 2JJSC 2CO7A 2XVGA 4W9JC 1Z9LA 3KG5A 4ZMAT 1G6RL 1TOXA 4WI6A 3UABA 5A1AA 1RIHH 1N10A 2F74B 2WBXA 2W8CA 4X6FA 4OCXL 4PRAB 4NXSA 3LEVL 1YVLA 4YDLC 3CSYB 3EXJA 3FO9A 3UJIL 2W59A 5E8PA 2YUZA 1UM6H 3B3BA 4PP2A 2A2QT 3QUYB 3ABZA 3MMEA 2DLEA 1UWGL 4R7VA 5AOZA 5FHBL 5IG7B 3TWCH 4IS6A 5D7KD 1RZ8A 2DWSA 3PHOB 4ZTOL 3DRTA 2FBJL 2E8ZA 3PJLA 2F54A 4XOCA 1BZ9A 2PXYC 4QWWC 5CLXA 3RFZC 4HGWB 3UMTA 1QSEA 4WO0A 3ATBA 3RY5A 5HJ3B 3CGTA 1EJFA 3WTXA 4Y4HB 4BK5A 4X9FA 4BFOA 3WS3A 1GGBL 4KXBA 4P5RA 5F0LB 2WTRA 2RACA 2XWZA 3HCVA 1IGYA 1EXHA 4N1CA 2APWA 3HZYA 4NUJB 2E74C 4OLVL 3LN9A 5D9SA 5IHUL 1B9ZA 2BCMA 1JYWA 3FNKA 2GJJA 4PJAA 4CGUB 5JNYA 3BH4A 3S3SA 4RGOL 2GIMA 1U8OB 2HRPH 2W07A 3K71B 3ULUL 3PUUA 3FFCB 3KYNA 3O6FB 4WKZA 4HT1L 4P46A 1SOSA 1QBMH 4FTVA 4CSZA 4LF3A 3Q6FA 1EEQA 2H45A 3E3QC 1TQVA 1C9SA 5EIVA 3MRNA 5HYSB 1GKEA 3FQWA 4LSSH 2JJTC 3DYMA 1DQDL 2QVMA 1IGTA 3QG7L 1KJ2L 3QA3B 4PJFB 2GJPA 4G7VH 4AGQA 3QJSB 4F8LA 4H44C 5DJ2A 3VE0B 5A2JH 4NENA 3ZRSA 4QKXB 3P3UA 3KEDA 4FNPA 4M5ZH 4UDTB 1BM7A 4J3XA 4TF4A 1WWCA 2XTJC 3C8KB 2FCBA 1T0MB 2QR0A 3D33A 3KLQA 5B7EA 1NQBA 2PP9A 3SKNB 1S7RA 5HPOA 3SB3A 2Z64C 4G7RB 2NCMA 5BRQA 3CLWA 2GIXA 5ICZA 4O58L 4JFFE 4NQDA 4Y9CA 4HBCH 3CC5B 4HQQH 2DLTA 3RUGA 5IFHH 5DJZA 2C4FU 3HLAB 3LN4B 4PYHA 4E9YA 1UQSB 4LSVH 4ZTPL 2V7NB 4WNJA 4YHOH 5INCB 4FULA 4I77H 2YK1L 2E4FA 3O8XA 2KLTA 4MXQC 1RJZB 3PWNA 4QXUL 2AJSL 3PL6D 1NKOA 2VQUA 4KKQA 1YAZA 2X7LB 4U6VH 3PUCA 1NCBH 2Y7NA 3AREC 4XCCL 2W81C 3MJ7A 2OMNA 3MOQA 4OZFG 1X44A 3J8F7 4L2YA 1JGUH 1SOXA 4WUKH 3AROA 4FLRA 3TN0A 1NCWH 3TO4A 2PW1A 4OZGA 5IMMA 3RX7A 3B34A 3NFSH 1NJ9A 5FM5M 3H2WA 4PRHE 5J89A 1O9WA 2YD1A 4F8QA 1U3YA 2ESVB 4JBSA 4M48H 3VFMA 5C71A 2QBWA 4P23B 4PUBL 3U6XS 1OGAE 4FQHA 4AMKH 1E43A 4HUUA 1FO0A 5E9DE 1CL7H 1IB5A 1C7TA 5ESVB 4ELKA 1H3VA 1X7TA 2ZOWA 3CFQA 4FFYA 5IEKA 3WUWG 3OZKA 4MQ7B 4I1NB 1FFPA 2BK8A 3LTVA 2AVGA 2ZX5A 3E8UL 4FNQA 3KEHA 2VO5A 1AY1L 1BQRA 1IARB 2C26A 4PJHA 4LEXH 3UYPA 4WI8A 1YNLH 1YAIA 4KQ3H 1L9TA 4PLNC 1UYWL 2B39A 4WDIA 1DDHA 4HUVB 3VFUB 1KB5A 3GPSA 4AIZB 1CWVA 4OD1H 3VFGL 5DJAB 4MDIA 5D96B 4DOHB 4HISA 3F83A 1RZKC 4RBPH 3UTTE 4FFTA 3CHPA 2ZUUA 4OIIH 3V0EA 3FU6A 4GQ9L 4BUHA 1KIQB 4LHUB 2K4AA 5HHOD 4JDEB <