2GC7C

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 26
structure length 105
sequence length 105
chains with identical sequence G, K, O
ec nomenclature
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2gc7C00
5PAZA 3X1FA 2WO3B 3ABLB 4G7SB 3NJHA 3WIAA 1OE2A 3U25A 2AVFA 2ZXWB 3NT0A 1NDTA 3NSCA 1CYXA 1AG0A 1AZBA 1BQRA 3CVDA 2DV6A 3D12B 3NJKA 2W8CA 1WA1X 4UF7C 1ASQA 1KYAA 4QLWA 2GI0A 4E9RA 3S3BB 4A2EA 3AG2B 1KV7A 1AAJA 2OV0A 4ENZA 1OCRB 1W6LA 3OD3A 2WSDA 1BXAA 2CJ3A 2QPEB 3AG1B 4WKXA 3QJSB 5B7MA 2J55A 4F2FA 4YSSA 3H4HA 1HAWA 1AR1B 2GC7C 1V54B 2HRGA 4PAZA 3TBCA 4DPAX 1NICA 3ZDWA 2EIMB 2CUAA 2GBAA 4AZUA 3QJRB 1W8EA 3UGEA 2PP9A 3EH3B 3FT0A 3JTBA 4M4RB 1GS8A 2PPDA 5FC9A 2XXGA 1RCYA 1GSKA 3WKQA 4KNTA 2HX7A 3PAVA 1KDJA 4YVUA 1TEGA 3T6WA 1HAUA 3NJMA 2VM3A 2FQDA 1JVOA 3AG4B 4E9VA 1TKWA 2J5WA 4YL4A 1OOWA 1NPJA 3IBOA 2B3IA 3SBRA 3X1GA 4YSQA 2CAKA 3FSVA 2XU9A 4KO9A 4W9ZA 3S3DB 5I5IA 3TBBA 4G7RB 5I5MA 1E5YA 3ERXA 1M9WA 1PLBA 2UXFA 4DP8X 3WI9A 1SHXA 1UATA 4BK5C 5I6LA 1SDDA 2R7EA 2H47C 5AFAA 4K9JA 5IY5B 2DYSB 2DYRB 2PCYA 4JKNA 2XV3A 4YSRA 3AY2A 2GB2A 2YAOA 1SJMA 5I6PA 2GIMA 2QT6A 2Q9OA 2LLNA 3JT2A 2GC4C 3NSFA 4KO6A 1PAZA 1IUZA 3G5WA 1ZPUA 2Y69B 2VW7A 4DP4X 2EIKB 1AG6A 3NJNA 2IWEA 4G71B 4W1TA 2HZHA 1AZRA 2XUWA 3FSZA 4NB7A 4E9TA 2VN3A 5AZUA 1SDDB 1GW0A 1GY2A 4HCIA 2GHZA 2BP8A 1L9PA 1ID2A 4A2HA 5LDUA 3MX0B 3BVDB 4BWUA 3TASA 1L9TA 4QKTA 4UAHA 5PCYA 1J5CA 1OV8A 2QPDB 1KBWA 2YAMA 2BHFA 2P80D 8PAZA 3TU6A 1ZIAA 1F56A 4AKOA 1JXDA 2QDWA 4G7QB 1ZV2A 1OCCB 9PCYA 2BO0A 1KBVA 3GYRA 2FT6A 3OQRA 4G72B 4BDVA 3T6VA 1J9QA 4AKQA 1RZPA 1SNRA 4L0PB 1QLEB 3UAEA 1JZFA 3KW8A 1GS6X 4UANA 4YSTA 1XB8A 1JXGA 2PPAA 4KO5A 2VSKB 2VW4A 3FSAA 4ZK8A 3FS9A 1SFDA 2BP8B 1A4AA 2X87A 3GDCA 2HXAA 5A7EA 3OM3B 3QPKA 1PNCA 1JERA 4E9YA 3ZX1A 1OE3A 1IKOP 4G70B 1AANA 3OMIB 3T6XA 1AQ8A 2JKWA 2YXWA 4BDVB 2PLTA 1XB6A 2PPFA 3NSYA 2BWDA 3FU9A 4DPBX 2FT8A 4JHUA 2XVBA 1ZDSA 2UXVA 4E9XA 2CBPA 1IC0A 3PPSA 1L9RA 1BYOA 3NYKA 2MTAA 5E9NA 3UACA 3UAAA 4FA7B 2RACA 4AX3A 1PZCA 4JHVA 4HHGA 2AANA 4BXVA 1WS7A 3QJTB 3FYEB 1AS6A 4N4YB 4BXSV 2FTAA 1URIA 1MZZA 1L9SA 1SF5A 5D4HA 1ET8A 3OMAB 3WNIA 1PZAA 2Y1AA 1X9RA 5B1BB 4KOBA 1OCOB 2MRYA 1V10A 1J5DA 3T71A 1E30A 4P5SA 3IE9A 1PLCA 2DY2A 2TSAA 3AG3B 3BQVA 1E67A 3DIVA 1SF3A 1MDAA 3S8FB 1CYWA 2W88A 2IDQA 3NJLA 1T5KA 4FAAB 4DP2X 1A3ZA 2IDFA 1PF3A 3PXLA 4AKPA 2FQGA 1JVLA 1KCWA 3KW7A 2J57A 3IN0A 2IH9A 3FQ2A 1WA2X 3FU8A 2XV2A 2XYBA 2JFCA 2B08A 1A4CA 4WTQA 3ASNB 3T6ZA 4DP7X 1W6WA 3IEAA 3N55A 3N2JA 4AI7A 1PLAA 1ASPA 1OF0A 4F2EA 4DP5X 2BP0A 2WO2B 1ET5A 1PNDA 4GP4B 5B3SB 1AIZA 1NPNA 5D4IA 1QHQA 2A3TA 3ASOB 3CDZA 3FQ1A 5I6MA 2YAHA 1DYZA 3S3CB 2VSMB 2R7EB 3H56A 4YSUA 3MBWB 1JZHA 4CSPA 4MFHA 4A2GA 4N8UA 1MG3C 2IH8A 3X2QB 5I26A 1RZQA 1CC3A 3WNJA 4BWTA 2PPEA 2UX7A 4HCGA 1A4BA 4RH4A 1JOIA 2BWIA 4HAKA 4DP9X 1PMYA 4PCYA 3UABA 3FPXA 5TK2A 3ABMB 2FQEA 1EZLA 1NIEA 3SQRA 4EF3A 2IWFA 1IBZA 1NIBA 6PCYA 3HB3B 1BEXA 3QJUB 3H4FA 2VMJA 3CDZB 2DWTA 2PP7A 1KGYE 1MG2C 2XLLA 4GP8B 4A68A 1XMEB 5AKRA 1AOZA 1JZGA 4X4KA 3FPYA 4KNSA 5B1KA 1NIDA 1BQKA 2YARA 4YSDA 4GYBA 1I53A 2CCWA 3TA4D 2FQFA 2PCFA 2IWKA 7PAZA 2EIJB 3ZBMA 5B1JA 4E9WA 2TSBA 1MZYA 1J9RA 3QQXA 1EHKB 1NZRA 2NRDA 1GY1A 1IBYA 3RYMA 1M57B 3X1NA 4GY4A 1WAEA 3FU7A 3CZUB 1AACA 2AZAA 3EH4B 1TEFA 2PP8A 1L9OA 1E65A 2I7OA 4Q8BA 4A2DA 2AFNA 4DP0X 2YAFA 3DTUB 2IDUA 3PAZA 3FYIB 4HALA 4BWWA 1VLXA 5I28A 1JZIA 3S8GB 1SHWA 1FFTB 4YSOA 5B1AB 1HFUA 1AS8A 1NIAA 3EF4A 3UADA 5F7AA 7PCYA 2FNWA 1BXVA 4E9SA 1ETJA 2X88A 1AZNA 4A2FA 2ZONA 1PY0A 2EINB 2XX0A 4HIPA 4YSAA 1GYCA 1YLBB 2HRHA 1N70A 2VM4A 3FU7B 2YXVA 1GS7A 3EHBB 2FJSA 3FSWA 6PAZA 2GSMB 4CSZA 2CALA 1V55B 5B7EA 1JZEA 2ZOOA 1NINA 3GXUB 1OE1A 3SBPA 5EHFA 1NIFA 2H3XC 2E86A 2OJ1A 1JZJA 3PCYA 1BYPA 4YSCA 4HZ1A 2VW6A 4KO7A 1L9QA 2EILB 2HX8A 4NAJA 4DP1X 3EH5B 2P80A 1ZDQA 2DWSA 2OCCB 2XWZA 3NJJA 2IDTA 2FT7A 2XV0A 3NJIA 3ABKB 3X1EA 4TXVB 3L45A 1X9UA 2I85A 2YAEA 1NWPA 2UX6A 3OMNB 1CURA 4GP5B 5F7BA 3FQYA 2HX9A 3HEIB 4KNUA 4A66A 2XX1A 3ZIYA 3DKHA 1OCZB 1ZIBA 5B1JC 2YAPA 3NJGA 2I7SA 2YQBA 1J9SA 4HCFA 3NP3A 3NSDA 3QJVB 4YVNA 4E9QA 2AZUA 2BZCA 2J56A 1WA0X 4Q89A 1A65A 4YSEA 1JXFA 1M56B 4M3HA 5I6NA 2H5UA 5TK4A 5ANHA 4P5RA 4YSPA 4KOCA 2IAAC 4GXFA 3V9EA 3PAUA 1KDIA 1FWXA 5B7FA 3CVCA 1AS7A 2BZ7A 4NERA 2JXMA 4HHWA 4F7KA 1TU2A 1NWOA 3T9WA 1J9TA 2BW4A 1QNIA 1ILSA 1AZUA 1BXUA 2BP0B 2IDSA 3PLYA 2PPCA 1RKRA 3AZUA 1A8ZA 2N0MA 1BAWA 5I5JA 3AW5A 3V9CA 3WKPA 3C75A 1ILUA 3WG7B 5I6KA 3CG8A 1ET7A 2BW5A 2QDVA 3ABGA 1FA4A 1AZCA 1R1CA 3NJFA 1ASOA 2HLEB 1GR7A 5D4JA 3CVBA 1B3IA 1NTDA 4DPCX 1KCBA 4A67A 2YAQA 1DZ0A 2FWLB 3QJQB 1ADWA 4DP6X 1PZBA 5I6OA 3NP4A 1WS8A 1BQ5A 1N68A 2UXTA 1PCSA 3IN2A 1SFHA 3SBQA 1XB3A 1E5ZA 3X1BA 1CUOA 2ZWNA 2Q5BA 2UXGA 2XXFA
chains in the Genus database with same CATH superfamily
3FN3A 3RRQA 3X1FA 4W9FC 5K39B 3ABLB 3KGRA 3MCKA 1EFXB 3L1OH 1ZVNA 1DQIA 4WO4C 2XWTB 1QFUH 2JKJA 4NYLB 2ZUUA 4I77L 4JPQA 4MDJB 3QG6B 4FMFA 3ECVA 1M9SA 1KLFA 3MRCA 2IXQA 1K6QH 1TETL 1VEOA 3B6SB 2P8MA 5B39G 3STLA 2RB8A 4LDCA 3SGDI 2RJMA 1OAYL 2Z93A 2VDRL 3AG2B 4NQXA 4ZD3L 3ZPDA 2AVGA 5KWYC 1T5WB 3HB3D 1CBVL 1N59B 3FCBA 2MJWA 4F9LC 3AVEA 3HN3A 2YA2A 4RWHA 5CP7A 4YSSA 3TJEH 2PABA 3PHQB 2JLPA 5JUEL 5A2BA 4Z7VF 3MV9D 2DJSA 1HKLH 5IP4A 1S3KH 1RZFH 3KM1A 1A8JH 5DFWH 3F7RA 3QIBD 4PW3A 1NICA 3S35L 4UV7L 3QULA 4MHHI 4U6XB 3IDXL 3SPHA 3BJ91 2EH8L 3GRGA 4BSJA 1GSKA 1MAKA 1Q1JL 4UT9H 1F4YH 5DDHB 1A7QH 4Q0XH 4XP5H 4YVUA 3U7WL 4AEFA 4F3FB 4FNRA 2ZPKL 1NOFA 3K2MC 1GSMA 5GGQL 4GG6E 1A7BA 2ATKA 5TH2B 5E1AA 3MJ8A 4KTYA 1RZGB 1T3FB 1OGAB 1DDTA 2E6PA 3ARZA 1S7WA 1FFNB 4E0RB 1F5WA 3G5ZB 5HI4D 5L9DH 1JK8B 4FTVD 5F7WC 4F58L 1M9WA 2HT2D 4HK3N 3P11L 1BA9A 4NQTA 1YPZE 4UU9B 1WAAA 1IEAA 2JI1A 3FK3A 1A6TA 2MMXA 1KENL 2O1AA 1ZHNA 1V7NH 3MQIA 4HYTB 5CJXA 4BK5C 4OVUA 4YHLH 2WTPA 2EJ1A 2FYYA 5JR1L 3VXUD 4ZFGH 1AGCB 2VRQA 5IVXA 5EF3A 1FBIL 2DYRB 5DEGB 4AM0Q 1P7KB 4OJYA 4PRAA 1OGPA 4KQ3L 5I6PA 4LL9A 4WHDA 4PRHA 1EZVY 1A6UH 1GGCL 1MEXL 4BZ2L 5C2BH 1H3PL 2C3HA 4XCNA 3D6GA 5KYWB 1P4IL 1V3JA 1ZPUA 2HVJA 3HMXH 1RUPL 4M8VA 4H20H 2X89A 3NJNA 1DQJA 2IWEA 3DBSA 3EO1A 2CLZB 1CLOH 2HZHA 4NFCA 1T0OA 3IJHB 1U8MA 1AI1H 8CGTA 3ZOAA 3QT2A 4M02A 1EJFA 3BZDA 5KSUA 3L3OC 5KJ7E 3ML9A 4FCAA 2GI7A 2PXYD 4PJIA 4ADGA 4QKTA 4PV1C 3WDJA 1OV8A 1BQHA 1QI4A 4P04A 5CILH 4QRUA 4HG4J 4QXTA 3OKMA 5JIDA 4AKOA 1F56A 2X2UA 4IDJH 5E08L 2VJ8A 1E2WA 5HI5C 4XB7A 1JV5A 4OF8A 1T1YB 2Y7QA 2ZWZA 3CDGB 4N2CA 3E6FA 1D5IL 1Z32X 1INDL 4J2QA 4H25B 4JFHE 4KTEH 1GS6X 1R4XA 4HV8A 2PPAA 1R47A 3GPEA 4KKNA 2VW4A 1EGJA 4GLRH 1IRAY 2XY2A 1J1OL 4R4FL 3GDCA 2G2RB 2HXAA 4CGTA 1II4E 9CGTA 1I9JH 5ETUB 3S4SB 5HJ3B 4BK4A 5LVEA 2AQRA 2D7TH 3P9LA 3LRKA 4UINH 4Y8AA 4BKLA 2J6EA 5IEHB 1U93B 4P9ML 2JCCB 2ARJA 2EYRB 4Y4HC 4RMVA 4OCRL 3PWUB 5E2WL 5KYUB 3MRPB 2CLRA 5K9JL 3EFFA 1ZA6B 1NOLA 3RY4A 2PPFA 1DP0A 4JFFA 4UIMA 1G9HA 1CLZH 3LD8C 2XVBA 1ZTMA 3QZMA 4GQQA 2NW2A 5K69A 3NGBB 4OGYH 3BAWA 1ZCRA 3CLEL 3BOVA 4FFVC 3NG5A 4YHML 2XJKA 3CVHB 1F90L 1HYRC 1QD0A 4I48B 3CQQA 5DMJB 3EJYC 5EEYA 1SEQH 4GSQA 5FO8B 2DM7A 4M9PA 4MTMA 2AANA 5DHDA 5C07D 2KT6A 2ZCKL 3PGCA 3MO1A 4P2RB 3U0PB 1AC6A 4L8SA 1PD6A 2WNXA 1LQBC 1UM6L 2NZ9C 3CXHJ 3QRFM 2XA8L 2R9HC 3GBDA 2NY5C 2ENSA 2QVIA 1WAAE 3QQNA 2JI3A 1HT6A 4KK5D 2EXYC 5AW2B 5B1BB 3ZY7A 5C0JB 4QRQB 1NC2B 2DM4A 3BEWA 5HVHB 2FBOJ 2CWRA 5IVXE 5H2BB 1C5CL 2X53A 4KKAC 1PLCA 1G7MB 4LK4A 3NEXA 3TYGH 3FQRA 3VXTA 4WV1A 1CXIA 3IM1A 1I1AA 4PRHE 2AEQL 5A2CA 4IBVA 4O4YH 5BO1H 4P2YA 5CZVL 1BJ1J 4FXKA 2H2SD 4WO0A 4N8CL 1JWSA 4R2GB 3NJLA 3ZSTA 1K2DB 1VACB 1W80A 1ZHBA 2IH1B 4M5TA 2PCPB 3H9SB 1WVZA 2V7HB 2X4RB 1H8NA 2JFCA 5E1QA 2B08A 3SE3C 4WEBL 4RAVA 2VLMD 3HRZA 3T0EB 1B90A 3U2SB 3QZBA 3ZE2B 3H9HA 3JWOC 4F80A 2FX8H 3C5ZB 4PTUB 5BVPL 4N2HA 2R0LH 4JRWA 4HU2A 4PJIE 2BP0A 3WTWA 1NJ9A 1QLRA 5KYYB 1U8KB 3TV3H 3EDDA 1YUHA 3PWLB 4JCMA 4QRSA 4F37F 4HKZB 1GCYA 4OCYH 3CFIC 1BF5A 2A3TA 1QTPA 5DHVB 2OYPA 3HTLX 1DYZA 4P2CG 4KXZI 1B4TA 3B5HA 4PJAA 1LEKA 4ZXBC 1LO5B 4GSRA 3MUGB 2CDGA 3PWVA 4X42A 4Y4FB 1MJ8L 4GRWB 4M56A 4WI9A 4DUXA 4PREA 1WBZA 5EC2B 1I8LA 3NSJA 2WUCH 5JIIA 4U6YA 3UABA 2ERJC 3MV11 2NCMA 3IDYC 4OM0L 2AJYH 4MCYB 3VFVB 4HZLA 3VH8A 4B41A 2OAAA 3W9EA 4NUGH 4FQCH 2YC1A 2EXWC 3IMBA 1C5DB 3DGGB 1JPFB 4WO4D 1P7QB 3ENEA 4HJ0D 2R1YB 4O02L 3L7FA 4JFFE 3GJFB 3ETBF 1GIGH 3NK3A 1NMBH 3FOMA 3DK0A 4DAGL 4AQ8C 2FATL 5CU5A 2LW3A 4B97A 2WXQA 3LPWA 2F7RA 2LGNA 2AI0L 2BOCB 3H3PH 4Q74A 1QI3A 2CGRH 1S9KC 3WO3B 3MLZH 4W9LC 4B9PA 3N42B 3S98A 3B5TA 4MA3A 4MD5B 5F70A 5I2IA 5EU6B 2W91A 3U0WL 4ODSH 1RMFH 1S9VB 2B2XL 2I7OA 2X4SB 2XIDA 5IBUG 3D0AA 3MRLB 3MRRB 1CICC 4Z76B 1IKNA 4J39A 2B39A 2VR3A 3BESR 3FYIB 3MRIA 5HGBA 5IMOB 1BZ7A 2ZSVB 3HZKA 5HYQA 1IQWH 5JIQA 1OO2A 2Q10A 2K45A 4KJWD 4PEEA 1HSBA 2IQAA 3KBHE 3FTYA 4KJYB 4NO0D 7PCYA 3KH4A 3HS0C 5FHBL 1CQKA 2FNWA 5C9KA 1BXVA 4BZ1H 1HNFA 5MI0C 1KCSH 4PJ8C 4HGWA 2EINB 4N26A 2GK2A 5IMKA 3MRMB 3QDGA 3DV4B 4GRLB 3EHBB 4PJ5B 4BRJA 1MW2A 2R56L 2WKOA 3MR9A 4X6EA 1MJUL 4HXAH 3CD4A 3BVVA 4AMWA 1T20B 5AD0B 1ZEAH 1BCIA 2G3MA 4LU5L 3QHFL 1TJGL 1WT5A 4KDVA 3D85B 4N87A 4TUKL 1ED3B 4HZ1A 1UASA 2HX8A 4NAJA 3C08L 4X80H 2FECI 3GMNB 2IBZY 3E3QC 5HI3D 1WICA 2DWSA 2XWZA 4UTAA 5IB3A 4ZUTA 1ORQA 3HPLA 3LV3A 2XVGA 2D2CC 4BFBD 2JKIS 2XTJE 3FQNB 1DBAL 1QW8A 4YHNA 4ZMZA 1QBLL 3PGDB 1HCYA 1X6NA 5DHYB 5I8KL 1J1XL 2I85A 4ADJA 2KPWA 1EXUA 2Y4SA 3KMDA 4O2CA 1CURA 3QCTH 2DM2A 2DLFH 4PJAE 4TNEA 1YMHA 3JZ7A 4LCIL 4Z77B 3HEIB 4L3FA 1NBYB 3PIQB 3WNPA 1XO8A 1FP5A 4M6OL 2WLMA 5I30L 4NP4L 4K3EL 3IXTA 1EPFA 1NAML 3Q9QA 1T0PB 1QAWA 1AKJD 1AXSB 2I07A 1FG2A 4BQ8A 2F8XC 2I7SA 1X9QA 2X4PB 1SN2A 1Z9SB 5TFSH 4XPTL 1T6BX 3ZUNC 3A6CH 5E5MB 2BZCA 3L5IA 2EICA 2CO1A 3N6YA 1F4HA 4HMCA 5I6XB 3H42H 4KKQA 4HKJA 1HH9B 5TK4A 2W0FB 4E5XG 4ALAH 4NI6A 35C8L 1IAMA 4FQ1H 3C9NA 3PL6D 5CLTA 3P3RA 5HD8D 5CNHA 5TE4L 4A04A 2FO4B 2IAMB 3T9WA 1J9TA 2HN7A 2UUDK 1BJ1H 3RWIB 3KHQA 4CSTA 2DIEA 4MNGB 4ONHA 4ZOCA 5HI5D 4HXBH 4WUUD 1Q72H 2AXFB 4OZGF 4PVBA 3NA9H 5B21A 3VFRB 1HXMB 1NCHA 4NO5B 3QYMA 4EAEA 3DJ9A 5J1TC 1INEH 1CD0A 2BP5M 1UZ8A 3WG7B 2J20A 1A21A 2DM3A 3FQUB 3IJ9A 1JCVA 2ENJA 1MFBL 4B0MM 3DO7B 2MIZA 4AYSA 2IGFH 2GJZA 4GG8A 1QR1B 3MV9B 3CSGA 2ZKMX 3F62A 4RFOH 3AY4C 3LH2H 1FC2D 1GL4B 2RALA 4FG0A 4GO9A 4XPHL 2VR6A 1ZLSL 4LLYA 4UNUA 1NBVH 5DK3A 5CCGE 4NHUA 2YSSB 4Y4HD 1UXWB 5ICYB 2FK9A 4PSPA 1UB5B 1G6RA 5AW5B 3BIKB 4PGBA 2DBJA 3QUZC 4JBSA 1E5ZA 4MSWB 5GQBA 5H4YA 2OL3H 4HJIA 3VG0L 5E00B 3Q6GH 5MEND 3NJHA 1ZRUA 3BE1H 1NAKH 5ID1B 2OMXA 3KVQA 4KI1A 3QDGE 4HOMA 4FFVD 3TEXA 1UWEH 3B2XA 2EE9A 2HLAA 3SDDC 2EDLA 3VGFA 4L9LA 1AZBA 1E9OA 1O5PA 3EJYD 15C8L 5EEUA 1HNGA 3LN5A 2YRZA 1PCXA 3CZFB 1CL7H 5FB8B 1QG3A 3FFDA 1AAJA 2L7JA 2NZ9D 2XKNA 1XSJA 4DW2H 5TF0A 3PHAA 4OF3A 2JIXB 2R9HD 3QR1A 3N40P 3B5GA 5B3JE 4NN6C 1QPXA 1U8NB 2ZUQB 4PLOB 4XMVA 5HDBF 1TTCA 5D1XB 2X5PA 4E68A 5C8JA 2EO9A 3ZGHA 3VXUB 3U48A 1Z9LA 3WEXB 4KKAD 1MJJB 1PYWB 1XF5B 2AJZB 1MRCL 2V4LA 2YFOA 4KKBD 4KUZL 2VJXA 4WWKC 3WIIL 3QWNA 3K2UL 1KTLB 3F64A 4RSVA 5AOIA 5I8EA 3MCYA 5KYXB 4B9ZA 3WFDH 1D3CA 3RVXC 2DWYA 4WW1A 2APXA 4LCCB 3TXAA 5DJDA 5I1HH 2VAJA 4HX1A 3CN0A 1LWJA 2PF6A 2V5SA 2V8MA 3QXDB 3PPEA 1BFSA 4ZYKA 5D1QC 1BPLB 3RI5F 4FNLL 2AK1H 5IB1A 4IBUA 4OZ4B 2P48B 2J8UF 3MRBB 4LLUA 5DJ0B 2MEJB 4Q9QH 5D7IB 1YC7A 3MJGX 4BE6A 4N0UB 4NQQA 1JHTB 5D93C 3K46A 2DDQH 4PUBL 2A4EA 2KPNA 1H5BA 1CGVA 4A63A 2OA9A 2WIIB 3CN4A 3RWFB 4JNXA 2HJFA 3MRDB 4WU7B 5DA0B 5FCSH 4FQIH 1Y0LA 3SJVA 2PETA 3APMA 2W65A 3ARTA 4N0YH 5I6LA 4PV8B 4YC2B 5JW4Q 5EORL 4HBCH 4WW2B 4ZXBD 4NQDE 1PX4A 1TKWB 2ADIA 5EBWA 2XV3A 5ALCH 4E42B 1CXHA 1DE4B 1TJXA 4ANWA 1OT2A 2CK0L 5A6IA 3T4AC 3I6KB 1FNGB 2QADB 3SYQA 5HYSG 4TSBL 2N7AA 4P46C 1KFAH 3CFCH 3EYOA 2GBVA 2Y69B 2NMSA 1PG7W 4PJGA 4KI5F 1Y7VA 5LCVH 4EVNA 1IC5L 3T4YB 1LP9E 3DUUB 4AGQA 5DJCB 2XUWA 5AG8A 1A1OB 2X1QA 4KXDA 1D5ZB 3CMOL 3NEEA 3HG1B 1CN4A 1OTTC 2CIIA 1EQWA 3V52H 2NXYC 3RPIB 4LQFL 3FB7B 4GBXA 1GTNA 1XZ0B 2Z6FA 3CHXA 1BWWA 5CWSB 5K1JA 3O11B 3SKOA 3WXWL 1CE6B 3RA7H 1IM9B 2CM6A 3MOAL 2WLNA 4G3YL 4FEMA 2XQYK 5F0LB 4FQJL 1TENA 2YPVA 1J8SA 1Q1PA 2EO1A 4WKZB 3RGBA 4F24A 3JWOH 4JFVA 4XNXH 3T6VA 1I8MB 3CFEB 3K2IA 3LCYA 4UV4H 4F93B 5I17B 3T0WA 2ZX5A 2Q86B 1JCKA 1CICD 3L9BA 2MTPA 5ACMA 5L4JA 4TULH 1A6VH 1WLHA 4PJHA 3B8SA 4FERA 3KLSA 2ZUWA 4ZPTB 3MFGB 1PNCA 1QP1A 2C7UB 4ELKB 1OD7A 4CC0A 3ESNA 3HR5A 2H32B 4UILL 3EGSA 3OKOB 5H35B 2IFFH 4DKDC 5I1LB 1C8PA 3MKKA 1AANA 1MCWM 4PJ8D 3IDUA 1N9PA 3O0LA 4B50A 4BDVB 3FMGH 4MDRA 1WEJH 1XB6A 2X9WA 3F6JA 2F54B 3GRWL 1ZDSA 5DU7A 4K8RL 1BLIA 4KWUA 4LVHB 2Z31A 4GQPH 1UUNA 3FO0H 3JWDL 3MMEA 2DW5A 5JORB 2VSCA 2DBLL 1KTDB 1RQ5A 2XPYA 3WLWC 1QZ1A 3N3EA 4XCYB 4B9CA 4DVRL 1HYSC 4R26H 2BERA 3ZKNC 5DK0B 1RAMA 3RQ3A 4A6YB 3UPRB 1PD0A 4MJ6B 1YEWA 4FKKA 1D5BB 5DJ8A 1OP3K 1QMUA 4AQ1A 2WXOA 4XOCA 1KB5B 1PD1A 4JPWL 1BVNP 4WI7A 3X3FL 2HG0A 2PR9A 5JNYA 1IFHH 1OM3H 1DUYA 1HQ4A 2YBGA 5LGJB 5C0NC 2IADB 4GSDH 5E4EB 1BDYA 1H3TA 2ZJSH 3SJVE 1F6AB 2FJHA 1S7RA 1OCOB 5T33H 4GXUN 3T71A 2YMOA 1O7VA 4QXGL 5IROA 4AG4H 1QBML 4U6VL 3BVNB 4KKRA 3Q0HA 2DLEA 4LCWD 1BM7A 2RGSA 3FN9A 3IGFA 3BP7A 3NAAH 2J25A 3P9MB 4OY9A 4KMTH 4N90E 4XN4A 4X8XA 2OP4L 4TQEL 1FO0H 3VCLB 4XN7A 5DMIL 4TOYH 3Q2LA 3R0MA 3ARFB 3INUH 4P49A 4X9BA 3O9WD 4PJGE 4A1RA 2NNRA 5CLYA 2I9LA 2BOBA 2EE3A 3DA0A 3LQAL 4LFHG 4PTTB 1RJZB 3FQ2A 3OF6D 1TR7A 1MIMH 2FBRA 2P5EA 4PRBA 4KHTL 1H19A 3W81A 1J12A 4E41A 3TL5A 4CMHB 2OFQA 3T6ZA 4WI4A 3IEAA 2XXCB 1Y6NR 4MS6A 4KH9A 1TNMA 1F00I 1XBDA 3P2TA 5DC9B 2IGTA 2XKSA 3H7BB 4M7KL 3TBSA 4OD2B 4Z7VB 3BO8B 2V2TB 1Z6JT 2OZNA 4AQEA 4PGCA 2CA4A 3I75A 4YXHL 1AJ7L 5FYLE 2YOAA 1WV7T 2J21A 3VD4A 1ZV5A 1VFMA 2R2BB 4IOSA 5DZJA 3V0FA 3FT3B 2CNYA 2EEAA 2XN9A 2QZ5A 2JJVA 1S6NA 3HE6C 1HEHC 5D5MA 4XWOC 3EADA 3BSGA 2IG2H 2NY4B 2IH8A 2QHRL 4XXWA 5HHVL 2HB0A 4XC1L 3PABB 1N6UA 1JK9B 2D03H 3G6JF 2G2PA 1IVLA 4WNQB 1YEGH 4DGYL 5GGRY 4FRWA 4QTIL 1E6OH 5A2LH 3IJ7A 1EEZA 1UFGA 1RXLA 3GSNB 3CHPA 3FT2A 4HUWB 2PP7A 5GS1A 2VDQB 3HC4L 4JHAH 4AJYV 2RTTA 3FPYA 2J2ZB 6FABH 1D5MB 3IGAA 4NBYB 2A9DA 3FL7A 4LL1A 3SDDD 1YJDH 4N2GA 3RNQB 2P44B 2YZ1A 2PCFA 1ZSDB 1KC5H 1WIOA 4MMXC 4MXWL 2FLMA 4AVKA 4F1ZA 5E1HB 3RBSA 1KJ2B 1S8DB 4YPGA 3CX2A 1MI5A 1LEGA 4Z7UA 4EMZA 1GY1A 5JOFA 3L13A 3EGDA 5TE7L 3Q01A 3X11B 3BZFA 3VSVA 1U3HA 4IEFB 4W6YB 2CK2A 3D25B 2FJGB 3BUYB 3CX5K 4N0FB 4L4VD 1T21A 3KPTA 2BVYA 3VXRA 2NTFB 1BJMA 1NEUA 3TC9A 2L0DA 1QI5A 4L37B 5M95B 5TGBB 4WWKD 2RA1A 3L4XA 4WLCA 1E6JH 2DZEA 3SKJH 1USQA 4ZO8A 3UTTB 1RULH 5G55A 2CBMA 3MLVL 5A6LA 3QE5A 1GHFL 3RVXD 3U4EB 2E7LC 4NZ8A 4RESB 5E4AA 2DIAA 1KBPA 1P1VA 2H9GA 2WVUA 1AKJB 1N5AA 3UOAB 4D0DB 3BH8B 1OAJA 4IGBD 4HIPA 1MFEL 5H8DA 2F9BT 3A22A 4POZC 5D1QD 3QEQA 1V55B 1UD5A 1F11A 4LOFA 1JGLH 4HA1A 3KYNB 1DJXA 3D08A 4IOFD 1QSED 1JZJA 1S7VA 4PRDB 5DD1L 5HGAB 4JJHA 2VW6A 1Z1WA 3QFGA 3MJ6A 2P5EE 4Z7IA 2VCOA 1AO7A 4E41E 3CDCA 1QNZH 4S1RH 5AENA 5LDSA 2VMFA 4ODWA 2GSGA 1J0YA 1E28B 3CH8A 1VDGA 1SUJA 1R0AH 2ATPA 2BSEA 3ECWA 1N4XH 5KBKA 5KUKA 1T7ZA 3NCCB 3O3AB 2ZAGA 3BUPA 3J2PA 2ZOWA 4HUXA 4XNMB 4XN5A 3KPSA 3N5AA 1RZKH 5ADPH 4R5TA 4H8WC 5EOTA 4LHUB 5IG7B 2VTFA 4JY5L 2COQA 3N1MC 4PJFF 3GTTA 2EDHA 4P46D 4KNUA 4UQDA 4Z7QE 4N24A 4JY4A 2V6HA 1VJSA 2EVIA 1CLVA 5D5ME 2C9AA 3TO4B 5CJBA 5TD4A 1XF3A 5CEYA 4NCC1 5E94A 2YAPA 3NJGA 1DQLL 2XBTA 4AM0B 3A3YB 4ZZKA 1AY1H 1W0WA 1KBGH 1SHMA 3GJEB 2EYSA 1RIUH 1Z3GH 5D9SB 5DEFA 2C5DC 3DYPA 5GSVB 2XPGB 2GJ6B 1GYVA 3EHBC 4DETA 4M43H 1XR8A 5IESL 4LLQB 4QRRA 2NXYD 4OI7A 5E4OA 2P8LA 3RJQB 3HNSH 3ARGC 1NCBH 1OTUC 1QLEH 2UZYA 4GT0A 3OR6A 1DQDH 3AXIA 5FYKU 1TU2A 1JFQH 2GW5A 1NSNH 1PZ5B 5ESQA 4DKEL 3DMMA 4LCYA 3I84A 4PWIA 4TNWF 3GHBL 3IGLA 2ZXGA 3B2MA 4P23B 3W9DA 4JDEA 5EZOL 4G8IB 3UJIL 4MJ5B 5D2NB 2WLIA 1A4JB 1MI5E 4Z7UE 2E6JA 3DX6A 2VDOB 5F1IA 4UMSA 3EYUH 2DQEH 2BIQA 5KOMC 2O30A 1FA4A 4WIQA 1AZCA 2XOTA 1H3GA 1S7TA 4MMZC 3GMLA 4BFJA 3PS6A 2KS0A 2R27A 3VXRE 1Z9PA 4F7EB 3PJLA 3QG7H 1UB6B 4X9FA 3NFPB 4DCQB 2A9NL 4TVPD 3SGEH 4XBEL 5F21B 3MRQB 3BLPX 3GIZL 3V7AG 1U8LA 3VSQA 4JE0A 3KPLB 4HPOH 4Q4EA 5EUKB 5L0QB 1UD3A 4KKPA 5EOCL 1WZ1L 5CBEB 3GJFK 4V2BA 5JW5A 3IDJB 4N25A 5ILTH 2WNKA 2JJUA 3BGFB 1B2WL 4GI6A 4XVTL 4KXAA 3U25A 1QA9B 3OB8A 2E27L 1KG0B 1INQA 4BINA 3QEQE 3T0XA 3X3GH 1ORSA 3WLWD 3KPNB 1HYSD 1V05A 2R2HB 3EJZD 3ZKND 4L2LA 5IFAL 3GBMH 2D0HA 3LX9A 3M88A 4DQAA 2X4QB 2WANA 4YUEH 2BNRB 1FFOB 3ZT6A 4K3JH 1AO7E 1UWXH 5BZDB 4PH8A 2YPLB 1BXAA 5MEQB 2L8AA 2VQ4A 4LVOC 1FL6A 2FJFA 2J55A 4F2FA 1DBBL 1U92B 1EK3A 4Y5VB 5C0ND 2GITA 5FO9A 2YMXH 1TTAA 2JKNA 5ESAB 3NTCL 3ILPA 4OH2A 3QVAA 1EANA 4GRMB 4LKCA 4LP5A 3BZ4A 4JKLA 3UGUA 4RZCA 5AWNL 5F9JB 3EO9H 3KPSE 1HIMH 2A99A 2BVUA 1CE1L 3G04A 5E1GA 4AK1A 3FHQA 4F92B 5KAQF 4LEOA 4UOW0 3LIZH 4X5PA 3RZCC 3ES6B 1I9EA 3CLFH 3RG1C 5CF3A 2F53B 2TRYA 1CDUA 2J72A 4WFGE 5TDOA 4GW1B 2VDPB 4ONFL 4LVEA 3RBGA 2EEBA 1JVOA 2HUHA 4JLRA 4KX8A 5IVZA 2CO7A 1VF5C 2OM5A 3QNYB 3LXCA 4P59H 4RFNB 4X4MA 4HJJL 3VWKA 1GZPA 3OKDB 4UT9A 4PLKC 4YSQA 3CQPA 4XMLH 4U1IA 3VGAB 5J0BA 2FVNA 3B2UC 3FH8A 2A74A 4A37A 5AAPA 2XZCL 1T0NA 4FXGA 4OZFB 4P2QD 2KHAA 4LRNH 3M6DA 3MSPA 4PP2B 3ROOB 1E5UI 4K9EC 1A7QL 1A7PH 4N9GA 4K07A 3MOBH 4RX4D 5FO7B 1CZ8L 4ZO6A 5IVNA 2WZ5A 3QUYA 5E70A 4HFWA 3MGTB 2YD0A 1JNHB 4KRLB 5ABAA 1P9MA 4Z3HA 5EA0L 1SYVB 3T2LA 3HE6D 3LEXA 5T1MA 3NFNA 2FIKB 2ADGB 2Q9OA 4X0NA 3RWHA 2BNQB 2VWEC 3CBKB 1M05B 5KVGE 2GC4C 1AMYA 3NSFA 1NMCB 3KS0J 1GGIH 4LDOB 2VN6A 5CSZB 2J73A 4HIHB 3AU1B 2L4OA 2ZG3A 1XIWC 1V7NL 3AB0B 2F74B 3APCA 3D30A 4ZQKA 4ES9A 4YHLL 5LLIC 4CGUB 2Z7UA 4OD3L 3K3QA 4NB7A 4M93C 1S9XB 1DUZA 5AVYB 2MPAH 1DVFA 1FFRA 2BP8A 3HMXA 4E5XA 2ZICA 2NY1B 5ISZD 2WWOA 1F4AA 3WHXA 2A73A 4Y1TA 4NPYA 3IFPB 4NXKA 2Y5TB 4PJBF 1GZQB 2Y5EA 5FM8A 1O9VA 2BHFA 4NN5C 5KVEH 4DOHE 1TF4A 3HMXL 4MCZB 4PI2A 2EVHA 2DRUA 4WDIA 4YEFA 1C5BH 3BKMH 5J13C 1KTJA 1B4JH 1RFDL 4YFEA 1CTNA 1R6VA 4HIEB 5T3XD 5FV2A 1AI1L 3SDCC 3VFSB 3W2DL 4PRPD 4AQAB 1DLHB 3R7QA 2VR7A 1JXGA 4AV4A 1NDGA 2XIIA 3JTTB 4JY6B 4PG2C 4JRXB 4OAWB 5JPNA 1BVKA 4OFVA 1YEKH 3BSZL 3O3EA 1R5VB 5KYNA 2VLKB 2BSRB 3SQBB 2XFGB 4BZYA 5KVFH 4QHLA 4R0LB 5LUMA 3WAJA 4MZRA 3MNDA 1IV8A 5C1MB 1TT6A 1UJ3A 4GW5B 1RJCA 3O41A 4ZOAA 2NSXA 4NSKA 4POZD 1IAOB 1UZGA 4DPBX 5SWSB 1JGDB 2ADJB 3MBXL 4FYSA 4HF5H 3CU1A 2PWDA 2YXFA 2GUOB 3B83A 5D7LD 1BYOA 3K6DA 4DERA 4AMKH 3BH9A 4OFYA 5IMMB 2O6CA 3IF1B 1AE6L 4ETQA 1Q9KA 2RACA 4OZGB 3D9AH 1NCOA 3ILDA 1H8OA 3LKRA 4X4ME 3S96A 3WIHL 1A3LL 5HHME 1LO3H 1QEXA 3H6AA 4L05A 4L1DA 3GKWL 4X5XB 1UH3A 2QKIA 4HUUB 3VQ1C 1CLYL 3QJTB 3SE4C 5A43C 3TN0A 1N8ZB 3T3MF 4JFDB 3JUZA 4F1SA 4ODTH 1YMMB 1W0VA 3HHRB 3SCMD 3TVMD 2HH0H 1NFDA 1YQVL 4MGXA 4PLJC 3FTVA 4B53A 3U7AA 4QO1A 5DFAA 1UEMA 2C9VA 3GB7A 4P5SA 3WUWA 5DHVH 5T3XH 2VMCA 1DSWA 2NX5A 3D2UB 3OV6A 1Z0NA 2CHDA 2HTLC 3MUHL 3LXUX 5EFIB 1SF3A 4OQTL 5DD0L 1BFVH 4OM1L 3TFBA 4PJDA 3SBWA 3S88L 3GBLA 3LXBA 2E6QA 3NZ8A 2OSXA 3PU7A 5F0MB 3ESMA 2EXTA 3ARVA 1I4FA 1MUJA 2MHAB 1BG1A 1OAKH 5D6CB 3FQXA 4R3SB 4HQQL 1ETZA 3QWOA 5BO0D 1RZ7H 1YEEH 3ARGD 1OTUD 5HJBA 1WC7B 3RVTC 4OI8A 3MRNA 3QA3A 3O2DL 3TYGL 5DQ9B 1WRFA 5IZ7A 4TMPA 1OF0A 2VDML 5EN3A 1HH6B 4XAKD 2Y2WA 5HDBB 4CN6A 3TBVA 3TYFA 1ET5A 4KZEH 4JQVA 1TYJA 1LO4L 2V7NA 1XGTA 5I66B 3OAYK 4PG9A 2F1EA 3DK2A 2H2PC 3AUWB 5EBLB 5AKVA 5E2TL 3VXSB 4H8PA 1I1CA 1SM3L 2H26A 3NDZE 5HYEA 3SZKC 3MV8A 2VGLM 3H56A 3WD5H 3S37X 1EV2E 3US1A 4M5SA 5HBBA 4OCNC 4W9CC 4JX0A 1NGWB 2NYYC 4JDVA 4UQAA 4Y16A 2R0LL 3H0TB 4UTBA 1T2QL 4YGVB 2NNCA 4PJEF 3DPBA 2EUZA 1RZJC 5GHWH 3CSPA 3O2VH 3EKCA 3T1WA 3MLYH 3DIFA 4I87A 3L3JA 2EIZB 1BEXA 4OVVA 1AXTH 1NM9A 3ARFC 1AIFB 2J8UB 1FVCB 4FHJA 1JV2A 1GVIA 4IGBB 1XMEB 3HZYA 4V1DB 3MLTB 43C9B 4JG1L 4RETB 4UQEA 3FO2B 2ITDB 3KG5A 5D7JB 3TJHC 1RP9A 3GI9H 2VMDA 3V7MA 1E0OB 5HPMA 2CHXA 3P0YH 3TA4D 1I1RA 1QSEB 3KS0H 5BVJB 2VABB 3EIFA 3QFDA 4PJXB 5D8JL 3T3PE 5MP6L 1BOGA 3L1EA 2TSBA 5BRZD 1JRHH 3QQXA 1NL0L 2YRPA 4K7PX 4Z3GA 4YMPA 5AOLA 2WLHA 2HSIA 3RYMA 5HY9A 4XTRC 3A4FA 1KZYA 2X6VA 3FHEA 4Q7DA 2HJLA 2G4EA 1E4HA 2BSSB 2B4CC 5T5FL 4ZFOA 4JPKH 4MASA 5F88A 5FYJD 1NFDE 4AV0A 2NY4C 4PJCA 5EIIB 1JHLH 3ARDA 3ORJA 3EOAA 1SHWA 3VI4B 1HFUA 3Q5TA 3RZCD 4PMFA 3QZWB 1O0VA 1DANU 4ZFOL 5I0ZA 2ROYA 3VYNA 4E9SA 2GKIA 2NX5E 5HYIA 3EDEA 1YG9A 3N1PC 4F27A 2Q20A 1BVOA 2CXGA 2DH2A 1RMFL 4PJDE 4YWGH 4CSZA 2IQ9L 2QQLL 2YS4A 4PLKD 5F6IC 3MN8A 4BZ1A 4DVBB 2VDRB 4H2AA 2OJ1A 2WBJA 2XWDA 4I1NB 1IQWL 3KWWB 4JFXB 2CKBB 3L4CA 3B2UD 3X13B 4G5ZL 5CUSH 4DO4A 5C0CD 2IPUG 2WUBH 3BWUF 3ZE1E 1NC4D 2ICEB 3U1PA 2G60H 3KYAA 4Y9BA 4KTGA 1U6AH 5GPRA 4J3XA 4N85A 1LWRA 1NMAH 1SXNA 3B4NA 3PDOA 1UQSA 4RFEB 2C1OA 3SPJA 4OZHE 1CR9L 5T1DL 4X6FA 2RAMA 3AC0A 3WSQL 1PZDA 4HPYH 2P47B 4HXAL 4WTWA 4TUUA 4ELMF 4MA8H 3MV8E 4PM1A 4UIKH 5LBSA 5A6MA 2YD2A 5HPOA 5ANMB 1G7IA 2ZX8A 4K73A 2H6OA 3V6BR 3ZIYA 2WQWA 1QQDB 2GYSA 5DUBA 3IFOA 4L0ZA 2WOYA 3BN9D 4ZI8A 1A2YB 1XIWD 2OI9C 4L4JA 1BQLH 5SWZD 3MV7A 3QJVB 3WFCH 3GLDA 3B43A 3P9WB 4E9QA 1NLDH 5AOJA 5SWQB 1ZS8B 4JFOB 4YO0B 5INDA 3WE6B 2K8MA 1T22A 1JN6A 4F8OA 1E5CA 2Q3AA 1PSKH 3QXAA 5I6NA 1PDKA 3S0PA 1IIIA 4EZLA 5KOVC 1CDIA 5ID0A 1U8PA 2JXMA 2CGYA 3S4SG 3A5VA 2GK0B 2EDFA 5E6RB 3E8UH 1OP9A 1EFQA 3CBJB 4JO8A 4AYID 1BXUA 2NNAB 2OJEB 3IMTA 2AW2A 2PPCA 1MHEA 5EZLB 1IO4C 1EHAA 1V8HA 3SDCD 1TITA 3ECBB 1BVZA 1ZXQA 3OAWA 5CD3A 1RZIB 5DYOB 3GO1L 1XGRB 2DQ6A 3H42L 4AEIH 5IM7B 4UYQA 3WE1A 4D9QE 4HS6A 4ALAL 1UG9A 5I1KH 1MCQA 2DQGL 3SKMB 2CUMA 3DV6B 2DWXA 4IRJB 3SE6A 2CNZA 2JJSA 4S0SD 5DFTA 5EO1A 4ACPA 3L3GB 1QOKA 1MVUA 4AIZA 1A6WH 5IHLB 4K71B 2YAQA 4PJCE 1KYUA 4QHMA 1TJHH 4J4PA 2CGZA 4WHCA 2DICA 2OPCA 2IANA 3UBFA 1F3JB 4MVBC 3F05A 3DX7A 4EKJA 1VRSA 4FFZH 3OLIA 1E5BA 4PS4L 3REWA 5DLMH 1HQRB 4BHUA 2BPBA 1OE2A 5HVGB 5I75B 1I7UB 1SRDA 3M07A 4XX5A 5EN2A 3BKCL 1ZGLB 3QXUA 1CYXA 1MLCB 1ZJBA 3W39B 5CFAA 5I73C 4RFOL 3LH2L 4LMQE 2OL3A 3TBYB 2JB6A 4GKNB 4W9IC 4P48A 3V8OA 1H9VA 3FDWA 1TVHA 4O2FA 2VQ1A 3GSVB 1NFIB 2WOBA 2EIDA 4BV1A 3HOGA 5ITBH 4P2QB 4ES8A 4P23C 5IW1B 3RGVB 3OLEA 2V5MA 1Y18B 3PHSA 2OL3L 3GSOA 3C8HA 4P2OB 5DJ2A 2YQGA 1Y1UA 3MLXH 4UNIA 3BE1L 4XBGA 5GRUH 4S10A 1HHJB 4Z95L 3G6JB 2C4FU 2HRGA 1YEIL 1UWEL 1ZHKB 5ITFB 3DXAD 5DGQA 4ZUUA 3V4UH 2OMWA 4JZJB 4OLVH 4U3CA 4N8VA 2ICWA 3F58L 3IMRA 2X10A 4JL1A 4WEUD 5EC1B 3ZL2A 3D0LA 4DW2L 1CFQB 1RK1B 3UEZA 4YDKH 1Q94B 4JMNA 4APXA 4FABL 3LS5H 5IUSA 2OTUA 1L6PA 4B6ZA 1ZLVK 1JUFA 2E4TA 3ARPA 3MV7E 1HZKA 3T1FB 2C9SA 2QLVB 2FDBP 1O6TA 4G8FA 2ZKHH 3RVTD 1MIEH 4GT7A 1KMGA 4KO9A 1WBYB 1FZMA 3PWNB 3KPRB 4HLJA 4XBMA 2ATAA 1MJ7L 3V2AR 2HFEA 5E6IA 4CDHA 4JREB 1SJHA 1U8OA 4K23H 5BCAA 4WWPA 1ZS2A 4AJ0A 3IT8D 1MQKL 5DI8A 4OV5B 3MA7B 1IC1A 4HFUL 2H47C 5HVFB 3WXVL 5AFAA 5E8DH 3MBWA 3VG9C 1RK7A 5F6HI 4EZKA 3KPQB 2PO6C 2BDNH 4NNPL 1FGVL 2EIBA 3SZ6A 2QT6A 4Q9QL 3ILEA 5FYKL 3P2DA 1H15B 2CLVB 4OGAD 5DO8A 4UM9A 2DDQL 5D6DC 5DO2D 5KJ4A 3SPVA 5F7LB 4L8DB 3WJMA 3VM7A 1KJMA 2QZQA 4L48A 4RRPG 4AYFA 2BY3A 4LLAA 3QR2A 2H32H 1F02I 3R19A 4EDXB 4Q9CA 2IANE 4PY7A 1TQWA 1TIUA 2ESVA 3O2WH 5F9WB 4Y5YC 2B20A 2SEBA 3TJHD 1B0GA 3GSQA 5LCVA 3FW6A 4JB9H 4XMTA 4XRCA 4KTDH 5H37G 3HIZA 4URTB 4Z0BL 1KFAL 3EW3B 1AGFA 5D2LA 4HIQA 3UDWA 1JPEA 1JZ8A 3IDIA 4LAQH 2P80D 1BVNT 1ZIAA 3TH2T 3VW3H 3FTGA 4RVBA 1VFUA 4G7QB 2ZUSA 3DPDA 4R7XA 5LCVL 4YBLB 2D7OA 2FT6A 4P3WA 4RMQA 4XTRD 4QD2E 3V5DB 3VE0A 1NLBH 2EEDA 3QFJD 4EI6A 1IJNA 2ZP8A 1RZPA 4PJFB 1J7VR 4AEHL 2OKMA 3QUXA 1E7VA 1WUZA 3L4WA 2EDBA 2H41A 2J88L 3C8KB 4CNIB 3TVMB 3SE3A 2ZNWA 1KB5H 3V52L 4AENA 4IBYA 2G5BB 1F42A 1QRKA 3G6DH 2APVA 3EG9A 4KROC 5DC4B 4JO1H 3IJSB 4KZDL 3GQFA 1KCVH 3IMVA 3Q3GB 3U9UB 3NACH 1N6QH 1J9CT 2E7DA 2F61A 1E43A 2V2XA 1OKEA 3P3UA 4K94L 1MCOL 4MAUH 4O02B 4WNSA 3W11C 3W0WE 2JH2A 4UZUA 2UZPA 2BINA 3QNZB 3FB6A 5FA3A 5E99H 5AYUL 3VXOA 2YXWA 5JHDD 1I7RB 1CI5A 4NZRL 3RGHA 3BP5A 3D69A 3HI6H 3TEWA 4KQ0A 3ZUCA 4FC3E 4ZXBA 2Z8RA 1J86A 3O0RH 4UQIM 4TV3A 2UXVA 4YDZA 3QCUL 1AFVH 1A6VL 3UACA 4DFIA 1AQMA 3UAAA 1F86A 5FUCC 3FAWA 4NNYA 1WCBB 4ABWA 1MRDH 4IIQA 4BSVA 4AV5A 5DD6B 2K0RA 1AHWC 5CAYB 4JJ5B 3SKNA 4ZFFB 2IFFL 3QIWC 4YE4L 1MQ8A 2ZXCA 4HWBL 4GUQA 3K80A 3DTDA 3E6HB 3RTQC 2WXGA 4O5LH 5JLZB 1EDHA 5EU4A 3OX8A 5EUOA 5C3TA 4MBOA 1WDAA 3ESPA 2M8XA 4U2ZA 2JVUA 4LKXB 5IJKC 5CN3A 3THMH 5DD5L 4PLNC 5KSAB 1ESOA 4WJKB 1HHIB 3DETC 2ZWLT 5BOPA 3FO0L 4PYGA 4WFFE 3QDMD 1CFNA 1E30A 2F18A 4AQ8A 1O7DE 4Y19B 1IU1A 4R26L 4IHOA 1RI8A 4KJPC 4MQXC 4QTHB 4NLHA 5LQBL 3SPGA 2XHNA 3RVUC 2FR4B 2Q1EA 1MFDL 4QRPB 5D7SH 1BMGA 2F6AA 3BAEH 1EERB 3AAZB 5EIVA 4R0LC 2QPUA 2AV1A 4Y9CA 1H6EA 4WHTB 4F15C 3OPUA 3E0GA 2M83A 2VERN 3J7HA 2HLFD 1A64A 4G8EB 4X98B 2ED9A 4Z9KB 1OCWL 1OM3L 4R5XA 4FAAB 1TZGH 1HHKB 3O4OC 3ULAB 2ZJSL 1CICA 3Q5YA 3DVNB 3JBG7 4PN6A 3D3VE 2BLFA 1FZOA 4Y5XC 1Y07A 1UM4H 1YEHH 2CHNA 3FQWB 1FO0A 4AE0A 3GSNH 1RPKA 2ESVE 1R24A 1MY7A 3BEVB 4ATTA 1QRND 3QUKB 3HS0A 2V3EA 3V0VA 5KW9H 2YUXA 2DQTH 5I16B 1I9IH 1J10A 4QF1B 1N64H 3BKYH 3EYFB 5K33A 1QKZL 2Q8BH 3INUL 2IH3B 3ECQA 5HHOB 1S7XA 4GIAA 3D7PA 2YQ2A 1KJ2H 5CS7A 2EDNA 1NAMB 3KLLA 4Y2DB 4AH2B 3ZLQC 1CGWA 4FGMA 4YDLB 1F97A 5GGRA 4UB0H 1QATA 4GSUA 1AGEA 2G30A 3ETBJ 2QV4A 1JZDC 2YLHA 1SLWA 4G9FD 3O8XB 3UJTH 1VESA 1X7QB 5FGRA 3SQRA 1TYRA 3DRTB 3EXLA 2WAQA 2OMUB 2DWTA 4WCYH 3FT4A 1KGYE 2DB8A 3HJ0A 4HKBA 2WW8A 3SOTA 4PBVC 2AF2A 5DZOA 3TZVB 1XL6A 2ZCLH 3D39B 5IHUH 3RWJA 4BELD 2Y36L 3G5YB 1UOWA 1BQKA 2YARA 2YEQA 4XPBL 3SODB 5T1KA 4NRXA 1S2EA 2DYPD 5DS8B 3A6OA 5GRXG 3AACA 4W9GC 3ILQC 5E9DD 3HVNA 3K6FA 2V9TA 2ZP0T 3ARYA 1DQML 1NZRA 1E6OL 3ZQXA 1RIVH 3B56A 4NO3A 1FNEA 3NIDE 5DVPA 1M57B 5I8CB 2IV9A 3CZUB 4TLKA 3QK0A 2AZAA 3FCSA 3RNKB 5EUOE 4RMTA 1IC7H 2VE6A 2EABA 4DP0X 6FABL 2MOGA 2VLLA 4MDIA 5IQLA 2Q6WB 4XCEB 2E76C 1MNNA 3Q6FA 1PY9A 4NUMA 4XO8A 4BSWA 5A2IH 1R5WB 1UKQA 4EZMA 5I28A 3S8GB 3PP3K 3B3IA 5E6UB 1TG8A 3DVGB 5GZOC 5K59F 4H26A 4ZTOH 1F8TL 1KIUB 2AQPA 3QCVL 2YMTA 5CZRA 3ULSB 3QEHA 1A1NA 4L3EA 1T4KA 1EVUA 1CDYA 2HVBA 2VAAB 2N01B 4K2UH 1N70A 2DTSA 1ECZA 4W9KC 5K9KB 5ENWA 2R4RL 5DJ6B 1WFMA 2PR4L 3RWGB 2F7PA 3BDXA 4JG0L 4RGOH 5C0AD 4MNQD 4GW4B 1X3DA 4HH8A 3EGXB 2WBWB 1N2RA 5E56A 4RMBA 2R1XA 3NN8A 4KO7A 1DR9A 1XMWA 4A39A 4IDLA 4M9OA 2YEZB 1XF2A 4Z7OF 1LGVA 3IU4H 4U6HB 4WK2B 1B88A 4GMTL 2HWZL 1BD2D 2KI6A 3QUZA 3HNVL 2DQUH 2B1HL 4XP4L 2LTQC 4FMKA 3TA3C 5C7XH 3NJIA 3PWJA 3G5VA 4NAQA 4G9DA 1J8HA 3N9GL 4J3OF 5L2JA 4PJ9C 3EH2A 3LNEA 1NCDL 4M29A 3TONA 4M5YL 3QW9A 5CXPA 5FR3A 3R18A 1P2CA 4JM2F 3WIFB 1SVCP 2C9RA 5E51A 3MU3A 2WK2A 2XBDA 2VDOH 4YXKL 4S1RL 1G43A 4OLWL 2B8OT 2W38A 4P3CH 1JDCA 3E3QE 3T2PA 1G9ML 2CCLA 4HCFA 1FIGH 3NP3A 3FQ4A 1R3JB 3LKOB 4KX9A 4BA0A 3BPLC 1RUAH 2VXQL 3GEFA 1DVQA 4UT6H 3ZGIA 3ATFA 3R7RA 2QFRA 1ZLWK 4A55A 2J56A 3B9KA 4L4VA 3TNMA 4F57H 2H1PL 4CBZA 3T3MB 4IRSD 5LO7A 1C1EH 5AUMB 2IPTL 2FO1A 1RY7B 3P4MA 4FZ8L 2PYED 5JZ7C 1A1MB 4PGEB 4TNGA 4B7IA 2KYIA 4Y1AE 3U46A 1EO5A 4GAGH 1JG9A 3UXFA 1SY6H 2Q8AH 3MA9H 1KEGL 3QRGL 4JFTA 4YL9A 3U36A 3U7YH 1E4XH 3LKNB 4YDNA 3B7YA 3C87A 3V9CA 3D07A 1EFXA 5B38B 4W70A 2UZIL 1I31A 3CXDH 4OGXL 3S36H 1VZGA 4NYLA 4UTCA 3QG6A 1JGVH 2OBGA 4KROD 4BBWA 3ULVL 1KGUA 4R97B 4TRPH 4K55A 3F01A 1U8CB 1SDAB 3VA6A 1NSNL 3RI5K 1I7TB 1J1PL 5DRWA 3IRZA 5J89A 3VNZA 1BAFH 3MJWA 3GFUA 4YHYC 3OC8A 2VITA 4KAQL 1S7QA 1H3UA 1N59A 1PKQB 5FW7A 4L3EE 4DQOH 2Y7MA 2PWHA 3PFQA 2CH8A 3I02B 1EA9C 3HLKA 5EG6C 1BV8A 1RIHL 4IK6A 4OCXL 3KBPA 3N85H 4NUJB 1HZHH 2DQJL 2VDPH 2VRKA 3L9RB 3MNVB 4ORGB 2Y7OA 3D12B 4J8RA 5DRZB 1WA1X 4U6XA 4UF7C 3QIWD 2WTOA 4QT5B 5DDHA 1KV7A 1CT8B 3IAQA 4F2MB 1W6LA 2QPFA 4FQLH 2R59A 3ZMEA 4HPOL 4PCSA 1FZKB 1CTOA 4CDGC 4YNYB 5CJXC 3US9A 2GJRA 4K5LA 3MROA 4CKQA 1ACXA 1HAWA 4OZFH 1B4LA 3IFLH 3EAKA 4I0PC 5TH2A 4D9RD 1J8HE 2YD7A 2ARJQ 1WAAF 1OAQH 3QDJD 1T3FA 1OGAA 1MH5B 1ONQA 1WYJA 4H8UA 4E0RA 1H3WM 3G5ZA 4WENB 3ZDWA 1JK8A 2EC9U 1I3GH 1SBBA 3RX5A 2PPDA 1QYGH 3GXTA 4UU9A 5L8KB 1XCXA 5FA4B 5IR1B 3K8KA 3LPGA 3F2LA 2J71A 4JZOB 4KNTA 5BUAA 3OZKA 3EH1A 2ZG2A 2NSMA 5BQDA 3IKKA 1UEYA 3T04D 3JT0A 1AGCA 3CFNA 3CPUA 3LIZA 3F04A 5DEGA 3MODH 5IUCA 1P7KA 5I19L 4CRPA 2R0WL 3TF4A 4I88A 3QB7C 3SKUD 1G1CA 1NEZB 4W4OC 1HIML 1Q4NX 5I5IA 5ACLA 2HJKB 1XGZA 4Z8FL 4H0LC 1EAPB 4GO8A 1PLBA 4JFSA 4K5PA 3O4LD 5IWLC 4HOWA 2CLZA 1EEYB 4PJIF 3IJHA 1AR1D 3Q2CA 2FB4L 5ABZA 2N1TE 2R7EA 1G7JA 1PS3A 3GK8L 4NX0A 1J5IA 2FGZA 1IM3B 3CVIH 4MRCA 3HFML 4JO5A 1U3NA 5F8QC 4FL4C 1U8JB 1L5GB 1EJOL 2WXNA 1KY7A 5D70L 1YDPA 3V0IA 3LOWA 3PGFH 5HYJD 4WK4B 3V4PB 2AHIA 2VLRD 1VGKB 4FFYH 2XWJB 2CO6B 2B7DT 1T1YA 3LS4H 3CDGA 1N12A 2EDDA 3F65A 4QLRA 1JF5A 4XCCL 2CZNA 4L8BB 3IGUA 3S5YA 4D8PB 2UVFA 2HT4D 4H1LB 1T1XB 3IDMB 2RFXB 2VOTA 5IQMA 4XXDA 3MX0B 2G2RA 3KYOB 5ETUA 3S4SA 5HJ3A 5GRWA 1DJWA 4EI5B 3FO9B 3F83A 3M86A 4P57B 3UG3A 3ILQD 1C08B 2EYRA 1G1YA 2H0PA 3NUKA 4QTFA 2VDLL 3FU3A 3PWUA 4JDTH 3U4BH 5KYUA 4L8SC 3OQRA 1JIBA 3R0NA 5GGSB 3OHXB 4AKQA 4M5ZH 4M6MH 4N28A 1HU8A 3DNKA 5AB1A 3UAEA 1I3RB 3OBAA 2MPAL 4W6XB 5TQ0H 3MJ9L 2Z3FA 2D31A 4XB8A 4AVIA 2X87A 5E7FA 1KCUH 4OFQA 3BN3B 4I48A 2Q87A 3RX9A 5FO8A 4NCDA 1CBJA 2OW6A 3P0VH 5GZOD 1OGAE 4WV1C 3WKYA 1I1AC 5KVEL 2FIRT 2NQDA 3C6SB 1UD8A 3QC5X 4G6JH 4LLWB 4YR6B 3L1FA 5D71L 4EQ2A 3K1DA 3CVHL 2H6PA 4RX4A 4FXKC 1VKXB 3QHTC 3JTSA 2J12B 5G2NA 4IBTA 1ACYL 4EUPB 2NUTB 5C0JA 1IC0A 1NC2A 3J27A 3BD3A 2VKWA 2Q76B 4LSQH 5H2BA 4L18A 1YEKL 3HRZC 1TQVA 1NGQH 3F7VB 1RUKH 3HFFA 5IVOA 4G1EB 4Q6IB 2V17H 3D0VA 3D1MC 4JHVA 3FU6A 3GSXB 2VZSA 3G08A 1OK8A 1K5WA 3WY4A 2XTJC 4H88L 4N4YB 2FTAA 1QFWM 4JM2D 1SF5A 3KLAB 2AITA 1FVEA 3MKGA 4G80B 4QGTA 4E36A 3OKNB 2C34A 2XZQL 3H9SA 4PJ9D 3ZHDA 2Y1AA 2DAVA 3WCYA 4K5NA 2V7HA 2X4RA 3LZFL 5IKCB 3T0EA 1Q0YH 3KDMB 1HDMB 3C5ZA 3KNBB 4MMXA 1MPAL 4PTUA 2F58L 1EZUA 2N59A 3BW9A 5KYYA 3RL2B 4U0RC 1Y6MR 1U8KA 3T8MA 5F97E 1OEZW 2OMZB 3PWLA 1YN7A 3K71B 3S8FB 4F8TA 2X4NB 1S7SB 3D06A 5TDPA 1YN6B 5DJYB 1CI3M 3AXLB 3QGVA 4ODTL 5DHVA 5FCUH 4ZO9A 3AREB 1FGNL 3MRFB 5AAMA 3LH8A 1EMTH 1KIPB 2NNXA 4JFUA 1LO5A 3KPOB 3O45A 2GG1A 3IN0A 3KW7A 5J11B 1J5OH 4DEPC 4Y4FA 1VAHA 5IFHH 1IAIM 3P02A 4IS6B 4JFQB 1RU9L 1RHHB 4N0CC 1JD7A 4DP7X 5JZ7D 1BGXL 5EC2A 2VUYA 3C60B 3FUIA 3KBEA 4MRBA 1MFAL 3QZLA 4F2EA 1P6AB 2AJVH 1D9KC 4FLHA 5I1IH 1WWCA 5INCA 2D73A 4YE0A 4MA1B 3LEVL 4MCYA 1BM3H 3VFVA 4JFHD 4JHWH 1JZ7A 4L23A 3O3DB 1QHQA 1OAXH 3BIAX 1FLRH 4WU5B 3VRJA 2EXSA 3HUJF 1C5DA 4LGPB 4IMLA 2EEFA 5C0BB 5L8LB 2DQIH 4RRPM 2IFGA 2R1YA 3UCRA 1FH5H 4YQXL 4XOBA 1TTFA 4GLRI 3OKLB 4AUYA 3A4AA 3EUDA 5H4ZA 3FUEA 3ZKMC 5KVEE 1OWRM 3PF2A 4WEEA 2EDXA 2GABA 2JJTC 2BOCA 3V5KA 2FLBT 2JNZA 1EO7A 1MAMH 1JOIA 2A6IB 3BPOC 2ADFH 3GM0A 1RURH 4P3DB 2NZ1A 5CM1A 1T1ZA 1FE8H 5JQ6H 1G9NL 3AWFA 4MD5A 2D7MA 5I1GH 5EU6A 2Z8SA 4WGVB 2Z8VC 3RWEB 4FQQB 2GTZA 2X4SA 3ZYOA 1QPPA 3EBIA 3WD5L 3MRRA 4UQ2B 1UT1A 1NIDA 2YD3A 4I77H 5KVMC 1BIHA 2A38A 2ZSVA 3I9IA 1WT5C 3QAZB 3BQUB 5IBLD 4RISL 5KVFE 3VTMA 2EIJB 1DDHB 1TETH 4KJYA 1TO4A 2JTDA 1UHVA 2VH5H 4XN1A 1LO2H 1MZYA 1FH2A 3QQ3B 1OAYH 4ZD3H 1GC1L 2VDRH 4ZMTA 5CD5C 1CBVH 1KLUA 3MLYL 4CMMB 5C0DB 3L6FB 3VGBA 1AXTL 3MRMA 4P9HL 3DV4A 2MNWA 4GRLA 1O7SA 1AACA 2BY0A 4PJ5A 1M2OA 1VCAA 4GS7B 4LCUB 2VYRE 4NQVA 5JUEH 2A4CA 2YAFA 2X41A 1T20A 5AD0A 4ZSOB 3H9SE 3ARGA 4KZCA 3LRMA 4PRHD 3P0YL 4YDLC 3HE7B 1CWVA 1M42A 3S35H 3T0EE 4UV7H 1FFTB 2PWGA 3ZE2E 4C4BA 3IDXH 1NCTA 1EJ8A 2EH8H 4OZFG 4QKXB 1M1XB 4ZUVB 3UADA 2Q3XA 4WQOA 1Q1JH 2X89D 4FULA 2P5WB 3TCLA 3FQNA 1SXSA 4LPVA 5HDQH 3U7WH 1DFXA 1OHQA 1NUGA 3UYOD 3E2HB 2ZPKH 3PGDA 3ZN6A 2XX0A 5GGQH 2F0CA 5DHYA 1UVQB 3P69A 3UZVA 2I9TB 5JA8B 2QVFB 2NT0A 2ZYIA 3RJDA 2DMGA 4IOIA 4XR8C 3ZRSA 4Z77A 1GOHA 3IXAB 3V6FB 1JHLL 1QABA 1NBYA 3PIQA 4GRWE 1A7NH 1LHZA 4IRSB 4F58H 1HILB 1BMZA 3P11H 1AXSA 1P6WA 1CXLA 3LKSB 4FKHA 2WAHA 2VL5A 4PY8I 1DVUA 4KFMA 5DVKA 3CH1A 4AGLA 1KENH 5E5MA 5AVUB 4F7TA 3U9PL 4HT1L 1HH9A 2K9UA 4DEUA 2W0FA 1MWAB 1DQTA 3TPUB 1AQHA 4DSYA 3VXQB 2W07A 5F7BA 2XT1B 5CUSL 3BUQA 4KRPB 1MEXH 2FO4A 4LSVL 2IAMA 3VFGL 4BZ2H 1H3PH 1BF8A 4Z5RA 3SHSA 2FEDC 1ULVA 1P4IH 2VUOA 1UWYA 1WFJA 4MNGA 1LNUB 1RUPH 2AXFA 4ZW3A 2X4UB 1IB5A 3VFRA 1U6AL 2VM9A 4NO5A 3GC3A 1HK6A 4DIXA 4JFFD 3FBQA 3WHE1 2WMPB 4UI2A 3ESVF 1FQ9C 3QO1B 1PZUB 4A2MA 3DO7A 5EU6E 4I18B 5ANHA 1QR1A 4OZIA 4UIKL 4ZOBA 4LNRB 2ZIDA 1QR4A 3PAUA 5EO0B 2Y7LA 3KPPB 5E8OB 3U30B 4UOQA 2XSKA 1FV1B 4CVZB 3WTVA 5KBLA 5BUGA 1YNTB 5ICYA 1UXWA 3UYRL 3HAEH 5IIEB 1CXKA 4AWJC 5C09B 5I0XA 1KNOB 1QNIA 5E08H 1UB5A 3SY6A 2MCMA 5FKAB 4X0KA 1BQLL 4LE8A 4WEMB 4S0HA 4MSWA 1EVTC 1JTPA 1NLDL 1D5IH 5CCJA 5E00A 4MCMA 1E9QB 1N18A 3GD1C 4L9DA 2F7QA 1UZ6F 5H94A 3DJRA 3AT8A 4PJ5E 1J1OH 3ZTNL 3QWRA 4R4FH 5LNGA 3UCQA 4F5CA 3CVBA 5C0CA 4N1EA 4NHCL 4XP1H 32C2B 1I1AD 1JTOA 3CZFA 4NN7C 4AYMC 4ZO7A 4J2XA 1DJHA 4OCRH 1AP2B 3NP4A 5E2WH 5KN5B 1T03L 1XBRA 1BQ5A 3QR0A 2JIXA 1V3KA 2Z92A 2UWEB 1CVRA 2FBJH 2YGQA 4L1HA 1U8NA 1M6OB 2J1XA 3DJSA 1OP5H 5D1XA 3FQTB 1VFBA 2WO3B 2WXFA 5D7KE 4HUMB 5LN8A 3OQ3B 4XGZA 2FX7L 3NT0A 5I9QC 5JPMB 1XF5A 2AJZA 2O5YL 4BKSC 4YHMH 1F90H 4FFZA 1KTLA 3QP3A 4LBEB 4K3HA 3VFWA 5KYXA 2ZCKH 4AGNA 2XTJD 4Z3EA 3UTPE 1FRGL 1TJHL 2VQUA 4QYOB 2I27N 1H5BC 4LCCA 1UM6H 1IBHA 3LZNA 5SWZA 1OCRB 2JKTM 4ZUSB 3SE9L 2XA8H 2F08A 1T04A 4W93A 1OARL 3NRPA 3NH7L 5DLML 1X5XA 1CG9B 3UTSB 5CSGA 1AR1B 1MCKA 1E40A 3RVVC 1KT2B 3WN5C 5DJ0A 2VRAA 3K4ZA 5I74B 5D7IA 3KXFB 4WI2A 4N0UA 1Z5YD 25C8L 2AQ3A 1JHTA 3QRBA 4YDVB 1UYWL 4I2XB 2AEQH 3PWPB 3B2DC 4BKTC 3JV5A 2LU4A 1GGBL 1L9NA 2WIIA 5CZVH 1KCRL 2NQCA 3BP6A 3L5JA 4J27A 4N8CH 4MNGE 4NKOB 4QY8B 1FN4A 2MKWA 1Q0EA 3MLXL 2JV6A 2VM3A 3D87B 4PV8A 2YD6A 2L3BA 1TKWA 1YAZA 1DE4A 4GKZA 1SZNA 2WCGA 3I6KA 4WEBH 4CVUA 1FNGA 2B15A 4N0CD 2CAKA 3V4UL 4PQXA 4JRFA 2XU9A 4W9ZA 3K74B 5G4NA 3EJTA 4OZIE 4DESA 5BVPH 4G7RB 3KWUA 3UBXG 1D9KD 2CJTA 4G59C 1ZA3B 5DC0A 5JHBA 4MXVE 5GS3A 4DP8X 1FNSH 3NPSB 3T4YA 4YDKL 4C8XA 1J0JA 5DJCA 2ZE0A 3DSNB 5KG9B 1D5ZA 1EHNA 1NBCA 3MOQA 3HG1A 2CR0A 2YD1A 3P3SA 4G43A 3HG0A 2J7LA 1O9ZA 1WWBX 2YAOA 3FB7A 1MJ8H 1EIBA 3EBAA 3P4NB 1BFOA 3CZLA 1L7TL 5DVOA 1CE6A 3D05A 1IL1A 4WNJA 3MLSL 1IM9A 3WENA 5DCCA 2A6JB 3JT2A 3CCHB 1ZY9A 2IWGA 4BHUI 2NXZC 1ADQL 3PG2A 3ZYZA 4NQCB 4F5CE 5C0FB 4NNXB 4WKZA 3FUFA 4K8RC 5F1OB 2WBKA 4PJHF 2EIKB 1HWGB 3VX1A 1I8MA 1HWHB 3JWDC 4W1TA 3H1ZA 4MJ2A 3QDGD 2BCMA 1FL5B 5I17A 3OLGA 1JGEB 4O02H 4Z7OB 5IJVB 2Z31C 5D1XE 4I9WE 3WTXA 4ZPTA 4DAGH 4ELKA 5MHSE 2C7UA 4X8GA 1KSRA 2FATH 4YOKA 1F4WH 1L9TA 3MUY1 4M03A 4YLCA 2H32A 4U1MB 1OK0A 3OKOA 2AI0H 2XJLA 5H35A 2ZX6A 3LH9A 3W82A 5I1LA 5CD5D 4GFXA 3BYYA 1OCCB 4HK3J 4BDVA 4JM2B 4P5TB 3QJFB 5T3ZH 3U0WH 2EDKA 1PZSA 3BLKA 2FH6A 4HJSA 2B2XH 5SWZE 1W16A 2ICWI 4YSTA 5LXGL 3O2WL 5FIEA 2CO2A 2BCKB 4X5WB 4L4TB 1YY9C 4U7SA 5LG1A 5JORA 4R4BB 4X6BA 5IROC 2V8LA 2DMBA 2IDCA 4OUUB 3RWDB 2DQCL 2FL5B 4LAQL 4MJ6A 2ZG1A 3LZRA 4WTZA 5D7IE 1D5BA 1DZBA 1LDSA 2NY3B 4LDEB 2FX9H 3LQAC 5FHBH 5DYFA 3X14B 4N0UE 1KB5A 4NWTL 4XNQB 4X99B 2HG5B 1AQ8A 3M7OA 1GPOL 2APFA 2LQRA 4KDWA 3AS2A 4R83A 4A6YL 3N04A 5LGJA 2IADA 3PNWA 2R56H 1F6AA 4E9XA 4XMUA 1JVKA 5B3NA 1X5ZA 1KB5L 2O6PA 1S9YA 3N43F 1CXEA 4LU5H 3JVGA 3QHFH 1TJGH 5BV7L 5F96L 5HGGS 3BVNA 4MX7B 4TUKH 3C08H 4XE5B 2GAZA 3P9MA 5DD3L 4V33A 3S5ZA 1OANA 3WEAA 4U1SA 3VCLA 3STLB 3TWCL 4PWHA 1DBAH 2HFTA 2WIMA 3ARFA 2UY6B 3KPMB 1SN0A 4NQDD 5E99L 1QBLH 4N1HB 3VA2C 3OHXC 1CU4L 4KY2A 4HPHA 2DLHA 5HGHB 5I8KH 1J1XH 3PE9A 4ZS6C 5CP7B 1AFVL 3C6LB 1OQOA 1RSFA 3FH5A 3HG1E 4Q9BA 4M1GH 4LCIH 3REVB 1IMHC 4XXWC 5F3BA 3MHZA 1D6EA 1DSFH 3PQYB 2FEDD 4M6OH 1OWWA 5I30H 2DY2A 2XVLA 4K3EH 4NP4H 5GS0C 1KXHA 1NAMH 4MJIA 2N3JA 5JTWA 4IJTA 4OD2A 5E8PA 4YIQA 4O5LL 4Z7VA 1MDAA 5J3HC 4X4YB 3BO8A 5D5MF 3VGGA 2V2TA 4XPTH 3CFDB 3QFJA 1T5KA 2MQCA 4OKDA 2FWOB 1KYOK 2R2BA 3L4YA 2YWYA 4XT1C 4Y4KB 1MW3A 3L4UA 35C8H 3PABA 3SDXB 1JK9A 5TE4H 4P4KC 4PR5B 1S7WB 4WNQA 1IGML 4NC1E 4G7YL 2BWQA 5F7MC 3L16A 5J5EA 1PNDA 5J8OA 1EUTA 2I32A 2P45B 3GSNA 2XXMB 2F5BL 3IJEA 1NPNA 4N68A 1U21A 4HUWA 1U3HC 2AQNA 4XAWL 3KH3A 2KDGA 1MCDA 1TEYA 2X2HA 1MFBH 2J2ZA 1AOHA 1D5MA 3V9FA 3HAEG 2MOQA 1TQBB 1PEZA 2F54E 4NFDA 5A16B 3ML8A 4N8UA 3BLBA 3GSNL 1TQCB 1ZSDA 3KL3A 4XPHH 5DMKB 4J3WA 4QAWA 2VDQL 2R29L 4PRNB 1QSVA 4PV9A 4ZW6A 1KJ2A 1VA9A 2BWIA 5KW9L 1S8DA 3FPXA 2AABL 1ZT1A 2CXKA 1XGPA 3X11A 4EF3A 3VMNA 1VFAB 4IEFA 2Q8BL 4QCIA 4OJCA 4YBHA 1DQJB 3D25A 2C3GA 3EO1B 2FJGA 2HKHL 3BUYA 4N0FA 3VG0H 2KBGA 2Z4TA 1AOZA 1EDQA 1HL9A 3EYQD 4R6UA 2LAAA 2ZOTA 4KNSA 4P5MA 3T0VA 7FABL 5I1AB 2M2DA 5E9AA 5TGBA 3I3BA 1N0XL 1DEEB 15C8H 3UTTA 3C60C 3E80A 4U3HA 3SD5A 4EDWL 1P6FA 3U4EA 4PU2A 4QXTB 1UKTA 3EXJA 1M1SA 5A40E 4D0DA 3BH8A 3S3JA 3LPOA 4YXLL 3SJVD 4F7CB 2Y7QB 2GCYB 3MREB 3B37A 1LEIA 3MAWA 4PWEA 5IHUL 3A21A 2AFNA 2NY7L 3DWTA 3GSUB 3KYNA 4PRDA 2J1KA 3WIIH 1MRCH 4KUZH 2CHWA 2H3KA 3K2UH 4GUOA 3ULUF 4N90D 2CSPA 1E28A 5HHXL 2JMRA 3P9LB 3B1UA 4GIOA 1F2XK 4EN3C 3NJVA 2Z7ZA 5A2FA 1FDLL 1RIVL 4MJIE 4HLZH 4Z7VE 5GGTL 4ODHL 5EMYA 1IC7L 2CALA 1TZAA 4JFFB 3G6AA 4XNMA 3ZKSD 1KUMA 1JS4A 4OKVA 3BPNC 2NW2B 3FB8B 1S5IL 5HTSA 5IG7A 4GBXD 4P2AA 4XVSL 3HBQA 3TO4A 1WTLA 1FNLA 1NCJA 4AJWA 1Z5HA 3DMMC 4PUBH 3JYBA 5FYLD 3QORB 3MO1B 2HPTA 2QQNL 3GJEA 5D9SA 3S3SA 3T2OA 2A83B 3OXSB 4MZ2A 4N22A 3ABKB 3MC0A 5GSVA 2XPGA 2ZTBA 2GJ6A 3L45A 1ZLUH 4WY7L 4LLQA 4GB9A 1TVBB 2CK0H 4RGMB 4GP5B 2BSTA 2A9ML 4JGJA 3QJHB 5J6HB 1DVYA 2JCWA 2VXTL 1PZ5A 4EEEA 2NXZD 1KYFA 5E9DA 3FQRB 1HC1A 4U1GB 2F5AH 4QEGA 4K8RD 4YN3A 4JAMB 3CPLA 3AUVA 4DO5A 1EO8L 4P23A 2DQUL 3OLDA 1IC5H 1HL8A 4MJ5A 1JJUA 4JGUA 5D2NA 4HIIA 1A4JA 4JG9A 1HL4A 4KHXL 4H8QA 3SYOA 1CO1A 3R8BB 4BYHA 5JW4N 1JWSB 1EXHA 3CMOH 3QC6X 4W4NA 3MNWB 1ZHBB 5AAWC 3KWVA 3O6FB 3QHZL 2Z31D 4LQFH 5DSCB 4FQXB 5KZCB 1KDIA 3WXWH 2DWEB 1UB6A 2E4FA 4LEEA 3NFPA 4LHJB 2NY5L 4DCQA 4UT6A 2R69L 3MOAH 3H9HB 4G3YH 1MY5A 4X6CF 3HC3L 3RUGA 3BDYL 2OQJA 1R3LA 3HKZA 4FQJH 3QIUC 1X4XA 1AMXA 1DN0B 2BP0B 3SYPA 3UTTE 3KPLA 2V5YA 1FIGL 2EYTB 3VH8G 3U79A 2A1WL 1A8ZA 1CDGA 4QRSB 4CADB 5JHMA 5CBEA 4XH2B 3N0AA 3S2CA 3WKPA 3IDJA 5MEPB 3BUBA 1JD9A 1IGCL 5CIPH 1KG0A 2EO7A 2QDVA 1SY6A 5DJAB 3WEMA 2CDGB 3PWVB 4X8JA 5IROD 1TOXA 3KPNA 1X5FA 2R2HA 3HHMA 1NTDA 3CIAA 4HD9A 1BZ9B 2X4OB 5D4QA 1HCVA 4UILH 1WBZB 1OLZA 2X4QA 2BNRA 1FFOA 3QJQB 4G6KL 4X9GA 3BVUA 6CGTA 5BZDA 2G3NA 4KQ4L 2ZQKA 4U6YB 5MEQA 2K7QA 4JFED 1U92A 4Y5VA 4LSTL 2IBZX 3ELQA 1X5GA 2XXFA 3GLZA 4FYTA 4HZLB 5DUML 3GRWH 1QWNA 3W9EB 3ZSSA 4X5RA 3EFDL 3VFOB 4K8RH 3S36L 2PO6A 5AW9B 3SDAC 4GRMA 2ZXWB 3UG5A 2P5ED 3ZDYE 3JWDH 4G8GB 1JGVL 4LARL 1FPTL 3EJUA 2DBLH 2ZKYA 5F9JA 3VWKC 2CD0A 1TTBA 4MBRA 4E41D 1AG0A 2RBLA 1BQRA 3QJZA 1QSFD 2DV6A 3OJDB 2ZXBA 1J87A 2XG4B 5D6DA 3HUJB 1L3WA 4F8PA 3SQOL 3WNLA 2F53A 1KGXA 1TTRA 3HG4A 5JA9A 3OD3A 2BSBA 3X3FH 2QPEB 4ZBJA 4WKXA 1JL8A 1IGYB 4Y88A 3QUYC 4ZS6D 4DQOL 5L2KB 5EPMA 5ABDE 2GC7C 4Y5YA 4TUJB 3WFHB 5F8RC 1VB9A 3OKDA 5AYQA 2GJ6E 2RD0A 4OQ1A 3N85L 4QXGH 1ANUA 3HC0B 2P49B 1QBMH 1THAA 1ZT4B 3DARA 2A0LC 4U6VH 1KCKA 2EIMB 1IAKA 4FE9A 5GS0D 1TJIL 1HEZB 4OZFA 1I85C 4V11A 4Y2OA 3ROOA 3Q9PA 2IQAB 5J3HD 2OP4H 4NGHL 4TQEH 1H6FA 5F72S 4RGNB 2HX7A 5DMIH 3O3BA 1K3IA 3TT1L 3P0GB 5GRJL 4D9LH 4HGWB 3MGTA 1JNHA 4CW1B 1IT9L 5IMKB 5D2NE 1MFMA 3QDGB 4YL4A 1SYVA 5KAQG 3NJXA 4NQEB 1DVFC 5DK2A 4KHTH 2FIKA 2FEEI 4X6EB 5JPMC 1UD6A 2BNQA 4BQBA 4P4KD 1M05A 2LE9A 2XFXA 4H1LH 3TBBA 1I3GL 1G87A 4HIHA 4FCHA 3H53A 4M7KH 1MI5D 1LD9B 5IB3B 1VADB 2V37A 3RUGE 2F74A 2QGEA 5LBGA 3LV3B 2X0WA 4YXHH 1AJ7H 1AGDB 1U3HD 4XXCA 4LGRB 5DJXB 3B7UX 4K9JA 1CF8L 5EOCJ 2LOEA 3VXRD 3BT2L 5E6YA 4EQ3A 4WI5A 4NDMB 1VFOA 3S34H 2LAGB 2OULB 2QHRH 3IFPA 2Y5TA 3FUDA 1GA2A 4XC1H 5I74C 1AHWA 1GZQA 4BFKA 3SGEI 3ZHNA 1UXMA 4GUCA 3RTQA 3BWAB 4DGYH 2BRRL 4QTIH 4WAFA 2BFVL 3DRQB 3IXTB 4CVXA 5LAXB 3FT1A 2I07B 2BNRE 4G71B 3DYOA 2J44A 4LHQB 4N1CA 5FYJU 3VFSA 3WGVB 4JE4B 2YPLE 4LOEA 3HC4H 3OTTA 5CKAA 3QEQD 4JY6A 3JTTA 4JRXA 1M4KA 4HCIA 1YHPA 4OAWA 4FFYA 1ID2A 1CTMA 3ZMNA 3TO2B 1R5VA 3OGCB 5LGYA 3APNA 2VZ1A 3HLAB 4HJEA 1WFIA 2VLKA 1J5CA 2BSRA 2QPDB 4KY1L 4MXWH 1AO7D 1ZK9A 2YLKA 4X4ZA 2DWDB 3PGFL 1VZIA 4FFTA 1V5JA 2VDNB 3FUHA 5DHXB 2QKIC 2QV2A 4OIBA 4R0LA 4FFYL 3SPCA 2HN7B 3VNYA 3TN0C 3LS4L 2BSED 2DI9A 2IGLA 1OALA 2K1MA 4GW5A 5TE7H 1PPIA 5FEBA 1X5MA 3BFWA 3L81A 1OAUL 1IAOA 2F53E 4HIJB 5L4IA 5SWSA 2ADJA 2KMWA 1DQKA 2GUOA 4Y5XA 3KCPB 1BX2B 1UZ8B 3WLBB 3KPSD 4Z3FA 5IMMA 3IF1A 1M2VB 1MSPA 1FFPB 5E5RB 4HCRL 4GG8B 3HHSA 5TTRA 2ZUTA 3A67H 1KWKA 2X7LB 4HUUA 4QOKB 1NFDF 5ICUA 3T2NL 4WFGD 1IKOP 3L3DA 1N8ZA 1GHFH 3MLVH 4JFDA 4G70B 4LLYB 3U4BL 1QVOA 4EN3D 4NHUB 2XWXA 2AJUL 3SBWC 4M5ZL 4B0MB 1MFEH 3X12B 4PGBB 3NQIA 1ERNA 3NSYA 2E56A 2BWDA 2IALA 3VJ6B 3BFQG 5FOBB 1CXFA 5J1AB 3ZRFC 2AK4B 2BK8A 1KGWA 3RKDC 2H0EA 3RDTB 5E9NA 1N7ML 3JV6A 3S2AA 2HUEA 1PKOA 5T1LD <