4L0YA

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4l0yA00
5G4NA 3IGLA 4QO1B 4L18A 4A63A 1T4WA 2IOIA 3Q05A 3VD2A 5AOIA 5ABAA 4AGMA 5G4MA 1IO4C 2ATAA 3US1A 1EAQA 2H1LM 3Q06A 3Q01A 4XR8C 4AGQA 1H9DA 4AGOA 4IBQA 3EXLA 4MZRA 5BUAA 3WU1A 3TS8A 3QYNA 3VD1A 5AB9A 5G4OA 3D05A 3WTTA 1LJMA 3WTVA 1EANA 2VUKA 2XWCA 3QYMA 3D07A 5A7BA 4AGLA 1HJBC 3D09A 4L0ZA 2GEQA 5AOMA 2RMNA 4L0YA 2FEJA 4IBTA 1GZHC 2ADYA 3WTSA 3KZ8A 2BIQA 2WGXA 3WTWA 2X0UA 5KBDA 3US0A 3D08A 2MEJB 2X0WA 2YBGA 2PCXA 3WTXA 4LO9A 1UOLA 1CMOA 4HJEA 5AOJA 4IJTA 1CO1A 4AGNA 4GUQA 3KMDA 1TUPA 2J1ZA 1HJCA 2J20A 3D0AA 4IBUA 4LOFA 4G82A 4IBYA 2J6WA 1EAOA 1HU8A 3VD0A 4LOEA 2BIOA 3D06A 1KZYA 5LAPA 5ECGA 2IOOA 2BIPA 4G83A 1E50A 4GUOA 2AHIA 3WTYA 2BINA 4KVPA 2AC0A 4IBZA 5AOLA 5LGYA 2OCJA 2BIMA 1GZHA 3EXJA 3IGKA 2J1YA 2J1XA 2IOMA 5AOKA 2XWRA 4IBWA 2P52A 4IBVA 3WTUA 2X0VA 1YCSA 1TSRA 2J1WA 4AGPA 4IBSA 2J21A 3ZMEA 4MZIA
chains in the Genus database with same CATH superfamily
5A1AA 3CUPB 1Q94B 3ECVA 3SDDB 1JPSH 2WWMC 4XP5H 5ALBL 3RIKA 3ZKND 5HYFA 4WHCA 2Z6FA 2ZICA 4U05A 2BDNH 4Y19E 3UXFA 4OIAA 3QNXA 3K80A 4L3EA 2Z7UA 1MFDH 2IADB 1BFTA 4KRNA 3HMXA 3CDZA 5DHEA 2E76C 1JZ6A 1FDLH 5D1ZC 3ARVA 3U0PA 1BBDL 3UTZA 3MCLL 1HI6B 2YA0A 3J2PA 3O4LD 5D8JH 3PE9A 1ET7A 4NPJA 1BQLL 3IXAB 3OHXA 5M7QA 1FCCA 3MRLA 1D5MA 3ILEA 1BLNB 4APQC 2XA3A 5DHYB 1SDDA 4JFFD 2Z65C 1J5DA 2CO3A 2BW5A 1JV5B 1X7SA 3LEVH 4DGYH 1P9MC 4UTBA 1MJJB 4FXTA 4A2DA 1CD0A 1LK3L 3V6FA 1RMFH 4NRYB 4A2GA 4Y4HB 3WD5H 1M2VA 3KCPB 4P9ML 4B50A 2CPCA 3BAEL 5HGGS 5HYSB 1ASOA 3OL2A 4FQPA 2EP6A 2EXYC 2H6OA 1J86A 2NTFA 1JGLL 3L9RB 4JZNB 5HPOA 5IWLA 2DMKA 1MFAH 1J8RA 3N41B 4L5FH 2VLMD 1R19A 2VMJA 3A6CH 4RAHA 4YN3A 1OP3H 1BVLA 5KVFL 3ULUE 4FYRA 3S88L 4XBMA 1CXFA 3IPBA 2ICWI 4RFOL 1A8ZA 1D6EB 1OANA 1OT1A 2ZAGA 4GNKB 2PP8A 3LN5A 5GGSB 1C8QA 1HXYB 1EHKB 1JOIA 1OAKH 4JDTL 4Q9BA 2GPZA 5IHLB 1M71B 4MQTB 1M7DB 3HB3D 4XWGL 1U8LB 4NRXA 2CBMA 2PWFA 3C9NB 2IIJA 3OJDA 4TUKL 4BKLA 4F7MA 4U1MB 4R4FH 4PTUB 1QBLH 4FEIA 2IQ9H 3M1CA 4JPVL 4UILL 3WXWL 4AJ0A 5IM7A 3K6OA 1U91B 4JHBA 4BUHA 1IV8A 1Q9OB 3KPOB 4MDRA 2BIIA 1INEL 5JZ7C 1XGQA 4CVXB 3B2UC 1FL5A 3RAJH 3I85A 1FVEB 5D7LD 3GMQA 2FJFB 3DHJA 3BPLC 2N0MA 3VXTA 3L5JA 5HJDA 4FFZA 3PIQB 2X4SA 5I73C 4NB7A 1F00I 1N5AB 2BHYA 2R69H 2FJHB 1VPOL 5D70L 2J72A 2EH7L 4HWBA 4FI7A 1WAAE 2XIDA 1NC4D 3MLSH 4N6QA 4NQCB 5EU7C 5G5DB 3RGVA 4DPBX 4OZGA 4AIOA 1MWAL 1U92B 4IBSA 2X4NB 2CXKA 1B4LA 4F1SA 3FZUD 5C07D 4FNPA 1W0VB 4ZX3A 4PWGA 3U2SA 5IG7B 3T4AC 5HHXL 1WYJA 1YY9C 5IUSA 4LDEB 1A6AB 1K8DA 3O8XB 5ENWA 4RISH 4A2HA 3ROLB 5JPMA 3CSBA 1I9IL 3RP1A 4FI6A 5DZOA 3PQYD 1JGIA 1MIML 5IJVB 1UQSB 3NJNA 3B2MA 2PWEA 5T3XD 2AITA 3DMMB 1ZSDB 4MFHA 4YHOH 1BM3H 2MQGA 2Q20A 1EXHA 3VFUB 4LRNL 4W4NA 1GAFL 4JAMB 5KVEH 3ZHDA 2DBLH 3L1OL 4LSDA 2A74C 3VNYA 1I8IB 4NZUL 3U48A 3EFFB 3ZYOA 1DVXA 2Q86B 2VAAB 2LLGA 1AKPA 1INQB 3SDAC 5FHAL 3FT3B 3D12B 2PR4L 4FXKB 4KHXL 4MBOA 3V52H 5CJQL 5I1AA 3LSOA 2Y7SA 5AG9A 1AC6A 1F90L 3VQ2C 1AS8A 4Z7NB 4M1CC 2BPBA 3BP7B 3G7TA 5KSVA 3QUML 4DEUA 2XN0A 1DBKH 3NIFE 5ERWA 2AQQA 2EDHA 3DKHA 4PS4H 4X4YB 3T0WA 2JJWA 3NGBC 4ANWA 4TTDD 5ACZB 2ZOKB 4PJDF 5IHUL 2CUHA 3LKPA 5FYLD 4YFLI 3ARGB 3GINA 4QHUB 2QMJA 5F3BB 4OZGE 3B7TA 1FL3A 1DBMH 4BZ2L 2AEPH 4X83A 3KMDA 3MO1A 1IM3A 1FCGA 2Y0SA 3IDNB 5CJXA 1CD1B 3GMLB 1QI3A 3ULVD 1GW0A 5MP6H 3ME0A 4XCCH 5IMKB 1TVBB 4OZ4A 3W5NA 1SFHA 3O0RL 3SPGA 3ZUCA 1H6TA 1ZT1B 4EN2A 3B2DC 1T2JA 1AFVL 3W1ZA 5EWIL 1KN2L 2CUAA 3MRPB 4WI5A 2C4FT 3MI6A 3NIDF 4RMQA 4JKPL 2CRZA 3RB7A 3RJQB 3SOBL 5HYJB 2AJUL 4FCAA 1XCXA 4XBEH 2A9DA 2VW6A 4MNGB 2ENQA 1C1EH 5D2LF 3S5LB 2QADB 3ETTA 2PO6C 3MUHL 4HC1A 4HZ1A 5FO9A 1FV1B 1OE3A 1WWBX 5DD1L 2AGJL 4YS4A 4DCQB 3MJ8A 4BFGA 2DY2A 2PCPB 2R1XA 1HIML 1E4HA 2VISA 3FQRB 1KPRA 3PL6D 3RIAF 1VFUA 1IAIH 2VSMB 5DUPL 3DOIA 3V55A 3W11D 4P05A 1LO4H 1AKJD 5L2JB 1FFOA 2EILB 1XF3A 2HT2C 2ROYA 2FTAA 1E3ZA 3SDYH 2IALB 4PRBB 4HIHA 3VB9A 1URZA 2YXWA 5EO9A 1CDCA 3O11A 1PJ9A 1L0YA 2G2NA 2JELH 4E5XG 3UG4A 4JGUA 3ARDB 3EBIA 1A4CA 1CFSB 3GK8L 3Q06A 4IDJH 5TGBA 2F7PA 3DTXB 3QXVA 2MCAA 2EVIA 2CIIB 1YJDL 1N6QH 4U3SA 4YAQA 2AQ1A 4HCRA 2B7DT 2CMRH 4A38A 2FYYA 3VFVB 4BH7A 4Y1AA 4QRRA 1WZ1H 4PVBA 1PNCA 4U1NB 2P5EA 3KYKL 4L1DA 4YH6A 1R5VB 4KTDH 5GSVB 2FJUB 2DWDA 2R29H 3V9EA 4B0MB 1OPOA 5F7AA 1VZHA 4PJAE 1PZ2A 2VDRB 4NM8H 3VFGH 1XH0A 2I9TA 3OZ9L 2ZKMX 3DOSB 3R4DA 2H5UA 5I66A 4KZDL 3EYQD 5IV2B 1D3CA 2QT6A 3MV9B 5ICZA 4XVSL 5GS2H 1ZJBA 1UKTA 2J71A 3FOLA 5E70A 1TJXA 2KL6A 4HLZG 2VLRA 2EDBA 2JVUA 4MNHB 2OFQA 1CDJA 1ZLUK 5IMLB 4JFQA 1RP9A 1ZS8B 4LAJH 5D1XE 3Q6FA 1BG9A 1CGWA 5B7EA 4M93B 2C4XA 1TU2A 5DUJA 3QRGL 5IB5B 4Z3IA 1NLDL 2X6AA 2KQMA 1GYCA 4IIQB 1SJEA 2WLYA 5ID1A 1W72B 2DQUH 5HDBF 3U4KA 5GS1B 3U6RB 4AQEA 1MOEA 4PGBB 2R27A 1YEIL 3QEHB 4R90H 1NCBL 1W15A 2VL4A 3CVHL 5G55A 2G75A 4V1DE 4WTWA 4UM8A 3K71A 2B20A 1AQ8A 2I5YL 4U31A 3DV4A 3BGFC 4BEIA 4NO2A 3MLTB 4I7ZC 1S9KC 3RU8L 1DLHA 4GKZB 1GIGH 1OTUC 2KT6A 4YJZL 2R0WH 2O5NA 3N1GC 1P5VA 3C12A 3P3SA 1AGCB 3LIZH 4KJPC 1OB1B 3CLWA 4XOCA 4Y16B 4OZFH 3D3VD 3Q7JA 3EFOB 5CN2A 1X5XA 3TNNA 4BE5A 4YDLC 4NQXA 2DPKA 4DN4H 5M94B 5CN3A 4XCFL 1L5GA 4Y1AE 3T0EB 4F2MB 2P5EE 2ADJB 1OSPL 4LKCA 3HPJA 2VWEE 5CWSA 3FAXA 5ANME 1N59B 5I2IB 2X70A 3EXJA 2DW5A 4D0BA 4PJCA 1UZ6E 5EBMB 1TFHA 5AAWA 3QUZA 1M7IB 1MPAL 1BYPA 2D73A 3BE1L 3TVMB 3ZQ9A 4EI6B 5I1IH 2Y7OA 3I6GA 2XN2A 4KDWA 3UYRH 5ETUB 4M6NL 1JPTL 4QI3A 1A6ZA 4TPRH 1J10A 4OFVA 2AQNA 4XN5A 2IXQA 3INUL 3MHZA 4LPXA 4MDJA 1ZVSB 3SN6N 4AW4A 3T1WA 2FLMA 2AJSH 1UCTA 6FABH 1HHIB 3FBKA 4HKBA 3VGHA 3VXQB 1RULL 3FNKA 1JVOA 3KPPA 3GTTA 4LP5A 1BQHB 5FUOH 1KLGA 3RVVD 3V4VL 1MRDH 2XKUA 5LVEA 2WXQA 1P7HL 4IHOA 3DRQB 4JFOB 5IVZA 1NDGA 1JF6A 1XGRB 4JFYB 4FL4B 4XP6H 1OTTD 3Q5TA 3ZQXA 4WF7A 1YSOA 4ACPA 4PJ9D 1BIIA 3NAAL 3EJCA 3QORC 1N68A 1QLFA 3B8YA 3NCCB 2BVOA 2R4SH 3ULUH 5HHQB 4JY5L 2EXWD 3L1EA 4TNFA 4X4XA 3VRLE 2OSLB 4NZJA 2F0CA 3KLHD 4Q9QH 3PNWB 1O5PA 2HJLA 4NOFA 4W9FC 1BYNA 4M7LT 1OHQA 4N2GA 4K71B 4JFZL 4RRPM 2WXGA 1GS7A 2UWEF 1BVZA 4IIZA 3E8UL 1MH5A 3PV7A 2GJZB 4XXCC 2DWEA 3IN2A 4WHTA 1C9SA 4GQ9H 2YAEA 1PG7X 3IMRA 1E2VA 1M9SA 5CS7A 3B56A 4HS3A 3WG7B 3IFLH 4K7FA 4EI5C 3B34A 5FAAA 5BS0D 3R7RA 1T21B 3HMXH 2V7NA 4OVVA 2MNUA 4GRMA 1KWGA 2QR0B 4OLUL 4YXKL 5D7IE 4D0CA 4K94H 5F7DA 1MFMA 5DJDB 4CC4A 1CGSH 3TBCA 2R0LL 1T7WA 3ZTEA 3EGXA 5DLMH 3HZVB 5CEXA 3UC0L 3VFRA 2QL1A 1TQSA 2JKRM 4JCLA 2VRAA 1OPGH 3HVNA 4PTTB 4XP1L 4G6ML 1OO2A 4ZODA 3VXSD 4BK4A 5KN5B 4OZHE 4UTBH 3ZKSD 1BMWA 1VJSA 2GQHA 2C1OA 3MNVA 4JN2A 4MB4A 3G3LA 1K3IA 4FTVB 2YXMA 5FM5M 4NLHA 3MXVH 4QTIH 4LLUA 5LXGH 4HT1L 4I3RH 1YNKL 3F7VB 2O5ZH 5IFHH 2BSTB 4Y9BA 4RGND 1TZHA 1UZ8A 2VNCA 3AVEA 2VMCA 3QIUB 1RJLA 3GZOA 3SDXE 1XMEB 3HE7C 5EU6B 5LGJB 4E2OA 3WDJA 3ZKMD 5A6MA 4NNXA 5B3NA 4MXQC 2JE8A 2F6AA 3FB6A 1OLLA 5CINL 3UJJH 2PWHA 4O2CB 3HNVL 5B1JC 1EZSA 1OGAA 2UXVA 4OV6F 2BP5M 4IS6A 1U3ZA 4MCYA 5TH2B 2EECA 3FU8A 4O02L 3PP4H 4YDKL 1NEZB 3C60C 3LAFA 4QHLB 3ZT5A 2OMYB 1KB3A 2MOQA 4GO8A 4JRYE 5T5NF 3RWIA 1I1YA 5IMMB 1B0GA 1U8PB 3I9GL 2Q7NA 3B1TA 4N22A 3ARBB 5DFVC 25C8H 4OCWL 5FKPA 5IQLA 3K4ZA 5GS0H 3SDCA 4JFED 5SWZB 3MRHA 2ADIB 1JFQL 3O3AA 5JDSA 3SO3B 1ES0B 1WCBB 4FFZH 1YNTA 1WFUA 4AZ8B 2N0KA 2WLKA 4LSTL 2E7MA 1CFTA 2W0PA 5F9DC 5M95B 1GZHC 2OMTA 3ZO9A 2MQCA 2VDOL 4N90E 4L4TE 1ESOA 4HWBH 3KPMA 4P23D 4XNMB 5I19L 4OM1H 5H4YA 5DD0L 3BKCH 3GLEA 5F6HI 1VGKA 4Z7WB 1WV7T 4RSVA 1ZKAA 4K9EH 4FHBD 3VI3B 2AEOA 2Y36L 3P4NA 1HQ4A 1CJYA 1T1WA 1UFUA 4X7SL 4AENA 2A7BA 4OGQC 4YIQB 1MLBA 3TIDA 3V0EA 2NOYA 1XZ0A 3K4AA 3I9PA 1GYUA 2VZVA 4GFXA 3HPLA 2E9JA 2DBJA 3S96A 2EEDA 3DPDA 2YQGA 3FU9A 2VXSL 3MGOA 1RIHL 4RMSA 4X4KA 1FZMA 1DJYA 4JRXE 4C4KO 4G82A 1J88A 3EO1A 2HVBA 1P4IL 2IC2A 3VA2C 4BQ9A 1JZIA 1IKNA 5CKAA 5DVKA 5F1KC 5BNXD 4N9GB 4OJFH 3WO4C 1QNZH 2VSKB 2E6PA 1T6BX 5JW4M 1QFPA 2XG5B 5CU9A 5F9AC 1BBJA 4X9GA 2LAGB 3UBHA 4Y4KA 4NP4H 5E8NB 5GGVL 3QNYB 4LMQE 5INDB 2DRUA 2WVTA 2WB7A 4F7CB 2O5YH 3FF7A 4J3SA 1AHKA 4KTGA 4OM0H 2CGRH 3EZJB 2JCCA 5C1MB 4EJ1C 2B4CH 4FDWA 2FO4A 2UVFA 5KAQF 4Z7UB 2H2SC 2IOMA 4MYWB 3B3IA 3ALXA 3MRNA 5T1JA 5ICXB 2FUTA 1HT6A 2YAOA 1MHHA 1V05A 1JNJA 2DQJL 1I9JH 2ZNXA 3BH9B 4LSUH 2X7LA 5TDPA 1TO5A 3QJFB 1MNUL 1LEKA 2XTLA 5AL0A 1PZUB 4WFGD 4MD5A 1K6QH 5B38A 3K0WA 2YUZA 3O4LB 4GEJA 1IIKA 4G7QB 5HGDA 1RUKL 2DM2A 2UUDH 4GKSA 4PLOB 2HUHA 1WBXB 2GCYB 1EAQA 2J8HA 4JFFB 1ZA6B 1U8OA 3EH3B 1ZGLA 4PV1C 3WSQH 3IKCA 5L7XH 3MNDA 3MKKA 4AJWA 2XTJE 3QHFH 5CAYB 1BFOB 2XN9A 2GAZB 4RETB 2ZWYA 5LDSA 4OB5L 3HOGA 1AVAA 3B8SA 3UJIH 4XB7A 1J7VR 4TQ8A 5DD3H 5F44A 4L8CB 4GIAA 2ZJSH 3POHA 1E9OB 3MV11 2K6ZA 1RIVH 1ITCA 3FUKA 3TV3H 4HC1H 2XG4A 5C0AD 1BJMA 4Y9EA 3G5YA 2C3GA 4IKJA 4YZWA 1NKGA 1JHKL 3FTGB 4M8QA 2EE6A 4RDQG 3PNRB 1E8ZA 3B5HA 2EDRA 1CUOA 2DKUA 2H0EA 2CKNA 2VABA 3HB3B 4MXVF 1XGYH 2P8LA 2K4AA 4G7VH 5I6XC 2ATKB 3HEIB 4TNEA 2E59A 4J2QA 1I53A 1WIPA 5DUBB 3UTQA 4HJ1A 2B9AA 4JJ5A 1ECYA 5CZVH 5C97A 3E1ZA 2CE6A 5A2KH 3MA9H 1HSBA 1OW0C 4P3DB 1OIOA 5AWNL 4JLRB 4WWID 4HJEA 5I16B 2EINB 4ZTEA 2DQIL 4AGNA 1TEYA 4QOKA 5EOCJ 3GI8H 4JJOA 1NAKL 3VI4A 4FNLL 2YD9A 3S37L 3B9KD 4WUUD 1A14L 5D7LB 2BP0B 4G1EB 1QFWH 3NFSL 3THMH 1T0NA 4HWZB 5IMOB 3NJXA 3FB5B 4GG6A 1QO3B 3MX0B 3NABL 1Z5HA 4K3DH 4HCRH 1J5OH 4LEEA 4F57H 1PQZA 1MW3A 4OV5A 1NBZB 2VZUA 5GZNA 5EBWB 1ODAA 3B9DA 4HWNA 1PFCA 1JRHL 4N2EA 3TH3T 5CIPA 1FA4A 3D39D 5LN8A 1P1VA 1WD8A 1Q9LB 4ODSL 1MZYA 2XN9E 5A2LH 2KPWA 3G5VB 2VDKL 3WXVH 3BUQA 5E0FA 5AZ2L 1SOQA 2P47B 4JHVA 1MCOH 5C07B 4F8TA 2VH5L 1UASA 5DU7A 1E6OL 1SYVA 1KT2B 2JKNA 3A4FA 4NUQA 4WI7A 5K1NA 3AQXA 1CFVL 2WB1A 4NKIL 4PJ7B 2XUWA 4JM2D 1F8TH 3FU5A 2ZD0A 1H8LA 4KKLD 2DLHA 3LCYA 4HMDA 4IRSD 5BMFH 4AV4A 4FQCH 4D8PA 3GM8A 3U7WL 2GI7A 1D5IH 5SWQB 2FECI 4I77L 3BVNA 4JHWL 3G5ZB 3LRSA 5HJGA 2Z93B 4MDIA 3VD2A 2XT1B 3UTTD 3VD4A 3L3IB 5IOPB 4QRSB 5JHDD 5FM8A 1Z7JA 1U8MA 3BGMB 1MJ7L 4FQXD 3OKOB 5DRXA 1NCJA 5GPRA 4YL4A 5BQDA 3AT9A 3GSOB 2H47C 4DP1X 1KGJA 4KKQA 5C09A 3ZQWA 4M9PA 4LLQB 4BSJA 4YHYC 1B0RA 4XTRC 3NJGA 1CFBA 2OXHA 1WICA 3A4EA 4OUUB 4PRNA 3WHE1 4Z8FL 2P5WD 3DVNA 2B77A 5C8JA 1EHLH 2O1AA 4HUXB 2Y5EA 1DQLL 3DTUB 3FT2A 1L9OA 4YSEA 4P3CL 2KI6A 3GBEA 4I1RA 3OKMB 3KJ6H 1AQKH 4KZ0A 3RHWK 4X8JB 4F8PA 2V7HA 3F64A 3QRBA 3F00A 3CH1B 3FBQA 2E7CA 3EG9B 4JO3H 4ZPTB 5DHVB 4IOFC 4J4PA 1GZQB 5AW0B 4UZSA 1MVYA 1F4WH 4ICXA 3H3BC 2EDTA 1E6JL 4OIIH 1RPQA 1YMMA 2BVQA 2X6CA 1Q1PA 4A2MA 2R1WA 3GM0A 2EKJA 3IF1A 3EJZD 1ZVHA 4PRID 3T0BA 5IIEA 4S11A 3B5GA 1MRFH 4UAOC 4M7KH 2A4ZA 2EH8L 1F3JA 5B8CB 2X9XA 5HPMB 4PREB 4XBGB 4KRPD 1U93A 5C0GA 3HS0A 4FABL 2DLIA 3PWPE 5I0WA 1T6VN 2DQGL 3NZ8B 4OD1L 4ZW7A 2YWYA 3QWQB 1DN0A 1WGVA 1IQWL 4YSPA 1X6LA 3FUEA 2NY5L 4U1JA 1L9PA 1LGVA 3CSYB 1PF3A 2E47A 2ICWB 3FAWA 5C0JA 2CJSA 3KM2A 3PL6B 2PLTA 4X80H 5EOCL 5GGQH 5GGRA 4HISA 4ALAC 1MW1A 1V3KA 2W0FA 1XF4B 4Q89A 5LQBH 3MLVH 4HBQA 2VDML 1AKJB 3V4LA 1NA8A 4HG4J 3TBYA 5I5MA 5I1KH 1NAML 3D52A 3MFFB 2CCVA 3TBSB 4NUGH 2LVEA 2OW7A 4HOMA 2WXHA 3O2WL 1HNYA 2X87A 4P2AA 4TUOB 4FULA 4KTYA 2XSKA 4JHAL 3NFPA 5TPWL 5L8LB 2VM4A 5E1QA 2K8MA 2W07B 1YN6B 2UZPA 3D9AH 5G4NA 3TT3H 4BHUI 3CAFA 1HYRC 3TBBA 1R3JB 3QULA 3CHOA 3CDCA 2FT7A 3PY9A 1UYWH 1YMME 2CG9X 3IU4H 3MV8A 1U2YA 4XC1L 1YQ2A 5KYUB 3HHSA 4NZTL 3KL5A 3GSNL 1XGUB 8CGTA 2AQ2A 3W38A 3D18A 5K9OB 1T0OA 3UAJD 2E7BA 1TETL 1UM6L 1HWWA 3EDDA 3WAJA 4P46C 5EPMB 3L6FB 3STLA 1F13A 5FV2A 5ALCL 2PPCA 1QSEA 3MKGA 3P3YA 5JOFA 1CGTA 5C0NC 3R8QA 2YD4A 1OP5K 2LW3A 1GTNA 2X89A 2QGCA 4H1LG 5D7JA 4B9ZA 2UY7B 4TVPD 1YYML 4AGLA 1SOKA 5C92A 1U42A 3TESA 3WV0A 3O81A 4GG8A 5J3HC 2QPFA 3N91A 4AYFA 3QRLA 3UTSD 2C34A 3T2OA 5CEZD 4NN7B 5EIIB 4XBPB 4JDZA 1P4LA 3DYOA 2Z4QA 3ZBMA 3DMMC 4ZTOH 2XWXA 3K6FA 4UQBA 3CLFL 4WSKA 1EXUA 1B9ZA 3GYRA 5LO7A 2G3ZA 3CSFA 1X7QB 4AEHL 3CDGA 1NMBH 1J9CT 1IGTB 5KBLA 4NYLB 4GW1B 1H15A 2KLTA 4YEFA 4JY4A 3FPXA 2FHFA 1CBVH 2DTMH 3FCTA 3FQWB 2DI9A 4PJ8C 4QNPF 4AITA 3D3VB 4ANVA 5IW1B 5CD3B 1IKFL 3BYTA 3MLRH 4H26A 3NIGF 3EOBB 3GGWB 4L9LA 4PS3A 1I7RB 5IR1A 1E4WH 2UV3A 3KW8A 1NGXB 3IGUA 5K9JH 3CBKB 4WK0B 5HYQA 5JW4Q 5C2UB 4EXPX 3WE6A 4CMMA 1MCRA 5EEVA 4H8WH 1QASA 5DJ0B 5J56B 3DX7B 5D2NA 5FPIA 1IGJA 4TRPL 3CVDA 4B9CA 1A7OL 4JDVB 5FUZL 2KLSA 4AIXA 3FO0H 4XXWA 4N87A 1ILSA 4WDIA 5DJ2B 4I48B 3IDIB 4KH2A 3S7GA 5E2UL 3RBSA 5I1GL 3ARGC 4JFUA 4P4KD 5GRUH 3H9HB 1JHTB 3REVA 4XAWL 1PKQA 3EO9H 4U6YA 4U1SB 4LSSL 4XPFL 3BIKB 4N2NA 2XJLA 2Q1EA 2LABA 1IJ9A 1SOSA 3JZYA 3LHAA 3ECWA 4WQOA 1WIOA 2IMMA 5DJ6A 2WKOA 4PRPD 4IMKA 4ZSOB 4C56D 3ARFA 2W65B 2LU4A 4AW7A 1N8ZA 1A3LH 3MR9A 4F33B 1AXTH 4ZFOB 3VFSB 2WLLA 1WWAX 5FWRA 4DH2A 1HC1A 3ZLQC 5I30H 4NQVA 5HJBA 1DEEA 2Q6WA 1JD7A 5DMKA 5GRWA 4ZK8A 1W0WB 2NQDA 2J5WA 4GLRH 4N0UA 3OSKA 4ZT1A 3VA6A 2CLRA 4DKEH 4ZX4A 2ZZUT 2PETA 4QGYA 3GI9L 2XPYA 1EMTH 4IBQA 5IW3A 3LY6A 3EJSA 1YUHB 1QYGH 4PJ9B 2XWTB 5TD4A 3VFPA 1SLWA 2KLRA 5CEYA 1KELH 3MXWH 4LLDB 2CCWA 2V9QA 1FPTL 2I60L 1GOHA 4MD4A 4YE4L 2CJUH 2KBGA 4NKOA 3CHRA 4GP8B 1AI1H 2H3NA 4HPOH 4G43A 3SQBB 1Q9KA 5L2KA 1A3QA 1SY6L 1D9KC 4N0YH 1WT5A 4YSAA 2HMIC 2G60L 2W1NA 1NGYB 1UVQA 1YQVL 5AENA 4L48A 3RGBA 3WJJC 5E99H 5FHBH 3VXUA 4ZMVA 3PABB 4NKMB 3O3UN 3O2DA 1UKSA 1EEZA 3E38A 3WLWD 1KV7A 2PYEA 1FRGL 3L4YA 4P99A 1PCSA 1FFTB 2DQHL 4K15A 4D9QE 5DWUL 1FGNL 4FAAB 5GRYA 2YKLL 1A6TA 4DO5A 3GMOA 4QPEA 5BS0B 3MBEC 1WZAA 4HEMA 4R2GC 5HHME 4UV7H 1VA9A 2YAMA 3WS3B 1NIAA 2YBGA 3WUZA 4I4WA 1IZJA 3B43A 2WQAA 2ZQKA 5DRNA 4TOYH 4WU5B 1U0QA 4DZBA 2OTUA 3O3EA 3QXAB 3VGEA 1GZPB 4KI5F 1OARL 1BW8A 2G5UA 2VJXA 1EDYA 4YHML 1X5LA 5DJXA 3QG7L 2WVVA 4WO4A 3RTQC 1OP3K 4GRWE 1G9NL 1WTGT 2WSPA 3VXSB 2YD2A 3DX9A 4B5EA 4BFBD 1HHHB 3QUXD 5EN2B 3VXRD 4MS8C 3CPLB 3KW7A 1FYTE 3D06A 4PJXB 1J9TA 3CCHA 3IBEA 3KYMB 4X8GA 5CHNA 2LU3A 3SIKA 2J8UA 2GFBB 5K33A 4MJID 4HS6B 2OK0H 1KBPA 4HXBL 2BIMA 5EZJA 4XPBH 4RSYA 2UVEA 4JG5A 3TZVD 2XQYA 2F53A 2Z0BA 3W9EB 2X4PB 4ONGL 2WQRA 2F18A 3Q3GB 2P80D 5FFLA 2O30A 4RRPG 4NO3B 1L3WA 2K3TA 5T1KA 1D5BB 2EYRB 5TE6H 4LSQL 4AMXA 2PXYD 2PYEE 1Y07A 3OKKB 3RZCC 3WY2A 3MLUL 2Y2WA 5LBVA 2A0LD 3POCA 1CG9B 4LVNC 1IM9D 4HX1A 4BCYA 4C8XA 2EE9A 5F1NB 1ZHLA 4ZTPH 2IJ0C 3SJVD 4XR8C 3MJ9L 5AVTB 5KSAA 4P4RB 4Z3GA 1P7QA 5DR5L 1G9ML 2BFVH 1PZDA 4UOQA 3AB0B 5AB9A 2JH2A 1S9VA 1FZKB 4NFCA 3TEYA 5ISZA 4P23B 3FT0A 3ZZLA 2OL3A 5CIPH 1JTOA 1KN4H 3OD3A 5C0RH 2A1WL 1HILA 3IGAB 2C9PA 3BKMH 4S1QL 3FRPB 2AAAA 1KACB 1UB6A 4R5TA 3TWCL 1C5DB 3LS5H 4ECNA 1UGKA 4Q4EA 3T6VA 1ASQA 3T0EE 2F19H 3PWLA 2WGXA 1ROWA 3D8MA 4NGHL 5LG1A 1RJZB 3P40A 1A1NA 4X7TB 2VR4A 3RI5F 1IGCH 1AS6A 2NY6C 1M6OB 3BD5A 5KBDA 2HVKB 2IFFH 4YBQD 2FX7H 1ZK9A 1I7UA 3G04A 4G6JH 1XDTT 4JVPA 2F53E 4X7EC 3QQ9D 3S36L 1U2CA 1LWJA 1W91A 2IANE 3ZKXC 3NG5A 2N7BA 3FONB 5EU5B 3V5DA 2FSEA 2ITDA 4FQQA 4OLZL 1YDPA 3FO1B 2HB0A 8PAZA 1MVUA 1M53A 1MDTA 3ARUA 2R39A 5EC1B 5C08D 3LKRA 4K8RL 2Y2YA 3A4DA 1GGYA 3S35X 1PKOA 3T5WA 5IFAH 4NX0A 4F7PB 2Y7QA 3MRGA 3EYSH 3FDWA 4TSBH 2EDXA 3QUKB 5CR8A 5E6RB 3C6LC 4PGZA 4AC4A 3T65B 1WEJH 3GRWL 5I8CB 2XVBA 2YAPA 5F7EL 3WFBH 3I3BA 2DEYX 3MV7D 2R7EB 3P0VH 4IU3A 4KVCL 3JV6A 2UZXB 5KSBE 4BZ2A 1U58A 4S2SA 2XA8H 5ISZE 2WLJA 4CDGC 2MCPL 4ZUWB 5JXEC 5IJBC 2BXYA 5E2TL 1JYVA 4CL7A 1FFNA 3AS0A 2AKRA 4OTXH 5EFIA 1BMGA 3UTPE 4ORGB 4HULB 1JF5A 4B60A 2CKBL 1VIWA 3QIBA 4O4YL 5JORB 2CK0L 2A9NL 4UTCA 3RB5A 2WQVA 1B6UA 4M1GL 4BGLA 3FOMA 4ZFGL 3CZSA 1KJMA 2YPLA 5AOIA 1TQCB 2A73B 4PW3A 4YXLH 2ATAA 3OKNB 4JKNA 3US9A 1QWHA 4XMLH 2FLBT 3QIWD 2J1KA 2RD0A 2APWA 1MVFA 4DPCX 4KKPA 5AVXB 1EZUA 3UIYA 2F54E 4KJYB 3N40P 4HSAC 3D0LB 3DBXB 1SLXA 3ESUF 5I82A 5C0AB 3FFCD 4FQIH 4KO5A 3VFWA 2Y1VA 2BSSA 2EXTA 2P48B 2Y5QA 4LEXH 4X4MA 1MG3C 3MRBA 3RL2A 3O3DB 3B83A 1X4XA 3UTOA 2ICCA 5FGSA 4U1LB 4A66A 5IQ7L 4NC1C 4YVNA 4R5VA 3RWDB 2J12B 5I1EL 1E90A 4WV1B 3DRTA 1AD9A 1ZDQA 3VWJA 3P11H 3T6WA 4ODHL 1FORH 4ZO7A 3QDAA 4G8FB 3CC1A 5CJ8A 4B6ZA 3MZTA 4FTVE 4LB8A 3RVUD 4WU7A 1EUTA 1NUNB 3FCUB 1D5XA 4HKZB 3B9KB 4WUUB 2Y4SA 1IC7H 2VDRL 3H54A 3RWEA 5EBLA 3D08A 3TEUA 5EZIH 5HI5D 1OCRB 3VE0B 5D4IA 2DAVA 3L2LA 4CKVX 3IMTA 3PPEA 4O58H 2QLYA 3REWB 3RVTC 2F58L 2FQDA 3MJ7A 3HCVA 4Z5RA 3BWAB 4CILA 2QV4A 3EGSB 2X4OA 1J0IA 1CLYL 4FKKA 4NOBA 1TSHA 1QSFE 3D39B 1KYUA 5CUSH 2CDEA 1TJHH 4G9DA 2KDYA 4ZQTA 3OR6B 3NRQA 4Y4FD 5FV1L 1CLOH 2OP4L 3SKNA 3QSKB 4RZKA 2W9EH 5CCKL 4KVNL 1W72L 3GXMA 3HNSH 4ZUSB 4N8CL 2CDGB 2ARJQ 4XNDA 4JM2B 2OXGA 4IRSB 4KMQA 4WSGA 1TMCB 1INDH 3CLEL 4NQTA 7PAZA 4BQBA 4WWKD 1JPGA 4GUOA 1E9QA 1T83A 2H6PA 1DLFL 2HX7A 3VO0A 4KY1L 1FIGH 2YPVL 3I6KB 5IJKC 1BX2A 2W94A 1NMAL 2J1YA 2Z1KA 4P49A 3SBWC 4FMFA 4F27A 5IB4B 1J12A 4NQED 1U8KB 3UTTB 4HU2A 5JHDB 2ZCLL 4ZXBA 4PJIE 5E94B 1IT9L 2XV2A 4FQXB 4MASA 3LX9A 2YSSB 2XQ0A 4G9FE 2MFNA 3BQVA 1BQUA 4OCXH 3VD9A 4RMTA 5D71L 1KY6A 4FLRA 4ZMPA 1SEQH 4GBXD 2Z35A 4IJ3B 3FUHA 2P5WB 5DEFB 5F1IB 4I3SH 4X9BA 4ZUUB 4DIXA 3RILA 4NNYA 4JHZA 2N1KA 4NO0B 4M48L 4XH2B 1JG9A 4M02A 4MJ5A 1B3IA 3MAWA 1LL1A 4LASH 1D6VL 2MWCA 3IM1A 4PS8A 2AJZA 5HD8D 3QEQA 4PYHA 4N2OA 1U8HA 4WWPA 1RZ8A 1H0DB 4ONHA 5IKCB 5E08L 4GFTB 3WIFB 2MSPA 5H2BB 2CGZA 1NANH 4HU8A 3OG4B 1JCVA 1S9XB 3V5HA 5AOMA 4DKTA 3TNMA 3RDTC 4WEBH 2VDLL 5BOJA 3MRFB 4PRIB 3MU3A 3GXDA 4J3TA 2MKLC 3FYIB 3RUGE 1I1CA 3MRRB 1NPUA 4ODUB 3ZHNA 3PCYA 1DVZA 1L6ZA 1A8JH 4OQTL 4KRPB 1YMHA 2IBZY 1GJUA 3V0AC 4YX2L 1NJ9A 3EBAA 1CLZL 1UGNA 2A74A 1XEUA 1G4MA 5T5FA 4KC3B 5IUCA 3LKOB 2OMXA 1DE4B 1I9EA 1GGUA 4DP8X 1B4RA 3LMJL 1GW6A 4UB0L 4GRWH 5BZWB 1Q1JL 3MTXA 3CU7A 4WKZA 5DMJB 3OLEA 2GJJA 1HINL 3WUWA 2ZPKL 4P3WA 2XBZA 2IPTL 5E2WL 2CBQA 3HB3C 4FA6A 2X3CA 4X98B 1ZTXH 1MAJA 1JDDA 3FRUA 4DGVL 3ECBA 2L7UA 1RK0B 2Z34A 2HTKC 4JGMA 2YXVA 3SE4C 2RCSH 5EU7E 2Y2TA 1RIUH 2JI3A 2VL5B 2Y5TA 3WKML 1ETZA 3GNML 4U1GB 4OCSH 5LCVL 1OAQL 2MQ0A 1MCLA 3C6SB 1BXVA 1MELA 2M26A 2YMOA 3FCSB 3EJTA 1JSYA 2HFGL 2NTSP 5EOQH 2CO4A 1RZ7L 1I3VA 4AEIH 1LEIB 3O2DH 2OYPA 3W9DB 3DYPA 5ITBL 2QTEA 5FOJA 4X0NA 2Z92B 1QFOA 2YHGA 1JWUB 2ZXBA 1CS6A 4FFVD 4UM9A 1AANA 2HN7A 4KNUA 1RZQA 1BBDH 3VWKC 4BINA 4EUPA 4F58L 3IJYB 3FB7B 4K2UH 1NLBL 5EIVA 4YDMA 5HVWA 3GSRB 3IVKA 5D6DC 4XO4A 2NW3A 5FC9A 2D7TH 1U8NA 2G3MA 2XPZA 4X6EA 2PO6A 3FKUS 2PPDA 3HG0A 3IXTA 3NN8B 5B3JE 3QXTA 4ODWA 3M6DA 3RPBA 2A6DA 4WNQB 1UCBH 3Q1EA 4AXWB 2FK9A 4HIXL 1KFGA 3QJHB 3FQTB 4K23H 1AGBB 2I07B 3MNZB 3DPBA 4ONFH 2BM3A 5E9DA 4PGEB 3S3JA 5CM1A 2LAAA 1UURA 3WELA 4F7EA 4D9RE 1ZHNA 3DX6A 2EADA 3BSGA 1WHPA 4HDIB 3UTSB 5CZXC 3BVVA 1YC7A 5CD5D 3ES6A 1DZ0A 3LXBA 4MMXB 4Z78A 5ESQB 2Y1ZA 5MEPA 3DNKA 4XMWA 3QH3B 1A4JA 2NR6D 5ABZA 5ESVA 5FCSH 4E41E 1N9PA 3A22A 1CI3M 1JE6A 2CA3A 3FS9A 1O9VA 4DUVA 3WEBA 5DCCA 2WWKO 3GMPB 3A6OA 1UT1A 4XWGH 1KGCE 2DL9A 1FGVH 3EYOB 2Z8RA 4FC3E 4MA3B 3VXMA 1BDYA 3OAYH 2K1MA 1JDAA 1OCWL 2EDMA 5HYEA 2AI0H 3QFJD 5DZNA 1DQTA 5TQ2L 1TG8A 1E40A 3P30H 1IVLA 2Q8AL 4OKVB 1MHCA 5T1MB 1XF2A 1FL6B 1QRND 1XCQA 2YOCA 1F42A 3UZQB 1BCIA 1IGYB 1MCJA 1X5FA 3RY6C 4HOZA 3EHBD 1DUZA 3FT9A 4MRCA 2OR7A 1JCKA 2JKWA 4PCTA 2FBJH 5E1IA 1S7TB 4M61B 1U3JA 4FP8L 1GC1H 4G11A 1S7RA 4X5XA 4P4KB 3HBZA 4DPAX 2JCCF 4NNPH 4QUOA 3K1KC 2VXVL 1Y18B 4WHYG 5KJ7E 3ARXA 4Q9RH 5E9DE 1MCCA 2X4RA 4H20L 3LHPL 2E7HA 2A9ML 4PRPB 1GJIA 2P24B 3GHEH 2OL3H 3SYQA 4C56B 3C8HA 4W9DC 5GGUB 4TULH 5B8CC 2ICEB 5K93A 2P8MA 3U4EB 3N0AA 4G3YH 2BNQA 1NM4A 4PJBA 5F7KC 3A3YB 1CYXA 4A7TA 3B1UA 1IAII 4PJFE 3KXFB 4LP4A 4PP2A 1MJUL 1I1AD 3V8CA 4JFXB 2ZT9C 2JTDA 4K3JL 1Z9SB 2BVPA 2V9RA 1E4XL 1SN2A 3JQOB 4P9HL 5GIRB 4HUMB 5JHLL 1IC5H 1A6WL 2YSTA 4IRZA 2DD8L 1NWPA 3PL6C 3HE6D 4QRFA 4QTHA 1CE1H 1KPUA 2R9HD 1NCDL 3STZA 3W11C 3X13B 1II4E 4LVEA 4I85A 3HG1A 3B2VL 3GS0A 1XCWA 1QAWA 1LDPL 5I8EB 3ML8A 3OX8B 4KHXH 4MZ2A 3I2CL 4OFIA 4AY0A 1LEGA 2WXLA 2IDUA 3D05A 3R06A 4JO1L 3LEYH 4JPIB 1FAIH 1MI5D 1YPZB 1PSKL 3ELAT 3S9DB 1NBCA 1JGVL 2UUDK 4BRJA 2PWGA 2PW2B 5FKAA 3G6JB 3ZYIA 1BWWA 1EHNA 1NMCC 2WYHA 1I8LC 2BNUB 2H8PA 1NCWH 1MCWM 4XO3A 1TTRA 1XIWC 1QR1A 1UOVA 1X6NA 5GHWL 5BRZB 2Q7AA 3CFJB 3WJMB 3VI4F 4LNRB 4YPGB 5I8OH 1CE6A 4Z7OE 3LKQA 2ZWSA 4LLMB 5DGQA 4GG6F 2K4WA 3II1A 3E9UA 4PJBE 1QI5A 5FB8B 3EH4B 3VGAC 3M7FB 1A64A 1KTCA 2QVTA 2MCMA 3QORA 3F5WB 2XZQH 3QUXB 1BXAA 2UY6A 3LQAC 3VXRB 4TL5A 1C5BL 2OYMA 3H7BA 5IFJA 3BVWA 5I1DB 2R2BB 3TH2T 3HN5A 4N24A 2VUYA 4DK6A 3BDXA 2ATPA 5A16B 3KLLA 1RAMA 4EF3A 4PIBA 2YFNA 1CU4H 2ADGB 2WOYA 1MCIA 2ITCB 3MREB 3QDJD 2VZSA 4ZMNA 1PZCA 4YR6B 2VLKA 4MJIB 5AYUH 3C8KB 4ORZC 5E03A 1U36A 3QI9C 2XNAB 1VGEL 3ZOAA 4A1RA 1RUQH 3QPQC 4G6FD 2GSIB 1MREH 3BOVA 2ICWJ 4XXCA 5DQDH 1HKLL 4YNYA 1OAUL 3ABKB 3TZVB 1KXVC 2YMXH 1W0YT 4R26H 1RZJC 5GISH 4I2XE 1NL0L 4UT6L 3FTXA 2ZX8A 4EI5A 1NGWB 4IRJB 3UFIA 5I5IA 2PXYB 4M6ML 3NBNA 4R96A 4PJ6A 3GLZA 3TOPA 1DVFC 2J4WH 4G80A 2OCFD 3BN3B 2XJKA 3DJ9A 1CK0L 3GK8H 1XH3A 3H9SE 3M88A 4FKEA 4NXKA 1IM9B 5FWQA 2K9FB 3QPXH 1P5UC 4KBPA 1RK1A 5TDNA 1T0MB 4TQEL 3F62A 3W0WA 3UAEA 1UACH 3SJVB 3W37A 3P4MA 4N0FB 3OR7A 3SE6A 3PV6B 3N44B 3QE5A 4YZFE 4PG9B 3QNZA 3S3SA 3KYKH 1T0PB 2PYFB 4WY7L 3UBXG 1MW0A 3T3PB 4KY2A 1CD9B 1ULVA 1HCFX 4X6FB 4CSPA 5I0YA 3ERXA 5D5MB 5IY5B 3X11B 1H6EA 5EO0A 4N6RA 5DZ9A 1Q72H 3FUNA 4LF3B 4UDUA 1RCYA 3FN0L 5E6IA 4Z7QE 4XCEB 4XODA 3UERA 4KKBD 1EV2E 1P6WA 4KPHH 4CGTA 1IQDB 3CFBA 5AAMC 2RIKA 3HE7A 5T3XL 3NPSC 3FHAA 1PEWA 2YC1A 3ZDXF 2QPDB 3ZYJA 4JZOB 3O6FD 2P7TA 4BSVB 5AQ0A 5E5RB 2BSDA 5F9WC 1N4XH 1NLDH 4JM4L 4JE0A 3QDGA 5FYJE 4AKPA 1TTUA 4XP4L 2XWZA 4J3WA 2NY7H 3HC4L 4MB5A 4L0ZA 3S34L 2IH9A 4DKAA 3EFDL 3W82A 4B97A 4PVMA 1QQDB 4LSVH 4MMZC 3ISYA 4QXTA 1OGTA 4H0HB 3VXNB 1BZEA 5TDOB 2FGWH 5F71A 3C60A 2X6BA 5D9SA 4TLTA 1M56B 3U2JA 1VZIA 1I8MB 4M6OH 1RHHA 1MHPH 3AQZA 1AGFA 3PYCA 5FCUL 2PCFA 1BVKB 2GW5A 3X14B 4NCC1 3P3TA 3B7RL 4XAKD 4E9TA 3F7QA 3HG2A 4GS7C 3D34A 2QVFB 5C08B 3PAVA 1KBVA 2EYSB 2LU5A 3BUTA 2PTTB 5ADPL 1NINA 3QWOA 3X3FH 2WTRA 3EYFB 5EU3A 3BW9A 4KMTL 1E27A 5BV7B 5MEND 5FYLL 1VADB 1PGRB 4XMVA 4ZMOA 5EB9A 1WC7A 5JW3L 5CMAB 2NY3C 3LPGA 2YEZB 4XC3H 3PDOB 1TPXB 2GBAA 3MV7B 3ULVL 1AE6H 4PB9H 2DIBA 1CICA 2DLFL 2XZCH 4YXHL 3WFDL 4F9LA 1UJ3A 1MPAH 1ORQA 4PR5A 3U83A 4DOHE 4Z76A 5JW5A 1Y0LB 5F89A 1DQDH 2GHWB 4PH8A 1N67A 3VMNA 1IE4A 3MRKB 1ZXQA 2AJVH 2ZSVA 3AS1A 2H41A 3AS3A 4M6NH 3UYPA 3P9LA 1TZIB 1RZFL 4M56A 4N1HB 3QO1A 3CHPA 1OM3H 2BS71 1UD3A 2FL5A 3LB6D 1JPFB 3RVXD 1JZ2A 5A2CA 2JKTM 2R23A 3HHRB 3CFQA 3QDGE 3NCYP 4A6YB 3FQNA 2Z0UA 1U33A 2JB6B 1EBAA 3BPCB 4XXDB 1K8IA 2ZYHA 3IFPB 5I17A 5KJRL 4M5YH 2LFEA 3QIWB 2YEVB 3FUIA 3U1PA 3NSJA 3ZY7A 5GXBB 3EO0A 1OAYL 1OCCB 5T5FH 4CC0A 2LTQC 4YBLB 5DO8A 1TMQA 4BH8A 3FFCB 4OLYL 4RGNC 3SE8L 5ABAA 3Q13A 3RPIA 1QG3A 3CHQA 3RVWD 5CBAB 2N4IA 4NM4H 3V8OA 1A2YA 2R56H 2WQ8A 1WJ3A 1RU9L 5C7ZA 2KS0A 3OLIA 4WI0A 2FJSA 4LHQB 2R0ZH 2E27L 3GKZA 4LAQL 4U4BA 4N28A 1CBJA 1R3HB 1OZUA 4RAUB 3BISA 3QQ3A 4GQRA 3VFOA 4EIZC 2I7SA 4D0DA 5D1QA 3BKYL 4HJGB 1WSST 4UT9L 4ZFQA 4H40A 1XF5B 3KWUA 4N2AA 5HGHB 2VE6A 4PY8I 1GTFA 2DTSA 3VJ6A 3VRJB 2EIZA 5BJTA 2XQBH 3IPFA 5FGRA 5KBNC 4UBDC 4XX1E 4YHZH 2V2XA 5AW8B 3T77A 3UOAB 1NBYB 4U1HB 1CF8H 4Y19D 5EEZA 2YK1H 5DMIH 5J9PA 3CZFB 3OGOE 2APBA 1VFBA 2OMVB 3IDUA 4PJGF 3MCYA 1TZ8A 4YGVA 4NWTL 4BFNA 2DYPA 4BYHA 4EUPH 5C0EB 3STBA 5ICYA 1AS7A 1OSYA 1KIPB 2NW2B 4J1UA 4JN1L 4LCCA 3EYVB 5T1LB 1P1ZB 2BCMA 4NQDA 4TLSA 3MBWB 4PRAB 4Y4FB 4DUXA 3L2NA 4EDXA 5FXCH 1KIQB 2X12A 4UQAA 1QD0A 2F2HA 3G08A 3HI5H 3L3KB 4XP1H 4ANUA 2IEPA 1O75A 5LWYH 3LKNB 2BSED 3BCFA 4WWKB 1RL1A 2IGFH 1DSFL 3L4VA 5HHVH 2O5XH 1G7PB 2A6JB 1PDKB 1NFDA 4FFYL 4I18B 2DQFB 4R0LC 3L81A 1SXBA 3CG8A 2WKOF 3ULUD 5E5MA 1UWYA 2WYZA 5AUMA 4C83A 4NQEB 4LSPH 2HFTA 1OW0A 1U2HA 5BZZA 2Q8BH 4DAGH 1JV2A 2BC4A 2R8SL 3U36A 2I9LB 3ARSA 4ELMA 5IB3A 3HZMA 3Q2WA 4PJEE 3TBTA 4X6CB 1A3RL 3CZJA 3LNFA 3QDMA 4MJ4A 1MFBL 5FW6A 4XCNA 3TPUA 3C5JA 2ZKWA 1F6FB 2A6KA 3WFHB 1AC0A 5FYJL 1KIRA 2YOAA 1KJ3H 1A7PH 2P52A 4GBXB 1DO6A 5E5UB 5F96H 1NSNH 4FZ8H 3GMRA 4WGWB 2QSCL 4DVBA 3SKMB 4L8SB 3IT8D 4QO1B 1OP9A 4L9DA 1IGIH 3P54A 1QACA 2W8CA 3C5ZA 1EFXD 4U6VH 3CV5A 3FU0A 2F61A 4AV0A 1JFQH 3ZE1F 4OGXL 1F5WA 2GSGB 4M5TA 1J1XH 1GHFL 4LARH 1EEYB 4NQDE 4XMKH 4NN5B 5SWSA 3FUJA 4MNQA 3B9VA 1TQUA 5CKGA 1BAGA 1SEBA 4M43H 3UJTL 2VDOH 2Q7YA 1ETJA 2BXZA 2PPEA 4FADA 2CO6B 3VU2A 3RNQB 4AH2A 2FZ3A 4Y5XB 3ZE0E 1B4JL 1Z5LA 5E1AA 2CRIA 2WLIB 3NACH 1AXSA 3CXDL 3I3DA 1HWHB 1DBJL 2QKSA 1THCA 1UA6L 3D09A 1TQCC 4UV4L 2BHZA 4LKXA 4RGMB 5JPNC 3TBWA 2N59A 4MQXD 4NBXB 7FABL 1JGUL 4P5TA 1T66D 2VIRA 1L3NA 5TFSL 3BPOB 1PYWA 1RIHH 1ND0B 1J8HE 2V3EA 3JUYA 3KPQA 4CU8A 2IPKA 4MX7A 1NWOA 1YAZA 3KYNB 2CA4A 2HWZL 3CUPA 4JFTA 4WI2A 4B27A 1Q94A 1D7DA 1K9TA 4IRZH 2QQQA 1L0QA 1E5AA 3IDGB 5AVUB 2Y1YA 3OBAA 1YNLH 2OTWB 1OCOB 2E4FA 4Y5VB 3H42H 2EVJA 1FQ9C 1FZOB 6TAAA 2Z9TA 3NK4A 4DKDC 1ACYL 1AGDB 1QFWI 1RSFA 4FFWD 2J8UF 2L04A 4AJYV 4G59C 3WFCL 4L4JA 4AIZA 3IXAA 3OHXC 2DQEH 1YEGH 4LRIC 1DJHA 1S3KH 35C8L 5DHYA 3L17A 1KZYA 3NCXA 4K5LA 1XB3A 2BIPA 3P9WB 1JV5A 4LOUD 2BOCB 4OLWL 4L29B 2BNRE 4MNQE 1JZHA 1DBBH 2BCKA 3MSPA 1UOKA 3RGVD 3LXUX 1I4FB 2DWYA 4NRYA 1S78C 3FFOA 5FUCE 3D85A 2FWOB 3KCPA 1IEAB 5HYSA 4AUUA 1XD0A 4FG6C 4JZNA 3UCQA 5I1HL 5IWLC 2BP3A 1C16A 1AGEB 1WUNT 3U1SH 1TJMA 2OJZH 4GAFB 1TZGL 4OIFA 2EQDA 5B39G 3AXLB 5IK3A 3QO0B 1WFTA 3HG3A 1KB5B 5E8PB 4YC2C 3VRIB 5IROD 3LQZA 2B59B 5HHVL 1FSKB 3GS7A 1RLWA 32C2A 1N64L 2HG5B 4UQ2A 3K2IA 5JTWA 5LBSA 3K1DA 1M71A 4KXZH 4LGPB 2HKHH 1M7DA 1RUPL 5DD5L 3JT2A 3KLAA 4K55A 1U8LA 5J57B 1U9KA 2CJ3A 4P2QE 5FF6B 3BRDA 3K8LA 1MIEL 2WXMA 2WYTA 4PTUA 2K7PA 4QRUB 3SODB 1U91A 3TS8A 1Q9OA 1NM9A 3KPOA 5B22A 4FJYA 4J3OG 4KK5C 1JS4A 3GSWB 1HSAB 5E56A 5I15L 2B14A 1DVTA 2HVJB 3MRDA 3VYNA 3F85A 1FVEA 4WENB 3W5MA 1RERA 2X2IA 5CP7B 4KI5C 2FJFA 4XVTL 4DETA 1G0DA 2GKIA 4GJTB 3Q2VA 3CFNA 4Y9CA 3APDA 4RIRB 3PIQA 1F41A 3QFJB 3Q1SH 3VYPA 2XVKA 2XV0A 2FEJA 1F4XH 3Q2LA 3ZDYE 4CJ1A 4JO4L 2FJHA 2VN6A 3OXRA 1MJ8H 1B4TA 3AXHA 1G94A 1QRNB 2KDGA 4GOSA 4CAGA 3S37H 4NQCA 5G5DA 3APMA 4AYMC 3WTWA 3ARQA 4UDTA 1KBKA 3EHBB 1U92A 3DJRA 3VH8G 1P84K 1JNLL 4QYOB 3PWNB 4ZI8A 1J1OH 2NY2D 2WINA 2VAJA 4PJHE 3MRCB 5EF1A 5I71C 1W0VA 4GI9A 4HUWA 2XRAL 1NUFA 3I02A 3HA0A 2OI9C 4ERSH 1NFAA 2ZWZA 4MJ6A 1JRHH 3FT4B 1A9EB 5IVXA 3PU7A 5JPMC 1BGXL 4YHNB 4ODSH 3KGTA 1JZGA 1UG9A 1UQSA 5AZUA 2RACA 2CLVB 3EJZC 3L95B 4YSRA 3ZDZB 4R4BA 4XMUA 3MA7A 4ZDHA 2XBTA 3DMMA 1ZSDA 2AXGB 1RPKA 4YEEA 2WTPA 1HU8A 3TEZA 1T22B 2GB2A 3EADA 4KRPC 4NKIH 4AM0B 3VFUA 5F6HJ 4PWFA 5D1XD 4G6KL 1N0LA 1E30A 2FH6A 5F7LB 3F58H 4OCYL 1OSEA 3KBFA 3MGTB 4X9HA 2ZXAA 4G8IA 4HHAA 3FQYA 2WNGA 3BDYH 2VAAA 3TF4A 1INQA 1I1AB 4NZDA 4PJ8A 5AB0A 3VG0L 4ZYKB 3INOA 5H37A 5K59E 2RFXB 2DL2A 3HE6B 1ML0A 4V1DD 1DQQA 3BP7A 4HGMA 4ZUVB 1WAPA 3ASOB 5LAXB 1RFDH 4JHUA 4Z3TA 4XZUB 1L7TL 4X4YA 4NP9A 3WS6C 2X3AA 4UNUA 1JIBA 5ACZA 4RX4D 1FNEA 3VSQA 2R4RH 5D96B 1CFNA 1KTDA 2J2ZA 4Z0XA 1VEPA 4W6YB 5JHBA 3ARGA 2Q76B 3GHBH 5EULV 5F3BA 5F7BA 5GQBA 3KR3H 5FK9B 3GRWA 5DK2B 4MWFA 3SGEI 5GZOA 3IDNA 3A67L 3GMLA 4Y1AD 1MI5B 5IMKA 1TVBA 2P5ED 2QHLA 3IEAA 2VC2B 1NCOA 3IRZA 3SQRA 3CIQA 4XCYA 2GTWB 3BVDB 4Z9KB 2YD7A 1Q90A 2N7AA 1EAPB 2YJLA 2JFCA 3T09A 1AHWB 1WA0X 2D31A 5D6CB 1XR9B 1MAML 5HYJA 2VDQH 5A3IC 4MNGA 3C2AH 3P73B 3UAJC 3S5LA 1F97A 4U6HB 1FV1A 5TE4H 3U0WH 1NCGA 1EO5A 4GUPB 4HYTB 4I89A 4OZIF 2A6IB 5D7EA 2DN7A 2WQWA 4AK1A 1SBSL 1JNNH 1OSZB 4X6DA 2PCPA 4LBAA 3BT2H 2UXFA 2ESVE 3FQRA 2C3VB 2ZCKL 4H0IA 1QEWB 1IC1A 4NN6B 1S9YB 1R34A 2GUYA 2J55A 5FA4B 1BQHG 4XO5A 3A4AA 3SPVB 4X6BB 1HEHC 4ADJA 3M1BB 3RFRA 2IALA 2IV9A 3F83A 4PRBA 4TLUA 3QWRA 2FO8A 1LP9A 3QDJB 3K8KA 3HMWH 4I1NB 2VQ1A 3K72B 3L5XL 3WJJA 2DH3A 1TVHB 4KITB 4G6FB 4ENEC 2XWBB 3DTXA 1T5XB 3ESMA 1QA9A 3T6XA 4TNWK 5JUEL 2NUPB 2DM4A 3CN3A 4LMQI 3F7YA 1AQHA 2BRQA 1KGYE 2XX0A 2DJMA 1I9RH 3MBEA 1AZBA 2QVKA 4Z7VA 1KTBA 5GSVA 4ZOEA 1OVZA 3EOTL 3MFGB 3RWHB 3TO2A 4XNZB 2Y07L 5JQ6H 2CSPA 1UATA 3DOSA 2Y6SD 2IH3B 4FGMA 5IV2A 2BJMH 3MV9A 3RLSA 5LKNA 3RTQA 4LLVB 3UX9B 1D7BA 5KS9B 2VDNH 2WZAA 4QAMB 4IHBA 3BZEB 4MNHA 3SGKC 5F2FA 3SSGA 4NZTH 4QCIA 3DJZA 3U6XS 5IMLA 4FOMA 2HTLD 2X4TA 2XZAL 3QZNA 1CR9L 5IB5A 1FZJB 4G1MB 1IX2A 1G7IB 2WBXA 2AF2A 4IIQA 5JLZB 3PWUB 5DEZA 4HWUA 3FQ1A 4N5ED 4N9OB 3U6RA 4Y5YC 2YGNA 2QQNL 2UXGA 3D0VB 4HGWB 3C09C 1KPVB 3QEHA 3UDWA 1TZAA 2GK2A 3CFCL 3RQ3A 4NENA 3EH1A 3SYAA 4OLVH 1TJIH 3RJOA 2O6DA 3O6FB 3DSFH 1BIHA 5K39A 2A99A 3K2UH 1XL4A 4NRZA 4MZRA 2LR4A 1LP9E 3MLTA 1T5WA 4ZX5A 7CGTA 4GKZA 1R3LA 5I23A 5F7WC 1S7WB 1AGCA 1OB1A 4Y16A 4ODVL 1KSRA 3JYBA 1JL8A 3NP3A 1OF2B 3EFOA 4HIIB 3UBXI 3CLFH 2NNAB 1EANA 1H5BB 4KK6D 1MFCL 3RZCA 1KGIA 4M4RB 1EGJH 4K3EL 4KKAC 4QRPB 4GAGL 2ADJA 4Z7VE 4AQ1B 5FGBC 5I1CH 3ARYA 4JREC 1S7VB 3DLQR 3HC0B 5EUOB 5I2IA 3BSHA 4H4NA 1G6RB 3GD1C 4HJJL 5AAWC 1FVDB 3FULA 4WFEE 4DO4A 2MTAA 1FO0H 5MENB 1UM5H 3TVMA 4EI6A 1BM7A 1XTLA 2JWYA 2ZUYA 1ZHKB 3GO1L 4JRYD 3VTTA 3ZRFC 1BZ8A 4C4UA 2GSMB 3GKWH 5BVPL 5ETUA 5BZDB 2HKFH 1EUUA 2HG0A 3KXFE 2X28A 1UD6A 3CFKB 4Y0GA 4LESA 4J7RA 5GGRY 1LWRA 4PV9B 2V5TA 4HH9B 5FYKE 1FP5A 3O6LL 1NUDA 3VXQA 1RV6X 4PI2A 3L7EB 4DEPC 5E2VL 1NGPH 5AW2B 2EZ0C 4LSSH 2R2CA 2UZIH 4JL2A 4KV5F 4KUCD 4JUSA 2FQFA 1F18A 4L4TD 4N90D 4XPAH 1A7NH 5FFGA 4JB9L 4JFOA 4OQTA 4WCYL 1XGRA 2XN1A 2ZCZA 3NSYA 1T1YB 2FVNA 4ONOA 1I1FB 2Z31D 4NT6B 3Q8EA 5E0QA 1SN0A 4K7PL 1AHMA 5DT1L 1SZNA 4Z0BL 3G6JE 2CCLA 4I0PD 4JO5A 4Y2DD 4I0KA 1R5IB 3HAEA 4O2EB 3PNWA 2WXJA 2E7LA 3APFA 4PRHE 3MJGX 3MNWB 4JRXD 4XN1A 3OMNB 1X5ZA 4O9HL 3FU7B 4OZFB 5BRZE 3W2DL 4F37F 2WUBH 3C6LA 2J25A 1ODUA 4P57B 2SEBB 4JG9A 3F04A 3TCLB 5PCYA 4APXA 1GGIH 3IDJA 3SYCA 4OJYA 3DO7B 3CQPA 1T21A 3ZL1A 3RX8A 5TE7H 2Q10A 4Z7IA 5BVJB 5DYOB 5JXEA 2OZ4L 3ILPB 2OR9H 2YARA 4LQFH 4AYEC 3CXHK 3ML9A 5DJDA 1M1XB 2Q9OA 2WLNA 5DJYA 3TC9A 4ZNEE 5AW3B 2QLVB 3LNDA 3C8DA 4JRFA 3EIFA 4Y19B 3WTVA 1S7XB 2J56A 5DUMH 1SJVA 1XSKA 1BHGA 4PTTA 4PAZA 4GXUM 5GJSL 3N43B 5KN5A 2ARWA 4N8VG 3B7UX 3BMVA 3AGVA 2BVUA 5HGAB 3TP4A 1NGZB 4W9EC 2XZZA 1V3MA 4BXVA 4DGIH 2B5IC 3F7VA 4BUQA 1EDQA 3WNPA 2D03L 4U33A 3QIUA 3JV0A 2XTJD 1M3IA 1XGPB 1QWNA 2FECL 3GJFA 3KPSE 1XD1A 4BQ8A 3ZVVA 1I3GH 1GA2A 2GITB 4NZ8A 3GMNB 4PWJA 1UOLA 1TZOA 1A65A 1YYCA 4NZFA 4XN9A 5LBSH 3SCMD 4O2CA 4ALAH 3LIUA 1CO1A 2F8VA 4KROC 2HCZX 4FA7B 5JOPE 4DF9A 5E8OB 3DO3A 5I6PA 2VZOA 3CDYA 3KH4A 2XQYK 5AB1A 3OAYK 4BRVA 1UZ6F 5TH2A 1NEZA 2I25N 5HI4C 4GP4B 4QHLA 3PLYA 4H8WC 2OMYA 4TQHA 3T0XA 5IMMA 3GBNL 5BUPA 5D2LA 2XV3A 5I74B 1U8PA 2DJ4A 4U0RC 2YPKB 4ES8A 3ARBA 4ONGH 2CDFA 3SDCC 1QUNB 5JOEA 1AP2A 4N5UA 5SWZA 2ADIA 4HUUB 3RE0A 4LSQH 3L3OC 3GDCA 1ES0A 1WCBA 5IQNA 3UGUA 2WXOA 1UHVA 4AZ8A 4NDMB 1QKZL 1IBZA 3MLUH 2FSDA 1SMDA 3OVUB 2ZOTA 2NQ3A 3MACH 1T5KA 3CDZB 3PGFH 5C6PB 3VDBA 3FMGL 3U0PB 4XNMA 1EFXB 4GSDL 2HLAB 1RJCA 3UTZB 4W9CC 5I0DA 3JWOC 4D3CH 1SXNA 1UA7A 2CHZA 1NC2A 1XL6A 5TF0A 4NERA 1IUZA 1AR1D 1IU1A 4Z7WA 4ZRGA 2E4TA 3MRLB 2Z91A 2VXTL 1RZPA 1SDDB 2C5DC 2ZE0A 3PFUA 4MXWL 2FQGA 4PJDE 4YIQA 5F0JB 2JB5L 2PTUA 3HLAA 3L3JA 2ZX6A 1DCLA 2NNFA 4J6RH 1P6AB 1JK9B 2XN9D 3BZDA 3EH2A 2H1LM 1BF2A 3H9ZA 3V6FB 5IJKA 3CVHB 4Z3EA 2IF7A 1M2VB 1VLXA 4NC1E 3QZLA 2RALA 2HZHA 1ZSHA 2NTFB 1Z0MA 2VOTA 3OZLA 1WVZA 1U3HD 5FYKL 4H44C 4N9GA 5EF3A 4RGOH 4M4PA 2XG5A 1CVRA 3PJSB 1BVLB 3AU1A 3EF7A 2ENYA 3EBGA 4EZMA 1S5HA 2VJ8A 3NIDE 5E8NA 2ZCHH 3QNYA 4EUPG 4YBLC 3LN5B 1DHKA 5INDA 4A7GA 3R4RA 4HIPA 3IGFA 5D2LE 4F7CA 2BOBB 1MY5A 4CMHB 1N7ML 1E5BA 3DWTA 4BZ1A 1YA5A 4F15C 1GH7A 3LH2L 5T3ZE 5H37H 2GBUA 2P4AB 2AEQH 4Z7UA 3V6OA 3GBDA 3NA9H 2BIQA 4LDCA 3SKJH 3VVWA 1QX1A 2I24N 1IFRA 2X3BA 3WHXB 2CLZA 3NCEB 1E67A 1FNGA 3TO4D 4Q8BA 3BH9A 3MRQA 4R97C 1WGOA 3QCVH 1TJGL 1FL5B 4PB0L 5I6KA 1KCUL 2HRHA 1Q38A 1U6AH 2DICA 5CLWA 1KENL 1QFHA 2AQ3A 3O4LA 2WWNA 4OZHF 5HY9B 2WVSA 3RDTA 4P04A 4WTXA 4MAYD 1WBXA 2GCYA 5IHZA 4DFHA 2FWUA 3GRWH 3I3EA 2AVGA 4JRWA 3NIFB 4JFFA 5KYXB 3MLXH 4URTB 5A2IH 1ZA6A 3D0AA 2NT0A 2DZEA 4HQQL 4M7JL 2XI9A 2EDEA 1SXSA 3F12A 3GBMH 3LOWA 4NUMA 3IJEB 4YHLL 4DK5A 2YLHA 2WZPA 3B9EA 2GAZA 5LGHL 4ZG1A 4IGBD 2GUOB 3RGVB 1B3JA 2R83A 2MCPH 1FBIH 3IMWA 1KEML 3SDXF 4OZGB 3V4VB 3GHPA 2X9ZA 4XT1C 1ETB1 2V33A 1O6SB 1RJYA 1LXMA 3OSVA 1E9OA 3S6CA 1BFSA 3U2SB 3IJ8A 5F0LB 2AJYH 4H88H 3UIZA 2Z7ZA 4HV8A 3FTGA 2QZ5A 2DWXA 3WNOA 2J1XA 1YN7B 3IDXL 3LDBB 3PWPD 4AWJC 4WWKC 2VRKA 3Q43A 4RFNB 1VSCA 1R75A 3JWDC 5JIPA 1BD2E 3DJSA 3E6HB 4YDIH 2EIDA 1RZKC 5DUBA 3HZ3A 2EDYA 2FBRA 3CN2A 2L7JA 2WNWA 4HS8H 4P3DA 4L2LA 1HKFA 4RH4A 1Z3RA 3RIFK 5HDBE 1FHNA 4JGJA 4IKLA 2ITEA 1J18A 5DC0A 5IQ7H 1W9XA 3C6EA 1ZAGA 3PAUA 4ZQKB 3WE1A 3FL7A 4C4KT 4AGQA 5D7LA 4KUCF 4UT6A 4G1EA 2ZAHA 3FF8A 3ILQC 3NDZE 4FQ1L 4HWZA 5KUKA 3FB5A 1QO3A 3FQXB 1ONQB 2DJUA 1FLTX 4MTMA 2NX5E 1EO7A 1PG7H 3SYPA 1V7MH 5DVNA 1NBZA 5E9NA 4BJLA 5GZNC 5D6DA 2QGDA 4DVRL 1JXFA 2G30A 4L8SC 2D8KA 1NC4A 1BZ9A 2E9GA 4KXBA 3LKPB 1NANI 3G5VA 4J4PD 2AV1A 1ZANL 2NCMA 1EZVX 3RY4A 3V4UH 2NY2B 1PY9A 5C07A 3SHSA 4C54A 4LCIH 1KT2A 1Y6MR 5HD8C 1IGML 1YMMD 3ULAB 3ME0B 4AM0A 3DI3B 4WEUD 1NOFA 2VMEA 5GRJL 2BS8A 3AZUA 1KYFA 4PJAB 1AOHA 2C9UA 4POZD 1U8JB 4XWOC 5EORH 4Z3HA 3PQYA 4E9RA 5A2JH 1U8IA 5SWQA 3FO2A 3EDEA 2JV6A 2D0FA 4GY4A 4KQ4H 4TUUA 4E9WA 3BSZA 1O7DE 1OTSC 4GAYA 5JMOC 2Z93A 1FG2A 4XHJD 4JR9H 3AG1B 3L3IA 1ZMYA 5F6IC 4QRSA 1HOCB 4NHCH 4NUPA 1Q0YL 1SXZA 3BGMA 5D1XB 3W39A 1ZV5A 1IEBB 1SQMA 1AJ7H 1LO3H 3CLEH 3OKOA 4HJIA 2ZWNA 1BEXA 3MJ8B 3GSOA 2X41A 4OFDA 2YLKA 1KPRB 1EX0A 4O02B 1KEGH 1NMAH 3T3MF 3FUFA 4OGAC 1ZRUA 5DO2D 5F7FA 3GXIA 1FFOB 15C8L 3IFOB 4HUXA 4V1DB 1HK6A 3FB8B 4DKFL 5BV7L 1A7QL 4HIHB 4PJ5E 2TSAA 3HRZB 5AW6B 3RY6A 3AAZB 4X8JA 2VTFA 4UIKL 4IKKA 2DQTH 3CH1A 2MKWA 3EG9A 4ZPTA 1GZQA 3BYYA 4XP9L 1LWHA 3M8OL 3QZWG 2FBOJ 2FYYB 4Y1AB 1J48A 4AL8C 4OSUL 4RAVB 4CU6A 2JF1A 5CJ5A 2P5EB 2CHXA 1M9WA 4UF7C 5T3ZL 5KZCD 4JNXA 4Q6KA 3ZU8A 2C9RA 4TXVB 2DWDB 1ZPLA 2UWEE 3E6FB 1XX9C 2NY0C 3BIAX 5ANMB 3K6DA 3O2VH 3BZ5A 1M2OA 4RLDA 4U0QB 3BP4A 3D51A 5B8CA 1BZQK 5A43C 2OMNA 2VR7A 3R1GL 4KTEL 4LVHC 4PREA 4XBGA 4GMSL 5HPMA 5I66B 5E08H 1WO2A 1S7SA 2J73A 4XX5A 3HS0C 1R6VA 5ICZB 1L9SA 3NCYS 3W57A 3HUJF 3NZ8A 5E6SB 5HDRA 3FOLB 3NJHA 4ZJ9A 3N9GH 4F2FA 2X89D 5D7JD 3PHQA 2H1PL 4NLAA 4TNVK 1TU2B 3ZE2F 1CVSC 3K6NA 2ICWA 4OQTH 2Z3FA 4HK3N 1PG7W 3DXAE 3PL6A 1SJEB 4CBPA 4L2YA 1ZV9A 5I75C 2KUTA 2ZUVA 1XF4A 3ZL4L 2ZKHH 3UBFA 2NZ9D 4KKCD 1AKJA 4GI6A 1ADWA 2TAAA 3PRZA 2UYLB 4K8RD 2NCEA 3MFFA 3K71B 3GSVA 4M5ZH 3TBSA 1JK8A 3ZHLA 1MCQA 1F11A 4KZEL 4BSWA 4TSAL 3DV4B 2X2YA 2E9BA 3BLBA 3HAEH 3NZSA 4K5MA 4ENZA 2ZPKH 1DLHB 2F08A 1KBGL 2ITFA 4V33A 1EEQA 5DJZB 1A0QL 1HQRB 1P5VB 2WQUA 3RFZB 1MF2H 1EZVY 3TCXA 3ZHFA 2W07A 4MGXA 3V79C 1NFDF 3K2MC 2X42A 4UT9A 2JJSA 4UNTA 3QXWA 5JHMA 3MOBL 3EW3B 1L5GB 3OGCA 4IOSD 1AOZA 3H2PA 3GMMA 5KYUA 4B9YA 4GINA 5CJBA 1XGUA 5EZPA 5K9OA 4ELMF 1MFEL 3GIZH 5BO1H 2X70B 4D0BB 4PJCB 1UH3A 5EPMA 3M46A 1NCCH 4P06A 2FX9H 3L6FA 4NI3A 2CHDA 3EHBC 4D9QD 2IG2L 1NDTA 2V2TB 3QUZB 5HHPB 1IE5A 1HZKA 3LZQA 4P59H 4QXWA 4FCHA 2B1HH 3I6GB 4J3OD 5KOMC 3V5KA 2XOTA 1WE5A 1X5IA 5HHMD 2ZWLT 5AZEH 3D87B 2UY7A 2H9GB 2Y3AA 5F3HB 3HR5B 4LLWA 4PSPA 3VMPA 5D7IB 4FXGB 5E4EB 2OULB 2PP9A 2ORBL 1H3WM 3ZGIA 5EEYA 3T0VA 1BPLB 2D9CA 5EIIA 5FO8B 3T04D 1Q9WB 5FR3A 2BZDA 4F37K 1WBYB 3E2HB 3BVXA 3KNBA 5A6LA 3KPPB 2DQDL 4DN3H 2X0VA 5CFAA 4JQVA 3UROR 4O00A 4CVZB 1JGDA 3BC9A 4YLQT 3BQUC 4XPHL 1AZRA 4PMFA 1P2CB 1X7QA 3GJFH 3ARPA 2NY4B 1C7TA 2R0KL 2BZ7A 2N1TE 2WBJD 2NNRA 2FIKA 1KXVA 1FYTD 1I85A 4NYLA 3TEWA 4GW1A 4LU5L 4XX1G 1RLBA 4F8QA 4CADA 1BIIB 5EOTA 1I1AC 4FLHA 5IW1A 1FH5L 5CD3A 1MEXH 1M4KA 4PPTA 2BVOB 4YSCA 1T7YA 3EOBA 1I7RA 2ZKYA 3PP3H 3B7SA 3C75A 2GJ6E 4MCZB 1NGXA 4GXVH 1KFAL 4DW2H 4JUTA 3FTWA 3PWJB 3OJMB 3KVQA 4NHUA 5C2BL 2ZUSA 3DX7A 5D2NC 1BLIA 5CU5A 4UIMA 3ZDZE 3MN8A 5DSCB 4JDVA 2B2XL 4Z95L 5E51A 1RZGA 1YEKH 1OCWH 5DJ2A 4I48A 1MH5B 2YJQA 2ZUQB 3QDHA 1JTTA 2PYED 3O9WD 5T33H 2DWEB 2BSCA 4WHTB 2BWDA 4E9LA 2WXFA 5J6SA 1KYOK 4JRYB 3SY0B 1A5FL 4HS3B 5TQ0H 4DP0X 4NJAH 4GT0A 3L9BA 5FECB 5JW4N 4K7FB 2K70A 5E24E 1JZ5A 4HPYL 4L37A 4N85A 1ASPA 1YVLA 4EZJA 4GRMB 4ZSOA 1URLA 1XCTB 5I6NA 3TPKA 2FEDC 3ARFC 4GMTL 4PI0A 3VFSA 4ZFOA 2I26N 5HDQH 2F7IA 2VLLB 3BX7C 4GKNA 4KHTH 5CEXB 1FJ1B 4HXAH 1P4BL 3VXOB 3JWNC 4W9LC 2BRRH 2WQSA 3FCBA 5GJTL 4WO4D 2AABH 2W0KA 5F9JB 4L4TB 5E6UB 2YZ8A 2A9MH 5AKTA 4IQHA 2AMGA 3NT0A 1N6UA 4JN2B 2VR3A 5J1SC 1XO8A 2A3TA 4JY6B 4QWWC 4J3BA 1PZ5B 1YUHA 3GFUA 4PJ9A 2Z31B 2XWTA 3WJLC 3ZTJG 4NN6C 4O5LH 1PNDA 3BIBX 4QT5B 1V10A 3T0ED 1M7XA 4JKKA 4XPTH 1KC5H 3KM1A 4I0PB 4Y2DB 3N41F 1CFQB 1S5IH 4NNXB 4K3JH 2JIXD 2W9DL 4XNYH 5CJOL 4JRXB 3X3GH 4P9HH 5DRWA 1NGYA 4HF5L 4R8WH 1TQBB 2F53D 4OAWB 2H32B 2IAND 2R1YB 2YMTA 3PABA 4NKMA 3VFTA 2OCJA 1PIGA 2BK8A 3MRJB 3TIEB 5C0BE 1MG2C 5D1ZI 4BZ1H 4WTQA 5BQ7A 2AXHA 2VR8A 4PD4J 3OB8A 1NEUA 4MCYB 1ZLWH 3L4ZA 2C26A 3MCKA 3LNHA 3RWIB 3HBGA 1I1YB 1G7QA 1QSZA 2V17L 4QEGA 4G5ZL 4LSRL 5KYWA 4JO1H 3JZ7A 2WXNA 3JVGA 3MVSA 1YG9A 4XNZC 2VR5A 1I75A 4WU5A 3D50A 1C5CL 4QXUL 2EC8A 3MRHB 4FZEH 4ZO8A 3O45B 3O3AB 3QXAA 4GRLD 4OCRH 3U4BH 2IO5A 3PHSA 1TTBA 1YNTB 5MEOB 3OXSA 2YIHA 2EDQA 3GXUB 1VF5C 1CFTB 2NDGA 5TK2A 3ECUA 1WD9A 3D69B 3R0NA 4RVBA 3MBXL 2WV3A 5GGTL 3VXSA 5ISZD 2QDVA 4YHIA 4L8BB 1RUML 1KB5L 2Y24A 4DQOL 2XWEA 1L7IL 1VACB 5F1OB 1EQWA 3ZX1A 1VGKB 2LU7A 5EO1A 2AJ3A 1ORSB 4PJXA 3UTPD 6CGTA 3V2AR 3DUUB 3EOAB 1E4XI 3EGDB 3P4NB 1XXDC 1HQ4B 1T1WB 3AABA 4PGJA 4AENB 3UG3A 2XTJB 4OLXL 2GFBA 5ESAB 1XZ0B 4HS6A 3DECA 3I84A 4NKDA 2DKMA 3U9PL 1KCSL 1TENA 3ZIMA 3MGOB 1NAMB 3IB4A 1FZMB 3NTCH 3SCMB 2HFFB 1DBAH 3W9EA 3EO1B 2X4PA 2YN3A 2F54D 1DL7H 2VERN 4CGUB 1U4FA 4NO3A 3QEGH 1JPSL 4XP5L 1B0IA 1NTDA 2XWJB 4H2CA 2EDWA 4N3UA 3UBXB 4MKTA 3S37X 3UEQA 4BCXA 2BDNL 3MMEB 2EYTA 4HJTA 4LO9A 1CMOA 1MFDL 2MTPA 4G8GA 1FDLL 5F1NA 3COOA 1WFJA 3E3QC 1BQSA 4LL9A 4UT6H 1DJGA 2X09A 4JFEA 4XNUH 5D8JL 3RL1B 1UD8A 3WYRA 1N19A 4QF1B 4R5XA 5EA0H 4Q6IB 5BW7C 4X99A 4YWGH 5E2JA 4ZMWA 2WANA 4OQ1A 4Z7NF 2VXUH 4NI6A 1WTLA 2IDFA 1MHHB 1FZKA 1OM9A 4FTVD 4WTZG 3LEVL 4DGYL 1H8NA 2IDQA 2DQCH 1MDAA 1N0XH 1J0HA 1J05B 4MD5B 1RMFL 2WUCH 1ZS2A 3WD5L 1WH0A 3U0TB 1PPIA 1AR1B 1NKOA 3IGAA 5HGDB 3I6LE 1ZLSH 4GKSB 3FRPA 3BN9C 3GTVA 1SQ2N 1C5DA 4ZBJA 3S5YA 4BFIA 1MFAL 4Q52A 4L5FL 3BCDA 2WOBA 3BPNB 3A6CL 1QSFD 4QRPE 1JN6A 3NDYE 1YCSA 2XN9B 2ZWKA 3QJUB 3TA3D 1M6OA 2X05A 3T6QC 4LCWE 3LB6C 4L4VE 3RVXC 1OAKL 4XOAA 5ELIA 4Q74A 3VDAA 3H6AA 1OZTG 4HIJB 2AEWA 3BSZH 4LOVA 3OV6A 1U3HB 5H94B 1WCQA 2EKSB 1OK0A 1FN4B 3MROB 2XG4B 4R4FL 4WFFE 3FO1A 3SGDH 3WIIH 1QBLL 4XP4H 2QHRH 1WK0A 1E8XA 2CBPA 4M8QB 5EC1A 2GVYA 3PWVB 4HFUH 4FJZA 3WU1A 2NRDA 3BEVB 3P9MB 2WWMD 1TQVA 4HUKB 1CC3A 3PHOB 4G8GE 4S1SH 5DI8A 3RAJL 3RVWC 2P8LB 1NOLA 2OPCA 4CUCA 4UYQA 9CGTA 2F7OA 5FCUH 4OT1H 3QUKA 3UTQB 2YUWA 4BSWB 5JYMA 2NXYD 3T65A 5D1ZD 5J8OA 3KBPA 3C2SA 1HSBB 4G9FD 1TYEB 2R69L 3FO9B 1KTJA 3TO4B 5DRZA 1JYXA 4X0KB 2AQTA 2UZXA 2VXQA 1Y7VA 3MLSL 3GZPA 4APQD 1T1ZB 1KULA 4ZUWA 1VB9A 4C57C 5FYLH 5I24A 3NVQA 1F3DJ 2VR6A 4ESKA 3KAAA 4OU3A 3D25B 4MAYB 5JW3H 2A77H 2E75C 2OS7A 4QIRA 4HOWA 2P8PB 1GS8A 2W60A 4OV5B 3QIBC 1KLFA 4U7KA 4LCUB 2XY2A 4RISL 1EBPA 5CIPB 3VMOA 4XNXH 2EXYD 4F5CA 1QZNA 4IGBB 1EZLA 3AMLA 3GSQB 3WFZA 2A73A 4OF3A 4RQQB 3SKOB 1OE2A 3OKNA 4GUQA 3IMVA 4XMTA 4Y2LA 3QHZL 3MLYH 3N0PB 5J13B 2HPTA 1GS6X 5B4MD 1MNNA 4YHOL 1RZFH 3FPYA 1BM3L 4ZOAA 5FYJU 5C0AA 3D0LA 3DBXA 5KVEL 1E7UA 3CZUB 2FB4H 4Z18A 3O3DA 3V4PA 4S0SD 5DF0A 1EO8H 3PWPB 3N1PC 4NZRH 4P0DA 4Q7DA 3RWDA 5D4QA 3LRSB 5I0VA 4DZ8B 4HCGA 1VFAB 1KGUA 2J57A 2HJKB 2W88A 3V52L 1XBDA 3SZ6A 1BZ7A 3VWJC 1L6XA 4EN3D 3B2UD 5D7SH 5DRXB 3LPPA 2R15A 3B2XA 4KGLA 4G8FA 1DBKL 5HVHB 1QLRB 2AP2A 4PS4L 1V5JA 1TQWA 3H3KA 3PREA 5KVGH 1XZWA 4LRIA 1B0RB 1HOEA 1ED3B 1TCRA 1YJDC 5BXFB 1BOGA 2OXHB 3B9KA 3ZR6A 4ZZFA 4WUUA 3HNTH 3ALWA 4PRNB 3QJXA 3VE0A 1X5GA 3DVNB 1DBML 5C8JB 2G0KA 2AEPL 3REWA 1J0JA 5E00A 1EVTC 3L9EA 2ENSA 5MP6L 3BEWB 1SVZA 3BWAA 3KLSA 3EGSA 3IDYC 5KJ4A 4QNPE 1SDYA 1K2DB 3WNIA 3D39A 4NQSB 3A23A 1Q4NX 5DWPA 4J3UA 3RWCB 1OLZA 2FWSA 1Z5YD 2X10A 3OR6A 1YY9D 4FQ2H 2IMNA 5EZOH 3WLBA 4XBEL 1NEPA 4KJWC 4ZUSA 2PCYA 1YMMB 2GC7C 1C1EL 2CDGA 1HYSC 2W0LA 2AVFA 4NS0A 2R1WB 3NH7H 4IRSA 1LE5B 3IF1B 5IIEB 3BZFA 3LQAH 5DJAB 1T83C 1F3JB 4P5MB 2ZSWB 4EKJA 4WFHE 4LIQE 4ZMYA 2ZP0T 4HETA 1XGTA 1L9NA 4LBEA 1U93B 3MC0A 1QFUH 1TFPA 1JP5A 5C0GB 3DDFA 1IAIL 1AO7A 2V8LA 5IB4A 3DX2A 5IB2B 1F58H 3UTTA 3L3DB 5JHDA 5IW6B 1LO4L 4ZXBC 4PY7B 5E4OA 4L3EE 1KTLB 1XSIA 4FQXA 3SDAD 3SPHA 4D9RD 5BCAA 2HT4D 1A1MB 2JJVA 5HGBA 5C0JB 2JELL 2VN4A 3HVDA 4M1CD 1RZJH 4IDJL 2W0FB 3TT1H 4E41D 5DEFA 3OPZH 4I87A 5F1IA 3WNLA 1G6RL 2R8SH 3TBYB 1N6QL 2DOCA 4ZUUA 1UXWA 2CMRL 4S0HA 4FLOA 3NFNB 2M2DA 1HXMB