4L0YA

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4l0yA00
4A63A 5AOMA 3EXLA 2FEJA 4XR8C 2GEQA 2BIOA 4AGLA 1E50A 5G4MA 2PCXA 2YBGA 5KBDA 2ATAA 3VD1A 2J21A 4AGOA 4MZIA 3Q06A 2AC0A 4GUQA 4QO1B 5ECGA 4IBYA 4AGNA 3KZ8A 4LOEA 2IOOA 3US0A 2XWRA 4AGQA 3D09A 4IBUA 3QYMA 5LAPA 1TSRA 4GUOA 4LOFA 3ZMEA 5LGYA 4KVPA 3US1A 4IBVA 3VD2A 3WTYA 3WU1A 2P52A 2MEJB 4HJEA 1GZHA 2J1ZA 4AGPA 2J6WA 2XWCA 2OCJA 5G4NA 4IBZA 2WGXA 1LJMA 1H9DA 3TS8A 4IBWA 2J1YA 3WTXA 3VD0A 5AOKA 3WTTA 2H1LM 1EAQA 2BIQA 2IOIA 4MZRA 3D05A 5ABAA 4LO9A 5BUAA 3D0AA 4IJTA 4IBTA 2BIPA 4IBQA 2J20A 1EAOA 3IGLA 3D08A 1GZHC 2X0UA 3Q05A 3EXJA 4L18A 3KMDA 5G4OA 2X0WA 3D06A 5AOJA 2ADYA 1IO4C 3WTVA 3WTWA 5AOLA 1T4WA 1HJCA 4L0YA 2BINA 1EANA 2VUKA 4AGMA 5AB9A 3IGKA 2X0VA 5AOIA 2AHIA 1CO1A 2J1XA 3Q01A 1TUPA 3WTUA 5A7BA 1YCSA 4L0ZA 1UOLA 4IBSA 2BIMA 3WTSA 2IOMA 1HU8A 3D07A 2RMNA 4G83A 4G82A 1KZYA 1HJBC 3QYNA 2J1WA 1CMOA
chains in the Genus database with same CATH superfamily
3DX2A 4NX0A 2ZD0A 2ID5A 5H2BB 4I1RA 4Z7WA 3EJCA 4DIXA 4UM9A 1WCBA 1UWYA 2JIXD 3HBQA 2ATAA 3VMOA 2NTFA 3SHSA 4EZJA 1FC2D 3T8XA 1AZVA 2EH8L 3UABA 2GPZA 3GRWA 4LSRH 3ZPDA 3S5YA 3JTTA 4AQAA 4F20A 5F1OB 1V7MH 3GF8A 2CR0A 4QJ5B 4LCWB 4JGNA 4MXVE 2O5YL 2WKOA 3A6CH 3TO2B 3R06A 3MJ6A 4QHMB 3PQYA 2H32A 4RAUB 2V5SA 1JPFA 4G1EA 4PJDF 2G3NA 1TVDA 4XC1L 2X53A 2GSIA 3NP4A 5C7XH 4AW4A 3QNZA 3VD2A 3RY4A 1RZKH 3HNTL 3V4PH 1IC5L 5JQHC 1JYNA 3WU1A 2MEJB 2WPGA 2R4RL 2LGNA 3C6SB 4G7RB 5CEZD 2FYYB 1EGJA 5KOVC 1TFHA 3MHZA 1KWGA 4S1QH 1NC4A 1VEMA 3RUGA 3ZDZE 1HN1A 2ILLA 4NFBA 4ONGH 1W91A 3AREC 3DKHA 1E5AA 4HXAH 3FB7B 1H9DA 5D7JC 3APMA 4FFVC 2DI8A 2AVFA 3HLKA 1XL4A 2QGDA 1HSBA 2ZUYA 1FLRH 3DX1A 4KXAA 3BJ91 1NCWL 5HYJD 3HR5B 3X17A 4HS6A 3PNWB 4NP9A 4PREA 2F8IA 3OWEA 3NIDB 2ZWYA 3PFUA 2F61A 2KH2B 3UPRA 3APCA 3FF7A 3JV4B 3JWOH 4EDWL 1OAXH 5DQJB 5EU6D 3BFOA 2UZIL 4ZYKA 5CF3A 3VFWA 4NQDA 2XWJB 4MLIA 4BHUA 2DQGH 4R7DB 2MPAH 5HI5C 4M61B 1JHTB 1B4JH 4UV4H 3L1GA 4OLZH 3RA7H 1SM3H 3F58H 4ZW6A 1I3GH 5HVWA 2WAQA 2VQUA 1RZPA 2PYED 1VADB 2VXUL 4M7LT 1LO4H 1RUQL 3TWCH 2XG5A 4UIMA 2HX8A 1XX9C 3VXSD 3A67L 3H2PA 1MRDL 1UZ6F 2J8HA 3ZMNA 1XSKA 1FH2A 1OKEA 1FNEA 3SQRA 1VGKA 1XGQB 5D1ZD 5I76B 1RZJH 3BIKB 1M7IB 3QFJE 4QD2E 2IV8A 2WUCH 5SWZD 4YUEH 1MRFH 5A16A 3FU9A 3KPPA 3Q0HA 4JFYB 4FKHA 2UUDH 2BOBB 4IHBA 1E2ZA 1K6QL 4U1IB 2YJQA 1FVEB 4XX1G 3SE4A 2GEQA 2BIOA 4RWHA 4ZMWA 1OD7A 1EJFA 4NQQA 3X12A 5CFAA 3DI3B 1CU4L 4R4FH 1CDIA 4LB8A 1NJ9A 3T0AA 4FI8A 1LO5B 1TTCA 5DTFB 3C08L 3NCCB 2ZG3A 1HINL 3DTXA 4M56A 4K2UL 5JO5A 2APWA 4UQ2A 2VWEE 4NSKB 4O5LH 1WA0X 4R0LA 4U1SB 1A6PA 1EO5A 3WFDH 5IFAL 3F64A 4TSBH 5AD0A 1K4DB 4KTEL 3F7RA 4X7SL 1AGDA 2OMYA 4EN3B 4S1SH 2F1EA 4XN4A 2DF3A 5KSAD 1UKTA 4XPTH 4R9HA 5B3JE 1XEUA 5DUBA 2AJYL 2ZYSA 4PRHE 5SV4A 3ZU8A 3KPMB 1TJXA 1CGXA 4KVCH 4WF7A 3LV3B 4HC1H 1W6LA 3NPSC 2WC7A 4V1DA 3US9A 2XQYG 3SDCC 2VYRE 2XQYA 2PW2B 4LVNC 4UT6H 3VMPA 3RQ3A 1P7BA 2VDRB 1P5VA 3QRGH 2VXTL 2NT1A 1P9MC 2V5TA 1NIAA 2XIIA 3GI8L 5D9SA 4ZPVB 3RZCD 2QADD 2BIQA 4L0PB 2YRPA 2Z31C 4G9DA 2VMCA 4MJ5A 2A4EA 5DHYB 4XTRD 2V17H 2H26A 2PPDA 4IYKA 3CFJB 5C0ND 2DW5A 3BESR 5JHLH 2CHXA 2DN7A 5DHMC 3UJIH 4IDLA 1WGVA 3CK0L 3BGFC 1LE5B 2D7PA 2B5IC 1DCLA 5I16A 4JFZL 4A7SA 2DS4A 4HS3B 3RTQA 1ZTXE 3W11D 5C6TL 5AOJA 2B1HL 3WFCH 4XRCB 2EO1A 2GBAA 1GGBL 1RIHH 4GP4B 1QBML 1P0SE 2WYZA 1GZQB 2YD6A 4GRWE 3R4DA 5D93C 4K94C 3ZUNC 3ULVE 5I74C 1OM9A 5DUMH 4KK8D 5EPMB 1NDMA 5EBWB 1KY6A 3HKZA 3QI9A 4QWWC 3QEQA 3NYKA 4JFHE 4KGLA 3V2AR 4HBQA 5JHDE 1X44A 2IDTA 3BGAA 1NBQA 4DOHB 3CFKB 1JCKA 3C9NB 3RPIB 3U0PB 3L3OB 2R51A 1SLVA 1BIIB 2NSQA 1HXKA 2VB5A 2GVYA 4PJGA 5MHSE 5E8OA 2XNAB 2HA1A 5JPMB 4PCTA 3LSOA 4HHAA 2ZWLT 1V3MA 2AXFA 3I9IA 1OWWA 1ROWA 3QAZB 1VZGA 1ZEAH 4K9EL 2CMRL 4WGWB 4L1HA 2FBRA 3EG9A 5D96B 5KVEH 1IEHA 4TUJA 2NUTB 3DVFA 5GSRB 2VXVL 1BBJA 1F2XK 2HFEA 3UJTL 5K5YA 1LMIA 1BLIA 2W91A 5AW9B 4NN7B 5B38A 5B38G 4ELMA 1SXCA 2CUMA 4L4TE 1BA9A 2F19L 5I75C 3LHAA 4ZSOA 4I0PC 1TZHB 2R2HB 4IRZA 5E2WL 2MCMA 4QYOA 2ZUQC 2XZAH 2O5XH 5C0BB 4JDZB 1B3IA 3T6WA 2UX7A 2X4UA 2XA8L 1FZMA 3KWVA 5DZLA 1FNLA 4C83B 1WAAE 4OLWH 1CDCA 1GW6A 2GSMB 2G3ZA 1XF2B 5EA0H 1TJMA 1C12A 5IY5B 3H3KA 4YHLH 2YD8A 4M6NH 3FOMB 4ZS7H 3FCSB 1M7XA 5EFIA 1BYNA 1FP5A 2QKIB 3MUY1 4WY7L 4PB0H 2DYRB 4YC2B 3OLIA 1MJ8L 5GGTH 3MTXA 1OO2A 1NGPH 4ELDA 4IBWA 5K59E 2HVJA 2VXSL 2X4NA 2HB0A 1H9VA 2R69L 2Q3XA 2HRGA 1FZOB 1ONQB 2Z64C 4NOFA 2WLHA 4X9FA 2IDSA 3RWHA 3T0XA 1FJ1A 3D05A 4YLQT 3WFEL 1YEHH 3UAJC 1J1XL 2CM6A 3BFQG 1DYZA 3SEPA 2AKRB 4YR6A 2P42B 2BCKA 6FABL 5GS1A 5I73C 5JIDA 1DLHB 3BAJA 1NCHA 1PYWB 2AZUA 5GJSL 3C2SA 4JG0L 3EOYG 3K74B 2UWEE 2J88L 3VGAB 4MAYB 4DKFH 1L7TH 1ID2A 1OPGH 3D08A 3ZX1A 2OMVA 3TTYA 4JFDB 5A3IC 1FVDB 3D06A 1UOWA 1I31A 3HN5A 5H37G 3GEFA 4XOAA 5H37A 3ZZLA 2A9NH 1CYGA 3VXPA 5AB0A 2FLMA 2NX5A 4WEBL 3D2UB 4UAOC 4RFNB 4BH7A 1G5GA 3PU7A 4HK0A 3JWOC 2J71A 1E27B 2ZJSL 2DMGA 3FW6A 2YAQA 2ATPB 2Z93A 4P23B 1YYLH 2FVNA 3NN8B 3QPKA 4Q9BA 4NRZB 3UADA 4XAKD 3BISA 3MRGA 4HKBB 4CSSA 3N0PB 5GXBB 3D85A 2H1PL 2CZNA 5IQOA 4UOW0 4OKVB 5IVXB 3EGDA 2X1PA 1NAMA 2MQCA 5CJ8A 1M57B 2NY4D 1R9FA 1RZIB 3FU7A 3ZYIA 4CILA 3H42L 4PGDA 4JCWA 3I6LE 1I82A 1KWKA 4YUEL 4QTIL 3NACL 2YUVA 3TEYA 3L4UA 1RZJC 1U8NA 1VFBA 2N56A 3EOTH 2MHAA 4ETQB 4XZUA 1SY6H 2LLGA 2I24N 5DD5H 3CSGA 4IOSA 1JYVA 4WWKD 5E8DH 2NSXA 1CUOA 1EK3A 2RA1A 5IZ7A 1DSYA 4XNAA 5E4IA 1BXAA 2I60L 2D31A 5T1JA 1FN4A 1EHKB 2DL2A 4HJJH 1C8PA 5EF1A 3GS0A 2N1KA 5DHDA 5GGUB 4GUPA 1FNGA 3SGKC 4UTAL 1KC5H 4LRIA 2C1PA 3OL2A 3MOAH 5DS8A 2BFVH 3P0VH 2P8MB 3S7GA 3T0VA 1TPXC 1AJ7H 4D0CA 3C75A 1I7UA 1W2KT 2Q76A 4EKXA 3AREB 4TYUA 2XPGB 4JCMA 3ARPA 3QEGL 3MV8B 3KLHD 1XQ4A 4KZDL 3MRMB 1CYXA 4MVBD 2Y36L 5D7JB 1XGTB 7FABL 4FFZA 4AUUA 1LP9B 5F7LB 1HI6B 2XN1A 3X1FA 3BPCB 1UH4A 3ARBD 2HTKD 2CBMA 1FPTH 2EE9A 1N10A 2F53A 3EO1B 4AQ1C 3ZTEA 4KRPD 5IIEA 3EYSL 4GXVL 3UBFA 5FO7A 3QH3B 1IM9D 4Q4EA 5BZWA 1I8KA 1ZSDA 1S7WB 3WO3B 3CPLB 5BOPA 4WCYH 1TIUA 4TOYH 3VWJD 2AK4E 4NYLA 1QI4A 4KUCD 1FORH 2WQRA 4JO5A 4HZLA 1CXFA 1RURH 5E24E 5HDRA 4IK7A 1QACA 5C08D 4GBXD 3OB0H 1MWOA 4AIZB 2ZCHL 5JA8B 4OJDH 4JB9H 2DKMA 2OXHB 1IC1A 4DZBB 1IKNC 2LABA 2PXYD 3FONA 3N9GH 3QG6A 4MNQD 3HCVB 3G9VA 3DTUB 3WCYA 3TLRA 4X6CF 4TUKL 2A73B 2BS9A 2KLSA 5AENA 4AZ8A 3HMXL 2VUYA 1KB5L 5D1ZC 4LVHC 4KAQH 4Y2OB 4EZMA 5BJTA 2E5EA 1NANH 5GSVB 1TUPA 1URZA 3MJWA 1P7KB 3HBZA 5LGKA 4NAMA 4NNYA 4RRPA 5BV7C 1J48A 1G9NH 2WD0A 4XMZA 5GRJH 5D70L 4FYTA 3LCYA 4BCYA 2R1WA 1ZANH 3NTCH 3U9PL 1MHHA 3T6XA 1VACB 3U30C 2Y1YA 4PV9B 1QLFB 4XBMA 2ADIA 2VR7A 3C6LD 3OXSA 3RJOA 2OP4H 5IB2A 4ENEC 1R5IB 3OF6D 3WEXA 1AHWA 4MNGB 1IM3B 1SYVB 1XCQB 4MJIB 5SWSD 2XHNA 4ZS6D 1AD0A 4XPGH 1ZTXH 1NEUA 3CLEH 4MMZC 4TULH 1OCZB 5K9KA 3T6QC 2R56H 3VWKC 4FTVE 1WZ1H 4NKMA 2OTUB 2J25A 3ULVH 5DC2A 5LBVA 2JKLA 3QDJB 1ND0B 3JV6A 2H41A 3PCYA 5KSAC 4J5VA 1WBXB 4G9FA 1Q0EA 2RALA 1LL1A 3VFSA 4H88L 4M8RA 4K55A 1ROCA 2TRYA 4FHKA 4DH2A 2FSEA 1PKOA 4TL4A 4CMMB 2WXRA 1DVXA 2QDWA 2EIBA 1JOIA 2LU7A 5EBLA 1ZVYA 1NIFA 1KF9B 1O7VA 2Q7NA 3SDXE 3SGJA 2YQGA 2VLRD 1GGIL 4YPJA 4C56B 5I5RA 3PJNA 4L9LB 4UV7H 4GFXA 3RZCC 2A1WH 1OY3B 2QADC 4IBZA 3IU3B 5DI8A 5GRZA 4P5TA 3LD8C 2R29H 4UT9L 4UCFA 3TZVB 3UYRH 5C0NC 3Q1SL 4OD3H 1MREH 4H8VA 1Z5HA 4U1MB 1O6SB 2R23A 3DURA 4MA7H 3UAAA 4FRWA 5FYJD 3CMOL 3FO1A 5I30H 1E9OB 3N1MC 1HSAA 2GJRA 4I9WE 3FQXA 4KITB 2JTYA 4TNFA 1G7IB 5HGHA 4WVRA 4KNSA 2GUOA 2JJTA 3W11C 1HQRA 4RSYA 3U1QA 1T66C 2E0PA 4ZFOL 5DMIH 2K0RA 1DEEA 3IJHB 3GPEA 4PWHA 2N0KA 3LHPL 4DGYL 5EC1B 1BVNP 3FO9B 4KK8C 3E0GA 1BF5A 1P4LA 2CO2A 2CO7A 4XMLL 3U1SH 3VXNB 2Q7YB 3H85A 2X2IA 1L6PA 3LKSA 3K6FA 5FC9A 3MXWL 4PJ5D 3NQKA 1CIUA 2AW2A 5E5LA 1GOFA 1MI5A 5CJXC 3UJJL 4EEEA 1F4YH 2QFRA 1HOCA 4Y5VC 4X6EB 2B9BA 5BCAA 4WU7A 4MB4A 2ERJC 3O2DA 5FYKL 3T0EE 3JVGA 5JIKA 1QSVA 1U8QB 1JNHB 4AENB 3CN2A 3WYRA 2HJLB 3WNOA 4X6DA 2V2XB 3MBEC 4U1KB 5FV1L 3S35X 4L8BB 4DFIA 4LK4A 1E2VA 2AITA 3SKJL 5GGQH 3D39E 4PRBA 2CO3A 1LO3H 3ASNB 2WXLA 5B1CA 1QBBA 4CNIB 1AO7D 3SDAB 3TIDA 4NQEE 1N26A 2JWYA 5C8JB 4F2MB 3PG2A 4M7ZB 3VX1A 2YPVA 5T3ZD 4OU3A 4KXDA 2K7QA 4FQ2H 4O58H 4OV5A 1V3KA 3QUXD 5CZKA 5TDPA 1NPUA 5HVGB 3P4NB 2ZXGA 2OA9A 3MFGB 4Y2DA 5IKCA 1UFUA 3KXFB 4HJUA 5I75B 1OAZH 3LZRA 4I0PB 3MLXL 3B8SA 3G5VA 4E5XG 2R39A 4E5XA 1TQCB 4N90D 3KPRB 1I53A 5D2LB 4TUOB 1S7QB 4X6BA 3OR6A 4XVJL 3RVTD 4B9IA 3HE6D 5IR1B 4GS7B 3PGDA 1U3HC 2GJ6B 3P9WB 4LHUB 3IU4H 1H3UA 1YPZA 5T5FH 2FR4A 4NQTA 4OGXL 4NQCB 3KPSB 4HT1H 2Q0ZX 3TNNA 4DT2A 3UPCA 1X5GA 1MELA 1NCUA 3ZK0A 2DI7A 2MKWA 4H0LC 3TYFA 4GFTB 5ELIA 4HFUH 1TZIB 4N8UA 5LBSH 1FYHB 2JCCB 3GSNL 1MCOH 1NKGA 1SFDA 1Z1WA 5AALA 3V0EA 2ETWA 5EC2B 3U7WL 4PJEF 4XOBA 4WW2F 2XG4A 2Y1VA 3B5GA 3RIKA 3RFZC 4YZFF 1TVHA 3K8LA 3V4PB 3K6OA 5MI0C 4DP0X 2Z34A 5ALBH 1E5UI 1A1NA 3D1MC 2O5ZL 3FT4A 3MNZB 5I73B 5ITBH 5F6IC 1CLOL 4GAYB 1FO0L 5INCB 4MDIA 4ICXA 4QRTB 7PAZA 1DJGA 1Q9WB 1YRKA 1RZ7L 3GSVB 3O8XD 2N4IA 1AQ8A 3CZFA 4X8GA 1EEZA 1RUML 3JQOB 3GZKA 1IAII 3QISA 4GEIA 4N9GB 4LLDA 3AS1A 4L0YA 4PGBB 3BXNB 3ME0A 3IN0A 4NFDA 2JJSC 3DLQR 1MLBA 3CXHJ 1JPSH 4FNTA 4HPOL 5IG7A 3FB6B 4ZX3A 5HVHB 2GG1A 4HCIA 4HEPG 5CBAA 2M26A 2EADA 1QBAA 3ABZA 3HVNA 4E41E 5GS0H 2D3NA 2BDNL 2YD0A 3V0GA 1YZZA 1N6VA 2HFFB 4XNMA 1H15A 5HDBB 3B2XA 3II2A 3P4OA 4YGVB 2PUQT 5DJYB 3E1ZA 1HEZB 4MD0B 1CK0H 3CX5J 3QUKA 3PUUA 4JY4A 2ICWB 1SQ2N 3S5ZA 1XGRA 4HSAC 3ZDXF 2MQGA 3PABA 3LN4B 2D3VA 4HUNB 2QTEA 3RL1B 5GISH 4CKQA 3E1F1 1C7SA 1UM4L 5D4IA 5EO0A 1FYTB 1PEWA 1P69B 4LASH 3VI3F 4A63A 3H3PH 3OMIB 4JPQA 1M6UA 3HN8A 3VQ1C 1W0VA 4RNRA 3R4RA 3X11B 4U6YA 4W9JC 3WIAA 3PWPE 3PGCA 3WS3A 4X98A 3H7LA 1A7RL 2BPBA 4NJ9H 1KLGB 3CHSA 4JJOA 4JQVC 1MF2L 4OQTA 3HG1D 4K3HA 4AH2B 4IM8A 3L4TA 1FFPA 1IGML 2WZAA 3MV11 1J9RA 4NB7A 4PRIA 4KHXL 4YSPA 3OKOA 5L8KB 1O9VA 2EIMB 4L3CB 4PJFE 5EEXA 3NJVA 1LK2A 4I3GA 2AV7A 3KLHC 3MSPA 2VAJA 4MVBC 2ZPKL 4P06A 4YXKH 1TPXB 1G7LB 3KNBB 1RERA 5FM5M 3S5LG 2HT4D 3S5LA 1P7QA 3MRPA 3ARBC 1A6ZB 2HTKC 1TYJA 4HYTB 3TT1L 2J6EA 4DEPC 2IBBA 3GHPA 4JJ5B 2Z7WA 4PJDA 1BXXA 1PTZA 3U4EB 4KRPC 4LEXH 3VRIB 3IAQA 1R46A 1GJWA 2R15A 4Y4FD 1OSZB 5LB1A 5TK2A 5KBLA 3VFTA 4GT7A 4B50A 3S88H 4ZMOA 1ET8A 4AQ1B 2CSPA 5E1QA 1XR9B 2BVPA 3THML 3W3BA 1XF4A 3KPQB 4GMTL 1ZS8A 2H3XC 2WXJA 3MJ9L 3PV6B 2PO6B 5A40E 1BV8A 2OL3H 1J1OL 2ENPA 4Z7NB 4NHCL 4Z7UB 4GBXC 4ATTA 4FXKA 1CFVH 2K8MA 4Q52A 4P5KB 3I9PA 3GS4A 3INOA 4PRPB 5F44A 4UQAA 3MMEA 3OXRA 4W6XB 4FA6A 4TSAL 2BZDA 1U6AH 4KPHH 4MMXA 2AEWA 4W9FC 5LXGL 1DHKA 3HIZA 2OK0H 5EOCL 2R0ZH 5IVOA 1OP9A 1VZIA 1LD9B 5AW7B 2YA1A 5FO9B 5E0FA 1E42A 3GZOA 2CJ3A 4MCYB 4PBWD 4PBXA 3NJGA 3GJFA 4YDJB 4HKJB 4YPGA 3NP3A 2J1XA 4HGWA 4OF7A 3P73B 5KVDE 3BX7C 2FJFB 3RX7A 3IGAB 3OPZH 2DKSA 3Q2CA 1VKXA 2YIHA 3U30B 5I17B 5KVGL 3DV4A 2NDFA 4PWGA 1ORSA 4MQXD 3JYCA 1IBGH 2CBOA 1AVAA 4YOKA 3UYPA 2X70A 4P3DA 2NY5L 1CFTB 4KDTA 5I8KL 5TJWK 4BWUA 4JUTA 1NA8A 4ZS6C 1HT6A 1KJ3H 2G60H 1P4IL 3FQNA 2VTFA 1I8UA 5D1QE 3FHAA 5A2FA 5I1GL 4TLUA 1JK9B 1Y7VA 3FQTB 4P2CG 3L4VA 4R90L 5KZCD 3BLPX 4Q2ZA 3WNMA 1NCCL 2AJXL 3T77B 5E2UL 1I9JL 1QQDB 1Q1JH 3GS7A 1CFNA 2HN7B 3VWKB 2VE6A 2MNJB 1JGEA 2YN3A 2ESVB 4ORGA 1KTDA 4XMVA 5KYXA 4HF5H 4IW4C 4PGCA 3NIDF 4OB5L 2OBGA 1XF3B 4GW4A 3T4YB 2JK5B 3L54A 3CVIL 4HIHB 4FZEH 2F18A 1IC7L 5GGRY 3QUYA 1QSEA 4MXWH 5AVTB 1MN4A 3S2AA 3SBPA 1T03H 1D7CA 4IOFC 4DZ8A 4MD4B 2FECL 3QS3A 5JIHA 3PHQA 1W8NA 3DMMD 5ICXA 4I2XA 3EOBA 4Y1AB 2FATL 4PJ7F 5IF0B 1IRAY 2BHYA 4OM1L 3RZCB 1CLYH 4OR1A 4PJHB 1FHNA 2UZYB 4LP4A 1M2VB 3MR9B 4NDMA 4C54A 2CDGB 5F3BB 3TCTA 2XN9A 2WBJB 5C0FB 1IGTB 3PWJB 4MA1C 4MB3A 1U8KB 3ROLA 4PJIE 5FXCH 2ED6A 5IK3B 1Z3GH 5GRVK 2YLKA 2X4TB 1SMOA 1RLBA 1ZHKB 2AEOA 4PP2A 3IKCB 3CHPA 4HUCA 3RAJH 4A1RA 3P4MB 4DFHA 3ZUCA 1RUKH 4M5SA 4A67A 1JGIA 1MNUL 2XFGB 1R33A 1E8YA 2YZ8A 3S35H 2ODIA 3KLDA 3RDTD 5FK9B 1PNDA 1EFXD 1IEAB 1X9UA 5JQIB 2EXWD 2X0UA 3G3LA 3BT0A 3P77A 1A3LL 3L8QA 2PNDA 2BRRH 5IMLA 1LEGB 1UOKA 1ES0B 5D2NC 1WS8A 5GQBA 4FQXA 3VXRA 1G0XA 3KCPB 1MJJA 3KLLA 2WZ6A 4RLDA 4AC2A 4LSQH 1EANA 4QOKE 2YRLA 2Z7ZA 1F4HA 1KB9K 2JE8A 2YR3A 3CC5B 4GO6B 4MQ7B 5EZOL 3K72B 3WY1A 4XCFH 1BVKB 1Q9KA 1QI3A 1HCFX 1ULVA 3QEUA 4AZUA 2X42A 2V9RA 1KBBA 5F1IB 1PS3A 4D8PA 3TONA 1A4KB 2OMUB 5D1XE 3MBEB 1EEQA 1QSFD 1VFOA 3SE8H 2YUWA 3MV7E 2XWDA 1UJ3C 4ALAL 1OAQL 1H6EA 3PL6B 4ZAKD 4M1DH 1NFDA 3DX8B 2WQUA 2XIBA 3CLFL 5EZLA 1UHVA 3I6SA 3QUXC 3V6OC 3RFRA 1FRGH 3D3VE 1QFUL 4Y5YC 5GZND 5IHLB 1UYWL 4PIRF 5GS0C 4MD5B 5I15H 1MVYA 2QPDB 1Q72H 4K3JH 3Q6FB 4JPWL 3OPUA 5F7EL 1B9ZA 4Y0GA 1EXUA 1MAJA 1FCGA 4CVUA 3NJMA 4M62L 5DJ8A 3FFCA 6PCYA 3UP1A 3OZKA 5EIQA 4M5ZL 1HXYA 1XMEB 1ADQH 4UM9D 4CDHA 2VDMH 5TFSL 4QHLA 1U3HB 1HHIA 4NKIH 4WJKB 3QR2A 4JDVB 1SOQA 2VR6A 2EICA 3SE9H 3HC4H 2AJVL 2D4DA 2Y6TE 1PD6A 2R2CA 2HG5B 2OZ4L 1QATA 5C0CE 4GG8B 3RWCB 3PQYD 1J88A 3QARA 4YSSA 1WF5A 4YSQA 2MFNA 2W9DL 2Y2WA 1KGXA 2DEWX 5JORB 2BVUA 3ARFC 5B39B 3CNKA 1KTRL 1WCQA 5JZ7D 3RFZB 4RZCB 4OLVH 4I0KA 3RWEA 3DROA 3HG2A 1NC4D 1Q0YL 1LDPL 3HG4A 1PL3A 2VITB 4M6MH 2NT0A 2ATKB 3O8XC 4LSTH 4GG6E 1AXSA 1EBAA 2XKNB 4DQAA 4QRPE 2AEIT 2ZCKH 3II3A 2FEDD 5LWYH 5IQ7H 1NLBH 1FFOA 1KXTB 5CU9A 3W56A 4Z7QE 1H0DB 5T1KA 2FD6H 1RJYB 5DLMH 1O7DC 2KQNA 4CBPA 4KI5F 2FDBP 3L6FB 2AGJL 4H8PA 5C07D 1T5WA 2V2WB 3VGBA 1QX1A 4H0IA 2B59A 3QG7H 5AWNH 2HPTA 3ZQWA 4APXA 1BX2A 1BOGB 4YIQB 4AJWA 2ZSVB 1N6QL 1AE6L 5K69A 1UM6L 3QK0A 4NQDD 3QIBA 4ZQTA 4WNQB 1ET7A 3KJ4C 1JRHH 2P8LA 5A7BA 1NLDH 2OJZH 1UADC 2HLEB 4EOWL 5C0GB 3I9GH 2YD3A 3HEIB 4Z7OE 1HEHC 1DQIA 3V55A 1DN0B 3R1GH 1GMIA 1YVLA 2ZIDA 4QDGA 2NY3D 4U6VH 2ARJB 5DFVD 1DDTA 1YEGH 5HJBA 4PRHB 2IFFL 5IJBC 3CDGA 3SO5A 4DGVL 1U92B 2F74A 4KFMA 1EVUA 3HJ0A 1ZWIA 1FL6A 1IGIH 3NJJA 4PG9A 4FQLL 4ODXA 3K8KA 1DBBH 3MJ7B 3QUZD 3MBXL 3DGGB 8FABA 3EFFB 5EULV 3WXVH 2YK1H 5IBTL 3QGVA 3F7KA 4Y19A 1DUYB 4QMEA 2IAMA 1RQ5A 1DZBA 5GGVY 1A3RH 3QO0A 1CBVH 4HAKA 5DJCA 4KJWD 1JE6A 1N3NA 3GXUB 2JMRA 4BUGA 5CXPA 2EYTB 2F8OA 4FS0A 2ZOUA 1V54B 3ILQD 5J12C 5DJXA 3MREA 2VR5A 4YHPA 2G3XA 4ZNCD 3T5WA 4BJLA 1B90A 4MKTA 2FJHB 4PJ9A 3H2WA 1RUPL 1GTFA 5F2FA 4NIKB 3EJTA 5LO7A 2R0KL 3RB7A 5KVDH 3FTZA 1SUHA 4E9RA 2RAMA 1BREA 4LBEB 4L4JA 4A37A 2P52A 4GRWB 4Y4FC 3ARBB 2H9GB 2Z92A 5FWQA 3RX5A 3GXDA 2A4CA 2WQVA 1OHQA 1RIVH 1Y18B 4LOVA 1BYPA 2X05A 3M6DA 4OCMC 2BWIA 3MGTA 5JHDB 4WFED 5CILL 3L7EB 4L5FE 1E4XH 5FEBA 5F70A 4PPTA 2G9KA 5IV2A 3T0EC 3FTGB 4TVPL 3T0WA 1MCFA 4X9IA 4HC1L 4WUUA 5I1DB 1UWEH 4V1DD 3K7UA 1T7YA 4GRLB 4N8VB 5IVXF 4RZKA 3QRGL 2Q8BH 1J8KA 5KSVB 3VJ6B 1U91A 3RBGA 3QJVB 3NCYS 2M83A 3ULUD 1DFXA 4HMCA 1WFNA 2K1MA 1JZ5A 1OGAA 2AEPH 3CBRA 1MWAH 2N59A 4I3SL 4L1SA 4Y8AA 5I18H 1D6VH 2FHBA 4L05A 2B0SH 1Q0XH 4XVTL 4L4TB 3SJVA 3I85A 4FNPA 1HHGA 1FG2B 4ENZA 4GXUM 4L8CB 1YAIA 4U3XA 5DGQA 3RPBA 3RTQD 1F3RB 3V79C 1HL4A 4MQXC 1NBZA 3CH1B 3KJ6H 5ESQB 5JOPE 4J1UB 1ETA1 4P46A 3UPAA 4N0YH 3CX5K 4NUJA 3CFDA 4X6CA 5E0QA 2DJSA 4R7LA 1A02N 2UZPA 2BP0B 2H2PC 5SWSB 5AAWA 3MBWA 1E9PB 1D5MB 1Q94A 2Y2TA 1JDCA 2V9UA 1MQ8A 1ZJBA 1T20A 3O6KL 3QUMA 4I3RH 1N2RA 5DJ0A 1KCVL 1KJMA 3VU1A 4R7VA 3QIWB 3INUL 5KN5B 1T22B 1R17A 3PP3H 4HIQA 4OCRL 5LQBH 1PFOA 3M8OH 2R2BA 4LPUA 1A47A 3V4VA 1C08A 1F4WH 1L6ZA 5FUZH 4BA0A 3WNJA 2E74C 1TJHL 4JG9A 3NPZB 2BW5A 4KVNH 3DMMC 2UWEB 1AGBA 5FOBA 4HJIA 2EH7H 1JHLH 3D48R 1IQWL 2E8ZA 4ZMYA 5D71H 2YN5A 1NGWA 3TH2T 3IFOB 3NA9H 3FOLA 4JQXA 5IJVA 4M4RA 3V10A 4F57H 3WNNA 1A2YA 2WWKT 4PJ8B 3V5HB 1CICA 2A9DA 4AW7A 5DQDL 3BCFA 5GIRA 5I5MA 2F7IA 4K71C 4OLYH 3AAZB 5ENWB 1MPAL 4XOEA 5KYYB 3BYTA 5AFAA 4NAQA 1DVSA 3PJSA 2E9GA 3H9SA 3QR1A 3G04B 1CFQB 4KNQA 4WK4B 4M6NL 4X0KA 3BP4B 5J6GA 5L2KA 3EJYD 3C60A 1K8DA 4I88A 3CN0A 4LCYA 1KBGL 1UCBH 1JZDC 3RDTC 2DQDL 5A6MA 1FE8H 2EXWC 3WSQH 3ZO9A 1SHMA 1W0WA 2EDJA 1U36A 2IQAA 4LNRA 3QCTH 4MDJA 4UZUA 3T4AC 2R0LH 3FQ1A 5IMMB 2E6PA 1NAKL 5D2NB 1VERA 4NNXA 2IALB 4LP8A 3GMNB 4FCAA 2DAVA 2C1OA 4RGNE 1XMWA 2ZNXA 2VZOA 1L0QA 3M1CA 4FQ1H 5B21A 1VLXA 1IEBA 4OLUL 5DD1L 2D8KA 1YLBB 4RH4A 2Y7MA 1BPVA 3F7VA 4LESA 4UOZA 1EAJA 4BV1A 4PW9A 5FFOA 4XXCA 4ZAKC 1JZEA 4QRQB 4F7MA 3TT3L 2CDEA 5HHOE 3LS5L 1UJ3B 3B7TA 3SKMB 1A3QA 5DVPA 2NX5D 3EYOB 1NDGB 2Y24A 2MNUA 3NCWA 2DEXX 1M71B 4ZQKA 3GLEA 1DANU 3FQRB 3WLWD 3DX7B 4PSPA 1NC2D 3MRHA 3BDYL 1KTLB 1T0PB 4Y5YB 2K9UA 3H0TB 3E9UA 3MI6A 4NLAA 2AEQH 4APQA 5HYQB 4QTFA 2WW8A 4HH9A 2GIMA 4GMSH 2G5BB 5CZVL 4IS6B 2HKAA 4F5CA 1EJ6A 3KEHA 4YHML 1TTAA 1EIBA 1YUHB 2WWMD 4GSDL 4M6OH 5ABDE 3K0WA 5A2JH 3ECBB 1CE6B 3AWGA 3EJSA 5BQ7A 4KQ0A 1KT2A 2Q6WA 1FL5B 1MEXL 2ZF9A 4LKXA 3PDDA 3U7YH 4YHYC 3NMEA 4UOW1 2A9MH 1ZAGA 1ZV2A 2AK4B 2Y5QA 3EDEA 4FYRA 3T8MA 1AOHA 1C5CH 2VUOA 4G11A 1UXWA 4M3HA 4OCYL 5D7LD 2XWXA 4EN2A 2ZQKA 1S9WA 3OSVA 4I48A 2WXIA 5EB9A 2B15A 5DJ6B 1U8IA 3W2DL 4LT7A 3QDAA 2EDEA 2CE6A 4G42B 5JZ7C 4OI8A 4QXGH 4YGAB 3O3BB 2LAAA 2APBA 4EI5A 3ARFB 2PCFB 3BEWA 4GSRA 5D5ME 1A1OA 5IFHL 1XD0A 3BE1H 3ZKXC 1LJMA 3LKQA 3NFNB 4S10A 3W9DB 5EUKB 3DC0A 1EZUA 2FEDC 3FO2A 3X1GA 2PCPB 2LQRA 4OFQA 2DMBA 1RJLA 5B1JA 3Q3GA 3P9MA 1V3JA 1JDAA 3O11B 2OMWA 1S3KL 1RP8A 2YKLH 5DZJA 3LQZA 5F21B 5FYLD 4BK5A 4FZ8L 3KW7A 4JLRB 2Y5TA 2F53D 3WGVB 3M17B 1G7HA 4WI2A 1P1ZA 1ZT4A 3APDA 3MYZA 1WVZA 5FYJU 5H4ZA 5IB5A 4KDWA 3QHFH 1EA9C 2ENSA 4UTBH 2DZEA 2OL3B 1OL0A 4B9GA 1QMUA 4JDTH 2GC7C 5MENE 4OJFL 2BMKB 2VDLL 3UXFA 3FQ2A 3GB7B 3OAUH 4D3CH 4XPFH 1PG7W 2NY3C 2G9HA 1G6RL 2H0JA 2V7HB 4IIQA 2GTZA 3S3BB 2V2TA 3LIZL 1GJIA 1SJEB 5GZOA 1SXZA 1IGFH 1HKLL 2WLNA 1KJ2L 4HBCL 2IPUK 2IBZY 4JN1L 4NPKA 2QQQA 3TO4A 1XSJA 3KPLA 4J3WA 1PG7L 3QUZC 2YAFA 3SDXB 5IROA 2P80A 4ERSL 4FG6D 3K6IA 5CSBA 4JRYA 3VXTA 3OKDB 3UG3A 2LTQC 4KJWC 5GRJL 5I1LB 4PGJA 3ILQC 2ITDA 4TQPA 2VLLA 3TF7C 1ZOXA 1KLFA 3MGAA 1TCMA 4TRPL 3L4ZA 2EE0A 5J89A 5J12B 4I0CC 3O3DB 4HZ1A 1QEWB 3LQMA 4JY5H 2QFPA 5ETUA 4IOIA 4AGNA 2VQ1B 2Z4TA 3DHJA 1MZZA 2A0LD 3FB8A 4R0LC 3M1BB 4U7SA 4KUZH 1TETL 4GKNA 2A9CA 3OKMB 3CLEL 2ARJQ 1XIWC 4NHUB 5DRNB 5LGYA 3MLWH 5BVJB 2X6AA 5DK2A 1T0NA 2YSSB 4HK3J 1B88A 4HDIB 4Y4FB 1Q9LB 4IKNA 5B4MD 3ULVL 3T6ZA 3DECA 2CUHA 3ZKND 2ADGB 2OSWA 4G9FD 3AM8A 3NCJH 3O2WL 9PCYA 1WBZB 4YK4B 4ZW3A 3FUMA 3GSQB 1ED3B 4OZHF 4OM0H 3B9EA 2ZX9A 1JV2A 1VEPA 4HGMA 3T0EB 3D4ZA 2KMWA 2YZ1A 1T1YA 4OFKA 1TR7A 4JQIH 6TAAA 2K3HA 4LLWB 5EN2B 1JS4A 2H1LM 1MQKL 1RUAH 3BO8B 3G08B 5HDBF 4DKEH 2DWXA 3HG5A 4P5TD 4PGEB 1YC7A 3ULUC 4NT6A 4I18B 1EWHA 4OT1L 2Z8SA 3D39B 3U6RB 3BKMH 1YECH 2QQKH 1CD9B 2OTWA 2XZQH 3D0LA 1WISA 3MLVL 2OYLA 3RWGB 3P0GB 5EF3A 4MA7L 5BUPA 4NQEB 5ANME 2BS8A 4ZZKA 1I3RB 1SEQH 2GY7B 5DEZA 2OSLB 1D2PA 4ZNEE 3LRKA 4ZD3L 4O02H 1DVUA 3K71A 1Z7JA 3HPLB 4IRJA 4NFCA 3LNGA 3UTSE 2E7MA 3K5RA 5AW4B 5ADPH 1FGNL 2GSGB 5H2BA 2XTSA 4RA3A 2J8OA 1B9KA 4MNHB 5F1NB 1T2XA 3VI4E 1DLFL 1BFVH 4KOBA 2QL1A 3NJKA 5LDSA 3L16A 3HVDA 4BFIA 5E08H 1J5HA 2NMSA 2VDOL 4HJTA 1MHEB 4AJYV 2R1XB 2E46A 3REVB 4JM4H 4LCWA 1KLUB 3D69B 3TO2A 1EEYB 2QPUA 4W9GC 4RAUA 4LSVH 1K85A 4XMTA 4RVBA 4U7KA 2V37A 2CU9A 4OCLC 3QE5A 5I8OH 2JFCA 2IH1B 3V5DB 4A6YL 1NCAL 1SDDB 4XI5D 5CEXB 2PPCA 3C6SA 3KBFA 1VEOA 4YDVA 2FYYA 1W6WA 1QUNB 1OW0A 3BSGA 4AG4H 4UDTB 4MAUH 2HMIC 3VRJA 1H3PH 1LO3L 1OTSD 4KKRA 4NO3A 4XC3L 3FB7A 2OYMA 2Y1AA 3FRPB 4P49A 1SJXA 4QO1B 5KSBE 4KV5F 2G5UA 3N41B 2W8CA 4RMRA 2LU3A 4ZBJA 3WN5C 3ZT6A 1FIGH 4HXBH 3CDCA 2X9ZA 3Q43A 4RFOL 4B7IA 4XMPH 2FEEI 3ZSSA 2GBTA 4KXBA 1KYUA 1Q8MA 1VA9A 3APNA 2DQUH 4OIAA 4Z95L 5I66B 3HC3H 3NQIA 4W4OC 1BYOA 3D4CA 3PNWA 3BSZL 1THCA 3GSUB 1TQUA 2OS7A 3IGUA 5EHFA 3WELA 2WYHA 3LS4H 3SBWA 2NY7L 3ESNA 2P5PA 3JV4A 4K71B 4B9ZA 3VGHA 2J1ZA 5DQJA 2QKSA 2VN5A 4JRLA 3U1PA 3OD3A 3RI5K 3AG2B 4QJ3B 1MW3A 3QDMD 5DZVA 2VDMB 3EJYC 2H47C 5F9JB 4DKDC 2XWJA 4D9LL 4HULB 4FXLA 4ODVL 1CDBA 3ZHFA 3KGRA 4M61A 4PCKA 4E41B 1JHTA 1ZGLB 1S5IH 1QRNE 3IJ7A 1GY2A 3OSKA 4R2GB 4X9HA 5JW3H 1TJIH 2W9EL 1FVCB 1J10A 1DANT 1VADA 5KTEL 3DI2B 3KL3A 4OZ4A 3LMJH 5FF6B 3LY6A 2FIKB 2CCWA 2WQSA 4UB0H 4NUQA 5GS1C 3T4AB 3ML9A 4FEMA 1XGQA 4HMDA 2FJGB 5I76A 1KCRL 1M7IA 3Q05A 2HJKB 2X10A 1I7ZB 2EAEA 4ORZC 3UDWC 5IBUG 1HNYA 2FX9H 3P40A 2NR6A 4OUOA 4AVHA 1XFPA 3PWPB 4JFYA 2WB7A 5C3LD 2DQHL 1EHLH 5AAPA 3EH3B 1WTGT 5BZDB 2NZ1A 3BZ5A 1KIPB 4WWNA 4PUBL 2WLZA 1HKFA 1YN7B 1AFVH 4U1IA 3UAFA 2Y1ZA 2VLKD 4PR5B 1FVEA 2IWKA 1KBKA 1A6WL 3PWLB 3IETB 4K3EH 5HHPB 4PJFB 1KFAL 1Z9PA 3NZHL 1AGFB 1LO5A 2YQBA 3BP6B 3JUYA 1A8ZA 5CHNA 1RJZA 5DTFA 4AYID 3OAYH 4DP4X 1SXSA 1WTLA 4NSKA 2EYRB 4U1SA 1YO4A 3CZLA 4EUPH 5I1DA 1QFOA 4F7EB 4OH2A 3POCA 2PKDA 1OE2A 3BD5A 3KYNB 2ZKXA 4WGVB 4G82A 1K4DA 1ZIAA 2EVHA 3QJRB 1PU0A 4EN3A 1L3WA 4PTTB 3WFBH 3QYNA 2CDFB 3W9EB 3CX2A 4XXWA 4B9CA 2WWKO 1AY1L 4FQIL 2K6YA 3VQ2C 1IAOB 3KPMA 4OY9A 1HEJC 3LV3A 2WVVB 4B53A 3HUJE 3FL7A 2DRUA 2RIKA 4XWGH 1JXDA 4Q9RH 2BNQA 4MZIA 4XMKH 3ARGA 2PW2A 1CCZA 3ATFA 4YSAA 5KEZA 4OZIF 3D2TA 3ULAB 5FCSH 4PG2C 4B41A 1SUJA 2C9PA 3BHBB 4P99A 5ITBL 4AQZA 1ZIBA 2YGOA 5DHYA 1BQLH 1BVLB 1C1EH 1VJSA 1CC3A 2FO8A 3CFJA 1F4XL 5AW6B 1OPOA 1OSPL 1GGUA 4XOCA 5CLTA 3WTYA 3IMTA 3MCG1 4BEIA 4ZMZA 1N5YL 3EDFA 4LOUD 4ZO8A 5FW6A 5SX5K 1LE5A 1GZHA 1WDAA 2Q86A 1KEML 2VDPH 4PRID 1IGCH 5F7BA 3ZE1F 3I74A 5CWSB 4O2CA 3ZKXB 3BT2L 2E7HA 3ZHNA 3UL4A 4HS3A 5KVFL 3IBEA 1WITA 4EIUA 5L4IA 1LXMA 4FJYA 2IGFL 3MRQA 4OF6A 4XRCA 4H8UA 3HW7A 1SOXA 2H0PA 3RWIB 5JNYB 1EHXA 1P7QD 1AS7A 3A0OA 3WUWB 1SMAA 1JD7A 1SMDA 4L3AA 5EPMA 4KQ4H 5C07B 5HGAB 1XGYH 2E75C 5EBWA 2W38A 1BFOB 3L45A 3CD4A 2FUTA 5FUCE 1DO6A 4IJTA 3S88L 4Z3GA 4B97A 1EV2E 3CFKA 1B2WH 3C9NA 3RPIA 3GZQA 3L3OA 4G80B 4XPHH 5D1QB 3ZTDC 1BIIA 3DARA 2NXZD 3KYAA 3ZIMA 2XNAA 2NNAB 5JPMA 5KS9F 1QNZL 3CSPA 4XCCL 2M1KA 2I5YH 1J0YA 1WPCA 1HL5A 4GAGH 4F8TA 4OCXL 1G7PB 4MCNA 3DXAA 3SYQA 1FWXA 2Z8WC 1F3JB 4ZUUB 4IU3B 4DGIL 2XA3A 3CXDH 3II1A 4K5OA 2P5WA 2NUTA 4YSRA 5GSRA 3K2UH 3S6CA 1XBRA 3ISWA 3BVVA 4XMUA 4WZ9A 3DO3A 2IIJA 1MWAB 1NWOA 3MNVB 4FG6C 4ILDA 2KPNA 2H4EA 1YN6B 4X7DC 2IOMA 1PLBA 2B4CL 3D07A 1TZHA 2R2HA 3DX9B 4YSUA 2NYYD 1U8MA 4XH2A 3S2CA 4BKLB 5CKAA 5C0BA 4JDZA 1PZSA 3Q7JA 1L3NA 5HHXL 2VDNH 4C83A 2LTQB 1LK3L 4NWTH 2XLLA 3E3QC 1U9KA 2Q87A 3O9WD 2I9TB 1YEDB 1XF2A 5AW3B 3FTYA 1FZKB 2OQJB 2IXQB 5K39B 3WO4B 4AGLA 2XY2A 2FWSA 4PJIB 2WLYA 2WXKA 1AHWC 3ARDA 3QCUH 3FOMA 3MUUA 1GS6X 5KJ7E 3A6BL 4F7CB 2UYLB 2QKIA 4KQ3H 1R0AH 4AGOA 2PP8A 3PGFL 3FCTB 3KH4A 4YDMA 4WI4A 3LNHA 3BKJH 5I6MA 5BRZE 1PY9A 4AQOA 5B4MC 4CC4C 1E6JH 1XIWB 2YOCA 3ZKNC 1FZOA 1ONQA 2GK2A 5DHVH 2A6DA 2AXJA 2EEDA 3FCBA 2BWDA 1EX0A 2BX5A 3VA2C 1CR9L 1CPUA 1UATA 1UXMA 2XZZA 3O2VL 4PS4H 2PMZA 3ABGA 4J6RH 2AKRA 5D7IE 4M8UA 5C71A 2G4GA 1DLHA 5T5NF 1PYWA 4U3CA 2VC2L 3BKCL 2X40A 4QOKB 4MAYA 4AI7A 3QUYD 1QSED 4GUCA 1DL7L 2LW3A 2CJUH 1JN6B 1WAPA 5I6XC 2VO8A 4JPVL 4ZT1A 3ZE0F 4X80H 4JFDA 1FVDA 2QQNH 4WJ5A 1WFOA 4OF8A 7CGTA 1M7UA 3H3BC 1DQLH 1VIWA 3VD0A 4K8RD 4M43H 3EW3B 4Z0BL 3QXDB 5DEFB 5D1XB 1N68A 3J8F7 1BBDH 1RVFH 1ZE3H 3D2UA 4P8QA 3GSWB 4X42A 5B3JF 1ZLVH 4LO9A 4XMWA 5EH1A 5KJ4A 1SDYA 2FX8L 2MWCA 3CFTA 3NIGE 2ATPA 2DDQH 3ABKB 3JZ7A 3NH7L 3VDBA 2APTA 5E6ZA 4P23A 1Z3GL 3PWUA 4NRZA 1CGYA 3QZMA 4G59C 4P2OB 5DEJA 1OCOB 1XZ0B 3F04A 3NVQA 5FUOL 4ZTOL 1BDYA 4HKBA 2PF6A 5CZXC 5C2BH 5EUOE 3WDJA 3PHSA 5IVXA 4OKVA 4RMUA 3ILEA 1FBIH 3HI6H 3NIFE 4AK2A 1RZIA 4LHQB 4L3EE 3AQYA 5GGRA 3JTSB 1NMBH 2QVFB 4ETYA 1JMZA 1AIFB 3WI9A 5DMKB 2K6WA 3S4SB 2BRRL 2VZ1A 4ODTL 1QKZH 4FQXD 3VXRD 3B9VA 3Q5YA 2MOVA 4R4BB 4RAVB 3K6SB 1TO5A 1IV8A 4C8XA 3ECVA 3JVGC 4V2CB 2GJJA 5LCVH 3SD5A 3AVEA 3Q8EA 1YDPA 2EUZA 1P6WA 5C0CB 1JZHA 1NCBL 2BP5M 4YNYA 4PTUB 1JUFB 5AYTA 1ZS2A 3MJ8A 2G2PA 5GGUA 1OTSC 2ENYA 3EXLA 4YHIB 2A83B 1DJYA 2OSXA 1UENA 4X8XA 2G3MA 2ZXDA 4Q6YA 5EZIL 4RQQA 3PF2A 4JO1L 4KUCF 1RHFA 4NZFA 5TH2B 1M9WA 2N01B 3AREA 2XPGA 2CIKB 4POZD 4RGMC 1IMHC 3MV8A 3DIDA 4WO4B 3MRMA 5DJ2B 4GG6B 3UBGA 4QRPB 5D7JA 5FPIA 4K8RH 1LP9A 2VN3A 2NCEA 1HI6A 2Y7OA 1IQDB 3WKPA 4Z7QB 1Q72L 4G7VL 2Z91B 3SQOL 5CUSH 1TJGH 1VB9A 1J86A 3QPXL 5L8JB 5EEZA 1A22B 2EVGA 2WM0A 1S7WA 3CPLA 5HGDB 4HOZA 2LU5A 3GO1L 4UYQA 4Y9BA 3LAFA 4J3OD 4IK6A 2XTJD 3JWDC 3OLDA 5F7AA 5HJGA 5BQDA 1KG0B 3A6OA 3MJGX 3H9HB 1D5BB 1CXIA 2OW7A 5F93C 4YE4H 3WENA 1DBKH 5HHVL 2K45A 3MQIA 5E6IB 1G6VK 4AIZA 4BZYA 1FV1B 2VZVA 1H3VA 2J5LC 2OXHA 3REWB 4ZFGH 1JL8A 1NGZB 4DZBA 3BRDA 5D7SH 3T2NL 4Z7OB 3QNXB 5E8PA 1L0YA 3F05A 3SCMB 3VFGL 1BZ8A 2A73A 3IFNL 2ZWKA 4CU6A 4R7NB 4Y2OA 3F84A 4JW3A 4OTXH 5GSVA 5JIQA 1P7KA 2HLAB 4FFYA 4N2KA 3VU2A 5I6PA 5L88L 2VXQH 4N5ED 3MUHL 2AF2A 4XNYH 2XX1A 3ZRSA 3RWJB 1VACA 3ZVVA 4PV9A 1QLFA 3N85L 5CZRA 3FT2B 3TNMB 2V5YA 5T1KD 4X7EC 3WKMH 1EZVX 1GGTA 1R5IA 3GMPB 4N5UA 4PP1D 3GNMH 1NANI 4AGMA 4DP9X 2K6ZA 1IM3A 1SYVA 1XCQA 4MJIA 1IL1B 4GSQA 3BLBA 3ALWA 4GI8A 2K4AA 2QSCL 2OTUA 4G5ZH 3HC0A 5JTWA 3S36L 3G9AB 4N3UA 4DVRL 2EDHA 1F90L 1ND0A 3IBOA 2RMNA 3QDJA 2Y6SD 2IPTL 3QIBD 1WBXA 2DLIA 2VLMD 3LEVL 1A7OL 2FQGA 3OJVC 3G5XB 4WSJA 4P2QE 4PI0A 1KENH 2Y7SA 1AGEA 3D9AL 2J56A 3NRQA 1KXQE 4BINA 4CMMA 1G87A 3QDHA 4U6VL 3FO0H 3V9FA 5FO2A 1FQ9C 1YEGL 3CZEA 4N2AA 5FA3B 4C56A 4GNKB 5GGSB 2WN3A 4J8RB 2XTLA 4PJBE 5D7KE 4W9CC 3TFKD 4BQ8A 3IU3A 3K3QA 1DFBL 1ZV5A 2IFGA 1UGNA 4LAQL 3TZVA 3OKKB 4Y19D 2IAMD 1D5IH 3ZHKA 1GYVA 4LFHD 1U33A 1O6SA 1TZOA 3NDYE 4U1MA 5EDXA 4LOUC 25C8L 43C9B 2NY1B 3MA9L 4PJCB 1E7UA 2CNZA 1ZLWH 4PS8A 2C3XA 4HJ1A 2BOCB 4NXKA 4K5NA 1RLWA 1TENA 3MZGB 4LCIH 4P9HH 4PJ9D 4Z76B 1U8HB 3H8NA 4GAFB 1S9VB 4QUOA 3IJHA 1HC1A 4JVWA 3CN4A 4XNDA 1IIIA 1N6UA 3TF4A 3CUPB 3FO9A 3VXNA 4WTZG 1MW0A 4WTZA 2Q7YA 1E4KA 3AG4B 4L2YA 1FFNB 4LPTA 4Y4HC 5F6HJ 4W1TA 2X4QB 3SE6A 2QQLH 4NJAL 1MIML 5KBKA 2NXZC 3B2UD 4X6EA 3WIHH 3VDCA 5ALCH 5E9DA 3L3IB 1M53A 2O6CA 1U8QA 5E94B 5C0DB 1JNHA 4DTGL 5GRVL 1X5ZA 4AENA 2HJLA 3CHRA 4GP5B 3FB5B 3ZSTA 1F1DA 4L8BA 1OAYH 1IB5A 3WE1A 2W0LA 1E0OB 5LBGA 1H8NA 2Q8BL 2MJWA 3GI9L 3G5YB 4UQIM 1XGZA 4CNIA 4KBPA 3SDAA 1JF5A 3PREA 5C8JA 4F2MA 5CINL 2EEAA 5C1MB 3IRCA 4E9QA 2D7MA 2EDNA 4Z3EA 3P4NA 1J5OL 4G7YH 5CD5D 3BI9X 3KXFA 1B4RA 3LIUA 3H6AA 4HZAA 4I0PA 3SJVD 2XVGA 4O02B 5I19L 4GJTB 3HE7C 1MFNA 3BAEL 3O9WC 4JFFE 1S7VB 2L7JA 2O61B 4QXUH 3BN9D 2DBLH 4TUOA 3SD2A 1S7QA 1SLXA 1PZCA 4FTDA 4H2AA 5IR1A 2A2QT 4HD9A 4TXVB 4XX1E 1IBZA 3WGUB 2Y07L 1AC0A 2GJ6A 4KDTC 4LHUG 4LHUA 4P46D 4YSTA 5AKTA 4NQCA 3BIBX 3KPSA 4IDJH 1HZHH 1A6AB 1HAWA 1OT1A 3O3UN 4N85A 2K8QA 4G8GD 4J2XA 1R19A 4YJZL 4I87A 4Y9EA 5MEPB 3GGWB 5LAXB 4BZ2L 1TZIA 1HX0A 2JCCA 3AXLB 3OHXB 2NQCA 1N59B 2D2CC 2ZP0T 3HNSH 2FBJL 3B2DC 4K94L 3L1OL 4BUQA 3QWOB 1NGYB 1BG1A 3GRBA 1NM4A 3V4PA 2I85A 4J3XA 2VLJD 2OJ1A 4KC3B 5HJDA 2HX9A 3QUYC 4JO3H 3MNZA 3VVWA 4L4VD 2JELH 4GAYA 4RGNB 5INCA 4QRTA 4D0BA 3Q8CA 2IBGA 1Q9WA 2FBOJ 4K8RC 3U0TA 3GSVA 5C0EB 12E8H 2EH7L 1AP2B 4KXCA 3IJ9A 1BEYL 2R4SL 4HUUB 1UA7A 1FI8C 4N9GA 1LWJA 4OUUB 1NQBA 2GHZA 3P3UA 3LH2H 4F57L 4PGBA 4X6FB 3BXNA 3F7YB 2YA2A 5PAZA 1U3YA 5HHOB 1FNSL 2LR4A 4M5YH 1X7TA 3QZLA 4Z8FL 5F8QC 4F3FB 1FDLL 3QZBA 1GPOL 4NRYB 5AUMB 3TASA 4NWUH 2CBPA 3LQAH 3VH8B 1JCVA 3B7RL 4KNUA 1HL8A 5FIEA 4PAZA 2HFFA 3IEAA 1IILE 2DQMA 4Z18A 2AFNA 2EABA 3C60D 5F0PB 1J7VR 3IDXL 3WJMA 4YGVA 5DJYA 5E4OA 4CL7A 4FLSA 1KGCE 4MD0A 3GM8A 3BWAB 3PY9A 1P1VA 5E6YA 4A7GF 1S9KC 3N04A 3VFNB 4MZ3A 2X6CA 3MLYL 2A74B 3RL1A 3LN4A 3DUSB 3QEQE 1NBVL 4H4NA 1ZY9A 4PQXA 5CMAB 2EH8H 2XQYK 2P7TB 4R6UA 3WS6C 1XR8B 2HCZX 2J43A 4FULA 3X11A 2QSQA 2AHIA 5DRWB 4NI3A 4D2NA 5ACLA 2QT6A 3WY4A 5DS1A 1OAKL 2XVLA 4XC1H 3ZDYE 4IBSA 4QF1B 3VG9C 1KLGA 3FH8A 3HNTH 1IC5H 4CRPA 5JXAL 1LYQA 2R4RH 4AH2A 2VR9A 1UD4A 3VB9A 1CFSA 3DRQA 4L23A 4N2EA 1J0JA 3PS6A 4L3CA 5D5MB 4QRSB 4PJAE 3SGKA 4MWFB 4POZC 1SEBB 3SPHA 4TTDC 3LKNB 5F7HA 1G9HA 1MFDH 4ISVB 1ZPLA 1G7LA 3KNBA 3S98A 2ZXBA 1UACL 5F3HB 4RGMB 4ZSOE 3QULB 1A6ZA 2UZXB 4YH6A 1NCWH 5TF0A 4EUPB 4NO5B 1CG9B 3U4EA 3VRIA 1Q1PA 4BRVA 4MTMA 5TE4L 3TN0B 1OSZA 5AZ2L 2DI9A 3VD3A 4M6AA 2IOOA 4AQ1A 4UIKL 3DX6B 1XR9A 4EDWH 4J3OC 3KPQA 1DJSA 3NEEA 3OGOE 3PV6A 2PO6A 2UZIH 1OTTD 4JVPA 2GAZB 5HVFB 2HG0A 4XB7A 2X88A 4P5RA 2WHVA 4B5ZA 4P5KA 1BQUA 1RK1B 2A9ML 4UT6A 4PRPA 5MENB 1M42A 5J3HC 4W68A 1C5DB 1ZT7B 3V5KA 5DJAB 5HI3C 2VXUH 2J5LB 3J7HA 1IGYB 1RUQH 5E2TL 5BMFL 1S46A 1IKNA 1GMEA 3A67H 2E9WA 1MRDH 2B8OT 3O4OC 2FNWA 3A24A 3IDIB 5D7EA 1CGTA 3VFPB 5JHLA 1OGTB 1XXFC 4EI5D 1LD9A 5I1HL 5B7EA 1KTJA 1V55B 3AB0C 4Q0XL 1OAUL 5FO9A 3S96B 4N5EC 4A2EA 4MCYA 4P9HC 2VDPB 3MX0B 1NBYB 2JQMA 3BE1L 4XCNB 3L3KB 3PP4L 3NAAL 3FQ4A 3GBML 3ZIYA 4E9TA 3D0AA 1PLAA 2VSKB 3P73A 4S0TD 2FJFA 3IGAA 5ISZE 5GPRA 4N8PA 3MCLL 3HZKB 4ZX6A 5I17A 2VLKB 5T3XE 1FF5A 5MP6H 4D7BA 4PP1C 4W4NA 3MNWA 5CEZL 2A9AA 1CU4H 4WV1C 5AOLA 5JW4R 3QZPA 1CFTA 2X38A 3OG6B 1WZAA 1BAWA 2AABH 2BINA 2WCGA 2WJ7A 4XPAH 4AY0A 4R7XA 3AU0A 1JK9A 3C08H 5ICYB 3FQTA 1HINH 4K2UH 4DESA 2NXYD 1I9IL 2MMXA 3N41F 3T77A 2EDTA 4Z7VE 2VJ8A 2HKFL 2HYMA 1QQDA 5IFAH 3QIBC 4MMZA 4UNUA 5CAYB 4OZGE 1PFCA 2HN7A 3VWKA 4KTEH 1G1OA 4U6HB 4X7SH 5E2VL 2AQNA 2ESVA 4YFDB 4HWUA 2AJSL 4M93C 3ZL1A 1WWBX 4RGOL 2BFGA 1ODUA 4M48L 3CVHL 3Q2WA 1XF3A 3T4YA 4PW3A 4MJ6B 3HMWL 1B6DA 1GIGL 4HIHA 2EECA 2HWZL 2AQ1A 4WHYG 1WFIA 1ZLDA 4ABVA 3RHWK 4B9YA 4NNPL 2BOLA 4L5FL 1S7RA 4PVLA 4MRBA 5IMKB 2CUIA 3C12A 4MD4A 1OP5K 2DQTL 5BZZA 3TFKC 4H0HB 5GJTL 4Y4KB 1KPUB 3CH8A 5DHEA 5IM7B 4Y1AA 5IF0A 2BIHA 2VXTH 3GI8H 5IROD 3KS0J 2P80D 3RZCA 2NQ3A 4PJHA 2UZYA 2IAMC 4JRYD 1M2VA 3MR9A 3GMMA 1VSCA 1YEFL 2CDGA 5F3BA 3AGVA 1BZOA 2MCPL 2VDNB 2WBJA 4ZO7A 5C0FA 3V0VB 4TQEL 3EO0B 3P3YA 2IH3B 1SF3A 2NW2A 1U8KA 3VSTA 3G5ZA 4HOMA 3CK0H 5IK3A 1ILUA 1U30A 4MHHG 1DP0A 2DLGA 4JFZH 2X4TA 3V6ZB 5ANMB 3I50L 3FULA 1ZHKA 1E5BA 1MJ7L 3IKCA 2AJ3B 4K7PL 2BVYA 3LEYH 2B1HH 4GINA 5EIIB 5C6TH 2AQ2A 5BV7L 1HH6B 3B1UA 3P4MA 4OZIA 5GGTA 1QBMH 3S37X 5HDQL 4PY8J 2WXGA 3CZGA 1OP3K 4KUZL 5FK9A 1N0LB 4O2EA 3UTSB 2VNCA 2DM4A 1IEAA 2AERT 2QR0B 5I8CB 2XN2A 5JLZB 5IB1B 1R3HB 1WWWX 3MCYA 2IH9A 3GKWL 3MLWL 4U3HA 1LEGA 5AKVA 1ES0A 5DHVB 2JNZA 1AHMA 2C3HA 3CU1A 3CSTA 1I1CA 3KCPA 4Y4HB 3VI4B 2AJZB 4CSZA 5CJXA 3L9EA 5CSZB 5F7KC 1K8IB 4EXKA 5FV2A 4MQ7A 4AQ8C 1KBVA 3K72A 1BVKA 2F5AL 3DVNB 1YNKL 2CKBL 4WENB 5F1IA 5DD6A 3IDJB 3W39B 3GHBL 4BGDA 3KVDD 3S3JA 4K9EH 1A4KA 2OMUA 4JPSA 2CMRH 3MBEA 2D9CA 3UBXB 4N2NA 2FX7H 2ZCZA 1KDJA 3PL6A 4DERA 4PSRA 3DOIA 1K3IA 2VXVH 3VXUE 4NN5B 3UJTH 4WTWA 2Y7QB 2QSTA 5DEGB 1MCQA 2BVOB 3ESUF 3QJSB 4NO2B 3GSOB 3SKUD 3LQAC 2F19H 5CD5C 2BXYA 3LXAA 4O4YH 4XBEL 5KS9A 5KSBB 4MD5A 5E2WH 3FSZA 1H5BC 3LNEA 2ZT9C 1KN2L 4U1NB 3IDYC 2ZXWB 1A9BB 1EO8L 1PDKB 1T4KB 2XA8H 3HPJB 1E8XA 3Q6FA 3VDAA 3BN9C 1J5IA 5A6IA 1RH8A 3IE4A 1AMYA 1EAPB 1KZQA 3NCEB 1BQSA 3AJ7A 4IRJD 3HE7B 2YAMA 4FC3E 4KMLB 5BXFA 4P46C 4FI7A 1A6VL 1KTKE 4K5PA 4OQ1A 1A9EA 4PV8B 1U3HA 3PHOB 4LE8A 3RUGF 2EDYA 2WINA 4U4IA 4FHBD 4JDVA 4WY7H 3ZKMC 4HJSA 5FYKE 3E6HB 1MJ8H 1URIA 4GAAA 4XBPB 1QFHA 1HVXA 4P59L 1SY6A 2VXSH 1QRNB 1KCSL 4G6ML 4NC0B 2HG5A 3CPUA 2R69H 5BVPL 4GG8A 3G6JE 4ZZFA 1CTOA 4K0OA 3WHXB 2FT6A 5JORA 1CL7I 1GCYA 3GRGA 6FABH 1BAFL 3RFZA 4RZCA 3AY4A 4XGZA 1DJZA 1W8OA 5GJSH 4JG0H 2C9SA 2J88H 2DYPB 3NSJA 4J6IA 1S78D 2ATKA 2NYZA 3RY5A 5AZUA 2XKNA 3OJDB 4AKPA 3H1ZA 4M5TA 4WFGD 2ADJB 3ZDWA 1KXTA 1H0DA 5AQ0A 1S9YB 3DOSB 4NGHL 1RJYA 2X9WA 1LNUA 2VQ4A 4AYBA 5JDSB 4XN2A 3L6FA 3QQDB 4WEBH 5CCKL 1QSZA 3GMLA 1UG9A 3V6BR 3F01A 3JUZA 2RR3A 2ZJSH 5T5NG 3QIUC 3LS4L 3EYFB 1BOGA 4YIQA 1CXEA 3RYMA 1FAIL 1NUNB 2JLLA 3C60C 4IBLT 3K4ZA 3P9LB 4BH8B 2H1PH 2ZUVA 5E23A 4Z23A 4NZRL 4PHXA 5C0GA 3CDZA 4HWBA 4TM9A 1DN0A 3VFOA 1OTUD 3H42H 3JV5A 3AWEA 4UU9B 2WUBL 2IG2H 4S2SA 3BFWA 4LLAA 4L29B 3NACH 4QTIH 1Z2KA 4PRHA 1MI5E 1IO4C 3FN0H 1P4BH 3AABA 3KPNB 1U92A 2VISB 4JPKL 2JKSA 1YEEL 2I7OA 1JF1A 5E6UB 3SQBB 3HUJB 2YD7A 3EGXB 4JO2L 4TNVK 1PY0A 2Y72A 2ZKHL 4LMQI 1FHGA 3MJ7A 1C5BL 3DGGA 3RWDB 1JRHI 3EFFA 4Q8BA 1A66A 4UQEA 2N7AA 1DUYA 4FQJL 3DTDA 3N42F 2NR6D 1M6OB 2WLLA 2FO4B 2I60H 1AXTL 4G3YL 4P2YA 4XXCC 2ORBH 3W5MA 4JQVA 1PZDA 2EYTA 4XP9L 4UTAH 3TH3T 2NSMA 4L8SC 5DK0B 2X5PA 5DC9B 3TEUA 2FJHA 3HZMB 4F58L 4XNXL 3VYPA 5LKNA 5EOQL 3QEGH 4KZDH 2Z7UA 5DD3L 2VSMB 2Y36H 7FABH 1UA3A 5JPNB 4PWJA 1KXHA 3W0WE 4LBEA 3B83A 4YHOL 2BO0A 4I7ZC 3ARBA 4G5AA 2OFQA 2H9GA 1OB0A 1A0QH 4HPYL 3M7FB 3ETBJ 4G8EB 1DVTA 4X5LA 3EYSH 4GXVH 4KKCD 4EN3D 3ULUF 1Y18A 1LQBC 1OTTC 4FMFA 5JHDA 3EZ8A 4IMKC 1MY7A 3L7EA 4P2RD 3EH5B 5DUJA 2ICCA 3FTSA 3FTGA 3QNYB 4ABQA 1NFIB 1S7UB 2CXKA 3T3PF 3ZMEA 5C08A 2DWDB 2WKLA 4GBXA 3FRUB 4AVKA 1J8RA 5E6SB 3TBYA 1KB3A 4GRLA 5TE6H 3D33A 3HHSA 4N8VA 2RQ8A 3G6DL 4I4WB 3HRZB 1DTUA 4G8IB 5KSVA 3VJ6A 2R29A 3NBNA 4X83A 3H4HA 3LKRB 4QRRE 4KZEL 3PWNB 5EU5A 3S3SA 3CLWA 3ASWA 3HMXH 4QAMB 1KB5H 1FC1A 1VRSA 4EI5C 1E4XI 4QNPF 5AAMC 5JUEL 4HOWA 3O4OB 5IW6B 3OG4B 1XCTB 5A2IH 4HV8B 1ACXA 3KWWA 1AG0A 3F62A 3DJ9A 4L4TA 2VDPL 1HIML 2IF7A 5D70H 1N8OE 4PJGF 3T0BA 1FG2A 5AG9A 3Q44A 4L8CA 3UZQB 2I7SA 3CQPA 4ACPA 3BH4A 5LN4A 4XZ4A 2XSKA 1XGPB 1JNLL 2OCFD 3I6GB 3VFVB 1L9TA 5ESQA 3BW9B 4J7RA 1NSNL 4Z6AT 3PHAA 4J1UA 1J8HE 2WLJA 3VGEA 4G6KL 5F89B 3KYMB 3N91A 3OF6A 2B1OA 5C6PB 4JL2A 1HE8A 1RULL 3DVGB 2BP0A 2YEZB 4JHWH 5SWSA 2H3NB 1E9PA 3P1VA 4Y1TA 1D5MA 2X4RB 3ZKQD 4GG6F 4ELMF 2CCVA 1ZT1B 4ATWA 4P4KD 5HGBB 2OMZB 3GXMA 4GQQA 5E4EC 2XACC 4B96A 2W94A 3M07A 3QIWA 5J1SC 2WANA 1U8LB 1MKFA 5CCJA 5BRZB 2C9XA 4K9EC 4XB8A 2I07B 4H88H 1M7DA 2APVA 4IIQC 3LKPB 5EU3A 4OF5A 5D7IB 4KK6D 1OK0A 5CNHA 1JPTH 4U6XB 1JZ4A 1WFJA 5EN3A 1GGIH 3PIQB 1KGWA 1IBDA 2FWOB 2DOCA 4NBYB 3NIFF 3DX3A 1B0RB 5E00B 4BKSC 3SDDC 3IFOA 4UT9H 5J11C 2CLRA 2EEBA 4K15A 1QFPA 3Q1SH 4W9IC 5C0BD 4Z7OF 5KVGE 3V5HA 1JZIA 5EOTB 4ZUVB 2P26A 2OJEB 3IJYB 2B14A 1T2QL 4NPYA 3CMOH 3UMTA 4KDVA 3AAZA 5ENWA 1CBJA 5KYYA 4N0FB 3U83A 5I2IA 3LJ3A 3WD5L 3D0VA 1HQ4B 2FZ3B 3NIGB 5T5FA 3G04A 2ZX5A 4NZTL 5FCUL 1CFQA 4OGZA 2ROYA 1AZUA 4L1BA 1INEL 2QGBA 5ITFB 3BP4A 3D09A 2AQQA 4QPEA 5EG6C 2E86A 1MRCL 2BLFA 3RHWF 3LHPH 3DSFL 4DGYH 4ABWA 1V7NL 2ICEC 3IPBA 1A6TB 2WXQA 4XMLH 5LBSA 5EUOB 1HH9B 2LVEA 3BOVA 4NBXB 2JKNA 3MRBA 2CLVB 3SPIA 5EDSA 1LE9B 4N25A 1QW9A 3MXWH 5HYEA 4L3EB 4MGXA 1OARL 2ZXEB 5IMMA 3MRKB 3Q2NA 1BD2E 5D2NA 2IALA 5F9WB 3OBAA 3C5JB 5HTSA 3GMNA 1NKRA 5FYKH 1QR1B 3F7PC 1NMCB 1D7FA 3BZ4A 3V9EA 4MAYD 1KYDA 3GUFA 1IAKA 3WE6B 2YFOA 1B2YA 4JFDD 1U93B 1SJHB 3SKJH 3T2OA 5E95B 4C4KT 1R5WB 2AI0L 1IC0A 1IFRA 4CVZB 2A6KB 5J9PB 3ARZA 2F54E 2WZ0A 3CN1A 1UJ3A 3SKMA 1AO7A 1EAOA 5EMYA 4OGYH 3D2UD 1NDGA 3KHQA 3CZJA 2Z4QA 2CALA 3FQRA 3OC8A 4LEBA 3DX7A 1YSOA 3V6OA 2HVKB 3S97C 1KTLA 2YOAA 4Y5YA 3DNKA 4P23D 4RAHA 3H0TA 4H1LG 3MLXH 4H1LA 4DUVA 1H5BB 3STBA 4GKZA 3IDYB 5DJZA 2XBTA 3VSVA 4IS6A 1YUKB 4XVJH 2FK9A 4H25B 1YUHA 2XBDA 1M05B 2X89A 3ECBA 4PJCF 3RZWA 1CE6A 1KACB 4B9JA 4OGXH 2BY0A 1UZ6E 5DDHB 2B3RA 2AK4A 4G8GB 1MVUB 2W0FB 3PWVB 4RDQF 3FT1A 5BOJA 5K33A 3GSNH 4MSWB 3SODB 4JCLA 3BVXA 1CLZL 3BZEB 5EU7E 5DJ6A 3U7WH 4LAJH 2MCG1 4G42A 5IVZB 2W07B 3A23A 1T1XB 2VLJB 2C26A 1WE5A 3ARFA 3ATBA 3RX8A 4URKA 3GJFK 1S78C 2O5ZH 2O6PA 5AVYB 3GQFA 1CGVA 3M46A 1T1ZB 1CLOH 1ZCRA 4L4VB 3W9DA 4BFBD 5EUKA 1FO0H 3OKLB 3VD5A 5ESVB 4LNVA 2PCPA 2AQRA 4J3UA 1RZ7H 3ARED 3BVUA 3O8XA 4I2XE 3MV8D 3O11A 4UOQA 3AITA 2G0KA 4N1CA 1RUMH 3BP7B 5D7JD 1HCZA 1WG3A 3MRIB 4JLRA 4KX9A 2XN9E 1WP6A 3FTXA 1EDYA 2X4OB 2E9BA 4CN1A 4LDEB 4X5QA 5HI4C 5CUSL 2I27N 1BMZA 4HPOH 3KWXA 3SE3C 3M7OA 1JZ6A 1R3KB 3QIUB 3HLAB 5T3ZL 4F93B 2OL3A 2ZOWA 1D7DA 1W72L 1OCRB 3WFHB 3L3HB 3CVCA 5D6DA 4S1DD 1EAQA 2BMKA 1PIFA 2DEYX 4UTCA 4AITA 4WDIB 3EF4A 2XBZA 3GB7A 5HI5D 3V52L 2EE6A 4B27A 1PJWA 2V7HA 3CSBA 4P2QB 1NCNA 4AX3A 4ZFGL 5I1EL 1KCWA 3WAJA 1SJEA 3WAKA 4OD1L 1UM4H 1WCBB 4ES8A 4MA3A 2Y25A 4GRMB 4GIOA 3ES6B 5F9OH 1DVFD 1LEKB 3B7UX 4TN9A 1X6NA 3GIZL 1QASA 2QLYA 3IMBA 4OGQC 4PJBB 2VERA 4QTHB 1CGSH 2VOTA 1A7RH 3ARYA 3OKDA 1AMXA 1JSYA 3EKCA 2PW1A 3NUKA 3SKNB 4P57B 1INDL 1MF2H 4OV6F 1ZLEA 2NPLX 5I1LA 4A7GA 1H3WM 5FM4A 1QTPA 1N67A 4N0UA 4XO4A 1IGMH 2UY6A 4EE2A 4KHXH 4LU5L 2P5EE 2OMTA 3B9KB 2BXZA 2ZAIA 3O3DA 4WTQA 3BVNB 2DQFB 3PPEA 1QEWA 4GI6A 1INQB 5DVLA 4OF3A 3UTTE 2ZPKH 5E1GA 2VQ1A 3B9DA 4G71B 1WHOA 1IM3D 4MJID 1F86A 3M1BA 5HHQB 3TT1H 1CWVA 4BXVA 3H7BB 1U21A 4NHUA 4NQSB 3LPOA 4TNVF 5DRNA 1I3UA 2FWLB 5A7EA 4KKCC 5BVJA 4KY1L 4HDIA 4Y4FA 1KGIA 1Q9LA 2Q9OA 4XR8C 2WLIB 2FGWL 3QDJD 2ZCLL 2APXA 2W59A 2ADGA 3FFCE 4G8AC 1ZHBA 3T3ME 3THMH 1EJOH 3IJSB 3O0LA 4GMTH 4X5XB 5A2BA 5HYIA 1KXVC 4QY8B 3HB3C 3MJ9H 1MG3C 1NWPA 3UPRB 1MY5A 4DPAX 5D6CB 1J1OH 1LILA 4ZK8A 3GSQA 1ED3A 3AU1B 4D94A 3M86A 4NHCH 4B9KC 3JYBA 1GCFA 4LVEA 3T0EA 4M9PA 4C56D 3TL5A 4LLWA 1UM5H 1E67A 5EN2A 3D12B 3G08A 1F5WA 2VW7A 5LAPA 3QZWG 1EVTC 2Q7AA 1RSFA 4PGEA 1QHOA 4I18A 4TSAH 5CLWA 3X14B 5LXGH 3D39A 3I2CL 3TZVD 4PFEA 3ZTNL 1AR1B 2O6FA 5EOCH 2F8XC 4G2AA 1D5IL 4X50A 2XG5B 3RWGA 3GXFA 2B16A 5AW0B 4NQEA 5K9QI 3WJJC 2A77L 1UT9A 3N44B 1BM3L 2Y7LA 1I3RA 3V9CA 1N4XL 1YEKL 2OSLA 2CA3A 2Z9TA 4RFEB 5J13C 3HPLA 3WUZA 5CM1A 1A5FL 5DZAA 1CJYA 4NQVB 3SZ6A 3UTOA 4HG4K 5KVGH 4X6DF 1QFWL 1GYAA 4JFFB 1DBAL 3OZLA 4KZCA 1DEDA 4MNHA 5BUAA 2ZICA 4W9ZA 5F1NA 3IMRA 5IGXL 1HK6A 5HYFA 3R0NA 3RTLA 4TMPA 1LLAA 1P4IH 4RBPH 2VM4A 2DV6A 5I1GH 1JAEA 4R90H 1MHEA 2R1XA 1NCCH 3G7TA 4P4KC 2AJXH 4WWID 3REVA 5HSFA 1KLUA 3D69A 5E2UH 1I9JH 1XB8A 2WIIB 1EEYA 4UQ2B 5ALCL 5GS2H 5CKGA 2Z1PA 3CBJB 1KUMA 5B22A 3NCYP 1AYRA 5E4EB 3QAZC 3WNLA 1KYAA 4F7PB 5AG8A 2IH1A 2VUKA 3V5DA 1KBPA 4FA8A 3QXUA 4JANA 1SDDA 2ROXA 4J3BA 3L4WA 4L1DA 3K4AA 5CEXA 1NOAA 1GZPB 3CVIH 3DHUA 5D96C 1TCRB 2NZ9D 1QWUA 1IC7H 1YCSA 1QUNA 4NKQB 4UDTA 2KL6A 2VRAA 5F6HI 3FRPG 4NN7C 3FRPA 2NY0B 3SDAD 1DQJB 3HI1A 4HHWA 4QO1A 1Z5LB 2R1YB 2DWTA 3MACL 2FATH 4MASA 2F08A 5L4FA 3GK8L 4DK6A 3LNFA 4OM1H 3UTZB 1J87A 1P5VB 5I66A 3KXFD 3LNIA 4ODUB 3SDDB 3MV01 3GSUA 4O2FA 5LGJA 5A1AA 2HRPL 3H54A 3KPRD 3N6YA 1EPFA 1NTDA 4LL4A 5FKPB 1U42A 1ADQA 1RSYA 2J21A 5I6KA 3VE0B 2GJ6D 5J6SA 5SX4I 5I16B 2KKQA 2WXFA 2QKIC 3F00A 3GJFH 5F9JA 1QFWM 5F0MB 1MFBL 3KPSD 4NQCD 4YC2C 5KYNA 4FXTA 1CI5A 1HZHL 1MAML 4AJVA 4E41A 3TJEL 1QPXA 2WNWA 1ZGLA 4UILL 1MNUH 3B3IB 5F1SA 1PX4A 1UH2A 4TVSa 4X7CC 2DQEL 4ODSH 3MV9E 1A3LH 2DMKA 5MEQB 1IE4A 4ANKA 2Z7YA 2OAAA 5FF6A 2FIKA 1X4XA 1Q38A 3HNSL 4IKJA 4ANVA 3HI5L 3QI9B 1U3JA 4FG4A 3T4AA 4AM0Q 1XF1A 4M7JL 1QPPA 1PX3A 2FJGA 4LLVB 3VGAC 1RPKA 2GIXA 1S2EA 3V0IA 5EZOH 2HJKA 4JO3L 2WGXA 1I7ZA 4ANUA 3U4BL 5ACZA 5E8OB 2D0FA 4WUUE 3TS8A 3PWPA 3QQ4B 1RU9L 1Q9OB 2VO5A 3MROB 3ZDYB 5BZDA 1KIPA 2VAAB 3TIEB 3A5VA 2PPEA 1YN7A 4AEFA 4PR5A 5IJCC 2QVIA 1UASA 4ZAKA 3PWLA 1XH1A 3FZUC 3IETA 3CLFH 3EG9B 1ZLUK 1N12A 5HHPA 1KBWA 3SDYL 1HNGA 1OGAE 4PJFA 3F8UB 4PJAB 1W8EA 4IMLB 4B95C 3BAYA 1J1PL 1QFUH 1AGFA 2E27L 4TLKA 2Z35B 3BP6A 4Q9CA 1UYWH 1WEJL 2F7QA 5B38B 1LEIB 3CN3A 5CN1A 2VW4A 3MRCB 2EYRA 2X12A 4S1RL 4KU1A 4JPWH 4ZSOB 3BPOB 3KYNA 2E76C 5F7EH 1YYCA 1XHHA 2EACA 1ITBB 4ZMNA 4PTTA 5I0YA 2CQVA 5K9OB 2CDFA 4M62H 3W9EA 3Q9PA 1SXNA 4XVSL 4DQOH 1M3JA 4M5ZH 3WBDA 3FU8A 4AV0A 4QHPA 4X6CE 4PB9H 1Y1UA 3LPGA 3PXLA 1IAOA 1UT1A 5TFSH 4JX0A 4ZOBA 1CL7L 4KJPD 1X3DA 1L9NA 1XH0A 2P45B 4TPRL 4BZ1A 1G7MB 4IQHA 4Z3HA 1FYTD 2H2SD 2ZUSA 2AJVH 1BMGA 3DOHA 1BOYA 3DGDA 3IXAA 4WI8A 4YE0A 3W5NA 2B9AA 1AS8A 2I25N 3GLAA 2OZ4H 4W70A 4XPBL 3BHBA 1WHPA 3ATDA 4E9WA 4DP6X 2BP8B 2W9DH 3IK2A 5E1IA 1M56B 5I8EB 4J8QA 4XVUD 4M00A 2YMOA 4G6JL 5F0JB 1J0ZA 2E47A 2Q8AL 3VI4F 1E4WH 1YMMD 1TEFA 4EVNB 3IVKB 3Q8FA 4GQRA 1Q0YH 1LDPH 4XWOC 2APSA 2V3FA 5MERA 2L04A 1ECYA 4JR9L 3RBSA 1MFDL 4KXZH 1TKWB 3UTPD 1G4RA 3RWIA 3CSYB 5ISZB 4R8WL 3FSOA 4DEWA 3CWGA 2CH8A 4DHLA 3WUWA 1EBPA 2AGJH 5C07A 5HGAA 5DVMA 4LSSL 3IJEB 4DN3L 2QPEB 4DP1X 1BFOA 2GBVA 5DC0A 3VXPB 4C4KO 5ESAB 3F12B 5JW4N 4Q74A 3ROOA 4G80A 5D1QA 2DQJH 4HD5A 3H9SE 3I75A 1N6QH 1WC7B 2PO6D 1AE6H 3CHOA 4S1DC 1UM6H 2EDFA 2NNAA 3DIFB 3QRLA 4TVPD 4JREB 2PYFB 4Z7VB 3TTSA 5L2KE 1SZNA 5AB2A 3L5IA 1F6LL 3A22A 4UYPA 2YARA 4OZGB 2AVGA 4EOWH 4CSPA 1R4XA 1A4BA 3T6VA 2X3AA 4YFEA 4PRPD 1G7PA 3D85B 2Y9RT 3BQUB 1F3JA 1PZ5B 4IU3A 2D9QB 5E4AA 4AYFB 1L9MA 1DVFC 2IFFH 1KB5B 4DGVH 1MWAA 2WVUA 3MNVA 3HBPA 4NC2B 1B4LA 2NW3B 1PKQE 4NZ8A 4FQLH 1YN6A 1VFBB 3GRWL 2EDDA 3QUZA 3MBXH 4N26A 3EXJA 1DVQA 3C2AH 5IBTH 1RL1A 4BKLA 2WOYA 4QLRA 3MRNA 1I7TB 3T65B 3HNVL 1G1CA 2EDWA 3ZLQC 2VDQL 2I9TA 4LLUB 1YEDA 1MOEA 3BUQA 4JZJB 2XV6B 4P04A 1BQKA 2NY5C 3PFQA 1FZKA 4D9QE 2IXQA 5K39A 1W0YT 4WW1B 5MP6L 2DLHA 2IANE 4PJIA 4C58B 1EGJL 1RUPH 5IJKC 4DF9A 4F7CA 2UYLA 1PG7X 3BD4A 3QHTC 2AABL 3V6FB 4XPAL 5HHNA 2R0KH 4ENED 1TITA 2EDLA 4PD4K 3HHMA 2E7DA 4UT7H 2NNRA 4J3SA 1UVQB 2SODB 1A7NL 1BZ7B 3BAKA 1WFTA 1XIWA 1N8ZA 1YEIL 4XNUL 3VWKD 2RTTA 2ESVD 4LSUL 2Z0UA 4F5CE 3O4LE 3MKGA 5CILH 3EJRA 5T1LB 4TLTA 5FO7B 4P2RB 1X4YA 3HB3B 2ADFL 4DETA 4QOKA 4TVPH 1XBDA 1JN6A 1LO2L 4L9LC 5JHMA 1G84A