4L0YA

Crystal structure of runx1 and ets1 bound to tcr alpha promoter (crystal form 1)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
128
structure length
128
Chain Sequence
b'SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title Structural basis of Ets1 activation by Runx1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 23
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4l0yA00
4G82A 4GUOA 3TS8A 3QYMA 3US0A 3WU1A 1KZYA 2BIMA 1UOLA 2WGXA 2AC0A 1HJBC 5LAPA 3US1A 3WTVA 1GZHA 3VD2A 2ATAA 2AHIA 2H1LM 4AGMA 2J6WA 3WTXA 3D09A 4A63A 4G83A 1HJCA 3Q06A 1EANA 2X0VA 2BIQA 3IGLA 1H9DA 4MZRA 4AGPA 2FEJA 5LGYA 3Q05A 5AOMA 4IBSA 3EXJA 4IBTA 4IBUA 4LO9A 3WTYA 2X0WA 3WTWA 3KZ8A 5AOJA 2J1YA 3D07A 2RMNA 5AB9A 2BINA 2J21A 5ECGA 4KVPA 3D06A 3VD1A 2ADYA 5AOIA 5G4OA 4AGQA 4XR8C 3WTUA 3VD0A 3D05A 2VUKA 2X0UA 3WTTA 2IOOA 1E50A 2GEQA 5G4NA 4L0ZA 5BUAA 2PCXA 4MZIA 3IGKA 1TUPA 2P52A 2J1XA 1YCSA 4IBYA 4L18A 2XWRA 5A7BA 4IBZA 3D08A 4GUQA 2YBGA 4IBVA 2OCJA 5KBDA 4AGLA 2J1ZA 2J1WA 1TSRA 5AOLA 1EAOA 1GZHC 4L0YA 2BIPA 1HU8A 4LOFA 1IO4C 3KMDA 3D0AA 3Q01A 1T4WA 3EXLA 5AOKA 5G4MA 2IOIA 2MEJB 1LJMA 1CMOA 4LOEA 2IOMA 2XWCA 4AGNA 4AGOA 4IBQA 3ZMEA 2J20A 5ABAA 3QYNA 4HJEA 2BIOA 4IJTA 4IBWA 3WTSA 1CO1A 1EAQA 4QO1B
chains in the Genus database with same CATH superfamily
4DIXA 1E2ZA 2EH8L 2GYSA 4KKBC 5D1QA 2YPLA 3H9HA 1G9MC 4BZYA 5ID1B 5JQIB 4NC1E 3A6OA 5GGRB 3QJUB 4BFIA 1WWBX 2BZ7A 1OL0A 4NZRL 4KI5E 1Z9LA 4JQVA 5TDPA 2ETWA 5GRZA 1BJMA 4MSWB 4W4NA 1GRWA 2Q20A 2UWEF 2LE9A 4HUCA 2OYLA 1XGZA 1JNHA 1S3KH 2YXFA 4PJ8B 3CK0H 3B34A 3OAUH 2BRRH 4LE8A 4N8CL 2NUPB 1CT8A 3QWOB 5F70A 5GSRA 4WU7A 4PHXA 5FUZL 2ATKA 3QG7L 1HSAB 2VE6A 3NIGB 2DQTL 4PBXA 4HUVB 2Y2WA 4U3SA 1BECA 1A7QH 2AXWA 2LAAA 1SVCP 1V7MH 5B38A 1DVYA 1B4JH 2BNRE 3BVVA 5EO9B 2J56A 1ZOXA 3M46A 2B16A 4J3OH 1I7TB 1YNLL 4QTHB 4FXKB 5EHFA 4HJJL 2YXMA 1G7JB 3PU7A 4H26B 1MPAH 5KSUA 1PZBA 2JK5A 1SN0A 5BRZE 5EU5A 4JDTH 3EOTH 5F9AC 4H2CA 1NWPA 1VPOL 2R2CA 2FGZA 1IM3A 4UUJB 5J6GA 2GSIB 3JWNE 1KJ2L 1AC6A 3K7UA 3FU6A 4HJGB 5DFTA 3GRGA 5FYLH 1RAMA 3C5JA 1RZFL 1XL4A 3SQOL 1HEZB 1WSST 3NEXA 1T20A 3OL2A 3TT1H 3FCSB 2F1BA 4N8VA 4X4ZA 3BPNC 4ODXA 2IAMA 2QJDA 3TT3H 5K1JA 3MRIB 4Z0XA 4Y8DC 2DQDH 5A7BA 5GPRA 4KAQL 4QLWA 5CMAA 5FX3A 4XN4A 2XN1A 5FYKE 4PJIF 1QFPA 4JO2H 2DMBA 3B9DA 1T1WB 1L6PA 5ID1A 3VI3B 3OKMB 3BPOC 5A2AA 3GHEL 1M7XA 4ZO9A 4JANB 5E8DH 3QQ3B 1DVZA 2OXHA 3UTSE 2CJTA 3C5SA 4MSWA 2LOEA 3WEBA 5ITBH 1B2WL 1I1RA 3HMWL 1CDCA 1X4YA 4LCWE 1CFMA 1HAWA 1KELH 2Y7OA 2ZUYA 2IOMA 4O02H 4WVRA 4X99B 5CSBA 3ZRFC 3QWOA 2PWFA 3N40F 4LRIA 1S46A 5AZUA 3U4BL 1HSAA 3V4VB 2WY3B 4HUVA 2OYMA 3UGUA 4TQ8A 3V8CA 3HS0B 4QO1B 1QVOB 5EO9A 1NANI 3QIUA 4NIKB 5KANG 3VFSB 4QTHA 5ADOH 1DBBH 2ODIA 4JY4A 3VFGL 3O9WC 3L45A 4KNTA 3BO8A 3WHXB 5J13B 2XWTA 5FW7A 1T0PB 3FTZA 1OP5H 1I9IL 1R3IH 4O9HH 4HKBB 4UUJA 4K3GA 1IB5A 2GSIA 4HIXH 1YY9D 5EU6B 4ERSL 5J89A 4HJGA 4MD5B 3OAWA 2Q8BH 2EDMA 1IBHA 5MENB 3PP4L 4XPTL 3UJJL 3CSTA 1HEZA 2XU9A 3WGUB 2JJTC 2IDTA 3FCSA 3UP1A 1BG1A 1MIML 1QYGH 4KHXH 4LHUB 1VF5C 3MRIA 4LSSL 2XQBH 4HC1H 4WSJA 2F8VA 1VACB 5IB1B 2VDOB 4OZIB 1BIIB 1PLAA 2QELA 5DU7A 5IT2H 2P8MB 4YHOL 2E7HA 1E42A 1FJ1B 4MASA 4ZO7A 1LNUB 1T1WA 1M42A 2E5EA 5FGSA 3OKMA 3OJMB 3T0VA 1FVDB 1H5BC 4NYLB 2IAND 3DX1A 4GSDL 1G4MA 3RIFK 3ZTNH 4JANA 2AAVA 3QQ3A 1F45A 4YK4C 4F7KA 1SJHB 3HN8A 4NDMA 3ZVVA 3QZWB 7PCYA 1GKOA 2VUKA 1CFQB 2X4NA 3BKCL 1UC6A 3L5XH 1T7XA 2FX8H 3AXIA 1F42A 2EDWA 1M7DB 1HSBB 4X99A 1OGTB 1X5HA 2Z8VC 2DYPB 4OD1H 1A3LH 4M48L 5CNHA 5D7JB 4NQCB 4A2LA 3TZVC 2Y06H 1T2JA 3LEXB 2A9NH 1QTPA 2YZ8A 4QDGA 1OF2B 3L3HA 4QO1A 2Z64C 5DJ6B 2X1QA 1QVOA 3NQKA 4KDTA 4B9IA 2KHAA 4JM2F 3MJ9H 4YPGB 5TDNA 5BS0E 4IOFD 4B5ZA 2EDTA 4QXUL 3TBTB 3CLEL 3P73B 4PV8B 2RGSA 1NKGA 4JHAH 4L8BA 1VLXA 2XG5A 3HLAB 4BXVA 1JPTH 3ES6B 4YIQA 2PCFB 5GIRA 3WFHB 1IM9A 5AZ2H 2BSSB 3CVDA 4AYID 2B08A 1UZ6F 4YL9A 5EU6A 3LKOB 3NRQA 3RILA 3POHA 1KCSL 4MD5A 3T0EC 5B3JF 4Y2DD 4CADB 5MENA 5K1NA 1QEWB 4QXGH 4BCZA 2WN3A 2R0ZL 3K2UL 1YEGH 1ZT1B 4J6RL 1EGJH 4GBXD 4ZW7A 2DJUA 1SQ2N 4LHUA 4FEIA 3S37H 2XBZA 2W81C 3NACL 3O2DH 1KZQA 3QCVL 5D71L 4ZMWA 3OC8A 4JY6A 3ROLB 1KGYE 1VACA 5BNXD 5IB1A 1QBBA 4OZIA 2CU9A 1BVLA 4OLYH 2P8MA 3KPQB 3VYNA 5F7BA 1FJ1A 1NL0H 4YE4L 3HG2A 5E94B 4QHKI 1RIUH 5I5RA 4ZMZA 2WO2B 5FV2A 2DLFH 1W15A 5E2VH 4LSUL 5I1JH 1JTTA 1FVDA 4NYLA 3N0AA 4G7VH 5EOTA 5G2NA 4PR5B 1M2OA 1SJHA 4P3CL 2DQ6A 5DFWH 1MFMA 3RWFA 3QZWA 2XTJD 4XNXL 2ICWA 1CFQA 5E8OB 4PD4J 4M29A 1UYWL 2IALB 4G72B 2QMJA 4TUUA 4HCFA 1AXSB 1AO7E 1LO0H 2AXFB 3EO9H 1M7DA 1HSBA 5HVGB 4JFED 4YSCA 5E00B 2DYPA 5AQ0A 4DKEL 3S9DB 2VDKL 4UV7L 2E9WA 5D7JA 5D96B 3VD9A 5E08H 4GG6B 3GRWA 2UYLB 3LEXA 3Q9QA 3RBSA 1OF2A 3OMNB 2HTKD 5M94B 3BEVA 5DJ6A 1JNJA 2B1HH 3MRRB 2DQIL 4UINL 4KJYB 4PJCF 4JRYE 2QVFB 1HXMB 1U95B 3QORC 3UEQA 5KSVB 4JW3A 2V9TA 3TBTA 3V7MA 2GQHA 3P73A 2UXGA 5CR1A 5E9AA 1J1PH 1OARL 3HLAA 5LDUA 2CE6A 1LYQA 3WFHA 1X7TA 1UD3A 2PCFA 2F53D 2VR4A 4KRPB 3RVVD 4H88L 1AQ8A 2C1PA 1NUDA 1EZUA 4CU6A 1O7DE 1GCFA 2JKSA 4CADA 3J2PA 5J3HD 5HHXH 5IBLC 5EIIB 3RP1A 3SGJA 4W6WB 1SBSH 1ZT1A 4UYQA 2V3DA 1DQQB 2FNBA 2KLTA 3B7RL 1KXQA 3QRBA 4DT2A 2ZCHL 4AQ1B 4YE0A 2VISB 3OMZA 1HKLL 1QZNA 2NYYD 3G5WA 2BHUA 5IB3B 4W9FC 4APQB 1XR9B 3INUH 3U9PL 1EQWA 3AQXA 2X1PA 1TZ8A 3D2UB 4I7ZC 5E94A 1WIPA 4QY8A 3CMGA 3ULAB 2QLVB 1IC5L 3D34A 5KW9H 5CLZA 1OAUL 2GBTA 3QIBB 5DT1H 2AVFA 5J5EA 4BFRA 3PPSA 4Y4KB 1MW3A 1J18A 5F1NB 3LN5A 5DJZA 3WNIA 5IM7B 4ZFFA 2VQUA 5E8OA 2PXYB 2B1OA 2P1YA 4KUZH 2IALA 4LEXL 1MCRA 1RULH 4WHTA 2PTTB 1AXSA 1BFSA 1Z9NA 2AXFA 2DQHL 3TXAA 1B0GB 4IMKA 1GGIH 1MNNA 5TFSL 5AVYB 4GG6A 5IW1B 5CCJA 2OL3L 2VXVL 4BK4A 3OWEA 3CC5B 1I8LA 1C5BH 4HIEB 3W9DA 2UY7B 4KJYA 1HJBC 1U95A 2LT9A 2X4QB 3IMBA 1N0LB 3VGAB 1MJ8H 5GZOC 4DCQA 4KFMA 5BO0D 1JZ6A 3TO4D 1A4KB 3UEZA 4ZUVA 3OAYK 3OKNB 2VERN 3MUGB 2ZXWB 1MI5E 2WBJB 1X4XA 2IPTL 3DYMA 3WY3A 4S2SB 5I71C 1QKZL 1BLNB 1TVBB 3Q6FB 2OI9B 1MKFA 1DQQA 2NXYB 2FSEA 3D4CA 2EDNA 3FO9B 4Z3JA 4N2MA 1K5NB 1T0NB 2VISA 3EJYD 3UC0H 2VC2H 3GXMA 4C4KT 5DHMC 4KPHL 1IJNA 1R5WB 5IB3A 4ZBJA 1NAKH 3EHBD 2JELH 4FQJL 5FO7B 1M53A 1XR9A 3T0XA 1KCRL 4TQEH 4WI4A 3UTOA 5I1GL 1BVZA 4EOWH 3UBXI 3D2UA 4Z7QF 1UWGL 3ZHLA 4JG1H 4UT9A 1MRFH 4RSVA 1KYFA 3B9KB 3WS3A 2ADYA 3ILPB 3QIBA 4U6HB 5LBSH 4PJAF 2Z8WC 1JDDA 2JFCA 2UZXB 4N2KA 4PB9H 4Y4KA 1N0XL 1B0IA 1USZA 5F1NA 2IADB 3KPRD 1BJ8A 2KPWA 3CIAA 3CAFA 2PXYA 4QHMA 2PTTA 2YS4A 1B0GA 2KMWA 5E8EB 1EEQA 5FO2A 4D0BB 3BWSA 1LILA 2BVUA 2BP3A 2IBZY 2J12B 4Q2ZA 5D1QC 2IMMA 3S48A 3TIDB 1RZJH 4G5ZL 5ITFA 4HLZG 2ZYRA 4OW6A 1UOKA 3CC5A 3PV6B 5BVPL 2OJZL 1X7SA 4JQVC 1C8PA 3PJSA 2UXVA 5C86A 1PZAA 2UY7A 3HC2A 3B2DC 2CA4A 4YXKL 1MCHA 2E9IA 4XMKL 4LGSB 3GPEA 3N9GH 4L9DA 1A02N 4M5YH 1ODAA 1QP1A 4PJ7F 5E6ID 3C2SA 1NM4A 1YVLA 3O8XB 3G5XB 3OKNA 1TEYA 3P30L 2XWCA 4NPKA 1ZLWH 5C7XH 3MUGA 4MXVF 3EF4A 3KVPA 4J3TA 3CD4A 4W9ZA 4WRLA 2WBJA 1VGKB 5K93A 2O30A 1ZHKB 4BFKA 1QNIA 1GW6A 5CLWA 2IGTA 1FORL 1BLNA 1TVBA 2R1XB 4NFBA 4NBXB 1NCUA 1L3NA 4UTAH 2TSBA 2G4GA 2OMWB 3FO9A 9CGTA 2I24N 1K5NA 2L04A 3HTLX 5DD1L 1FV1B 4MNQD 3EBAA 3C6LD 4ODVH 2ZWLT 1AR1B 5FO7A 3HNVL 3GSRA 1BQLL 3ILQC 4OSUL 3LXCA 3CXFA 1CL7H 3AACA 4ABWA 3B9KA 4KXZH 4U6HA 3KPSB 2YD6A 3L4TA 4NP4L 5FCSH 2OJEB 3CHOA 1RU9L 5E1IA 1F8TL 4CKQA 5DVOA 2IAMC 2IADA 4H8PA 4JEGB 4BZ2A 3FQNA 1YEFH 1L9NA 4O5LL 4NUGL 2ZG3A 1DL7H 3QSKB 3CWGA 4LEBA 5E8EA 3T0DA 1YMHB 1VDGA 1XXFC 1EJFA 3TIDA 3A3YB 1HWGB 5CWSB 5HDBB 3SSGA 1KXTA 4P2RA 3SCMB 3X12B 2DQFB 2VN3A 2C8NA 4H8VA 3TLRA 4X5WA 4UU9B 2XVLA 1BQUA 3D0LB 2WQXA 3VD1A 1KEGH 2F5BH 4EEEA 2B4CL 2DD8L 5L2KB 4F8LA 4JDEB 1IKNA 2GEQA 2F19H 4EPSA 3VQ1C 4LRIC 1ZLEA 3O8XA 4PJ5A 2H45A 1A14H 3G5XA 2XQYA 3NVQA 1SM3H 1YMMB 4BQ8A 2DMKA 2OR8A 4KKCC 2WXLA 1VGKA 2ZOWA 1ZHKA 5C2BH 1WJ3A 2AJ3B 1X5MA 2VQ1B 1UACL 4TOYL 2BOLA 3QIUC 4G1MB 2R1XA 3WS6A 1JMZA 2YEVB 3LKNB 1M57B 2KLRA 2OMWA 2ZOOA 4TYUA 3WEMA 4KUCF 1J1XH 1RZIB 1FV1A 1ZVYA 1BZDA 1IFGA 3GTNA 2ZAGA 4M1CD 4M3KB 2OK0H 3ABKB 1CFBA 2FH6A 2XXGA 4M1DL 3DIFB 4MQTB 1WAAE 3Q6GH 4B5EA 1CGWA 4OFDA 4I87A 4AENB 2ZPKL 3QUMH 5ANHA 3P9MB 3PUCA 3CVIH 4YQXL 4JO8A 3KPSA 4PEEA 4UT7L 3IE4A 5F21B 5BW7A 2OJEA 1EO8L 1I1YB 1KLGA 2AEIT 4ZMPA 1U2YA 2H8PB 3ZE0E 1HZHL 1A6WH 1KPUB 4PJHE 2F2HA 2AK4E 2V7HB 1CLZH 2VLME 3R4RA 1TKWA 1E8XA 2F54D 4I18B 4TUKH 4XNUL 2JB5L 2FX9H 1OAYH 1V3MA 4GQRA 1ZLUH 2ARJQ 1QUNB 4KKAC 1L9OA 4KI5F 4GSQA 4XO9A 1YMHA 5E99L 3P0YL 4HEPG 3HW7A 1CE1L 5G5DB 3RIFF 1C08B 5CWSA 1VZIA 3DBSA 1F56A 2IBGA 4KX8A 4XN1A 4NS0A 2EVJA 4UF7C 5ALCH 5I1IL 3BP4B 2R59A 1CLCA 3IFNH 4UU9A 3VWKD 1GHFL 3D0LA 4IIZA 1NOAA 4JG5A 5HHMB 5IG7B 3BKYH 1SMOA 4S0TD 5HHOE 1Z9OA 3CUPA 4JO4H 1P7KB 3KYNB 5L2JB 4EI0A 4OIAA 5DRXB 5IHZA 3KBFA 5EEVA 4G8GD 1CIUA 2IV8A 4K3DH 1XBRA 2D2CC 4DP9X 4NQEB 4YFDB 1F11B 4KZEL 3ALPA 1B4TA 4Z6AT 4FXGB 1QQDB 3TA3D 1KN4L 4KDTC 32C2B 5TF1H 1YEEH 3LKNA 1AJ7H 4LGRB 1NCAH 3DA0A 3VB8A 2R56H 2XFGB 1XF3A 1RZIA 4LO9A 3GS4A 4L8CA 1ECYA 1JGEA 2VKWA 4DHLA 1P4BH 1CE6A 3DIFA 4NFDA 5LUMA 2DQUL 1IIKA 3S4SB 4G9FA 4FERA 4S0SD 4J3WA 5EU7E 3EYOB 1NIFA 1ETA1 1I1YA 2R0KL 2Y07H 1LDPL 5KYWB 5CP7A 2H8PA 1A7PL 1IC7H 1QSVA 2VZUA 4MZIA 4F2EA 1KPUA 4LNVA 4RWHA 2V7HA 1KXVA 3NJHA 3KPMB 4ODWB 3CFBA 4I18A 4LCIL 1ZWIB 1JK9A 1G84A 4N90D 1KGUA 4IKKA 1ZT4A 2CLVB 5EUOB 4UV4H 1QSED 3UG5A 2RTTA 1QUNA 5D72H 5AWNL 3AREA 1NOLA 1F4YL 2LHAA 1I8MB 2H6OA 5AOLA 3FH7A 4FADA 4AW7A 3MV8D 2JJVA 4YHML 3E2HB 1ZE3C 3CSYB 3RPBA 3BE1L 4I1RA 5I76B 4AEIL 4ZUSA 3BP4A 4TVPH 2BVEA 3GSOB 3VSUA 3BAEL 2VUOA 3NSFA 4D0CA 1JV2A 5IG7A 2MTAA 2AQPA 3QULB 5EPMB 3F64A 1KEMH 4QD2E 4AYSA 3VRJB 5L2JA 3KYNA 5FYJH 2YIHA 5D7JC 2FLRT 5DRXA 4WEMB 1L9RA 4XOAA 4OY9A 4U7KA 3UYPB 1RJZB 2NY5C 1K8IB 5IMKB 1WGVA 5D5ME 1CGSH 3T4AA 1E5YA 1F11A 1NUGA 5F7HA 6CGTA 4FXGA 3TBYB 1JWSA 3IRPX 1Z3GL 2ZCLL 32C2A 5ABDE 3S34H 3B9VA 1NCJA 5CINH 5BZXA 2BIMA 3T6ZA 4FZ8L 5B1BB 1NFDE 1RPKA 4QT5B 4U6XB 1Y0LB 3HAEH 2OW7A 4XPHH 1TQVA 3NSJA 4PPTA 2K0RA 3P4MB 2V2TB 4U1MA 5DJAA 4GS7B 4IRSB 1JXFA 1G0XA 1H8SA 3EYOA 3KPPB 2WWMD 1NC4D 4RGOL 1LO4H 4PJBB 1NWOA 2H9GA 3HR6A 1T1ZB 3SGJC 1WG3A 4YXLL 4PRIA 5DD3L 2VN6A 4GOSA 3UBFA 2WOYA 4TV3A 2A4ZA 1PMYA 3X1BA 4R26H 4WWOA 4ZODA 4MZRA 2EO9A 1Q38A 1ZWIA 4CKVX 1IKFH 2VABB 2CLVA 5EUOA 5KZCD 2O6FA 1T66D 1C1EL 1WBYB 2WYZA 4ELMB 2WTOA 4K3EH 4BINA 2VLLB 2XXFA 1I8MA 3LPOA 1YO4A 1NC2D 3RNKB 4ZAKB 3L95B 3CSYA 1MFCH 3M7OA 3RGHA 2CXKA 3EF7A 4UZGA 5FGCE 4XBEL 5F7EL 3VFUB 3CZEA 3QULA 4TKWA 5AKVA 3IKCB 2FGWH 3IMTA 2B9BA 2JF1A 4IMKC 3FTSA 3QNZB 5HYQB 3LZQA 4GXVL 3RPIB 3L5WB 5D96C 5DRNB 4J2XA 5AVWB 2F8IA 3D4GA 4N87A 1CTNA 1NM9A 1IFHH 1RJZA 3JWOC 4YWGL 3UYPA 1K8IA 5IMKA 3IAPA 1I8LC 3MODH 2PR9A 4R2GD 3CPUA 1SXCA 1BJ1J 4W9EC 3QDMD 1R3JB 4U1GC 3TBYA 2J1WA 4DP2X 2NPLX 4K9EC 5HI3D 4P2AA 5AKSA 3ULSB 4EVNB 2C3HA 4KH9A 1PG7X 3V4VH 4QT5A 2BXYA 5DVPA 4U6XA 4ZDHB 2EE9A 4RZKA 4JHWH 5DURD 5HY9B 5KVEH 3HZMB 3DVIA 2FEDC 5GRVK 1YN7B 4FP8H 1GSKA 5EN2B 2V2TA 5L4JA 2QTVA 1B3JA 1OAKL 5JA9A 4WWPA 4IRSA 4HUNB 1FH5H 3KPNB 2CH8A 3A0OA 4HWEL 4PJBA 4LF3B 1T1ZA 4WUUB 2BS8A 1J10A 3EO1B 5HTSA 3KWUA 3QEQE 3MLUH 4AKOA 3NABH 1U2HA 3APDA 1HXKA 3K8KA 1CC3A 3BPCB 4RWYL 3KHQA 2IWEA 4ADGA 3DO7B 2AQNA 2EP6A 2VABA 1MFUA 3SGKA 3QYMA 4XNYH 1WBYA 3WDIA 3BGAA 3CFMA 2E7MA 2FRGP 2VQ4A 4PMFA 2BFVL 5IQLA 3BQUB 3RNKA 4ZAKA 3UAFA 3QIBC 5HDRA 1I3GL 4NWTH 5EU3A 1CFVH 4Y4KC 3ESVF 2VDOH 4JFHD 1VFOA 2XZAH 4CVZB 4Y9EA 2Y72A 3FW6A 2VSCA 2PXYC 4L48A 5ANMB 3VFUA 5L8JB 4LL9A 1FL3B 2VZVA 4TN9A 2EYSB 2HT4D 3DPBB 3IKCA 3QS2A 4GINA 4HV8A 1NBVH 2QR0A 3UADA 2E4TA 3K8MA 3QNZA 5HYQA 5A2CA 5DD0L 3RPIA 5CJOL 1AZUA 3L5WA 2YUZA 3IJSB 5KTEH 3SODB 1YNKH 4AQZA 5KVFE 2BVTA 4I2XB 3TEXA 3NCWA 3OKLB 5BS0D 1R3JA 3PWLB 3S3BB 3AS1A 3UTQB 3NTCH 5LKNA 3IAGC 2AW2A 5AOJA 3ULSA 3OV6A 1OTUC 2FT6A 4EVNA 2BXZA 5K9QG 1DQMH 5KVGL 1NGWB 4ANXA 1AGCB 3DTUB 4OJEH 5J1AA 3SY0A 2OV0A 1N26A 2P5PA 3RZCB 4ZDHA 2P5EE 4H0LC 5TQ0L 1XR8B 2KL6A 2YUVA 3HZMA 1E3XA 4JFQB 1AYOA 5EOQL 5JIQA 4I13B 3BAKA 1DN0A 4FFYH 4HCRH 5KSBE 1A7OL 3I6KB 4Y9CA 4Y5YB 2WBJC 4EXPX 3KPNA 4CJ0A 2CR6A 4DK3A 5F2FA 3E1F1 4UZSA 3QFJB 3QRGH 4RMWA 5IGXL 1KIQB 3EO1A 2P47B 3UCQA 2OI9C 4XXDB 2NXYC 2EZ0D 5AAMA 2XV6B 3GMMB 4PJGA 1KENH 4X6CA 4OKDA 2FJSA 2PKDA 4F8TA 3DSFL 4MAUH 3UAEA 4B9PA 1ID2A 2E76C 2Y5TB 3F65A 3VA6A 3BPCA 4WU5B 3VDAA 4B0MM 4NJAL 2P5WB 5I28A 2FTAA 2W65B 1BGXL 3MRDB 4R4NC 1S7UA 3S35H 3KJ6L 4JQIL 1EAOA 5T3ZH 4AX3A 1DE4A 5KBKA 1SEQH 2MNWA 3B9KC 1JOIA 4NCDA 3BQUA 3HMXA 5D7HA 4Z3GA 4YLCA 2Z3FA 2PWEA 4I5BB 2G3ZA 3CZLA 4JKMA 4MBRA 4XGZB 5E1HB 3VXRE 4CVZA 1X3DA 4D7PA 3LSOB 5ANMA 3V0DA 4QJ5B 4XNMB 1FL3A 3L17A 2EYSA 2WMPB 5IEKB 1KPRB 3FU3A 3W11C 4CSSA 1JZEA 3PS6A 2OP4H 2WOBA 3QE5A 1HKFA 2QKIA 3MXWL 4DPRA 1C9SA 2OZ4H 5FGRA 4CJ1A 3DJ9A 4G6JL 3IJSA 3BAXA 4I2XA 1G6RA 4M7LL 2NNFA 3P0VL 3PWLA 4WFGD 3UTQA 3J07A 5I5IA 5LQBL 5HVFB 4OZHB 4JZJB 4XC1H 5LN8A 3TPUA 4ZFGH 2MCPH 3RZCA 1SHSA 1IKNC 1XR8A 3UABA 4AJWA 2VLKD 3AG3B 2O72A 3II2A 2G2RB 3JBG7 2JI3A 1O0VA 3O8XC 5DQ9B 1ZLVK 3RVTD 3S5LG 5C0AE 5B3NA 4X6EB 2HPTA 1U8HA 1SYVA 4Y5YA 4CN1A 3NJLA 5DF0A 2H5UA 1P5UB 3NJMA 2O5XL 1KIQA 4FQ1L 4NO2B 3D0VB 3WS6C 4H7VA 4NN6B 4XXDA 3VH8A 3GMMA 2I25N 1CFSB 4XB7A 3MV11 1OCWH 2CWRA 2N1KA 4WU5A 4AW4A 4QAMB 5BZWB 2W65A 2YFNA 4IK6A 2D73A 4B9FA 2J1YA 5F96H 4R7LA 1T6VN 4YHLL 1OAXL 2CLZB 3HZYB 5HGBB 2JIXB 3GMLA 4O2CB 3MV7D 2GC4C 3HG1D 5A2JH 4TSBH 5BW7C 4G43B 5I1KH 3MRKB 3AWFA 3NQIA 3ZSSA 1CXIA 3QHZL 4I5BA 1SLWA 4XGZA 3GIVB 5DJ0A 5ESVB 1IC4H 2HKHL 1IGTB 4XT1C 4UT9H 1J5IA 1NH6A 4XNMA 3VXOA 1ITCA 3SYCA 4Y16D 2P52A 2GFBB 1IBBA 1MCWW 1KPRA 3WAKA 5IEKA 3FQWB 3GSUB 2VDNH 2LU4A 2Y1AA 4AIOA 3KYKH 4LSQL 3U36B 1M9WA 2RCSL 3CZKA 1KTLB 1JZ2A 2I9LB 1UT9A 1J5HA 2GBAA 3GHBH 3FHAA 4P4KD 3GK8L 4YXHH 4JZJA 4M7ZB 3ZZSA 3H9SB 1I9RL 4XPAL 4FULA 4Y2OA 5AOKA 3RRQA 2YR3A 2EINB 4XOCA 3V8OA 1XB3A 2HJKA 5GGSA 1GTFA 2K3TA 5J6HB 3ML8A 2VDPH 1FDLL 3FUMA 4KROC 4J3UA 4F7PA 1PKQB 3SE4A 4X5LA 3ZPDA 1MFDL 1P5UA 3W2DH 3QWNA 3LNFA 4Y1AD 2NW2B 1ZA3B 1N6VA 1T83A 3D0VA 3LNEA 3SYOA 3DX9A 4H8WL 4R96B 5EO1A 2BWDA 1GXEA 1S7RA 2W9LA 2JKJA 1PBYA 4G82A 3LCYA 5JUEL 2W0LA 5BZWA 3AC0A 3VDCA 5D7KE 1VRSA 1Q0XL 5D7LB 4RCAA 4UAHA 2Y25A 2CLZA 5C09D 3U7YL 4WWKB 1NCHA 3A24A 3BI9X 3CBJB 5I8KL 4O2CA 4HAFA 5GGUB 3VU1A 2D7NA 2CLRB 4UTBL 3RTLA 3N44F 4G43A 3MRKA 2AERT 4E0RA 2J72A 3TM6A 4LAQL 4UQBA 5GGSY 2ZD0A 3MREB 4XOBA 4ZPVB 2MPAL 4JJ5B 1KXVC 4FQ2H 4I18C 2WIIB 2FD6H 4KDWA 2GFBA 3JWDL 3EJJX 3PHAA 4P06A 3A6CH 4TTDC 3RX8A 1QFWH 2YPLE 3FQWA 3GSUA 2VR6A 3JWNG 3PV7A 2FWSA 3AREC 4XB8A 2Q3AA 3RA7H 2X10A 1O5PA 1WP6A 3VXSE 3ZTJG 2ADIB 3U36A 2L8AA 2BX5A 4FJ6A 4BZ2H 4ZX6A 4PJDB 3WCYA 2I9LA 1L9MA 1UXWA 1SBBA 4ALAH 3A4FA 3D07A 3DARA 4HZ1A 3HC3L 2RALA 3GBDA 5IEHA 3IS0X 2AEQL 1AZNA 2KZBA 2VDRL 1XCXA 3TESA 4HG4J 1YEHL 3H9SA 4XCEB 5GS0D 3QPXH 4ABUA 5D8JL 4MJ6B 2MKLC 1U8CB 2DYRB 1EJOH 5GISH 3WO3B 2A6DB 4HBCL 3STBA 5J6HA 4XNBA 3KJ4B 3O4LE 1BZ9B 3X3GL 1PKQA 1JV5B 4ZS6D 4S1DC 3T4AC 3AMKA 3ARDD 4OCYL 4MGXA 4FXGC 4NPYA 4Z7UB 2EH7L 1ZA3A 2JMRA 1HE7A 5KUMA 3CFJB 3U0WH 3RWDB 1KSRA 1UM5L 4R96A 2KT6A 4KVCL 1BQKA 1RJYA 5AW6B 1WAAF 1H3VA 3AAZB 1AD0B 3CFQA 3VFTB 1MFAH 4GMSL 1ASPA 1KY7A 4L0YA 2D7OA 2LABA 1EAPB 2FAUA 4BYHA 3MACH 2NXZB 2GBVA 1O6VA 4Q14A 1UWXH 2YRBA 1UOWA 3ZE0F 4YEFA 4PJHF 2CLRA 1JTPA 4G6MH 4A04A 1HC1A 1RZ8B 4ZTEA 1JZ4A 3GKWL 1GJWA 4U6VL 5I1AA 3IDXH 2PLTA 3MREA 4FNTA 4M7JL 4ZPVA 4Z0BH 4P07A 3TNNB 5CUSH 2Y6TE 2FNWA 4JJ5A 3Q5YA 2K1MA 2WIIA 3KLHD 3C08L 4FA6A 1CD0A 3PFUA 4B50A 1E5CA 3DUSB 3U2JA 1JYNA 2ADIA 2JCCA 3OJ2C 2CG9X 2HG5A 2YWZA 1Z6JT 3CNKA 3E2HC 4PJDA 4N0YL 3WNJA 3I6LE 3PDDA 4YDKL 3LN4A 1VEMA 3Q8BA 2CGRL 4WDIA 5C0CB 2B77A 4R4FH 5AALA 1OF0A 2BP0B 3B2UD 3EDKA 4QRFA 4WGVB 1N4XH 2WZPA 4CC4A 1ZS8B 4MJ6A 5AAPA 3MLPA 2J4WL 1CLYL 2EYTB 3OZ9H 2I5YH 4OCNC 3VTTA 1U8CA 1G9ML 2A6DA 3FAXA 1H3XA 1FGNH 3LZNA 1BZ9A 1FI8C 4P5KB 4FQLH 3R1GH 4KK8D 2P80D 4TRPL 1CL7I 1IT9H 3UCRA 5LN4A 4Z7UA 1J8HD 4KXZI 2FATH 3RWDA 5TH2B 2P43B 4IU3B 4RLDA 2E74C 1DBKH 1A1NA 1U4EA 2KH2B 1ASQA 5IHWA 2EE6A 4DP6X 4ZW5A 3AAZA 1AD0A 2V4LA 3UTTE 2WB7A 5I1EL 3OVUB 3M1CA 2R0LH 4FTDA 1ZIAA 2WLYA 2YN5A 3MV01 4TUOB 3QJFB 4QHNB 5GRUL 5FFOA 1ILUA 4EKXA 4JFFA 5SWSB 5T33H 1T03L 2JE8A 4GS7C 1PLGL 4IRSC 4YN3A 4LGPB 5KOMC 1I7RA 4PP2B 1TPXB 4WSGA 3UPRB 4OFVA 3MI6A 1RY7B 4ODSL 1OTSD 4EI5A 2ADGB 2WWKT 2V5RA 1J9CT 4ZD3H 5JO5A 5LWYL 3L2MA 1WS7A 4W9CC 3QR2A 3DKHA 1T1YB 1WITA 3FRPA 4H0IA 4NHUB 3SGKC 1ZHBA 3QK0A 5C0IB 1U42A 4OZGE 1MJJA 5D2LE 4Q9RL 3T0AA 3E6FB 1NOFA 4NN7B 4AYGA 3DUSA 4GQ9H 3VXTB 5CS7A 2D03H 3MROB 2EDXA 4LLAA 3HNSH 3MRJB 4V1DE 2QBWA 2Q5BA 4ZAKC 4GIAA 2HKFH 2HB0A 3QCUH 4NBYB 4N0UB 1L6ZA 4JPVL 4Z7WB 1KCWA 1JWUB 1MNUL 3CDZB 2DLFL 4P5TD 3PABB 2WLJA 2WLIB 4F1ZA 2NY6B 2XETA 3AY4A 5F3BB 2NRDA 4JRLA 3QDGE 2R8SH 1ZMYA 5TTRA 1CUOA 1ZS8A 5C0FA 2GY7B 1LO3H 4MA8H 4MJIB 1SJVA 5D5MF 5I24A 4L1LA 2ZX5A 4MDJB 2ZX8A 1JZHA 1XCTB 4HCIA 1VZHA 1MOEA 3V4UH 4HUWB 4J6IA 4MCZB 4FLQA 1NFDF 2UZPA 2WXPA 4DKDC 4RFOL 5CGYC 1R3KB 1ANUA 3EDDA 2YKLL 5TH2A 1IAIH 3B6SB 4NKIL 4A6YB 2WTRB 3OHXB 4X7SL 1CFTA 2MPVA 2QQKH 3D85D 5C0JB 1J9TA 3V6OA 3TH2T 5F9DC 3VMNA 3US1A 2D3VA 1N70A 3DNKA 2F68X 4TUOA 4UOJA 4D9RD 2AI0H 1QG3A 4QHNA 4MKTA 3OX8B 1FNAA 5SWSA 2YEZB 3HLKA 3DTXB 1ZHNB 4O2EB 5KYNA 1VADB 2BOCB 4U1SB 1T0OA 3UPRA 1CDBA 1FZOA 5FHAH 5EBGA 4MAYD 2AXJA 2VN4A 2VLRE 4B60A 2A9MH 2ADGA 3HRZA 2Q7YB 1XB6A 3ZL1A 5AAMC 4FS0A 2NOYA 2VZSA 4OCXH 2EQDA 2X9YA 2GTZB 3H42L 3AQZA 2F1EA 1Q90A 2VW7A 5HHQA 4D7BA 1T1YA 3TFKD 2R4SH 4NHUA 5JXEA 4PGCA 5C0IA 1CR9H 3FT4B 1NCDL 1NMCC 5DA4A 4N1HB 4JY5L 4Q9CA 2UXFA 3RFRA 5LAXB 4QRRA 2R51A 3VXTA 3RKDD 5D7SL 4X6DE 3FH5A 3MROA 3LS4L 2GIMA 5T3XE 2X9WA 3MRJA 1JGUH 2Y6SD 3BQUC 2OCCB 3NCJH 5KG9B 3BFWA 4BXSV 5TE6L 1ADQL 1PG7L 1OP9A 3QRLA 4NFCA 3PABA 4Y9FA 5T1MA 3ULVH 2WLIA 4DGIH 2DQCH 3IBOA 3FQ2A 3TJPA 2VR9A 1KF9B 3SDYL 1IAMA 3RURA 4DTGL 2CMRH 3LZPA 3SYAA 2QKIC 4WJ5A 5J12C 4OF8A 3DXAA 4X0NA 1EHLH 4K23L 2V8MA 1XCTA 4O2FA 5F0LB 2Y7QB 4OKVB 5FUCE 4PTTB 4KC3B 1AKJB 1UFGA 3H3PH 1NCCL 3I6GB 4NNYA 3B2XA 1ETB1 3B6SA 1AG0A 2ZUTA 2DQMA 5GZNA 3O6FA 3TBCA 4LESA 3RZCC 5C0JA 4QWWC 2AEPH 3FXIC 2VL4A 1ROWA 3DIVA 3C5XA 4FQPA 4WY7H 4ZOEA 4UT6A 3F3HA 5DFVD 4EIGB 3ROOB 2BNQE 3OX8A 3FO0L 3G04A 2YEZA 3SJVB 1A4BA 2GABA 5J9PB 4Y5YC 1ZHNA 4UQIM 4RFNB 1VADA 4U1SA 5C0NC 2J88H 1I8KB 1X5KA 1JGLL 2CBPA 4Y1SA 4JG0L 3MRBB 3BT0A 3LB6D 4HUUA 2GTZA 3KDPB 3TCLB 4I0KA 4LSRL 1QBLH 2XWZA 4HS6A 2R15A 4DP4X 2DRUA 1CYWA 1CU4L 4PGBB 2I60H 5LAXA 1L7IL 1ICTA 4MYPA 1MH5B 2VTFA 3GT6A 3EYFB 5KG9A 2WUBH 2VXQA 2XYBA 3K4AA 1WEJH 4WLCA 3JV0A 5CO1A 3BN9C 3UO1L 5JOPE 2WP3T 4HPOH 2NYKA 2WO3B 2X2IA 4Y88A 3WY4A 3Q06A 1Y1DA 1HJCA 5E1AA 4NPJA 3ARRA 1PX8A 3QUGA 3KAAA 4JG9A 3VDBA 1N3NB 4DGYH 4QCIB 4YGAB 4D8OA 1NSNL 3HE7D 3GI8H 1IBGL 1AGFA 1DQDH 3KYOB 5DC2A 1IARB 5HYEA 4V2BA 2BW5A 4OKVA 3HHMA 4IBSA 1UTDA 4PTTA 3DHPA 4B9GA 4XPBL 1T04B 2F1AA 4KJWC 3ABZA 3H2WA 4R84A 4XP1H 4JZJC 1SRDA 1OD7A 5H2BB 1RIHH 4AUJA 5KSBF 3LZOA 1TTGA 2IBZX 4RMUA 3N40P 2ZKYA 4CA4A 4LVNB 4NKDA 4XR8C 1GGCH 3H53A 3WLBB 2Z91B 3ROOA 2H32B 4PJIB 3SE4C 5J9PA 4G42B 1DQLH 1P5UC 5E6ZA 3NJIA 1I8KA 1T83C 3R19A 2I26N 4XAWH 4XI5D 4UILH 5E5UB 2YC1B 5FA4B 1N5AA 1J0KA 4MDRA 3TCLA 4P23D 1QRNE 5EB9A 3FCGA 3M8OL 3B5GA 5E2TH 1KJ2B 2FEEI 5J6SA 1QACA 1GR7A 4ODVL 4PGBA 3RDTB 4YSSA 4FFVC 1X5XA 1SXBA 3EYFA 3LEVH 5FLUA 3N1FC 5E4AA 2DTML 4XTRD 3RBGA 2HUEA 1OOWA 3T0BA 3O2VH 3MGOB 1T22B 2BC4B 1TTRA 3RVUC 3CLFL 4AIXA 1RJLB 3KL0A 2Q10A 1FYHB 3NG5A 3O81A 1L3WA 1N3NA 1WUNT 4X8GA 3RQ3A 4LPVA 5C07B 5DMGC 4QCIA 2W8CA 2HFFA 5L9DL 3F6LA 3KYOA 3MLSH 4ZSOE 2BERA 5CHNB 4HFWB 2EIEA 5KVDE 3BKML 4PY7A 1LMKA 5GGVY 1BQHA 1URZA 5ALBL 1T04A 5M95B 5TK4A 3RTQB 3ZE2E 3MGTA 5H2BA 4BFFA 4FNLL 4OCSL 3WEAA 3WN5B 2EIMB 1NEZA 1HHKB 3IDYB 2JKIS 2YRPA 5HVHC 1U8MB 4XOEA 5FKAB 3GXIA 4PW9A 5F8RC 3WLBA 2Z91A 1BW8A 2FYYB 4PJIA 1XGQB 4G42A 1I1AD 1VFAB 4E41D 1CICB 1E9PB 3VW3L 1AOZA 1MREL 2ZJSH 5AD0B 3I75B 1NQBA 3QXAB 4EE2A 2FJGB 3R7RA 2YC1A 2K7QA 2KKQA 2COVD 4TULL 2HT3C 1OGAB 1P6AB 2BSTB 4ANWA 2PO6D 1MSPA 4IYKA 1HDMB 4FG4A 2HA1A 2F7RA 3QJQB 4OUUB 1ILSA 4B96A 1IGIH 3J8F7 4N20A 4X4ME 1FNSH 1ROCA 2DWEB 4G8AC 1S9WA 4DQOL 2X4PB 3MGOA 4UQ3B 2BC4A 2CIIA 4F15B 1BFVH 2FQFA 4JM2B 5CCKH 1RJLA 5DS2A 1CXLA 1Q72H 1K6QL 4JFDB 1RSYA 2GHZA 1QWHA 2NX5E 4HX1A 5GJSH 15C8L 3VFWB 3CDCA 1N64H 2JJSA 4MDIB 3GSNL 3BFOA 2CDFB 3EBGA 3GLAA 4NHCH 1IILE 1JSYA 4P2RE 4FNPA 4Y2DA 1MRDH 2A83B 5CHNA 4ONFH 3FCTA 4PMEA 4GBXA 2BO0A 5LCVL 5E7FA 4AXWA 1A7BA 1CPUA 4I0PB 1PPIA 5DD5H 4EDXB 1KCUH 4M00A 5HP5A 3HZKB 1MCWM 4OCWL 4CC4C 4I9WE 3E80A 3Q01A 2WBXA 3DJRA 4NLHA 1HHKA 3EBIA 1S5HA 4PJ5E 3FTYA 1U8MA 3K0WA 4KJPD 5FKAA 4BH7B 1JUFB 3S3JA 4POZC 1UXMA 1XFPA 1XGQA 2AP2A 1JXKA 3ARSA 4IBQA 4LLYA 4W70A 3MV9D 5DJ8B 4PG9B 4F27A 1NLBH 1CICA 4BFEA 1SHMA 2K6ZA 3FUNA 5AD0A 3ZBMA 2EIJB 3I75A 3QXAA 5EEZA 3RAJH 3NGBB 2Q87A 1FFRA 1FNEA 1Y6KR 5HPMB 1WH0A 5TQ2L 4KQ3L 1OGAA 3ZDZE 2BSTA 2CGZA 2A99A 1A8ZA 2ZP0T 1MQ8A 4PAZA 3U1SL 3DHUA 4M43H 1SHXA 2NXZC 3AM8A 5J0BA 4KGJA 1P4BL 4OUUA 4KXCA 4JZNB 4CW1B 4EI5C 3HA0A 3TJHD 2ZWSA 5HSFA 2EVIA 1L9PA 2K6YA 4LARL 4L4TB 2WWOA 1IBFA 5DXWA 3KWXA 3IMSA 3PWUB 1PJ9A 4QGYA 3SKOB 4G3YH 4Y2NA 5A6MA 2F5AL 5ID0B 4JM2A 4PJCB 3T6VA 5AKTA 4OBRA 3KE0A 3KVQA 2AZAA 3PXLA 3TN0D 3ULUE 3RIAK 4MDIA 4QHUB 2P46B 1SDDB 3N42F 1XT5A 4MS8C 2CDFA 4FFZA 4W9HC 1QA9B 4XMPH 2ADFL 3KLDA 3CVBA 1A3ZA 2A83A 5HI4D 1GY2A 3W5NA 4YSDA 2X4UB 1H3PL 4WV1A 2QZQA 1DSFL 1BZ8A 1W91A 3AY4C 4JN1H 4I0PA 3NP3A 4IU2B 1TJGH 1G0YR 4R0LA 3HZKA 3ZE1E 1R9FA 2Y69B 3EHBB 4Z7IA 2XWJB 5CU9A 2VDKB 2BVPB 2IOOA 2K9FB 1RD6A 4MCMA 4LIQH 4OI7A 1K72A 2EDYA 2EXSA 4BH7A 2VIRA 2QGDA 1NIEA 1JUFA 1QAWA 2NSMA 3ATBA 5GS3A 2BK8A 3S96B 2L7QA 1LO2L 2ZUUA 3VXMD 1RZQA 2AQ1A 5DJ8A 1XSJA 4PG9A 4GKOA 1QUPA 1DFXA 1QFOA 1YJDH 2XIDA 2C9XA 2X87A 2YAMA 2ZWZA 3NN8B 3LH9A 5B1AB 5C6TH 2X4TB 3KPRB 2GJRA 3VGBA 3H4FA 3OBAA 3DDFA 4CMMA 1E6JH 2CUIA 4M8RA 3IDJA 4JLRB 3V6OC 1QPKA 4HU8A 2Y7SA 1VEOA 1EZSA 4P2QD 3QUYD 4G9FE 3WUZA 2DBLH 4N2LA 4XVTL 4FYSA 3MRNB 5IUSA 2NY4D 2J7LA 4CW1A 1TPXC 4UNVA 3BEWB 4P59H 2AJVH 3HRZC 4ONHA 1RZGB 3NJVA 4ORGB 1SUHA 3ETSA 2CUMA 3PWUA 3QQNA 3T77A 2Q7NA 2J20A 1QNZH 3KH4A 5ID0A 1MCPH 2BM3A 4PJCA 5HGDA 4D2NA 1OE3A 1N6QL 4M6OL 4WI7A 5JXEC 2EACA 1OLZA 1N59B 3LIZH 4S1QH 1DZ0A 2R1YB 4YZFE 3VXSD 4NN7C 1EXHA 3DI2B 2IH8A 1HVXA 4BSVB 2BY0A 2XG4B 1MLCB 1NDGA 1DBAL 1BZOA 1H6TA 2IFFL 1ZTMA 3DSNB 2LTQB 2X4UA 1M2VB 2F6AA 2BP8B 2NY6C 1BHGA 3SPJA 2QVTA 4JRXE 4K8RD 5CEZL 3NCEB 3V9CA 4DKTA 4OLZL 5FYLE 5A7EA 3BWUF 3I3BA 1ZGLP 2XWJA 3V4PB 3SBWA 2BVPA 2VLJB 1E3FA 3U48A 3KHOA 1D6EB 1CXFA 4BUHA 1G7LA 2TAAA 1J11A 3S96A 4Z7QB 4B95C 2F58H 4JJHA 1HS6A 4RISH 5GRYA 3NN8A 4HXBH 2D4DA 2MWCA 2XY1A 4PJAB 4L4VB 3B37A 2X4TA 3KPRA 4P5MB 4K3JH 5A43C 4DN3L 3GLZA 4EDWL 5GZNC 1UUNA 3O6FC 4XCFL 5IVZB 5JHDB 2VH5L 4JLRA 1BD2B 3EJZC 1IGCH 4RGMC 1ZIBA 3K1KC 1FRGH 2PYEE 3LV3B 1SY6A 3QCTL 4I3RL 1E8ZA 4GKLA 2XA8L 3MRNA 1A4JB 3MLZH 1G7HA 1QFWI 5JW4M 3UH8A 3CFCL 4EO5A 1ORQB 4XE5B 4PRIE 3BEWA 5KS9E 5HYJD 3ARGD 1RZGA 4ORGA 2Y1VA 3G5ZB 4PTUB 2G5BA 4KV5E 1EA9C 2JKLA 1UCBL 3VE0B 4OZGF 5D2LF 4X6BA 1ZLSL 3F00A 3L08A 3HI5L 5FPIA 1ZVHA 2OXGB 1LDSA 4X5XB 3FHEA 1FE8L 4QXTB 1N59A 3CCHB 3DMMD 3HG0A 5FIEA 4E2OA 5E6IA 1KDJA 1VENA 3GMQB 5AVXB 4ZTPH 3C5ZB 4PJ7B 1V7NL 1OSPL 2AV1B 4BSVA 1TJIL 3ET9F 2BJML 3I6LD 5GS2D 1FG2B 1ZXKA 3H6AA 2ALWA 3LPGA 3DSNA 3ZYJA 3RJDA 3EYUL 2BP8A 3LZRA 3B8SA 3RPKA 2AAAA 1UUSA 4UAOB 5H4ZA 2B9AA 2V2XB 1FNLA 3CC1A 3VX1A 3LRGA 4CN6A 3V4PA 3DPDA 2VLJA 3QEHB 1ED3A 4WNJA 1KBKA 1QFUH 1PZCA 1S5IL 5JIMA 4PRDA 1UD4A 5KBMA 3IDIB 4JCLA 3VRLE 1YEDB 1FNGA 3NT0A 1EUUA 2V5TA 2WZ0A 4L3ED 3CFKA 5GGTH 3ZLQC 5BO1H 3NYKA 5I15L 3PL6B 5DQJA 1UCTA 4FQIL 4L4VA 2FHCA 2MOGA 4PJAA 5F72S 4P5MA 3UTTD 3QJHB 2J1KA 3LQZA 1OSZB 2DICA 2PYFB 2A9CA 2E7BA 3BZFB 3EH4B 4G7YL 2NLJA 1NCBL 4LRNH 4N0FB 1XQ4A 4NM8H 5AVTB 1P4IH 1X5IA 3CZSA 4QF1B 3GRWL 2AEOA 3S5LB 4LQ1A 4AGMA 1BM3L 3WNNA 2FUQA 2Z31D 2NY5L 2P7TB 3K6NA 5EZLB 3RUGA 4XVOA 4BKTC 3RL1B 1C16B 1MCLA 4RFNC 3WFBL 4Z5RB 4NZTL 3SE8H 1ORQA 4FCHA 3NZHL 3OB0H 4GEJA 4LPUA 2FJHB 4NQUA 4AYEC 1NCWH 5F6IB 3BSZH 3G5ZA 4MQ7B 4PTUA 5C9JA 5TF0A 1A4CA 3H7LA 3VE0A 2JJUA 2ZXQA 4H5SA 5K69A 4OLXH 4X6DF 3KXFB 2FO4B 4UOW1 4X5XA 4EZJA 3E8UL 2QSCH 4JB9L 3CCHA 2XRAL 3WV0A 2XN9D 2WCPA 2C3WA 3GMQA 3OHMB 3VTMA 4E42B 4PJ7A 5KYUB 2W59A 3P4OB 4UBDD 4XN2A 4FMFA 1FSKB 3NJXA 1FG2A 4YLBA 2ROYA 5CZXC 1EZVY 4HDIA 2YAPA 1EEUA 2CO2A 5EIQA 2DMGA 3D06A 2ZF8A 4HWUA 4MHHI 4DGUA 2YAQA 2BDNH 4KKNA 1KB5A 2VITA 4UTCA 4KZDL 3TNMB 2V2XA 1E50A 2ITCA 2ADJB 5KJRL 1U3ZA 1O9ZA 2CO3A 2IXQA 3QEHA 4OTXL 2DOCA 4A55A 4IS6B 4NUPA 1YCSA 1J0ZA 4L18A 5IW6B 2VM3A 1MAKA 1QZ1A 4YDVB 1SLUA 1GZQB 2FB4L 2HT2D 2Z9TA 3IDIA 2YBGA 4AV0A 1YEDA 1CQKA 4EN2A 3K72B 4H25B 4NGHL 4JDVA 3PL6A 5EZIH 1CLOL 5IHHA 3ERXA 1OAZL 1CXHA 3QJHA 5IJVB 3P3UA 1MFBL 1CDIA 2F54A 2PYFA 4ENED 4N8PA 2WD0A 1TQWA 3T5WA 4N0FA 4ZS7L 1JVKA 1TENA 2XNAB 4LVNC 1C5CL 4Z76B 4RMTA 1JYXA 3S5LA 3JUYA 3CZNA 4RGND 3JWOL 3V79C 2F74B 3GD1C 3RL1A 1C16A 2AFNA 2V33A 4A6YH 5EOCJ 2VLRD 3PHQB 1HNYA 2QQLH 1RZKH 1U36A 3SDCD 2NNAB 2KDGA 4K9EL 3ARBD 2FJHA 4PJGE 3GMOB 3L7EA 3BVDB 4Y9BA 4L8SA 4X6CE 1RVFL 4MQ7A 4NAJA 4EZKA 4R97B 2H1PL 2I85A 1F2XK 5AYUH 1SLVA 2D3JA 1QPPA 3KXFA 1T5XA 2FO4A 1VGEH 2G9KA 3NZUA 4Y1TA 2ZWKA 3QZLA 5T3XD 3KGRA 1CF8L 5KYUA 1PLCA 5DZJA 3QH3B 1QR1B 1P84J 1RPQA 4LLMB 4NC2B 3UZQA 1UM4L 5K9JH 2BNRB 1BBDH 3FUHA 3IFLL 2E3VA 1OP5K 2RFXA 3TA3A 3FQ1A 3KPTA 2VN5A 2GB2A 1I3UA 3B7TA 4TQPA 5FFGA 5BRZB 3RWHB 3TNMA 1HCYA 1HESA 1IAII 1WLHA 4FQXD 5E5RB 3WXWH 1KTDA 3FPYA 3SGDH 4OZ4B 4HFUL 2JJSC 2VDLB 4UT9L 2H2SD 4RMBA 4IS6A 3BUQA 4NQTA 4TLUA 2ZNXA 5IW6A 4Y2DC 3HNTL 3FL7A 4JMNA 1GZQA 3Q8CA 4JPSA 3ZXAC 3TYGH 3DGGB 3MA9H 1KY6A 3K72A 4GBXC 4H25A 3UL4A 3OAZH 3KYAA 3WJJA 1TZAA 2GAZA 4FFTA 5I73B 3S5YA 2Z7WA 1RUQL 2TSAA 1DBJL 1P5VB 2FECI 5IJVA 3EKCA 4XC3H 4HLZH 4FG0A 2WKLA 1NINA 3IDYC 4JFYB 4YC2B 2ATPB 4P46B 4BFGA 1UZ8A 2WQVA 5F7DB 1IAKB 1U21A 3TBVA 4ANUA 4BA8A 2BVQB 1OALA 5CM1A 2F74A 2WLHA 5ETUB 1NC2B 2OKMA 2D9CA 1RPUA 3FT9A 1CICC 1FHNA 4AL8C 2NNAA 5I66B 5E2WH 3KBHE 3UTSB 3BAWA 4XWGL 3GMOA 1HILB 3Q1SL 2IV9A 3P4LA 1G9NC 3KPOB 4LCWB 4AKQA 3MRQB 5DS1A 5ESQA 5I1CL 5EORH 3W38A 2J73A 2AK1H 1EO7A 3MXVL 1GPOL 4ZZFA 4OUOA 3RX7A 1EHNA 3RLSA 5MEPA 1A9EB 1NBZA 4JFOA 1INDL 5IQ7L 4RA3A 2YGQA 1H8LA 4K94C 5GJTH 3AM8C 3QH3A 1QR1A 3C2AH 2EUXA 5E9DD 4MFHA 2CIKB 2BNRA 4NJ9H 2HTKC 4ZPTB 2WXGA 1HYSD 4WI2A 1NFAA 3A47A 5D1ZD 1KGIA 3T3PE 1S2EA 1T7WA 4OJCA 3B7UX 5GSVB 3FT0A 4DEWA 3VI4E 1NGZB 5EBLB 3MVSA 5BRZA 3IBEA 4KXBA 3RWHA 3K5RA 4F15C 4JM2C 1QHPA 1BVNT 5IROD 4LP5A 2KC0A 3VXUD 4Z1PA 4WIQA 4OZ4A 2BZDA 3DV4A 4FZEH 2GK0A 3FPXA 1ZDSA 3RVVC 5IZ7A 2VR3A 2ALAA 5CJQH 4FJZA 5CIPB 3MLRH 1JK8B 1XH0A 3ZE2F 4LXFA 3I50H 1ORSB 4HHWA 1A47A 4DZBA 4WV1C 2EH8H 2BSEA 4XRCB 3NZ8B 4JPIA 4I0PC 4BIKA 1PU0A 3BPLB 4R0LC 5CSGA 4DAGL 3MBED 2EKSB 4NZRH 2NY1D 4JFYA 4KBPA 4P46A 4PIRF 2ZOUA 1IAKA 1L0QA 2BVQA 1IC1A 1KFGA 4ZNEE 5L0QB 1N5YL 3GZQA 5ETUA 3M45A 3T08A 1NC2A 1ND0B 5GISL 2G75B 4WFFD 2JKNA 2AXHA 1Q9KB 4N8CH 4R6UA 1XEUA 1MRCL 3UTSA 3VFMB 3OXRB 3MBWB 1HILA 4K71C 5J7CC 5FUZH 1TFPA 1TQSA 3QG7H 4RX4D 1B0WA 3NGBC 3GBML 5F7WC 3RFZB 2DQTH 2KDYA 1P0SE 2WXMA 3HPLA 2HFTA 4LCWA 2QDWA 3MRQA 2H32H 3ZYIA 1E67A 3FN9A 5JMOC 1G6VK 3FCUB 1QSFE 3BFQG 1A9EA 5CZKA 1YNLH 3H0TB 2NR6D 4HJJH 4FQHB 3WNMA 1Y6NR 5B38G 3MCYA 2YAEA 1Q9OB 1U6AL 4OAWA 5DEFA 2CIKA 5AOIA 2JH2A 4ZPTA 1BREA 1VPOH 3D3VE 5BS0B 3VD0A 1KIPB 1LP9E 2EAEA 1JWMB 3QBTB 1NGZA 1KJ2H 2XC8A 3BHBA 4F5CA 3EADA 1RZFH 4MNGE 1GGUA 3SQOH 1M4KA 4EAEA 4F33B 4HBQA 5JHLL 3P3TA 4ZQKA 2XWBB 1R24B 3QPQC 1PVHA 1SJEB 2CSPA 4WEBL 4JE4B 3QUZB 1I53A 4BJLA 4KAQH 3R0MA 1OY3B 3F8UB 4I1PA 1W6LA 5D6CA 3U1QA 1U91B 4A68A 4CVUA 1DVFD 1BX2B 2YOCA 3ZTDC 3ZDXE 1ONQA 3NZ8A 3EJYC 4WW1B 4KTGA 3AXLB 3GHEH 4OB5L 4S10A 1E8WA 1BXAA 4MZ2A 3EHBC 3SBWC 1NGXB 4QRTB 3DROB 4HD9A 2VDML 1MHPL 1KGCD 1BZQK 1LJMA 3PJNA 1WZMA 1B2WH 1HHJB 3HMWH 1RMFL 1BEYL 4K7FB 4Z7AA 1KTBA 1KYOJ 1Q9KA 5I30L 1YY8A 3VFMA 2FL5B 3ZDZF 2TRYA 1J9RA 2E8ZA 3QQXA 3U4BH 3RFZA 2BS71 2SODB 4G80B 4MCNA 1ESOA 1AO7B 1G7MB 1LHZA 2OTUB 1DJWA 4PRPE 2O5ZL 4EQ2A 4GW1A 2JQZA 2ZUWA 2CO7A 3BVWA 3RB7A 5IOKA 2GJ6D 1Z9PA 2VOTA 4J28A 4YHNB 3X11B 3VFGH 3EOAB 2QGBA 1Q9OA 2Z92A 3QDJD 4PJ6A 4UWQB 2BWIA 4M5SA 4WFEE 3P3SA 5K9OB 1I9IH 2EIZB 3L3IB 4JRYB 5BS0A 4DW2L 1T2QL 3CN2A 4ERSH 3ULUF 4UQEA 1TITA 2K3HA 1MQKL 2X7LA 3G5VB 3BRFA 5F8QC 3OKOA 3PP4H 4XPTH 3TURA 1K4DA 4FTVD 1GYVA 2MCMA 5E6IC 4UNUA 5EU4A 5B7EA 1MIMH 1KXHA 2WLZA 3NJGA 2JCCE 2AQ3A 2XWBA 1R24A 3QZNA 4P8QA 1OEZW 4LSSH 1SJEA 3QUZA 3B3BA 3B2VL 1UA7A 1HL5A 1BF5A 3ZE1F 2XKUA 1U91A 2NY3B 4FXTA 5IJKA 4YHOH 4QTIL 1BX2A 2WZ5A 1W0VB 1XGPB 2XICA 4BQ9A 3B83A 1E5AA 5EC1B 1A8JH 1TTBA 3IJYA 4F2ME 4EIBA 3AXLA 2F15A 4GSDH 1ULVA 2DS4A 5DZLA 4QRTA 1N12A 4ZJ9A 4TMPA 3O6LL 2YLHA 2XX0A 1AHMA 4ZMQA 4FX5A 3NAAL 3BKCH 4R7VA 4TSAL 1HHJA 2O93L 3IGKA 4LVOC 1UWEL 1BVKA 1WD8A 3LNGA 2DWDB 3ELQA 2DAVA 1R47A 3REVB 4M48H 3H1ZA 3KCWA 4PJEA 4ECNA 3I02B 5E23A 3O2WL 1AO7A 2VXSL 2WW8A 1G7MA 3TU6A 2OTUA 1CFNB 3LQAC 3QXDA 1BVNP 2QPSA 3TO2B 4PHZA 2ZYHA 4MXWL 3MCKB 4JFFE 4UCFA 5T8IA 3C60B 3MMEB 2CKBA 1LE5B 2WYHA 4XXCA 4I3GA 4NRXB 4HJ1A 4YHNA 5JIKA 3X11A 4QXUH 4DVBB 2NQ3A 3CLEH 3OMIB 1Q0YL 3CHSA 4JGUA 3L3IA 4JRYA 1WFNA 1II4E 5C08D 4YZFF 5DJ2B 1KCSH 1JHLL 2A9ML 3IKKA 4FF9A 1ZLWK 1JF1B 3Q2LA 3MLWL 4J3OF 4W9IC 4AI7A 3T2LA 4NKOA 2R0ZH 2XWEA 3ZZQA 1EEYB 1SOKA 3ESMA 2HH0L 3K2UH 4J6RH 3D87B 4F57L 3DYOA 3MRHB 1MI5B 2BOBB 3D9AL 3NACH 3QCVH 4OD3L 3HC0A 5D71H 1T1XA 2ICEA 2ZXAA 5IB2B 4P49A 1A6VL 3QEGL 4LCYA 3TV3L 3WKML 2I9TA 1LGVA 1W0VA 1XGPA 4YE4H 2AHIA 1PAMA 3X14B 4PM1A 4N86A 1AZBA 4LSUH 4PP1D 4M1CC 4ICXA 1N9PA 2W9EL 1SF3A 1AKPA 5H37H 3U0TA 3FO1A 1L9SA 2G5UA 3BISA 4P3CH 3MAWA 3Q1EA 4M7KL 3KEHA 3GZPA 5DRWA 1ZLDA 2D0FA 4XNXH 5CSZB 1UYWH 4XCCL 3Q9PA 4PV9B 3A67L 4ZG1A 2DWDA 3QZWG 5C1MB 2QPEB 4H8QA 4DKEH 2VDKH 3PL6C 2OMYB 1G43A 4UV7H 5DUJA 4TPRL 1H3GA 3N6YA 4B53A 4IM8A 4N6RB 4GIPD 5D4QA 3V6OE 5I6KA 2BHZA 1CFNA 3TO2A 4CSTA 2DQIH 3CVHB 4UINH 4FD0A 3MCKA 3C60A 3C6SB 3MMEA 4XVUD 1FZKB 4TSCL 4AVKA 5KS9F 3VYPA 4NO3A 4NRXA 4TVPE 5MERB 3VD4A 4JUSA 4KV5F 3F5WB 4GAGL 1RUML 1JHTB 3PP3H 4FYQA 4K3HA 1OARH 3U4EB 4QHLA 1Z66A 3NCFB 2OMVB 4L8SC 5F6IC 4ZUTA 1HL4A 4C56E 4DVRL 4H88H 4PREB 3O3EA 5DJ2A 1FHGA 5FYJE 3VM7A 4PBWD 1UT1A 1Z0MA 5FS5A 4FMVA 3K6SB 4DO4A 1TTAA 3I9PA 4GW4B 3ABGA 4QRRE 3VGEA 4J3OD 1PCXA 3ECVA 2ZCHH 1MI5A 3MRHA 4YL4A 4JHUA 4JFZL 2JCWA 1HKLH 3LKQB 2BOBA 4MD4B 3IFPA 2IFGA 2R69A 2HWZL 2YD5A 5CR8A 3H9YA 5IB2A 2NDGA 4M93B 3UBXG 3U9PH 3TA3C 1JXJA 2PW2B 4FOMA 2V8LA 1RXLA 2LU3A 4I85A 3RVXC 2GHWB 5CAYB 4ETQA 4FLRA 3X14A 3KM1A 2OAAA 4PVBA 2ZX6A 1IC5H 4R8WL 4ZTOL 1SJMA 1G1OA 4JPKL 1OAUH 4M61B 1DTUA 4LPXA 2APBA 4PRHE 3BP6A 1XB8A 4J39A 4MA3A 1HEHC 3IDGA 3VRLF 3DXAE 5SX4H 7CGTA 3TV8A 1J87A 3KM2A 1FIGL 4AC2A 1KYDA 5I16A 4H13C 3MRGB 4LEXH 2CK2A 4IJTA 4KRMB 1HT6A 4Y7OC 5KANI 3EOYG 3IVKA 4JJOA 1MZYA 2DQHH 2F8OA 4AYFB 5CEYB 4JZOB 5TFSH 1G7IB 3N44B 1ZLUK 2OMYA 3TL5A 3WJJC 1UEMA 1W9XA 4TQIA 4E36A 2WXOA 3UJTL 5JW4N 1XZWA 1E8YA 1TJHL 2VXVH 4G9DB 4L1BA 2YBRB 1EXUA 4JO3L 4PJBF 1NGPL 1GOFA 1NAMB 3CVHA 3OF6D 5AW0B 3V6ZB 3QP3A 3B43A 5FOBA 2HVKA 1FL5B 3C6SA 3FCBA 3MUHL 4NC1C 1FZKA 4S1SL 3DVGB 3MLVL 3UG3A 2VR8A 5MERA 1ET8A 3MRPB 3VXPB 1N68A 1LO5A 3CXDL 3TVMD 3F5WA 3WFZA 3JV5A 5F0MB 1JHTA 1W6WA 2EEBA 1F4AA 3CQPA 3L3JA 1UVQB 4RSYA 3JTSB 2OMVA 4GT7A 4MA1C 4FA7B 4R97C 4PREA 3O3AB 3HVNA 3II3A 2IPTH 1QX1A 4XP5L 3HHSB 4BHUI 1MVYA 1QKZH 4FG6D 3NMEA 3WELA 4X7TA 5F88B 3LKQA 4MD4A 2DQEL 5F0JB 4KPHH 43C9B 1XCQA 2RBLA 4DFIA 1BPLB 4FQJH 3ARDA 1MCIA 3X13B 1KCRH 1YAZA 1DJYA 5I1GH 3U4AA 2PW2A 3LKPA 3HN5A 1UWGH 3U0PA 3BH8B 4HCGA 4BELD 4M61A 1U92B 2WXQA 3JWNC 4TNEA 1N0XH 1TETL 2E46A 2NMSA 5IB5B 2A6IB 3BP7B 3V0EA 3HMXL 3X3FL 1LEIB 4MB3A 3MJ6A 3MRGA 3CGTA 2WWMC 2ESVE 3ZE0B 4AITA 1D5IL 2ZX9A 4PJHB 2AK4B 4AYFA 3Q43A 1FL6A 2QHLA 1G7IA 4JZOA 5CEYA 2HYMA 3TOPA 5I73C 5KSAB 3LRSB 4G9DA 4G5ZH 4LLQB 3RGVD 1I4FB 3IDMB 2YBRA 2VXTL 4GP5B 5BVPH 2OJZH 3HG4A 3L3KB 2JKRM 4YC2C 1FFNB 4P46C 1R34A 2N0MA 2ZE0A 1NAMA 3ZO9A 1T66C 3VD7A 4YXKH 1UH2A 1FL5A 2DQJL 2EICA 4PIBA 3U6XS 3MLYL 3V0AC 3DVGA 3MX0A 4PJGF 4U6TA 5FLVA 5BVJA 4FN0A 4KKBD 4X6CF 1BEXA 7PAZA 4HK0B 1G6RL 3QUXB 4O58L 4XMKH 3UX9B 3FSOA 4W81A 4P5SA 3NZSA 1B9KA 1IEBB 2XJKA 4YSPA 1UVQA 2G3NA 3JTSA 4M9PA 1QWNA 1A6UL 1QLEB 1SGKA 3P30H 5HHOB 4D8PB 3GBNL 3O3AA 4UM9D 4EN3B 4AIEA 4PYHA 2FO8A 4XB3A 4K7PX 1XH3B 4K9JA 5I1LB 3OJVC 1FORH 2R29A 1JNLL 2XQ0A 3IU3B 2WUCL 1D6VL 3O6KL 4HJTA 5TGBB 1R75A 1UKSA 2C5DC 5F88A 4OJDH 4LLDA 5DD1H 4UQ2B 3FQXB 1SYSB 2P80A 3KD4A 4R2GC 3HNVH 3X13A 3FB6B 3CX5K 1WE5A 3UTPD 4PGJA 1BQLH 5GS2H 4OSUH 5HI3C 4PS4L 4OV5A 2G5RA 1OM3L 2OMTB 1TEGA 4D0DB 4J12A 5TPWL 1YZZA 4NP4H 1U92A 2ZG1A 2FYVA 3AU0A 5F7MC 2VYRE 1RU9H 4MVBC 1F8TH 3D39E 4XODA 4HOWA 4LLUA 2DKUA 5T5NF 4JREB 4Y5XA 2A6IA 2IAAC 4O5LH 4NUGH 2R23B 1OGSA 2NTFB 4KK6C 4U05A 1AXIB 4PJXE 3JTTB 3QFDB 2AK4A 5KN5A 4F92B 3VQLA 5BXFB 5IB4A 1PEWA 4J1UB 4AE0A 3LRSA 3VX0A 4WO0A 4HJSA 4OM1L 4R90L 3L3KA 4HWBA 1QO3A 3MJGX 4HT1L 2BSDA 1X9RA 5EO0B 3OKDB 4I77L 2IANE 2O5NA 4HK0A 2B4CH 2X09A 3E3QC 4L9LB 2DD8H 1MCSA 5D1XD 4CU7A 1IEBA 1UD2A 3K2MC 4P5TA 3BH9B 2XWDA 4F7CA 1JN6A 3NFSL 5FW8A 3RFZC 2NZIA 4D8PA 5DVLA 1E4WL 4EN3A 1XF2B 5J11C 5TE7L 5FHBL 3U79A 1DDHA 2AABL 3WY2A 2HT4C 3BVTA 2AS5M 4AGLA 2WBKA 2H1XA 3K8LA 1UACH 4TOYH 3D4YA 1R3LB 1ETJA 3IU3A 3T3PF 3NSCA 2HN7B 1FO0B 5D5MB 2AV7A 1QHQA 5GHWL 2GJPA 4UQ2A 3VI4F 1SYSA 4Q9QL 4DWHA 1AFVL 4M1DH 3WENA 3FB6A 3DO4A 4OQTA 5CN1A 1IC0A 4N1CA 1EMTL 4DP8X 1NFDB 3CN1A 5HHPB 2ZPKH 4D0DA 4RQQA 1MUJB 3D85A 3O9WD 4YQXH 5SX5H 4UT7H 4N0CC 2DLIA 1EO8H 1D5XA 1Q1JL 3OR7A 1HZHH 2ZOLA 1IAOB 2OR7A 3I2CL 5ICXA 3N5AA 5FB8B 4AVHA 1M05B 4H1LG 1EHKB 1JF5A 1XAKA 4HHAB 4XNUH 1TU2B 3QUZC 2JB5H 2R23A 3BPNB 2NTFA 2PPDA 4HMDA 4DEPB 4MAYA 1KLFB 5HBBA 1K9TA 5EDXA 5IJKC 2VKXA 3JTTA 3QFDA 3VSTA 4N2IA 5E99H 4BZ1A 1IQDB 2AC0A 3P0YH 5BXFA 1CE1H 5EOCL 3ZTJH 3WO4B 2XVKA 3G6DL 1CS6A 3HG3A 4JFUA 5I1IH 2WYIA 3PWVB 3I3DA 3BPOB 3D09A 3D18A 4TVUA 1JS4A 3D12B 4JFXB 1GHFH 1EO5A 3FFCD 5EO0A 2YPKB 3OKDA 5IESL 3CHQA 5IHBA 4L9LA 5CN3A 1NGYB 2NT1A 4BBWA 4ZFZB 1OCRB 2C9AA 5FGCB 3ATEA 4MMYB 3VSQA 2E7LA 3BH9A 4OLVL 2XTJE 2W80C 1DLHB 2UZIL 3N1MC 4DK6A 4WKZA 2BWQA 3JVFC 1XO8A 4P2OD 2Y7MA 3QJRB 4JFEE 4KZEH 3BP5B 3FBKA 1KN4H 1MDAA 4QYOB 1NFIB 3KZ8A 1R3LA 1FGVL 4XXCC 3SGDI 1FO0A 5HJBA 3TZVD 4QXVA 5SWQA 1GOGA 4MLIA 3PWJB 2W07B 5F93C 2PMZA 4N25A 2CRZA 1PNDA 2DQUH 3MRFB 5IHUL 1PTZA 1NFDA 1YUKB 3GXNA 3QJOA 3V0VB 5HHPA 1CLVA 1MUJA 1T89A 2R0WL 3V55A 3FZUD 4D3CL 1M1SA 2F53E 2R0KH 5EV7A 3VXNB 1LDPH 4Z8FH 3GI9L 1A7PH 2GW5A 1O7DC 1IAOA 2O6PA 2J43A 1X9LA 4WWNA 1M05A 2ICEC 4HHAA 3ZDXF 4LCIH 1TU2A 3T0ED 2NY7L 1WA0X 2I07A 3GB7B 3QEQB 5I6MA 3CDGB 1GSMA 1KLFA 2NY3C 1ZKAA 5AWNH 1IQDA 1AGEB 4PGDA 3W0WE 2BIPA 1F4YH 5DR5L 1S9KC 5FCUL 3L5IA 1AZRA 5MP6L 1Y6MR 1H6FA 5CIPH 4YHMH 4PWJA 1JAEA 1NBCA 4WUKL 3BE1H 5T1KD 3PWVA 3TWCL 4QRUB 4AEIH 4MAZA 2CO4A 4UM8B 2ZF9A 1JJUA 3BAEH 1X9QA 1CTMA 4JFXA 3PXJA 2YPKA 4AMKL 1NGYA 4XO5A 3V0WL 4ZFZA 2DLGA 4MMYA 4U49A 4N2CA 2ED9A 1U0QA 1DLHA 1EAQA 1MJ7L 7FABL 1FFOA 5FW6A 1TDQA 3K71A 3ZR6A 1N2RB 4GT0A 2EE2A 4LZKA 2JKTM 1NPJA 5KJ7E 4PCYA 1Z3GH 3DX0A 1NFIA 2ZCLH 3C60C 2FZ3B 3GUFA 3IMUA 4MMXA 1P4LA 1LK3L 2X2UA 2P8PA 4FZ8H 5DI8B 3P77B 4ODHH 3QWRD 4JCWA 3PWJA 5F9OL 5DEZA 2OYKA 3SKJL 3OZKA 3MRFA 5AYTA 2YPVL 3V0VA 2P5EB 1T5WB 2JCCF 3QORD 1K3IA 4FKKA 4JE0A 4LU5L 4IIQB 4RGOH 3IT8D 1XF1A 3APCA 3N2JA 3IJEB 4YXLH 3VXNA 5KSBB 2Q86A 5DD3H 5EF2A 4BKSC 3HI6L 1BF2A 2CKNA 5JIIA 2ZXDA 1COBA 1DCLA 4Z95L 1CVRA 3FUJA 1ADQA 1YECL 4MD0B 3QEQA 3CDGA 1C1EH 4WWID 5IBLD 2ARWA 2L7EA 4MJ5B 1NBYB 1AZVA 3OAYH 2WB1A 3CH1B 4P57B 5L7XL 2B7DT 3I85A 4NXSA 5HPOA 2DQGL 4NERA 1F6FB 1CJYA 3W5MA 2H0FA 4XMWA 5DD6A 4RBPK 3TONA 3ISRA 2YOAA 5DMKB 4XBEH 5F7EH 2OMUB 5I0WA 3PHOB 2PR4L 3VXRB 4JN2B 4RAHA 2FLMA 5D6DA 2BVYA 4GXVH 3SB3A 2ZSWB 4WGWB 4KNQA 2JQAA 3NCXA 4GKNB 4YWGH 5K1VA 5E1GA 1HH6B 1N2RA 1P2CB 1M56B 4YUEL 3UTZA 3EO0B 3EDJA 4L8DA 2FZ3A 5DHEA 3SQBB 2CCLA 4NO0B 4TUJB 2HLAB 5FC9A 2BIHA 3JTBA 6PAZA 2Y3AA 4C55A 5CJ5A 3MNDA 1E9OB 1F3JB 1QR4A 2WNXA 5FM5O 3F84A 3IRCA 4I48B 1D3CA 1OOAA 1OAKH 5ABAA 1PLBA 5GS0C 3V6FB 4IIQA 1FZJB 5AW4B 4PJFA 1PEZA 3S6CA 3LZLA 4HWEH 5JW3L 3RI5F 2WQWA 5KSBA 1CVSC 1JRHL 1QPXA 4UQAA 5C0AB 4F58L 5BOPA 5BV7B 1BXUA 2YRZA 4ZFOB 2XZQL 2IQAB 4XNZB 3LD8B 1BMWA 4RWYH 1DQJB 3B2MA 4E41A 2ICCA 1T4KB 3ARDC 4MD0A 3GJFB 1IJ9A 2CJUL 1S3RA 3PWPD 1Q8MA 4MJ5A 1TVHB 3BZEA 2AITA 3KPLB 4MNQE 4S1RL 2BFVH 1HL8A 1I75A 1SNRA 4NQDD 3CH1A 4P57A 1I3GH 2R2HB 3APNA 4HWNA 4YDZA 1HK6A 2EJ1A 3KGTA 1T7VA 2PN5A 3SQRA 4NM4L 2D8KA 5D2NA 3V5HB 4ZMOA 4LOUC 1L5GB 5DMKA 2JSFA 2L7JA 4Y19D 2OMUA 3KW7A 3ECBB 3ZL4L 2BW4A 3PHOA 4KMQA 3GSQB 3U2IA 4JN2A 5DD0H 5CJOH 4PJ9D 2VW4A 4DUXA 4AM0A 3T1FB 3FK3A 3KLHC 1FYTD 1LLAA 1HH6A 1JPFB 4PCTA 3SD2A 1X5YA 5I2IA 3EO0A 3FMGL 4Q74A 3RUGE 1A6PA 3WFDL 2B2XL 3SQBA 3WOVA 4UIKL 2F0CA 1TQTA 5KVGH 4TUJA 5D1QD 2HLAA 4C83B 1WZ1L 1DFBL 5DJCB 2PETA 4NRZB 3BH4A 4YAQA 5TQ0H 1BYOA 4H8WC 3S97C 5FECA 3WUWA 1E9OA 1O7SA 4XX5A 1F3JA 4ZT1A 5EOQH 2WSDA 3NA9L 1A2YB 1B9ZA 1A7OH 1HHHB 4V2CB 5GS1B 3TF4A 3B2UC 3LH8A 4IRZA 3RJQB 3V6FA 1FZJA 5A6IA 4UT6L 5IGXH 1D5ZB 1OAJA 1ACCA 3HOGA 2J71A 4R4BB 5C0AA 43CAA 3T04D 4DUVA 5I0XA 4JDZB 4ZFOA 5I71B 3DSFH 2P26A 2IQAA 4KK8C 3L3OB 1DQJA 3MV9A 4NJAH 1T4KA 1BGXH 1N10A 2IVFC 2X2JA 5EEYA 5LXGL 3KJ6H 4JQIH 4X9HA 4HK3J 1JE6A 1TVHA 1F13A 3EH2A 3OXSB 1UWXK 2XBTA 1BP3B 5F7UA 4HXAL 2VR7A 3WNPA 4HUKB 4JX0A 4RH4A 1T0MB 3PXHA 4DESA 3KNBB 4Y5XC 3ILQD 1P4UA 2ZUQB 3GTTA 1J8RA 1B3IA 1H3TA 1S8DB 2NY4B 2VXQL 4H4NA 4BQ6A 4AEFA 5LGJB 3ECBA 3GSQA 5CCHE 5I8CA 3WL9A 2O1AA 1W72B 1O9VA 4PYGA 4K5OA 4UDUB 3FB7B 3MXWH 1OSEA 2F54E 2ZCKH 4G6JH 4ZOBA 4GO6B 2YPLB 3H9HB 4M7LH 5F3HB 3D69A 3P0VH 3TN0A 3VXSB 5LQBH 3BMWA 1H8NA 2NTSP 4DEUA 2A73B 2D7TL 5TDPB 2EUVA 4G7SB 4EZMA 2XTSA 1H6EA 5DJCA 5T5NG 1OK0A 4NRZA 3S5ZA 3R8QA 4C56D 5EF1A 4P5TC 5B39B 3QDAA 1KFAL 3VRIB 3O6ML 1IGFL 3CVHH 4ZMNA 1A2YA 3KR3L 4LLWA 5GS1A 4EN3C 5E95B 4M6ML 5GSRB 1FAIL 4UOQA 4WU7B 2Z65C 1JDCA 3WIHA 3BXNA 1IE4A 4J4PA 2O5XH 4PJ8D 3FUDA 1D5ZA 4FQ1H 4G71B 4U3SB 4G8GE 3O4LB 1RURL 12E8L 5B38B 4KTYA 2KERA 2Y1ZA 4L0PB 4JDZA 2X4SA 3K6OA 2FR4A 3L3OA 4H8HA 3VXMA 3BDBA 4HOZA 4KKCD 4YHKL 3VH8G 4HYTB 1S78D 2N4IA 4K5PA 4YHLH 1OAXH 3RL2B 3BZ4B 4J8QA 3DJZA 3OXSA 5ABZA 5J6GB 2JNZA 5EZPA 4GRWH 3WBDA 1F58L 4NKMA 5EIVA 5GGVL 2Z8RA 1DQTA 1T0MA 3GFUA 4GPVA 3QHZH 3C5JB 3NFNB 3UDWA 3TBSA 1DO6A 2PCXA 3KNBA 3UAAA 4A2MA 2RA1A 2R2BB 2HKHH 1S8DA 1TMQA 3OLGA 1CGYA 3HCVB 4LEOB 5LGJA 1X5FA 1PL3A 2IAMB 4JFTA 4MAYC 1PSKL 5LCVA 1W72A 3MFFA 3O0LA 4K7PL 5IVXE 2FQEA 1CIDA 3FB7A 5I6NA 5HGGS 4LSQH 4NRYB 1WBZB 2DJMA 2KZWA 2RCSH 1LWRA 4N90E 4L1TA 4C8XA 3MOBL 1QSEE 3SYPA 3TFKC 1J9SA 2P9RA 5F3HA 5CEZD 3GK8H 5DZAA 3VXSA 3R8BB 2OTPA 4QJ4B 5DHYA 1MVUB 4KO9A 3MV8E 2A73A 2Y6SC 2N3JA 4L9LC 1I9RH 4HUXB 2OXHB 4P48A 4PW4A 2OMNA 4XPAH 3C5SB 3AWEA 1IU1A 3DWTA 3VQ2C 5B39A 2E7LC 2OSYA 2D7QA 5E2UL 3SE9L 5CZVL 3VRIA 2X6AA 3T6QC 5I6XC 1FDLH 1G7PA 1RZPA 4XXWA 1MFDH 2ITEA 1ACZA 1GH7A 4ATTA 1LTXA 1AY1L 3EYSL 3O4LA 1Y1UA 1YEKL 4EJ1C 4H8WH 1IL1B 5H35B 2OMXA 2VM9A 2DM4A 3QIUB 5SX4I 5JUEH 2X4OA 35C8L 5CLYA 4JS7A 4JY4B 1NTDA 2AJZB 2NY0D 2A7BA 3BO8B 3U4KA 3Q44A 1KN2L 1Q0XH 2XWTB 3UAJD 2ENJA 3RL2A 1GGTA 3BZ4A 4FHJA 4QJ3B 3U7YH 5HDQL 1UADC 3UTTB 5I8KH 4G83A 1MZZA 3B4NA 5DZNA 2FWLB 1TZIB 1YA5A 3L4UA 4UTBH 3U46A 1T89C 5AW3B 2YQ3A 4Y5VA 5D7IE 5E6UB 4LAQH 1I3VA 4WW2A 1BOGB 3NFNA 4PJXF 5DFVC 2MPAH 4B7IA 1QTSA 2E4FA 2ESVD 2R2BA 2N1TE 3AS0A 3QO0B 2EC9T 5DYOB 3ECUA 3HCVA 4LEOA 5AVUB 1E7VA 3M88A 1EPFA 4DEPC 5MEND 3JWDH 4QPEA 3ARGA 5HYJA 2C4FU 4YBQC 2NY2B 2JV6A 3GBEA 4DN4L 1KGJA 1G94A 4OLEA 5DO2C 3WO4C 4NRYA 1JERA 3A6BL 1WBZA 3S2CA 4LHUD 2D31A 5ICUA 4OZGB 1XF5B 2LVCA 5D2LB 1ZV5A 2IF7A 3HC3H 2NZ9D 3Q2VA 1HOCB 4V1DB 2FIKB 2AEQH 2ZP8A 4DQAA 1WPCA 2VDRH 4B3VA 1MVUA 2IPUK 4GY4A 1YEHH 2FJUB 5JA8B 4NDMB 4HUXA 3AWGA 3NH7L 5D8JH 3UPCA 1IBDA 3PLYA 1TLKA 4WK4B 2V2WA 2X4NB 3DV6A 4HBCH 1AACA 4GFXA 3QDGB 2ZZUT 1FPTL 4WEEA 1ACXA 1Z32X 3X3GH 2W0PA 4Q6YA 1E4XL 4OCYH 2EH7H 4XBGA 2H0PA 3CHXA 1HX0A 1MCOL 2DYPD 3L3HB 1UM5H 3MBXL 1IL1A 4MMXC 4KVCH 3AB0B 3AXHA 5D7JD 4NQCD 5H35A 2D2OA 3CZGA 3ZDYE 4AL8L 4U3HA 3QDME 5TDNB 3ZQ9A 4GMSH 4L3EA 4WK2B 5LGKA 2AJZA 1OE1A 1SHWA 3PNWB 2R9HC 3QR1A 1G9NL 2DLEA 4F5CE 1ADWA 1YYML 4L8BB 2XG5B 1T21A 4YIQB 1UA6L 3UTTA 5GIRB 5JQHC 1IM9B 1TZIA 4QLRA 2HAZA 3D39D 1HYRC 5CXPA 1NFKA 1RLWA 3AUVA 1FBIL 3ZMEA 2I32A 3GKWH 4K94L 3F7YA 1IX2A 1QLRA 4U6VH 1BOGA 2ZG2A 4M7JH 3QYNA 2Z4QA 1A3QA 3QO0A 3EDEA 5DYOA 2A9AA 2VLRB 1HCZA 4MMZB 5JW4Q 5JDSA 3C08H 2UXTA 3GQFA 3WMSA 4RIRB 3MOAL 5IWLA