5IMKB

Nanobody targeting human vsig4 in spacegroup c2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imkB00
4P23B 5K59F 4P4KA 5ICYB 5JOFB 3VFRA 2NY1D 3IS1X 4NKDB 4M93B 3FQRB 4ONFH 2GUOA 1I8KB 4IOSD 1HSBB 1G7QB 2G75A 5GRXG 4RGMB 1P2CA 4HUMB 4UILH 1A9BB 1EXUA 2X1PA 3GMNA 2F53A 2VLJA 3WNMA 1VADA 1OW0C 3MBEA 4XCYB 3O6FA 5CP3A 1DEDA 4YH6A 2VNCA 5E5RB 4APQB 2AXFB 3UTTE 1KCUH 2R23B 2B5IC 2Y06H 3HG1E 4JJ5A 3OX8B 3KLHD 3FMGH 1WC7A 3FTGA 3MBXH 3DX8B 4X4MA 1PVHA 2NW3A 3AY4A 5T5NG 1NGPH 1RU9H 1HHJA 1BAFL 3GJFB 3QQ4A 3VI4F 3KYMA 4TULH 4KQ4H 2W0FA 1DVFB 5BVJA 1F2QA 4Y4KC 1CBVL 2CLRB 3QRGL 4LLAA 1SY6H 5J12C 1WICA 1S7XA 4M5YL 3W11C 2B7DT 3HNVH 4NKOA 2V5YA 4Z0BH 1YPZB 4Y2DA 5IMMA 3MGAA 1X4YA 1EFQA 5IBUB 5EU5B 4ZTPH 2IBZY 1JHTA 4DKAA 2VXTL 4DGVH 4OCNC 1IKNA 4GT7A 3OXRA 5MEQA 2P8MB 4F9PC 4EDXB 4X9GA 5L2KD 3OB0K 2F58H 2NY3B 2H2SC 1HDMA 2PXYB 1ODAA 3PWUA 3DIFB 1HYRC 1OAKL 2ENYA 3GJFK 1JUFB 2VLRD 3B83A 2PTTB 2BX5A 4PRBA 3MRQA 4E41A 4LRNL 4WNQB 2VRAA 2PF6A 3DOSA 2R29H 4LU5H 1AP2B 1V7NH 2UYLB 4NKMB 3EOAB 3ZHLA 1W0YT 1RURL 3MV7E 1D7FA 1KJ3L 4NN5C 5JXEA 3VG9C 2WBJC 4JO4L 5FYKU 4IOIA 2DAVA 2JJUA 4Y19D 5D7IA 3LQMA 3NAAL 2NMSA 3CFCH 1N59A 4PJCF 3MV9A 5D71L 1QNZL 2SEBB 5CSZA 4EJ1C 3X12A 4TUJB 4M4RA 3V8OA 4JR9L 1G7JB 2PW1B 4QWWD 4XX1E 5E6IA 3I2CH 4P5MB 5EZOL 2E7HA 4U6HA 1H3UA 1UZ6E 4G8GD 3RVTD 4CN1A 3UTZB 1RIUH 4OZFH 1X4XA 1KTKE 5EZJB 1I3GH 4N0YH 5HVHC 4X9HA 3KPSD 5D5MB 2WLYA 5CBEB 4GRLC 1MLBB 2R0WH 3DV6B 4L3ED 3C5ZD 1SJHA 4F7TB 1EDQA 2A73B 2NY1B 2DBJA 5IM7B 1CGSL 3GGWA 2HN7A 4PRID 4HMCA 2Z4QA 3SKUD 1P5UA 4PFEA 1KB9J 4I2XA 3ARUA 1FNSL 4KC3B 1TVBB 3CFIC 4K3JL 5KVGL 1A6VH 4XNMB 4CN4A 1FL5B 5ID0B 3ILQC 4O2CB 2IGFL 4MLSA 4NRZB 2I9TB 1XF2B 3RWGA 4KJQD 4GAGL 1MI5D 3SDCC 3NCJL 4GG6A 1N2RA 2C1PA 2WWMC 5C0RH 4GMSH 1PQZB 1YY8A 5E2JA 3LS5L 1AJ7H 1PD6A 1OCWH 1MCLA 5C07D 7CGTA 1BVLB 1Q38A 3QIBD 3RWCA 4L29B 3JVGC 3E6HA 4LASH 1Q72L 3RVUC 3OKDB 5DS8A 3FN9A 4WW2F 3FOMA 5D6CB 1LO5B 4Z7OE 3MLWL 1ES0A 2KZ1B 1V3JA 3I3EA 4IIQB 3CH1B 2R39A 2R2CA 4FA8A 3WD5L 1XMWA 1N4XL 1FNAA 4Y1AA 4ODXA 3NPSB 4XRCB 3C9NB 3OKOA 4RA3A 2P48B 2YPLE 1GZQB 1Z5LB 4OIAA 1T7WA 4TNWF 2DTML 5GGTH 5T1MA 1IC5L 3MLUH 5L2KB 3QP3A 3ELAT 3QWOB 5J89A 1U8LA 3F12A 3LZFL 4LSSH 4Y4KD 2Q3AA 4HXAL 4YAQB 3QI9C 3K46A 3WL9A 2VLRB 5T3XE 1OB1A 1EA9C 1MJ7H 1CTNA 1WVZA 2G5RA 5FYKE 3O81A 4GAYB 4JG1L 4PP1C 4R7NA 2VYRE 4UNVA 2ED7A 4Y5YC 5BRZA 5C0FA 4GKNB 1CF8L 4UZGA 1YEGH 3IAQA 5DO2D 4X4XA 1FNEA 3HI1A 3OB8A 3ARWA 1CGYA 3QZWG 4Y19B 1AH1A 3O0RL 4XVUC 4WFGD 1IEBB 2Z91B 5J6GA 3GSWB 3C2AL 5E2UH 2X9XA 1DZBA 4WRLA 3ZTNH 5IMOB 3ARED 1OGAB 2X70B 1P7QD 2DB8A 2R0KH 5HHME 2HH0H 1CLZL 4J4PC 4RQQA 1IGIH 2KUTA 2I26N 3VDBA 3L6FB 2CIKB 1VFUA 4N5UA 4AEHL 4HX1B 4G8GB 2DM3A 2FATL 3D2UD 5D7KE 4K2UH 4PJXF 5K9KA 5T5NF 2WBJD 2HG5B 5E1HB 3R06B 1Z0MA 3GKZA 3KPSB 5BJTA 1R3JA 3BP5B 4O02H 4UNUA 3GMRA 4FTVD 4JY4B 4L3EB 4Q9RL 3OGOE 1VKXB 2XT1B 5CGTA 4M6MH 2A6JB 1CLYL 2W60A 5I9QC 1MREL 2Q86A 4PRIB 3F7VB 4J8RB 3OR7A 4OAWB 4PJ9A 1UT9A 2AXHA 2VMFA 2CRYA 2VDKH 3QHTC 2D2OA 1VFAA 2OTUB 4HXBH 3RKDD 5KG9A 5EORL 4OZGF 1MI5B 4GRLD 5E08L 3JWDC 5ILTH 5JDJA 4I18A 1P1ZB 3ABZA 4FP8L 5HHOD 2D0GA 3V9FA 2PO6A 1L7IH 5EFIA 5C07B 1YEFH 1B6UA 2A1WH 4ETQB 4LIQL 3QIBB 5GRVK 1A1MA 5FB8A 2N7AA 2GTZA 5GRYA 3HC0B 4U7SA 4NBXB 3QUYC 5ISZD 1WEJL 3MRLB 3ILQD 1U6AH 5F9AC 35C8L 2X4OA 2FO1A 4OZFB 2B5IB 3JTTB 3ME0A 1A6UL 3DVIA 4LPVA 3JV0A 4UQ2B 5HGHA 4ZSOE 5C0BA 4YE4H 5KN5A 2P1YA 2P8PB 3AC0A 2ZUVA 4NNYA 3V6FA 2EYSA 4FQIL 1BEYH 1XF5A 1S7SA 2C26A 1KACB 3F5WB 4BQCA 3QJFA 1DBKL 3K81A 3U46B 3ULUF 2MNUA 1G6RA 4Y4KB 2CKBH 2VAAB 3SDAA 2VQTA 1UH4A 4XP5L 1D5ZB 3N06B 1PG7W 3HR6A 4BFBD 5JW4Q 3SJVA 4XC1H 5KVFH 4S2SA 1S7QA 5D2LB 1YEJL 5B21A 4IS6A 1HZHL 1T2XA 5C0GA 3WYRA 2FRGP 2WUBL 4LHUA 3ZDYF 4Z7VB 3VXUE 2ICCA 4LBEB 2J6EA 3DX7B 4ALAL 1NSNL 4F8QA 1I8MB 4DN4H 1V3KA 3B9KC 1D9KA 2G5BB 3H0TB 5KSBA 1P7QB 1J10A 3N1GC 4CU8A 3KYKH 4X5XB 4EBQL 12E8H 3NZ8B 1OAZH 2C1OA 4P3CH 5TE6L 2FL5B 4JDZA 5JW4M 3G6JF 4HGMA 5E5MB 4BZ1H 1MQKH 3D2UB 4NN5B 2F5BL 3DECA 4HZLA 5GS2D 1W0WB 5DEFA 2WBJB 3QBTB 1JZ4A 1N64H 1NGYA 2ADIA 3JWDH 4QT5B 1NGWA 4R8WL 2AABH 5E70A 4OCSL 2BNQE 5BO1L 4AENA 4FTVB 1I7ZA 1C8PA 3SGEI 3L3IB 3O6KL 3QUMA 5E2TH 2XICA 4J4PD 3TPUB 1K4CB 4MS8C 1RZFL 4KWUA 3TC9A 1BBJA 5I1DA 1F45A 3EYQD 5B3JF 5ALCL 1CWVA 1FZOB 1MCPH 1S7UA 1LP9F 1IGJB 3KPMB 4NZTH 5HVHB 1J05A 5F8RC 5FGCB 4GRLB 1DN0A 4EI5C 5I8KL 5JLZB 5CWSA 1F3DJ 3S5LA 3VD4A 3L3JA 4JPWH 1HE7A 3LS4H 1Z2KA 2YC1B 5HHOB 3RQ3A 3QHZL 4HC1A 4O2EB 4ZFZA 1QPPA 2PETA 4M6NH 3MO1B 4JFEE 3MJ7B 1ZS8A 4J3OC 4LKXA 3RDTD 3AVEA 3HMWH 5DJ8B 2YD2A 1PW3A 3VXTB 2NY0C 1WQVT 4N8VB 5KS9A 5ISZB 1A6ZB 3CVIH 4KVCL 1UYWH 3V0WH 5JHDB 1PZUB 1FSKB 1JP5A 1A7OL 2Y7QA 4JKWA 3OF6A 4MXWL 4YUEL 1RULH 3ALXA 5J1AA 4U49A 1L9NA 4K7PL 1WGOA 1BM3L 1F58H 1TZGH 4OBRA 5C0EA 3IYLW 3ARRA 3FO0H 1AHWA 3N0PB 5F7NC 5JW3H 3JV6B 4PREB 1IE5A 4QRRA 4H0GA 4I0PA 5IHZB 2IADA 3KXFE 5IB5A 4XPHL 4WY7L 4HEPG 2YXFA 4MGXA 4OCMC 3TBSA 4U6XA 5INCB 4QCIA 1NCNA 3IXTA 4PV9A 1B0GA 4Z7NE 1A3RL 1HOCB 3KYOA 3B9DA 1BF8A 3QIUD 4XNZB 4KMQA 1G7IA 1HCVA 3RVVC 3W39B 4RAUA 4XZUA 4Y0GA 3LB6D 3X14B 3EOTH 4Y89A 5C1MB 1Q0YL 2OTWA 1HH9A 1GC1L 3HCVA 5FXCH 4YQXH 4DKFH 2J1KA 3VRJB 5T3XH 3Q5OA 3IJYB 5ACLA 3V0AC 2NY7H 3ESVF 3GNMH 2FZ3B 5FYKH 4L4VA 2E3VA 1JHLL 4OCLC 3S9DB 3FN0H 2ZCKL 4OLZL 4JFDD 4Y5YB 3S88L 4Q9QL 5E9DA 3VFVA 1Y0LA 4PJDA 2YMXH 5DHYB 3TM6A 1PLGL 1X5XA 4H1LH 4IDJH 4E5XB 1UG9A 3TV3L 3KPNB 3BKJL 2R69H 4ODBD 4G8FB 1PKQE 5AEAA 1QSVA 4KJYA 1WIUA 3VXNB 4AYFA 4LLMA 4P2RA 3PL6A 5AZ2H 2CKBB 1FH5H 1YY9C 1MWAL 5I1JH 3WEXB 5CLWA 1A6AB 4ZNEA 2HKFL 5EOQH 3LMJH 4K7PX 6CGTA 1ZA3B 3KPRA 5E8EB 3RHWK 1MNUL 5I6XB 1I7RB 4MAUH 1KC5H 4UIKH 4YNYA 25C8H 1ORSB 5I1GL 1DE4A 3K3QA 4LL9A 2FO4B 4G6FD 5E2VL 3WFBH 1WZKA 3MRCB 3UYRL 2ICEA 3QDMD 1QACA 5AUMB 1E4XI 1KELL 4NJ9L 5I9QB 3TA3D 4MS8D 4KTEH 4FMFA 3FFDA 4J12A 5DD1L 4ZS7H 3RDTB 2VZVA 4HWZB 2O5YL 4IOFC 4OFKA 1P4IL 3ETBF 4DVRH 2DN7A 2QL1A 1U8QA 5H94A 1BZ7A 1ZEAL 5CKAA 2CDEB 4GXVH 3V6ZB 2GK0B 1AQDA 1OD9A 4K9EC 2AK4E 4U1LA 2W0KA 4X4YB 1TITA 5KTEH 2X4UA 2EIZA 3HNSL 1LHZA 2FEEI 4URTB 1HHHA 5DHVA 1VB9A 3BP4B 4JB9H 2ESVD 4F58L 1BJ1J 2MQ3A 4R7DA 2Q3ZA 4LSQL 1VCAA 3QFJA 3BKYH 3DTXB 3IDGA 1UKTA 4X0KB 4PJGF 3MLSL 1DSFL 5C08A 5J6HA 3GUTB 4HCRL 5DK0B 1TJHH 1K5NB 2P46B 4JHBA 4HMDA 4RRPA 2OK0H 5JDSB 2UUDH 4X6FA 2J8HA 3JV5A 2D03H 3X13A 5HVWA 2X42A 4OFDA 1ROWA 5DJ6B 1B4JH 1JRHI 1QR1B 1N5AA 4LLUA 3DGGB 4OZHB 2GAZB 3QIUB 1F8TL 5CJXA 1BOGA 3TIEB 5D70L 4NFDA 3QIWD 1C1EH 5IFAH 1KN2L 4WUKH 3P9LA 2ZOKA 2CR6A 3BO8A 5D2NE 4RZCB 1SYVA 3S3JA 4CNIA 3QFDA 4J1UB 3ESUF 2BOCA 2V17H 5LGHH 4JFDB 2NCMA 2X1QA 3QEHB 4ODHL 5DEZA 3G5XB 4JFZL 5A43C 3RVVD 4NQTA 4JFPB 4PRHA 4UDUA 3VH8A 1BLNA 1FNLA 2QSCH 4DAGL 2EZ0D 2CR3A 1SEBA 1FV1B 5FK9B 5IESH 1JMXA 2VLLB 5EULV 3IDXH 5GGRY 2EDFA 2V5RA 2ZG3A 3EFDL 4OBSA 2XQYG 5C3LD 2BMKA 2XNAB 1MJJB 3TBWB 3WCYA 1KEGL 5JW5B 4NSKA 1NDGB 2VITA 2F19L 1NCCH 1K4DB 3K74B 3STLB 4LDLB 1E4XL 2DYPD 3TJEH 4BQ6A 4YO0B 1UZ8B 3LEXB 3B2VL 1A2YA 3V4VH 1JL8A 5GGSA 5HHXH 4QHNB 3GEWB 4K9EH 4G6FB 3WIFB 4AEIL 1QFWH 1UFUA 4LEOA 1R0AH 2VXUL 3OJDA 2B2XL 4U33A 4JFFA 2MQCA 2PYED 3ULVE 3IKCB 3TA3B 4OV5A 4K3DL 4CMHB 1ADQL 5CCKL 5MHSD 3R0MA 1JNLL 4H5SB 5L6YH 3G04A 5JQ6H 1CXHA 2FEEL 3WHXA 3CFBA 4WFEE 3SY0B 3WFEH 1KTDA 4F80A 5IB4B 4KK5C 1MCJA 5GRWA 1YNLL 4H1LB 3MNZA 3OL2A 1X5KA 4OFPA 4O5LL 2Q7NA 1G1YA 1ZHKB 4EOWL 1OGTA 5KSVB 3BWUC 5HHQA 3NFNB 2LV4A 1CLOH 3C8KA 4PJBE 1U3JA 2ESVB 1NEUA 3KVQA 1T1WA 3PWNA 3LQAL 2Q6WB 5JPNA 3FAXA 3T0BA 4YWGH 1JRHL 5JORA 4CRPA 1FYTA 1H3WM 4IOFD 4OCXL 1CR9H 1QSFD 2J4WL 4WEBH 4MVBD 2EKSB 2YUWA 4MQTB 3RNKA 1PYWB 4FXKA 4JQVC 3A6BL 3DARA 4QLRA 3HZMA 4L8SC 5FOBA 3Q1SL 5F70A 4YR6A 1AY1L 3WN5B 1QYGH 3QDJE 1WF5A 3MBED 3QIWB 1F4AA 4C55A 1FRGL 2ZUYA 3KLSA 4I13B 4WW2A 4A6YH 3WUWA 3Q48A 4WWKA 2BSTA 1AGCA 3FO1B 1L9MA 3J7HA 4W6WB 3H7BA 3ROOB 3O11A 2EDBA 5KJRH 4LVEA 3ARXA 5AZEL 2XWJB 3EYFB 4FNLH 5DVLA 2OZ4A 4MA8H 2H3NA 3GBNL 5K9QI 4JDTH 3IJSA 4U4BA 5F9JB 1HSAA 2BERA 4F7CB 2R8SL 5J56B 1I9RL 3BOVA 2UWEF 3GSUB 4Q2ZB 3FO2A 5GJTL 5CSGA 4TVPL 2X4PB 5IF0B 4GQ9L 4HIEA 3S96A 4Y2DD 2FYYA 1NDMB 1R5IA 4QF1B 5D7LA 4NHUA 3SPVA 1CYGA 4L3CB 4C83B 3QUKA 4MYWB 1I7UA 1R3HA 4FZ8H 4LF3A 1KSRA 5I1IH 2OMNA 4X83A 4NNXB 4W4OC 3OKKA 2HWZL 1FG9C 4PGDB 1YMME 1U8PB 4FQHB 4FQ2H 1BFVH 1LK3L 5DMGC 3LKPA 4E41D 1RK1A 4PJIE 4GFTB 5DLMH 3P11H 4KHTL 4BA8A 4J2XA 3KDMB 4LSVH 2PYEB 2GHWB 5D2NC 3ARSA 3AUVA 1JPFB 1A5FL 1CICA 2VL4A 2D31A 1FFQA 3L5JA 3W9DA 1U93B 1U3ZA 3NIGE 2AXGB 3E8UH 2EXYD 2Y72A 1HI6A 4PGBA 3PUCA 2UUDK 3FB7B 4ODVL 1HWGB 3NABH 1VPOH 1MFCH 4LCCC 4HS3A 3DPBA 3LKSB 1U8JB 3EBAA 1QEWB 3DSFH 3GI8L 5HDQL 4PRNA 3SE8L 3QWQB 3QEQE 3QQ3A 4WI7A 5ALBL 1R6VA 5D8JL 1MH5B 4HKJB 1ZTXL 1OPGH 3MOAH 4JN2B 3O3AA 4E42A 1KIQA 2X4RA 3G5YB 2QHLA 3SE3A 4UT9L 4P2OA 1FDLL 5A3IC 5E8DH 1QSFB 1ITCA 1JF6A 4MXQD 4OZGA 2L0DA 3VGFA 2A9NH 4G8EB 3QXAB 2JCCF 2BNQB 3VXOA 2E7LA 2G75B 5IJVA 4L5FL 3F58H 3PWPA 4DEPC 4FFVC 3BIBX 3ULVC 1C5DB 1EEQA 1LNUA 3D25A 2FX8H 1WJ3A 3TESA 2H6PB 3QEGH 4XNUL 4IJ3C 4U3XA 3HKFA 4NOFA 5GGVH 4ZFOA 2IC2A 4HUWA 5MENE 1KLUA 4OI7A 4A2LA 5IMKB 2DDQL 3V6BR 2GJ6D 3D69A 5DGRA 3ZKQD 1IGYA 4C56D 3SQOH 3WHE1 2YPVH 1KXQE 2AKRB 1AXSB 5I1AA 4MJ2A 5FA3B 3MA7A 1TJGH 4Z7UB 3ILPA 4ZUUB 1MCFA 5D1QC 3TZVD 1KTRL 2Y07H 1A4KA 2OJEA 5C6TH 4DWHA 4J23A 5CIPA 4Y2DB 3HHRB 3T0WA 3MJ9H 3U0TA 4WI3A 1Q94A 5DA0B 3VMNA 4J6RH 4MX7A 4Y4FA 4K7FB 1ZGLB 5HGDA 1KFAH 2YD3A 1NGPL 3GI9H 2KDGA 4KKAD 5CKGA 2YBRB 2AK4D 43C9A 1FGVH 4KQ4L 1QLEH 4RGNE 2F74A 1P6AB 1FZMA 4DVBB 4PTUA 4M7JH 4QOKA 2E9WA 3DX9A 1CVSC 1WBYA 2CK0H 2R2EB 5CS7A 5B4MC 5T33H 2QQLH 1F6AB 4ONHB 1NCDH 4Z0BL 1NAKH 5HYSB 3S37H 3BKML 4A6YB 1KB5H 4EN3C 3VGDA 3OTTA 2ZCLL 2R1XA 3RX7A 4DGVL 1ZSDA 3WNLA 4IOIB 3P4NB 4UUJA 4Z5RB 2IFFH 2F58L 3G6JA 2YA2A 3FT3B 4HV8B 4YHIB 3QUZA 3LRSB 1F6FB 4QXUH 1Z3GH 3TYFA 1UVQA 1EAJA 5ESAA 4W6YB 4J3UA 5FCUL 1YEEH 3QDAA 5J3HD 4U2ZA 1AD9A 3TBTA 3ARZA 3M8OH 2XWTB 1MFEH 1E6OL 2HYMA 5IEHA 3ULVH 4OJFL 4YHZL 4K8RC 5E00B 3X17A 4JN1L 4Z77A 1J1XH 1MCQA 4N9GB 3O4LE 4XCFL 3T04D 4CAGA 4YC2B 1KN4L 2EYTB 4JVWA 2GITB 4L8BA 1SHMA 2R1YA 3CFCL 2IJ0C 5I1EH 3NGBC 1W72H 4LLQA 1SJHB 1YEHH 3VWJA 1F90L 4WTZG 5JA8B 3IDJB 3MRDA 5E4IA 1RUKL 1SYSB 3BISA 5DRWB 2BHUA 2XA8L 4OKVB 2IPKB 1T22A 5GS0D 1OTTC 4CADA 3U9PH 4LSPH 2VZUA 1I3GL 3GBMH 1YDPB 4N1HB 4YDVA 4YHMH 4K94L 5A3ID 1TXKA 5EOCJ 4HJJH 1K3IA 1DQQB 1OTSD 4ZUSB 1FBIL 1XGPB 1D6EB 2VOTA 2GJ6B 5EG6C 2APFA 1E28A 4YPJA 4C56B 2QBWA 3CUPB 5E8OB 5DD6A 4RAVB 5FFLA 4U1MB 3ULVD 2VTFA 2PR4L 2DTSA 3BPNC 3TZVB 4LGSB 3VG0L 1MRFH 1X5ZA 2X89D 1UEYA 4PJAF 3NCBB 3FOLB 3K8MA 5C0DA 3ZTJG 3IU3B 1OCWL 3CX5K 5T3ZH 1RZ7H 3SOBL 3U4BH 1UM6H 4V1DD 2HJKA 4Z7QE 1J0ZA 3L7FA 3QDGE 4LASL 2AK4B 2DD8L 2E8YA 3KYAA 3IAPA 5DMKA 4RX4D 1P84J 4UU9B 3VRIB 4G9FA 2XZQH 4J3WA 5GQBA 1EGJA 5E1AA 2EH8H 1GGIL 5MERA 4XVJL 1EGJL 3ZYZA 2BVUA 3GRWA 1S5IL 3D1MC 4U6TA 1DLFL 1HILA 4K8RH 3ZT6A 1CDGA 1LE9A 1U95A 1A1OA 5C09E 1L0YA 5SX5H 1FNEB 1I7TB 4OIIL 5TE7H 3Q6GL 3V4UH 2KL6A 3FRPA 1NAMB 4HD9A 1UADC 5F72S 5JUEH 3C08L 3T65A 4LSSL 2YEZA 1DQMH 1EBAA 1D9KD 5TDOA 4JRXD 3PDOB 1NFDB 3ARGC 3N85H 4OD1H 5B4MD 3BDYH 4HHAA 1I3RB 1CQKA 4AH2B 1XIWA 5BW7C 5BS0D 1MLCA 3ZMRA 4N8PA 4EN3D 4JFYB 1J0KA 3TNNA 4ACPA 1N3NB 2NTSP 4YDIH 4X6CB 3VXSE 1YEGL 5T3ZD 3VFUA 3TYGH 3VGBA 3X3FL 3DRQA 4OZ4B 5SX4H 4KY1L 1A9EB 5E24E 2EDLA 4PBVC 1NBZB 4RGNC 5C2BH 2MKWA 1D6VH 1DBJL 2R0KL 1X3DA 2W60B 3PJSA 4LCCB 5C0JA 3BEWB 4NGHL 4XPTL 2HVJA 3RUGF 5EBWA 1KCKA 3LRGA 2O5ZH 1QFUH 4P2QD 3ARBA 3MRKB 4K2UL 5F96H 4IMLA 2P5WA 1WWAX 1T2QH 5FKPB 1ORQB 4U1IB 3DVNA 5GS1C 4PR5A 5TDPA 3SKJL 1A14L 2N56A 3S3PA 5DJXB 1UCBL 3M17A 3TT3H 3RZCC 1MHHA 1OARL 4M6ML 4ISVA 4PJ5D 2GY7B 2P44B 3OKLA 3D39A 1UXSA 4D9QE 4YHPA 5FO7B 5B38G 4JKKA 4YHYC 4HFWA 2BNRA 1BBDH 2YHGA 4GW5A 5TQ2H 4DEPB 3MGTA 1DTUA 3GZKA 3T8XB 1OTTD 3RWIB 3DVFA 4OLEA 4LNRA 5CGMA 2MPAH 4NT6B 3ULSB 1K2DA 1WV7T 2CLZB 3BP7A 3IRPX 4O4YH 4IJ3B 4LOUC 4PJGA 1HK6A 2PTUA 3OF6D 5ANMA 5HGHB 4RSVA 3MRFA 4LPCA 1W72B 3RAJH 1I9IL 2EYSB 4JPIB 4OQTH 4V1DB 4M61A 2VDML 2FHBA 1BD2A 2A77H 4U1HB 1N6VA 1UB5A 4MA3A 2WUCH 1B0WA 5FHAL 5E4EC 4QRRD 1A3LH 1BIIA 4I8DA 1MJUH 2COQA 2E9BA 1JPST 3UZVB 1YJDL 4BQBA 1T21A 1E6JH 3CSGA 4NQUA 1VEMA 5CMAB 2C3VA 4YE4L 4R0LC 3R1GH 1G9NC 4NM4H 5I19L 1BEYL 2WM0A 3BEVA 4QXGL 1A7PH 3BE1L 4U1JB 2BVOB 5D1ZA 5K93A 1S5HB 3IETA 3KPOA 5BMFH 4DK3A 4GJTB 1D9KB 3PHSA 3LKQA 4JRXB 1BQUA 4HIXH 2V2WB 5DUMH 3NIFF 4HPYH 4JFXB 4WDIB 4XC1L 4L4VD 3D6GA 3WXWH 3QCVH 1WBZB 5E0QA 3DVGA 3HRPA 5T1DH 5BS0B 2RR3A 1PG7L 3MYZA 4EN3B 1A6TB 1OAUL 2VXVL 2C4FT 3GSQB 2B1HH 5F3BA 1QTYT 4I3RL 4L8CA 2ICWI 15C8H 1T1ZA 5D5MF 4I9WD 3P77A 3VRLE 4Q6IA 4UQ3A 3V4PL 1YYMH 3D3VD 2JELH 1RUPL 4OD3H 2NNAA 4W68A 12E8L 1KUMA 4NYLB 4HKXA 5I8OH 3B8YA 2BCKB 3T77A 5IEKB 3HAEH 2V9QA 3FB8B 5CZXC 4E9LA 4P2QB 3A67H 3ET9F 3KPRD 1MQKL 3WDJA 1ONQB 1S7UB 3UTQA 2ZNWA 3SDYL 1HQ4B 3QCUH 2A6KB 1JZ6A 1I8IA 3LKNA 5CD5C 1TNNA 2CPCA 5DJYB 4GAFB 3O3EB 4NQSB 4U0RC 2HTKC 5LQBH 3LSOA 4AJ0A 5SWQB 4GKZA 4ZFZB 5E2TL 1YECH 1ZWIA 3MRJA 1LDSA 5EOCL 4PJ5B 5KW9L 3BPLB 3AFLA 1HKLH 2EDOA 3CXDL 1NL0L 2LU7A 4Y7MA 1G7MA 5J8OA 3C6LC 1QLRA 2VAJA 2W65A 2ATPA 3P9MB 5FDWA 1MOEA 1KEMH 1AR2A 1NC2A 2ITDA 2VXQL 3VFWB 4NZTL 3ZE1F 5F71A 5FO8A 1I9JH 3PDDA 3OAUH 3N1QC 5IG7B 3H9SE 3U1SL 5JXAL 4NQDA 4JPWL 3JWOC 3CFJB 5CEYB 2LE9A 3QA3A 1AGFA 3RZCD 1G9NH 1GGUA 4HDIB 2I5YL 4FFWC 4BZ2H 1FVDA 1A7BA 4Y4HC 1PG7X 4MCYA 3T08A 4CBPA 5C0EB 2JJSC 3GMPB 4F9LC 1I75A 3RU8L 3THMH 3V0WL 4EUPA 4QRRB 4JVUA 1B6DA 4PJ7E 3BPNB 4ZYKB 3NMEA 4JFHD 1FN4A 4UT6L 1MPAH 1TJIL 1C08A 1UB6B 3G5ZB 5CJQL 4S1DD 4JHWL 4LOUD 4UT7H 4G43A 1NMCC 4PV9B 4MSWB 2BFVL 1RULL 3SHSA 4N8VG 4NO3A 4XMKH 5I0ZA 3UPAA 1ERNA 3MLRH 4HWBL 1S78C 3E2HC 2JIXA 2GSGB 5IV2B 1WWCA 4MQXD 4CW1B 1XGRA 4DZBA 1CE1L 1H3VA 2ED8A 3IXAA 1K8IA 4P57A 5D9SA 2EXWC 5EIQA 4Z18A 3HNTH 5FA4B 1FNHA 4YZFF 2VC2H 2UWEA 3GSOB 3GMQB 5I76A 5EO0B 5ITFA 5E8PB 5FUOL 4HG4K 4NUGH 5F8QC 1F3RB 3T3PE 4QRTA 4HIJA 1EH9A 2WNGA 3LN9A 4LPXA 4Y16C 5A2KH 1JFQH 1OLZA 4TUKH 4ODTL 1YN6B 4ZMAT 2DLEA 4XCEB 3SGKA 1M05A 3ARPA 1P9MA 3EOTL 1KCSL 4WHTA 1FHGA 4M7KH 1KNOA 2X40A 3I75B 4M9PA 3EO9H 4AMKL 4KKCC 2HVKA 3D3VB 4FFZH 4R4NC 5DD3L 2MHAA 4LLMB 5T3XL 2YZ1A 2HFGH 3ARGB 1BX2A 1PBYA 3T0EE 1ZA6A 1KJ2A 3EGSA 3WO4B 1J1PH 4FQQA 1J0JA 3FN0L 3BW9A 4WW1A 2VDQL 5FYLL 4OLUH 1TMCB 2YMXL 2F53E 1F4WH 2VLJE 5C8JB 1U58B 5KAQG 5EO9B 4WV1C 1A7QH 1ETZB 4ZXBA 4M3KB 6FABH 3JWOH 4LCUA 1CLCA 1DBMH 4G80B 5D1XC 5L0QC 3WFCL 1AD0A 2FJFB 5IWLC 3EYVA 1FH5L 4PJ8D 4X4ME 3HI6H 5EOQL 3LMJL 2G2RA 1WAAF 5FYJL 4P0DA 3AM8C 4U1KA 4OB5H 4D0CA 25C8L 5H94B 3WFHA 5I1KL 4MD0A 4JM2C 4TN9A 4KH2A 5GS1B 4KAQH 3A0OA 5DQDH 1R5VA 4KRPC 5I1LB 2E8ZA 2HTKD 3HI5H 2ZUTA 3T0VA 1FNGA 2X4UB 4G7VH 1MRDL 4LSUL 3RZCB 5CEZL 2Q8BL 4Y8DC 5HGBB 1H9VA 1M7DA 4G3YH 2JCCA 1LO3H 5CD3A 1QQDA 5IFJA 3KWWA 2YD4A 4ZS7L 5C9JB 4OLYH 4Y88A 2AK1H 1JPSH 4FZEH 4H8WL 1FO0H 2CDGA 2O5XL 3LVEA 2LQRA 3HUJB 5CINH 1FZJB 4G6JL 5J06A 5HD8D 3CZFB 3X13B 3PIQA 2NYYC 5D2LF 5KTEL 4BSJA 2BSSA 2CQVA 2BVQA 1UA6L 1WZLA 3OR6B 3PGCA 1MRCL 3OAYH 5I8CB 1HHKA 2ARWA 4Z7VF 3G6AB 1QSEA 4XMLH 3QXTA 4P2YA 4HUNB 5D7IE 5IBTL 4ZD3L 3MV9E 2ZOKB 4JDVA 3FCTB 5E4EB 1TJHL 1HXMA 1YEIH 5DUBA 5EUOE 1ZVSA 3IF1B 1QLFA 3QFDB 1Q9LA 1QVOB 4O2FA 4RMVA 1JBJA 3MUZ1 4N8CH 4Q9BA 3GIVA 2YRLA 1N8ZA 3Q6FA 5DUPL 5FM8A 4R0LB 1Q0XH 2HRLA 4X9IA 4XB7A 4UDUB 4NBYB 2VISA 3L5WA 3LIZH 2H8PB 1T89C 5L2JB 4H26A 1Q9OA 5D7LD 5IFAL 4WUKL 2ARJA 5AAMA 3RGVD 4N0CD 4LRIA 4D0BB 3HE7A 3FT2A 3ZKXC 1IARB 1DBAL 2NY2C 3RI5F 5DSCB 3C60A 3P4OA 5HDBE 1SM3H 5BV7B 3MV8A 1R3LB 1PDKA 3OPZH 2R4SL 3NIDF 3BVNB 1S7TA 4I2XE 4X99B 1LWRA 4UB0L 1O7VA 5L7XH 1XCTB 3UTPE 2DKMA 5GGSB 2UZXB 3F6IA 5IESL 3U9UA 3PWJB 1KPVB 5ENWA 2MJWA 3PHOA 1B9ZA 2NZIA 3P0YL 4KKCD 4GG6E 4KHXH 3IDXL 4R4ND 4C57C 3WS3B 3DO7B 3BXNB 2P7TA 4OV5B 4PJ8B 1CFNB 5F1IA 3KS0H 2O93L 1WCBB 4ZODA 3W0WD 1NCCL 4QRPD 3BQUC 2OX5A 2AEQL 3TJEL 2RCSL 4YXKL 5F6HJ 4ZPVA 2EIDA 1LQSR 4WUUA 4Y5VB 4QHKJ 4KMTL 1FQ9C 3BHBA 5HHXL 1CD1A 4NRXB 3JTSB 5IP4A 2P5EA 3U7WH 4U0RB 1IGCL 3GSNH 1MVUB 1VGKB 4DK6A 2QSTA 1QRKA 3DX6A 3U30C 4HUUA 2WANA 2BOBA 4JQXA 4Y1AE 3TFKD 2CO7B 2QQQA 5GRJH 4P4KC 4PGEB 3T0EC 4KMLB 2CLVA 3KPTA 3IU4L 4UDTA 1MAML 4ZFFA 1OAXH 1TPXC 4A2MA 3WFEL 3MOBL 3MLXL 3BGMA 3WKMH 3L95B 1AO7E 1T04B 3OJMB 3PWPD 4OFYA 1I8LA 2R4RL 3RVWD 5BRZE 2VDPH 4YFDB 1NUNB 32C2B 4UBDD 3SQBA 2XTLA 3U0WL 4XP1H 3AY4C 2V2TA 1MCOH 4R96A 1MAKA 3VDAA 5DK2B 1QBLH 5KAQF 1XR8A 4WEBL 4HT1H 2OQJB 3WSQH 1LK2A 3Q5TA 4PJAA 1ZT4A 4QNPF 1NMCB 1CTOA 4MHHG 3CSBA 1R3IL 3O6ML 2P8LB 5DT1L 1UJ3A 1ZV5A 3SDDA 3E2HB 2AJXH 3BGFB 4M62H 3LOWA 3SPVB 1HINH 1G7HB 4WFHD 3RGVB 4U7MA 2HT2D 3WIHH 3IDIB 4PB0H 3VD5A 5F9OL 1FO0B 3EW3B 3WLBB 5IIEA 2YK1L 4B7IA 5JR1H 4JDTL 3VFOA 5EU6D 5CEXA 3PF2A 4Y16B 1INQA 1CFSA 4F7EB 3EDJA 3WDIA 3KR3H 4PP2B 3MR9A 1G9ML 2QV2A 1UWEL 4G5ZH 3CPLA 5F9DC 5J1SC 1AGDA 3VI3F 3A6OA 1DUZB 1OSPH 2OP4L 1HCFX 4MXVE 4Z76A 1EJOL 3IDNA 2QR0A 1GYAA 1FIGL 3T0XA 4LIQE 4QY8A 1S9WB 2XKNB 4BQ9A 2GCYA 4FZ8L 2JJTA 4JGUA 1JGVH 3W0WB 3W9DB 4QRPB 1NKOA 3CFKA 2FECI 4Q7DA 5E6IC 5IB1B 1HI6B 1SQ2N 3NTCL 4ZOBA 3FT4A 3L3KB 2OL3A 1LGVA 1CDCA 4JANA 4WU7B 3SCMA 2OL3L 5I15L 5D7JA 5C7XH 4WV1B 1BFVL 4MMZC 4NQED 5D1XB 5GGUA 4P23A 2DOCA 3P11L 5L0QB 1Q9WA 2DQIL 3OAYK 3O2DA 4PRNB 5ICYA 4LSVL 4U6VL 1UACH 4NKDA 4ZAKC 4L4TA 5EC1B 3FQRA 1I8KA 1HSBA 5GRUH 1BAFH 2F54D 1CDUA 3E8UL 1A9BA 1CBVH 1KIQB 4GKSB 3QRGH 1FG2B 1H3PH 4XCYA 3OGCB 2PW2B 1IGMH 3G9AB 4APQA 2AXFA 3EOBB 2R23A 5DRNB 3T1FB 5B39A 3OX8A 4NZDA 4KRPB 1RJZB 3SJVE 3DSFL 3QAZC 3DX8A 2MCG1 5CJ5A 3TO2B 2VXTH 3PWPB 4OZHF 5ID1B 3F6LA 3VXMD 4QEGA 4Q58C 3T0ED 3GJFA 1X7QB 5DI8B 5CP7B 3B9AA 3VU2A 1DVFA 1ZANL 1ZT7A 2CLRA 4XVSL 3VFGL 3O3UN 5E8DL 3BGAA 2DL2A 4M8VA 4NFBA 2YZ8A 4YHLH 2AEPH 1TENA 2NY4D 4XC3L 1YPZA 3B43A 3LKRB 4TUOB 4X7SL 5EU5A 3JUYA 4N0UB 3SO5A 1RURH 1KJ3H 1XGTB 3PP3H 2X44D 4MQSB 4JO4H 4UTAL 1BQHB 2P8MA 3PGDB 1G0DA 4P9HH 4EDXA 5C70A 2FX8L 1A4KB 4HGKC 3RY6A 3NAAH 1EK3A 1H5BC 4BFEA 1GXEA 3QEGL 5IQ9B 5D71H 2PXYA 1TVDA 2AQ3A 1BHGA 3DIFA 4G6MH 2ZUXA 4GXUN 5GGVL 4MX7B 4AG4L 1CT8B 1JUFA 3T4YB 2PTTA 4BH7B 4JR9H 5EZOH 3QXUA 4WNQA 5IW3A 4Z7OF 1INDL 2APXA 1RZJL 2H2PD 1AP2A 4RIRB 2VZTA 5EU6B 2UYLA 4NKMA 3EOAA 2VDNH 3EZ8A 1H8NA 1TJGL 4WTZA 5DMIL 4G9FD 5JMOC 1KJMB 4WJ5B 4TTGA 2Y07L 3T2QA 2FECL 2W9LA 3UYPA 1F3JB 4H20H 3UBXB 4ERSL 4HUXB 2SEBA 1JYVA 1J0HA 1MY7A 1TIUA 2AGJH 2JB6B 4TUJA 2IEPA 3SGJA 2FIKB 2RFXB 1G7JA 1CGSH 2A0LD 2PW1A 4BKLB 1KFAL 3WDHA 4P99A 1IT9L 2E5EA 2IH1B 1FNSH 1QLEL 3UTZA 2E7CA 3VMPA 5KS9E 1RJLA 5DC0A 2IGFH 5EZJA 2CK0L 4X5WB 4GAGH 5D5MA 1U8IB 2QQLL 5CBEA 3MRRB 4NQEB 3NCJH 1MLBA 2E7BA 2XV6B 3DV6A 5EDXA 1AD9B 2J8UB 3LS5H 3N9GL 4F7TA 1KB5L 1Y6MR 2A73A 2Z8WC 1CD8A 4Z77B 5LGKA 2GT9B 5GSVB 1RHHB 4I0CC 1U3HD 1Q72H 2F54B 3BQUB 1TVBA 2F8VA 5HYSG 5ETUB 4M8QB 4XNMA 1FL5A 5ID0A 4FQ1L 4O2CA 4NRZA 2I9TA 4XPAH 3MLWH 4PJ9C 5GS3A 1CCZA 1YEEL 1PQZA 3CXHK 2ZKHH 3CIQA 2MCPL 2DWEB 3WD5H 5JPMB 1CVRA 1WTLA 4I18C 3OHXB 1BVLA 3U30B 4GBXC 2XIDA 3VXMB 1J1XL 4L29A 2PO6C 5GRZA 3T0EB 3KHOA 5HYFA 5J9PB 2DM2A 1IC5H 1EEZB 5AAWA 3OKDA 3LZFH 1BMGA 2NXYC 2OCFD 4AEFA 4HXAH 1X5GA 4POUB 4YDVB 3HPLB 1YEHL 5D6CA 1TPXB 3H2WA 4KK9C 1LO5A 4UAOB 1XT5A 4C4KT 3NCYP 4IIQA 4MJIE 4UOW0 4X80L 3CH1A 1BFOB 4JG1H 4ESKA 1MIEH 2BNRD 1Q1JH 3PABB 1CF8H 3T3ME 5SX4I 1GZQA 1Z5LA 5E9DE 2CUHA 4PJDE 4HKZB 3VWKD 3CSYB 2P4AB 5HI5C 3O0RH 5L2KA 2AQ1A 3QWOA 4QRQB 3IDYC 1VFBB 4YAQA 4YHML 2VLRA 1AE6H 3FQNB 1BOYA 4P2RE 1QRNE 3S4SB 3MLYL 1BD2D 4GAYA 3BRDA 2F8OA 4LCYB 4ZNEE 4I4WB 1MELA 3QQ9D 4NN7C 3OMZA 2C3WA 4G9FB 4YHKH 2AEIT 4Y19A 1U42A 2APWA 2FWOB 4M5ZL 5I8EB 1IEBA 2Z91A 4HW6A 3GSWA 3SEPA 1JMZA 5EBMA 5IMOA 1E4WL 4Q9RH 4JKMA 2EE9A 1OGAA 1CLYH 4NCC1 1OOAA 1MREH 1U95B 2H32H 1RZ7L 3U4BL 1SY6A 5F88B 3PWVB 4QTIL 1JK8B 3L6FA 1TETL 1IZJA 2CIKA 3N50A 4HX1A 4G8GA 5D1ZD 1AO7D 5JO5B 2D7PA 3ECBB 2HTLC 1ZT1B 2XZQL 4N0RA 2HG5A 4PGCA 3R06A 3KPSA 5EORH 5E08H 4ZUWB 3BP5A 4RMWA 4KROC 2IBZX 2R0ZL 3IVKB 4JY4A 4L3EA 1T6WA 1Z9SA 4FP8H 3N1FC 1VKXA 4O51A 3QNXB 1F11A 4PLKD 2A6JA 2BY1A 5K59E 3EYSL 3BAEL 4LIQH 3EAKA 2Z35B 1T1XB 5JOPD 3I6LE 3TT1H 4PRIA 1U91B 3F7VA 3DMMC 3UTOA 4J8RA 4IRSD 1U3HB 3QFJE 5JUEL 3L9RB 5ADPL 4OAWA 3BD5A 1RZ8B 5HY9B 4P46D 1WEJH 1EX0A 1XAUA 2OTUA 35C8H 5C08E 1MI5A 2NX5E 1CDYA 3FB6B 1A6UH 3CLFL 1P1ZA 4M43L 3PP3K 4WU5B 5C07A 1KF9B 4M03A 4ETQA 3WXVL 3QIBA 4ZAKB 4OCYL 3EHBC 3GSRB 3QO1B 3HC0A 1A6PA 1DBKH 3HRZB 3VCLB 4X5LA 1WAAA 3R0NA 4KVNL 1PZ5B 3VI4E 3MRLA 4D94A 1G6RH 1OW0A 5C2BL 4HLZH 4XP5H 1RIVH 1GAFL 3QB7C 4OZFA 2NPLX 4WHYH 3JTTA 4YEFA 2LU3A 5I66B 1S7VB 2EDYA 1YEJH 3MMEA 3V8CA 4GO6B 4UQ2A 2O5ZL 3QAZB 1QFUL 4NO2A 5EN2B 2FH8A 3OJVC 4NQVB 2WUBH 4KK6C 4Z7UF 1XZ0B 1C12B 4GQPH 1NC2D 1T2QL 1D3CA 1MQ8A 4ALAH 3VWKB 1NSNH 2YR3A 4PS4H 2E9IA 3U46A 1OAYL 3UCRA 1CFVL 2EDJA 4Y4KA 3L7EB 4BZYA 1T83C 2VAAA 4L9LC 4KK9D 1D5ZA 3MRFB 5LJYH 4OLVH 4M61B 2EDEA 1P53A 2W92A 5TE6H 1BD2B 1ZMYA 4I0PC 5D2LA 2C3GA 1OLLA 5BOZG 5KANG 3CNKA 1NCWL 4KKNA 4LBEA 3WKNA 3DX7A 4R8WH 1I8MA 4OCSH 2VZOA 1H5BB 5M7QA 3MCLH 5BO1H 4PJCE 1GC1C 4RFOL 3H0TA 3O6KH 1P7QA 2Y36L 4X5XA 3NZ8A 3RAJL 3QUMH 3C8HA 1RZFH 4UV4L 4JFFE 4DGIL 4OQTL 1MJ8L 1WITA 3EKCA 5D4QA 2EIBA 2FL5A 3LDBC 1U2CA 5EIVA 1VFOA 5ALCH 3VFSB 1AO7B 3UJIL 5E5MA 1CG9B 2LU4A 3KPOB 4MJ6B 2WUCL 4XXDB 1W0WA 3LKQB 2WBJA 4XAKE 4QT5A 1A3LL 3ZLQC 4XXCA 2BXZA 3DXAE 5F7DB 5GGTA 4MNGB 4FTVA 2GJJA 1E6JL 5HYQB 3L3IA 3QHZH 2IPUG 2XN9D 4UTBL 4YK4B 4HC1H 3TPUA 1K4CA 4DW2H 3R1GL 1UWXK 3PL6C 4IRSB 3P4MB 5DJAB 3TVMD 1FZOA 1U92B 2QADC 5BMFL 3BUYB 1RPQA 1IGJA 3KPMA 4KVCH 4P46B 1FYTE 3S8WA 4GRLA 3OG6B 2FSEB 5JOEA 4KROD 1ZHLB 2PYFA 5JLZA 1HWHB 3WXWL 3LKOB 3G5VB 3QCVL 3ZDXF 2YC1A 4MXWH 4YUEH 5FM5O 3GHBL 4O2EA 2FD6L 2XQBL 3MO1A 4K7PH 1F42A 1QUNA 2B1HL 3MJ7A 1BM3H 1RV6X 3DMMD 2H32B 2R0LH 2VLKD 5DJ8A 4ZXBD 3VXTA 4S1SL 3ZDZE 2VR9A 3AMLA 4N8VA 4X6EB 5ISZA 1A6ZA 5JHDA 3K4DA 3ZHDA 4XPHH 4WY7H 5HYJE 3CD4A 4G6AC 4AL8H 2EKJA 1OM3L 1JHKH 1A3RH 1MHPH 5DFVC 4HAGA 4Y5XC 3A67L 2W65B 3EHBD 1NC2B 1JJUA 4NPYB 2EE6A 1Q0YH 1GC1H 4TVPE 3T1WA 4KZDL 2ZPKL 1G7PB 3GHEL 3JV6A 1KJVB 4PREA 2XY1A 3CK0L 1AGFB 3QA3B 3QO0B 5IHZA 2OXGA 4S10A 4U05A 5INCA 1AR1C 1HKLL 4XCCL 1I1YB 1JHLH 2RBLA 2PCPA 2ZCKH 1HOCA 3S88H 3S7GA 4Q9QH 4POZD 1YA5A 5IR1B 4KK6D 2YUZA 5GZOC 5LGJB 3W39A 3S5LG 3I50L 5F7FA 4LPWA 4EUPB 3X14A 1MHCB 3TV3H 4NKIH 1CN4A 4HF5L 4KKLC 4CVZB 4PIRF 1I9JL 3SO3C 2UVEA 3IDYB 2VQ1A 4G43B 4DGYH 3C8DA 3DUSB 2IQAB 2VR5A 3VRJA 3IJYA 1FL3B 4MWFB 1MWAH 2FZ3A 2CXGA 3UTTA 4QRUB 5D96C 1J1OH 2DS4A 2HKFH 3HG1A 3SN6N 1O7SA 4PD4K 4Y5YA 1SJEB 1MNUH 4KI5D 2IANE 5B8CB 5IK3B 1BVKA 5DHYA 4FQXD 3THML 1NFDF 1FZKB 4PJXE 4E5XA 3P2TA 4X8JA 2ZCHH 5I1GH 3KPNA 1F4XH 2EC8A 5DC9B 4RGOL 5E2VH 3MLZH 4YFLI 3U79A 4U1NB 1MPAL 4GS7C 4G8FA 2HP4A 3MTRA 3UYRH 4S0SD 1IQWH 2XN9B 3VXNA 5KSAC 2CKBA 4NJ9H 4XMKL 4J4PA 4X6CF 5T5FL 1U2HA 3WEXA 3MLRL 2V2XB 4MJID 5DD1H 4HJ0C 3HLAB 4DCQB 4GMTL 4E0RA 2DWDB 2O5YH 3TVMB 1ZA3A 5E8EA 4GAJL 4D9RE 1I7RA 1WFTA 1P4IH 2FH6A 1KIRB 1NGZB 1PAMA 1J8KA 2FO4A 4LSTL 5SWSE 1HXYB 4NWUL 4KROB 4OZGE 1JTOA 3MV8D 1JV5B 3ALWA 3MRCA 1HH6B 4Z0XB 2J88L 1VA9A 5HGGS 1JFQL 5AUMA 1MEXL 1V5JA 4F58H 3FQWB 2RHEA 2B39A 2EYRB 4LSQH 2CMRH 3DMMB 2VH5L 1QRND 3RDTA 2VLKB 4M7KL 4XGZB 3G9VA 4HWZA 3DNKA 3V0VB 3MLSH 1DSFH 4FFZL 5H8DA 4HCRH 2W9DL 1SBBA 2CDEA 3MNVB 3V6ZA 1EERB 1CDHA 3I3DA 1J0IA 4X4YA 1M71B 4M4PA 2W38A 1JZ7A 2ZUWA 1F8TH 3BP4A 5C71A 1HQRB 3U0PB 5D70H 4OLUL 2L4OA 5IVXB 3TPKA 3ULVF 2AJYH 1A7QL 3DTXA 4LMQE 3LQAC 3JWOL 1KN2H 4X0KA 1MCIA 2P5ED 3QUYA 2YWYA 3ULUE 3GUTA 1K5NA 1GIGL 5JDSA 4DTGL 3DYMA 1EHLL 1IAOB 2ATKB 1IVLA 4HULB 1QBML 1KB9K 5DFVD 2XOTA 4ODHH 1QR1A 1J88A 1RUMH 3DGGA 4OZHA 2GAZA 3LH2H 3HA0A 4OB5L 4DAGH 4NO5B 3ZDYE 4ELMB 2ICES 2V5TA 4KAQL 1BREA 1OWWA 4G42B 4LCIH 3QCTL 3EFDH 3HI5L 2YA0A 4L9LB 3BH9A 4RZCA 4OFYD 1HHGB 2EE3A 3X3GH 5IMLB 1KEGH 4G3YL 2XFXB 2OI9C 4J1UA 3OG4B 3NFSH 3F7YB 4S11A 1DQTA 4OLYL 2NLJB 3MZGB 4JFDA 3CH8A 3QEHA 1JGEB 4RBPK 3G5XA 3UTSD 1JPSL 4HH8A 1W0VB 3G6JE 4FZEL 3B2VH 4JFPA 4FQXB 5IHLB 4DUXA 4GH7B 4KKLD 5FK9A 1VDGA 4YHNA 4Z95L 2VLLA 4LCWD 4AEIH 1Q9LB 3VGGA 3B9KA 2VXUH 1CL7I 3GIVB 2B2XH 1F3DH 5EH1A 3U36B 1N8ZB 2HAZA 2XNAA 4OLXL 1MJJA 3RTQC 3TBWA 3ZT5A 4K3DH 5CCKH 1ADQH 3HPJB 3RPKA 2Z31C 1JNLH 5JW5A 1NDGA 4PY7B 4MJIB 4RRPG 3FHAA 3LDBB 3DLQR 5B3JE 2FR4B 1Q9OB 5EOTA 4YO0A 1UZ8A 2EDNA 3LEXA 1LP9E 3AXLB 4QHNA 1Q9KB 3ZYIA 1YNLH 1YEIL 1LEGB 4NRYB 3WIFA 2C4XA 3MV8B 4XWGL 4N8CL 2YD5A 5J11C 3FKUS 4UNTA 5KSAD 3TA3A 4X7DC 3V5DB 3P0GB 2FGWH 3WNKA 4H5SA 3S35L 3LQAH 1MWAB 1QRNB 3LIZL 4OGAC 1JI1A 2R15A 4FQLH 2DLFL 1RHFA 1T5WB 1XGQB 4MAYD 3SY0A 4OCXH 4JREB 1IGTB 4KJWD 5IB4A 2P7TB 4H1LA 2EE2A 3A6BH 3R8BB 5CJOL 1ZHKA 2FNBA 1NEZB 1AY1H 3NFNA 4YXLL 5DA4A 2ESVA 4F33B 1I3VA 3SCMD 5KVMC 1DQJB 5L7XL 1FRGH 1INEL 2Q6WA 2DQFB 1CFTB 2FDBP 2P5EB 5BVPL 4L3AA 5IKCB 2VLMD 5DEGB 1VGEL 3RA7L 1GGBL 2EKSA 4HBQA 4HUUB 4MNQD 4NQCD 4L4TD 4LSDA 1AQKH 1PYWA 3UO1H 3JBG7 2YN3A 3DXAD 1M6OB 2DJSA 2R8SH 1I9RH 4Y5XB 3WN5A 3EJYC 4ZFFB 5EA0L 3QIWA 1KBGL 5GJTH 4TVPH 1ACZA 4OIBA 3RWHA 5TJWK 4XCNB 5KVDL 3FO1A 3U7WL 1HIML 5K33A 3GSNL 3ROOA 3HB3C 1C5BH 2HLFC 4WVRA 5F9WC 2XWJA 1YZZA 3EYFA 3LY6A 3MGOB 4YGAB 4TTDC 1FFNB 1DLHB 4LGPB 1B3JA 4YDLB 4S1RL 3W5MA 2NX5B 5F9JA 1CL7L 4P5TD 5EU3B 4F7CA 3BH8B 3UTSB 3DHMA 3S35X 5A16B 4DFHA 3GSUA 4Q2ZA 2JLLA 5IF0A 2X4PA 4QF1A 1NDMA 4LCWB 4YBQC 1BP3B 1T7YA 4H88H 4ZPTB 3ULUC 2IMNA 1UC6A 4L3CA 5I75C 1X5IA 4C83A 1ACYL 3QG7L 4Y4FC 1S9XA 2AV1B 5HYJD 3QYCA 5D96B 3L3GB 1CFQA 5C0AD 4ZDHB 2GSIA 4NNXA 2AQ2A 3TH2T 3IAGC 4ODVH 1MVFA 4FQHA 1U8PA 5I17B 1F13A 5H2BB 5FF6B 1I1CA 3DYOA 1IAKB 3QPQD 4N9OB 4GS7B 5HDQH 3UJJL 4M6OL 3SE8H 4EI6B 3KDMA 1S3KL 3CDYA 4IRJD 5KSAB 2PYEA 3RTQD 2ADGB 1J5OL 5D8JH 4N90D 3MR9B 1JPFA 1AIFB 3MJ6A 4HAFA 3SKNB 1BJ1H 2NY6C 1MF2L 1U93A 2P5WE 3CVHL 2AXGA 2EH7L 2E6PA 2C7UB 1N6QH 4XBEL 2Y5EA 2DIJA 4UT9H 1V7ML 4MAYB 3FB7A 1WT5A 2BVEA 3WIHL 3QUZC 1R5WB 3LKSA 1U8JA 1IAII 1QEWA 3E6FB 2JK5B 3D39E 3BP6B 2BK8A 3IGAB 2FEDC 4RDQG 3KR3L 4BM7A 1MH5A 4JANB 4HKJA 4IRZH 3PV6B 4ZUVB 5DFWH 4JN2A 3RGHA 3G5YA 1OSPL 3P40A 1Q9WB 4PJGE 3IFPB 1QSFA 1HYSC 2IAND 5DJZB 3B9EA 2DDQH 4MNQB 4NQCB 4L4TB 2BZDA 2VDLL 4G8EA 3QXAA 4CMMB 1X9QA 5JNYB 2BNQA 3DXAB 1JGVL 2BNUA 2W1NA 2EO1A 1C5DA 3L3OB 2DLGA 5C7XL 3HUJF 2H6PA 1JN6B 3EYOB 5B39B 3ULUH 5CIPH 3I84A 1G84A 3BJLA 4FFYL 4OI8A 1FGNL 4D9RD 2Y5TB 4K94C 4U1SB 4G9DB 5IMKA 1UACL 2VKXA 2YUVA 3AGVA 3ARDC 5SWSD 3ZKNC 1TTFA 5GRUL 2AKRA 4P5TB 1PY4A 1AXSA 1KULA 1WFOA 1U8HB 3QEUB 2ADFL 5FA3A 5GJSH 3MRIB 4Z7UA 1ZT7B 4LQFL 3NA9L 4ZUUA 3WJJC 1H3PL 1IGML 3T0AA 3REVB 3V6OE 5BCAA 4F7PB 1DEEB 1PX4A 1LO0L 3BKMH 5ACZB 4K7FA 1ZGLA 2ZCLH 1U8OA 3WS6C 4BJLA 1JF1B 4PJEB 4TTDD 4HLJA 2OI9B 2VSCA 4HK0B 1JPTH 1A0QL 5HYJB 3VGAC 3F7PC 5C0AB 3KNBB 2EC9T 2YBRA 3SKMB 1J8HD 4WO4C 4DVBA 2RJMA 1YNTB 3OKEB 3D85D 4N5EC 3HC4H 2R2EA 4ZQKB 4YEEA 5BZDB 4YHLL 2AEPL 1F6AA 4ONHA 5FCUH 4KK8C 1BQLL 5HYSA 5K9JH 4U31A 1E6OH 3GJEB 4A6YA 3EOYG 4OJFH 4YHZH 3MLVH 4IRJB 4YBLC 5DC4B 3RTQB 4JN1H 1IAIL 1JIBA 2VERN 4TOYL 4FABL 3QHFL 4XCFH 4P9HL 1KN4H 3P4NA 4AT6B 2EDKA 4UOW1 4Z5RA 4YGVB 1IC4L 3FT3A 4HV8A 4YHIA 3LRSA 4AIOA 5FGRA 1OGAD 4G6ML 1RZIB 3X11B 1F90H 2WZPD 3UZEA 3MNWB 5GIRB 3FZUD 1GZPA 5DVNA 1KYOK 1RUKH 2XWTA 5HI3D 2VDNL 5J11B 4NC2B 2XA8H 5E00A 1RJLB 4OF7A 1DDHA 4N9GA 5F1NA 4P5KB 2EYTA 1T1YA 1Y18B 2GITA 4TSCL 4HPOH 4H20L 3I02B 4R97C 4K94H 5FYJU 3K0WA 1RK0A 3KJ4C 2AGJL 2PUQT 4NZJA 4NQDE 1TCRB 1FBIH 2IANB 2KBGA 2CIIB 1IILE 2HT3C 3IDJA 3LN4B 5E6ZA 2GY5A 1SYSA 5E99L 5J13C 4LDOB 5E2WL 5I73B 1OTUC 5DRWA 4OKVA 1WISA 2IPKA 4F2MB 2PR4H 3ARBC 3PQYE 3VG0H 2HJLB 4KJPC 2XRAL 5TH2B 4JY6B 1YDPA 4DJMA 4LVOB 2UY6A 1DQQA 3KAAA 4ZUSA 1HYSD 4K71C 4X7TB 3SOBH 3IB4A 1XGPA 1D6EA 2Q76B 4M1GH 2NY5C 2GJ6A 1WUNT 4JQVA 3S3SA 4C56A 5SWSB 4NUJB 2X4QB 1A7NH 2J3SA 1YEKL 3CUPA 2DD8H 4YDJB 4Z7WB 5E8OA 3REWB 5KANI 4WEUD 4RAVA 5EBGA 4U1MA 1X5AA 3IT8D 3TZVA 1GGIH 2L7JA 3GKWH 4TPRL 4XVJH 2UWEE 4XPAL 1EGJH 1OP9A 1S5IH 1MHEB 1DLFH 4KKBC 1BPVA 2ZKHL 1RQ5A 4JKLA 3FOLA 3IU3A 4OIIH 3Q6GH 3ZKND 1EEYB 1S7RB 5EZLA 2ED9A 4GG8B 2AK4A 4HG4J 3C08H 3HR5A 4OUUB 4R4BB 4RDQF 5I71C 1J8HB 3VRIA 4UU9A 3EJZC 3D85B 4EIGB 1JGDB 3TJHC 3W11D 1CDJA 1JYXA 3EO0B 1YJDC 1QHPA 2HFEB 3M45A 1MIEL 3AS2A 1RZGB 1Q1JL 2YD1A 5HVGB 5I75B 5FYLE 4QHMB 2OMBA 1I7TA 2R2BB 4WFFE 2ZSWB 1RSFA 5HPMB 1NAMA 3VFNB 3X3FH 4W4OA 2H2SD 4KY1H 1NAML 1RJYB 2G9HB 4WO4D 1GGYA 5EBMB 5C0IB 3PDOA 4PRPE 1NFDA 5BOPA 1DBJH 5IFHL 1VHPA 1AE6L 2XXCB 1YUHB 4NGHH 3V6OC 4XPTH 1I3RA 4AH2A 1UM5H 2DF3A 4JFYA 3MJ9A 1R24B 1N3NA 1ND0B 4X6CA 5FYJE 4YHKL 4PGCB 3KPLB 1A02N 3WLWC 4OZ4A 1FIEA 2AV7B 3SKJH 1A9EA 1XR9B 1A14H 3TBVB 2IH3B 1UCBH 1NBZA 4O51B 2NY5H 3NCFB 1F11B 1OARH 3LEYL 2OS7A 3D87B 3KYNB 4LCCA 2IF7A 5CEZE 1OT1A 3BEWA 4PJHB 1DUYB 1YNKH 4KQ3L 2ZNXA 3RL2B 3GO1L 2JCCE 1G0YR 3MRKA 3FN3A 1XEDA 1LO4L 4HS8L 5I1CL 5FKPA 1ORQA 4U1IA 2ORBH 5GS0L 1I1FA 1G0XA 2HA1A 1NMAL 4JRYD 1TTUA 1A7RH 5DJXA 4ZS6C 3FRPG 1BECA 1I9IH 1QBBA 1LP9B 2AI0L 1MCNA 2HT3D 2VDMH 3TT1L 2AS5M 1EUTA 2ITCB 4JCLA 5F6IC 5FO7A 3PWLB 1KGCE 4JO3H 1QSEE 3SDXB 5FHAH 4QRSB 1GRWA 1TDQA 3T8XA 5JHDD 1MCRA 3RWIA 4YX2L 4MCZB 4KJPD 3SDCD 4NT6A 2WWMD 3ULSA 1YJDH 4YPGB 2CLZA 2X89A 5EZIL 1TLKA 1EFXD 5AG9A 3MMEB 4WGVB 3W9EB 3ARFC 4NO2B 1R3KB 2Z9TA 1W72A 4AQOA 4G7YL 4JPIA 4KDTA 4BFIB 4NNPL 1A6WH 3KPQB 4V1DA 4GLRH 5BZWA 5I19H 1GGTA 4QXGH 3ARDB 4HFUL 1IAIM 3QZWB 5TE4H 4EQ2A 2I27N 3BE1H 1ZK9A 4R3SB 4U1HA 1KT2B 3RVUD 1WWWX 1KCVL 2NW2B 4RX4A 5C0CD 1IM9D 1G6RL 4IEFB 5J12B 1RIVL 3AB0C 4EVNB 3ZO0A 2OXHA 4XPBH 4TQEL 1NBYB 1T5XB 4PY8J 1PG7H 4W4NA 5CMAA 1OAUH 2VXVH 4ELKA 2FJGB 3P4LA 5DRZB 5I30L 3O9WC 4I3RH 2DKUA 4U1JA 2BVOA 4PS4L 3VGAB 5AWNH 2J6EL 3EYUH 1S5HA 3V4PH 4WO4B 1FLRH 1RUPH 4JRXA 3QI9D 1QHOA 2Z93B 4ONOA 2V2WA 4BSVB 3QDJA 2YPKB 2MKLC 4JFXA 5E95B 4WDIA 1N6UA 3UTTD 4OLVL 2FHCA 4PP1D 3HG1D 1WBZA 4DUWA 5BS0A 2WINB 4EN3A 1A6TA 4YBLB 3NCYS 3GSQA 3BZFB 3SDYH 4NFCA 3VG9B 3CSPA 3FHQA 2KQNA 3A6CL 5HVFB 1P4LB 3OWEA 4XVUD 3SGKC 3MCLL 3MJGX 2J8UF 1JPGB 1FFPB 2K3TA 2DQGL 4RFEB 5L8JB 4JHAL 3V52L 4K3EH 5EOCH 1RZKH 4XWOC 3QUML 4NYLA 1Z9MA 5KW9H 1IEHA 2BCKA 3AS1A 3RP1A 3CXDH 1NL0H 5IEKA 3FB8A 3T3PF 5C92A 2XPGA 4P2QA 3TN0C 3GMMB 1ONQA 4MD5B 1HQ4A 2VXQH 2A6KA 1L7TL 4CN6A 5HJ3B 5DJYA 3VW3H 3O3EA 3U1SH 2KZWA 2PYFB 5JXAH 4JRYB 4NQSA 4R97B 3HFML 1FFRA 5SWQA 3KJ4B 1P6FA 1SEQH 4JZJC 4MDJB 4RA0C 1UM4L 2I5YH 5C6WH 1NC4B 2I9LB 4HC1L 3O2WH 4PJ5A 4DW2L 2F5AL 5KSUB 2BJML 3DI3B 4ODSL 3BPCB 3P9MA 4OZIB 2XWBB 3RU8H 3W2DH 5DJCB 3MV7D 4JO2L 3ISWA 3L3HB 3VFWA 5IOPB 1G7LB 2R9HC 4DOHB 3EO1B 3SDCB 4UT6H 1TJIH 5IG7A 5CJQH 4JHWH 1KG0B 1EFXB 5CEYA 3CFJA 2BFVH 1GOGA 3QRFM 4PJAE 5IT2H 4O9HL 4M02A 4HDIA 3C5SB 4K71B 4KPHL 4HWBH 2AJSL 1DJSA 1T66C 2R0LL 5JHLH 1CE1H 1LILA 3GMPA 2D7QA 3QUYD 5C0CB 1L0XA 3BX7C 1IM9B 3FB5B 4LAJH 5FUOH 4ZYKA 2O61B 4H8WC 5JW4R 1IM3B 3G5ZA 1UB6A 4AL8L 1T20B 5A2FA 1AKJD 2PCPB 2JJVA 1FORL 4JAMA 4MSWA 1JHKL 1MHPL 5DK3A 4ODTH 2X9YA 4BUHA 4Q74A 3QULB 2GSGA 1KCSH 5IV2A 4K07A 4CW1A 4UIMB 1II4E 4AMKH 3V2AR 1NQBA 4DQOL 2VQ1B 5FA4A 5I71B 3GSOA 2VXSH 3NCCB 2HRPL 3QI9B 3GMQA 5DD3H 5EO0A 4X9BA 5E8PA 1ED3B 3RVXC 2Q8AL 3UTTB 1RUAH 3DRTB 3HG1B 5CGYC 4AM0A 3H9YA 2VDQH 5AYQA 4JY5H 1YN6A 2MSPA 5FM4A 5FYLH 2G60L 4U3CA 4XCEA 1BVKB 2Y6SC 2C9AA 3AS3A 4X8JB 3HZYB 4NQXB 4NKIL 5ABDE 3I75A 2E7MA 5D72L 5I2IB 1FJ1B 5A40E 3B9KD 3WFCH 3D3VA 2X1WL 4DGYL 3RWEA 3ARGA 43CAB 4C4KO 4LRIC 4EUPG 2H41A 4PV8B 3HE7C 1NFIB 3B3IB 5ERWB 1J1OL 5BW7A 2NQCA 1KPUB 2OR7A 3RUGE 4E0RB 3FFCE 5FYJH 5I1KH 5C8JA 1U58A 3MUY1 5EO9A 2ZCHL 2YPLD 1ETZA 1F4XL 5H37H 4X6DE 1CIUA 1PJ9A 5A2LH 3CMOL 5HHNB 3VXPB 3MLZL 4G80A 1GHFL 2FJFA 2A9MH 4NC0B 1MRDH 1IQWL 4LSUH 4ZOEA 2JB5L 5CEZH 2OR9L 1KXVC 2N4IA 2Q8BH 1WZMA 1T0NA 5T3XD 5L8KB 4KV5F 4FXGB 3BWAB 5FYKD 1V3LA 1QO3B 4M7ZC 3TN0D 4NO0D 4H8WH 2IBGA 2O5XH 3MV7B 2DI7A 1WIPA 5GS1A 1QPXA 1VSCA 4G6JH 3OZ9H 4WFFD 4EI5D 1JNHB 5I1LA 1WIOA 4Z9KB 3WJLA 3RZCA 5F21B 1UA6H 4PRPD 1MRCH 3WE6B 5HGBA 5HHMD 1K3ZA 2CMRL 5TPWL 3FRUB 5C9JA 5F6IB 2NY0D 4HH9B 1I1AC 1T4KB 3I6KB 5IBTH 1M1SA 3QUYB 4ZD3H 1H15B 1XH3B 1SJVA 3FQTB 5D7KD 2CRZA 4LK4A 3HUJA 1FZJA 3CZFA 4LDEB 1PY9A 1AKJB 2Y4SA 2VDRH 3U4AA 4MB4A 5HHPB 5TDNB 5DUPH 3ARFB 3U6RB 3OR6A 4MNHA 4UOJA 1QG3A 4N0FB 5I8CA 5CEZD 2MQ0A 3G6AA 2AJYL 1T66D 3BRGC 3RJQB 4D8PB 3IRZA 1I1RA 2GJZB 1OVZA 5I74C 2DQTL 3RY4A 3FCTA 1EPFA 3MUHL 4IBLT 3BH9B 4RWHA 1DBAH 3IF1A 4U3HA 2HMIC 1NCTA 1QVOA 5H37G 2XZCL 2WSKA 2Q1EA 5A2JH 2ZUSA 2WQRA 1B0RB 2R4SH 3B6SB 1RUML 4R0LA 2P49B 3LH2L 1SMAA 1DL7L 4OF6A 2VL5B 4UB0H 1YEDB 3QG6B 4KUZH 3O9WB 2WIIB 2C5DC 5LAXB 2H8PA 3RWJB 4YHNB 5L2JA 2K9UA 4TSAL 3O3BB 1KLGB 1UJ3C 5D5ME 1C16B 3SDDC 4LCIL 3P0YH 3B9KB 4D0BA 2F15A 3MLPA 3NA4A 2NR6C 5CHNA 3X3GL 5DSCA 2ICWB 3QPXL 4M00A 5JIKA 1YN7B 2FBOJ 3K8KA 1R3LA 3NFSL 2YA1A 3O3DB 5CGYD 2AEQH 4LKCB 2RCSH 1P84K 3ARYA 3BVNA 3C5JB 3OKMB 4YXKH 2NZ9C 5EOTB 4X99A 3BJ91 4KGLA 3ARTA 1XCTA 4KMTH 3DBXB 2YPLB 5D93C 1G9MC 4WEMB 3PWJA 1KPVA 5EPMB 1T3FB 4AQ1B 1NGQH 1IGCH 4LPTA 1C5CL 4FOMA 2PTVA 3B2UC 3LHPL 4JKPL 3WS3A 3DO7A 3BXNA 1NJ9B 1YY9D 4PJ8A 1CFNA 1WCBA 4TSBL 2R1WB 4OGYL 3IU4H 1MAMH 2EDQA 3MJ8B 3TN0B 2IWGA 4NO0B 3H42L 2B4CL 4Y5VA 3CXHJ 5BQ7B 4OF8A 2DQHL 3MOBH 3HMXA 2YKLH 3MLXH 2Z8RA 4NRXA 3VXUD 3ZE1E 3JTSA 4EI5B 4HEME 5D7JC 3U7YH 3DETC 5FGBA 1MVUA 1VGKA 3NH7H 4JZJB 4PRPB 2W0LA 2R4RH 1F4YL 5HHMB 2FGWL 4PGEA 3BT2H 3CC5B 5DJ0B 3U0WH 5F1OB 3TP4A 4PG2A 1VACB 3FO9B 2NY0B 5SWZE 1CGXA 4FQLL 3C6LA 2DQUH 3QT2A 5L2KE 3O6LL 4XP6H 1S7WB 3CDGB 3NN8B 2AAVA 3H3BC 1U8MB 2BNQD 1B88A 3L95A 4APQC 1T04A 2EEBA 1S9YB 2YUXA 1R3IH 3O6MH 5DT1H 3MRGA 3I3BA 32C2A 3PGFL 4JZNB 4Y4HA 5A2IH 1FLTX 3RWHB 5F1SA 4Y19E 1I1AD 3TEUA 4IMKC 4F9LA 5DK2A 4OM1L 4YZFE 3VXQB 1DVFC 5F9OH 3PE9A 2OQJA 5BXFB 1AQKL 3UO1L 2YK1H 2OZ4L 3D9AL 3LV3B 5DVKA 3LPFA 3S36X 2A74B 1T2JA 1ZGLP 4XH2B 1UXWB 3B5GA 4EDWL 3ZKSD 2P8LA 1BQSA 2C3HA 1DANU 1G9MH 1VEPA 1UWEH 4JFED 4IM8A 3EUUA 2A2QT 1Z9OA 5F7YC 2OP4H 1G7HA 3VE0A 5DZOA 3RGVA 2QJDA 1S9KC 1C5BL 1EJOH 4L3EE 7FABL 3IDIA 1P7HL 1FIGH 1FO0A 3MFFB 1WCQA 3WLBA 1S9XB 2XQYK 4LMQI 1CFQB 2YSSB 3GMLB 4Y16A 5IW1B 2GSIB 1RZJC 4F7EA 3NTCH 4P48A 4ZSOB 4PP2A 1FAIL 4O00A 3FAWA 2OL3H 5I15H 4OD2B 3MREB 5CUSH 1DUZA 2DQIH 1JYWA 4LP4A 4H88L 1J0YA 4U6VH 2X4SB 2GK2A 3O2DH 5DQJA 4BSWB 5CBAB 1U8NA 1AXTL 2GI7A 3KXFD 1S9WA 5C07E 2XKNA 1EMTH 3W0WA 2I24N 4QRPA 4MMXC 5IB1A 3MYJB 3AAZB 3WFDH 3L3KA 4ZUTB 2NZ9D 4MB3A 3V7AG 4WU7A 5IVNA 1IEAB 4QHLB 4OGZA 4WV1A 5FV2A 5F7EL 2OSLA 3VXUB 1IL1B 1K8DB 5D1XA 4HKBB 1UENA 4RISL 1N7ML 1LDPL 3EDKA 3B2UD 5KBNC 1J87A 1A4JB 4GRWE 4JLRA 5EC1A 5IVXF 2DBLL 2RQ8A 1N6QL 3CGTA 4M7ZB 1ZANH 4F57L 2ERJC 1D5MB 4GKSA 4XVSH 3VFGH 1FG2A 3AM8A 3OGCA 2PW2A 4JM2A 3EOBA 4KK5D 5DRNA 3SGDH 4XC3H 4DN3L 3T1FA 4XBPB 4RWYH 3C6SB 1RJZA 4X7SH 4P59L 3B4NA 5JIPA 2BNUB 5D2LE 3TO2A 3KLHC 5ID1A 1H0DA 4UTAH 4OF3A 4RFNC 4IRZL 2QHRH 4ELMF 1X7QA 4Z7VE 5DI8A 4GW1B 5CP7A 1PKOA 2CDFB 1I1AB 3KGRA 5LBSL 3I9GH 4WFGE 3FFCD 2VDOL 2YD7A 2KH2B 4AG4H 4XPFH 4ZFOL 2BP3A 3U2SB 4CDHA 1INDH 1RZJH 3LKRA 4TUOA 4N0UA 2YWZA 5DMIH 1XGTA 5JTWA 4KI5F 4QTHB 1BQHA 1FE8L 3PGDA 3HC3H 4JFEB 2DL9A 5E8NB 3GSVB 5IB2B 3NPSC 3O8XC 2X09A 5IQ9A 3VMOA 4ERSH 4CVXB 2CRMA 5HPOA 3ULUL 4XP9L 1H3XA 1CXKA 2VZ3A 1NLDH 1CT8A 3FQXB 3T4YA 5EIIB 1U8OB 4BH7A 4ORGB 1DR9A 1X5FA 1QFPA 2A6DB 4RIRA 1EBPA 4UV7L 1IT9H 1IGFH 3H9SA 5EU6A 5AYUL 2AJVH 1MSPA 5B39G 5GJSL 1MFAL 3NIDE 1XF3B 2IALB 1KJMA 4WJ5A 4LPUA 3TCLB 4NZRL 1A1NB 3CU7A 3OSKA 1YC7A 1F3JA 1T89A 3UBXA 4M7LL 5FGCE 4HUXA 1WFNA 1XF1A 4YIQB 3N9GH 2JB6A 3RIAF 4UINL 5HHOE 4EXKA 2FIKA 2RFXA 3F62A 4FQCL 3KXFB 4BKLA 1JNNL 2Z92B 1JPTL 3FQUB 3TWCL 1B90A 2E27L 2IH1A 4QWWC 1PEWA 3ZTJH 1U8KB 1Z0NA 1XCQB 2K1MA 3UPRB 5GISL 2WAHA 3PXHA 4FQ1H 4P4RB 5IBUG 3HC4L 4PG9B 5ISZE 2EDDA 3PHQA 4X5WA 1U8IA 5DMGD 4OTXL 3MRHB 3MRRA 1AGBB 4NQEA 1JVKA 5TF0A 2MCPH 1GZPB 5K9JL 4PGZA 1OSZB 2J8UA 1E27B 3MLVL 3UP1A 3C5ZC 2D7TL 2GT9A 3DURB 4H0IA 1DDHB 5F1NB 5GSVA 1RHHA 1T1YB 1X44A 5J0BA 2F54A 3BQUA 3DV4B 5ETUA 4M8QA 2AERT 3WFZA 1RK0B 1IMHC 1UGNA 4X80H 5TQ0L 4KTYA 2DWEA 5JPMA 3MRBB 4WI6A 3CFDB 4JFQB 1JWMB 1PKQB 4I0KA 3OHXA 2V7HB 1V3MA 3VXMA 4OV6F 1RUQH 4XHJC 3T0EA 3BESR 3CAFA 4HIHB 5J9PA 1EEZA 1MCHA 3QIBC 4HPOL 3RUGB 3FFCB 3HPLA 2X5PA 1HNFA 3IFNH 3MRNB 5INDB 1WLHA 5JQHC 3SBWC 3DUUB 4B0MM 3MLYH 1BFOA 4X6DB 3GM8A 4L8SB 4QNPE 3PABA 3AROA 3MACH 4FFVD 3V79C 4D3CH 5KVEL 4H25A 5TGBB 2BRRH 3ZE0F 4HKZA 3CSYA 4KDVA 4M5ZH 5FUZH 3MXVL 4QRQA 1LE5B 3W5NA 1E4WH 5DHXB 1VFBA 4X98A 4WFED 2ADJB 2FLBT 3O45B 4PD4J 1IJ9A 3FQNA 4M1GL 3H9ZA 3S4SA 1EO5A 3RX5A 4QTIH 2XKSA 3G6DL 1TETH 4NWTL 5EZLB 1A7NL 1PFCA 4LCYA 1RVFH 4I4WA 3HR5B 5GGQL 3ZYOA 1IQDB 5D1QD 3GKWL 2KKQA 2XZAH 2HFFB 2FWOA 2X6MA 3O8XD 5I8EA 5DO2C 2R0ZH 1GSMA 3VI3E 1MCEA 3GRWL 4YJZL 5IJKA 5SWZD 3BKCL 2EDTA 3AU1B 2MMXA 3UC0H 2P45B 4UMGA 3EYSH 3BAEH 4LLWB 3AREC 4FQPA 5F88A 3PWVA 1T0MB 3QNZB 1JK8A 4PJFE 5GSRB 5ADPH 5K9QG 2QQKL 1TZHB 5JO5A 3ECBA 5EBLB 1ZT1A 1OAQH 2W59A 3D18B 3QDJD 3ALPA 3KG5A 3I85A 4ZUWA 4I3SH 3CLFH 5ICXB 3IVKA 1FYHB 4GLRI 1N5YL 4XXCC 4M43H 5DD0L 3QNXA 2MOVA 2W9EH 3WXVH 1QD0A 2Z35A 4OCYH 5D2NB 1T1XA 1U91A 1HNGA 5EUOA 3RWDB 3NBNA 1U3HA 3L9RA 2Q87A 4KVNH 4LEXH 1RZ8A 5HY9A 4ODWB 3GB7B 4L8DB 1ZHNB 4PB9H 2UZIH 1KTLB 3VJ6A 1GAFH 2GW5A 4XPGL 1H3TA 3FB6A 4LAQL 4TRPL 3RKDC 2GTWA 1UM5L 3WHE0 2V9TA 3HZKB 4WU5A 5CZVL 4K8RD 4GRWH 1NLBH 4ZAKA 1KB5B 4OZHE 3GSRA 3QO1A 3O4OC 1CS6A 2H26B 3HE6C 5DWUH 3HRZA 4O58L 3VCLA 1I1FB 1OAYH 2CD0A 4ODUB 1PZ5A 1CFVH 4W70A 4BH8B 4I5BB 2ERJB 4XB8A 2NY5L 4RCAA 3PP4H 2FX7L 1YMMD 4XBGB 5ICZB 2VIRB 5I66A 1S7VA 5IHUH 1YNKL 1E4JA 3BZDA 1FSKC 5EN2A 2A6IA 1AC0A 4NQVA 4F3FA 3SE4A 1XZ0A 4R90L 1IKFL 1C12A 1IBGL 1NCWH 4JFDE 3UDWA 4XHJD 1ITBB 2ORBL 3VWKA 4RFNB 1ZLSH 1YPZF 3L7EA 3ZDZF 1A7RL 5ITBL 3UAJC 1MUJB 4RFOH 4DKEH 4FQJL 4AIZB 2Y36H 4PJEF 4UV4H 4DGIH 3AS0A 1MJ8H 5DJ2B 5BZWB 3VA6A 2IQ9L 2E6QA 4CJ0A 4P3DB 2X41A 4JO3L 3UJIH 2D7MA 3JV4B 3QEQD 2ZOLB 8CGTA 2DQDL 4PJBB 5D1QB 3RFZC 4XNZC 1TVHB 3PV7A 1H5BA 1UH3A 3O8XB 3P0VH 4PGJA 3LN5B 5SWZB 4C54A 4JE4B 4WCYL 4UTBH 3QDME 4ELKB 3INUL 2OR8A 1T6VN 4BK4A 3BIKB 1OL0A 2YRZA 4NDMB 5T1KD 1A6WL 5TE4L 4V2CB 4CJ1A 2A83A 4HQQL 4OZFG 5ESQB 4G6KL 3VFSA 1AO7A 1CG9A 4MJ6A 5H35B 4XXDA 4OSUL 2FBJH 2UY7A 1GGCH 3QDJB 3VFMB 5F7DA 4XPBL 4MNGA 5DVOA 2FLRT 1UJTA 3P73B 1KPRB 5HYQA 2HFTA 3GHBH 2FD6H 1D5IH 1M7XA 1NBQA 2XQBH 1DBBL 5MEND 2XG4A 1BZ9A 4HWUA 4BK5A 2ESVE 4S1SH 4IRSA 3P4MA 5DJAA 4XP4H 5AWNL 3EYUL 1DCLA 1U92A 3BUYA 1G9EA 1E4KA 1FLRL 4P46A 1FC1A 3EYQC 5EU7E 1NFKA 3VFTB 5F3HB 5LVEA 3ARGD 3HS0B 5I6XC 2X9WA 1YQVL 2FSEA 1ZHLA 1OM3H 3LKOA 3G5VA 4JO1L 3VXRE 5B38B 2GEEA 3MOQA 2XPGB 4L1HA 2QTEA 2XG5A 3C5ZB 1ZLVH 3EIFA 3GM0A 2H32A 1UQSA 3GIZL 4XNQB 4X8XA 3STBA 4KZDH 4X6EA 1M7IB 2ZPKH 1OY3B 3GHEH 3NGBB 5D6DC 3RDTC 3CK0H 4RGND 1EAPB 4K3EL 1RZKL 3MA9H 1YMMB 4DZ8B 4XCCH 5FV1L 3RL1B 4PJIB 3ES6B 1URLA 1FCCA 1KIPB 1WBXB 2DMKA 4Z7WF 1PGRB 4JPKL 3I50H 4GBXA 4GUPB 4NPYA 4OCRL 4HF5H 1XGUB 3HE6D 5HHVH 5L88H 3VW3L 1CD0A 4CL7A 2ZG1A 1G7PA 4M3JA 1KJVA 3QO0A 5FIEA 1HEZB 1SEQL 1UCTA 5SX5K 3O2WL 1AGEB 1I1YA 3CCHB 1EO8H 1J86A 1F5WA 2X4NB 3QUXC 4FRWA 4NOBA 5IR1A 1CGWA 4OLWL 3QWRD 1D5BB 5LGJA 3QEQB 4HMEA 3W2DL 1MHCA 3BZEB 5GS2H 4GRWB 4HBCH 5DDHA 3QIUC 4JG0L 4K55A 4CVZA 3O4LD 4KXZI 4RGOH 4M1CC 1LEIB 1S8DB 2LFGA 2RIKA 2EDHA 2XI9A 3LB6C 5J1TC 3MRPB 3T2NL 2HKHL 1P5VA 3UAJD 4JAMB 3DUSA 5IROC 2IQAA 5IT2L 1FL3A 4MWFA 5T5FH 1U9KA 2PYEE 4QRUA 1I9EA 5T1KB 4AK1A 4MDIB 3NACL 5MHSE 4GMTH 2ZJSL 5JHLL 2APTA 2DQEL 2AJZB 1SJEA 4GAJH 5B8CA 5IK3A 5IMLA 5DTFA 1FZKA 3S6CA 3TO4C 1I85A 1MFDH 4I1NB 4LSTH 5E94A 4NWUH 4U1NA 1WZ1L 2FJHB 3M1BB 1BF2A 2J88H 4AM0B 2XN9A 5MI0C 1MEXH 2ID5A 5DZLA 5MENB 3AREB 2V2XA 2VH5H 2XTJE 3HLAA 1L6XA 4DCQA 2DWDA 3OKYA 3TVMA 3O41A 3QNYB 4OT1L 1NBVL 2VXSL 4FXLA 5DQ9B 1KIRA 3RWEB 2W9DH 1NGZA 5L9DL 1EJ6A 4NJAL 2WMPA 1HXYA 1QSFE 3LD8C 2DJUA 1RUAL 2OJZH 4PJHF 2ZSVB 1JV5A 1KJ2L 1HH6A 4Z0XA 3L5XL 2V6HA 5AD0B 4JY5L 5JW4N 4TNVK 3FQWA 2EYRA 4N1EA 3STZB 3DMMA 2VLKA 3TA3C 4CMHC 4XGZA 2B8OT 4M48H 4F7MB 3V0VA 3QDGD 3Q3GB 3RWFB 4RGNB 1GIGH 3MNVA 4DTGH 1EHLH 4TYUA 2VO5A 3SKOB 1T0NB 3NCMA 4Z78B 3MV11 5GGSY 1QBMH 1M71A 5CZXD 2HLAA 4V2BA 3SDXF 4R9HA 2VUOA 1HQRA 3U0PA 4BFGA 5IVXA 2CGRL 4Z7UE 3CDFA 5C09D 5MEOB 1V05A 3O4OB 3HE6B 5CD5D 3QJHB 2IBBA 3OXSB 3QCTH 2A9ML 5C86A 3RI5K 5EU7C 4R26L 1IAOA 1QP1A 2ATKA 1LMKA 4MJ5B 1YMHB 3C6LD 4YHYB 3HAEB 3JSSA 1UH2A