5IMKB

Nanobody targeting human vsig4 in spacegroup c2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imkB00
1MRFL 1R24A 3IXAA 1B90A 4GW5A 4QHKI 1NBYB 2FBJH 1ZA6B 2XNAB 4AENB 3ARDA 3O6FB 4H20L 2YA2A 5HYSG 4RAUB 5HJ3A 3ZKMD 5C08A 5F9WC 4G3YH 2YRPA 4BM7A 4OD1H 4QRRE 2RCSH 4O00A 2BVPA 1V05A 2MKLC 3QIUB 2W9LA 3O6FD 4XCFH 3DETD 1T7ZA 4IRZL 1ONQA 4Z7UF 2Z92A 3ZDYF 2HFTA 2R29L 3K80A 2XA3A 4OF8A 3SCMC 3WHXB 1MHPL 3QIUD 1YPZA 2HFFB 4K3HA 5HHQB 2IPUK 4LL9A 1NCWH 3OX8B 5FYLL 3RA7H 4UOW0 3TNMA 4OI9A 1ZGLP 3DBXA 5A2IH 3KYOA 4L8CA 3KPPB 3S5LB 5LGHL 2MFNA 4P2CG 1U95B 4G42A 4HIIB 5E94A 1F90L 1WBZA 4G7YL 4FG6C 2R2HA 2A73B 1AQKH 2VOTA 1RULL 3QEUB 5EZIH 4WUKL 4UT6L 2VLKB 4R4FH 3B3IB 4MX7B 1QSEB 4ZPVA 4JFQB 4ONFH 3X17A 1JPGA 4XAKD 2ADJB 1MQKL 3EW3B 4ERSH 1JGDA 1DZBA 4GBXC 3WFHB 1AFVH 2R0KL 4NBXB 4XPTH 2VLKD 5DRWB 2AEPL 4JB9H 1QSED 4U3CA 4CU6A 5MERA 2WSKA 3UTQA 3L5HA 4DUXA 4XBEH 2APFA 4O2CA 4L1HA 1AGFB 1GH7A 4KJPC 3KPRE 3MO1B 5FUCC 1FV1B 3SKMB 3D48R 1ORQA 5K9OA 3PWNB 2ED8A 3TN0C 2D7NA 5DHYB 4XCYA 5C7XL 1KB5H 1ZHKA 3ARFA 4Y16C 1XF5A 5CEXB 5AZEH 5E95B 1IC7H 4Y4FB 1CD9B 4S11A 1IKNA 1CLOL 1YEJH 3FO9B 5H37H 2WQRA 2LAAA 3RY6C 3HFML 3P73B 3VG9B 5CJOL 2JK5B 5KSAB 2ARWA 1SMAA 2H6PB 4U1KA 2FX9L 2W0FA 4UINL 5GRJH 35C8L 4Y4FD 1ZHNB 1D5BA 3B43A 2V2XB 2EE2A 4Z7UA 4WV1A 5KSAD 1JPSL 5AWNH 5EZOL 1EERB 4GAGL 1U58A 4HS6B 3BQUC 5CUSH 1QFWL 3L5XL 3CFEA 1NCAL 2LAGB 1Q72L 5ENWB 4WFEE 3UJJH 3HS0A 4Y19D 3UCRA 3TCXA 1KNOA 2ADFL 4NQEA 5JA9A 1KELL 4F2MA 2AJXH 4GG8A 4YXLH 3WKNA 4CN4A 2FEDD 1JNHB 4TUJA 4ALAH 5FKPA 12E8L 2AJ3B 4Q2ZB 4U0RC 3C60B 3W39B 1MCSA 1KTKE 4WY7H 4K3JH 2Q20A 3B6SB 3BPOC 5FYJL 5LXGL 4Q9RL 1DBAL 2Q76A 4X80H 4NDMB 4OCSH 3MLTB 2B5IB 4P4KC 4QXUH 3HCVA 3C60D 4HJ0D 4WU5B 5C0BD 4KK8D 4LLWA 3C08L 3TH2T 1UH4A 4RX4D 1KENH 3UTPE 3IFOA 4UILL 4XNXH 1ED3B 4X5XA 2YRZA 4LSPH 3QFJE 1ETZB 1G7PA 3ARPA 5EC1B 5CEZL 4MB4A 4FQ2L 3TJHC 1LO2H 5DK2A 5C0JA 4KRPB 1F3JB 1SJEA 1J1OH 2QTEA 5DXWA 1VB9A 3ZKQD 5DJDA 4ZS7L 2R8SH 1FFOB 4BSWB 1JWUB 1FRGH 1HI6A 4U1LA 1U8HB 1AGDB 4QLRA 4PJIF 3RNKA 4KRPD 4P57B 5CILH 1LEGA 3WUZA 4BZ2L 1J86A 1P7QB 1SMOA 2AV7A 3EHBC 2XT1B 4K3DH 2F9BT 3DYPA 3OQ3B 4IOIB 1G6RH 3VRLE 4Y5YC 2DQTL 3LS4L 4OLYH 3ZTJH 5ILTL 1P7QD 1VACA 3UTZA 5FYKH 3VXQB 2QKIB 5I66B 1CFBA 5HHVL 5JXAH 1QSVA 4OIAA 3ZHLA 1GGUA 3HZVB 3HRZB 3D3VB 5FM8A 4KXZI 3JWDL 1MIML 2X4UA 3IAQA 3C5ZB 2IPKB 3W2DH 5I6XC 2NNAB 2W65A 3G9VA 3TIDB 7CGTA 3D3VD 3M45A 4F15C 5ESAA 5EBLA 3VMOA 1NKRA 3V6OC 3WNOA 3MRJA 4KRNA 3MREA 2YXFA 4G5ZL 3C5ZD 3SGEH 5I9QC 2NY3B 4L5FH 4PJXE 3Q48A 2MHAA 4N5EC 3OKLA 5AEAA 3BT2H 2NY3D 3BP4B 3CCHB 3T0EC 5I16A 5DJZA 4N1HB 1P2CB 43C9B 1N3NB 1NEUA 3RU8H 1A4KA 3D39B 3V7AE 4KQ4L 1ZVSB 1MFCL 4ZTOL 4OZHF 1C8PA 4HWBA 5HDQH 3N0PB 4EVNB 3VH8G 5HHNB 3SDYL 5EOCL 1QFOA 3LVEA 1U92A 1WF5A 3QO1B 1CS6A 3HNVL 3D39D 3EFFB 3DYMA 3V5HB 4P9HC 3RWDB 1QBLL 5J89A 4OM0L 1JV5B 3MOQA 3WFBH 4Y2DA 5F7NC 5I71C 4HULB 1H0DA 4LDOB 3VDAA 4XC1H 4YBQC 1N2RA 5F8QC 1VHPA 4U1MA 4Z77A 3WSQL 3UPRA 2GJ6A 4DVRH 4HF5L 2R56L 3GK8L 4MXQD 3IXTA 5CINL 3BH9B 4LIQH 5F7UA 3EZJB 3ALXA 2JJVA 1V3LA 3AFLA 3RVXD 5F71A 3PL6A 4ODTL 5FDWA 5HVFB 3K8KA 4TSCH 1T1YB 2Q8BL 3UO1H 4Z7QF 2YD8A 5JXEC 4ZUUB 2F19L 4Z7VB 5KOVC 4KZEH 3KAAA 1QFUL 3TT3H 1Z3GL 2A9NH 2C4XA 3DRQB 2BNQE 4P9MH 5FYLD 3ESUF 1JZ3A 1NGZA 4ZSOE 1IM9A 5TH2A 2ZCHH 3QIBB 1LK3L 4JFDB 5E70A 4ZO8A 2J88H 4MAYC 1F4WH 3B9KA 4GG6E 5IW6A 5C2BH 3Q3GA 3QR2A 1LE5B 2ATKA 2LV4A 5AYUH 4RAVA 2AQ2A 2XY2A 4NZRH 3HI5L 2V17H 2V7HB 3X14B 3SOBH 1OGAA 3QIBD 5HBBA 5BO1H 2HJLA 4JFDD 3OV6A 4HKBB 4K8RL 3L3IA 1JZ6A 4EOWL 5IROA 1CDYA 2BC4A 3V4PH 4W68A 1T6VN 1IBGH 5CMAA 5TDPB 5IT2L 2AJZA 4Y4KC 4OZGB 3OKOB 4Z5RA 4R0LB 4OZHA 5FOBB 4PJAE 3MLXL 3PJSB 4EDWL 1BVLB 1TJGL 4OQTH 4X4YA 5E2TL 1YQVH 3SDAC 2NXZD 1XCQB 4KK9C 5EUOF 1NAMH 1N5YL 5HGBB 4X4ME 4W6XB 3O6KH 1DQLL 2Z31A 4EI6B 3ZSTA 3MJ8B 4LSTL 1TETL 3QWRD 5DD3L 5ISZE 2VAAA 2J6EH 4GMTH 4OUOA 4CW1A 3AREB 4HK3N 1EGJL 3CDGA 1MFAH 1G1CA 3T65B 5ADOL 1GCFA 4PGBB 4OI7A 3BGFC 2R4RL 4KKBC 2DDQL 4XC3H 3LHPH 5IMKA 3MLYH 1D5ZA 5C07B 3ARED 4BH8B 1F02I 4P23B 3QUMH 2VXUL 3BPNB 4KUZL 4R8WH 5SX4I 3MUGA 4MQXC 2EDFA 4FQCH 4MA7H 3QNXA 4U3XA 5C07D 4Z7WF 1WV7T 5E6YA 2CKBA 1BP3B 1CU4L 2XKSA 5MEPA 3BDYL 3D85A 4P23D 1P7HL 5LJYH 2X42A 4NSKB 1JNNL 3BP7A 1R0AL 5EU5A 5IBTL 5FHAH 1NMAL 1I8IA 3F12B 4YNYA 4OCLC 3ARZA 5DHVB 2BK8A 2ICWJ 5KSBE 4WTXA 3X3GH 3GSNL 1K8DA 3T08A 3H0TA 4QTIH 3IDIB 1FL6B 3ULVL 1NUFA 2NY6C 4HDIA 5FO8B 1HSBA 4JM2F 5FYJD 1RUAH 5FM4A 4ZXBA 4HPYL 5L9DH 2EYRA 4QNPE 1YJDL 4B7IA 1PG7H 1MOEA 1QR4A 3STZB 1I9RL 3O9WC 5IEKB 1ES0B 4JDZA 5BW7A 2IANA 5MI0B 2B1AL 4HH9A 3LQAC 5GRVK 4PLJD 5CHNA 1OAXH 1BOGB 3EYOB 4M6NH 2P5WB 1GHFH 1MRDH 3FFCB 3EYUH 5E9DE 2I07A 5LWYL 5FXCH 5EUOA 5LAXB 1C5CL 3L3HA 4M7KH 3WIHA 1D6EA 4OFKA 4OIBA 1VFOA 1HILB 5CEZD 3A6OA 4ELMA 3SKOA 2P5WD 4H8WH 4PJ8C 3FFCD 1DQTA 4NQCE 3MRRB 1R5VB 3UYOD 2APBA 2VNCA 2UYLB 2R1YA 4TNVK 2VIRB 3DX8A 4NQVB 3O3DA 2MCPL 5CJQL 5DJ6B 2Q7YA 2I9LA 3T1FA 1MJ7L 2P5ED 4G8GE 1PFCA 1IAOA 4GRWH 2PCPB 3WFDL 2BJMH 4OLUH 2DWEB 1HYSC 5TJWK 2XKNB 4PGCA 4MXWL 2CK2A 2GTZA 1HDMB 3IFLL 2WWKO 5HI4C 4LVOB 4NFCA 3ARBA 1IEBB 4YHIB 4NJAL 4Z7WA 4C55A 4ZD3H 4QYOA 1FGVH 3OZ9L 5CP7B 4GRMB 4PJDB 4LSDA 3U0WL 5GJSH 4HS8L 1TQCC 3BSZL 4HKJB 5IOPB 2P8MB 1JTOA 4RIRB 5CBAA 2VLJB 1GZQB 2EE3A 3LKRB 5GS0C 5EH1A 3LKQB 1DP0A 5ACZB 1QLFA 5E6IA 4UAOB 4JM2A 1QRNA 2EKSA 3BD5A 4BZ1H 4NWTL 3CXDL 2VLJD 2IBGA 1ZKAA 3ZYZA 5GZOD 4WFGD 1BJMA 3VD9A 5EBWB 1X5ZA 1K4DA 5KN5B 3RX7A 3OKKB 4KGJA 3PWPB 3P9LB 1P9MA 4J8RB 1T21A 3DYOA 3K1KC 5DK0A 5MEOB 1ORSB 2AP2A 1N0XL 3MRHB 1DBMH 5ESQA 4QRRB 2HN7B 3P30L 4O2FB 3PWPD 1E4WL 3LKNB 4JZOA 3SHSA 3GSXB 2DKMA 1EAPA 1ZVYA 3CC5B 5ERWA 3VXRE 3BE1L 3DSFH 3AC0A 3U83A 1U8OB 1XCTB 3WN5B 4QRRD 4NNYA 3OR6B 3OXSB 1ZHLB 2DM3A 5JZ7C 1XAUA 2GAZB 3C5SB 4I2XA 1K85A 4R90L 3UJTL 2IFGA 4M43L 1QLEL 2RR3A 5J0BA 3FZUD 2A9MH 3VFSB 1VENA 4XNYH 3P77B 5FUOL 1MCNA 4YDLB 1NBYA 1ZA6A 2XNAA 4AENA 3FT4B 1RJLB 4M48L 3O6FA 3DSNA 3MLVH 4RAUA 2CRMA 1FYHB 2GW5A 2XN9E 2VXQH 1CDUA 2GJZB 1IFHL 3IRPX 1EHNA 2NY5H 3QO0B 3QIUA 2A6DB 3A6BH 3N1MC 3O8XC 4DUVA 4U49A 1OCWH 4BFEA 5A2FA 2NY2C 1KEGH 1SY6H 4K2UL 3WHXA 2DLEA 1MVUB 2EDNA 3B2UC 2D7TH 5E5MB 2HFFA 4XP1L 1P4BL 3N1QC 2Z4QB 3X3FL 3KPRB 3OX8A 3VI4F 3G08B 3JWOL 1OQXA 1G9NL 3ARXA 5JQHC 3KPPA 3S5LA 5EU6E 1WWWX 1D6VH 3G5VB 3PXJA 3VGAC 1U95A 5HGDB 4HIIA 1ZGLB 1A64A 4K8RD 2A73A 3DUSB 1F42A 3T77B 5EPMB 3W11D 1FFQA 4GAJH 2HYMA 3QEUA 3Q1SL 3QHFH 2EH8H 2VLKA 1WT5A 3B3IA 2K1MA 1QSEA 4MX7A 4R26L 4CVZB 4JFQA 4KJYB 3ULUH 2ADJA 2JJSA 3FL7A 2MTPA 1MLCB 1CXFA 1CXIA 3WFHA 3ILQC 1Q0XH 3QAZB 4HAGA 5DMGC 5DRWA 3MLSH 1CFSB 1B0GB 3NIGE 1ZEAL 3RX5A 3VXUE 4OJFL 2VZOA 4O4YL 1AGFA 1FLRH 4LQ1A 1XMWA 1I3GH 3FN0H 5I2IB 3MO1A 1JMZA 5E7BA 1FV1A 3SKMA 3ZE2F 4KHTH 5TDNB 3PWNA 1DUZB 2P48B 3R1GL 5DHYA 1EH9A 4WFED 1IT9L 5CEXA 3IDXH 4Y4FA 1MCQA 2HFGH 4LF3B 3FO9A 1TJIL 5D6DC 4L8BB 4BSJA 1CZ8H 1J1PH 2NTSP 3SDXE 3P73A 3LIZH 5HXMA 4KH2A 5DLML 5KSAA 1WQVT 5E1HB 2K3TA 4G8FB 3V8CA 2FH8A 5IGXH 3QXAB 2YPVH 1ZHNA 2EC9T 3DECA 4G8EB 4Y7MA 5JNYB 2V2XA 4ODWB 2OL3B 4Y19A 4LLAA 4UT9L 4G6MH 4HS6A 2C5DC 2DQIH 4D0CB 5FYKE 1AGCB 4EUPH 2VXTH 1TITA 3NPZB 5ENWA 4L4TE 5FDYA 3DUUB 3CXHJ 1ZE3C 4WRLA 3QFJB 2QQLH 1I9IH 3UTPD 4XP5L 3HI6H 4AMKH 4N8PA 4F7PB 2GT9B 1VFBB 3WO3B 2H45A 3KYKH 1TVBB 1JNHA 4Z76B 1L7TL 3ULVD 4HUXB 4G9FB 1YEIH 2AJ3A 1NGPH 1UG9A 3QFJD 5C6WH 4Q2ZA 2G60L 3C60A 3CVHL 3W39A 3VWJB 4P2OC 5C0BA 1T89C 3B6SA 2RB8A 5CBEB 2B1HL 4X6DE 3EDFA 1AXTH 4G9FD 4FMFA 1MHEB 4NDMA 4H26B 5DMIH 4WU5A 3VWJD 2QHRL 3AB0C 4N0YH 1E6OL 1U42A 2HA1A 5D72H 1ED3A 4YHKH 3SKUD 4LK4A 1KACB 1OAKH 3HB3D 2JCCB 1ETZA 1ERNA 3FOLB 5EC1A 2X1XR 3DARA 4G3YL 4HFUH 4JHWH 1JNLL 5E4IA 2RCSL 1F3JA 3MOAH 2YD4A 5F7MC 1QKZL 2BSRB 1NLDL 1RIUH 3MGOB 1YC7A 5LCVL 5HYJE 2F8OA 1FFOA 4BSWA 4ZOBA 1JWUA 2WW8A 1U8HA 1AGDA 3GGWA 2EDTA 3QIWB 2ID5A 4HK0B 4NC2B 4DEPB 1A3LL 4KJWC 4P57A 1JFQH 1P7QA 4PD4J 1XT5A 3HNSL 5BVPL 4PJXB 2FJGB 3VWKB 1NCWL 4H25B 4IOIA 2HLFC 1HHKB 4LIQE 4BKLB 1G7MB 4OGAC 1XF4B 3NVQA 1OAZH 1GGYA 1P4LB 2V9TA 3VWKD 3VXQA 2QKIA 5I66A 1RIHL 5LBSH 3NFNB 3FQUA 1AIFB 4PJBE 3HZVA 3HRZA 3D3VA 1NGXB 4YC2B 4Z7VF 4ONFL 5IJVB 5EBGA 1FC2D 2FL5B 3C5ZA 2IPKA 3WD5H 3GHEH 2NNAA 1IL1B 3TIDA 1YYLL 4XTRC 4K71C 3QA3B 4XP9H 1IC1A 2A2QT 3KJ6H 5GISH 3MRGB 3UZQA 3U4AA 4XBEL 5F9AC 4PGZA 1GAFH 2NY1B 2YK1L 5FK9B 2ORBH 5CSBA 2V5SA 2DM2A 1C5DB 3EUUA 3CLFH 4YEEA 4RA0C 1KB5L 3BP4A 3CCHA 5AZEL 2NY1D 43C9A 1P2CA 1N3NA 3D39A 1T2QH 5ADPH 1JF1B 5I1JH 4OZGF 3TO4B 1ZVSA 2Y5TB 4EVNA 1HINH 3D69B 5HHNA 1WSST 1QO3A 4PRPE 3BW9B 3GBNH 5GRJL 1IC4L 2BNQB 3QO1A 4FHBD 1UWEL 3EFFA 4XP4H 3VCLA 3QCUH 4ZSOB 1OP9A 1U8NB 3TO4D 3V5HA 3RWDA 5AWNL 2AEQH 1OOAA 2ZCKH 4GG6B 1IGJB 1IC5L 1JV5A 5GQBA 5HPMB 2BNQD 1JCKA 3NAAH 3UJJL 1UCBH 4JRYE 4URTB 3MUJA 4AL8L 5B38B 2AJXL 5EIIB 5DA4A 3BH9A 4ALAL 3RVTC 4QCIB 4LRNH 4KI1A 5K33A 1T1YA 3QEGH 4K3JL 4PJAB 4QHMB 4ZUUA 4L29B 4Z7VA 1RZKC 1FAKT 1N6QH 5GHWH 5E6ZA 3NZHH 4X80L 1EVUA 3DRQA 4OZIE 4OCSL 4QXUL 5J6HB 3QIBA 2RGSA 4JFDA 3WS3B 1KENL 4XNXL 3EOYG 3QQ9C 2F5BH 3DX7A 3MBXH 1I8MB 4P49A 3RKPA 2BSSB 5KS9B 1E0OB 4P9HL 5ISZB 1YEDB 2UVFA 1IGYB 2V7HA 3X14A 2OI9B 4RNRB 4HKBA 5E2UH 5LQBH 1IQDA 5BOPA 5KG9B 5FCUL 5ISZD 5TDPA 3CU1A 4M9PA 2CO6B 3TBTB 1HK6A 4OZGA 3OKOA 1AXSB 4R0LA 3AGVA 3ZKND 2ZKHL 5FOBA 5C0EB 1FRGL 3PJSA 1KTDB 5DJ0B 1BVLA 4N0RA 1JYWA 3N50A 2WP3O 4NNPL 1ACYH 3QWRA 1EJ6A 4K3DL 3FHQA 1XCQA 4JQXC 4ZUVB 3SCMD 3DXAB 5HGBA 5EO0B 4XNUH 4LCWE 3MUY1 1TIUA 2G5BB 4WCYL 5INCB 4EI6A 4HUVB 2JB5H 4OLYL 3MJ8A 3TWCH 5KSBB 5FEBA 2X40A 1YNLH 3DXAD 2DF3A 2BVEA 5DJ8B 4G6AD 3AREA 5JXAL 3VFGH 3T65A 4PGBA 1MLBB 4IMKC 3ARQA 1BLNB 3MLZH 4GRWE 4X98B 5FGSA 3TYGH 3BGMB 4JFYB 5GRWA 5C07A 3PP4L 5DR5H 2Z93B 2DJUA 2EC9U 3H3KA 3IAPA 4BH8A 4P23A 4C59B 1RIVL 4HJJL 3ELAT 3B9DA 5E9DB 4OCRH 3CVHB 3NA9H 2E7LC 3LMJH 4PJDF 5IG7B 4RFNB 4NSKA 1RZGB 3WDIA 1LO0H 1TCRB 4KJPD 5E00B 1E6JH 3F12A 4NQCB 3PDGA 1T1XB 5DHVA 4HUUB 2W59A 2YBRB 3RU8L 3CDFA 4M62H 3IDIA 5IJKA 2QR0B 5FO8A 4ZO9A 4I0PC 1DLFL 1CGYA 2Y4SA 4NQCD 2R0WL 2OJEB 3STZA 2CXKA 4G8GB 1U0QA 3V4UL 4J3XA 3BQUB 5IEKA 1ES0A 5DMYA 2EEBA 4OCMC 2L0DA 2YN3A 1DN2A 1FYTE 2GK2A 1M6OB 1XIWC 1BOGA 5C0CE 3EYOA 1NDGB 1QSFB 2P5WA 3U46B 1T03L 5ACLA 5F88B 3FFCA 4NRXB 4G8GD 3WFBL 1BIIB 3BQUD 5LAXA 1HILA 2AJUL 3QUZC 1QSFD 1KG0B 4LHQB 2ATPB 4U0RB 5E2WL 3MRRA 1Z2KA 1R5VA 2ESVB 4GW4B 2UYLA 4NZJA 2IPUG 3OJVC 2VIRA 1KIUA 5KVEH 4NQVA 2WWMD 5EIQA 4AG4H 2VDKH 1H3PH 4P4KB 4ONHB 1IEHA 1XFPA 5DJ6A 2ESVD 4ISVB 4YIQB 4L3EB 5B39G 5IESH 3TT3L 3T1WA 4I77H 3X12B 1S5IL 2VDQH 2B4CC 3KYNB 2PCPA 4WI2A 1H3VA 2ZCHL 1NDMB 1BZ9B 1FL3B 2DWEA 2J88L 2XKNA 4P4KD 5E4EC 4LNRB 3EO9H 1HDMA 4L3ED 4MVBC 5AYUL 4YHIA 4HIJB 1IEBA 1OAUH 2V17L 5CP7A 1BZ7B 3INUH 4GRMA 5KZCB 4PJDA 4JR9H 1FZJB 5BO1L 3V5KB 1CE1H 4HKJA 2NXYB 1JRHI 1F4HA 5E56A 5IOPA 2ADIB 2VQTA 2P8MA 3JTSB 1KJ3L 4RIRA 4X7FC 2VLJA 1GZQA 3WNNA 3LKRA 4X9GA 5DC4B 3QUKB 5F7EL 3LKQA 5ACZA 1WWCA 1YEFH 5JQ6L 3GIZH 2HG5B 2NXYD 2BRRH 1XR8B 1KB5B 1NCDH 3HG1E 1BF8A 5EBWA 4Y5YB 5KN5A 2RJMA 4WUUE 3PWPA 3P9LA 1FLTX 1NAML 3MOBH 4J8RA 4LCYB 2VDMH 2FB4L 3EHBD 5MEOA 5EN2B 1ORSA 1PQZB 3ULUE 1VGEL 3MRHA 4JG0L 5GGTA 4H0IA 2CIIB 1FO0H 1CR9H 1S7QB 1IMHC 1IAMA 3VRJB 3TPUB 2HN7A 4QRRA 4O2FA 2HVKB 4WI8A 3LKNA 3GIVB 4P5MB 4XWOC 3GSXA 3CC5A 2OTWB 3HMWL 3O6LH 1U8OA 3B9EA 1XCTA 4RGOH 3PQYE 1WC7B 3RY4A 3OXSA 3OR6A 1ZHLA 2OTUB 3HAEB 2R4SH 5AUMB 2GAZA 3C5SA 3V0WL 4JM4L 3QUML 4NHUB 4R7DB 3E3QE 3R8QA 5IFHL 1P6FA 5GS0L 3VFSA 5EU6B 3O6MH 3CX5J 4GQ9H 1J5OL 3P77A 2APVA 3NTCL 5HD8D 4LPYA 3FT4A 1RJLA 1JGUH 3TFKC 4N5ED 2DD8H 5EU6D 4DKEL 3QWOA 4KQ3L 4I3RH 1MCEA 2IH3B 3X3GL 2GJZA 1TMCB 4D9LH 3BWUC 3QO0A 2WUBH 3QUYB 2A6DA 4MDIB 4OKDA 3QDGE 4S1RH 1RUAL 3VFOB 3MCLL 1FVEB 3T8XB 1URLA 3PG2A 1PG7L 1R6VA 2GYSA 3GNMH 4KMTH 1MVUA 4R3SB 5E5MA 3QUYD 3ULVF 4Z6AT 4C58B 4UNTA 2X4SB 2Z4QA 1OAXL 1OT1A 4RDQG 4DUWA 4Y1AE 1GHFL 3G08A 1EHXA 1RV6X 2A77H 3G5VA 3MLPA 3KJ4C 5HGDA 2MQCA 1ZGLA 4M7KL 3GKWL 3S36H 1HH6B 2HAZA 3E6HB 3DUSA 3T77A 5DZLA 5EPMA 3SDXB 4H8WL 4YBQD 3OPZH 1CK0L 3QDMD 3KS0H 1J1XH 3KLDA 1Q1JH 4CVZA 3CSPA 4KJYA 3NABL 1Q0YH 1KT2B 3UTTE 1Z5LB 4I9WE 3K74B 4RWYL 2X4TA 1MLCA 1TJHL 1L6XA 4CJ1A 4PJFE 3HR6A 1CFQB 5D1QB 4MNGE 1J18A 4U1NB 1CFSA 4ZMAT 1B0GA 5CCKH 3BD4A 2IFFH 2HRPH 4DK3A 3D25B 4MAYB 1ZK9A 4W70A 2ZWLT 1PX4A 5GS1B 1NSNH 2JJTA 1D5IL 5D1QD 5I2IA 2BJML 3K0WA 2JCCF 4QHKJ 2O5ZL 3ZE0E 2W60B 3WFEH 1LEIB 1A3QA 5TDNA 4IBLT 1DUZA 4MAYD 4KY1H 4MSWB 2D7QA 4P5TC 4LF3A 5GJSL 1OQOA 4ONGL 4L8BA 4LLQB 2QL1A 1MJUL 4MJID 2YMXH 1U8IB 5K93A 4G8FA 5L2KE 4X6DB 3QXAA 1KLGB 5IVNA 1F6LL 4G8EA 5GGQH 5JNYA 3LN9A 3EYQC 4PJXF 4ODWA 1YNKH 2OL3A 1Y0LB 4C57C 1N7ML 2KQNA 4JFPB 2IALB 1G9MC 2OX5A 4D0CA 5I1DB 4OZFH 3IDYC 1AGCA 2GK0A 4QRPB 3DGGB 4ZFGH 3VJ6B 3S37L 2ZUXA 5GZNC 1INQA 3DUUA 4HAFA 3SDAD 3QFJA 3WLWC 5K59E 4WIQA 1DBML 5F1IB 4QRPD 4F7PA 2HRLA 1VFBA 1TVBA 3GI8L 4Z76A 3BGFB 4HUXA 4G9FA 4LEOA 2Y23A 4XCNB 4ZOCA 4ZFZB 1T83A 4TVPH 1FCCA 3P40A 4WWKC 4GKNB 4O5LH 2DICA 1UJTA 2M26A 4YBLB 3VWJA 1EHLL 4NO2B 5IR1B 2QSTA 2OR9L 4Y8AA 1UJ3C 3DV6B 4H88L 1MHEA 2OBGA 4P5KB 3CZFB 4H26A 5HDLA 4UIMB 2BNUB 3E8UH 4XVJL 3FRUB 1IGFL 4LFHG 2A9ML 4XVSL 4XNYL 1TCMA 3IDNB 1HCFX 3ARSA 5CJ5A 2DTML 3O3AB 1JGEB 2VO5A 4MQXD 4XPGL 1UM6L 3FRPA 1HHGB 4E42B 2Z35B 3CFKB 3MLVL 2JCCA 4XAWL 2QEJA 1FBIL 3FOLA 1PZ5B 3FCTB 3PGFL 4ZYKB 3MGTB 4OTXH 2JIXB 2CGRL 1U3YA 25C8H 2BDNH 2W07A 4GO6B 2BSRA 3JUYA 3MGOA 1NC2B 3A6BL 1JHLH 1PKQE 4RMRA 1SYVA 2KBGA 1NBVL 2NY6D 4Y88A 2BY1A 1KEGL 2JIXD 2R69H 3QIWA 4HK0A 3VU2A 3S34H 4GG6F 3BZEB 3SY0B 2K7PA 1WCQA 2D7TL 1KXVC 4FQPA 4PJXA 3M07A 2FJGA 3VWKA 1JUFB 1KBGH 1NC2D 1WZKA 4NO5B 4H25A 1EA9C 1HHKA 4BKLA 1YEGL 1G7MA 5DQ9B 3MPCA 1XF4A 4FMKA 1D6VL 1OTTD 1UM4H 4XMPH 3VD3A 1P4LA 4JFFE 1GOGA 1C12B 2DQUL 5IB1B 1BWMA 2H8PB 4GAJL 4DQOH 4ODUB 3NFNA 1AIFA 1CT8A 5C6PB 1NGXA 5I15L 4PJAF 2R0ZH 4PRPB 3ULUL 5IJVA 1NAMB 5FUZL 3PWVB 4HUWB 2FL5A 3MNWA 1KGCE 1MFBH 4LHJB 1AGEB 1FGNL 1IL1A 2QSCL 4YHOH 3KNBB 3U30C 3QA3A 1XGQB 4UIKH 4W4OC 4HG4J 3MRGA 3PUCA 3V0AC 2RAMA 5KS9F 1CICC 1V3KA 1OTUC 1YN6B 1FLRL 5FK9A 2IGFH 4U1GC 3S3PA 1ITBB 3FN0L 1KCSL 2ITCB 1H8SA 2YN5A 3W9DB 4M1CC 2FO1A 1C5DA 1UQSB 2EIEA 2LE9A 3MRBB 3IDXL 3QUMB 1HWGB 1MNUH 4A2LA 2E8YA 5J7CC 1JF1A 2F53E 3MLRL 3LIZL 4P3CH 3BAEL 3CFJB 3TO4A 1BQHG 2Y5TA 3D69A 4WEBH 1F3DJ 2O61B 2AGJL 4FOMA 3BW9A 3U48A 1UACH 4NPYB 2BNQA 2YWYA 1RUML 5T33L 4ZSOA 1K6QL 5GS0D 1U8NA 4PG2A 4G6ML 5D8JL 4GG6A 3NCMA 1IGJA 1ULVA 2VXTL 5HPMA 4HXAH 2X4OB 5KSBF 1IRAY 2YPKB 1FNSH 1BZQK 3H42L 3PE9A 2QQLL 3MRQB 1I9IL 2EH7H 1PG7X 5EIIA 1PKOA 2NY0B 2P47B 4QNPF 1ZMYA 2CK0L 5D7KE 1CF8L 3DX6B 4QCIA 4NRZB 4KAQH 1NGPL 1X4XA 3GRWH 1K4CB 3OJDA 2PR4H 5I1CL 1D9KC 3T4YB 3BRFA 4QHMA 4PJAA 3UDWA 4L29A 2NY0D 3SE4C 4A6YH 4NZUH 3CVIH 1KEML 2CLZA 2QADC 1YEKL 2Q87A 5DMIL 4NC1C 5J6HA 5JZ7D 3H9SE 2RFXB 1V7NL 3WS3A 4LCWB 4B50A 4N0YL 3TGXA 3VXTB 5BJTB 2CUHA 3HPJB 4Q6YA 1I8MA 2BSSA 4DFHA 5E24E 5DJCB 5KS9A 5ISZA 2QQKH 1YEDA 2UZIL 3OKMB 1IGYA 3N9GL 2DQEH 4R96B 2ENSA 4BFIB 1GPOL 3O2WL 2BXZA 4LCWD 4RNRA 1EFQA 1NBZB 3QRFM 2NZ9C 1A7BA 1G0XA 5KG9A 3C2AL 4JKPH 1U3HB 5D2NC 5HHPB 4JY5L 4NQUA 2IMNA 3F7QA 1HKLH 1CLZH 1INEH 1NMCB 4YZFE 3TBTA 4F8QA 4JFHD 3PDOB 3SCMA 2N56A 4Z0BL 5E8DH 5C0EA 3D2UD 4Z8FH 5DJ0A 1KTDA 4I13B 1J88A 1EXUB 3BN9C 1U3HD 2NY2D 5HI3C 4ZUVA 2QQQA 3DXAA 5HTSA 1JGLL 5EO0A 1NEZB 3MNVB 4P2QB 1A6UH 2EEDA 2G5BA 5INCA 4HUVA 3OR7B 4PJ5B 3L3KB 2I9TB 5KSBA 4PB9H 4JCMA 3VH8B 1NCNA 4X7EC 1KIRB 2A38A 2YUVA 5DJ8A 2C1OB 4P2QD 1MLBA 1QTYT 4PJ5D 2BHZA 1BLNA 2X2YA 4X98A 1MCKA 3TIEA 3S37X 3BGMA 3WD5L 4JFYA 5EG6C 4FP8L 2Z93A 1FYTB 4WFHE 3BPCB 4YGVB 3MYJB 2BFVH 3VXNB 4GLRI 5C0CB 4WTZG 1PY4A 3KJ6L 5DMGD 3WS6A 3TLRA 4KRMB 5E9DA 1FYTD 3CVHA 3MZGB 5GGRY 4BJLA 5EA0L 3WJLC 3CJJA 4KMQA 4OGYL 5C0CD 4MA1C 1RZGA 1ZTXL 1TCRA 5E00A 3F62A 4OFIA 4PY8I 4NQCA 3RY6A 1T1XA 2EKJA 2YBRA 3GUTB 4FXLA 4NM4H 5ADPL 2QR0A 4RMVA 1DQJB 3VFUA 2OJEA 4G8GA 3TEUA 2AQ1A 3BQUA 4HEPG 1LO5B 3QCUL 5FYJU 3FO0H 3QCTH 1M6OA 5EFIB 3D0VA 3L7FB 1NFIB 1NDGA 1QSFA 3OTTA 3U46A 1M4KA 5F88A 4NRXA 1OAYH 1NL0H 1C5BL 1BIIA 3NAAL 5I8EB 5TF0A 3BXNB 1LQSR 4DN3L 4FZEL 3QCVH 1MJ8H 2WLZA 3TPKA 3WDJA 1KG0A 2ATPA 4DKFL 3VGDA 3RGVC 2ESVA 3PGCB 3QG7H 4GW4A 4JCLA 1QRKA 4YE4H 4NOBA 5CKGA 1HXYB 1OARH 3MGAA 2JB6B 3WMSA 4AEIH 2HT3C 4P48A 1UH3A 4LASL 4P4KA 4ONHA 4HIEB 4ISVA 1N6QL 4YIQA 4L3EA 3NZHL 4WEUD 4E9LA 1C7TA 3DHJA 4WUUB 1NFDE 3X12A 4XBGB 3NIDE 4JY4B 1UWXK 3KYNA 2Q1EA 1NDMA 1T0NB 1BZ9A 1FL3A 4JGJA 4LNRA 2XRAL 2F5BL 2DM4A 1KCUH 4HIJA 1J0IA 3NPSB 4AEFA 4WUUD 5CSGA 4J12A 5AAWA 4NO3B 3CMGA 1BZ7A 1FZJA 3V5KA 2GTWB 3FONB 3DI2B 2YD9A 2ZNXA 3ULUD 2NZIA 3GMNB 5LQBL 2ADIA 1WBXB 3JTSA 3W0WB 1ZS8B 1JPFB 4KVNH 1MFEL 3PQYB 5IFAH 2VSDA 3QUKA 3P4LA 4G6KH 5ICYB 1M05B 4OLWH 2HG5A 5C0RL 2APTA 4Z7UE 4XPFL 4EQ3A 3W0WD 2Q86B 3WXVL 1XR8A 1KB5A 3NH7L 3IKCB 3HE6C 4M6AA 5A3IC 2D31B 3BZ4B 4DGYH 4Y5YA 1ACYL 5BMFL 2VDOH 1BFSA 4XNUL 4DZ8B 3A67H 5EN2A 4DGIH 2EDLA 3SDXF 1PQZA 4GXVL 1MJJB 4G8IB 2Y1VA 2CIIA 1S7QA 1M7XA 4OGAD 1HOCB 1GGCL 3VRJA 3TPUA 1YNLL 2HVKA 2H3NB 5DC9B 4P5MA 3QDGB 2P46B 4Z95L 2E7BA 3Q0HA 4QRSB 4EUPB 2OTWA 1BEYH 4K71B 4IM8A 4DKDC 3TYGL 1WC7A 4QXGL 1XGUB 2XTJC 4JJHA 4PS4H 4F7TB 3V6OA 2OTUA 3HAEA 5DR5L 2ITDB 5AUMA 1VGKB 4LPTA 2AKRB 2DIBA 4NHUA 4R7DA 4YHNB 2WBWB 4XCCL 5DD6B 1L0QA 5M7QA 4JHAL 2E9IA 5EU6A 4B7LA 5HGAB 1JL8A 3NA9L 3QZWG 3LMJL 3NGBB 1CQYA 5SWZE 1LO0L 1E6JL 1OD7A 3ZYOA 3PF2A 3AS0A 3VXOB 1VPOH 2AXHA 2IH3A 3QUXC 3MXVL 1PDKA 4X6DF 4XMKH 3UTTB 2IQ9H 4ZUTB 4FQXC 4U1HB 3QUYA 4MDIA 4PJFB 1GGBH 4AQ1B 3FB7B 4MNGB 4X5WB 3VFOA 1FVEA 3T8XA 1OLZA 1DCLA 4TTDC 3STLB 2ENYA 4K94H 2DL2A 3NCJL 1RUQH 4I9WD 4R3SA 1WFTA 4M7JH 2X4SA 1A6VL 2YA0A 3LKPB 5DVKA 1E4XL 3QRGH 2QLVB 3QDMA 2PF6A 2K9UA 1QYGL 1RPQA 4TVPE 1WLHA 1T1WB 4HK3J 4EXKA 1HH6A 3E6HA 3KLHC 4JJ5B 5IBUG 4HBCL 2DB8A 3U1SH 3SDXA 1A47A 4YK4C 4WHCA 3RIAK 1O5DT 5DT1L 4KVCH 4M5ZL 5L2KB 1AKJD 3MRFB 4LQFH 5B21A 5D71L 1KT2A 3W81A 4C4KO 1Z5LA 4HSQA 2DN7A 3RWHB 1CCZA 5L6YL 1FCGA 2EDYA 3LS5H 3T0WA 3RVTD 3KPMB 2CLRB 2Z0BA 1GRWA 2VDKL 1CFQA 5D1QA 4B0MM 4U1NA 5L2KD 5IESL 4OFPA 5I1EH 1DFBH 1MCPH 1AE6L 3D25A 4MAYA 3DTXB 3PIQB 2VDQL 3O81A 5GS1A 1A2YB 1OGTA 2W0KA 1LDSA 3BN3B 3I02B 4M7LT 1CE6B 1BGXL 3CX2A 3EO9L 2W60A 1LEIA 5DEGB 3D5OF 4YEFA 1K2DB 4ODHH 2YHGA 4MSWA 3QQ9D 3BUYB 3INUL 3RDTB 3HNTL 4FN0A 1RJYB 1A7QL 1X5FA 3BKMH 4LLQA 1JPTL 2APXA 1U8IA 4WO4C 2D2OA 4JPKH 1LNUB 4X6DA 3JWNC 4MA3B 4V1DE 1KLGA 4S1DD 4KI5C 1YEFL 1A14H 1DEEA 4PP1D 2HTLC 3SDAA 1Y0LA 3QHZH 4CUCA 1VCAA 4JFPA 2IALA 4AZ8A 3SE9H 4PJIE 4BUHA 5IVXE 3DVFA 4QRPA 1IVLA 4NO0B 3DGGA 3E2HC 5I8KL 4UTAH 3VJ6A 3ET9F 3MOBL 2C3WA 1IZJA 2VDML 3ZYJA 3L6FB 1UWXH 1I3RB 1U6AH 1JZ5A 2R0LL 4NZTL 2FIRT 5DO2C 5F1IA 4DJMA 2GJ6E 4NO0D 5DQJB 3IETB 2D3VA 1A21A 4LSVH 1WZMA 1NCCH 2OSLB 4XCNA 4ZFZA 1PKQB 5HY9B 4QOKB 5JLZB 1NUNB 4W4NA 5IR1A 5ITFB 3G5YB 3DV6A 3D1MC 4P5KA 2XXCB 1RFDL 5IFJB 3CZFA 4UIMA 2BNUA 4QOKD 3FRUA 4L1DA 3CFIC 3OHXB 3IDNA 1G7JB 2VL5B 3O3AA 1JGEA 4JFFB 1W0YT 3SDCB 5JOPE 4J3TA 1HHGA 4P46C 1G9ML 4E42A 2Z35A 3CFKA 5FGBC 4KRLB 3GSOB 3BWAB 5GGRB 1PZ5A 3FCTA 4ZYKA 4I3RL 3MGTA 4I0PB 2VDRL 3ARRA 5T1DL 1B6DA 2JIXA 4MXVF 4U6TA 5E99L 5J12B 3SDCD 2VB5A 3CGTA 3MA7B 2D4DA 4L3CB 4BZYA 3JXAA 1NC2A 4D3CH 4OZHE 2F5AH 4I0PD 5C0IB 2N7BA 3AXLB 4LAJH 4JO1L 4HLJA 3BZEA 3SY0A 3SEPA 1RHHB 1KGCD 2DQHL 1MRFH 1WEJL 3GBML 4YO0B 1NANH 3K7UA 1JUFA 4NCC2 4CMMB 3ZL4L 3RWFB 4WI5A 4NO5A 2CKNA 4H20H 2LFGA 5DQ9A 3HUJF 3SGJC 3QUZB 2H32B 4JDTL 1H8NA 2EYTA 4HMDA 1SBBA 1KIQB 2A0LD 1C12A 4X7CC 5IB1A 3WIIL 2H8PA 4RGNE 2QSVA 4ODUA 3OPZL 4IRZH 3P11H 3PDDA 1IKFH 3OSKA 1J9CT 1Q1JL 3QUZD 3MSPA 1NAMA 3PWVA 4HUWA 1MHPH 1AGEA 1R3KB 3KNBA 2DQGL 5FYLH 1XGQA 1JZ4A 3HMXL 5CCKL 2IFFL 1B3JA 3RWGB 2J6EA 4LGRB 4YDIL 5E2VH 4XBPB 1E4JA 1KJ2L 1YN6A 1F90H 4G7YH 4UOJA 2Y7QB 2ITCA 4YWGL 1RULH 1NUDA 1UB6B 4WUKH 1UQSA 4UT6H 2WUCL 1Q9KB 3V2AR 2W0PA 3MRBA 1MQKH 3QUMA 4H1LH 3R06B 2DQJL 3UZEA 3CFJA 4TVSa 2R0KH 2AEPH 3TV3L 2HTKC 2O61A 3G9AB 3FAWA 3BDXA 4NPYA 1N64L 4RBPK 1MELA 4HGKC 1S7WB 2IANE 2EIDA 5DWUH 1YNKL 3DNKA 3H9SB 1HQRA 5I75C 1DLHB 5TQ2H 1CDGA 1M1SA 3NOIA 2X4OA 1SBSH 5I1GH 2FNBA 2CMRH 2P8LB 5BV7C 5I1HH 3A6CL 4HBQA 3H9SD 3OGCB 4CVUA 1CLOH 3MRQA 1B88A 3WNPA 4WHYH 4JN1L 5CJOH 4IRSC 1JYNA 1YY9C 3HA0A 1RU9H 3DRTB 2FX9H 3DX6A 4YDJB 1L9MA 4UINH 5DRXA 1OW0C 2PYFB 4TVPL 1K4CA 1AO7B 2EXWC 1B9ZA 3S97C 4WW2C 3T4YA 4QWWC 5CLWA 4XWOD 1JPSH 5EZOH 2IG2H 4N5UA 4GAGH 3KXFE 3W9EB 4L8SB 5IM7B 4JPVH 4LHUB 1QFWH 3L5XH 3VXME 2DMKA 1EK3A 1NCAH 1AO7D 3E8UL 3DVGB 2RFXA 3OL2A 4LCWA 4UT7L 2FWOB 3VXTA 1KELH 3L9RB 1AC6A 5BJTA 2PXYC 3HPJA 4LHUD 4MMXC 4JQVC 5DJCA 3OKMA 1OD9A 12E8H 4R96A 5TE6L 4BFIA 4M3KB 2VABB 1NBZA 4X6EB 4BUGA 4TOYL 3IVKB 1I9EA 3HC0B 3OG6B 4YHML 1RK1A 1U3HA 2BDNL 5FYJH 5HHPA 3QULB 5LXGH 4Q9RH 1DBAH 2LTQC 4ORGB 3PDOA 1CL7L 2J3SA 2XTJE 2IADB 1YZZA 1QRNE 5AD0B 4LGSB 4HXBL 2I5YH 3C08H 1EXUA 3WUWG 2E6PA 4ETQB 2Y06L 1U8PB 1QD0A 4OB5H 1MCWM 4BQ6A 1NMBL 1X5AA 1KBGL 3KJ4B 1ZVHA 3TYFB 1NEZA 3MNVA 4P2QA 4M00A 2AJVL 4NN6B 3JBG7 5SWSE 5CEZH 5C92A 3OR7A 4PJ5A 3VGHA 3L3KA 1UM4L 4FQ2H 4XMPL 3RWCB 2I9TA 1WWBX 2L7JA 3VH8A 4P2RE 2VRAA 1KIRA 2HJKB 1P69B 2VXSL 2GKIA 3VW3H 2C1OA 4X0KA 4JRXE 2J5LC 4ZS7H 5T3XL 3RL2B 2FX7H 4IJ3C 1FNGB 4BZ2H 2XOTA 4BQBA 1FYTA 1MY5A 3BPCA 4YGVA 4I2XE 3MYJA 3VXNA 2BNRE 1N6UA 1FO0B 2JELL 5C0CA 2BY0A 2V9QA 3ULUF 2DQTH 2FCBA 2ICWB 3LS4H 2J1KA 3S98A 1LEKB 4G7VL 1CGWA 5EU4B 4RMQA 5HHVH 4P5TB 1F97A 2EE9A 4U0QB 3SJVB 5D6DA 1AI1L 2J8UF 1MCJA 4JFOB 3KDMA 4ZPVB 1MIMH 1T04B 3GUTA 3FQWA 3FOMB 4LARL 4LU5L 3J7HA 1HHIB 1QEWB 1RZ8B 4P5TD 2XYCA 4KXZH 2WQ8A 3GB7B 4MGXA 3SJVD 4WEBL 3C2SA 2RBLA 1IZKA 1SYSB 1UACL 5DD5L 1S7TB 1NFDB 1UB5B 2D7OA 1LO5A 4EXPX 5DSCA 1CN4A 2KZWA 2BP3A 5EFIA 4LAQL 3L7FA 1NFIA 3SGDH 5I1IH 1UADC 4Y5XB 4TNVF 5I8EA 2BMKA 1XF5B 1FNSL 2HWZL 3BXNA 4I3SH 1KC5L 3MCG1 4TULH 2FX8H 4KQ4H 1A6AA 3WLWD 2VLKE 2R23B 3O2DL 3SDYH 3T0XA 4YHYC 3PGCA 1PEWA 2FEEI 3TESA 32C2B 1AQDB 3GRWL 1HXYA 1UJ3B 2PR4L 3HNVH 2JB6A 1BD2E 1P5VA 43CAB 4MJ2A 2PYEE 5I73B 1IARB 4HIEA 3CDCA 5FV2A 4OM0H 4MJ5B 4EN3C 3S36X 4RBPH 1MREL 4WUUA 4XBGA 2GIYA 1I1YB 2B7DT 1T0NA 2YSSB 4PTTA 4Q9BA 2KZ1B 3WSQH 5E0QA 2BY2A 5AZ2L 2R56H 3GK8H 2OR8A 5FKPB 1FNHA 4NO3A 3KVQA 3O0RH 4LEXL 2EE6A 4YFLI 2DM7A 2GTWA 4PJFF 3GMNA 5IW3A 3W0WA 1ZS8A 2F19H 3TVMC 1KJ2B 1AR1C 3PQYA 4JKPL 4K55A 1QFUH 1CLZL 3CD4A 1Y18B 4LSQL 5ICYA 2N4IA 1M05A 3ARDC 4ZOEA 2GCYB 4Y19E 3U9PL 1LK3H 2Q86A 2YKLH 3WJJC 2PKDA 4TNWK 3ZE0F 3IKCA 5DF0A 2D31A 3BZ4A 4MAUL 4H0HB 3U0TB 4C4KT 3FTGB 4NIKB 3T4AB 5JHLL 1EIBA 4DOHE 4DZ8A 5SWZB 4MWFB 2XQYK 1A6UL 4N8VB 4X6CE 3PGDB 1MVFA 4J4PC 4K8RH 1MJJA 4G8IA 5JW4M 5IVZA 1FH5L 4EOWH 2VLME 5I19L 5K9JL 1HOCA 2QBWA 2ZOKB 2H3NA 2VZ1A 4TTGA 5SWZD 3QDGA 4OZFB 4QRSA 4EUPA 4NUJB 3I2CL 5C0BE 2C4FT 3MLXH 1TJGH 1XGUA 4OAWB 4F7TA 1QOKA 4FFWC 2AKRA 1N5YH 2O5YL 4YHNA 1L4IA 3T0AA 3QI9B 5DD6A 1WWAX 1DQLH 2VH5L 2OM5A 3QYCA 5HHMB 5HGAA 1TETH 4R6UA 3AY4C 1OTUD 2KDGA 1EGJH 4NQDB 3QI9D 2CO7B 5ADOH 3EJZC 3VXOA 1TQBC 4M1CD 3MNZB 4TVPD 5HHMD 5CZXC 4NP4L 4NM4L 4U1HA 2UWEB 2L7UA 4PJFA 4NQDD 3FB7A 4MNGA 4N0UB 2VXUH 4M6OL 3VGFA 3STLA 1AD9B 5ESAB 3VG0H 4I8DA 1IGCL 1TVDA 5GJTL 1BJ8A 3V6ZB 3ARFC 5HVWA 1RZJC 4BQCA 1N5AB 3LKPA 3MV9E 1ZA3B 2EDJA 1JNNH 1CDCA 4LRIC 1R0AH 1NL0L 1NMAH 4HCRH 1V3MA 5L0QC 5IBLC 1T1WA 4HLZH 3GSNH 3CH1B 4JJ5A 3UPAA 4U6VL 3L3DB 1M7IB 3ULVH 4K3EL 3MXWL 4WV1C 3X11B 4HPYH 2NY7L 4FABH 5L2KA 1YJDH 2AV1B 3MRFA 3IB4A 4V1DB 1I9RH 4UBDD 3RWHA 3WYRA 5CD5C 3MROB 3KPMA 2CLRA 2EO1A 3WFZA 4AEIL 1I8LC 1A0QL 4GAFB 4PJIB 5IVXB 4V1DD 2EDXA 3DTXA 4PJHE 1MF2L 3PIQA 1A2YA 5ALCH 4A2MA 3IDGB 5BXFB 2DLHA 1QHOA 2VC2H 3I02A 2IQAB 4XP6L 2CXGA 1T20B 5I74B 5T1KB 5DEGA 2VMFA 4JO2L 1K2DA 1L7IH 1C08B 1GGTA 1XGTB 3BUYA 4NCC1 3RDTA 4F9LC 5FDWB 1SM3L 1RJYA 3EOTH 3UX9B 4HIXL 2X1QA 2MCPH 2X5PA 5CJQH 5T1KD 1X3DA 4OGXH 3Q5TA 1D5XB 2EXYD 1LNUA 1MJ7H 5IFAL 4I18C 2NZ9D 4MA3A 4G6KL 4OLWL 5EZLA 4IIQB 5GGUB 4JQXA 4R4NC 4FQ1L 3WFDH 1BF2A 3IFLH 1CBVH 4DGYL 4NO0A 5EWIL 3VFMB 1VERA 4NJAH 3BN9D 2A6KB 5HI3D 3L6FA 5ITBH 1I3RA 3A67L 3U0WH 4DGIL 3BSZH 3OKEB 2H2PC 1BFOB 2GUOB 2X7LB 4LCCB 3RNKB 2CLVB 4EIZC 5DUBB 1YUHB 5DQJA 1JYXA 4GW1B 3IETA 4D9RD 4IMKA 1PJ9A 2EO9A 5JOPD 5C0AD 3ETBF 3DROB 5FYLE 2OSLA 3EOBB 1KN2H 1PKQA 1FPTL 2CD0A 5HY9A 1OTSC 4QOKA 1N26A 1BEYL 5JLZA 1VFUA 15C8H 2PN5A 4CBPA 3CXDH 5ITFA 4XXCC 2MQ0A 5HVGB 3WO4B 1ZSDB 2VZ3A 1G9EA 2VDNL 3ZHDA 5I8CB 4PREB 5F70A 4RRPA 2E7LA 1N0XH 3OHXA 4MA1B 1LO4H 1G7JA 2VL5A 2UZYB 2J8HA 1S9VB 5EB9A 4JFFA 1QACA 3K8MA 2MCG1 3SDCA 1A3RL 1F8TH 3P30H 2GI7A 1E4WH 2ZOLA 5D7SH 4A6YB 3GSOA 2P44B 5LGJB 3BWAA 5GGRA 4Y5VB 3BE1H 4I0PA 1ZAGA 1DQML 2J4WL 5HI5C 1W72L 4HQQH 3D9AH 4L3CA 4OZGE 3UJTH 4ZNEE 5L8LB 4M43H 1MWAH 1JHTB 3LCYA 4OCNC 5C0IA 3S5LG 3AXLA 5E8NB 4L9LC 1H3UA 4YO0A 1I4FB 5MEPB 3BKJL 4CMMA 2KQMA 4K7FB 3RWFA 1I7ZB 4M48H 2VWEC 2HT4C 5BS0E 3NCYS 3U7YH 4ZFFB 1U41A 1T4KB 3QUZA 2H32A 1A7PH 5HYEA 3LRGA 1KIQA 4HUMB 4HW6A 1IFHH 2APWA 2PTUA 4YZFF 5H8DA 1INDL 5JW4N 3V8OA 4KVCL 2D7MA 4KV5E 4LQFL 3THMH 4Y2DC 2DI7A 4UNVA 3F7YA 1R3KA 5F6IB 1P4BH 3ZE1E 3X3FH 3JWOH 5I1EL 3RWGA 1G9NH 1MCPL 2HFEA 1Z9LA 3VFWB 4JKLA 4XBPA 3TH3T 2HKFL 3PL6C 3SDDC 3TZVC 4DKAA 1DVFB 5FYJE 1UB6A 3Q1SH 4ODHL 5F1NA 1Q9KA 4HEME 1FNLA 4M61B 4R97B 1S9YB 1XGPB 2ZUTA 4NN7B 5CD3B 3ARUA 1DDHB 3TC9A 3R06A 4JN2B 4JVPA 4OLEA 1DVFD 3RPKA 1HWHB 3B9KC 3KXFB 4JPKL 4NJ9H 4MJ6B 1JZ2A 2C4FU 4OGZA 1ZEAH 3CH8A 3VXMB 4DWHA 4OJFH 1A14L 1MI5B 1S7WA 3HE6B 4I4WB 4OV6F 3UBXB 3BRGC 2BOCB 1EO8H 4GOSA 5CEZE 1A1MA 1Z0NA 3H9SA 3GJFB 5C70A 3B5TA 5B4MC 1DLHA 4HPOH 2IEPA 3KXFD 4X6BB 2P5WE 4LLYB 4LFHD 5IROC 3VXMD 3R1GH 1MI5D 3HE6D 5SWQB 1YEHL 1YECH 2P8LA 3ORJA 4DTGH 4XPHL 1U6AL 4TRPL 3OGCA 3DVNA 1MEXL 1GOHA 1NGWB 5DLMH 4LSVL 3DRTA 1PW3A 2P5EE 4YDJA 1NCCL 1U2HA 1KCRL 5F7HA 2AVGA 2M2DA 2PYFA 1KJVB 4LVNC 2HT2D 2XTJB 5JO5B 5E6IB 1AO7A 3I84A 1AC0A 5E8OB 1X6LA 1U2CA 1B4RA 3UYRL 1MAML 4UT9H 5GRYA 3W9EA 1U8QB 2FLBT 3GSVB 3OXRB 4L8SA 3O45B 5IM7A 3MRIB 4LHUA 5J6GB 1EUTA 2XTJD 1Q9WB 1W8NA 3DVGA 2W9DL 1P4IH 1KB9K 2FWOA 3L3JB 5SWSB 4XP5H 1H3GA 3IU3B 2OTPA 4UQ2A 4P2RB 2YC1B 4TSAL 3V95A 1R3IL 2VABA 4UDUB 2G60H 4JRXB 3CVHH 4HT1L 4X6EA 5SWSD 1IAIL 3IVKA 3QXWA 3HC0A 5BV7L 2VN4A 1FC1A 5GRZA 2B1HH 3QDJD 3QULA 4P2RD 4FFYL 4ORGA 4FQXD 1QNZL 2BNRB 2GITB 2IADA 3KPSE 3GM8A 4JRXD 3O3EB 5AD0A 2QHRH 4JO4H 4TTDD 4ETQA 1U8PA 3PWPE 2BNRD 2XIDA 3TYFA 1T1ZB 2Z8SA 3PWUA 4JHBA 4ZXBC 2FHBA 4JHZA 3HC3L 3R0NA 3RWCA 4YK4B 2YRLA 1JNLH 5BW7C 1ACZA 2HJKA 3T04D 1QKZH 1NLDH 1RURL 3CSBA 3VFRB 4LOUC 3KLHD 5LCVH 3P11L 1IKFL 2NYYD 3RL2A 4UUJB 2WBJB 1FORL 4N0CC 5D7LB 1A3LH 1OF2B 5KVGL 1EJOL 1FNGA 3HNSH 5BVPH 2CRYA 1DL7H 1FO0A 3M8OH 2YUWA 5AG9A 3LB6C 2WBJD 4CNIB 5D7LD 3MACH 5E2VL 1JNJA 2ICWA 3MFGB 1PD6A 4PRAB 3W82A 2KH2B 5DEZA 1LEKA 3RHWK 4FTVE 3RVUC 5B3JF 3L7EB 5EU4A 2P8PB 1RIHH 3VXPB 4P5TA 4EDXB 4N1EA 4D94A 3SJVA 2EDHA 4JFOA 5C0NC 1T04A 3ZDZF 4GXUM 1NQBA 3FN3A 3FOMA 5EO9B 1BD2B 1HHIA 1QEWA 3DLQR 1RZ8A 4MQ7B 4ODSH 3UAJC 1YYLH 3GB7A 4KKCD 2PYEB 2VDLL 1EDQA 4QY8B 1SYSA 1HH9B 1S7TA 1ZOXA 4JREB 1NFDA 1UB5A 3GHBH 3FQXB 5DWUL 5C9JB 1BD2D 3E2HB 4E5XB 2YK1H 4KI5D 3ZKXC 2PYED 5ICXB 5TQ2L 3RI5F 2W92A 4NN5C 4CU7A 2M1KA 3S96B 3PABB 1W72B 4Y5XA 1SBSL 3MBEC 2JJUA 5I1GL 2CMRL 5I1HL 1KPVB 3H2WA 2XZAL 2EDEA 2MPAL 5JW3L 5FB8B 2R23A 1CXKA 4F9PC 1BFTA 4XPAL 1RU9L 3TT1L 32C2A 1IC4H 1AQDA 1J7VR 4MCZB 1UJ3A 1UWEH 4WENB 1FNEB 3F65A 4Y19B 43CAA 2IG2L 5CP3H 1S78C 3RZCC 4JPVL 4XCEB 5EIVA 4YHLL 4MJ5A 1IC5H 5J56B 3VDCA 2KUTA 1ZWIB 1I1YA 3QISA 3SO5A 2CJUH 3UROR 4K3GA 4WW1A 4DOHB 2MWCA 3HAEH 1D3CA 2YSSA 5GGSB 4P46B 4X6CB 4AL8H 1U3JA 4LMQE 1TTFA 3ZZ1A 2J8OA 3MRPB 1WJ3A 4F7CB 6CGTA 4PY8J 1LILA 2UWEF 4IOSD 3HMXA 1N4XL 1J8HB 3B83A 4P46D 5C0BB 4NQXB 4KK6D 2VLMD 3I3EA 1KJ2A 3AU1B 2AABL 5KANG 1Y18A 1UCTA 4PBXA 1YN7B 3O6FC 1XZ0B 2XWTB 1J8HD 2GCYA 3K46A 4XNZC 4AM0B 2I5YL 5AYQA 2BVTA 2L4OA 4OB5L 3V4VL 3U0TA 4ELKA 4Q9CA 3ULVE 4P9HH 3FTGA 3CFDB 3QIUC 3T4AA 5C0GB 5SWZA 4MWFA 4N8VA 2YZ8A 3IJSB 3PGDA 3P0YL 4JE4B 4K07A 4S0SD 2AXGB 2ERJB 5FCUH 2B0SL 4G9FE 2ZOKA 3VW3L 1L0YA 3MRMB 4OZFA 2XZCH 2ZKHH 4UQ3B 4NUJA 3GGWB 5FM5O 2AEIT 2FX7L 2VQ1B 3EZ8A 5IVXF 3QH3B 1DBJL 1YEEL 4OAWA 4W4OA 4PP2B 4NNPH 3T3ME 3MV9B 4PV9B 4YX2L 3QI9A 1LP9E 1OP3K 1C1EL 1WT5C 4WCYH 4BQ8A 4K7PL 4NKOB 2OR7A 2AJSL 4IRJC 4M9OA 1U9KA 4M02A 4Y2OA 3MV9D 2JCCE 4NQDA 3FQUB 3CDYA 4GT7A 5DUML 4XWGH 3U7WL 1WTLA 1CD1B 1F4XL 3MNZA 4O02L 2DLFH 3OMZA 2UWEA 3PP4H 4N0UA 5J3HD 1AD9A 5DJAB 1RIVH 1TNMA 2DKSA 2E7CA 4HJJH 5I75B 1FFPB 3V6ZA 4PJHB 2HTKD 4JZJB 4Y4FC 1N5AA 1ZA3A 5DYOA 5BV7B 5KSAC 5I1IL 2EYSB 3R8BB 3MJ9L 4I3SL 3CH1A 4PJEF 3S9DB 1T2JA 4TULL 3L3DA 1M7IA 2FX8L 1E27A 5D70L 3X11A 1DLFH 1FNFA 3SE3A 5A1AA 5KOMC 4X4ZA 5I1LB 1QO3B 2AV1A 2R0WH 4RDQF 4IRSD 4V1DA 1YY9D 1FIGH 3V4UH 3LQZB 2H2SC 1U8KB 3VCLB 3MROA 5KVDH 1O7SA 5IHUH 2EXWD 3SO3C 4PJIA 1T03H 3QQ3B 5IVXA 4QWWD 5IMOA 5KVFL 3OG4B 3C6LC 5ID0B 5KSUB 3E6FB 4HC1L 5CGYC 4OUUB 3IDGA 3QDAA 5BXFA 3BYYA 2AJUH 2IQAA 4MS8D 1T20A 2WNGA 5T1KA 2X05A 1RZJL 2ADGB 5A40E 5E2WH 1H3XA 4YQXL 1C08A 1IEAB 1XGTA 3O0RL 3I75B 4Q6IC 4LKXB 3JVGC 4ORZC 2LTQB 5AG8A 1FG2B 3S4SB 1D5XA 4GXUN 3EOAB 3CNKA 2VKXA 2FD6H 1S5IH 4YXKL 3AUVA 3ZTNH 1J12A 4IIQA 2YKLL 5GGUA 1I7TB 4LCUB 4MZ3A 2W0LA 3DX7B 4H1LB 1OB1B 3VFMA 1OY3B 4KRPC 3LQAH 2A6KA 5C0AA 5D1ZC 1FP5A 4YAQB 3OKDB 4CN6A 5D1XC 2QQNL 4IDJL 1GZPB 3EDKA 3OKEA 1JI2A 4Y0GA 3VXSB 1BFOA 1IQDB 1QVOB 2GUOA 2X7LA 4LCCA 4XVTL 2CLVA 1KJ3H 5DUBA 1YUHA 2VQUA 4GW1A 4PY7B 4KTDL 5ID1B 4PJEA 3DROA 2NXZB 5F7EH 4IJ3B 3EDJA 3EOBA 5TPWH 5JQ6H 3RVVC 4FS0A 3VXSD 1RMFL 1X5HA 4X7SH 1G1YA 5JPMB 1SQ2N 3I85A 1KSRA 1WGOA 1B0RB 4K23L 1E4KA 1YMMD 1ZSDA 3BKCL 2YR3A 4M7ZB 5I8CA 2FB4H 4PREA 3O2DA 5BS0B 4P99A 3SQOL 1VGEH 1V3JA 4JG0H 1CYGA 1KUMA 2EIBA 3GRWA 1S9VA 4YBHA 1IQWL 1CFTB 5KS9E 2VUOA 4GUPB 3U4BL 4O58H 3CFCL 4A6YA 3CK0H 3DIFB 2CH8A 5BS0D 5LGJA 3KYMA 4Y5VA 3HMWH 3IDJB 2W38A 3DVIA 1P6AB 4KFZC 2NY3C 4ZAKC 4LPXA 4M93B 5IIEB 5F9JB 4LLVB 4KK5D 3V0WH 3FT3B 4JM4H 4JZNB 5E5RB 3LD8B 1JHTA 5IFHH 3VG0L 1XF2B 1H3WM 1HQ4B 4UTBL 5GS0H 3GMRB 5E8NA 2BOBB 3BJLA 1J5OH 5J11C 3NTCH 3REVB 1W0WB 2WM0A 4FNLL 4I5BA 1I4FA 1RVFL 2DKUA 1WICA 3DXAE 4K7FA 1I7ZA 4DVBB 5DI8B 1OP3H 3N06B 5IWLA 4DKEH 1WFUA 4HCRL 4KQ3H 1T4KA 4ZFFA 4X6FB 4YHYB 4X8XA 4S1QL 5I76B 4MLIA 4R7NB 3MCLH 5F7DB 4FABL 4AH2B 3T2NH 1MIEL 2FGWH 4PRHE 2NY4B 3QJHB 3MC0A 4EN3B 1H8OA 1C7SA 2XI9A 5GS3A 4TUOB 2WLYA 1DE4A 5EOQH 5LG1A 5FUCE 2NY4D 3VFWA 1T2XA 4XI5C 2ICEB 4PJ7B 5ALCL 3GKWH 2YD7A 4EN3D 4U31A 2VC2L 4JKWA 1JZ7A 2I27N 1DVFA 1OSPH 1TXKA 1CK0H 5C86A 5IVOA 1XF1A 1L7IL 5DZOA 4M61A 5C71A 4HWEH 1S9YA 1XGPA 2P5EB 5CD3A 3NABH 1LGVA 1DDHA 1PY9A 4HWBL 4RWYH 3EOTL 4JN2A 1TJHH 3IGAB 3F5WB 3QIBC 4OGXL 3KXFA 3IT8D 4K7PX 4MJ6A 1F6FB 4LSSL 2CUIA 5I30L 4K9EH 3VXMA 5BQ7B 1MI5A 1AR1D 5A16B 1T66C 4FZ8L 1MHHB 3HE6A 4I4WA 1JIBA 4LLDB 3UBXA 4WGWB 2BOCA 1D5IH 5B8CC 1SJVA 3GJFA 2BSED 4X6BA 2O5ZH 1QSFE 1CBVL 4OV5B 3GMQB 4LLYA 4B53A 4PRNB 1B4JH 1I1AC 2CPCA 5F97E 2ILLA 5SWQA 5ITBL 1Y6KR 3QQ4B 4ONGH 4KTEL 1NGWA 4ZFOL 4OCWH 1WK0A 1MJUH 2ESVE 4J4PD 1NUGA 4EI5B 3K8LA 3LDBB 1KLFA 1KJVA 5JO5A 1KN2L 3KPSB 1GSMA 5E8OA 4BFGA 1N7MH 15C8L 1KYOJ 1U8QA 5F3HB 1PVHA 3GSVA 4M3JA 3OXRA 3O45A 3MRIA 4L3EE 5J6GA 4EI5D 3V5DB 4MA8L 3S37H 1UXSB 1Q9WA 3FRPG 3KPSD 2XWJB 3AREC 1N0LA 4FFWD 1QBAA 3QSKB 4OFVA 4EBQL 3DURB 3L3JA 4YDKL 5SWSA 1LO4L 4N90D 1GL4B 4MD4B 2VDPH 3IU3A 3QDJA 3GI8H 1F8TL 4P2RA 5K9QG 2YC1A 5D7SL 2NMSA 2FDBP 4LLMB 4FQXA 4OI8A 4UDUA 3BPNC 3UMTA 4JRXA 4KI5F 1R3JB 2SEBB 1EHLH 3DV4B 3SBWA 2OR9H 4I1NB 2PO6C 1WZ1H 2NX5E 2DYPB 4PGEB 5JIKA 4H88H 1Z9OA 4HQQL 3D9AL 2A74B 2DLGA 2BNRA 2Y07L 2GITA 2ZNWA 1MWAL 3O3EA 4NZDA 4XVJH 1IGFH 3EYSL 1NBQA 1A6ZB 4XVSH 4UZGA 5T1MB 2DYPD 5A2LH 5CGTA 1V7ML 2DTMH 4ZS6D 4FTVB 2F54D 4XPGH 3TBYB 1UM6H 3B8YA 1T1ZA 2YOCA 3BI9X 3P9MB 3V7AG 5IB4B 4XAWH 1D5MB 1NCUA 1FBIH 1CLYL 5GGVL 3QWOB 3U7YL 3PGFH 3GJEB 1A7PL 2CGRH 4FTVD 4IEFB 1WZLA 4K9EC 5IBLD 2H41A 4IMLB 4XZUA 3STBA 3VFRA 3HZKB 1CD8A 3OB8A 4XHJD 1GVIA 3VI3E 1NBVH 3THML 4UUJA 1MCOH 2WBJA 4O51B 3O3BB 3ARVA 5D7LA 1X4ZA 4KC3B 1OF2A 2Y6SC 4JQIL 3V6OE 4QGTA 3HN3A 5CD5D 3V0VB 5KAQG 4F33B 2WBKA 3EBAA 1YEGH 4X6CF 4CNIA 1AH1A 1R3LB 4PRAA 3L7EA 1N59A 2DQUH 1MCLA 2P8PA 3T0EE 3P4MB 3VXPA 1JF6A 4EDXA 3P9WB 5I15H 1GC1C 3CPLB 2V2TB 1RK0B 2FIKB 5FUZH 2X4TB 4I18B 5IB2B 2FECI 5EO9A 1BD2A 1FGNH 2QSCH 4DN4H 5ELIA 3EGSB 4MQ7A 3JWDC 2PYEA 1NGQL 2BSTB 4NJ9L 1KN4H 4LVOC 4QY8A 4XX1E 1HH9A 1RHFA 3AM8A 4C56B 2G5RA 1YYML 2FJHB 3TF7C 3FQXA 4IOFC 5C9JA 2WMPA 1EO8L 4E5XA 3AS3A 3P4NB 1SVZA 3QXUA 5ICXA 1KCSH 4HPOL 4U3HA 5B38G 1FZKB 4OKVA 4JG1H 4WI9A 3QDME 3WIHL 4R4ND 3S96A 3PABA 4LSRH 1W72A 4NKIH 2DIAA 4C56D 2AQ3A 1YECL 5IQ9A 1KPVA 4DTGL 3LAFA 4UAOC 3MLRH 5FB8A 3BAEH 4AK1A 4NCDA 2AGJH 3SGKA 3UBXI 1JZ8A 3I9GL 4MCZA 1RUMH 5T33H 1FE8L 1FNEA 2OS7A 1K6QH 4OF0A 5F7WC 4U4BA 1S7RB 3MZTA 1QBBA 2BCKB 1A7OL 5D8JH 3GSNB 3BVNB 4XCEA 2GK0B 4X83A 1RUPL 5D7JB 1INQB 1IGIL 1ZWIA 4XMLH 3H42H 1JN6B 1P4IL 5GGSA 1E28B 1P53A 4P46A 4X6CA 2ZJSL 4MJIE 3VRIB 3MRPA 1I85C 3WN5C 3TA3B 2CK0H 4F7CA 2UZXB 5D7JD 1KIPB 1J0YA 1CF8H 2OQJB 2VR9A 4LEOB 1Q9OA 2IBZX 4XGZB 3LH2L 5I1CH 1J8HA 4F8TA 1F58L 4QXTB 4NQXA 2GY7B 4RX4A 3AU1A 3TA3D 3BUTA 4YDLC 1KEMH 3AVEA 4PJHF 1YEKH 2IH1B 4WGVB 1YN7A 5DRNB 5HI5D 1XZ0A 2XWTA 2VAJA 1F6AB 4AM0A 4N8CL 4OZ4B 5C3LD 1LP9B 1V7NH 3RNQB 4LDLB 4JO4L 2I26N 2JLLA 3FB8B 1DSFL 1JHKL 4QRPE 1BBDH 4RGMB 3SGJA 3BOVA 3O11B 2UZIH 3CFDA 3N9GH 5C0GA 1QFWM 1GPOH 1A5FL 3O2WH 3IJSA 2AXJA 3H7LA 1RY7B 3EJYD 4APQB 4WW2F 2AXGA 3SE8L 3C2AH 4N0FB 4JY5H 1I1CA 1KPUB 1SJHB 3MRMA 4HZLB 1BQSA 4Z0BH 1SYVB 3IFNL 3MLUL 4UQ3A 4FXKB 4U6YB 4F7MB 3WIFB 5I1KH 4APQD 4C83A 4HV8B 2VQ1A 3QH3A 5IK3B 5LGKA 4YH6A 4PP2A 1J11A 3QJFB 1WITA 4FQIH 3MV9A 4ZFOB 1R3HB 1DL7L 1RZKH 3M8OL 1JGLH 4P4RB 4PV9A 3BO8A 1RZFL 5DVNA 3DI3B 3SDDB 2RIKA 3MACL 2ZP0T 3TZVB 5BZDB 3EO0B 3GDBA 1EAJA 4NKOA 5JTWA 4OF5A 4AEHL 3S88L 1FZMB 4CVXB 3QAZC 1CT8B 3SDDD 2VUYA 3VA6A 2VSCA 3TZVD 3RL1A 2KKQA 1CD1A 2G2RB 2P1YA 4DK6A 3MNWB 1AHWB 4F57L 4FP8H 2AI0L 4ODSL 1EVTC 3O2VL 5DJAA 3S7GA 3BHBB 1S7UB 5DFVD 5GRXG 4CAGA 1FFPA 3QB7C 4OBRA 5KJRH 4PJHA 2EDKA 4CKVX 2X41A 3GHBL 4JZJA 4XRCB 4GLRH 4X5LA 5EA0H 4M8VA 1LO3H 4OGYH 4QKXB 1ZLUK 3RIAF 2A1WH 1ZTXH 1NPUA 5B4MD 2EYSA 5L88H 2JTDA 3B5GA 1MWAB 1JTPA 5K9KB 1P1ZB 2PNDA 2EDWA 4LVNB 2C3VB 4KROB 3MV7D 5D2LE 1TDQA 4FQJH 3GSQB 5I1LA 4WHTB 4WW2A 4NRYB 5M94B 4ZTPH 1BVZA 1UA6L 3LQZA 1BFVL 1U8KA 4OD3L 4KROD 4Q97A 1F3RB 3C9NB 1FSKB 3QQ3A 3SKJH 2DQCH 3GMOB 4G43B 1C5BH 5ID0A 5DA0B 5KSUA 3E6FA 2CJUL 4DN3H 4FZEH 4OUUA 3F7VA 1DQDL 1PLGH 1WAAE 2ADGA 2VLRB 4KV5F 4DKFH 2ICCA 1IEAA 4IHOB 3I75A 4LKXA 3V6BR 3OJDB 3B5HA 1QR1B 2KPNA 1RZ7L 3ZE1F 1CQKA 1FG2A 4LASH 2VLRD 3S4SA 4MXVE 4MD5B 3J8F7 3ECBB 3EOAA 2CLZB 4LCIL 5H37G 1YQ2A 2DMBA 2YA1A 3VFTB 5HPOA 4OIIH 5E5UB 2E5EA 5JMOC 1X6NA 1I7TA 3D85D 2XRAH 4LCUA 2OP4L 2FJFB 3K2UL 4H1LA 5DD0L 4L3AA 1OB1A 5E1AB 2VXVH 4F80A 3T09A 5F9WB 2LU7A 4YAQA 3OKDA 5MEQB 1GZPA 3I6GA 3T2OA 1TZHB 3VXSA 2Y25A 3HUJE 1QVOA 3QIWC 2XICA 1MFEH 4PY7A 5ID1A 1I3UA 4NGHL 5JOEA 4HKZB 2H32H 3VWKC 3SCMB 4ZNEA 2XZCL 5C0RH 5F89B 4XPFH 5JPMA 4JFZL 3WXVH 4JAMB 4LOUD 3NH7H 1T5WA 1ADQL 1B0RA 3JTTB 5TFSL 4YPJA 5BMFH 4PJ7F 1EFXB 4KKAC 2OK0L 3HPLB 5BS0A 4YC2C 4GXVH 1T22B 2B4CH 1CFTA 5IP4A 1GGCH 4GUPA 1JI1A 1EFXD 1QUNA 4GQPH 5TE4H 4RMWA 4WU7B 1CXHA 4JFHE 1KTRL 3RVUD 4D2NA 1F00I 4FG6D 1NLBL 4Z95H 3DIFA 2GJJA 4XWGL 5EULV 4GBXB 3IDJA 4POZC 2WIMA 5L7XL 4LSUL 3EJJX 5A43C 1YMHB 4PRHB 3TIEB 4Q7DA 4QXGH 1I75A 1I7RB 1KPRB 2DLFL 3RKDC 5IIEA 4TQEH 5F9JA 4LLVA 5HHOB 1JYVA 1BIHA 1FDLH 3FT3A 4JZNA 5L8JB 4GBXD 4XCCH 1XF2A 3ZKXB 3UAJD 1HQ4A 4JHAH 1ZGLM 3GMRA 5DVLA 2F8VA 2BOBA 4PRHD 2XPGB 1TPXC 3REVA 2X10A 2W9EL 1W0WA 3TN0B 3IU4H 5HHOD 4N9GB 4Y16B 1KFAL 2YS4A 4LBEB 4DVBA 4P2QE 5DI8A 4BSVA 1LVEA 4PLNC 2B2XL 3WV0A 4PJ5E 1CD0A 3UTSB 3MXVH 3VMPA 4X6FA 3TN0D 4GAYB 3MBED 2YUXA 4Y16D 1HKFA 4ODBD 5I76A 2O26U 2YEZB 4R7NA 5F7DA 2MOVA 1EEZB 3VFUB 3ZTJG 3PWLB 5ANMB 4AH2A 3UTSD 3QP3A 4PIRF 1FIGL 3NCJH 4HKXB 5CJXC 1Y6NR 4R4BB 1NAKL 3RZCB 3QJHA 3KWWB 4EN3A 1FVCB 5KVDL 4RSVA 5IHUL 1A6VH 5ESVB 3D0VB 1E4XH 3IDUA 4TUKH 4KDTC 3GBLA 4NFBA 4TUOA 3GM0A 3LZFH 3HLAB 1UZ6F 2D4FA 5FECB 3RZCD 1QYGH 4NWUL 4M4RA 5DRZA 2ICEA 4PJ7A 1IM3B 3N1PC 1BECA 4LVHC 4HBCH 1ZLUH 2BVUA 3PHQB 3RI5K 1H15B 5DT1H 4V2CB 4M5ZH 1KV3A 1A7RL 2P5EA 3BPOB 5D71H 4J3WA 2V7NB 5L6YH 4M8QB 3AAZB 3DMMC 3IGAA 3F5WA 2D03L 3QEHB 4WEMB 2C7UB 7FABH 4XNZB 4W81A 3HE7C 3PV6B 1TTUA 3WJJA 4ZO7A 1UWGH 1AE6H 3VE0B 5BQ7A 4EEEA 1KCKA 4EZMA 5A16A 4LLDA 4PJGB 1MHHA 3ZLQC 2FD6L 4FFZH 3FB6B 2J7LA 2OI9C 1CXLA 3ZTNL 4XT1C 4HHAB 3ZKNC 1BGXH 2E27H 4OV5A 3GMQA 2VTFA 2R15A 2ZCLL 4J4PA 3LQAL 1A1OB 1BM3H 4FQHB 4PRNA 3ARYA 3VGBA 2ZPKH 3QQ4A 3HNTH 5H94B 5GIRB 1A7QH 2Y36L 5F7FA 2W1NA 3KLAB 1JPTH 4KWUA 2NX5B 3TJHD 4EI5A 2IJ0C 5DGRA 4NM8L 5TPWL 1JRHL 4QRUB 2E6QA 1P5UA 3KPSA 4G6AC 4X7SL 2R2BB 3DX9A 3MJ9A 4PRBB 5F3HA 2NX5D 3VFNB 5I8KH 3V5DA 5I18L 2ARJB 2IPTL 1UXSA 2XWJA 4GKSB 4IRJB 2FBOJ 2R0LH 3AY4A 4NZTH 3DURA 4HGMA 5L8KB 4PTUB 1XGYL 3ROLB 2VR5A 4MD4A 1B2WH 2DBLH 4O58L 4D9QD 4IRJD 4LLMA 4MB5A 4NQSB 3O4LB 3CK0L 4C54A 5I6XB 1R3JA 5JIHA 2EDRA 1JWMB 2SEBA 3W0WE 1GIGL 3RVWC 2J8UE 3OWEA 3WS6C 3DV4A 4FA8A 5KANI 4F15B 3KR3L 3MJ7B 2DYPA 4HC1A 3WHE1 4PGEA 4MCYB 3RUGE 2F54A 1RFDH 1RZIB 2A74A 2X4RB 3O4LD 5I9QB 3P3YA 4RFNC 1HHJB 2F8XC 1A6ZA 1BVKB 3VD7A 3TBSB 5T1MA 4OCXL 4LRIA 4FRWA 4L8DB 1UKSA 4FTVA 2FO4B 3TBYA 3T0EB 1G9MH 3P9MA 2YZ1A 1QFWI 5IB4A 1OSZA 5D96C 1D5MA 1CWVA 5DTFB 1XH3B 1CGTA 3GJEA 2VDRH 4MQTB 5T1DH 5E99H 1NKOA 3REWA 1QPXA 3T0ED 3WFCL 4IMLA 3F6IA 3HZKA 2VL4A 1FFNB 4O51A 1I8LA 3MRDB 2FGWL 3O3BA 2FSEB 3T2NL 1T80A 4JO1H 1RJCA 4OM1L 2E9BA 3SO3B 2DQHH 5D7IE 2V5YA 1WEJH 3GBMH 3UJIL 3C6LB 2WWMC 5I71B 3BFOA 1UM5L 4XPBL 3V0VA 3ZL4H 2H2SD 5TE7L 1K8IB 4F33A 3CXHK 3QDMB 5EOQL 3LEYH 1R3LA 1F2QA 3ZKSD 4U7KA 4JDTH 1MFDL 3C6LD 4KPHL 1LWRA 3WIIH 4F9LA 1Q8MA 3P4MA 3NBNA 1OSPL 5IKCB 4Q6IB 5CGYD 2XZQH 4Z78B 2V2TA 3CPLA 4HWEL 2XXMB 2DI8A 1RK0A 2FIKA 3OAUL 5J1AB 4FFVC 4I18A 5IB2A 3N85L 3NCEB 3EGSA 3T3MF 4J3VA 2E7HA 2BSTA 2DQGH 1LP9F 3HMXH 5JXED 4TPRL 4K9EL 4PFEA 4YDIH 2HKHL 5T5NF 4C56A 4JPIB 1EGJA 2FJHA 1KJ2H 2ED7A 1OGTB 2FATL 1I1FB 3P4NA 2NXYC 1MCWW 2ZUUA 4UV4L 5D1ZB 4P3WA 1FZKA 4JVWA 3MFFB 4YWGH 4PUBL 1J10A 5D1XB 5C9KA 1U91B 4MJIB 4PRIE 5SX5K 2WUCH 2P45B 5EU3B 1B4JL 3QDHA 3O4OC 5DS8B 3ILPB 4I48B 5J9PB 5JHDE 5KBNC 2RHEA 5D1ZD 2DQJH 3E0GA 2YD6A 4OCWL 3K4AA 4PG9B 4Y4KB 5D1XD 3KGRA 3TV3H 2PTVA 2D0HA 3BKYH 3DOSA 1QLRB 1N64H 3WUWA 4U6HB 4NKMB 2ARJQ 4XXCA 1DR9A 1DEEB 3MRCB 1GC1L 3SDAB 4PD4K 2GSIB 1I3VA 4HCRA 1S7RA 4MD0B 4Y4KD 4Y8DC 3RVVD 2BCKA 2X4QA 1JPST 3GSNA 3BVNA 5DD1L 5HYSB 4ZO6A 5D7JA 3UP1A 1CTOA 1ROWA 2X4PB 1JN6A 3A6CH 1I7UB 4KK9D 1QBML 2BERA 1E28A 1Y6MR 2PUQT 4U1SB 4JN1H 1U8MB 2AJYL 1IGML 3RQ3A 2GFBB 3VRIA 2VDPL 3TA3A 5HD8C 1KIPA 2OQJA 3SGDI 1HNGA 1DQQA 4HH8A 4XGZA 4ZAKB 4TNWF 5T3ZL 1T5XB 4QXTA 1J0ZA 1WZ1L 4KKBD 2LVEA 5J13C 1X4YA 2HH0L 5CIPB 2IH1A 4ZUSB 3NCBB 4WWID 3WKMH 5J11B 1FVDB 2E7MA 4L9LA 5DRNA 2C3XA 4ZAKD 1NEZG 1F6AA 1T3FB 4OZ4A 4J6RH 2X70B 1N8ZB 1LP9A 3RNQA 4DW2L 4EIGB 4UT7H 3FB8A 2VKWA 3WL9B 3O11A 3QUYC 5GGTL 2X6MA 2DIJA 5TE6H 5F3BB 3UC0H 5MHSE 3BEVB 4UV7H 4Y89A 3JV0A 2NY6B 3KPNB 4TOYH 4APQA 4YHMH 5EU7C 3QFDA 2PTTB 1OM3H 5B22A 2YD2A 4WVRA 4N0FA 4AIOA 3ALWA 4PV8B 1KPUA 1SJHA 2FH6A 3O9WB 5F96L 1CL7H 4XXDB 4HZLA 2ZUYA 4QOKE 4FXKA 4HXBH 4PJCB 1CIDA 4U6YA 1MCOL 3WIFA 4EKXA 4QHUB 4F7MA 4HV8A 5IK3A 2Y06H 4CRPA 1OWRM 4G6FB 3O9WD 1NMBH 3QJFA 3ARTA 4ZFOA 1R3HA 2VE6B 4P4RA 2AJVH 4YXHL 3SDDA 5FA3B 4CVWA 3GJFK 3TZVA 5BZDA 3EO0A 4O9HL 5J8OA 2PW2B 2EYTB 4PJ8B 4G6FD 5ACMA 4XI5D 2VXSH 1FZMA 4CVXA 1G7QB 5D1QC 5D2LB 5T3XH 2G2RA 3F7RA 1H5BC 4PJ8D 5DMKA 2IWGA 3V52H 5GS1C 1AHWA 4DN4L 5TQ0L 3ROOB 2JELH 2D9CA 1W0VB 3BHBA 4ODVL 5B8CB 2AW2A 3HR5A 1KN4L 1S7UA 1FG9C 1FHGA 3MUZ1 5DZNA 3T3PF 4G7VH 4XRCA 2R1WB 5GS2H 1H9VA 1T66D 4CMHC 1I1AB 4KDWA 1K3ZA 5F93C 4JG1L 3BPLC 3MV7A 1TQCB 2Z91B 1HYSD 2ED9A 4LSRL 4NKIL 1AI1H 1A9EB 2H1PH 4JGUA 5HI4D 3CFBB 1MWAA 2XWBB 5BCAA 1I1AD 4LARH 4LU5H 5FA4B 5K9KA 1P1ZA 2C3VA 4WTWA 2FYYB 5FF6B 3GSQA 4WHTA 4NRYA 4ELMF 1HE7A 4JPWH 1BMGA 5DD5H 1A7NL 3KPTA 4MDJB 4BFBD 3GMLB 4YR6B 1HQRB 2DWDB 4LMQI 4YHPB 4LAQH 2DAVA 3C9NA 1F45A 2P24A 3GMOA 1BHGA 4G43A 2NCMA 4GRLC 3WBDA 4XMLL 2HWZH 4F3FB 1KC5H 3G6DL 4PB0L 4YBLC 1Z9SA 4X9FA 3HUJB 2Q7NA 2VLRA