5IMKB

Nanobody targeting human vsig4 in spacegroup c2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASGRTFSSYGMGWFRQAPGKEREFVAAIRWNGGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAGRWDKYGSSFQDEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
molecule keywords Nanobody
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imkB00
2VL5B 4WV1C 4Y19A 3W5NA 3BUYB 2JCCB 4R90H 1HXYA 2R2HB 5I71C 5DMGC 4R7NB 1SVZA 1DVFB 1ZWIA 3ALXA 2CLRB 5J89A 4ODTH 2WZPD 4R8WL 3BKYL 4Y1AA 1KCVH 4PJFB 4EUPB 1XH3B 2M2DA 1X7QB 5EA0H 3JXAA 2AJ3A 2FB4L 3BP5A 4PJ9C 1KEMH 4JPWL 6FABH 4PUBL 3QRGH 4EI5D 1FYTD 3WDJA 5AZ2H 3DX7B 1A1NA 1N2RA 3VFGH 3IDIA 1BQHA 5HHOE 3KLDA 2GK2A 3MA7A 1MCKA 1D9KB 1I8MA 2Z0BA 4TUJA 4TVPE 2P24A 1DQTA 3MRFA 4CDGC 1JF5A 5ESQB 5KVFL 3MUZ1 3RZCD 1T0PB 3U4EB 5M7QA 1OCWL 3MODH 2QHLA 2EH7L 4ZSOE 4NJAH 4PJGA 3TYFB 1F2QA 2ADGB 4Y5XA 5J0BA 1IKFL 1J0ZA 2F19L 1FYTE 1T6WA 3O8XA 4PY7A 1AI1L 2EDLA 1UWGH 3GI9H 3MV7B 3EJYD 4ZO9A 5FM5M 1LILA 3ARFA 3BQUA 2AJVL 5E94B 5EOTB 4OZFH 1OSZB 1ZT1B 1ACYL 2DLTA 1UWXK 4OTXL 5SV4A 4YDIH 2A9MH 4U1NB 2YZ8A 3IS1X 1KYOJ 3BQUD 3O9WB 1FPTL 3WNMA 2IWGA 2NY6C 3MV7E 1QR4A 3RWJA 3T0AA 3OAZK 3BRFA 4XPHL 4Z5RB 5IHUL 2BVPA 2YN5A 1F6AB 3FCTB 4OUUA 5F3HA 3VW3L 4XBEL 2CLZB 4O51A 3BP5B 4XI5C 3D18A 1YQVL 3BZ4B 1U8NA 1IL1A 2FIKB 3OZ9L 1LO5B 4X8JA 4YFLF 5GGUA 3D9AL 4MCYB 2X4QB 3LKQB 4Q6IC 5C08E 1KIRA 4A2LA 2Y7QA 1T1YB 1F97A 4PR5B 3UZQA 1DQQA 3T2PA 3LDBC 1YY9C 2BOCA 4NSKA 4X9BA 2XKNA 3GSNA 5F44A 1A14H 1PKOA 5ESAA 5IMOA 1HSBB 2Z93B 4PTTB 4JANA 1TQBC 4QRRB 5IFHL 3VFNA 1K4DA 3WXWL 5F7WC 1ACYH 3FN0L 3NCFB 1K8DB 4XVSL 5DEFA 1RUQH 4G8EA 2I26N 1RIVH 4I0PD 3UROR 4OF5A 4YE4H 4L4TE 5IG7A 2EDEA 5EG6C 4K8RH 4BKLA 1AGDB 3QQ9C 3STBA 3LHPL 3VGHA 1OAYL 3RFZC 4QTIL 2JCCE 3TWCH 3TBVB 4IOFD 4OBSA 5E2WL 5KZCD 3RL1B 1E4JA 5EZIH 1NBVL 5D72L 3MNVA 5DMKA 1QLEH 5GS2H 1WC7A 4GBXC 4I3SL 5TPWL 3BISA 4P57A 2AXFA 3ZKSD 1I3VA 4S1RL 1EFQA 3P40A 4UV7L 5TDPB 2FATL 1ZT4B 4JREC 1RIHH 4U7MA 3FONB 3PWJA 3S3PA 5F1NA 3HE6A 4E42B 5TDOA 3DLQR 3GMOB 1P4LA 1XMWA 4OZIA 3S34L 2FWOA 1LO3L 3VFVB 2H9GB 4UT9H 1HHHA 1KJ3L 1JZ3A 2HTLD 1KCVL 4RFEB 2VXVH 2MKWA 2YPLB 2IEPA 3CVHB 2VDPH 2ZUTA 4AMKH 3C6SA 1HHJB 2NXZC 5GS0L 4EN3B 1W72H 3LZFL 5ETUA 1MREL 2UY7A 3MLZL 1OQOA 2V9QA 5EBLA 5JTWA 4NKQB 1LK3L 4Z77A 3QH3B 4PJAB 1ZHBB 5EH1A 1G84A 1FIGH 2BVEA 3VI4E 4H8WC 1NGXB 4S2SA 5JXEA 3ARWA 5T1KA 5IROC 3VWJC 3TYFA 3BPOB 5DEGB 4U6YB 4YWGL 1MELA 4DZBB 4JN1L 5CBEA 5DGRA 1FFPB 3O6MH 1T21B 1XIWA 2XRAL 5TQ0H 4P49A 5CILL 1B9ZA 5F7YC 5IW1A 4HMCA 2GK0A 5EOTA 3MRLB 5I71B 5JW4N 2EC8A 2EKSB 2JJUA 4KV5E 2JIXD 4GRLD 4JHZA 3LQZB 4N0CD 2AEIT 2YKLL 4QEGA 4P2YA 4ETQB 2DQCH 1BAFL 4YDVB 1HHIB 5D70H 5C0DA 1YN6A 2P49B 3JTTA 5CBAA 3C5ZD 2VLME 1QRND 2WLYA 3OGCB 2PW2B 5JHDA 4AEIH 2Q3ZA 4BQ9A 3IJHA 5FM5O 3MNWB 4G5ZH 2FJHA 1KCUH 3GSOA 2FSEB 1G7QB 4WV1A 3DGGB 2NY6D 5CP7B 1D5ZA 2LAGB 3TH4T 1OAKL 1R5WB 5F9OH 4N8VB 1UM5L 2BXYA 1OARL 4NQCA 1N4XL 5E6IC 4EVNB 5DK2B 2YD7A 1F4WH 4KQ4L 3O0RH 4OF6A 5HHVH 1U95A 2CR3A 5L0QB 5T1DL 1MIEL 1UB5B 5BS0A 4W81A 3V52L 2CDEB 3LSOA 3DO7B 3EO9H 5ADOL 1J18A 3ZE1E 2PXYA 4X4MA 3EYQD 2EIZA 3NIFE 4O4YH 4AIZA 2WP3O 4P46C 5IVNA 3VMOA 3DUSB 3HPJA 4L4TA 1TXKA 1A7RL 1RJYA 3E3QE 4NWUL 3VRIA 43C9B 4WEBL 4FQIH 2JCCA 2ZOKB 4HJJH 1D5MA 3CFBA 2FH6A 2AEQL 2K7QA 3TN0C 3PL6D 4FQXA 4OZFG 1BVKA 1TZHA 1UM4L 2JJVA 3MRFB 4LCWA 3GMLB 5GZNC 4KJWD 3V0AC 2X2YA 3WFHB 3NCEB 3FO0H 4ZS6D 3GMNA 1A7BA 2HVKA 3BESR 4I5BA 3PNWB 3CFJB 3BE1L 2SEBA 2VNCA 2DLGA 2ZUUA 4Q6IB 4J3TA 3DVNB 4UDUA 4J3OC 2ZSWB 1YMHA 4OGZA 4YQXH 4EOWL 2F53A 2Q87A 2UZIL 3GBNH 5HYJA 1WLHA 1MRCH 3OXSA 3QA3B 5IIEB 2FEEI 3EDJA 5D9SB 1KPVB 1U91A 3QJFA 4J3XA 3KPRD 4ODUA 2NLJB 3K74B 1OSPH 5F8RC 1EEUA 4X80H 2V5YA 4U1NA 3MUHL 3CK0L 5E1AB 3QUMA 3IAGC 2XZAL 1C16B 3P0VH 1PLGH 4PJ5B 1LQSR 2BSRA 1XR9B 5KSUB 1CYGA 1E6OL 1U8KA 2J4WL 5C0ND 4P2QE 1KLFA 4NQSA 4PJDF 3V8OA 1UZ8B 5KVGL 2D3VA 4KDWA 3REVA 4Y5XC 3VXTA 4NZUL 2E6QA 1QBAA 5DD6B 1M7IA 4I2XA 1U3YA 2DTSA 2Q6WB 3U7YL 1TJIL 4U1LA 2F74A 4KJYA 3VRJB 1N0XH 4BZ2L 5D1QD 5DJZA 5DRXA 2JELL 3SKNA 15C8H 4Y4FD 3WJJA 2HMID 5I19L 4AEEA 5BXFA 1XF4B 2FO4A 1OP9A 2ZCHL 4PJBF 2MQ3A 2VZVA 3QDJE 1PSKL 3QNXB 1VPOH 4GAGL 2KH2B 2HJFB 2PO6C 3DMMA 4B0MM 4QRRA 1KJ2B 3DRQB 4YHYB 1F90H 1VACB 4NC1E 1MIMH 3N1PC 4PJ9A 3WLBA 3TJHD 4O51B 2VC2L 3HC3L 4PRNA 1YN7A 4JHAH 1EH9A 1YNKL 4TNVK 2HWZH 3MXVH 4NM4H 4Z7VF 3HKFA 1LEIA 2YUZA 4MVBD 4HWNA 4LQ1A 5T3XD 1JGVL 4QF1B 4XH2A 3QULA 5FUCE 3HZYB 5AG8A 1NAMA 2UVEA 2R2HA 4HXBH 2BVQB 5BRZB 3MRKB 4LF3B 2R8SL 5ESAB 1FJ1A 2BERA 1A0QH 4RNRB 3TA3C 2P8PA 5L2KB 1I85C 4IS6B 4UQ2A 1R3JB 2DIJA 4CU7A 2CK2A 1J10A 2DQHL 4C56B 1YNLH 3IDMA 35C8L 1I9RH 4PJCF 3ULVC 5JW3H 4YZFE 1S7UB 3D87B 1NANI 4NQCB 2PO6B 3OKMA 4P2OD 2EYTB 1FL5B 1KYOK 3FOLA 3P0VL 4OZGF 5CZXC 5CD5C 1NDGA 2Y4SA 3FONA 3TZVB 3BPOC 3SGEH 3HI6L 3F7PC 3MRCB 3MRPB 1EO7A 4HPYH 4PRHD 3SE3A 4B7LA 3SDXA 2OR8A 4L8BB 4XVTH 2JB6B 5C9KA 3S98A 5KSBA 2WUBL 4UT6H 3OKDB 1MCJA 3IETB 5F7LB 1CG9B 4L3ED 4D0DA 3RWHB 5DMKB 1RFDH 3IKKA 5B4MC 4AH2A 3DVGB 4RMSA 4XBGB 1AXSB 4MHHI 1MQ8A 1D5MB 3CFBB 3U1SH 4HFUL 3P4NB 4KK5C 5CHNB 4ZOAA 1C1EL 3SE8H 2YSSB 4M61A 4XB8A 3C2SA 1J1XH 3OKNA 4PRPE 2QKIA 4YEEA 5KVEH 4M7KH 1C12B 3IAQA 1K6QH 3K8LA 4LCWE 3WHE0 3WE6B 5I2IB 1WBYA 5D2LE 4YDJA 5IEKA 1OSZA 1ZT1A 4XAKD 1HHKB 5K33A 5ADPL 2CKBH 5IVXB 1LO4L 3GJFB 1NFDE 1E4WH 5K9QG 5KS9E 2X4UB 2HLAB 1BPVA 4G80A 4PTUB 1UEMA 4NBYB 1TJHH 3AXLA 3F7YA 5EC2A 1W8OA 3VFOB 2P43B 1T4KB 4RFOH 1YC8A 3KNBA 5ID1B 4JFZL 3N1QC 5GGTL 1IFHL 2P46B 1J8HE 3MR9B 4KKBC 3NPSC 1IILE 1F4WL 5GRVL 5DMYA 1ZTXL 2UUDH 3VRLF 4PJ5A 1N7ML 5JHLL 2E9JA 3X3GL 2MQCA 4LEXH 4JRXE 3HUJB 2E3VA 5CEZD 4TTDC 4HIIB 3LV3A 5F8QC 2DWEA 4GG6E 4O2FA 1U8IB 3B3IA 4RBPK 3MZGB 4HJ0D 1F58L 3NCYS 1MJ7L 3P11H 3SE8L 2J88L 4XVUC 3T4AA 5I18L 5J06A 3T0BA 2GSIB 1DL7L 4U0RC 1D6VH 3N0PB 1CFTB 3FTGB 4XWGL 4DZ8A 3ORJA 3P9MA 3QO0A 4KHTH 1ADQH 3T0ED 3IVKA 4YDKH 4LVHB 2J6EA 3CVHH 3WIFA 3T0EC 4XP1L 1PYWB 2E27H 4ZUWA 4ETQA 4YX2L 5ILTL 3HS0B 1JFQL 3OB0K 3WFDH 2LU3A 2YD9A 2EIEA 1GVIA 4BQ8A 3JTSA 5DQDL 4HWBH 5JZ7C 3V4UL 4LKXB 2VLMD 4LVNC 4LDOB 4X6CF 1MCQA 5IVXA 2JJSC 4WNQA 2HJKA 4R3SB 3DUSA 3VXSB 2UY6A 2ZG2A 3GSUA 4ODSL 43C9A 4QF1A 4XH2B 3S35L 3I50H 1JMXA 1P53A 1R3IH 4BSWA 5C07E 4FQXB 1K2DA 2VDQL 4U05A 4JRYB 5C0BB 4AIOA 2WUCL 4L1DA 3Q6FA 3QO1A 2KBGA 1GAFH 3ARBA 4NKIH 1NCDH 4OTXH 4PLOB 3D85B 3TBYB 3TNMA 2F8OA 2ITDB 3LQMA 2WM0A 1QFPA 3CC5B 1MLBB 2ZSWA 4I9WE 2ARJB 2B2XH 1A6AA 4GRWF 1KG0A 3NOIA 1GHFL 4LP5A 5FO8B 2N7BA 1RJLA 4QHNA 1IGML 3FRUA 1U0QA 4ODUB 3MLXH 1TJIH 5IWLA 4LSPL 1UXSB 4I48B 5DYOA 4WFFD 1B6DA 4G7VH 5T1KB 5DD5H 1MCOH 3KYKL 2AJYH 1O0VA 4M61B 1HWGB 5AEAA 4U6YA 4KI5C 4JN2B 1C12A 2P45B 6FABL 1QFUH 5C7XL 3T2OA 4F9LC 1MQKH 1HINL 2YPLE 3C09C 1HXMB 3WHXA 1C5BL 2BJML 2E7MA 3HRZB 4KKCC 2HJLB 4PJFF 2R0WH 4KJQC 3E6FB 3BWAB 4ZTPH 2EKSA 3UBXA 3QJFB 4RGMB 2J6EH 1WV7T 4BZ1H 3F7QA 3IU4L 3BKYH 3M17A 5K59E 4AG4H 1S3KH 5IROA 3VWJA 1AFVH 3FB5B 5DRXB 1A3QA 3CSBA 4BSWB 1KXTB 1FG2A 1KCRH 4E5XA 2VJXA 4PJGE 1ZWIB 4OQTH 3QDGB 1QG3A 4WUKL 2ADJA 2R4SL 5FYLD 4NN6C 4P9HL 1RZFH 3MRHA 5TF1H 3V6OC 1CICD 1HEZA 5DR5L 2X4NA 4LQFH 3W2DH 3MV8B 1A22B 3GSOB 1W0YT 3CC5A 3OAYK 4FTVA 4RMUA 2CLVA 1M7IB 2DD8L 3HNVL 3DX7A 4JJHA 3LY6A 3HCVB 3KYOB 1H9VA 4KAQH 2Q86B 4PFEA 2CPCA 1E28B 4PRDB 4XNQA 3LS5H 2DQTL 1R6VA 3N85L 5J56B 1MAMH 3VJ6B 1J0YA 2A6JA 4JFHD 3O45A 3UX9B 5CLWA 3SDAC 2OR7A 3STLA 2HFEA 1MCCA 5SWSB 4DKFH 1KV3A 4JM4L 2OZ4L 1PG7L 4BQCA 1RJZA 1TVHB 4NBZB 3VXUA 2ADGA 1J0KA 1AR1D 2GHWB 1BQHG 3ZO0A 1FZOB 3KLSA 4X9FA 3RHWF 2PTTA 4UOW0 3G5YB 4P2RE 3ARFB 4EXPX 1FO0L 1HOCA 2VLLA 3LPFA 4JR9L 4N9GA 5I1HH 4RBPH 3SQOH 3PF2A 2IANE 4WCYH 4OCNC 3M8OH 1NAKL 5C9JA 1IT9L 3X13B 1GSMA 4D0DB 4IS6A 1TZHB 1H3TA 1U8PB 5IBTL 1QO3B 1WAAE 3KXFD 1FRGH 4UILL 4XBGA 3UTSE 1HHGA 3T1FA 1QSZA 4GS7C 2EECA 1FORH 3GB7A 1ND0A 3KPQA 2AGJH 5FM8A 4D8PB 2Z4QA 2Y6SC 3S36X 2VKWA 2R0KH 1FSKC 4J8RA 2E27L 1NCNA 2JB6A 1BZ9B 2F53B 5HHOD 3MRQB 3SE9H 1JRHH 1VENA 4H25B 4F3FB 2YXMA 4TVPD 4X6BB 4JZJC 3TN0D 3HCVA 4NKIL 1S5HA 2W91A 4YC2B 4LLAA 2QQKH 4WFHD 4NWTH 1KTKE 1PAMA 1U8JB 4TNWK 1ZVHA 4OJFL 1P84J 1GZQA 1Z0NA 2GTZB 2A6JB 4OSUH 4JKPL 4KXZH 3O45B 3VH8B 3WUWB 1I9JH 5GGSY 4JM2A 4H8WH 5ERWA 5ID1A 4I3RL 3F7VB 3O3AA 1TNMA 2HFFA 4H0HB 4ZUSA 3QIUD 3IT8D 4BK5A 1YMMB 4PP1C 2EDTA 5CP3A 1OTTD 1RUAL 2FYYA 4KMQA 3QUXD 3UTTA 5HBBA 3RWIB 2NY0B 2PYEB 1HHKA 4WU5B 1DQJB 4MS8C 4HH9B 1U8OA 3MJ7B 1AE6H 4XPGH 3DSNA 3VWKC 5JIIA 3MACL 3QCTH 4PV9A 3GIZL 4GQ9L 3OPZL 5F6IB 2XTJD 3OKKB 5ITFB 3UYRH 1J1XL 1WFTA 3P4OA 2J8UB 3ULUE 4M7ZC 1KJ2A 3DRQA 4M43H 4WFEE 4D8PA 1YEFL 4R2GC 4U6VH 1JF1B 4RA0C 4O4YL 5F1NB 1M6OB 4NZRH 5TDOB 1MJJA 8CGTA 1XF3A 4OZIB 3BSZH 1HEZB 4NRYA 1H5BA 4MD0B 5F89B 4M8VA 3L3GB 1HHHB 4WEBH 3QULB 5JW4R 3U4BH 3T4AB 2L7JA 2IBZX 4LSUH 4LF3A 4DUVA 4PV8A 3TIDA 3P9MB 3GI9L 1FV1A 5IOPB 5I8OL 1FN4B 2ADIA 4P4KA 5E8NB 1CE6B 1TTFA 1C5CL 1S7UA 2R0WL 3DO3A 3KPOB 3A0OA 1RMFH 2YPLD 3C5SA 4HPOL 2J3SA 4LOUC 4EN3D 2HFEB 4OFVA 4HFWA 5FO7A 4XCNA 4IRSD 2N1KA 3C6LA 4ONHB 1DR9A 3ARBB 4PJ7B 5I75C 1DANT 5KSBB 1BLNB 2XG4A 5J1SC 4HF5H 1IQWL 5D7LE 3MRNA 4JVUA 3I6KA 4LARL 4GQPH 5JOPE 5DUBA 2OK0H 4FMFA 3QCUL 3QQNA 4QRQB 3DYMA 4LBEA 3DVGA 1CVSC 1KBGL 3VFWA 1J5OH 5FGSA 4MCZA 3BIKB 2C3VB 2Q20A 2DQUH 5CJ5A 1BEYH 2YUWA 4DUXA 1NCBH 1IRAY 1QLRB 3CGTA 4HGWA 5HYIA 3PGFL 2WBKA 4HKZA 4CW1A 3MLWL 5H2BA 4KK9D 1UXSA 2AK4E 3F65A 1BP3B 2IAMA 1NGQH 1CGTA 3QEQE 3QXAB 4N0YH 1ND0B 2J5LC 3MUY1 2JIXB 3MNZA 5BZDA 1E27B 3OGCA 5DMJB 2BSTB 1BFVH 1WCBB 5F89A 3HMWH 1NC4D 3MGAA 1NAML 3BPCB 3HMXL 4JPKH 5EIIB 3ZTJG 1QRNB 3D39A 3VDAA 1DBMH 1CFNB 2DOCA 2ADFH 1A6VL 1YNLL 1FN4A 3ZZ1A 2DS4A 4JFYA 1XCQB 5GIRB 1AHWC 4XB7A 3GJEA 3QIBA 4OLZH 1OGTB 3OMZA 1JZ7A 3PWPB 1FHGA 4YHZH 3MGOA 1SMOA 4X5WB 3MYJA 3OR6B 5E8DL 5FO7B 3B2VH 4KK6C 2B0SH 3O3AB 5FEBA 3SEPA 3GRWL 3FAWA 4PRBB 4C83B 2XA3A 2CJUL 1RURL 2Q7YB 4OLVH 4TOYL 1MFEL 4GAJL 3GBNL 3MBXL 3OAZH 4AL8H 2EIDA 2EH7H 1RUAH 5IHZA 4WU5A 1R5VB 3IKCB 2ZUQB 5C0AD 5J7CC 2EDOA 3EGSB 1RSFA 4KKBD 4FTVE 4JCMA 3TH3T 5JOEA 1PYWA 4G3YH 1U3HC 3MCLL 5T3ZL 4IOSD 5DLMH 5SWZA 1AHWB 4LCWB 4OFKA 5F88A 4U1SB 4HMDA 1FG9C 2EDXA 3FHAA 4DFHA 4X99A 4R0LC 2D0FA 3MJ6A 2QL1A 1T22A 2W59A 1N8ZA 4NKMA 2H6PA 3DVNA 3WFZA 2DKUA 4I3SH 3E6HB 3INUL 3SGJC 5FO9B 5GZOD 2EC9T 2NXYC 4YDLC 5IBLD 4GFTB 5GZOC 3D39B 3CXHK 1NGWA 3VGAB 3D2UD 1H3PL 1CGXA 3QWOB 2AJSH 5EZJB 1WZ1L 2B1HL 4OZHF 1U6AL 2RFXA 5HDOA 3ROLA 4O58L 5E1AA 4ZMAT 2B4CH 4GKZB 1LO2H 4KDTA 2F15A 2IPTL 3W11C 1WAAA 4MA7H 3KPQB 2HYMA 4XBPB 1FZOA 2YZ1A 4JFXB 4RGOH 4KRMB 3ULVH 2I60H 4JFQB 2CIIA 4N1EA 4PREB 1YEEH 1Y18A 4PJ5D 2APBA 4J8RB 1VDGA 1HOCB 4PS4L 3IDYC 1AO7A 5IHZB 1FFRA 2AV1B 4G6KL 1RJLB 3S9DB 3X13A 4BH7B 3FFDA 4YXLL 3OKOB 4PJAF 4AEIL 3JWDC 1T03H 2BNQD 4Y2DC 1FFNA 1UCBH 3P4MB 4G5ZL 4KI5E 2A6KB 3IAPA 43CAA 1TETL 2ATKA 2XWBB 2GTZA 3VD7A 5D71L 1OF2B 2NTSP 3KPTA 3DXAD 3QT2A 1CTOA 5ERWB 5D1QB 2X4RB 2CH8A 4QCIB 5A3IC 3QIWD 4YR6A 5J4MA 4F7PA 4JAMA 4LVOC 5JHDD 1JRHI 3B43A 2O61B 1IKFH 1CT8B 1SY6L 1OQXA 4EI5A 3BN9C 1MJ8L 1GC1C 3BWAA 2Z8SA 2HLFC 1LNUB 1P4BL 1UYWL 3UJIH 1A0QL 2NZ9D 2BVQA 3AMKA 5BRZA 3BP4B 4JZOA 5BO1L 1MI5D 4H1LB 4JM2B 4DN4L 4S10A 3EOAB 5I30H 2DLFH 5CEZH 3D1MC 2QEJA 3LKSB 3S97C 5FHBH 3NABH 5I75B 1AD9A 1L6ZA 4HIEA 5IB5A 3IDUA 4ZXBA 3MV9D 4D9LL 3KJ4B 1VFMA 4HD9A 3WIHH 4ZUTA 1WISA 4OD1L 1HZHL 4C83A 2YUXA 2ZCHH 1QBML 3P9WB 4L4TD 4R96B 3L3KB 3NAAL 5I15H 3RUGE 3NCBB 3OKOA 4G8IA 4PJIE 4Y4KA 1OWRM 1FYTA 1T89A 3G04A 3S34H 4PGDB 2HRLA 3P4MA 2C3GA 2O93L 1PEWA 4JZJA 2OTUA 1UH3A 3CFDA 4NNYA 1T04B 4L3AA 3TN0A 1OF2A 1HDMB 1TVHA 3VXUB 5L88H 1LP9B 3QQ3A 4NKDA 3BKCH 3MJ9H 3DV4A 4LSTH 5JR1L 1MAJA 5B39A 4HWEH 2XTJE 3PUCA 1QKZH 2BVOB 3EO1A 4PGCA 4MAYC 5FKPA 5F93C 1AGCB 1Z9MA 1QEWB 1MHHA 1Q38A 3PXJA 4QT5A 2WBJC 1ZVSA 3HNTL 2Y36L 4JRWA 4EI5B 4G9FB 1T66D 1ITCA 1AH1A 4RGNC 3ZYIA 3S36L 4MNHA 2GAZB 4KJPD 4V1DB 2C7UA 1M4KA 1OAYH 3IGAA 5EIQA 2GEEA 3BW9B 5D93C 4FABH 1I1AA 2V2WA 4D9QD 5E2WH 3DVIA 1VFAA 5IOPA 4M7LL 5BVPL 5I1KL 4MNQE 4X6EB 4NNXB 3QWOA 2V6HA 5DD3L 5FCSH 3NACL 3LZFH 2W9DL 4ZFFB 4TUJB 4H26B 2ICWB 1EAJA 2C1OB 4AMKL 4PJ8C 5L8JB 3DVFA 1N6QL 4RISL 1I1RA 2GJJA 5HHPA 5KW9L 3PV6A 3MV7D 4GRWE 1YPZA 5AZEH 4OZFA 5JO5B 2RJMA 4O2FB 2XZQH 1BVLB 2P5WA 1G9EA 2WWMC 4JO3L 1BIIB 1U8JA 1AD0A 1YY8B 2LQRA 2OTWB 4RGNB 2AABH 1RQ5A 1N6UA 2D03L 1CFVL 2JJWA 4P2CG 3MUGB 1GH7A 3BQUB 2PYFB 2E9WA 2Y07H 5IMKB 3T09A 1JZ8A 3QHTC 4CN1A 3O8XC 5CLTA 2XN9D 4FQ1H 1JPGB 4PP2B 7FABL 2FLBT 1NCUA 5IMMB 1I7ZA 4HUUB 4XRCA 4DVBB 2IGFH 1YEIL 2Q8AL 4YHLH 4HMEA 2X4RA 5FKAB 4LCCA 2BC4A 5DHVH 2NY7H 5ELIA 5EN2B 1JV5A 3QEUB 1A47A 1NKRA 3L3IA 1A3RL 5IVZA 4X5XA 1BBDH 4QWWD 5E2UL 1LO5A 4X8JB 1KPRA 5DQJA 5DJYB 4LRIC 1RUKL 1F11B 3EDFA 1I8KA 3I9GL 4WI3A 4H26A 4OCXH 1KLUB 5IB2B 1HXYB 4JO1L 2DQEL 2YUVA 3L9RB 5FGCE 3ARGD 1MVUB 4Q6YA 4CN4A 3GSWA 1TZIB 4J1UB 3PDDA 1TLKA 2WBWB 5DA4A 5SWZE 4MSWB 1YECL 4FFYL 4PGEB 3ZT7A 5DEFB 4YAQB 5C0BD 4FQ1L 5FUCC 5C3TA 4JQVA 4K3HA 3QR2A 5KZCB 1SBSL 4L3EE 1CN4A 4EDWL 1DBAH 3SGDI 4O2CB 1O5DT 4Y2DB 3QUZC 1XZ0A 2WSKA 1U2HA 3PQYA 2PYFA 2YRZA 3UJJH 3R8BB 2YPVL 4B5EA 4XX1G 2D03H 4Y4HA 5JPNA 5MEQA 3GNMH 5GGRA 1H3GA 5IBUB 4JFHE 3SPVB 1AHWA 5ENWB 4JY6A 4R8WH 3UO1H 2A38A 5DJAB 4JG0H 3GM8A 3IDJA 3PQYD 3HR5B 4NNYB 4P57B 2Y5EA 3MA9L 5BV7B 4P5TC 4LVOB 4G6AC 5EOCL 5BV7L 3KPPA 5EBWA 3KPRA 2RAMA 2V5RA 4HG4J 3QIUA 4NQVB 1UWGL 3N06B 4Q2ZA 4LLWA 3QUXA 4YHIA 3RX8A 4HWZA 4PJBE 4QRQA 1A6ZB 3HFML 4BYHA 3FRPG 4N90E 4S1DD 2VUYA 3HRZA 2X89D 4Y16A 1Z9OA 5DWUH 2FL5A 3TO2B 3MODL 5C8JA 4IDLA 4HK0B 3UBXB 5H8DA 1N26A 4GMSH 4EN3C 5E4EB 3BHBA 1QLRA 2RCSH 3GBMH 3L6FB 4JPIB 3KDMB 1JPSH 1WSST 5E08H 1FG2B 3NA9L 4GLRI 4M7JL 1LD9B 4JDVA 2A9NH 2CIKA 4ELME 1JGVH 1PY9A 1QSFA 2B5IB 3H0TB 2BSTA 1MH5B 5F70A 4BUHA 4HS6A 3VXME 3M07A 1NCAL 1T1XB 3IDNB 3MV8A 4Q9RL 1I3UA 3FFCB 5DD0H 3JWOC 5JO5A 4G8GD 1NJ9A 4WI5A 4Y4FA 4FQ2H 2DJSA 3MV8D 3LN5B 4FXKA 3DV6B 4GG8A 4KQ3L 3JWOH 1BM3H 3QQ4B 4POZD 4LCCC 2W9LA 4GRLB 4JZOB 5ENWA 4GXVH 5LGHH 3FQTB 4PRID 2VR5A 1X5FA 4L4VE 1UVQB 5D96C 5KVDH 1S9WB 4M1GL 4OZ4A 4X9GA 3REWB 2BOBA 3C5ZB 5B22A 3RIFF 4G6JH 2X05A 2A9NL 1U8MB 2CRZA 2JB5H 3O2WH 2XKSA 5SWSD 3CDYA 1JPSL 3E3QC 1AGDA 3N9GL 4X98B 2O5YH 5GPRA 2VQTA 1CICC 2D0HA 4MA8L 4LRNL 3WDIA 2DKSA 5BJTA 4OI8A 3G04B 2UZXB 4HPOH 3VH8G 3WUWG 1HCVA 4KTEH 4E41D 4FG6C 5D7JD 4LAQH 1U9KA 1A9EB 1AD9B 4WW1A 3D9AH 2ED9A 1P84K 5DA0B 2ZSVB 1WWCA 2YRLA 1F3DJ 3JWDL 3NFSL 4ODXA 3AGVA 2PW1B 1IC7H 4L4VB 1JK8B 2KDGA 2NW2B 3KYMA 2GITA 3NN8B 3G5ZB 1TZIA 4J1UA 2Y06L 5HYSG 3GMOA 1NCBL 1KELL 4H25A 5DT1L 5EU4B 3LSOB 3DGCR 5C0AA 3EZ8A 1KT2B 4Q9CA 4YAQA 3Q1SH 1PQZB 4HIJB 2DDQH 5GS0D 5CJXC 3SO3B 4PJXA 4LRIA 5CSBA 1S7VA 1KLGB 2BY2A 2NW3A 2L4OA 2J1KA 3PL6B 1FNLA 4MJ6B 5D2NC 2GJ6B 3TT3H 3GSVB 3S4SA 1GC1L 4NWUH 4UDTA 3IFNH 4ZUSB 1KFAL 2FX7H 4O2EB 3AC0A 1BVKB 4PJFE 1BHGA 3K4AA 4HBCH 2I9LA 4GH7B 3CMOH 3U30C 4KVNL 4AQOA 3C5JA 4OZGA 1NGXA 3RWCB 4C59B 3QIUB 4NQVA 1DQJA 5HDBE 4JJ5A 1F3JA 1INEL 3O6FC 3QUXB 3RVVC 1ZANH 3C6LD 4PJDB 1M05A 2AJSL 2EXYC 1JNJA 4UT7L 5JOFB 5KOMC 1BOGB 4P9ML 4V2BA 1RV6X 2DWDB 3MROB 3EYUL 1WIOA 4HDIB 5GJSL 4P2OA 4L29A 2R1YB 5SWZD 1MCRA 1FL6A 1XR8B 1JK8A 1YPZB 3MLRH 3HHRB 1CS6A 1MFAH 2A1WH 3VXSE 1MH5A 3JVGC 1B0RB 4Z7WF 1JV5B 5HVFB 4F7EB 4LVNB 4U3XA 5F7EL 4HUNB 4PIRF 3CVIH 4PJXB 4HUXA 4M93C 5I1AB 4RGMC 4N8CL 1U8LA 5E5RB 3SBWA 4K94H 1GGCL 5E6YA 4IBLT 3V4VL 3RI5F 3UTZB 4BJLA 3BEVA 3DXAA 1NKOA 5IMMA 2OQJA 3CX5K 3OX8B 3DJ9A 2VXQL 5HVGB 1N5AA 2WWKO 4YHNA 4ZYKB 2P24B 5EZOL 2OMNA 1Q72H 3UEZA 4QRSB 1F4YL 1GIGH 5M94B 1FAKT 5IQ9A 4NUJA 2Z35A 1I8LA 1HH6A 4XNZB 1AY1H 3UP1A 4QRTA 1U8MA 2W38A 3EO0B 4X83A 2IFGA 4PRNB 5D7IA 4OM0L 3ARBD 5I6XB 5BRZD 2BRRL 1KOAA 5JOFA 5KTEH 4N1HB 4GG6B 4B41A 5T1MA 1EBPA 3U0WH 4L3EA 1R24A 4JRXB 2HMIC 3B83A 5IM7B 4Z95L 4Y2OA 4WU7B 1IGFH 3T4YA 5J6HA 2AK1H 3CFCH 3GO1L 2PO6D 4Z7OF 1ZTXH 1ZSDB 2VLRB 5J6GA 2R0KL 3CFEA 3F58L 1KCSH 3LIZH 3FN9A 5JW4Q 3GUTA 1DE4B 2VH5L 4X0KA 1KJ3H 3LEVH 4PGEA 1WICA 2PO6A 3OKMB 4MNHB 1E6JH 4PJGF 2J5LB 3O4OC 3PDOA 4WY7L 2E9IA 2QSTA 2QADC 4FZEL 4R6UA 4DK3A 3O2DH 3CJJA 3D18B 3BEWB 2B4CC 1NBZB 3AREB 5IW6B 3TO2A 4JKLA 4A2MA 4KTDH 2BK8A 2DM3A 3OKEB 1Z3GH 4S1RH 3HLAA 1U91B 5D96B 3IDXH 5I8KL 5T33L 5I1GH 3ABZA 4PJXE 5ALCH 1CLYH 1I3GH 2PTVA 3KDMA 1S3KL 1X6LA 4KMTH 5EU6A 1C16A 1QHPA 3IU4H 4UQ3B 5B3JE 3VWKB 2HG5B 4KUCF 1ZHLA 1BIIA 1YY8A 2EE3A 1AR1C 2HKFL 3WO4B 5I17B 3V0VA 4F7CB 5IG7B 4XVSH 5E7BA 1PDKA 4EQ3A 5I74C 3UYPA 2YK1L 3ILQC 1JI1A 3SDDB 4G9FE 5DVKA 1OT2A 4NQTA 1FAIH 5DJ0B 5LCVH 2MJWA 4QXUL 3GK8H 1RZGB 5GQBA 4GRLA 4R7NA 3H3PH 5DJ2B 3V7MA 3MC0A 3KLHD 4ZODA 4X9HA 4J3SA 4FP8H 5DDHA 3VI3F 3MJ8A 4W6WB 4HK3J 4PY8I 3AB0C 5CZVH 4GQ9H 1SYSA 4ZXBC 4HXBL 1G6RA 3L3IB 5EORH 5IVZB 2WLZA 1TTGA 3O4LE 1XGRB 4E42A 4K94C 2DWEB 3LKOA 1INDH 4JHBA 4HQQL 1T03L 3VFVA 4KWUA 1RULH 4M6ML 3UDWC 2V7HA 2XXMB 2ZUXA 4LL9A 5F6IC 4BFGA 4HUXB 1FNEA 2VC2H 3HC3H 4M5ZH 5F3BB 4JQIL 3D2UB 3QFDB 5FIEA 4U1GB 1GPOL 1U8HA 1MIML 4NRZB 3UTZA 1HHJA 4WHYG 3TNNA 3WD5L 5HI4D 4HIXH 1B88A 1I8IA 4YO0B 2C4FU 4K3JH 4JFXA 3EAKA 5HI4C 4LSRL 1SM3L 1X5JA 3B5HA 5FYKL 3RVWD 1BQLH 2K9UA 4IIQB 5ITBH 2VXUL 1JYNA 3RGHA 2UZYB 3RY6A 1KIPA 3VXSD 1BJMA 3BXNA 3LKNA 5C2BH 2VE6A 1UC6A 3O2VH 4UI2A 4R3SA 4F37F 3QXDA 2OL3A 4FQXD 3AS1A 4P2QB 1ZLWK 3ZE0E 5HDLA 1AXSA 4FXLA 2G75B 1HQ4A 4BFIA 4O5LL 3EJZC 4CMMB 3IU3A 1CXEA 1I85A 4Q0XL 5C0CA 3HE7C 4YHKL 1RAMA 1QVOA 5I1LB 4RFNC 4Y1AE 4U1IA 3BAEH 3O41B 4IMKA 3CH1A 2BHUA 1X7QA 3QDME 5IT2L 5I76B 2ESVE 5CWSB 2CRMA 1NLDL 2PW2A 2WMPA 2W60A 1GYAA 2C1PA 5I1CH 3THML 3RKPA 2V7HB 3G6DL 2VXTL 4JN1H 4MJ6A 5SWQA 5CUSH 4MMZC 4LIQH 3V5KA 3GSVA 3NIGF 1BZQK 4MLSA 1NBZA 3AREA 3BN3B 1FGVH 3HG1B 4B7IA 2AKRA 1SQ2N 5T1KD 5J57B 3X17A 1MCPL 2X70A 3BH9A 1MI5B 2BDNL 1G6RH 1FL6B 1XR8A 4XMPL 3U79A 1RZJL 4FFZL 3QRFM 4LLYA 2GY7B 3HUJA 5K59F 1ZHLB 3ULUH 4JPVH 5GS0H 3VGDA 5I30L 4KZDL 3MV01 3ZHKA 3QIWC 3CSPA 3PGCA 4FTVD 3I85A 4DTGH 3V0VB 4RMWA 4F2MB 1IE5A 2VZ3A 3BKCL 4R0LB 2H1PL 2Q76A 1HWHB 2XFXB 1WC7B 3CFDB 1S9WA 2AXFB 4ZPTA 3CAFA 4Z76B 1IM3A 4LASH 1HQ4B 4BFIB 1LWRA 2NTFB 4MQXD 1ZT4A 5CGTA 5DO2D 3TIEB 4WFFE 4E5XB 3GHEL 5A43C 2D9QB 3WFEH 1MHHB 1CE1H 4QRSA 1SYVB 2H32H 1F6AA 3FQNB 5KN5A 5DD1L 1EIBA 3JTSB 1CBVH 1Q9KB 1OTUD 2C7UB 2HP4A 1T20B 4H88L 1OTUC 3ULUF 2VDRH 2GJ6E 2VITA 3VFMB 5F7DB 3X12A 3A67H 1V3JA 3AAZB 3RY4A 4ERSH 2XWJB 3ZT5A 4QTIH 3EJJX 5F7FA 3RHWK 1FNSH 4V1DD 35C8H 5C0CE 2Y5TB 5C0NC 2PF6A 1BAFH 3QH3A 2GITB 3KYKH 2NX5E 2DM4A 2IQAA 5DFVC 3L3OA 3H2WA 3QO1B 4H1LG 3JV6B 3GUTB 3RKDC 4S2SB 3R0MA 4DKDC 2ZOLB 3RKDD 3WHE1 3NIGE 4KK6D 3P0YH 3DIFA 4KY1H 2DQDH 1JYXA 2X1WL 4OBRA 1UZ8A 4F9PA 2VWEE 3E8UL 2WP3T 1RFDL 3PGCB 2KL6A 5L9DH 3KXFB 5F21B 4RRPA 4ZFGH 1KPUB 3CXHJ 1U3JA 1ZXQA 5CEXA 4RGND 4LHUB 5DI8B 4OV5A 5E8OB 3SDAD 4OGXH 1TETH 4DKEL 2AV7B 3FRUB 4TTDD 4P2QA 2DM2A 1LE5A 1NQBA 4CADA 4HK3N 4QNPE 3CCHB 1IEHA 4WGWB 4ZUVB 4WHTA 1Q1JL 4LASL 3U46B 3DROB 3HUJE 3SDAA 2F53D 2XN9B 4RCAA 5K9OA 1MREH 2FECL 4TULL 4ODSH 3WLWC 5EBMB 2EDRA 3ULSA 5KN5B 2I25N 2H2PD 4MWFA 4FNLL 3V2AR 4HC1L 4FN0A 1EHLH 4LCUA 2H2SC 4MJ4A 3U0TB 1TDQA 5D7LB 3WDHA 4GW4B 4PB9H 4MJIE 1MFEH 3GIZH 5FOBB 1H3VA 2R1YA 3G6AB 3V5KB 5EC1B 3ARUA 1YMMD 4XPBL 2GYSA 5GHWL 2Y6SD 1T0MA 3QFJE 4UV7H 2NY0D 4MB5A 1OCWH 4MDIB 4MQTB 2PYED 4ZXBD 4LSQL 4OUUB 4EOWH 4NN7B 3RBSA 3ARDA 1QFWL 1A21A 3EFDH 4P5KA 3BKJL 2C9AA 1NCWL 5HPOA 2VISA 4NKOA 5JHLH 2ARWA 3NCJH 4PD4K 4JY6B 4NFDA 4G3YL 5DJ2A 3VJ6A 3F5WA 1G7JB 4JDTL 5IMOB 3TT1H 1U8HB 5D93B 3ULVF 3ILPB 4N0YL 3WFHA 2MTPA 5IK3A 1I8IB 2K3TA 4L9LB 2X4SA 4X6CA 1P4IH 3PNWA 4NQCE 4UNUA 2YSSA 4IRSA 4R7DA 4A6YA 4RA3A 2R1WB 3BUTA 3H3BC 2ZKHH 4XAWL 4JFDA 4OV6F 4RSVA 2XNAB 4ODWA 1II4E 4KZEH 1L6XA 4UB0L 3MNWA 2CMRL 5JUEH 1L9NA 1YQVH 1CF8L 1KTLA 2VE6B 2PNDA 5JMOC 4DWHA 1OP5H 3C9NB 5C92A 1ERNA 4EDXB 1TNNA 5IJVA 3F7YB 2BSRB 3BPLC 3TCLB 4NBXB 5FV1L 1DJSA 4F8TA 4P2RA 5DK3A 2G75A 3VE0A 5LWYL 1EGJA 1S5IH 2WW8A 4P5TA 3O11B 4W70A 4JM4H 1IGJB 1IC4H 4CAGA 1NFKA 1UB6A 4JREB 3L3OB 3U83A 3UXFA 2BNQA 4EBQH 3GMMB 5H35B 4HKJA 1XGYL 2R4RL 5ACLA 2H9GA 4AENB 1X44A 1WEJL 1A5FL 2V2XA 4WRLA 5F96L 4QXGL 3AM8A 4ONGH 3LQAL 2OL3L 1ZHNA 2C1PB 3ZDZF 3NIFF 3QI9A 1JNHA 4CN6A 2WUBH 4G8GB 3SDCB 3RNKB 3WSQL 4RQQB 2I24N 3CZJA 4FQJH 3MBEA 3MJ9A 2C3VA 1XF4A 3LCYA 4HPYL 4LHUA 5DI8A 5CS7A 2C4XA 2HG5A 4C58B 4OZ4B 3KG5A 1IVLA 2VSDA 4D9RD 2LABA 3I3EA 4J7RA 3WLBB 4LNVA 3IB4A 4JRYE 4ZUVA 4FFWD 3U9PL 9CGTA 1NC4B 3VDCA 2A6DB 4V2CB 2CO7B 5JDJA 2YA2A 4POUB 3T2NH 4M03A 5MP6L 5ALBH 5EFIB 4ZTPL 1ZGLP 2NPLX 4XT1C 5HHQB 1YJDL 1T21A 3NCCB 3R1GH 2DI9A 1YUHA 1F45A 4OLWL 3BPCA 4H88H 1TENA 2VXSH 4XP6L 4XXCA 3AFLA 2YR3A 5GRUL 4WTWA 1KPVA 3WBDA 3ESUF 4P4KC 2A83A 3T77B 2I60L 2MKLC 3U4BL 3HPLA 4BZ2H 1U8KB 2Y9RT 3G5ZA 1Q0XH 5EU7E 4MDIA 4L8BA 3FMGL 3BFOA 2EDNA 2R23A 3KPRE 5C0CD 5C0AB 5DGQA 3V9FA 4LSPH 3L3GA 2YMXH 2PN5A 3REVB 1CG9A 2AI0L 2VZTA 4MNQB 3J7HA 5HHXH 2GJ6A 1WBZB 2IPKB 2QHRH 3QXUA 4OB5L 4WJ5A 5C0EA 1OW0A 3VI4F 3D39E 4OQTA 3IXAB 4K7PY 3JBG7 1OT1A 4F57H 2J4WH 2VN4A 3U6RB 3U4EA 4PJIF 4NN5B 5E9DD 4GT7A 5DUML 4L8SB 1G9NH 1LP9E 4KROC 4JJ5B 2IAMC 4AM0B 1U93B 2V17L 4JN2A 5DUBB 5HHQA 2OL3B 2HLAA 3E0GA 4I18A 2OP4L 2APFA 4I9WD 5D5MF 1ZLUK 1CDHA 4Q9BA 1JGDB 1EJOL 3OGOE 4BQBA 3UC0H 1TQBB 4XPBH 5EZOH 3M17B 3T3PF 3ROLB 3O6LL 2OS7A 1V7NL 5I9QC 5E1HB 1NPUA 4EDXA 2GW5A 3VXRE 5I1LA 3LB6D 3FO2B 4ZPVA 3HPLB 4HGMA 3O41A 5IEHB 1J1OH 1QFHA 2OM5A 3FB6B 1KN2L 4F57L 5GS1A 1IGJA 3CFJA 2VQ1A 2ITCA 4KHTL 1QLEL 1Y18B 3LS4H 2MCPL 4ALAH 2BNQB 5H35A 1QR1B 3QHFH 5I1AA 4M6NL 1ED3B 2NYYD 4NJ9L 2Z8VC 3K4ZA 3BEVB 3DXAB 4HCRL 1I1YA 3QEQA 4KPHL 1IGYA 1JZ6A 4GW4A 2VAJA 3RVVD 1JNHB 3LRHA 3W0WE 3SOBL 1X5IA 1CZ8H 2ATKB 2XWBA 3QIBB 2W0PA 5ACZB 3FB7B 4H1LH 1E4XL 2EDBA 1V3MA 3SN6N 5FA3A 5IV2A 1A6WL 5IQ9B 5J8OA 5A40E 4HC1A 3P9LB 3ZLQC 1A7QH 1LO0L 1N7MH 3IRPX 4OD2A 1GZPB 2VDLL 2GSGB 2MHAA 2Q7YA 4DW2L 4F2MA 4NPYA 1J0IA 2ZZUT 5HHME 2ZWLT 2DQIL 1A8JH 1MOEA 2HT3D 5D5ME 4GG6A 4LLUB 1VGEL 3CSGA 5EWIH 3HNSL 1AQKH 2VL5A 3UPRB 3PWLB 1JGDA 4WHYH 8FABA 5IHLB 1I3GL 3D0VA 3G5VA 2VKXA 1G7IA 3F5WB 4BM7A 2CLRA 5I8CA 3MLUH 1CFBA 5HGHB 3H7LA 3DURA 5E7FA 3KJ4C 3PL6C 3GB7B 4FRWA 2P7TA 3SQBA 1T2QL 1YN7B 2H6PB 5T3ZH 1PY4A 3PHSA 1FC1A 4P5KB 4QHLA 5E9DE 4ZS6C 2R9HD 1TTUA 4RMQA 4HX1B 3W81A 1X9QA 4WUKH 4HEPG 4QXTB 3OKEA 4GKSB 1YEHL 1T89C 3VXUD 4KK9C 1KTLB 2BVUA 3BO8B 4ONFH 4ONGL 3UZVB 2FECI 3MRDB 4U1KA 1R3JA 3ARED 1ORQB 4K3EH 2A73A 4Y89A 1WF5A 4K3DH 5DYOB 3C8HA 2EDQA 3BSZL 2ZOLA 4Q7DA 4G9FD 3DMMC 4NHCL 1CLZL 2HFFB 5E8PB 3VG0H 1NDGB 1JYVA 1TQCC 4XTRD 5I17A 4EIZC 5GSVB 1IAIH 4ODBD 4LIQL 3CFKA 4G7VL 1A1OB 1MHEA 4Y5VC 3IDXL 1JTOA 2VRAA 5DRNB 3BKML 3BW9A 4X6DB 3NA4A 3GSNL 1HNGA 2ZG3A 1DQLL 4XC1H 1B4JH 1YDPB 4HUMB 3ARDD 4U6XA 2C4FT 1CXFA 1UZ6E 5TE7H 4CADB 3ETBF 4RQQA 4CNIA 3VE0B 3TO4C 5D2NA 3U46A 4FG6D 1EEQA 1GHFH 1UJ3A 3A6CH 5K9OB 4ODVL 5CJBA 4NO0B 4GXVL 5LGHL 1UT9A 2XZZA 4ZAKB 3Q6FB 1S7RB 2UUDK 3CFCL 2AJZA 1ZEAL 3EYVA 4L8DA 2AK4D 1WBYB 3NZ8A 4X7SH 1JGLH 5F1OB 4JKPH 1NBVH 3TGXA 2QQLL 4PRDA 4XNQB 3L7EB 1GCFA 4LU5H 2BOCB 3NH7H 4NSKB 5LBSL 3W39A 1BFOB 3FHQA 3QJHA 3P0GB 4OI7A 3S35H 1YYLH 4NNPH 4U1KB 4K8RL 3LMJH 1BQLL 5KVGH 1WT5C 1KJ2H 1JRHL 4IRSC 4NGHL 4LSRH 1F4YH 1GIGL 1HH9B 3TO4B 2HH0L 4D9RE 1AO7E 3QG7H 5TF0A 3BP7A 3QUYD 4LMQE 3KVQA 5HJ3A 5E8PA 5DK2A 4U2YA 2F5AL 2C26A 2NY2B 4JFZH 5BRZE 2I5YL 4ZUTB 3DO7A 1OTSC 1C5DB 4Q74A 5D7JA 2GSGA 3WSQH 2W0FA 3H42H 4AIZB 4G43B 3MNVB 2HJLA 4QOKE 1XT5A 1BGXL 4S1SH 3RY5A 1FDLL 2OJZH 3Q6GH 2VLJE 3OZ9H 1VFUA 2B20A 3ARGB 5D2NB 3UPRA 1QRKA 4XWGH 3QQ9D 4XWOD 4Z7NF 4C54A 2EDJA 2ZOKA 4UV4H 1UQSB 4FQHB 4J4PC 1FC2D 1X5AA 4P2QD 3HS0A 4TUKH 1Y0LB 1FZMB 3PE9A 1NMBH 5C86A 3C2AH 3U6RA 2AJZB 5EZLB 1QEWA 3UJJL 4Y2DD 4DOHE 4XPFH 2G2RA 4P48A 4XPTL 3U36B 1S5HB 1DZBA 2R2EA 3AS0A 4MNQA 1DCLA 1SBSH 5DC4B 4JDZA 5CZVL 3Q5TA 3K8KA 5D8JH 3PJSB 5I66A 2N4IA 3CU7A 3PQYB 3GSUB 1LO2L 3HG1A 3VGEA 4UT7H 1DQDH 1RU9H 1BREA 3O11A 2Q8BH 3V4PL 4N68A 4QXUH 1EK3A 5IB4A 3QDAA 3HG1D 2OZ4A 2FX8L 2YEZB 2OTPA 3EO9L 5ADOH 4XNYH 2H8PA 2JK5B 3ZKMD 3LKRA 5B3JF 1CIDA 3BP6B 3N9GH 4MQSB 1HIMH 3VD9A 5KVFH 1T80A 3DI3B 3H9ZA 4HBCL 1FLRH 1RZJC 5GS1B 4HH9A 1FFPA 4RIRB 4ELMF 4X7DC 1K5NA 1LE9A 1UM6H 1S7XB 1RHFA 2AXJA 5EA0L 1CGSL 2FL5B 2IANA 5HVWA 2D31A 3L5WB 1IEAB 4JHAL 4U7SA 1IGYB 1PFCA 2XT1B 4P5TD 4XTRC 4Q97A 3FO2A 1BM3L 4ZPVB 1H3WM 4FXGA 2IH1A 1NL0L 2V9TA 4LCIH 3ES6A 4XRCB 4YUEH 5FF6A 1FZMA 3FFCD 4K7FA 2HRPH 4U1SA 1J0HA 2Z92B 5IV2B 3ZMRA 4TRPL 2AK1L 2A0LD 3IJHB 5FKAA 3ZYZA 5DQ9A 2GQHA 1B0GA 3WO4C 1GGIL 2EZ0D 4OCWL 5T5NG 2FSEA 2EZ0C 2EH8L 1NCAH 4NPYB 2D7MA 1J9CT 2ZG1A 1IC5L 4PRIB 3P77B 1NDMA 3DV6A 5C0AE 1KEGL 2IG2H 2VUOA 3S5LB 3MRIA 3UJTL 5L7XL 1MY5A 3W9EB 2G9HA 4F7TB 1JWMB 1FJ1B 3MRBA 1QOKA 1KN2H 1NGPL 4TPRH 1MUJB 4P2RD 1LK3H 2E5EA 4U0RB 2P4AB 1RI8A 4QRUA 3REWA 2VXQH 3QWQB 4OCSL 1NEZG 1FIGL 3HFMH 1NEZA 1V7NH 1HQRA 3PP4L 2R9HC 4XNUL 4RIRA 5H37H 3K2UH 3SY0A 3TYGH 4LCIL 4E41B 2IPKA 1YEGH 1S7TB 4NZTL 5D7JB 5HGGS 5C0EB 1J88A 4YBLB 3RTQC 1YEKH 3Q0HA 1EMTH 3RUGF 3TPUA 3B2UC 1RY7B 1IEAA 2AJUL 1N59B 3G5VB 1DQML 5DSCB 1LHZA 5BMFL 5E03A 4U1JB 3H8NA 4L4VD 1K3IA 3MLYH 2VOTA 3V4UH 3CCHA 1Y6NR 4GUPA 3MLRL 3G5XB 3HR5A 3WO3B 2BY0A 4LHUD 5J13B 1F8TH 4OUOA 1JNLL 2GT9A 3H9SA 3SDAB 3AMLA 3BAEL 2KKQA 3BX7C 1RZFL 3QEQD 3HZMA 1BF2A 2G5RA 2B39A 1I7RA 3GKZA 4L4VA 4NZUH 4PB0H 3EKCA 2X4TB 3RIAF 5TPWH 3B4NA 1U93A 5EU6D 4XZUB 2D9CA 4QHLB 1EEYA 1N64L 5K9JL 5FYLE 4BFEA 2OMBA 1WZKA 4GW1B 2QLVB 4I18B 4Z8FL 1NANH 3FO9A 3EUUA 2GJ6D 2YD2A 5D7LA 3TWCL 2BFVL 4LK4A 3IYLW 4YBLC 1CDYA 3BHBB 3RTQB 1KLGA 3TVMA 3SDDC 1PZ5A 1FV1B 2A73B 2HA1A 1C5CH 3BP4A 2EIBA 5HI5D 1S7QB 3V52H 4UUJA 1QP1A 5D7LD 4CRPA 3VXMD 1MRDL 4UIMA 3EOAA 4DUWA 3OR6A 3O3DA 1A2YA 1IC1A 1BF8A 3NMEA 2EYSB 1U41A 3VWJD 5IFHH 1RHHA 2Y72A 4ZS7H 1ZLWH 3C6LB 4ONHA 4PJ7A 4OZHE 3VXTB 2FH8A 3GHBH 5EPMB 3RVWC 3QCVH 5AAWA 3CFKB 4NQXB 4ZXBB 5ICYA 3I2CL 1MVFA 1KXVC 4OCLC 1FNFA 1OB1A 2F5BH 3U7WL 1K5NB 2DMBA 4JKWA 3KLAB 3SO5A 4HLZG 2R2BA 4X7EC 3VFWB 4PJCA 3FB7A 3LRSB 1BOGA 2FHCA 4FQIL 1IGIH 1OPGH 5SWZB 4HQQH 5BVJB 1RZKC 1FE8L 4FQXC 5B8CC 5CJQL 1FDLH 2OJZL 1YA5A 4R4ND 1OAXL 4RDQF 2BNRE 1IGTA 5C0IA 1HKLH 2V2TB 3KR3H 3RGVA 2VERN 1K8IB 2AVGA 3QBTB 1RZ8B 1H5BC 3VGGA 1IJ9A 4KVCL 2Z92A 5CEYA 1V3LA 2J8OA 1XCTA 1S9YB 2I07B 32C2B 3GHBL 1JZ2A 4D3CH 3I9GH 4P9HC 3UAJC 4PJBB 4QYOA 4ZS7L 1GOGA 1QBLL 1J11A 4Q9QL 1MWAH 2VDNL 1U8LB 2OXHA 2CO6B 2FBJH 5ITFA 2QJDA 1G6VK 1N3NA 5IJKA 25C8H 3JV5A 5DVLA 4F7TA 1FFOA 5JXAH 2YC1B 1NFIB 1H8NA 1UB6B 5DURB 2J7LA 4DJMA 1MUJA 1T2JA 5DK0A 1PG7X 4F80A 4YXKH 4M6NH 3MCKA 5EZLA 3TFKC 4JFPB 3OKDA 4M1CD 1HH6B 4MD0A 4OZFB 4QNPF 3BPNC 4GKSA 4JRXD 3U36A 1DN0B 2BHYA 1G1YA 5C2BL 1NMAH 5L2KE 4JDZB 1DDHA 1T7WA 3DYPA 5EIVA 3DBXA 2VLRD 1HYRC 2W92A 4YFDB 1KUMA 1LEGA 5FYLL 1R5IB 4UU9A 3ZKXC 1UQSA 4FQHA 5CHNA 2AEPH 4XXCC 1X5XA 3SDCD 3MZTA 3BJ91 1EMTL 4PP2A 4K3JL 3VGAC 5TE4H 4WCYL 2NY3C 3TF7C 3LKQA 4X99B 5CEZE 3V5DB 5MEPA 5CCKH 2JK5A 5EO9A 4XCFL 4QWWC 1PGRB 1B6UA 2WAHA 1MPAL 4J6RL 2YBRB 3MRNB 1FNGB 1OTTC 1D6EA 2BC4B 3MBXH 5JXEC 4TSBH 2F58H 5ANME 3LEXA 4G80B 1HXMA 4K2UH 2OZ4H 4QYOB 2XA8H 1S9VA 2DYPA 2WV3A 4P4RB 3U0WL 1RZ7H 2R0LL 5KG9A 3EDKA 3IFNL 5A2JH 3T0WA 3VWKD 1P9MA 4QOKD 1QFOA 2X10A 3PDGA 4R4BB 3T8XA 5FAAA 2IG2L 1S7RA 4HKZB 3SKJL 2YPKB 5JR1H 2MFNA 1CLZH 4UUJB 3GDBA 4P46A 3H9YA 4APQA 5IB2A 2AQ2A 3EYVB 4JFFA 5CGMA 2ADJB 4NDMB 1IM9A 2DM7A 4U1HA 4D9QE 5DEZA 5KS9B 3V6BR 5DWUL 2CUIA 1UENA 3S37X 1NFDB 4JPKL 5DJDA 3SKUD 4YBQD 1VB9A 1AC0A 1FAIL 3SDDD 4WI8A 3V4VH 1L7IL 4BSJA 4Q58C 4PGDA 3RVTC 3VI3E 4MA1C 4MA3A 5EU3A 1XEDA 4BH7A 3RVTD 1CFNA 2P44B 3SE3C 2DF3A 5TDPA 5GS3A 3SDDA 5DJ0A 2IH1B 4DEPC 4CVZB 2CSPA 3PGFH 2FWOB 3SPVA 5ISZB 1FYHB 2BVOA 3IFLL 1EVUA 5F97E 3L5JA 4PRPB 1ZVSB 4YR6B 2NX5D 5EO9B 1I1FA 5FYKD 1BVZA 1NEZB 3NABL 1XF2A 1CT8A 3MTRA 5D1XB 1Q9WB 4YPJA 3FT2B 5DRZB 5E9DB 3NBNA 1CF8H 1BD2D 1JP5A 3QZWB 2EDWA 3S3SA 3LEYH 1FGNH 2ESVA 4U1GC 1A7OL 4XP4L 2HWZL 4ERSL 1JWMA 3MRBB 1BD2A 1RZIB 3RWEB 3I3BA 5DSCA 3QHZH 4JPIA 1KJMA 4M1DH 3O9WC 1EX0A 3OF6A 4K71C 5C07A 2ICEA 4JDVB 2NZIA 3VG9C 3V6OE 1CE1L 3TESA 1I7RB 5DJ6A 4IMKC 4NKMB 5HDQL 1T1XA 3K1DA 3L1OH 2ZCLL 2R4RH 4HUWA 1KG0B 5KBNC 3CLFH 3FO9B 3G9VA 4GKNB 4NO3B 5TGBA 1SJEA 3KPSB 1MEXH 4EI5C 2IJ0C 4L8CA 3PHQB 1SHMA 4MQ7B 5DHXB 3OL2A 2A6IA 5J3HC 4KK8C 5CGYD 4W6XB 1A9BA 4LLQB 3RDTD 1LP9A 5FA3B 2ZUVA 4XBPA 5DHYB 3VG9B 5GHWH 3NTCH 3QIBD 5LGJB 4WV1B 4WWKD 2YD8A 2AEWA 3RWIA 2BDNH 5DQDH 2COQA 3SGEI 1Q9WA 3LB6C 3UBXI 4G9FA 4FQLH 5HY9B 2PYEA 4JFED 1V8HA 3E6FA 5DJYA 5DJXB 2ERJC 5CFHA 1FNGA 2PCPB 5E2JA 4XCCL 3SE4C 1QSEA 3SDCC 2DJ4A 3INUH 5B38A 2APVA 2HH0H 3EJYC 1U95B 4MA8H 4NFCA 5GISL 4K7FB 4U3HA 1CK0H 5L8LB 2J8UA 1ZS8A 1WJ3A 4U1MA 3O2WL 2JB5L 1UEYA 3BQUC 1Z2KA 4OCYH 4G6JL 1MCPH 2JLLA 3WN5B 4PG2C 5KVDL 4FTVB 2HVJA 1OGAD 2DLEA 2BMKB 3HZVB 3AY4A 3FT4B 3GI8L 4FS0A 3VRIB 4O2CA 1IKNA 4YHPA 3DX6B 1DLHB 3P77A 1E28A 4L5FH 4X7TA 3BRDA 2QHRL 1WFOA 2F54B 2Z8RA 4UINH 3S5LA 2X1XR 1DSFL 2UWEF 5E5MB 3WS6C 2LE9A 3MUGA 4H0IA 4OFIA 5GRWA 2AI0H 3BO8A 3FO1B 4OD1H 3V6ZA 3IFPA 1WIUA 3R06A 3U9UB 5SWSA 1S78C 1JNNH 1LK2A 4OZHB 3U82B 4I5BB 3WFCH 3PWPE 2BNRD 2E6PA 4OLVL 4MHHG 1BZ7A 5CAYB 3RVXD 3KWWA 3U2SA 1SJHB 3Q48A 4Z7VB 5AG9A 1CK0L 4LPCA 3G5YA 5MERB 2ARJQ 5E8DH 3X3FH 2X9YA 3C5ZC 5E6ZA 4LPXA 5CEYB 2V5MA 3HRPA 1FO0B 3P30L 4JQXC 2APXA 32C2A 1F42A 4JFPA 3VXRD 1JGUL 2ATPA 1HE7A 5C9JB 3L5XL 4H20L 4DCQA 3KAAA 1F3JB 1ITBB 3HMXA 2YA1A 5HYJE 4I0CC 1QO3A 1V05A 3N1GC 5GZND 4LGPB 1KB5H 4MXQD 1N3NB 1L7TH 2P1YA 5CEZL 4TPRL 2Z4QB 5HPMB 3WFBL 4CMMA 1RZIA 3RWEA 3QI9D 3DV4B 2HT4C 1CXLA 3M1BB 4NN5C 4ONOA 1I7UA 1N6VA 3NPSB 5L9DL 4NO0D 4W4OC 3U7AA 4G9DB 2CK0H 1GPOH 3MA9H 5A3ID 2F74B 4JVPA 4KJYB 4QRRE 4XCYB 5EDXA 4ZAKD 5FUOL 5FYJU 5BZDB 3OAUH 4L3CB 5EUOB 2ZUQC 2OJEB 1KNOB 1CFQA 4XXDA 2V2WB 3QQ4A 1DUZB 4U6VL 4E41E 1URLA 4TRPH 5EUKA 5INCB 4QXGH 4D0BA 3L1OL 4NNXA 5E24E 5FYJE 5JA8B 5TGBB 4LP4A 1A2YB 5E8OA 4ZFFA 2R8SH 4HH8A 3OB8A 2C3HA 4JFYB 2ICWA 4X4ME 4CBPA 3BP7B 3ARRA 2J8HA 3MACH 2VDML 4WHTB 4R26L 4YXLH 1U3HA 3FKUS 4G8GE 4M3JA 3IFLH 5E70A 4JLRB 3QUYB 1NAMB 2Y36H 2NY2C 1YPZF 1P5UA 4KMTL 2QR0B 1A7QL 1LO0H 3X3FL 4NQEE 4G43A 5KG9B 2JJSA 1CD9B 4QHUB 3TVMD 3O6FB 3ZT6A 5C8JB 1A6WH 5JOPD 1Y6KR 1ONQA 4ZFZA 3OQ3B 3HI5L 5T1MB 5B38B 2ZSVA 4Y4KD 3L6FA 4X4YA 1EFXA 4GXUN 5HXMA 2W9EL 3IFOB 4XPFL 4M62H 1CXHA 3GSNH 3T0DA 1RZKH 2VLRA 1ZSDA 2P8LB 2ICCA 2XPGA 4Z7QF 5J6GB 1FH5L 3BVNB 4MMXC 4PJAE 3H9SD 3T0EA 2DRUA 3VD5A 4PBVC 2WIMA 4Z8FH 1JHLH 4GRLC 4G9DA 2KZWA 3MBEC 5TDNA 1CLYL 1ZLUH 4P3CH 4Y8DC 4M7LT 3FFCA 3B5TA 3TLRA 1H3XA 1CFQB 5FHAL 4MA3B 5EU3B 3TIDB 2FBOJ 5E9DA 1XGUA 2R39A 5DQJB 5H37G 2DIBA 1NCCL 4RZCB 2XWJA 1FORL 2EDHA 2DTML 3T65B 2A74A 3RGVC 3MLTB 4WW2F 5IW6A 3EFDL 5EZJA 2F58L 1KEML 4XPGL 2BRRH 5DF0A 2NR6C 2DDQL 3IFPB 5FECB 1F6LL 2P8MA 2WWKT 4NO5A 5J1AA 2DYPD 1EJOH 3LEVL 3QCVL 4QY8A 4DN3H 2X4OA 3GJFA 5C08D 4FNLH 1XF2B 1SJHA 4NP4L 4M8QB 1DN0A 4PREA 3AXLB 4UIKH 1GL4B 1NSNL 3O2DA 3GMPB 3OR7B 5DUMH 4Z7UE 1R3LB 1JMZA 1ZMYA 1IM9D 2OX5A 1MCWM 4JG1H 5FHAH 3GM0A 4BSVB 4KK8D 1P6AB 5EORL 4KKAC 4YHKH 4NUGL 1FFNB 1NL0H 1UXWA 4Z7UF 1DP0A 1E0OB 5A2LH 1ORSB 1ZKAA 3ES6B 4P3DB 5GGSA 5IVXF 4UBDC 5LVEA 1CCZA 4P5TB 2YBRA 3RRQA 4Z5RA 2AK4A 3CDGA 5FGRA 3H3PL 2EH8H 4L1HA 5FFLA 5IHBA 3H9HA 4KJWC 3S88H 1AGEB 2CLZA 3I75B 2XY2A 3MV11 2GI7A 1KT2A 4QGTA 5GGUB 3KYNA 4L3CA 3O4OB 1Q0XL 2DI7A 3V7AG 4NM8L 4DGIL 4ZUWB 3EIFA 4JFDE 1QACA 1S7VB 4F8QA 1NAKH 3Q5OA 4M1DL 4KUZH 1AFVL 3RNKA 4L4JA 3ZYJA 3FQXA 3PABA 2CD0A 4WTZA 1IFHH 1T1ZB 3E2HB 2CR6A 4GRWB 2IGFL 1X5GA 4KVCH 2IALB 1RVFL 4NRZA 3DRTA 5JXED 4PRBA 4RMVA 5LGJA 1FBIH 2Z35B 3V79C 2D7QA 2XN9E 5C0FA 1V7MH 1ZAGA 5F9JB 4M8QA 1PG7H 3U48A 3WN5A 4K3DL 4OZGB 3O6KH 1QBBA 3HC4H 2HVJB 4ZOBA 3EW3B 1A7PL 3UPAA 2LU7A 1KIQA 1GGYA 4G8FA 1J8KA 2VL4A 2EEDA 3D3VE 1FNSL 4PGZA 5B21A 3N85H 3KXFE 3MLYL 4OKDA 2VISB 2WINB 5I74B 4LPVA 1U36A 5ICZB 4IM8A 4APQD 3D85A 3TBYA 2YWZA 2AJ3B 2FX9L 3QDGE 4U1MB 2MPAH 4P99A 4L29B 3C5ZA 1MLBA 2NY5L 5C0CB 4L9LA 4X6CB 4EXKA 1A1NB 4S1SL 5B38G 1D3CA 3MLUL 1XGYH 3FZUD 1I9IH 4MNQD 1F2XK 1A5FH 4H0GA 5HYSA 4HKBA 4OLUL 4XVTL 2F5BL 1KC5L 2LTQC 3BGMB 5IVXE 1C7SA 3I84A 3HNSH 4RFEA 4QTHA 1G9ML 1YYML 2YPLA 4YC2C 3I3DA 4RZCA 4XNZC 1S5IL 3C6SB 4IOFC 3PWVB 3T65A 2H32B 1RUMH 3UYRL 3O3DB 3D0LA 4UZGA 5ID0A 3RTQD 2H2PC 4PLKD 3SBWC 1Q72L 4ZYKA 4YHNB 2DLHA 5D7KE 3MFFA 1J86A 1SY6A 2P8MB 1A6TA 1TJGH 1DBJL 2H2SD 2PXYC 3HMXH 4H8WL 4YXHL 3UZEA 2XYCA 4TSBL 5EPMA 5DVOA 4WI7A 4QRTB 3V4PH 3O9WA 4XPAH 1KB9J 5CZXD 4LEOA 2NCMA 2QQKL 3OJ2C 2XKUA 1ZEAH 3GIVB 4Q0XH 1P4IL 3G6DH 1OGAA 4DOHB 2QSCH 2HTLC 4MD4B 4MAUH 1NLDH 5BVJA 1A9BB 4KKNA 2IQ9L 2XFXA 4GAGH 4OD3H 1JPFB 2P5EA 3DX8A 5IQ7L 1ZOXA 1Q0YH 1KBGH 3ZKNC 1J5OL 1A4KB 3CFEB 3ZKND 2CLVB 3ARTA 3RA7H 1HYSC 5L2JB 3NZHL 1NGPH 1QFWH 1MWAL 2VDNH 1JHTB 3RNQB 1LEKB 2XKNB 4RFNB 5E8EB 2ITCB 1ETZA 1FZJB 5DLML 1Q9KA 5C0JA 3MLVH 1MRFH 3EOTH 4P59L 4M00A 1UA6L 2OP4H 1MCEA 5CP3H 1PVHA 3S96A 4J3VA 4NQED 3LKSA 2A77H 2JE8A 2W0KA 4D94A 2CJUH 5CSZA 2VXUH 4U2ZA 4GAJH 5LQBL 5GGTA 1EPFA 4WUUA 4M6MH 2FGWL 1BBJB 1UWEH 3NVQA 4HZLB 5I1JL 4DAGH 3FT4A 3HZVA 5C07D 4BK4A 3IDGB 4LLDB 5EOQH 4QRPD 4KI5D 2CUMA 1WWAX 2OLDA 1NEUA 3L3KA 4OD2B 1X5HA 3WJLA 3DETC 1I9EA 1X3DA 5DURD 3C2AL 1NMBL 4PJCE 3HAEH 5IFAL 5E99L 4W4OA 3SJVD 2X7LB 4TULH 2EXWD 1SMAA 2Z91B 2HFGH 3WJJC 4HJ0C 1UH4A 3WKNA 2FCBA 2EE9A 3IU3B 5GGRB 3OX8A 3TP4A 5SX5H 4YDIL 4KI5F 5C0BE 1N5AB 5SX5K 3RJDA 4WO4A 2IQ9H 3GMLA 2PKDA 4YNYB 1A6UL 1FO0A 5D2NE 5DDHB 4MZ2A 1PX4A 3KPPB 5EBWB 1FCGA 1QYGH 2C3XA 5I76A 3P73B 3GMNB 3CSYA 4NZJA 4ODVH 4LLWB 5GS1C 2AEPL 4Z7NE 2XICA 3LEXB 2W0LA 5C1MB 4JO2H 3OV6A 2UYLB 1ES0A 1UM6L 2GJZA 1CU4H 1R3HA 3HB3D 4HX1A 2BRQA 4KKAD 3QA3A 5D2LB 5IIEA 3TT1L 4OIIH 2P5EE 1BJ1J 1MRDH 3EYSH 2YN3A 1VA9A 3HI1A 2FX7L 4R4BA 2FNBA 2VDOL 5FOBA 3VFUA 5E2VH 1QA9B 3MRJA 2X4OB 5INDA 5KSUA 3N1MC 3RAJL 3QEHB 3DSFH 1A4JA 5IR1B 1ZGLA 2HN7A 2VDRL 3MFFB 4S11A 5K9QI 3ET9F 1YEDB 1KNOA 4UMGA 3CD4A 3QHFL 3GMPA 3OR7A 4B50A 3OKKA 1M1SA 3CLEH 3QZWG 3WIIH 4F37K 4YHML 2D7NA 4RAUA 4EI6A 5GRZA 3WS3B 1QHOA 3ARDB 1QR1A 5D8JL 5IMKA 1KTDB 1PSKH 3LKNB 4PJHA 3OG6B 4MDJA 1ZVYA 5T3XL 4GG8B 1R3KA 4JM2F 4TVPH 3ZSTA 3WFBH 4D3CL 2FRGP 4GG6F 2DQJH 4S0SD 5ESVB 3OKYA 3W5MA 2H26B 4K3GA 5FM4A 4UQ3A 4WI6A 2OI9B 3OXRA 2BNRA 2AK4B 3CDGB 1MNUL 3ILPA 5EO1A 2VH5H 3QUYA 1FZKA 2ZCKH 3P73A 5ISZD 1FNHA 5D1XA 4RISH 5F9JA 4R9HA 2AQ3A 4X5XB 4PRPD 3I02A 1A6PA 2Z31A 1T3FB 5C0GA 3MO1A 5D6DA 1RZJH 4FFZH 4QRPE 4X98A 3MFGB 2EC9U 4YH6A 7CGTA 5D1XD 4X7FC 3P2TA 5BVPH 5I1KH 3TO4D 1EFXB 1NSNH 2Y5TA 3ECBB 1BD2B 3GSXA 1K3ZA 3HR6A 5LGKA 1PZUB 1P2CA 2CDEA 1QSED 2F5AH 2IQAB 3O3EB 3OJDA 1UA6H 2NY2D 1A9EA 3I6KB 2GFBA 4Y4FC 3P30H 4N5EC 2OI9C 4ODXB 1GXEA 3DIFB 4NGHH 5HHXL 3ZTJH 1BQUA 5LXGL 1P7QA 4FQ2L 3MRCA 3MRPA 5DD3H 1S9XB 2MMXA 3VXQB 4KZEL 3EOBB 2E8ZA 1MF2H 4LU5L 1KPUA 4K07A 5JW5B 4M5YH 2FLRT 3TC9A 4Z18A 2DAVA 5H2BB 1D5IH 4X5LA 1FNEB 2R69L 1RK1A 3D2UA 3QFDA 4HJJL 4AH2B 2CRIA 1KN4H 3UTQB 2H32A 4Z7WA 3F8UB 3WL9B 2AP2A 1VGEH 3GBLA 3BWUC 1AJ7L 1PLGL 3MJGX 2CDFB 4PB0L 1K4CA 4KJPC 2YMXL 3RDTB 2FDBP 4MJ5B 5TE7L 1TJHL 2NLJA 4XVJL 1FLRL 2F9BT 3WFEL 1XCQA 1B4JL 1ODAA 3ZTNL 4HK0A 3GJFH 3B9VA 5GISH 4WWKB 3GSRA 1IGCH 1EUUA 2VITB 3UTPE 2FEEL 1OGTA 3C60D 1HILB 4HV8B 1L0XA 5DMGD 5J12B 1IZJA 3ECBA 4U6XB 1R3HB 5F6HJ 3UJIL 2KQNA 1EHLL 3WXVH 1JHKL 1S8DB 1VCAA 2XZCH 1OM3L 1IAOB 5LJYH 5EU5B 4KTYA 4M5ZL 3MSPA 3TBSB 1HYSD 4MA1B 3BPLB 4UOJA 3JV6A 3CUPA 3LS4L 1OAXH 4Z7QE 3WEXA 3CH1B 2EDYA 4NFBA 1NJ9B 4XHJC 2BY3A 3RDTC 3LV3B 3KYNB 3O3BB 3SKNB 1B0RA 1KACB 3L5HA 1INQA 2JKXA 4M1CC 3U9PH 5CJOL 6CGTA 2NY5C 1WITA 1OGAB 3QNXA 1C8PA 3PHOA 5IB3A 1G7JA 4YGAB 1MCWW 4UV4L 2Y25A 2IBBA 2O5ZH 3K80A 1G9NC 1MI5A 2X4SB 4YDLB 3E6HA 2NX5A 5FO9A 5HYEA 2OL3H 1QZ1A 5HGBB 1I1AC 4ORGA 4PG9A 2R1WA 4LLYB 2BNRB 5HHVL 4D2NA 4U0QB 5E8EA 2NY4C 1CLOH 1NBYA 4S1QH 3SOBH 3GSQA 2NY4D 2P42B 5HYJD 1Q9LB 1U3HD 5EWIL 3I6GB 3RL2B 2HJKB 2KPNA 3HTLX 3J8F7 12E8L 4YIQB 3ZSSA 3MX0A 3BI9X 1NC2A 4HBQA 4Z7WE 4JRXA 4P2RB 2VDLH 1UCTA 1IAOA 4WU7A 4ALAL 2PW1A 3BUYA 4YHOH 2P47B 3O81A 2NW2A 2XACC 1T0MB 5E6IA 4M4RA 1JNLH 4YNYA 1DVFC 3GMMA 1BMGA 1M71B 3HE7D 2P5ED 3FB6A 5DJCA 4HIJA 3QUMH 5D1ZC 4M48L 4JQVC 3PDOB 3TM6A 2XZQL 4LDEB 5AAMA 1T5XB 2Z91A 3SY0B 3WD5H 4NZTH 2XQBH 4KRNA 2E6JA 1BQHB 3S4SB 2GJZB 4NO2A 3IJSB 5FO8A 3TYGL 1I75A 3CFIC 1I1YB 1L7IH 3QEQB 3HI1B 4Z78A 5ESQA 4YPGA 2MCG1 1RK1B 1N0XL 4YDJB 5IEKB 1NLBH 1UACH 1J1OL 5GS0C 3EZJB 3C5JB 5EU6B 1RPQA 1F13A 1VFOA 1INDL 1Q94A 4PG2A 4PJGB 3VXNB 3AS2A 2X4UA 1YEJH 2VLJA 2C5DC 4JFEA 2LAAA 5EC2B 1JN6A 3NA9H 3P9LA 4M7JH 4XI5D 4C57C 2HT4D 1MJUL 1JWUB 2NXYD 4QHUA 4FP8L 4YFLI 4R4FL 5D1ZB 3B2UD 4XCCH 3QPQD 1PW3A 1LDPH 3MR9A 4NQDD 3GSRB 3VFTA 4MNGB 3VXMB 3MOQA 4ISVB 4Z6AT 5IB1B 5L6YH 4OV5B 1T2QH 4JFFD 2G5BA 4CUCA 5JUEL 4K2UL 4LCYA 2AQ1A 4NCDA 3TVMB 3VWJB 3GMRB 4A6YH 1X5ZA 1ZLVK 3T77A 4OCWH 3K8MA 3W0WB 4LMQI 3Q2CA 4FQCL 3AVEA 4K94L 5EOCH 4KRPC 5CCKL 1LEKA 1KF9B 5F1SA 2R23B 3WFDL 3MJ8B 1B90A 4EBQL 1RUPH 3THMH 4WWID 4JGJA 2ZJSL 3PV7A 4PGBA 4LCUB 4KY1L 1UKSA 1YYLL 5FYLH 1U8QA 3DUUB 5LKNA 1ZHNB 4PR5A 4PRIA 2W9EH 1VSCA 4KKCD 2CGRH 2ZCLH 3RZWA 4WUUB 4ORZC 5DFWH 2FGZA 5KSAA 4QT5B 1G7MB 2VN7A 4P9MH 4OLYL 3QFJB 4Z0BL 1F3RB 1FZKB 4OT1H 4U31A 3EO0A 3VXPA 4AM0A 4IDJL 2H45A 1MLCA 4LSQH 4MJIB 5HVHC 5D7IB 1HQRB 1ZANL 3OF6D 4X6EA 3ULVE 1QLFA 4IIQA 5C08B 1A14L 1RMFL 1G7LB 3GZKA 4M02A 1G0DA 2VLLB 5D1ZA 3TJEH 4FMKA 1YJDH 1MAKA 3RUGA 3STZB 5MEOA 4M4PA 5MP6H 2JCCF 3RL2A 5DRNA 4Q9QH 3B9KA 2NXZD 1SEQH 1OARH 1NGZA 4MAYD 1IQWH 4HIXL 3TNMB 5LAXB 3MMEB 3VFGL 4WEMB 1AD0B 2OTWA 4MYWB 3A67L 4PUBH 5FCUL 4UIKL 1A6AB 3OAYH 3CSYB 3OAUL 4NHCH 3UC0L 1T83C 1S9XA 2CK0L 2NMSA 1AGEA 5LWYH 2R56H 4U1IB 1JPTH 4HW6A 3MRQA 2DI8A 3SJVA 3BEWA 2HFTA 3C60C 4PS4H 1CDJA 1F3DH 4BFBD 1IKNC 1RUPL 4S0TD 1E6OH 2ILLA 1W0WA 1CFVH 1PJ9A 4MXWH 3V5HA 2OR9H 3NIDE 1VGKA 1UWEL 1WBZA 3K0WA 1QA9A 3C87A 3GRWH 3MRJB 4HULB 4JZNB 3QHZL 3F6LA 4IOIA 4KHXH 5C6TH 3QEHA 2D0GA 1CFSA 3DRTB 4K55A 5IR1A 1ZGLB 2R2CA 4JFOB 4KTEL 4LNRB 4YPGB 3WV0A 4P46D 1YMMA 1OD7A 2M8XA 5LCVL 1KPRB 1MRFL 3EOTL 3MLVL 2O5XL 4I77L 5MEPB 4NT6B 5FK9A 1KTDA 5K9JH 2M1KA 4AEFA 3MJ7A 1INQB 2W1NA 3PG2A 3PWLA 5JA9A 4QOKB 1AGBA 5AD0A 1RZGA 4EVNA 4PV9B 4M9PA 3K3QA 1JGLL 1QPXA 3GSWB 4GOSA 3HI5H 1F4AA 2GK0B 3X14A 1G7IB 3MBEB 3QRGL 2LU4A 1DLFH 3CZFB 4Z76A 4HLZH 3UTSA 2OSLB 1CL7L 1MCFA 1WGOA 1C08B 1FL3A 5TE4L 3JVGA 3W0WA 5I1GL 1Z9SA 1KCKA 3KYOA 4APQB 3DECA 4NRXB 3G6JE 1NC4A 1EO5A 3FB8B 3UTSD 1QTYT 3HE6C 4HXAL 4FQLL 4HKBB 1AP2A 5MENB 5EZIL 5A1AA 4OLWH 2FJFB 1H8OA 3PP3K 1OGAE 3VFSB 3BKJH 1XCTB 2V9RA 3WMSA 1CLCA 3K7UA 5ALBL 5IB3B 4XC1L 2IMNA 4GW5A 2B0SL 3V5HB 2CXGA 4JFDD 1VGKB 1IT9H 3PWVA 3VMPA 4YLQT 5BS0E 1CE6A 4PJEA 5HYQB 2ICWJ 3B8YA 4IOIB 2EE6A 1W8NA 4HC1H 4R97C 3L95A 2NX5B 3BDXA 3BMVA 5I1DA 2VXSL 4JFOA 4LNRA 1IAII 3VXRA 3O2VL 4PG9B 5F7KC 1AIFB 3PP4H 5FGBA 3ULUL 5F1IA 1G7HA 4KHXL 5IB4B 2RB8A 3ZL4L 3VXQA 4APQC 5AWNH 1KC5H 4K3EL 1NCDL 1KELH 1KGCE 3SKMB 2BCKB 3U30B 3ZDYF 5I8OH 3BP6A 2F54E 1U8PA 2DMKA 5JW5A 4PB9L 2N56A 4OKVB 3QXDB 3FT2A 5DRZA 4KKLC 1SEBB 1RUQL 3HPJB 2VAAA 1AY1L 2ZPKL 1EVTC 3KPNB 3BH8A 4Y8AA 1MSPA 3RUGB 5F6HI 4HS6B 4X4XA 1MEXL 3UTPD 3JV0A 1CI5A 3WNKA 2J12B 1CICA 4DTGL 3UMTA 4CW1B 4G6KH 3T3MF 1HN1A 2H41A 1FPTH 2IBZY 3HA0A 1QNZH 4YWGH 4MVBC 1NGYA 1Z5LB 3EYFA 3L3JA 2Q1EA 2XTJC 4L8SA 2X1PA 4OQ1A 1NMAL 4LIQE 4P9HH 5HDQH 4WO4D 3OB0H 1GGBL 4HWUA 4KRLB 1ZV5A 1FZJA 3T3ME 1BJ1H 3KPSD 4P23A 3FQTA 5E00B 5I1IH 3U7WH 4O02H 3PIQB 3QG6B 1WBXA 1BWWA 4XC3L 4ZO8A 5EIIA 4OCMC 3QDJD 1UG9A 1JF6A 1TZGH 4UTBH 2DD8H 5GRJL 3QAZB 1S8DA 3OG4B 4K23H 1CDUA 1OAQL 1NDMB 1EGJL 1NH6A 3MRDA 4L8CB 3QNZB 1BBJA 4UINL 4ZUUB 1GJIA 1AC6A 3ULUC 5DD1H 3EYOA 3WEXB 4AT6B 4LLQA 2AAVA 4W6YB 1NC2D 3K81A 4M9OA 5DD5L 4JFEB 3N1FC 4LPUA 3TJHC 3KPSE 2GUOB 3ZHDA 2IFFL 2W0FB 5EUOE 4J2XA 3GEWB 3RY6C 5GSVA 4DGYH 3C60A 1K9TA 2HFGL 4QRPB 1JIBA 3VFTB 5DD6A 4ISVA 5IB1A 3BH8B 1F4HA 4HAGA 5D5MB 5IMLA 2B8OT 1YDPA 1D5XB 3Q1SL 1N64H 5BOPA 1HKLL 1AJ7H 1XF3B 3TPUB 5CMAA 4LFHD 3TFKD 4KTDL 4NCC2 1SJVA 3Q6GL 4EQ2A 4NO0A 2EDDA 3RPIA 4KDVA 3RWDB 3NIDF 3B9EA 5HHOA 3X11B 3B8SA 3VXPB 4V1DE 5E99H 2F54D 3VFMA 1XGQA 4R7DB 3ROOA 2ADIB 4P4KB 5E8NA 4A6YB 3AAZA 2BMKA 5DO2C 1LGVA 4NHUB 4Z7OE 1G1CA 4KV5F 3DARA 3PJSA 3DUUA 3H3KA 3QZWA 3T0VA 3A6OA 2IMMA 1E4XI 1XGTA 1EHXA 4LSSL 3MRKA 5E4EC 1G7MA 3D69B 2IADB 5BOZG 4AQ1B 3LMJL 1UWXH 1L0YA 4YGVA 3AM8C 5IT2H 2RGSA 3F12A 4XMPH 1KJMB 3LKRB 5HGHA 5F9WB 4DKFL 3L95B 5C6PB 3KWWB 4PJEE 2WUCH 3MRGA 2B5IC 4ZDHB 4JB9L 4LBEB 3O8XB 2WQ8A 4PY7B 3VXRB 2GTWA 1MWAB 1KB5A 4O5LH 3TZVC 1S7XA 3B5GA 4X6DE 3SKMA 2QSCL 5CEXB 4HWEL 4IJ3B 4ZNCD 4QXTA 5DMIH 3H7BA 1CDBA 1V3KA 5EO0A 4ACPA 3QI9B