2J43A

Alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
b'ASHHLRMHFKTLPAGESLGSLGLWVWGDVDQPSKDWPNGAITMTKAKKDDYGYYLDVPLAAKHRQQVSYLINNKAGENLSKDQHISLLTPKMNEVWIDENYHAHAYRPLKEGYLRINYHNQSGHYDNLAVWTFKDVKTPTTDWPNGLDLSHKGHYGAYVDVPLKEGANEIGFLILDKSKTGDAIKVQPKDYLFKELDNHTQVFVKDTDPKVYNNPYYID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPYDX
publication title Identification and Structural Basis of Binding to Host Lung Glycogen by Streptococcal Virulence Factors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Carbohydrate-binding module
total genus 38
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A02
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A01
3AWGA 5BZZA 3V0GA 2YA1A 2FHBA 2J72A 3V0JA 2FHCA 3V0EA 2J43A 5BZXA 3N0AA 3V0FA 2J73A 2FHFA 1D5RA 2J44A 3V0HA 3V0DA 3AWEA 2J71A 2YOCA 3AWFA 3V0IA 5BUGA
chains in the Genus database with same CATH superfamily
4YLCA 1J1XH 4L48A 3NABH 5CP7B 5BV7C 2BZDA 5DFAA 1KXTA 5KVFE 2VIRA 3GMPB 1BVKB 2IDSA 3B83A 1GOHA 2ICWI 3SQBA 2ZOLB 4J1UA 2QVMA 5D1ZB 5KSVA 3NG5A 4L3EB 4IRJC 5CEZD 1FNGB 1YQ2A 1MG3C 5GJTL 5IGXH 4IGBC 2B0SH 5I1KH 3EGDB 1O6TA 4MCZA 4R4FH 3MCKB 4HETA 4KVCL 4RZKA 2WGNB 3UP1A 4ZMYA 3RQ3A 4MRCA 4JN2A 5DYFA 4ENED 4WJ5A 1XR8A 3S4SB 1URLA 5KYUA 5HDOA 3NBNA 2VL5A 3RUGA 3RB5A 2H47C 4LLMB 5ISZD 4Z95L 3HZKA 3ZE0F 1KULA 3TA3A 3MLSL 2E74C 3EO9L 3W38A 1NIBA 1PEWA 2AZAA 2FJHA 1F11B 5DJAB 1AJ7L 1DL7L 5LQBH 5F1KC 1J0HA 1JGEB 4JANB 1QEXA 3SGJC 2BMKB 4L9LA 3ZKXC 3RIFF 5KWYC 2Y1YA 3DRTB 1D5XB 4G5ZH 3L9RA 3WENA 4X4MA 1F3JA 4FNTA 4KX7A 3T77B 3UO1L 3KJ4B 4IDJL 5E8PB 4TQEH 3QJUB 4GRWF 5EUOB 3IGLA 2J8UE 3LXBA 5DRNB 2CALA 1XBDA 3MOBL 2FK9A 1BQ5A 3IRZA 2I07A 3PY9A 4GY4A 3QORA 1UGNA 3T8XA 3DUSB 4NYLB 1SM3H 2Y07L 5A7EA 1M7IB 1B3IA 4PGZA 2CHWA 3PL6D 1UATA 5IGXL 1FZKB 1WD8A 2B0SL 4NO2A 3VQLA 1UWYA 4BV1A 4C57C 4QYOB 3AAZA 3ARVA 4GLRI 3APDA 3DV6B 3QQXA 1G6RB 5F1SA 2NY0B 5J11C 1LK3H 5D2NB 2ZIDA 1A7NH 4TUOA 1EHXA 4UQAA 2OBGA 1K3ZA 4P4KB 2WLJA 1BDYA 3A3YB 4UM9D 5CCKH 4NZ8A 4Y1AA 4ZX3A 4IBSA 1K8DA 1J5OH 2YSTA 1OTSD 1W72L 4Q0XH 1JK8B 2VM4A 2I9TA 5CGTA 5LQBL 4N0RA 2IO5A 5EU3B 4XTRD 1I3RB 4Y16D 1AFVL 2VN5A 1SEQH 1EHKB 4QOKB 3J27A 4NI3A 2C3VA 4NBZB 4G5ZL 3BEWA 4UIMA 4P2QB 2QKIC 2DQFB 4WK0B 1U93A 1KTLB 1OP3K 4WGVB 4POZC 1YECH 4OAWA 1FN4B 2OZ4H 4TQEL 4FULA 4M3JA 1X9UA 4N1CA 3VA2C 4M5YH 5C09B 3AABA 4E9YA 3IRCA 3BT0A 2DQJL 4P4RB 4QRFA 3Q0HA 4ENZA 3K6SA 5AW1B 4DPBX 1YEJH 4MMZA 3G5YA 3GK8H 5CIPH 1SM3L 4UQ3A 3MRPA 1XD1A 4RRPM 3HRZB 1TPXB 3RGVB 4JQIL 1H8LA 5BVJB 3KHQA 5IMLB 4NO0B 4JPIA 3MJWA 4ETYA 2J55A 4GXFA 1HZHH 3MRRA 3U82B 2Z8VC 1WAAA 2YD2A 3GRWL 3W57A 1T04A 4KKLD 4LLAA 4S2SA 2AJZB 3JT0A 1LK3L 1A7NL 3FB6A 2CR0A 5E2UL 4GG6E 1A3RH 5CCKL 3AWGA 1J5OL 1FL3A 3SN6N 3IMVA 3C6LB 3VXRE 1ZEAL 4V1DA 5AQ0A 5AW9B 5A3ID 1G5AA 3R7RA 4P5TD 4MBRA 3US0A 2LLLA 4MXQD 2EDKA 1MQKH 1MW1A 1SEQL 1RUQH 4PLJD 3LQMA 5ICZA 4G83A 1CFQA 2Y9RT 5CSBA 3TM6A 2WSDA 4JLRB 4YBLB 2AV7A 2XPGB 3WSQL 3OWEA 4N8CL 1GY1A 4LLVB 3T1FB 1IGIL 1MCBA 1NDGB 4IJ3C 1O6SB 1ZE3H 1XHHA 1YN7B 3K2IA 4TKWA 4YSOA 3UFIA 4ETQA 5J3HD 3Q05A 1RPUA 1YECL 4M5SA 4TPRH 2OZ4L 1ZDQA 4F2EA 4OLVH 1QNZH 2W95A 2V2WA 5DHYB 3FTSA 3QDJD 4Z3GA 1JV5B 1NFDF 3MA9H 3KPOA 3IJYA 1C08B 3MRHB 4KFZC 3HG3A 2F53B 5C0FA 1AANA 4DVRH 1KB3A 3X1FA 4I4WB 3UTOA 3AT8A 4DT2A 4HJEA 3GK8L 2XN9B 3BQUA 3H2QA 3D85B 3SDDC 2CO3A 2BIOA 1MCLA 3GF8A 1VGEL 1HOCB 2AV1A 3HZVB 3BWSA 4NN6B 1HAUA 3I6KA 4LCIH 4F37F 3Q1EA 1LEIA 1HZHL 1YC7A 5DMGC 4BRVA 4I1PA 2COVD 2ROXA 2A1WH 4U0RB 2WXPA 4YQXH 2DEYX 2D31A 2YRZA 1T0PB 1RHHB 3DK2A 5F7YC 2J57A 3IKKA 1JGDA 4F24A 1V3JA 1ZHBA 4JDZA 4BGLA 4FQIL 2GC7C 1UFGA 3WN5B 2Y7QA 5LBSA 4PWIA 4TXVB 1GSMA 2VH5H 2V2XA 4JUSA 4RIRA 4QYAA 2KS0A 5DK0A 3S36X 3LNEA 3PGDA 3ZT6A 1XZ0A 3CQFA 1YN6A 1LO5A 3AG3B 4UAOC 3GXTA 4HUKB 2DZEA 2ZCLL 3RUGE 3T6QC 4PJEE 3BVTA 4PSPA 4RMUA 5KS9A 1NGZA 4N2IA 4ZOAA 4FQPA 4L4VB 4LAJH 5H35B 3WGUB 4G7VH 3MA9L 2UZYB 1TZGL 1ZGLA 1U95A 2NT1A 4Q6YA 1IQWH 4ONGH 2H2SD 2IWEA 2OX5A 2YFNA 1ZLVK 1E2WA 3TEZA 4ISVB 2BS9A 2ENYA 4U6XB 5IVXA 3IMBA 2AJUH 2O61A 1BPVA 3QFJB 2WLHA 2YS4A 1AO7B 3HI5H 4IDLA 1A2YB 1EH9A 1MY5A 2ZG2A 2X3CA 4MMYA 4X4ME 5E1GA 3O3DA 2R69H 3HE6D 2CBPA 3U7YH 1T0NB 2XTLA 3V6OC 4YQXL 2QGEA 1BXXA 2XTJE 4NOFA 4F3FB 3ARGC 4M7LH 2W8CA 4N0UB 4B53A 1T21A 5IK3A 2F7QA 3KPSD 2DH2A 3TYFB 3VXSE 5CBEB 5IWLC 4BDVB 3GUTB 1DQML 5ECJE 3O4LD 3SGKC 4M7LT 2JJTC 2VH5L 5C2BH 4YNYB 3NJIA 3JZYA 1A6ZA 1CLZL 2DJ4A 3UJIH 5DURD 2ESVD 3BC9A 1MHEB 2BOCA 4GBXA 4RFEA 3MLYL 3Q3GA 4H13C 3MJ7A 3D4ZA 5GRWA 3ULSA 2VDKL 4XCNB 2AQQA 3QRGL 2ISDA 2HT4C 1N6QH 5I16A 2ZCHH 3BUBA 2X88A 3EOAB 3MV7B 4LAQH 4G7VL 3QE5A 5C0CD 4Z5RB 1KB5A 4EIZC 2FEJA 3ARUA 4ONGL 3IDIA 1X9QA 3WO4C 4GAAA 2QPUA 2ZUUA 3GINA 5DD3H 4DP4X 5KANG 1SXNA 3S9DB 1IZKA 1U8HB 2XQBH 3BCDA 5FUOL 3K2UL 4KJWD 1PLGH 3V0FA 3F6IA 1JUFA 1CC3A 2F8OA 1RULH 3FDWA 1MFNA 2KL6A 3U7YL 4QGTA 1OTUD 5DJXA 1ZA3A 1DSWA 2P8PB 4XHQA 2XVKA 4OLZL 3U4BL 3Q9PA 3SPVB 2CJ3A 3RDTB 4O2CA 3EJZD 4X8JB 2K1MA 1KV7A 3V4VH 3GGWA 1W16A 1DBBH 1I7UA 2PP7A 2SEBB 2X4NB 3TJEH 2EACA 4ELKA 4EOWL 4JK0D 4BFIB 3FO1B 5C2BL 2Y2YA 5LJYH 4H8UA 4GSDH 1C12A 5HI4D 5C0ND 4IIZA 5JXEC 2WLLA 4OFKA 1BFVH 3UJIL 2VJXA 4OZ4B 4PJ8A 4JPWH 2Z7ZA 1VZHA 4JM2F 5ENWB 1MDTA 2HRPL 1MHHA 4ZS6D 2NZIA 2EVJA 1PYWB 4MB5A 1Q9OA 3U4AA 2DF3A 2ZCHL 3BHBA 3TVMC 3QEGL 4AYEC 5JNYA 4V1DE 1NAML 4I5BA 1E5ZA 2AQPA 5AG8A 4LAQL 3GWJA 2IQ9H 4XT1C 3HPLA 2B08A 2IAAC 3EOYG 4OZGB 4R8WH 4X5QA 4OFIA 4CUCA 1WC7A 3TGXA 5E5LA 1TEYA 1MAMH 1PLGL 3BP6A 5CEXA 4ANVA 4E41A 1RULL 3D39B 1E3ZA 3KS0H 2TRHA 4Q74A 4WW2C 3P4NB 1WTLA 3D18A 5E8EA 4GS7B 3RBSA 1JGLH 2NLJA 3FNKA 1MRCH 4MDIB 3MRFB 4IIQB 3NCBB 4KTGA 4ZPTA 2PTTB 2H0JA 1FVCA 4GIOA 1FNLA 5E99L 2A0LC 3VD5A 1IFHL 5D93C 2GUYA 5GRXG 3MUGB 1DBBL 3CX5J 1TDQA 4PRIE 3ZDXB 3TJEL 5HYQA 2CHZA 4G8GD 4ZMZA 2PTUA 3D48R 2UXGA 1RIUL 4GP5B 4HBCH 5LN8A 4GSDL 4QGYA 5TDPB 3HVDA 1I4FB 3S6CA 3WDHA 3CPLB 4CNIB 2H45A 3ECBB 4R4BA 3VG9C 3HB3B 3UZEC 5GGSY 3ILQC 2X1QA 4CMHC 4XI5C 4CSTA 1I8MA 2PR9A 4BGDA 2NY2D 1MHCA 1GZPB 4KI5E 4WNSA 2WLIA 2EVIA 4MJIA 4KDTA 1J1OH 5DJ0A 1AKPA 5C6PB 3DVIA 3QPQC 5D72H 2WXNA 3LXUX 1ETA1 1LNUB 3O4OB 3F5WB 2VDNL 2GTZB 3MRQB 4QJ4B 3PXHA 3V8CA 4AYBA 3N44B 4LDCA 1PD1A 1DJGA 3EJSA 3QUMA 4G6AD 4OD2B 1M6OB 3WMQA 3VU2A 3UEZA 1JWSA 5B38A 4L0YA 1GRWA 1WCQA 3F85A 2MFNA 1A4JB 1W72B 2ATKA 2E27H 3OJDB 5CMAB 5MERA 5AW3B 5IG7B 3G5ZB 3OKMA 5GIRA 2YQ2A 2M1KA 2GJZB 4RGOH 5TQ0H 1ZA6A 1ZLWH 1D5BA 5AAMC 5HP5A 5LG6A 3IGUA 5IVXE 5D4JA 3GUFA 2CDFA 1E5UI 4H8WH 4KJQD 4HBCL 3TFKC 4LFHD 3GDCA 4FJYA 4BK8A 2QPFA 3KLDA 5C0GA 1O7SA 3TJPA 3CSPA 4Z7VB 2AXGA 2P46B 2ZSVA 4I3RH 3DUUA 3TPUB 4QF1A 2GEQA 4GG8B 2YUWA 4N9OB 4NQUA 2NPLX 1A1OA 1G9MC 2XC8A 3AT9A 1IAOA 1AZCA 1KN4L 3TEUA 1BWMA 3VRIA 3EOBA 5FYJE 3IRPX 2Y7LA 3ZN6A 2ADJA 4KOBA 3SYCA 3WE6B 5C9JA 3MV8D 4X9GA 1OLLA 3H6JA 4S11A 2A9NH 4IBQA 1G7IB 4BE5A 3DK0A 5D7SL 5E6SB 4HVBA 1HS6A 2VZ3A 2A5UA 3B2MA 4L37A 4EN2A 2FX9H 2VW7A 4QO1A 5CJOH 3MLWH 4WHCA 2RQ8A 2XG5A 2PTVA 5AAPA 1THAA 2NCEA 4FQHB 3F04A 4TTDC 4JVUA 3MQIA 4N6RB 2BHUA 2CJUH 4P57A 5C08E 3DMMC 1DLFH 1QRNE 1X4ZA 4Z7QE 2G3ZA 3JTTB 3H85A 3SCMD 3QIWD 2DQGH 1B9KA 3QJZA 2Q87A 4CVZA 4GP8B 4H8WL 4YX2H 2P48B 2WXOA 1JVKA 4OIBA 2EDNA 4JQVC 3P77B 2LVEA 4D3CL 4U1HB 1DUZA 1IQDA 2W0PA 5EZLB 3F58H 1HT6A 4K5PA 3KEDA 4NIKB 2PCFA 5TGBB 2FH8A 2VZVA 5D8JL 5JHDE 4AYSA 4I3RL 4JHUA 2ZXAA 2CK0H 2CGRH 5CBAA 3QQDA 5FOBB 5T3ZL 4NUJB 4B9GA 1ET5A 3X1GA 2P3YA 2B16A 3SDXE 4QWWC 1U3HC 3TF7C 1D5MB 4YLBA 4M9OA 3ABZA 4JFHE 2A9NL 1X5LA 2DV6A 3M1OA 5ESQB 3BE1L 3O9WB 1DVFD 3BP4B 5A2AA 4EI6A 3O0RH 2HLAB 1AMXA 2FX9L 5DEZA 4QRPB 4X6DB 5AVSB 3MLWL 4UTAL 1M53A 4ECNA 3RVXD 4WVRA 3QZLA 3O6FD 2R1XB 4Z8FH 1QR1B 4L8SB 3MXWH 1X5IA 1CUOA 3ARBC 4PTUB 4R26H 3IXTB 3U0WL 1JZ2A 1YNLL 4PYHA 4UOZA 4KQ4H 3QVAA 2CUAA 1T03H 2BC4B 3H3BC 5F7BA 1UJ3B 4CU8A 4UT6H 3A6BL 3F00A 2FBRA 5ANMB 1MCOH 1QNIA 4Y5VB 5FLVA 1AQHA 1P7QA 5G5DA 1EFXD 2XG4A 3F01A 2DQEH 5DO2C 4JY4B 4YX2L 4BM7A 5IFJB 5IHBA 2BP5M 3LQAC 1MCSA 1QSEA 3QG6B 4XVTL 1BP3B 1BSIA 2DQDL 2X12A 3HS9A 3I6GA 3MGOB 5IQ9A 3NZUA 3H9SB 4FTVA 5DRWB 3F58L 4WU5A 1P6WA 2B20A 4ODHL 4JO3L 5DJYB 2F58L 3RWHA 4F9LC 4Y7OC 5KYWB 4MNQA 3N2JA 1TU2B 3ZZ1A 3KVPA 2WKOA 2DTML 2CK0L 2CGRL 4YDLB 1UXLA 2CLZB 3DXAB 3TZVB 35C8H 5J12C 5CCJA 1FNFA 2XFGB 1I1AD 5A6LA 3T8VA 4HKXB 4I9WD 4LLDA 3MRDB 2EIBA 3ARXA 3F6JA 4PP2A 3WLBB 3VI3A 4CW1A 5IR1B 3MKGA 2I5YH 4G3YL 4QI3A 1ZV5A 4QHUA 1R24B 2H26B 3MXWL 2MNJB 4JFYB 4PD4J 4R26L 1HQ4A 2G2RB 3OG6B 4GW4A 4U1IA 1R3HB 3KBPA 5JTWA 4UT6L 2R29A 1MCOL 4OF3A 1T20B 2ZKMX 4DAGL 5D1XD 4OLUL 2XYCA 2F68X 4M1DH 4IBVA 2DQEL 4J28A 1UQSB 4F33B 1UG9A 3VFTB 5ABDE 4J3OF 5CP7A 3AUVA 2D0FA 1JZHA 3HE7D 2V33A 2VDKB 4N4YB 1G84A 2VXSL 3GMPA 4UOQA 1YPZE 2I25N 2ZOLA 2O4EA 3VXOB 5KSAB 5D1ZA 2KQNA 1EJOL 4L3EA 1FNGA 2WAHA 3GHEL 3EGDA 5BMFH 3MCKA 1A14H 1T89A 5DZ9A 3BWUF 4QIRA 3V0WH 35C8L 2BSED 2AC0A 5JXAH 3HS0B 1J7VR 1DP0A 1S7UA 4N8PA 4YDKL 5EU6B 3PLYA 1NDTA 1E4XI 3MZTA 3GIVB 3QWQB 1AXSB 4UQ2B 3K5SA 4LLMA 4Z7WF 2L7UA 4XCEB 4PWJA 2FJGB 2IDUA 4ZTOH 1U30A 3FPYA 3FT0A 2J6EH 2HFEA 3G9VA 1D9KB 1F11A 5DJAA 4OLXH 1JGEA 4JANA 4JY6A 2V5TA 2BMKA 3HA0A 4LPVA 3SEPA 3IDMB 1A3QA 5CKAA 3PDOB 2X89D 4HSAC 2XDHA 3C75A 1ACYH 1UCTA 1D5XA 3S36H 3BJLA 3GLDA 2O26U 3GBEA 4K2UH 5TQ2L 2V37A 4HC1A 3OF6A 4JY5H 4AL8L 1NDMA 3T77A 5HI3D 5E8PA 1XTMA 1GGYA 4M1DL 5EUOA 5GGVL 1WJ3A 2MJWA 4I9XA 5DRNA 1UADC 3BH4A 3RVVD 1ORQB 4HU8A 2I60H 1V10A 1WFMA 3PDGA 3EDFA 2ZKYA 3M1BB 3VMPA 4NQED 1GCYA 4NYLA 3R7QA 1WAPA 1M7IA 1NAMB 3CDFA 5EC2B 5GGRB 1MVFA 1PZ3A 3AS1A 1T6VN 5E6UB 4FQXC 4QYOA 2ZKHH 3V0WL 3MNWB 3BGAA 5D4HA 5F7MC 1AGEB 3L95A 3DX7B 3NK4A 5L0QC 1G6RA 4LCCB 2FBJH 3CVIL 4HHAB 5CR8A 2A77L 3WFEH 4D0DB 4P4KA 1HYSC 2A83A 2J1YA 3E0GA 2FTAA 4XNQB 1JK8A 1YNKH 1Y7VA 5EU3A 3KGTA 1WTGT 2N1TE 5DF0A 1XMEB 2O5YH 2ZOOA 4HIXL 1UKQA 3N6YA 4QOKA 3A22A 1XDTT 4R7NB 1ACYL 3BAIA 5AB1A 3S36L 4KKBC 1UURA 3AQZA 4K2UL 4NN7B 1KTLA 12E8H 1U36A 2GT9B 3IMSA 2J1WA 4HWNA 1FN4A 4EDWH 2YXWA 2JKSA 2WLMA 2OI9C 3MRMB 4OI9A 1V7NH 5J8OA 1I8KA 2X2HA 4P4RA 4G7SB 1JXKA 4U2YA 1J0JA 3ZLQC 5EO0A 2D0GA 2DD8H 2BNQB 3HRZA 2BP0B 3QHFL 5D2LF 5IMLA 1A8ZA 1DSFL 3F62A 5C07D 3UXFA 1ZTXH 1CQYA 2O5ZH 2VDNB 4ZS7H 1LL1A 3FQTB 2GBTA 2AEPL 3IAQA 1BECA 4N6QA 1QSEE 3MNVA 4HUUB 4D9RD 4YHLH 5JIQA 1MCJA 3LMJH 3VE0A 1KDJA 2DL9A 4N0FA 5HJ3B 4MAYC 2BINA 3D4YA 2BSRB 1KT2B 3F12A 3P73B 3QUZC 3FHEA 5C0BB 3EDDA 5HI5C 3RTQD 4NQDD 4LCWD 3QEQD 4P04A 4EXKA 5ELIA 1DQDH 4AE1A 5SWSB 1A66A 2XPGA 3HUJB 4LLVA 3T1FA 4PAZA 1QBLH 1PLAA 1NDGA 1O6SA 2ZP8A 1YN7A 3T08A 4X50A 2K9UA 1KZYA 3JZ7A 4EDWL 3TBTA 1UWEH 3SDCA 3VI3E 2FO8A 1JV5A 2JKTM 2VSDA 5ITBH 1JI2A 1C08A 3MRHA 4MXVF 5IEKB 1S6NA 3LZOA 3SE4A 2VLLB 3MODH 3KGUA 3T2NH 2E76C 1CT8B 2ZUVA 4ZXBB 2H7WA 5C2UB 2GUOB 2XN9A 5BS0A 2FDBP 3D85A 5DYOA 1EAQA 3CMGA 1JTTA 3U4KA 1AE6H 4PFEA 3DGGA 1HOCA 1ZTXL 4YO0B 3FAWA 1H8OA 4PJCA 1IGMH 3EAKA 5GRYA 4N0YL 3BLPX 1R0AL 4QUOA 4ACTA 1J0ZA 1PGRB 2XQYA 5F3BB 3B9AA 3ULVC 1TETL 4KOCA 1RHHA 1NPJA 2E9JA 4MNHA 3T4YA 4LL9A 3CSYB 5F71A 1T1ZA 2EDEA 3WN5A 1E8YA 2BZCA 1HDMB 3MCYA 3PWLB 1F6AA 4NSKA 5EN2B 1E28B 3WKYA 3MX0B 1TMCB 3U2SB 4JFPB 3NPSB 3GPEA 2UY6B 4KK8C 4WU7B 5EOQH 2VR6A 1EZLA 2H6UA 1H5BC 1HVXA 2C1OA 1UWEL 6FABH 1JVOA 2BHFA 1OP5H 4L4VA 5ITBL 3L48A 2WV3A 5HVFB 4GQRA 3VM7A 5AW4B 3MODL 5LGKA 1UYWH 2CBTA 3T2NL 3UTPD 3W37A 1LO3L 1XCQB 4OD1H 2LFEA 2KKQA 1AO7A 3IMRA 3W0WA 1A2YA 1CL7H 1KTRL 6PAZA 1RQ5A 3KPPA 1T3FB 1UD6A 4MJHA 5F9WB 2CO1A 2WWNA 3MTRA 4Y5XC 1FFRA 1T0NA 2EICA 4OSUH 2EIZB 2XV6B 4F3FA 4N0UA 1HOEA 5ACZB 1PZBA 3VI4B 4H8QA 1XF2B 1NMBH 1XB8A 2ZXBA 5DMKB 3SKJH 1J10A 4NQVB 5CBEA 4IS6A 4BDVA 3GUTA 2R56H 3FB8B 5J89A 4YNYA 3G3LA 1FSKC 5GS1B 3HZ3A 3GSQB 3L9BA 2P5EE 5HDLA 3H3PL 4RZCA 3WLWD 5E2VH 2RALA 3B2VL 3EBGA 1LP9F 2A9MH 3ZL4H 4HLEA 5A6MA 4XCNA 2WYIA 2H32B 1RSYA 2ZYIA 5IB2A 1I3GH 3T0EC 4YR6B 3MV7A 3F83A 1IIKA 4KQ3H 1PG7W 2WUCL 4DERA 3OBAA 5HSFA 3REVB 3MXVH 2XKNB 1AKJA 1KGJA 3D7PA 3EJYC 4PTTA 4XR8C 4Z5RA 3LPPA 3CHSA 5CLYA 2VMDA 1UYWL 4JO5A 1G1KA 1SMDA 1U8HA 4OD1L 1A3ZA 1CDBA 2COQA 3BVXA 3O2DL 4XVSL 4G6MH 3NZHL 2R7EB 4PW3A 1OQXA 3QQ3B 4NN5B 4LOVA 5LVEA 3RIAF 2VB5A 5I0VA 3SE9L 3LYRA 4U1SB 3IDJA 5F7AA 4KO7A 3IFLH 3SPVA 4R7DB 2WANA 3HMXH 5A7BA 4AMWA 3AREA 4X8JA 4N2LA 3UC0H 2VR3A 4H1LG 2X4NA 1TCRA 1ZVYA 1E8ZA 2SEBA 5AWNH 3SKJL 2R56L 4BFIA 5CGYC 4NKDB 4EUPG 3P69A 4LSPH 3RL2B 4H8PA 3VSTA 2W60B 3IDYB 2R9HD 3VFNB 3ZL4L 2A9ML 5I6KA 3LNGA 1TQBC 1RKRA 1HIMH 3DSFL 1SDAB 5HYJD 1JZDC 1ULVA 1U8MA 3AB0C 5FA4B 3QYMA 4U3SB 4X6FB 4P9HH 3CSFA 2AABL 4E41E 4OZGA 5EF3A 5FGCB 3WI9A 4NDMB 4Z3TA 2Z8RA 1I8UA 4G6ML 1U8NA 2VKXA 1OANA 5HY9B 3GMRB 3I6SA 3VA6A 3CFJB 3D39A 5EEZA 5T1DH 2VLKD 2MTAA 2XQ0A 1CFTA 2ZONA 1QKZH 1QLRB 4Y5YA 5CGBA 1ADQL 4G6FB 3FRUB 3QYCA 4PJ9C 3SO3B 3WG7B 3HN5A 3LH2L 3HMXL 3APMA 1QI5A 1NC4A 2NYKA 2PTTA 4ZYKA 2X3BA 3KYKH 5D5MB 4KNQA 3L3JB 2RFXB 1HH6B 5EBMB 5I73B 5F7DA 1BD2E 3CXHJ 1CO1A 5AWNL 1IIIA 5BS0E 1ZVHA 4Q4EA 2PYED 4TSAH 4IOIB 5TDPA 3VM5A 2P8MB 4W9ZA 2EC9T 1I4FA 1OF2A 2X4PB 2Z65C 3CPLA 1HKLH 3KPRD 2BXYA 3ECBA 3EHBB 4PJCE 5T3XH 1PZAA 4Z18A 4A2HA 3OV6A 4JRXB 2NYZA 5D7LA 4EN3C 3ISWA 5I6XC 3ZKMD 3DJSA 4PBDA 3WJJC 1M7DB 2MKWA 2WSPA 3JTBA 4JRYD 1GZPA 3EO0B 2QBWA 3G6AB 4A2FA 1ROCA 1DCEA 3GZQA 3ARWA 1YYMH 1YEHH 5F96H 3QNXB 5M7QA 3VWJA 4P9HL 1ETZB 2ORBL 1H3PH 1LNUA 1BIIB 1LWRA 3O8XC 3HC4H 2GTZA 4JHAL 3MRQA 3WEBA 4ZAKC 5I75C 3QGVA 3TIDA 3WTXA 4P23B 4MGXA 3UP6A 5JIMA 1KN2H 4WO4C 1CD1B 1WT5A 5T1DL 1A6AB 2JXMB 3DOHA 4WWKC 2AQNA 5DVLA 4PY7B 1A4JA 1OGAD 3UZVA 3JVGC 4X4ZA 5CMAA 5IG7A 4ZT1A 4CVXB 3IMUA 3N85H 3KYKL 2DBJA 2W81C 4PEEA 1FFQA 3ZE0E 4U1NB 1WBXB 3D3VB 1N0XH 4TNEA 3W0WE 1GC1H 3X3GH 2LGNA 3RPIA 4KO5A 3T2PA 3SPIA 5KSUB 4MD0B 3QO1B 5T3XL 5FIEA 4L9DA 2BHYA 4PBXA 2J1ZA 5D71H 2IAMB 3ZXAC 4Z7VA 1VPOH 3TEXA 1WDAA 3TPUA 4M93C 1AGBB 2Y36H 4FADA 4GG8A 4PIBA 2AK1H 2Y0SA 5JA9A 3EFFB 1M7XA 2WGXA 4RMTA 3IBEA 3QT2A 4GRWE 1YEHL 2HB0A 4JQIA 1B0GA 1A7OL 3R0MA 2LVCA 3WE6A 4OVVA 4TL4A 3O45B 1MFBH 2VN7A 5TDOB 4BSVB 3GRWA 1R5WB 5IBUG 4EMZA 1USZA 2D3LA 2ODIA 2P9RA 5CZKA 3GKWH 3E1ZA 1A4KA 2BIIA 3BFOA 5CD5C 1OAUH 1NM9A 3B9KD 4N6RA 4YHNB 4OQTA 3EADA 2DEXX 3JTTA 3LKQA 1FGNH 4A2EA 1OW0A 3AMLA 5MHSD 4AQAA 2IGTA 2P5WB 4YDZA 3ZUCA 5PCYA 1EEZB 4ZQKB 4Y2DA 1GC1L 3P77A 2R8SH 3VQMA 1S46A 1WYJA 1EO7A 1UZ8B 4IMKC 3UTSE 5EZLA 2ATPA 2W65A 3JTSB 1NH6A 5D71L 4HS3B 1ZAGA 4KUZL 1G1OA 3M88A 3FFDB 5MENB 2Y36L 4GKOA 3BRFA 4KAQH 3MJ8B 3S3CB 1IAII 1QABA 5FOBA 2E4FA 1UD8A 4NUJA 1NZRA 2VDRB 4C83B 3SKOA 4YSCA 1D5MA 3KM2A 4C4BA 1NC2A 2XPZA 3W11C 3MYJA 3WXWH 4EI5C 5FKAB 2WUBH 4UT7L 3X1EA 3O9WA 1MFBL 3B4NA 3BP4A 3NOIA 2HLAA 4L9LC 2KZWA 4QRPA 4X6DA 5BRZD 5LCVL 1HHHB 1TTBA 4C4UA 4NFBA 1QR1A 1AY1H 1U8QA 3GKWL 4JKMA 4PRHE 2WZPA 4PJIF 2QDVA 3IXTA 4IRJD 4BHUI 1XGQA 1JMXA 1ZIAA 4G9FB 4IGBD 1SHWA 2BC4A 4JM2A 2JKJA 3W5NA 1OB0A 2E5EA 2C34A 3ATDA 4OZGE 4Y5VA 2EDHA 1FGNL 4AJYV 4N2MA 2E8ZA 3QORC 4PJ5B 3KW7A 2HG5B 2ZUYA 2G3NA 4JY4A 5IFJA 3MO1B 3DUHA 2A4CA 3QG6A 1DFXA 3L1OH 3MGOA 1IMHC 5JQIB 5DRWA 5DJYA 3UCRA 1JPGB 1SY6H 5EWIH 3I3EA 3Q8EA 5KYWA 5TFSH 1TU2A 1HL9A 3QCVH 4U6VL 1YRKA 3CH1B 3VXUD 2CLZA 4KMTH 5FYJU 3DXAA 3TZVA 3IAPA 1KXQE 1SVBA 3E6FB 3OB0H 1E3XA 4Y2LA 3WFCL 5I6MA 3ARFA 1D6VL 1DDTA 1W8EA 3VXQB 3D9AH 3L4UA 2K8QA 4HKXA 4LGPB 1D5IH 4ACPA 1NFDE 4B0MM 5A2KH 5IJKA 3MRDA 1E6JH 3LNDA 1KOAA 4QRRD 1TJGH 3N42F 3WV0A 2AJSH 2WUBL 3WLBA 4FLRA 5D7LE 4HX1A 1NGXB 5IR1A 5E6IC 3WTYA 2HUEA 3CVBA 3ARTA 4H2AA 3R8BB 3SBWA 1VFOA 2ZXEB 4CJ0A 1AY1L 1HKFA 4YE4H 4JFYA 2BDNL 2VRQA 5L2JB 5BUGA 3WFBH 2EECA 1LDPH 2HX7A 3FCUB 5DTFB 3ZE2F 2JE8A 5E9AA 1XH2A 3QWNA 2PPAA 5ABZA 4HXBL 4O5LH 3J2PA 3ULUL 2D9QB 2X70B 3QARA 4RH4A 1SHMA 3M6DA 3VGAB 4A1RA 3IEAA 1UQSA 3GS0A 4GRLB 4N2BA 4F33A 4NNYB 4GO9A 4Z7IA 1HH9B 5I17A 4Q58C 3ZL1A 1ZSDB 4FXGB 5HYSA 1W0WB 3U0PA 2QKSA 2HXAA 1JS4A 4JVPA 4R2GC 4QHLA 1YJDC 4DO5A 2QADB 1M2OA 5EWIL 2OMYB 3Q48A 3QUGA 4XB8A 5DHVB 3VXOA 1JNJA 3K72A 5DGRA 3M46A 2HWZH 5FYKU 4KMTL 2IANA 3VD9A 2X5PA 1CB4A 1W0YT 4DQOH 4Z7UF 2G2NA 4OB5L 4X80L 3JWNC 4POZD 1AXSA 1NUFA 4UQ2A 5TPWL 1D5IL 5B3SB 1RXLA 1U41A 1E6JL 5FUCC 4YL4A 4N5EC 4JRFA 3PQYD 4PJAB 4RMSA 4XXDB 5HHNA 2XBTA 5I66A 4NIYE 1D9KA 3QI9B 2CRIA 4X6CF 5FLUA 4HD9A 2DTSA 5KAQG 4L5FH 4DOHE 1LLAA 3PPSA 4HGKC 4LMQE 4MA7H 2CGYA 5I1GH 3RPBA 3WFBL 2OYPA 1LDPL 4JDVB 2C3GA 4LVNB 2X9ZA 1GY2A 1P1ZB 4HCRH 4FLQA 4O5LL 1IT9L 4U49A 5E95B 1XL4A 4IRZH 5JMRA 2CU9A 5I74B 2EJ1A 5C0AB 1AXTH 1MVYA 2AAVA 1F4HA 2CRMA 1OCOB 3IFNL 1MCHA 4L4TE 5E5RB 5KOVC 1GHFH 3ZHNA 4D9LL 1GAFH 1FDLH 2HKHH 3WUZA 1F41A 3K4DA 4F58L 3CPUA 4X4YB 1OT2A 1WHPA 1NGPH 1SYSB 2LABA 4PJDF 5HD8C 3M1BA 2B1HH 2F7IA 3D87B 1SVCP 4XPTH 1DR9A 2NUTB 1NAMA 3LRKA 1L9RA 5EC2A 1V7MH 5GGRA 2BS8A 2DWTA 4L2YA 1NEPA 1WVZA 3NCMA 2VAJA 1YMMD 5EDXA 3ZRSA 4BFKA 5ERWB 4JKNA 1FRGH 1AGEA 1B0WA 2M83A 3QISA 5MEPA 1FG2B 3GB7A 4TRPL 4HHAA 3VWKB 2P43B 1XXDC 1UWGL 3LEVH 1EMTH 3ESMA 1FNHA 2XNAA 2OMTA 1QFPA 3QAZB 3HG4A 4M4RB 3HAEH 1XCTB 3VNYA 1A6PA 4HU2A 3VD7A 4J3VA 4I8DA 43CAB 3WY2A 3HCVA 2NX5B 1SXAA 2CHXA 1MREL 3D50A 2IOOA 4P46C 2HLEB 5DMGD 5IFAL 2DI7A 4U0QB 2GT9A 5C1MB 2OTUB 3BYYA 3QUYB 1AXTL 2JV6A 5J1SC 1OQOA 4PUBL 4ZFOL 1ZT4B 3BWUC 3W5MA 2X28A 1BM3L 3OJMB 5DZLA 3MRMA 1OHQA 1GAFL 4ZMWA 2HKHL 4QRSA 5KVDL 2VLJD 4JR9H 2RIKA 1A21A 1TJHL 3QUXB 4XPTL 4IBZA 5IROD 3WTSA 3GSRB 2ZSWA 2BP0A 1V7ML 1WD9A 1XSJA 2A74B 1JYWA 3FH5A 1GGBH 4JVWA 1CWVA 3KCPB 5DMIH 4LSQL 4PRDB 1JNNH 3FQTA 1T1XA 2Q7AA 4PW4A 4DKDC 1V3MA 2HYMA 1PX3A 4HUUA 3LEVL 3RX8A 3D5OF 1IC4L 1HYRC 2EYRA 1EMTL 2UZIH 3T3PF 5FM8A 7PAZA 1N12A 1ORSB 1XIWC 3V5HA 1JGVL 3NSDA 5JDJA 3GHBH 3KM1A 1KT2A 3B3BA 2XZAH 2Y23A 3P73A 5C0BA 5IUSA 4UV4L 3QDMB 4KTYA 4PGDA 4O58H 3SD2A 2BRQA 4OIFA 2VXQA 4MJJA 1DFBH 4L8BA 5SWSA 2WN3A 1VFAA 3HUJA 4ODWB 4LDEB 2DH3A 4TSCL 1E9QA 3RJQB 2BY2A 3HG0A 3AGVA 4WI2A 2ID5A 1KCVH 4F9PA 2RR3A 2IOMA 2Y7OA 3H53A 4KX8A 5C0JB 3OM3B 3KWVA 3ARGD 3ZX1A 1WUZA 4ZMPA 1WH0A 5H4ZA 1N4XH 1SJHB 2YARA 5HHME 5IMKA 5JIPA 3KZ8A 1L9OA 4KJYB 1JZ5A 4A68A 4H1LH 1JWUB 4NCDA 2VLLA 2C7UB 2PCPA 4ZOCA 1R46A 1X9LA 4L29B 4ZO6A 1CT8A 3T0WA 3KXFE 3RRQA 4H44C 4HMEA 4X7SH 4G8IB 1K5WA 1M6UA 2G9HB 4GKNB 3TTSA 3MRJB 3T6WA 2AERT 3UTTB 4BK4A 3L3GB 1RK7A 3WIHH 5J06A 4JZJB 3QQ9C 2P26A 2APBA 4JO1L 4TLUA 2WVVB 1Q72H 5C6WH 1CK0H 4JB9H 4HK3J 2HT4D 1HCFX 3ROLB 4DGYH 2VTFA 5F3BA 1JYNA 4Z1PA 4BFGA 3GXDA 3CSYA 5HGGS 4WI0A 1E90A 2VUYA 2OQJB 3RZCB 2XZAL 1JYXA 4WAFA 1AGFB 1BJ1J 2E7CA 2GBUA 4JJHA 2IANE 4LMQI 5EN2A 1E28A 3HJEA 3F7VB 1DFBL 3CN4A 5TH2B 1AQDB 4P5SA 1C9SA 3U2SA 4JFPA 4OGQC 4OF0A 5K39B 2ZAIA 2UY6A 3HRPA 1FL6A 4WU7A 1NUGA 1F4XH 2BIQA 2Z6FA 4LLUB 4OFQA 4DGVH 1NAKH 3V4UH 3KL0A 1T5XB 1S7QB 3ELQA 5F88A 5FB8B 1A6WH 5JORB 4F7EB 4NKIH 4AUYA 3AXLB 3WJLA 3ERXA 1XMWA 1C1EH 2VLRD 4HWBH 4PJXB 4Z7WA 2IQAA 4AGLA 3G7TA 3RWIB 4JFFD 1FYTD 4WCYH 5F7WC 4YPGB 5CZRA 5JXED 5D4IA 4X7SL 4XCFH 1KJ2H 2NY5H 1PDKA 3BAXA 5C6TH 4BZ2H 2EZ0C 3P0YH 2QZQA 4JB9L 4GYBA 1IBBA 5J1AB 4KZ0A 5ACZA 1OY3B 2V7NA 2WIMA 4UTAA 3VI4A 1XF2A 2CLRA 4R4NC 1XZWA 1I8LC 1N7MH 2A6DB 4NQVA 3VX1A 3CFUA 1HQRB 3FB8A 4NM4L 1T5KA 4DIXA 2FZ3B 2LV4A 4LOUC 4NRXA 5ETUB 3MRCB 3PWJB 3GSQA 4PP1D 4NP9A 1A1MB 2ZT9C 5D7JD 5JIKA 3U4EB 3PWPB 1VB9A 3DJ9A 4TUUA 3IE9A 2WBJD 1TVHB 4IBLT 3KLAB 5EG6C 3KDMB 4DUXA 1F4XL 2VO5A 2H32A 2FHCA 1J18A 5AVQB 3ARYA 1SXZA 4NJ9H 2GHZA 4MDJA 3V4UL 5E24E 1OL0A 1C5CH 4YR6A 1RK0A 1A6WL 1RZJC 4NKIL 2A0LD 2XKNA 3REVA 2F5BH 1QVOB 4L1SA 2E7DA 1MEXH 1TQTA 4OFYA 4UT9L 2XXMB 2XA3A 5LXVA 4LIQH 4WCYL 4WV1A 4FC3E 3L1FA 4N90D 1HWWA 4OZFH 4RFNB 4OJAA 3V2AR 2Q76A 4XCFL 2GB2A 2XFXB 1KIRB 1KJ2L 2NY5L 2O30A 5FCSH 3ZR6A 3ZGHA 1HN1A 2WXHA 3M86A 3R0NA 4NQTA 4U1SA 3EJPA 2PYFB 4XI5D 4Z0XA 3W81A 1JBJA 3L45A 2ZP9A 4M7KH 4NOBA 4R7DA 3VXTB 3G5VB 2CPCA 3P11H 5D1QA 5TF1L 1VCAA 1AYRA 4JGMA 1HWHB 1X5FA 3O6LL 3GLEA 4PG2C 5EU4B 4BIKA 5T5NG 1NGWA 3FFOA 7TAAA 3D1MC 2DQUH 4Y4KB 4Y4FB 4OFDA 4AKQA 4AVHA 3L5WA 1X5KA 4JCLA 1OF0A 3RL2A 5I5IA 5GXBB 2EE3A 4N2KA 3VFNA 2R23A 1NMCC 1S3RA 3IBOA 1XD0A 4UANA 1B6DA 3PF2A 3A4AA 2FR4A 4C56B 1Z1WA 2RB8A 4LNVA 3VXMB 5FA4A 4BXVA 2Z1KA 4U3SA 4B7IA 4N1EA 4XP1L 5FOJA 2Q0ZX 2F5BL 5EO9B 3P4MB 1MEXL 1LE5A 4FCHA 3KG5A 4NDMA 4LIQL 1F6LL 4XBMA 4EIBA 2GJ6B 3ZR5A 1JRHH 2YWYA 5HY9A 4BRJA 5DSCA 3GMRA 1A3LL 3BKMH 3EYSH 5J13C 3L5XH 3CFJA 1A25A 5AOZA 3DX1A 3NIDF 1OAQL 2QJDA 1ZK9A 2VW4A 5CN2A 4L0PB 1HX0A 5K9JL 3BH8B 3FRUA 1L4IA 4TL5A 1GS8A 1G4RA 3O3AB 4RGNC 1E30A 3CZFB 4P5TB 4HJIA 3L3JA 1HH6A 3CDGB 5AYUH 2XY2A 1CLOL 1FFOB 2JQZA 4PI0A 5I71B 3VFSA 4FFZL 5L9DH 3VD4A 4KXBA 1MFEH 5DVNA 1FG9C 1TJIH 5L2KD 4H7VA 4JRXA 2ZUWA 4JHZA 3CFQA 4OFVA 1S9KC 3DROB 4S0TD 1G7PA 1KJMA 3DIVA 5EU5B 3QHTC 3N1GC 3NFSL 3UG3A 3G6AA 4Y4HC 4BH8B 3KH4A 3DMMD 1OSEA 1DQTA 4PB0H 2N4IA 1P7KB 1LQBC 3QNXA 3CHOA 4UILH 4B41A 3UX9B 2EKSA 1ZV9A 2DI8A 2VMFA 5F7HA 1JRHL 2X4SB 1TQCB 4F80A 2G60L 2WW8A 3EYSL 1CD1A 3FSWA 3L5XL 5F1IB 3V52H 2OZNA 2JXMA 1AHMA 5DVKA 2ZX6A 4ANXA 3ME0B 3BGFB 3L2LA 2ODHA 4XMVA 4XPAL 1IGFH 2YJQA 3D33A 1RZKL 4G9DB 4GQPH 3SODB 3S37X 5T1JA 4Z7WE 3SZ6A 5L6YH 1QLFB 1S7VB 3HPJA 3OKKB 3K2KA 4KV5F 1I85A 3BUYB 4U1NA 5AB9A 3CDZB 2P80A 1OARL 3HZYB 5L9DL 1J0YA 3MBEB 4R9HA 3BPLC 3FF7A 4NQXB 4NXKA 3RWFB 4BA8A 2OYLA 4MD0A 4FLOA 1TJIL 2CDEA 3EGXA 3ARDA 2IPTL 4PR5B 3OMAB 3QIUB 3EJCA 1EO5A 3QZBA 4Q6IC 2IAMA 4JFXB 4ZFOB 3CAFA 1Z5HA 4OZIF 3I02B 3T0VA 1NSNH 4MYWB 4N68A 2K6YA 3ARBD 4NQCB 4U7MA 2NY6D 4AGOA 5CFHA 1S5IH 4PI2A 2GBVA 3E80A 4A7TA 3LZPA 3EUDA 2EIJB 4JO2H 4YH6A 1UEMA 5SWQB 1PNDA 4MQTB 5CUSL 4EKJA 2EDFA 5J1TC 3ROOA 5DO2D 1R3KA 3UDWC 4CSZA 4NAMA 3SPHA 3O45A 1R5WA 4WFFD 1NKGA 2IF7A 2R2EA 3V52L 3OLIA 3GMLB 5JHLH 1RSFA 3NJGA 3O2VL 2WINB 4K3DL 4KK6C 1KIPB 2EIEA 1E4KA 3RA7H 2UUDH 1F1GA 1WRFA 4GI6A 4H8HA 5D55A 3T0BA 4YHNA 3EBAA 3GJFA 4NP4H 1ZK5A 3CHQA 1BYNA 4A2MA 4HKJA 1CF8L 4DEPC 1RJLB 5L6YL 3OAYK 2DWXA 5F70A 2JJWA 2APWA 2P5WA 4HS6A 4M8QA 3GBNH 2NW3A 3FT3B 4U2ZA 4FG4A 3EDJA 4QLWA 1GZHC 3ETBF 1CDIA 2BNRE 4PV9B 1Z0MA 2AVFA 2OM5A 4JUTA 2JCCB 2R1YA 3JTSA 3VCLB 3FFDA 5CU9A 2VZUA 1S5IL 4LHUB 4XO4A 4KDVA 5D1QE 5I1CH 2BFVL 1IC5L 4EO5A 3EF4A 1D5ZB 5D7IB 3QIBB 4X4XB 4N28A 4XCYB 1OCZB 1CLYH 3BVDB 2OJZH 5EIIA 4FG6C 3WHXB 2KDGA 5BQ7A 4MAUH 4BZ1L 1VJSA 2X4QA 3LX9A 1W15A 1OM9A 3AU1B 3OR6A 4B27A 5FKAA 4AJ0A 5T5FA 1Q0EA 3GTTA 2ZOUA 3ZDYF 1PZCA 3LH9A 5I1EH 3T65A 2PWEA 5JW5B 1HHHA 5LBVA 5D2LE 4KI1A 2MQ0A 2OSXA 3PWUA 1JD9A 4HUXB 1NJ9A 3PUCA 3KJ4C 1BZ9A 2ITDB 3TCXA 2OP4H 2W59A 1MVUB 3KMDA 5CSZB 2WYTA 4LF3A 5AVRB 2YD1A 5J4MA 4YHZL 1KCWA 4HAFA 3DURB 1KB9J 1NCDL 3RJDA 1TKWB 5A2JH 1WA2X 1ZOXA 3GBNL 4PJ5A 5K93A 2IBGA 2H5UA 3MO1A 4UQ9A 1QFOA 2R51A 2EXSA 1C5BL 1RURH 4FQCH 4OIIL 1YO4A 1IM3A 3SYAA 4ZUSB 5FO9B 2DJSA 1JPGA 3EDEA 1LWHA 1WITA 1CMOA 2XV0A 5I0YA 4MB1A 1XH3B 1JHKL 1IM9D 3IU3B 1NOFA 4OZHB 4R0LA 3QXWA 3FO9B 2DDQL 4HYTB 2NY0C 4H1LB 4UV7H 5D2NC 1MW0A 3ZUNC 3CXFA 3E6FA 4P4KC 3TN0A 1H0DB 1PX4A 4JGNA 1BF8A 1B6UA 5H37A 3PCYA 1BEYL 1CLYL 4EUPB 2OJZL 3VXQA 3N1PC 1P5UC 4M5ZH 4N1HB 4AIOA 2ROYA 4MAUL 1J0KA 4MXVE 2VT0A 4NUMA 4HOWA 1AZBA 3CU7A 4E9RA 2VDOH 1PMYA 3WJMB 1OZUA 4GFTB 4KVNH 4KZCA 3OXRB 1KY6A 4QHMA 3CUPB 3GTVA 3VRJA 1I7TB 1LEGA 1D7FA 5L2JA 3PNWB 1EZVX 4XXWC 4Y7MA 5DTFA 5ITFB 1UA6H 2OP4L 4FQXD 4LEBA 3OPUA 2I27N 3P2BA 5BW7A 5DUJA 3BD4A 3QJHB 4WI8A 1WA0X 1Q1JH 4ZK8A 1JZEA 4GRLA 1G1YA 5FYLE 4FMVA 1HWGB 1HYSD 4NNYA 3N41F 1HH9A 1RURL 2FLMA 3MACL 4FXGA 1MJJB 1TPXC 2YGPA 3RGVC 4KWUA 5IBTL 1Y0LB 1KCUH 4C55A 1VADB 1RMFH 2OULB 2IFFH 3D0VB 4BK5C 5DHVA 4B9JA 2OMZB 1B88A 2YXFA 5DWUH 4DJMA 1KFAH 4PJFF 2V8LA 4Q9RH 2FVNA 4GSRA 4PG9B 4TNVF 3UBXA 5JOPD 2QV2A 4UV7L 3MV01 3QG7H 4KKBD 4LASH 3ZO0A 4RFOH 1J88A 1TYRA 3C6LC 1J8HE 3KLSA 3Q2NA 4YK4C 2DLHA 2H3NB 4WTWA 3SJVB 1PTZA 4PJAA 2LTQB 3C5ZC 4XXDA 5MEOB 3BRGC 2FEDC 1DBMH 2LT9A 1ZLSH 4H5SB 1U33A 4ZMXA 4F92B 3EYOB 5HYIA 4YBLC 2DAVA 2XIDA 4O02B 4Q2ZA 1F90H 3KR3H 4HSCX 5BXFB 4HG4J 2BRRL 3SB3A 1SXSA 4M6OH 4PGEA 3DOSB 4D7PA 5L4FA 3LKOA 3NSYA 4HIEB 3LN9A 5C0AA 3FQRA 3OD3A 1KTJA 4HIJB 2EH7H 3CZNA 1Q1JL 2BK8A 3IJ8A 2R0LH 3NZSA 1IV8A 3U79A 1CTMA 3UAFA 4WUUD 3BSZL 2XACC 4QTIH 4X4YA 4MAYD 2CKBL 1SYSA 1KCUL 1MI5D 4XPFH 4NN6C 3QUZD 4X83A 6CGTA 1E50A 5EEWA 2NUTA 5DWUL 3D05A 1KFAL 5HI5D 4Q9RL 3VXPA 1LP9E 3CZGA 4N2OA 1JFQH 3QWOB 4N2DA 1QSFE 3QG7L 4Q56A 3PV6B 1BJMA 4RFOL 4JFEB 3FO0H 4UZUA 3Q01A 4PB9L 3AQYA 4XOEA 3ET9F 1OGTA 4LO9A 3TT3H 1AC0A 3D0LB 1KBGH 4F8NA 3VMOA 4GIAA 5H2BB 1ZT7B 5I8CB 3ARZA 4DKAA 4M4RA 1XCTA 5I30H 2X9XA 3E3QC 1ADQA 3ZHLA 1F90L 2B8OT 3KR3L 3F7RA 1ZXQA 1GMIA 4LBEA 2NX5A 3GJFK 2HRLA 4ZUVB 3RDJA 1WV7T 1OOWA 2Y5TB 4M6OL 3JWOL 3RBGA 1EEYA 3RYMA 4ZI8A 3MJ9H 3HG5A 1LMIA 5KVGE 3KAAA 3STBA 5KVFL 2ZOKB 4UQIM 4ZFFB 3ULVD 5IW6B 1ZT4A 1EAPB 4XWGL 1KXVA 4QTIL 4F2MB 2XBZA 4YHYC 3X13B 4NO3A 4XPFL 2PPDA 3IT8D 3QUXA 3GSRA 4GAFB 4O9HH 1J11A 2RTTA 2A74A 2OLDA 3PIQA 5T1LA 4OJFH 3KCPA 2MH4A 3WBDA 1Z9SA 3RIAK 1KCKA 2QMKA 4Y9BA 3DX0A 4PJIA 2L7EA 3QHZL 5JOFB 4HGMA 3TBBA 5CINH 5FR3A 1BOGB 3TT3L 2R4RL 2WZAA 1K85A 2R0KH 2Z0UA 3IPEA 4MA8L 1DCLA 1LHZA 2IBBA 3M17B 2PXYB 3IXAA 4YUEH 1JXFA 1SQMA 1FHGA 4D2NA 5D70L 4ALAC 3QDMA 4MKMA 4WEBL 4APQA 1P5VA 4F7CA 4EZKA 4OM1L 2FT8A 1NMAH 1A1NB 4KHTL 5ALBL 4IRSB 2AK4E 3FT4B 4QRUB 1U8LB 4LKXA 4KZEH 4ODWA 5B1JA 1EHLH 1KYOK 4HBQA 1MZZA 4WO0A 2Z93B 5IB5B 3RFZA 4ELMB 2ENQA 1F00I 2KMWA 3H55A 1T5WB 2X4UA 2W9EH 4KJYA 5I1HL 4QJ3B 5HJBA 2X05A 1U3YA 1JWUA 2JMRA 5E2JA 5GRVK 1SQ2N 2VABB 4L29A 1ZS2A 3TV3H 3JWDH 3PL6C 4OR1A 4NNXB 2HRGA 2UWEF 3T3MB 3PV7A 2FHBA 1L6XA 4OJFL 2QSQA 5J57B 4FHJA 2G9HA 5E4EB 2AQ2A 1Z7JA 3L3GA 1JFHA 4MS8C 3RDTC 3FN0H 2VMEA 3NIGF 2WVVA 5B38G 3T6ZA 5CINL 5CJXC 3ROLA 4FEIA 5T1KB 3UJTH 3US9A 4EBQL 3T0ED 1EZVY 2R0KL 1SEBB 5HDBB 4HWEL 1JPEA 1YDPB 2OQJA 4N2EA 3L3KA 3GXMA 4YUEL 3MVSA 4NKQB 3ZIYA 5IESH 3RZCA 4X4KA 1AGFA 4PVBA 1HHJB 3AQXA 1NMAL 3TH4T 3B6SB 5SWZB 5TH2A 1AQDA 5LG1A 3BPNC 1KLUA 2K9FB 3U7WH 5AKVA 4G7YH 4OTXH 4Y1SA 5K39A 2YPLE 1UZ6E 2QQNH 2ADIB 1RLBA 1BEXA 4R5XA 4E9SA 4CILA 4M8RA 3II1A 1T5XA 1DDHB 2ZUQB 5FB8A 1KF9B 2Y7SA 4Z7UA 4F7EA 1YEGH 4KROB 3QXAB 1S9YB 2F74B 2Y24A 2OW6A 3NFNB 1G7QB 3P3TA 1N26A 3AXLA 5ADPH 1SDDA 3T6XA 5IM7A 3II3A 4PJXA 2I7OA 3TV3L 1K6QL 1JYVA 3UROR 4F8QA 2C9PA 5CGYD 2F54E 4YPGA 1LO2H 2IDQA 5DD1H 4GS7C 2VW6A 2DWDB 4M6AA 3WFHB 4I0PB 1ZV2A 4IIQC 3SYOA 2IH9A 2JJSC 4HS8H 4JZNB 1KLFB 2J4WH 2PWGA 3EOTL 1XR9B 4OUOA 5J1AA 1GGCH 2JJVA 4ONFH 2QV4A 2X44D 1N3NB 3GSNH 5LCVA 1B2WH 4N8VG 4L2LA 3KPMB 3S37H 4MXQC 2IALB 2A6DA 5AZUA 2UX7A 1HQRA 1T0MA 1BHGA 3HB3C 3LZFL 1XGUB 4O2FB 5AKTA 4AI7A 5C7XL 1CG9A 5ETUA 3MRCA 4NWTH 2A6KA 3ATEA 5DZNA 1A1MA 3BFQG 3S3DB 1T1WA 4PHXA 2VUKA 3ZTNH 4PJDA 2YAOA 4ZUWA 2ICWB 3PWPA 3U4EA 3WN6A 1M3IA 5F7FA 3WS6C 3PP3K 4OTXL 5EZPA 15C8H 1TVHA 3KLAA 3QC5X 2QTEA 3KDMA 4DPRA 1M2VB 3ILPB 3UPCA 3O11B 2HRHA 1FL5B 4JL2A 1QR4A 4PN6A 3CFTA 3O4OC 4PJ9D 3GBMH 4G11A 1J9TA 5A6IA 1YEGL 4ZSOE 2HVJA 1QVOA 1TO5A 1WT5C 3E1F1 1JV2B 1LO2L 4YHIB 3B7SA 5DD1L 1KC5L 3IYLW 3PJLA 2XFXA 1KIRA 1FZJB 2OSYA 5IHHA 4FI6A 3I9IA 4EN3D 2AJXL 1A7PL 4JFDE 3S35X 2XWCA 2PYFA 4HS8L 2BPBA 3KEHA 4UM9A 2DMKA 3SGDH 3WIIH 4EJ1C 3GMNB 2X4TB 1JHLH 4UDUA 1U92A 3VSVA 1Y1DA 4XGZA 2VDPL 3QO0B 2NY3B 3VB9A 4GKZA 5I6NA 1Z66A 4K8RL 2K3HA 5EU4A 3VGDA 4AEIH 1JE6A 3BD3A 2XPYA 3BAWA 3O8XD 2H6PA 2KT6A 3EBIA 3SSGA 2DLTA 2PO6D 4NAJA 3NDYE 4LZKA 1F42A 4PJBB 4Y4KA 2DMCA 4Y4FA 1G43A 4P48A 1I9JH 1VF5C 2VN3A 1IKOP 5FDWB 1MCFA 4PJIE 3T2LA 1MOEA 4WO4D 5L4JA 15C8L 4WWKD 4X8CA 1OVZA 5DS8B 3QQNA 5EZIH 4YSSA 1KELL 4OM0L 2X41A 2BOLA 3KE0A 3QS2A 4I18B 1JDDA 4QPEA 4WFGE 3UADA 1DZ0A 5GS2H 3DVGB 2H2SC 4MD5B 1SYVB 5DEGB 4XVUC 5LGJB 3BH9A 3P4MA 2YA0A 3QDME 4NZDA 3SDAB 1T2QH 4W9HC 4XH2B 2GJ6A 3V7AE 3ATAA 4P2RD 2RCSH 2QFRA 4NS0A 3UYOD 3MV9E 3EH3B 1COBA 3PPEA 4M02A 5I8KH 3DHMA 3K8MA 4JFTA 4P8QA 5CEYB 3WIIL 2E3VA 2YO3A 5EU7C 3MUY1 1WZ1H 3V9CA 5KG9A 5F7EH 5JZ7C 3BIBX 3O3AA 3EG9B 3P9LB 3CZKA 3CZFA 1HJBC 2E9IA 4P5TA 4XMUA 1TOXA 2NDFA 3OZKA 4MCYA 2DWSA 3CZEA 3CDGA 5E9DD 5EOCJ 5IBLC 2WTOA 4RA0C 1GZQA 3TESA 5ESVB 1TIUA 3A4FA 1L7IL 5DC4B 2AJVL 2X6VA 3EYFB 3RWJA 4IBYA 4W9FC 3UBXI 2GIXA 5SX4I 2FD6H 4MMXB 3IWUA 3GSXA 4N2CA 4G5AA 3FUDA 2CA3A 4QHNA 5EU5A 4O00A 2A38A 3ZE2E 5L4IA 3ZVVA 3BI9X 5I76A 3QDJA 4DFIA 4HKBB 1O6VA 2CKBB 4LRIA 5EZIL 2VXTH 2XZQL 3E38A 4BH8A 3E3QE 4TQHA 4KXZI 1P7KA 2ED8A 2HT2C 2DYSB 1H6EA 5I18H 4LK4A 4XP4L 5GGUB 4L8SC 2MOVA 3GI8H 5JPNC 1JD7A 2X4SA 4MQXC 4EF3A 1XEUA 2TSBA 3VX0A 5B7MA 4G1EB 2AMGA 5FEBA 2C5DC 2NOYA 2C26A 1UJ3C 3IN2A 3ASWA 3C09B 5I8KL 5KUKA 1Z3RA 4F8OA 3UAJC 1ZT1A 4Y5VC 4Z7UE 1WZ1L 2EDRA 1I8IB 3LV3A 4DP8X 4RSVA 5F7EL 5I6PA 1ZGLM 3LHAA 5CEZE 3SPGA 4GXVH 5IOPB 1QLFA 1S7VA 3H56A 2AZUA 1AZZC 2Y5EA 3BAYA 3BUYA 4WNQB 4L3AA 5ID1B 1JAEA 3ZGIA 5LXGL 3W11D 3HZYA 3VQ1C 2YKLH 1CFVL 4X6CE 4EI5D 3ZZQA 2MCPH 5KSBF 1RERA 1WGOA 5ISZE 4PR5A 4F5CA 1HXYB 2X10A 3QIUA 4YDLC 7FABH 4JFXA 5SX5K 3TZVC 4XCCH 4DKEH 5LBSH 4IKJA 3CFEB 3QZOA 3QFGA 1CI3M 2EINB 1WWCA 3BZ4B 4QKXB 3VFRA 1CBVH 1U8IB 25C8L 5I18L 3QORD 5L88L 4R90H 2QMJA 5BOJA 4Y19D 3CIQA 5BZWA 4PJDE 1ZS8B 3ZMRA 3EH2A 3GI8L 4HJ1A 1TJXA 1F58L 1N5YL 4HT1H 3GMLA 5TJWK 1BQRA 1KIPA 2VKWA 3FFCD 5INDB 2YMTA 3QQ4B 1UXWB 1NM4A 4S1SL 3L3OB 2MMXA 3QJQB 2WSKA 1RV6X 2ZD0A 4LCYB 1H3GA 1EV2E 3O4LA 2ZCKH 5F6HJ 1RJLA 4GXVL 4Y1AD 4XMWA 1SOXA 3Q43A 1AIFB 3TP4A 2FYVA 2J8UB 2NQCA 2YKLL 4PV9A 5KSAC 2VUOA 4BXSV 3MRLB 2MCPL 2JCCA 2ZNXA 3EYQC 5IEHA 5E6ID 5DUMH 4DGIH 1GTFA 1YY9C 3CFIC 4XCCL 4DKEL 3VCLA 3L9EA 5CIPA 5DVMA 3HS0C 5LBSL 1OD9A 4LHUA 1YUKB 3KLHC 3FO2B 3WXVL 2HLFC 1D5ZA 3I9AA 5D7IA 2MCG1 3QIBA 4X4XA 4XCYA 3C2SA 4U33A 5E8DH 1BLNB 1CBVL 3WHXA 2WXKA 1D9KC 2EIDA 4RMBA 4B9YA 3QDGD 2YSSB 1ZTMA 3ZMNA 4X6BA 1O0VA 2LR4A 2X38A 2Z4QB 3RGHA 1E5BA 1IGTA 2OXHB 4RCAA 5JW5A 4R2GD 3TNMB 1KB5H 3PFQA 4NQSB 4XMXA 1INEH 4YGVB 4HWZB 5DVPA 3BWZA 4ZOBA 4AIXA 4POYA 4TUJB 4KXAA 4HUXA 1OKEA 3X17A 2ITDA 4FYSA 2BVUA 3Q2VA 2Y5QA 5EC1A 1MVUA 4WWID 5CSZA 5FDYA 3RWGA 5IHUH 1KEMH 3HC0B 2QVTA 3TWYA 4PJGF 1F8TH 1QFWM 2VXVH 4HALA 1TKWA 1SMOA 3WL9B 3T3PE 4XB3A 3P9MA 3A6CH 1IFGA 1WSST 3TBVB 3GFUA 1U91B 2J2ZB 3RNKB 1SJXA 2AAAA 4N5ED 4D7BA 2DYPB 1F13A 1RI8A 7PCYA 5MEQB 4LVHB 5FO9A 4ZUSA 5JW3H 1JZ8A 4HPYL 1CS6A 5IHLB 1XH3A 5FYKH 1E4XL 3IU3A 4OZHA 3ECUA 1RPQA 2ED9A 5FYJL 2EEFA 1JF1B 4LCCC 5LAPA 3FO9A 3S8FB 4N2HA 3A21A 4X6EB 1FC1A 1XCWA 1H0DA 2J12B 4LSVL 2VQ4A 5E8DL 1WK0A 4W68A 1R34A 2OMBA 2V5RA 1IBZA 4DH2A 2Y7NA 3FOMB 5E8NA 5FM5O 3AITA 4F91B 1BG9A 2XQYG 4QXVA 5HJGA 4HHGA 4RETB 5B8CC 4GG6B 1WUNT 2VISB 3OLDA 1PVHA 3DI2B 3VXRB 4FNUA 4MX7B 2MTPA 2OJEB 4ZMLA 4FGMA 4FQLH 5FGBC 5HD8D 2IC2A 1GGTA 1KB5L 3GZKA 3QDJE 2JKRM 3HIZA 1INEL 1S5HA 1JHTB 3C6EA 1I7TA 1B4LA 3CUPA 1QFWH 4HPOH 1I8AA 4NN7C 3TO2B 4H26B 5ITFA 4PREA 1XBRA 5I2IA 1JZ3A 1NCBH 4LXFA 2JWYA 4K5NA 1OSZB 4G8GA 1KEML 3KPNB 2AITA 4AQ8A 2VXVL 4FXKB 4XO5A 5DUPH 3A6CL 4XN1A 5E4OA 3TH3T 5K59F 5IKCA 1F2QA 2RJMA 3LSOB 3DARA 3P3YA 1MJJA 1ZVSB 3MA7B 4NJAH 4J2XA 1ADWA 2QPDB 1Y0LA 2YD9A 5JW3L 1IGJB 1KUMA 2Z31B 4JCWA 1VADA 4JRYB 1IJNA 2OKMA 1K5NA 3ZHFA 4G80B 1DVSA 1H8SA 1N19A 1M7UA 1TLMA 2F6AA 2IV9A 4FKHA 4PG9A 3BUIA 4UT9A 2DJUA 3EH5B 5MP6H 4OI8A 5E23A 4GQQA 3GMOB 1WP6A 3QPXH 4ERSH 4MZ3A 2IGFH 5HGHA 3KWWA 2H3NA 4ZUTA 3UMTA 1KXTB 3SJVA 5C0DB 3ABLB 4F5CE 2VIRB 2N7AA 5MEOA 3RVXC 3O6FC 3P54A 3U46A 3VTAA 4ZNEA 3SQBB 3PAYA 1H3WM 3LQZB 4J1UB 1CFNA 2D03H 2KH2B 1BQKA 4FQLL 4IKLA 4O02A 2VDPB 3KVQA 4JN1L 1OSYA 3FQ4A 4HPOL 4MASA 1I1FB 2KC0A 2WZ6A 4F7PA 4F9PC 3JV5A 4X7FC 4XN2A 4M8VA 1BM7A 1IE4A 1XR8B 3QUMH 4JG0H 3I84A 3D4GA 4MCMA 2IG2L 4PJEB 4YDVB 4HIJA 2BNUB 3HZKB 3FQWB 1NANH 3TA3B 2CPUA 3TASA 5IF0A 5F89A 1H15A 3P2DA 4KKRA 4OGAC 4W9CC 4ZXBC 5I9QB 1CN4A 3FXIC 2A4ZA 5F7KC 1UM6H 4AYMC 3C60B 2O6EA 1N9PA 3KPSE 2XV3A 1FIGH 1OCWL 3QPKA 1EGJA 1G4MA 3L9RB 4AGMA 5KZCB 3O4LE 4XNUL 2UZPA 3QWOA 4OT1H 1F3JB 2B77A 3PV6A 1KPVB 4K94H 3S88H 2AEQL 2XN0A 1U2YA 1S7XB 3G6JF 4K73A 2XTJB 2ESVE 3AGWA 4KRMB 2IGFL 4UQDA 3PAZA 4LSSH 2JCCE 1ZCRA 2QTVA 1UHVA 5TTRA 5H2BA 3UIYA 5I8CA 1JL8A 2Y2TA 5EZOL 3NACL 1QAWA 2YBRB 5D7KD 1V54B 5E8OA 3VXSB 4WEMB 1YYLH 1G6VK 1S3KL 5F1OB 3CN1A 2DQ6A 3ALWA 2M8XA 1DBKL 1E4JA 3LZQA 4H8WC 3NPSC 4R83A 5DC9B 1SNRA 2EH8H 5C0CE 2OMUB 3MHZA 5CM1A 2MPVA 3AAZB 3SCMA 4D8PA 2NZ9C 3QH3B 1IEAB 4X9IA 3FF8A 3CK0H 3QUML 3BAEH 4JG0L 2JH2A 4ZTPH 1MIML 3QQ9D 3PHOB 1KBPA 4ZOEA 5EA0L 4E42A 3WJLC 1WS8A 4W9GC 4H25B 4NCC1 4ZFFA 5FYKD 1CFBA 2CCWA 3NSFA 2F9BT 3QUHA 1RZPA 4GQ9H 2I9TB 3WEAA 5IHZB 3EYVA 3BKJL 4F2MA 1KEGH 3X13A 2P24B 4TYUA 4DFHA 4WFED 2YQGA 2LHAA 1SJVA 3IKCB 1RZ7H 4WSGA 4LNRB 2C3VB 2W80C 1W91A 4NERA 3U1SL 3BVUA 1U93B 4OLEA 4OT1L 4K94L 2ERJB 3S88L 4OAWB 2CQVA 1U2HA 1P69B 2JI2A 5IUCA 1NOLA 5FUZH 1RIHL 5BJTB 1DVFA 4PW9A 4LSSL 2MHAB 4C8XA 3GNML 3CBJB 2WZ5A 1RY7B 4XAWH 1GGIH 3K6SB 1YYCA 5GS1C 3OSKA 2YUXA 4S1QH 4MMZB 3M17A 1IGYB 3G5YB 2PXYA 2DBLH 1YYLL 3MRPB 1IBFA 2NXZB 4UQCA 1KTBA 5GJSH 4OCMC 2EH8L 4KNTA 2DLFH 3QXVA 4XNZB 3DYPA 1A1NA 3LEXB 4V2CB 3NIDE 3T09A 2WNKA 4QRUA 3FT4A 4LARH 3IF1A 1EFXA 3BAEL 4KFMA 1SUJA 3FQYA 4ELMA 1ITCA 2EZ0D 2X0WA 2X6BA 2Q5BA 1NCHA 1T5WA 4RSYA 4DP1X 5GGTA 1NBYA 1VRSA 4GQ9L 4V1DB 3ZHKA 3LEYH 2W94A 4R4ND 3KWUA 4I3GA 1QQDB 2W07B 3RTLA 2QT6A 2VABA 5E2TL 5FGSA 2DQIH 1CFQB 4A2DA 4GW5B 4LOUD 4UB0H 4NNXA 1PBYA 1I1AA 4G8GE 1OP9A 2G4EA 1KG0B 3BEVB 4ETQB 2C9XA 1PFOA 5KYYB 3QJVB 4MJID 5GSVA 4I2XB 1XAKA 3GTNA 4NNPL 4K7PY 3PU7A 2MCAA 3V0AC 5T1KA 2EAEA 2FUQA 2W5PA 2CO2A 1QYGH 2R2BA 1SEBA 2F1AA 4LRNH 1MCEA 2V17H 1OAXH 2EDYA 5DJCB 1GTNA 2DBLL 2NY7H 4PRIB 5K69A 3IDYC 1KJ3L 2Z35B 5GJSL 1HHJA 2AV1B 2DLFL 3K1DA 5EOTA 3I6KB 3B6SA 1LEIB 5SWZA 2J25A 2YC1B 3C8KB 4G6JH 2AJYH 4Z9KB 5D1XA 1P0SE 4LARL 2OL3L 4ZD3L 2ADIA 3OAUL 4PJFA 3V4LA 3EYUL 5FCUH 5BRPA 5KVMC 2QDWA 1DDHA 1BMZA 4ZNEE 4J5VA 5DEFA 1ZHBB 1RUMH 3LY6A 4JDZB 4KV5E 3QXAA 1S9YA 2F74A 3LEYL 1G7QA 4XNDA 4NHCL 4RIRB 2R29H 1OO2A 4BE6A 2X9WA 2C3XA 2FJFA 1ESOA 1EANA 4UB0L 1XZ0B 1YN6B 1LO5B 3L9YA 2QKIB 2DWDA 2EE2A 4OZIE 1LQSR 2ZWNA 3SO3C 4D94A 4BZ1A 2ICES 4TVPD 2YRLA 3PXJA 2DMBA 1KLFA 2ITEA 4WKZA 5I73C 1XR9A 2IPUG 3HG1D 2UX6A 2Y69B 3FH8A 1QYGL 5KJ7E 3KPMA 1TFHA 5TE6L 1OAXL 4J6RL 4AL8C 2IALA 3TX4A 2NY7L 1WHOA 5IVXB 3RTQC 4J4PA 3LKPA 4O2FA 1Q0YH 3QCTL 4TMPA 1E27A 1JGIA 2BY1A 3OMZA 2VERA 2DLEA 2ZCZA 4YXLL 2ICWA 2AJYL 2X1PA 3MV8E 1E0OB 5F97E 3MBWB 4KO9A 1I75A 3DPBB 1JZGA 5JHAA 1BREA 1M2VA 3ILPA 1T21B 1FL5A 4M9PA 4R96A 3C8DA 3FQ2A 1AQMA 4FMKA 1JXDA 5CAYB 2JIXB 2XZCL 1RUML 4RGND 1BIHA 4H8VA 4LSDA 2AXHA 2OR9H 4NQEA 1F86A 4HC1H 4P23C 4UTBH 4WW2F 2R29L 3UBHA 4RGMB 1L9NA 1A6VL 3ZYIA 1N68A 3M7FB 4GUPB 2XZZA 1JV2A 3ZQWA 4YHIA 2BOCB 4GBXB 2L3BA 4RFEB 4ZX5A 4K9JA 3T4AB 1J9RA 4IJ3B 3MJ7B 4HJTA 3ULSB 3HFMH 1PY0A 5I16B 3GMNA 2X4TA 1UFUA 4Q9QH 5C08B 3KJ6H 1BG1A 3MROA 2RA1A 1QRNB 4Y4HD 1FNSH 3QZWG 4Z7QB 5KTEH 2V9TA 5EPMA 5FK9B 5JDSB 2Q2LA 2X2JA 2DM7A 3FPXA 3IDIB 2VZTA 1BBDH 5EMYA 2WLYA 1G6RH 3ZDYE 5TE7L 3SDDB 1TMQA 4PJBA 5F7UA 2IWGA 2IAMC 2D7TL 3UAAA 2H0FA 3ZBMA 2I7SA 2WXRA 3R8QA 3LDBC 1V3LA 4NZUH 5FDWA 5E0FA 3I50L 1JPFB 2GKIA 1WFJA 5DJXB 1ZA3B 4YL9A 3BP5A 3E9UA 5JHDB 3IFOB 4J12A 5DS8A 4WFHD 1KCSL 4XWOC 2OK0L 3FUHA 2RGSA 1IAIM 1P7QD 1SLUA 4OKVB 3GGWB 1ODAA 2DWYA 1J87A 3ZO9A 1DZBA 3DETD 3DVGA 4ELKB 3IGKA 1UJTA 4DN3H 1E4HA 1DQLL 5LGJA 2YLKA 4HC1L 5EN3A 3SDAA 1C12B 4G7QB 3SDXB 3TWCH 4FTVD 4N2AA 4XH2A 3CFCH 1RU9H 1JGUH 2WN2A 4PJ8B 3ECQA 1F1AA 4PGCB 4Y9EA 5C07A 1C8QA 1E4KC 5IT2H 2E7LA 3W9DB 4MNQD 4NX0A 3RZWA 3DRQB 1MHHB 1FCGA 3HHSB 2V3FA 2FX8L 3MRBB 1VERA 1Q9OB 3HS8A 4DO6A 2K4WA 4OJEH 1XF4A 3BHBB 5JNYB 4CBZA 4AVJA 4GXUM 1UD3A 4I5BB 2Y1AA 3FTUA 3P9LA 4OJDH 3VFUB 1A6TA 5KTEL 5DMJB 4AEHH 1Z3GH 4XMKH 3H42H 4ZMAT 1YY8A 1FP5A 5DQ9A 1E65A 2WZ0A 4PMFA 4NQDA 4LCWA 2CHDA 1G6RL 2MKLC 4NKOB 5ESVA 3ZDZF 3CFNA 4PY8I 3BP6B 3W1ZA 4NFCA 3EYFA 4E41B 1TVBB 1IAIH 3BLKA 4IBTA 4XPBH 2CMRH 4I9WE 4MMXA 5HYSG 5E8EB 5GGSA 2EUVA 3NH7H 3BFWA 1BVOA 3SKMB 4KK6D 4D0BA 2NLJB 2ICEA 4WZ9A 3BSZA 2WK2A 4F27A 2OS7A 2V5SA 5HVWA 4JNXA 2LLGA 1WEJH 1SN5A 3FB5B 1Z0NA 3WNOA 4HKBA 1Q9LB 2CKBA 1GS7A 4NC1E 2C9AA 1BCIA 1MCPL 5CD3B 5HYQB 4LKCA 4DN3L 1OALA 2Z4TA 3CVHL 3G5WA 3LTVA 3TWCL 2YIHA 2NSMA 4G43A 5HTSA 1C5DB 2YUZA 2Z7WA 1JGUL 3HI6H 5GGUA 3V4PL 1QZ1A 3K6OA 4TULH 3N3EA 2XYBA 3CC1A 4UBDC 5D1ZD 5D1XE 5E5UB 1OHZA 4AK2A 4L3ED 3KYOB 4HH9B 3X1NA 2CCVA 3HN3A 4PJFE 1I8MB 3MKKA 1D7DA 1MHCB 2A73A 2DMHA 4PJ7F 2WP3T 1FC2D 4H20L 4FI8A 5K9KB 4MHHI 1NL0L 3LS4H 1UUNA 2FQEA 3O3BB 1CGUA 2YAEA 5DJ0B 4AKOA 4DKFH 4MNGE 4AEHL 3QJRB 3H42L 5AEAA 1JZ6A 4NKMA 4E0RB 3SY6A 3OPZH 1TFPA 4FG6D 4WNQA 3TXAA 5ID1A 2BVTA 4KTDL 3QUMB 1H9DA 1ASPA 2XIIA 2PABA 1IAIL 32C2B 3QAQA 2XN2A 1YA5A 1PF3A 4H88L 4XPBL 4BUQA 1TTCA 3NH7L 3THMH 4QT5A 3PXLA 1YPZB 2J5LB 5E1AB 3LPWA 1BAWA 4PRAB 2LU3A 1A4CA 3OF6D 2P44B 4XBGB 2QGBA 5GIRB 4N5UA 1I1RA 2V3DA 2YGOA 1N5AA 3NJVA 2CLVA 4MJ6B 4FNLL 3BZ4A 2DRUA 5D7HA 1D5BB 3ZTJG 2AFNA 2RAMA 3QCUL 5DD5H 2XX1A 1U8IA 2GY7B 2GC4C 2ICWJ 2W0FB 5I0DA 2EDWA 5DGQA 3ATFA 4YZWA 5LB1A 3HI6L 2ZKWA 4GUOA 4KC3B 4TULL 1BAFH 3K2MC 6PCYA 4XN5A 4ICWA 1VKXA 4JFSA 4X8XA 2AQ3A 2ZSVB 3B3IA 3KPTA 4PJHF 4XO3A 5A2LH 1FV1B 3OSVA 3TVMB 1C7SA 1UXWA 1KWKA 2IIJA 3L3OA 4FA6A 1IAOB 3VGAC 3VRIB 2NY0D 3LS4L 2X4OB 2YK1H 4NQEE 4DKFL 4LCYA 4XVOA 4GRLC 1XGYL 4P4KD 1M1SA 4FFVC 2A9AA 1MRDH 2ADJB 2LAAA 4IK7A 3HC3H 2JI1A 3AXHA 2YGVA 4LL4A 1MKFA 1II4E 3NPZB 3CFDA 1NCNA 3J07A 4S0HA 2QADC 3HEIB 3WNIA 1A7QH 2J8UA 3D30A 4L37B 1J9QA 4QO1B 3V5KB 1G7MB 3MRLA 4GW1B 3ZKMC 1SJEB 3JT2A 2MWCA 4QOKD 1UVQB 4DTGL 3THML 1PAMA 4XPHH 4P5KB 4FKKA 4N8VB 4P2QD 4I87A 3CLEH 4MKTA 3GM0A 2EXYC 2IDCA 5DHMC 4NCC2 3S2AA 3M8OH 3FO2A 5D93B 5DS1A 3ZYZA 2OSLB 3HLAA 2FE0A 4AGQA 4CVZB 1UOWA 1BLNA 5C09D 3T04D 3QI9C 2CBQA 2EEAA 3CLFL 2PR4H 2YSSA 1IQDB 4IOFC 4QXTA 4LSRH 2XTSA 1BAFL 1WBYA 2Z4QA 1U8PB 2DQCL 3RGVD 2Z7UA 2OXHA 3APFA 3G6DH 2P45B 3TS8A 1MJ8L 1UCBH 3TNMA 4NO0D 1AQKL 2GSIA 1X6NA 4LVNC 4NQSA 1OE1A 3K6FA 1HXMB 4TUJA 3QQDB 4JZOA 4ODUB 5I74C 3MCLL 3RKDC 3FBQA 2W91A 1ES0B 1HHIB 2YK1L 4JO8A 3S3JA 4HWUA 3CLWA 3SDYL 3AG4B 1LEKB 4CKVX 3HC0A 1MRDL 1XGTA 3C6LD 3HC3L 5C07E 3WL9A 5ILTL 4AQ1A 1A7QL 1F1DA 2J2ZA 1X7QB 4TUKH 3FQUB 4YHKH 4AW7A 5E4IA 2OL3B 1AC6A 2FEDD 2PP9A 4AH2B 1CZ8H 4GXUN 4ZZFA 4V33A 4D9RE 5MEQA 1MJ7H 2J21A 4JFZH 3BZ5A 4NUGH 3ARSA 2EYSB 4M03A 3VFGH 4B6ZA 2Y25A 4YSTA 1XF3A 3M8OL 3VWKC 1KLGA 2WC7A 4LCWE 2JVUA 3L3IB 3QAZC 2XG4B 3QEQE 2ZE0A 4NQDE 5F3FA 1E7VA 2EKJA 2XWRA 3FOMA 5KJRL 2F53D 1QSEB 5AB2A 2J7LA 1WIUA 2PR4L 2XV2A 4G71B 5IQ9B 4GG6A 5FXCH 4LSRL 2VISA 5AG9A 3UC2A 2XN9D 3KW8A 2VLKA 1NIFA 1E5AA 1K2DA 3D85D 2F8XC 4J3XA 4MX7A 2E47A 1YHPA 1UD4A 2UWEE 1UCBL 3RFRA 2D7PA 5B7EA 3LNIA 5GJTH 2P7TB 4Z76B 3MLRL 1JHTA 2ZUTA 4FA8A 2EILB 3VFOB 1MCDA 4J3OG 3QUYC 2FUTA 3NIGE 1KGYE 4G42A 5GRJL 4G59C 3VGBA 5INCB 2PYEA 2BHZA 2F18A 3KPNA 3WGVB 2EADA 4L05A 3KPRA 4NEHB 1XGZA 4FQJL 1BVLA 3LSOA 3VI3B 3QUXC 1YNTF 4HUVB 1L9TA 4TUKL 5DC0A 2WQSA 4YHKL 3MA7A 1ZVSA 4QHUB 2A74C 3FCGA 3VD1A 2Z31A 4P9HC 4IYKA 2YLHA 4JRYA 4N2FA 1HNYA 4NUGL 4OCLC 2F1EA 4G80A 4WIQA 3IK2A 5F7NC 1Y07A 2ZXWB 4W9EC 1ZXKA 3V6FA 3UO1H 1UT2A 5DT1L 1GA2A 1KPRB 4IDJH 1JSYA 4K23L 3UEQA 1QWNA 4JGJA 4L4VD 4WEEA 3MOBH 2IEPA 2WJ5A 5C0DA 1XGRA 1OCRB 1FE8H 1BFOB 1UM4H 3QFJD 1AO7D 2Y07H 3LQZA 1CICB 5GRZA 2V9QA 3E6HA 3G04B 5B1JC 4KUCD 1F4WL 3CFMA 1I1FA 2Q7YA 1HILB 3DDGA 3FK3A 4FG0A 5KSBA 3H54A 3A24A 5DA4A 4B3EA 3B8SA 5FWRA 1KGWA 2ZWYA 3QXDA 3UTPE 1S7UB 3DHJA 3ZKQD 2OFQA 4PV8B 2HT3C 1U3HB 2FJSA 3EO1B 1JCKA 2WOBA 3L16A 4ABVA 4PJEA 4YDVA 2XETA 1XVSA 2BNUA 3FQWA 3K3QA 2C4XA 2O5NA 5LDSA 1W72H 4YFDB 5HDWA 2HFEB 2H1PH 1U4EA 3KWXA 3KNBB 1WS7A 1AFVH 4JY6B 2B39A 3C60A 3QWRD 1I9IL 1ZWIA 5C7ZA 4HAKA 5KAQF 1JDCA 1S78D 3KDPB 1KY7A 4PM1A 4JZJC 1DJXA 3EW3B 2QQKL 5FX3A 3CFKA 5L7XH 1UT1A 1NDMB 1U6AL 2F2HA 3F64A 1J05A 2JNZA 4AC4A 1KPVA 1TQWA 3MV7D 1S7XA 3UL4A 2B5IC 4TNWF 2ZWZA 2TRYA 1SOKA 2VMJA 4DK5A 4I0KA 1FE8L 1UM4L 2DQJH 1YEDB 3ZYJA 1Y6KR 2YBRA 4OGXL 5F0LB 1EDQA 3VXSA 2A6JB 4JQIH 4EZJA 3B9KA 1F6FB 2UV3A 5GS0H 2OMUA 1GC1C 2KLTA 2JELH 2XVGA 4FA7B 5J12B 4PHZA 4AQZA 1DBAH 2P5EB 4Y8DC 4NBXB 3GRGA 3QH3A 1IEAA 3L95B 4Y8AA 3GRWH 3AADB 2AQSA 4MSWB 2EO9A 1CR9L 4MS8D 3RDTD 5IIEA 3BAKA 3AWFA 3PHOA 3DI3B 5AAWA 2A83B 5E2UH 1S7RB 3IS1X 4PVMA 4H25A 4G2AA 1Z9MA 1ZEAH 5EDSA 2H1PL 4OQTH 5IHZA 1QBBA 1BJ8A 2P24A 3MN8A 3K74B 3IKCA 1O7VA 5JHMA 4LNRA 1BMGA 4LQFL 3TIEB 5DQDH 3ULVF 3WSQH 1B4JL 2PLTA 4N8CH 4OV5A 5HHPB 1IGIH 1A6UH 3FUEA 4CAGA 4F58H 5F2FA 2BWDA 3CVHB 5L7XL 2WVUA 2J8HA 3BKCL 5DFTA 3V4PB 3G5XA 3TA4D 4JEGB 1IC0A 5BJTA 3L6FA 1MELA 2MHAA 3OKEA 3MGAA 4NZRL 1H6UA 1KV3A 1I8KB 2K3TA 3HBQA 4Y9GA 5BRZA 3B5TA 4JG1L 1A9BA 4FFWC 4PJGA 3CGTA 1IGYA 5HYJE 5EO0B 1Z5LB 1HZKA 2J1KA 1UD2A 3LOWA 4GRMA 1R33A 3D39D 1RFDH 8PAZA 5GS0L 1VGEH 2JELL 3LEXA 2YD8A 1DBAL 1QLEL 3L2MA 4S0SD 4GAGH 4M1GH 2GYSA 3BDXA 4GMSL 4YVNA 1EEUA 1LGVA 3DBSA 3MNVB 2O5XH 3O81A 4B95C 1JXJA 3VE0B 3ZKNC 4N0FB 3W2DL 2VLKE 2YMXL 4TQPA 2X6UA 3D25B 4FQIH 4OQTL 3F12B 4KQ0A 5HVGB 4RFNC 1GYCA 1QQDA 3SGJA 1KNOA 2W07A 1CXFA 1ZLUH 1DJZA 4Y88A 4HOMA 3HB3D 3HTLX 4GW5A 3VXUA 1M57B 5DQDL 3EZJB 1AXIB 1A6UL 2CM5A 2ZCLH 5D6DC