2J43A

Alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
ASHHLRMHFKTLPAGESLGSLGLWVWGDVDQPSKDWPNGAITMTKAKKDDYGYYLDVPLAAKHRQQVSYLINNKAGENLSKDQHISLLTPKMNEVWIDENYHAHAYRPLKEGYLRINYHNQSGHYDNLAVWTFKDVKTPTTDWPNGLDLSHKGHYGAYVDVPLKEGANEIGFLILDKSKTGDAIKVQPKDYLFKELDNHTQVFVKDTDPKVYNNPYYID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPYDX
publication title Identification and Structural Basis of Binding to Host Lung Glycogen by Streptococcal Virulence Factors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Carbohydrate-binding module
total genus 38
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A02
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A01
2J43A 2YOCA 3N0AA 3V0DA 5BZZA 5BUGA 3V0IA 2J73A 2J72A 3V0JA 2YA1A 2FHBA 1D5RA 3AWEA 2FHCA 3AWFA 5BZXA 3V0FA 3AWGA 3V0GA 3V0EA 2J71A 3V0HA 2FHFA 2J44A
chains in the Genus database with same CATH superfamily
3DECA 5DZLA 4K3JH 5TDOA 4EN3B 1THAA 3KPOA 4OKDA 2AZUA 4NP9A 2X44D 4OKVB 1YDPB 1YCSA 5EUOE 1GS7A 5H2BA 5KYUB 1L9MA 2XFXB 5HPMA 3TO4C 2N3JA 1K2DB 1UD6A 1OL0A 2PCPA 3QQ9C 4XHQA 3IDGB 1BQLL 2YN3A 5EU6D 3MU3A 2J1KA 1ZTXH 4R26L 5T3XH 4MJID 4KX7A 4N0FB 5EU3B 2XBZA 4IRJC 2XRAH 3NZ8A 1NCBH 4N9OB 3IMRA 3TFBA 4MXVE 1M3JA 3T6VA 4M48H 5IESL 4JFVA 1HXKA 2WP3T 1RJCA 2BO0A 3GBDA 2HKFH 3I9AA 2NX5B 3RU8L 4N26A 4RSVA 1EAQA 1I8KB 2P5WB 1OEZW 3CVDA 4Y5YC 4H1LB 5F96L 1KTDB 4P23B 5DJZA 3LH8A 4TL5A 3S3BB 3GZPA 3WKMH 5KN5B 2BVOB 4EUPG 2J1YA 4FEMA 3JUYA 4L2LA 1XV8A 1NWOA 3QAQA 2QQLL 3FQRB 4TPRL 2IWEA 1X5YA 3J8F7 3MCKB 1IBDA 1IFRA 5F9WB 2KZBA 3MA7A 1B2WL 4PJAA 3LPPA 3DVFA 3KLHD 5ERWB 3JWDH 1U3HA 3GBEA 2Y6TE 2NLJB 4TSAH 3D50A 4FFTA 2FEEI 2RHEA 2ZD0A 1EXUB 3MV7E 4AWJC 4FXKC 1A1MA 1N8ZB 1I3RB 2YEZB 4JW3A 4LCUB 3DV6A 4JRXD 5G5DA 5HGGS 4FA7B 5T1DH 4IM8A 5CBEB 3HRZA 1A4KA 1DQQA 1ZT4A 1BFVL 3UCRA 1FFTB 3PAZA 5H37G 4P2QE 2ODIA 2EKSB 4Z0XB 1DLHB 1RIVL 3ROLA 2F7IA 5I1LA 1FNSH 4Z0BH 2F18A 2ZUUA 1ZSDA 3WLWD 2IO5A 3L1FA 4H8WH 4NQEE 4L4TA 1AFVH 1XD1A 2FJSA 4WKZB 4OLZH 3VU2A 2BRRH 4OLVL 4QD2E 5JXEA 3P30H 4FKHA 4N0CD 2CO7A 3VQLA 1SDDB 4Z3HA 1GCFA 1F00I 2EH8H 1GZHC 1SHSA 2NXZB 4HEPG 1UWGH 2NQDA 1CBVH 4HIIB 2R0ZH 2OLDA 5GIRA 4ESKA 1U3JA 3T5WA 5K9QG 2DJSA 4C83A 5DK3A 2EXWD 4HZLB 4YHNA 2KPNA 3GS7A 1OT4A 2CPCA 3ILQC 4QRSB 1CD8A 3KWTA 2D03H 5I16B 3T08A 3KYNB 1XR9A 1CN4A 4G5ZH 3RVXD 3NEEA 1I8UA 2IH1A 4DAGH 5AW5B 2AGJL 2D9CA 4G7YH 4TSCH 4RETB 4LQFH 5D1XD 5EEVA 5E95B 15C8L 5AEAA 3K7UA 3CFJB 1HTYA 2BIOA 2E4TA 4YE0A 1UZ6E 5C0ND 1ZHBA 2A7BA 5GSVB 2XQYA 4NJAL 5DLML 3LDBC 2QGEA 5LLIC 5IJCC 4LASL 4UNTA 3QB7C 1JSYA 5CN3A 5IHWA 5L4MA 4IBVA 1L7IH 3ARXA 5AW3B 3CN0A 2A6JA 4RFEA 3U6XA 4AXWB 4PY8J 4FNPA 2D2CC 3X3FL 2DW5A 2O5XL 4JRYD 4UV4L 3ZMEA 4ZS7L 2BY3A 5ACZB 4YDIL 4NO2A 3LIZL 2VMDA 3T0BA 1OOAA 5GGRY 3X1NA 4X6DF 1KJ2H 2R7EA 4ODXB 4QOKA 1IE4A 1YQVL 1K5NB 2VH5L 2ADJA 4AC2A 4OUUB 2H2PD 1KB5B 2J44A 4WFHE 4P5TC 2Q76A 1WA0X 3PGDB 1S78C 5BUGA 4EN3D 1A64A 4WW2A 4DERA 2VSDA 4XPAL 1JXGA 2EIMB 4KRPC 3GSWB 1ERNA 1J88A 4XRCA 1WE5A 3A24A 4YC2C 3RHWF 3EGXB 1Z5YD 2K7PA 5HPOA 1NBZB 5GXBB 2ATPB 3IDXH 3OKOA 1SEBA 3RBSA 2OZNA 4QKXB 4QRPB 5PCYA 3NJNA 1VFAB 3BZEA 3QNXA 3ZDWA 1YEKL 2WZAA 4MFHA 2ZQKA 1PEWA 4UINL 4CSPA 5CUSL 3BMVA 1KBKA 2IGTA 5EEYA 2X0UA 3CVHH 3UPRB 4ZDHA 4M7JH 2XA3A 3PF2A 3I6KA 3C6LC 4TVPE 2TRHA 5ESAB 1CD1B 5DJCA 1YJDL 4X9FA 5HHOA 3U46A 4OV6F 5AW0B 4GKNA 2UWEF 3GMMA 1JRHL 1R24B 3MLVH 2EH7L 3QUMH 4G9FA 4PJ8B 4PHZA 1TVHB 5IQNA 3SDAB 1BBDH 1VGKB 3FKUS 1OAYH 4L1HA 3STZA 2P5WD 4PG9B 5JHLA 2ZTBA 3IFOA 4I9WE 3SODB 1ZIAA 4PJ7B 4RZKA 4P23D 2A73A 4JCLA 5FM5O 3SGKA 3BVTA 2XT1B 3O3AB 5C0RL 2OMXA 1JWUB 3PS6A 4CGUB 2ATKB 1VACA 2GTWA 3TO4B 2MKLC 1AE6H 4WUUE 5D1QB 1TPXC 1PKQA 2VC2L 1X7QA 4MAYC 1USZA 2H8PB 2KH2B 2IQ9L 1IC5L 4R90L 5D7IB 2O5YL 3OBAA 4WO4D 3VGDA 2N01B 1L6ZA 1QBAA 2G3MA 5HYSB 3NACH 3I2CH 4KJYB 4WNQB 1RMFH 2UY7B 2Q7AA 4F1ZA 4PTUA 1NGXB 3EH1A 5I8CB 1UKSA 5DYOA 5EEUA 3GBNH 2V7HA 4NKOB 3D33A 5BRPA 3SKOB 1Q90A 2ICES 1JV2A 1A9BB 3LZNA 4I0PD 1YN7A 1MCEA 5JHLL 4PD4J 1ECZA 4LESA 3RNQB 1PJWA 4KK6C 2X3CA 5E9AA 1HAUA 3RUGE 3U82B 3SDCA 4YUEL 1BVLB 4AH2B 1QTPA 3E6HA 4NO5A 5KTEH 2I9LB 2RFXA 2A4CA 1TNMA 4HC1L 1PZAA 3AACA 3MGAA 4AC4A 4S0SD 4XXWC 1DANU 5ABAA 2NXZD 3OR7B 4NQVB 5AAMA 4YDLC 2Z8WC 2JIXD 4OY9A 2R2HA 2X89A 5CO1A 4O02B 2FEEL 4UU9B 1Z7JA 1HILB 1NCCL 1QNIA 3Q2LA 4MNHA 2NR6C 3N42F 4RCAA 1AANA 1XCTA 3BUPA 3OTTA 4YSSA 1CDHA 1FZOA 1BQLH 5DI8B 5FO8A 1VEPA 5C9JA 2XI9A 4R26H 1GYVA 2ZE0A 1AS6A 2OMVA 1I7TB 2GSGB 3L16A 4GPVA 4DGUA 1G7JB 5F1SA 4MRBA 1R47A 4FLHA 3HNTH 5CZXC 1IM3A 1JZ2A 5IESH 3AT8A 3Q8EA 3RZWA 1KEGL 3S3JA 4D9QD 3T4AC 2VSMB 4X5RA 1I3VA 4K5MA 2XKSA 4P2OA 2H6PA 3NZSA 3RU8H 1PZSA 4TQHA 3VFMA 1H3XA 5F96H 3PWPB 2ZUTA 1RERA 4UDUA 2UVFA 4XP1L 3QORD 5F21B 4P9ML 4HIQA 4F33A 4UQ2A 4FMVA 5IK3A 4YHOL 2LV4A 3HZKA 2XJKA 1U8CB 2QQLH 2Z1PA 3GSXA 4TPRH 3RVVD 1R5VB 1WEJL 5F7UA 3G9VA 3QIWC 4BKSC 3PPSA 4I18A 3ULSB 1B2WH 1IGML 1U92B 5JOPD 4U1JA 5BW7C 1B6UA 5B4MD 2BVQB 4X6BB 4ZUTA 5C0EA 4HJIA 3JWNH 3CZUB 3W39A 3K71B 3M86A 3LDBB 3JTBA 2WVVB 3S35L 1X4ZA 3O4LE 4HLJA 1BFVH 5E8DL 2EEXA 3KYMB 4HDIB 5FB8A 1E2VA 1RIVH 3U4AA 3ZRCC 5FWRA 1CL7L 4XMXA 3L3DB 4JS7A 1B4JL 1UXSB 1WG3A 5GHWL 4IOSD 3ZE2E 2Y23A 3OJDB 4PJEA 3QDMA 2R23B 4L9LA 4MMZA 3H4HA 2WSKA 3UO8B 4OV5B 2WTRB 1HH9B 4OLVH 3OAWA 4PAZA 4R7LA 1G9EA 3ABKB 1WFNA 2AAAA 3RVUD 3QJHB 4ZW7A 5EEWA 4JQXC 4OZFB 2ZX6A 1J05A 4C56E 1SXSA 4HSQA 3O3DA 4YIQA 4P5TB 4BQ8A 1QFPA 5J6HB 1W15A 3SDAD 4PJ8D 1A6TA 1NQBA 4JG0L 2PTVA 4M8UA 4P59L 1JZ8A 4N8VA 5HGDA 1H19A 1BOGA 4JKWA 1KCBA 5E24E 5F7FA 5IROC 4Z7UA 3GMPA 3O3UN 5ISZE 3GPSA 2DL9A 1ETB1 4ZO8A 4FHKA 1E43A 3N40F 1JPSL 4NNXB 3C12A 1MNUL 2YD3A 3LQAL 1SN2A 4JQIL 5D1QD 5GRJL 1DFXA 4GQZA 2AGJH 4LEOB 4QRBA 1BFTA 3IRPX 3MRQB 4YFLI 4QGTA 4QYOB 1KGYE 15C8H 1YN6B 3GXDA 1A3RL 1MAJA 4NSKB 1MUJA 3UJTL 5DQ9B 3C6LB 4NJAH 1TVBA 5DLMH 4MDIA 3ARYA 1ND0A 3WL9B 2YXVA 4JFUA 1X4XA 1T2QL 4LASH 3TVMC 2B1OA 4HUXB 3I02A 5IY5B 3CQFA 2WBJD 2H47C 3A21A 4RESB 3P11L 3GYRA 4FLSA 4EMZA 4IKJA 4NHUA 2FYYB 2R59A 2FWSA 3X3FH 3HAEB 4WFED 4MJ6B 2MRYA 3SYCA 2O5XH 3OKYA 3OJMB 4UV4H 4UTBA 4ZS7H 1MVFA 1RL1A 3D9AH 3LIZH 4YDIH 4FXGA 1EZLA 3BP6B 1MCDA 1AHKA 5DVPA 4Z7QE 3S48A 2HX7A 4G82A 1D9KA 1TPXB 5CZVL 5ID1B 4BFEA 5DVLA 3CSYA 1JK9B 4LARL 1YQVH 5INDA 1VAHA 3SN6N 5C0GA 4QYAA 1DSFL 2AITA 3LPFA 4HP5A 2JKJA 4R4FL 2VISA 2AK1L 4GSQA 5E4OA 3D30A 5EBLB 3PWUB 3ZJAA 2LAAA 4UBDC 1AGDA 3DRTA 2YPVL 3ETBJ 4OFYD 4WWOA 5TK2A 3BVWA 3L3GB 4CVZA 4XPAH 5CWSA 3WIFA 5HVHC 2E6JA 3WENA 4ZMTA 4ZQTA 3SDXF 1OTSD 2CCWA 4J28A 1MVYA 2VL4A 2HJFB 3MBEA 1CQYA 4DGVL 3RGBA 2B2XL 2ZNXA 2CR3A 2KZ1B 2OR7A 4OLEA 4XNAA 4GQQA 3ME0B 4UF7C 5DHXB 1YEKH 4UINH 3EJQA 3HZYA 4UTBL 1T5WB 3HN5A 4S1SL 5CUSH 4E5XG 3OKNA 2QZ5A 1S9XA 1RURH 1XGYL 1P1VA 4LLMB 5F3HB 2CDFB 3SYAA 3OL2A 3PWNA 3QJUB 3P9MA 1BYPA 4HUVA 1YJDH 1CI3M 1RJYA 3P9LA 2X4PA 2W38A 3C87A 5E99L 2CUHA 1L7TL 1JRHH 4DZ8A 3EH5B 2EH7H 2I24N 2X2YA 1CLCA 3BP7B 3C60D 4NOFA 4WWKD 1E28B 1S7UA 2Z1KA 5ICUA 4XX1G 5C07D 1PY9A 2V0AA 1R3HB 3LKSA 4KK5C 1ZGLM 3PWPD 2CO6A 1WBYA 3UO1L 4Y19E 3UP6A 1TU2B 1BOYA 4NHCL 4WNJA 3VWJB 1EFXB 3PABB 5D72L 3RX7A 5C0RH 5L2KA 4YQXL 5F6IC 4YDJA 1N12A 4K9EL 2VNCA 3A4DA 2VC2H 3IDJB 5KSAB 4JFED 4PJXB 1IAKB 1J86A 1X4YA 4KTDL 2IQ9H 4JFFD 1IC5H 4R90H 2CLVA 5KJ4A 3S3PA 5E5MB 2O5YH 1HHJA 4UB0L 4PU2A 1IQWL 1HDMA 4LZKA 4Z7VB 2R69A 1E4HA 4BKTC 4MYPA 3T4AB 2Y7QA 3KYKL 3A22A 4WHDA 5FWQA 5AZUA 4MQXC 2XQ0A 4J3XA 2DI8A 1UH3A 5D2NC 3KS0J 5FOBA 4EQ2A 2XN1A 5A2FA 1RSYA 4QRAA 4EKJA 3FCTA 2X9YA 5KOMC 2F8IA 3MUZ1 3O3BA 2XWBA 2V5YA 4U1GB 5D1ZD 3A6CL 1TQTA 4OCWL 4RGNC 5KBKA 4PB0L 4P4KA 4ZNCD 2X4UA 1ZA6B 3EDDA 4MD5B 4IBYA 3ZDYE 1MHPH 5EH1A 4YUEH 4MNQE 4Y4KD 4ZOEA 1F4AA 5T1LA 5LN8A 3QFDA 4BFIB 2FBJL 4HC1H 3UZEC 1NCDL 4S10A 3FZUC 4Q6IA 2GEQA 2I27N 4HAFA 1IC4L 3DX2A 4MCYA 4U4IA 5FECB 4UOW1 2W0PA 5DK0B 3IJYA 4FEIA 3RWDB 2DI7A 4WUKL 4KNUA 3X11B 1RXLA 2R69L 3SE3A 5F3BB 2XWCA 2E7DA 4NUJA 1NCCH 4ETQB 4X6CA 1MZYA 5C2BL 2IOIA 5HVWA 2AK4E 1EANA 1CDUA 5DUJA 1U8KA 4JHZA 3CC5A 3L8QA 5EPMA 1WWWX 4ZFZB 5CJOL 2FJGA 1CIDA 3GTNA 3RRQA 4B9GA 3ISYA 1ZVYA 2K3HA 3HB3C 2WO2B 1PU0A 1KIUA 5GISL 1QUNA 5IQOA 2EABA 1OHZA 4NJ9L 1KEGH 3OC8A 4G8FA 3OV6A 2HG5B 4B97A 2ZX5A 2NYYC 5C71A 4WTQA 3TP4A 2XCMC 5DUPL 3AS1A 3CV5A 3UX9B 1LO0L 3FO9B 1WRFA 1RZKL 4JZNB 2J72A 2ZAHA 4XP1H 4IHBA 2W8CA 4P9MH 4X5XB 2GB2A 5L8LB 4DETA 4FQLL 3LS5L 1QRNE 3ARGA 2AQNA 4B5ZA 4YHOH 1TNNA 1RP9A 2GK0A 4B6ZA 1HHGB 2UXVA 1MIEL 1WEJH 3JBG7 5BVJA 3UBXG 2XA8L 1DVFC 3TBWB 4AYEC 5SX5K 1IGMH 1ADWA 1YPZB 4QRQB 4UCFA 5F1OB 4RX4D 4Z6AT 2PP7A 1T83C 2VLLA 2UZIL 5CP7B 3P73B 1ZTXE 1WAPA 2BSBA 5T3XE 2C3VA 2YUWA 4OF5A 2C9PA 1XF5B 2I25N 1U8OA 3FQNB 4KJWD 3B2MA 4PRPB 3UAEA 4ABQA 4G8GB 3SOTA 3S35H 2BSTB 2BWIA 5E8DH 1R3KA 5J9PA 3NSFA 4M3HA 4DUXA 3FFCA 1HH6A 4B9IA 4F8LA 1CL7H 4RZCB 1B4JH 3D5OF 5GHWH 1OF2A 3CXHJ 2MNWA 1V5JA 3TTSA 3MRIB 1E2WA 3C8DA 2ADGB 3DTDA 2DKMA 3VFOB 1PG7X 3KLSA 1AGEB 2ARJA 3DROB 2MCAA 1QD0A 2I07B 4NN5B 3KYAA 2X4SA 1VDGA 1C5BL 4PLOB 4UM9A 4U7SA 3B7UX 4MQ7B 4HIJB 1NL0L 4HFUL 4RMSA 4JFQA 3QH3A 4P59H 4JG0H 4KTGA 2PCYA 4XE0A 1LP9F 3IEAA 5HD8C 2WQSA 1EMTL 1YYML 4S1DD 3IKCA 4XNZC 2QV4A 1NOLA 3FTGA 3HE7A 3VWJD 3CTTA 3SDDB 2XWJB 4A04A 1EFXD 5T5FA 4MS8C 1FAKT 2C5DC 2WZ0A 1JPSH 3B8SA 3LKRB 5K69A 3D08A 2XBTA 2FO1A 3KXFA 3DIFB 1ZVSB 3DXAE 1MNUH 4O51B 3LQAH 2P1YA 4JQIH 2WLKA 5GRJH 2OYKA 4KKCC 4PGEA 1Q9WA 5KSAD 2QGCA 2EEFA 3W1ZA 2ZOTA 4FFZA 1NBCA 4OZGE 4DQOL 1NGYB 5F2FA 4U7MA 3NBNA 4FG2A 1A3RH 2I26N 4BUQA 5IVXF 3IVKA 1FVDB 4DK5A 3UJTH 1L5GB 1LWJA 3HBQA 5KSBB 1T2QH 3CDCA 4Z76B 2DDQL 1RKRA 2QDVA 3UP1A 4BA0A 4N2FA 3VFSA 2VM4A 5BS0A 5E8EA 3P11H 1N7ML 3R0MA 1BM3L 4JFHE 1KIRA 4NN7B 5EZJA 3GSOA 3A67L 1KLFB 3V6OA 1DVUA 2A77L 5JR1L 2BK8A 5T1JA 3IPBA 2WV3A 4GLRI 1WDAA 3DPBB 3E7JA 3MLZL 4JREC 5BV7L 5F6IB 1C12A 3PJSB 4P9HC 4BBWA 4OCLC 4KY1L 4WIQA 5CZVH 3U9UB 1U8LA 4LARH 2F53A 2ENPA 1DSFH 3TA3C 1WV7T 4R4FH 2AEPL 4WU7B 2AK1H 3D3VB 1VESA 1KBVA 4MAZA 1DQLL 5I75C 3IN2A 1R1CA 1D6VL 4F2ME 4M5ZL 2YPVH 3SE6A 4B3EA 1KTLA 4HJ1A 4M7ZB 2H9GA 2YUXA 3CJJA 3NFPA 2Y7NA 1QSZA 2J5LC 2FJUB 3O6FC 2GCYB 3F5WA 3S3CB 4XZ4A 1F3RB 5D2NB 4F37F 5JOFA 5KYXB 1HVXA 1JZHA 4DGVH 5BRZD 5D9SB 2B2XH 3SB3A 4LPCA 3KGRA 3NIGE 2PF6A 3KPQA 3L7EB 2X38A 4J3BA 4UTBH 4S1SH 2EO9A 2IAMA 4NKIL 1XGYH 1BA9A 5L6YL 4JVPA 5T3ZL 2VMCA 2VTFA 2OMNA 3BQUA 5E99H 2EXTA 1L7TH 5B8CB 1VERA 5GPRA 2GY5A 2MTPA 4LL4A 4MSWB 5GGVL 1HEZA 1Y0LA 3Q8FA 4JDZA 1FZJA 1PZ5A 4BUHA 3UO1H 3QUKA 2EEAA 4NHCH 3QUYB 5D72H 4HWUA 1FSKC 2E9IA 4TV3A 4YQXH 2BNQA 1U95A 3L3OB 5IMMB 4K9EH 2JVUA 4JDEB 4A2MA 1E9PB 4R5VA 4NUPA 1QEWA 2WVUA 4LF3B 4Y5XA 3D0AA 2OPCA 3I3EA 4KTDH 5JA8B 3W0WB 2QTVA 3AGVA 2Y07L 3GPEA 1EWHA 3V6BR 3HB3B 4UB0H 4YWGL 1IQWH 2CE6A 2Q6WA 4QJ3B 4CKVX 5FUCE 4OSUL 3D2UA 4CN6A 1SJEB 4PRPD 3KYKH 4FFWD 1JJUA 4K7PL 4OVUA 5MENB 3RNKA 2VR3A 4EIGB 2X6BA 2ROXA 4Y4HB 1JPEA 2P8PA 4J3OH 4ADGA 4ENZA 3N41B 4YPGA 4M7LT 2YD9A 2EQDA 2Z64C 3A6CH 4OCWH 3TNMA 4PB0H 4LMQI 2PPFA 4G8IA 4Z7AA 3D09A 2APVA 3HN8A 3A4FA 2PW2A 1A7PL 3Q8AA 2FBJH 1NCDH 1E2ZA 3ATBA 4JFDD 3ISRA 1TCMA 1IC4H 3TEYA 4GEJA 4X5WB 3T0EE 3UPCA 3PUCA 2EIZB 1A14L 2I7OA 4WUKH 4XBEL 3QJRB 1KLGB 2R69H 3O9WC 3Q9QA 3M46A 4LCWA 3S5LG 3VRIB 3VG0L 5C2BH 5JTWA 1XB8A 4YBQD 1VF5C 4IRSB 3SDDD 5CLYA 6CGTA 4DSYA 3LKNA 1B0GA 1UT2A 4NQTA 1DE4B 5CJOH 5JHDD 4PREB 2EO1A 1OSZB 1CGWA 4UTCA 4QAWA 4PR5A 5HHMD 1NMBL 3Q0HA 4AYFA 5KS9F 5GISH 1OP3H 5H94A 4TQ8A 3UGEA 2YD2A 2CGRL 3M1BB 4NJ9H 2YPLB 4P2RA 3WTUA 3KLHC 1B3JA 2PP9A 4FRWA 4Z7WB 1RK7A 1AYOA 2Y7OA 3CHPA 3IBOA 3V2AR 5KANG 5I73C 4N85A 4YHKL 5DUPH 3U0WL 3MJ8A 1AQ8A 2B3IA 3TPUA 3OX8A 2VR4A 1G5GA 1LO0H 3WN5C 1RZKH 3ZXAC 1EO7A 1V10A 4GO9A 1TJMA 3LPWA 1XGUA 2FE0A 4MA3B 4FQLH 4D0CB 3LS5H 1DCLA 1S8DA 2RD0A 4HX1A 1MIEH 2WPGA 2YGPA 2OI9B 3WLWC 4LKCB 1VPOL 2XA8H 3PWVA 3S8FB 3W9DA 3UTQB 4UNIA 3EJPA 1A0QL 2ZWZA 3H54A 1T7WA 3PNWA 1XBRA 2OS7A 3QFJE 1QHOA 4XP9L 2DH3A 1TQBC 3B2VL 2UZIH 5DRZB 1AS8A 2JQAA 3D3VD 3PL6D 4AZ8A 3WJJC 2ZCLL 1LHZA 3DSNB 5F0LB 2BNRE 2KQMA 3ZO9A 3GXPA 3KPRA 5GGSY 3VUAA 3QEQE 2VLJB 4PG2A 3B9EA 3ARZA 2WKOF 4R5XA 2FO8A 1EEYB 1WHOA 1ZLEA 2XZCL 5FYKL 1DR9A 5G4NA 1T0PB 4HETA 4ALAC 1R5WB 4FHBD 2AEWA 5D7EA 3MRNA 3H55A 2KZWA 4Y9FA 4M02A 1T04B 1ZS2A 3MOBL 2UUDH 1FYTA 3VI3F 4HKJA 4MMXB 4JREB 4Y2NA 2P9RA 3BAYA 1FI8C 3MRJA 4YHZL 4R3SA 4L8SA 3QK0A 4KXBA 4AYBA 4F5CA 1IGFL 2R0KL 5EIIG 1BMZA 1C5BH 1FZKB 2YMXL 1PF3A 5C0FA 4ZFOB 5I1AB 3BEVB 3DX7A 1HQ4B 1FV1A 1NL0H 4HFUH 1M7IB 2DQGL 1ORSA 4NM4L 2L7QA 5I75B 4QXTA 1N2RA 1A7QL 1I1AA 1EMTH 1YYMH 4M62L 3TONA 2GFBA 1KN4L 4UT7L 5AZEL 3OHMB 3S37L 1UWYA 2JV6A 2CUAA 2KT6A 3VYOA 1KEML 3LKQB 1JYVA 3BT2L 3TV3L 3BP4A 1UWFA 3BC9A 4NIKB 4PJDA 4PRIE 5CEXB 4JN2A 5DJ0B 3P77B 2J1XA 1ZV2A 4WFGD 1J9TA 4DQOH 2YD6A 1NINA 3T65B 2VQ4A 4JVWA 5GJSL 3QR1A 5BMFL 4Y1AA 3M7FB 1JF1A 1X3DA 1ZANL 3ECWA 3MBXL 2DDQH 4MWFB 3VFPB 5EUOB 3SJVB 1TKWA 2AEOA 3VXTB 3RTQA 5E1GA 1FLRL 4S1RL 1WZKA 2HFEA 1BM3H 3KPNA 3WLBB 5AVQB 5EMYA 4MJ5A 4Y4HD 3THML 3A67H 3U7WL 2IANA 1UKQA 2A77H 4HV8B 4PJAE 3LMJL 5JR1H 1A4JB 1XH2A 2C1OA 5D55A 4ELDA 3KS0H 3MLZH 3RDTC 5BV7H 2EDHA 4L5FL 2DAVA 4KY1H 4EI5B 2BS8A 2AJZA 2AQTA 2Z92A 3CUPA 3OAZK 3TIEA 4D0DA 4IBTA 1SOQA 5IV2A 1V05A 1KJVB 2AEPH 2JKIS 3BEWA 3DETD 3HG4A 3UTTB 1J1XL 2CA3A 3TBVB 1DQLH 4B7IA 3RVTC 1D6VH 3QA3B 4XN2A 4M5ZH 3V6ZB 1S7RA 2O6CA 4HLZH 1NGZA 4XX5A 3UGUA 3ULAB 2Y1YA 4A7UA 2FHFA 4L4TE 5CKAA 4YLCA 1JS4A 1X44A 3MO1B 2XG5A 1YEDA 4L37A 1E8XA 2P5ED 4GAJL 4NNPL 4IRSD 3OGOE 3WHXA 1P1ZB 1HHIB 2WINA 5DYFA 3G5XB 3GSNL 5I71B 5IVZB 4ZMYA 3EZ8A 2CBQA 2NZ9D 1S7QA 5DHVH 4NKIH 3T3PE 2O72A 3CFBA 3GHBL 4K0OA 1MXGA 1S4IA 4CDGC 5L0QC 5L6YH 2NSXA 2EDBA 4N6RB 3MV7B 4F24A 3QQ4A 2EYSB 5T3ZH 4Y16A 2GITA 2YPLD 4PJ7F 4ANKA 4BFOA 4TKWA 3ARDC 4HJJL 4WO4C 2BIHA 5GGVH 1KLUB 2ZUQB 1ETZA 3P9WB 5HHXL 4PMEA 5INCA 4B27A 2WQXA 2XXGA 2ZWNA 4NQEB 2WXQA 1JCKA 1AR2A 1M4KA 5CILL 3CQQA 3K72A 2XX0A 4NWTL 2EP6A 3G08A 5JUEL 1ZLWH 4NQSA 1BX2B 4L3FA 3T1WA 1DQDL 1S7XB 3C6SA 3VX1A 2Y07H 2DWEB 9CGTA 3V4PA 4BFGA 2OXGB 4YWGH 4BFFA 1LQSR 2DTML 4OSUH 4HZAA 5IJKC 1W0YT 4M61A 5HHOD 3BD5A 2HPOA 1U93A 4K7PH 5FM4A 3NFSL 5I9QC 2AXFA 4R6UA 3DUUA 4FQPA 5HI3C 4N2DA 2DIEA 2J3SA 4QY8B 4QOKE 3CMOL 1HZLA 4KBPA 4PW3A 3EXLA 3L4ZA 5DD1L 3UPAA 5B1JA 2D7OA 1A7PH 3OKDB 4NO3B 2W9LA 1UQSA 3SD5A 2FVNA 4PJ5B 3LNGA 1GJUA 5GGRA 1P0SE 4QKTA 1G7QB 2BP3A 1UADC 3Q6FB 1KG0A 3IU3A 2CAKA 2PXYC 3NSCA 1A14H 3PP4L 1WCBB 4E36A 4HGWB 4XBEH 4P07A 5AOJA 3ZTNL 4PJBA 1QP1A 2E86A 2O93L 1W72B 5BZDA 4LE8A 4PV8A 3VG0H 5ANMA 2DLTA 1LEGA 2ITCB 3NABL 4J12A 2FLMA 3V4LA 2ED9A 2J55A 4HU8A 4IEFA 3K46A 3CMGA 1E0OB 3QORC 4Z3JA 5HHOE 4AGPA 5ALCL 1FYHB 5HJ3B 4G9FE 1SBBA 1ACYL 2J8UA 4PBVC 3RVVC 5IF0B 2DH2A 2JI3A 1NMBH 2BC4A 1AQDA 1B0RB 3ABLB 3QWRA 2IFGA 4H26B 3SDCD 1J8KA 4A2LA 1N3NB 7TAAA 2CGRH 2NY2C 3MX0B 1F3DJ 4JFPA 2Z6FA 5HTSA 1BQHA 1KGWA 3FSAA 3TT1L 3BT0A 4YHKH 3U0WH 3BGFB 2JELL 1JHLL 5AOMA 2O61A 2IBZX 3B7TA 5H4ZA 1PKQE 2A6IA 1W91A 4HBQA 5L7XL 4W81A 5K59E 1JGLL 1U58B 4LEXL 3SE4C 2JJSC 1NLDL 1KACB 4HGMA 1TYEB 4B9ZA 4U1IA 4PJIA 4XNUL 3O41B 2H7WA 1R3LA 2YK1L 3CFUA 1AD9B 1Z9OA 1TYJA 1OP5K 1AKJB 1CFVL 2DKSA 1A0QH 1HXYA 4N3UA 3MNWB 5DGQA 1HSAA 1YC8A 4XP9H 3NJKA 3B2VH 3PUUA 3KJ4C 3UTTD 2ZCLH 1I8MB 4H8QA 3LN4A 4ODWB 2UZXA 3DO7A 5KVFL 5E8NA 1ET8A 4AQ1B 5I15L 5L4JA 1T0NA 1XEDA 4H8HA 4H1LG 4LDEB 4B5EA 5D6DC 3L1OL 1KJMA 2XZCH 3D39B 3F00A 5FYKH 4JZOB 3ZT5A 5J6GA 4PD4K 1ITBB 1F86A 1DEEB 1MWAB 1T1YA 1XAKA 2DQMA 4GRLB 3RIFK 5JORA 2XICA 3MOBH 5IB4A 1KNOB 4NPYB 3BRDA 2OTPA 1FL6B 4YHZH 2ENJA 2B0SL 3K6IA 4OJEH 4TUJA 4JZJC 3GIZL 1A6AB 1IGFH 2R0KH 1NPNA 2YMXH 1TSRA 1ULVA 5DEZA 4F2EA 3FB7A 4GKSA 3HE6A 3LD8B 4QHLB 4RQQB 1RU9L 4ZAKC 1XH3B 2APBA 3B9VA 2BVPA 2QGDA 3EFDL 3S36L 2DQGH 1K9TA 2JK5A 4NM4H 1G5AA 3C8KA 3SO5A 5IB2A 1SVCP 2Z8SA 1A7QH 2EAEA 1MFVA 3IDMA 4M62H 4ODTH 4QR7A 4EZJA 1KN4H 1M71A 4M5SA 4UT7H 5AZEH 1W8OA 4EUPA 1UD4A 4ISVB 4UMGA 1IJ9A 1PQZA 2WBJC 3S37H 1QW9A 4W6WB 4OCMC 1XGTB 1KEMH 3VFNA 3BT2H 3TV3H 1PAZA 4IJ3C 5C0AA 2GJ6A 1AGFA 2YD1A 5JHMA 1YRKA 5GGUB 4LIQL 1MLBA 5GJSH 4JE0A 4PVMA 4NZJA 4NQDB 2YC1A 4GINA 5BMFH 3FHAA 1I9IL 1MCWW 4NZUL 2VLKA 4HFWB 1ZANH 3MBXH 5DEFB 5ID0A 1FHNA 3R18A 2P8MB 4XHJD 1MPAL 5EB9A 4WF7A 1FLRH 5H37A 1S7TB 2ZF8A 4S1RH 1ODUA 1NUGA 2Z31D 3F83A 4Y2DB 5IW1A 3THMH 3U7WH 2QR0B 5FXCH 1NC2A 3DJ9A 3LMJH 3TLRA 4GW4A 4Q4EA 3VXPA 2ZYHA 4NFBA 1I9RL 2D8KA 1AY1L 4XOAA 4HZ1A 4L5FH 2HLAB 4IHOB 3O45B 1BZOA 1TQWA 3EBAA 5CM1A 5JOEA 5HVGB 3DYMA 1TZIB 4PJ5D 4HEPA 3DVGA 3CFDA 4RIRB 5AG9A 4OZIB 3GJFA 1J1XH 3QRFM 1SQMA 3FRPA 3ZE0E 3Q5OA 3QISA 1V27A 2EUZA 2Z35A 5EOQL 4PRHB 4X0NA 5EO1A 3EFFB 1S9VB 3R4RA 4LDOB 4R4BB 3QQDB 1QI5A 3QDME 4PJEE 2AJSL 5AOIA 1YHPA 5LB1A 1R6VA 4NZDA 4R0LA 3C60C 4WWKC 3WIHA 5C8JA 4GAJH 4NNPH 5GS1C 4NP4L 3GKZA 5FF6A 4C59B 4UT6A 3WN6A 4E2OA 4N87A 1S9YA 4N8CH 3ISWA 5EC2B 4L29B 3GSNH 4X4ME 3QXAB 2QJDA 1YY8B 4L3EA 5KSUB 3VA6A 4ZFFA 2XLLA 2WHVA 2CCVA 2HZHA 1P4LB 2IC2A 2CHZA 3QS2A 3GHBH 3HLAA 5BQ7A 2AHIA 1S7WB 2FHCA 3KPPA 4DESA 2OL3B 4Z7UE 4HJGA 3D0VB 3FH8A 4HJJH 1JGEB 1F58L 3O4LB 3U4EA 1MAKA 5CLZA 3NSDA 1I7UB 5HHXH 1MCKA 2PXYB 2A4ZA 2XETA 4G8EB 3MI6A 3H7LA 1F97A 4WENB 2SEBB 4A2FA 2C4FT 4UQIM 3WEMA 4LLUA 5F72S 3KWUA 2WCSA 4PJXF 3FU7B 2BIQA 1NFDE 3FCBA 3RZCA 4N2NA 5CILH 4IGBC 1EEZA 3WIHL 4NKMA 1DJIA 4LVNC 1M6OB 4NWTH 1ED3A 3DVNA 5JUEH 4WI3A 3US0A 4Z7VF 4QF1B 4U31A 3PDGA 5F6HI 5DHDA 4J2XA 5FDWB 3MBED 3BFQG 1G6RA 5CD3B 1JNJA 1DQDH 2Z91B 3DMMB 4C56B 32C2A 4APXA 3GHPA 1E4XI 3QJXA 3AREB 3JWOC 1K8DB 4WO0A 4Y4KC 1P5VA 4HAGA 2HAZA 3OG4B 2JKRM 2BFVL 1RHHB 2DTMH 3PDOA 5TJWK 3T1FB 1UXWB 3WKQA 3FUEA 5ISZB 2V2TB 2BRQA 5E9DB 1KENL 1W0WB 3D85B 2CR6A 1VFBB 4ZUVB 4CVXA 3AITA 5IIEB 1HCZA 2VDKL 1SDYA 5TQ2L 4YAQA 2VXQL 2YAPA 3D39D 5F6HJ 3CMOH 5T5NF 1OZTG 1DDHA 5AVWB 4I2XA 5DD1H 4EVNA 1I1YA 2BIPA 3DC0A 3P3SA 4GXVL 4A7VA 3K2IA 1H8LA 2ZOLB 4YNYA 3VXOA 3FB8B 3TJHD 4DGIL 3EDFA 2NY3C 2Q10A 5HYSG 1YEHL 3EOBB 3PP4H 4I13B 2FUQA 4QRRD 1NAMB 1ZLVH 3ZTNH 4Q89A 5I30L 1Z3GL 3F6IA 3JTTA 3KPSA 1SXCA 2PN5A 1NH6A 3S98A 2CMRL 3PWLB 4JFWA 3NABH 3WNJA 5DO8A 2YA0A 4OLUL 2HUHA 1MAML 2NY5C 1OAZL 3MRDA 3VGEA 4ZK8A 5A2BA 2X12A 1IAII 1KCUL 2A9ML 5GQBA 3FUMA 2I9TB 4AT6A 5I17A 3ENEA 5ALCH 4GKZA 3GI8L 3TNNB 1ACYH 3ARPA 2CXGA 3US9A 5IHHA 1S7VA 1HN1A 3VXNB 3EF4A 4NQDD 1NIAA 1FP5A 1QBBA 4K8RD 5ITBL 2VDRL 2EDQA 3Q2NA 5L2KE 3TT1H 4JJHA 1MHHA 1IGJB 1JHLH 1VZGA 2JELH 2FZ3B 2ORBL 2VN4A 4IU2B 3V7AE 4NUGL 1BAWA 3DURB 5L7XH 5AB0A 1E5AA 1JGLH 4LEXH 4Y2DD 5ITFA 1NLDH 4LVEA 4QTIL 4MJJA 3ZR6A 1N6UA 2ROYA 1YPZF 1IBYA 3LVTA 4A2DA 4EZLA 2WMPA 2PPDA 4XNUH 3G5ZB 3VRJA 5A2CA 3U2IA 3WNOA 2YK1H 3EAKA 1ACZA 3P69A 2ZIDA 1EDHA 3FAXA 4Z3IA 1CFVH 3FOMA 3GMNA 2XNAB 3BPOC 1BSIA 1CU4L 3TZVA 4YGVB 2QKIC 5JMOC 1BPLB 1U4EA 1I75A 4LLYB 2NY4B 2HVBA 2P80A 3RFZC 4ADJA 1H5BB 1FH5L 1SOKA 1T20B 4PRHD 1HINL 3POCA 4Y19B 1WHPA 5DMGD 5KVFH 1DVQA 5I15H 2BXZA 1NOAA 1J12A 3PAYA 2UVEA 3H9SE 1QZNA 2YZ8A 3L1OH 5I0YA 2FK9A 4U3SA 4WDIB 3GZQA 5DJAB 1L4IA 1SXZA 1OGPA 2VB5A 1JGDB 1OP9A 2RMNA 5E0QA 1DN2A 1UH2A 2AJ3A 4C4UA 1T7XA 3MMEB 2B0SH 3UADA 1KY6A 5CEYA 2N56A 2Y7LA 3HG1B 4C57C 3FQWB 3GIZH 5D70L 5MHSD 2ENQA 3VFVB 4G1EA 2ZT9C 1U8HA 1RU9H 4WI0A 4NZ8A 1A6VL 2G5UA 2JNZA 3S36H 3EFDH 4KI5E 1F6AA 1X5FA 4KUZL 4ZMAT 1YNKL 3MR9A 3P0YL 2WOYA 1QSVA 2YPKB 2ZXAA 3BSZL 4P5MA 4TNWF 4WSGA 4LCVA 2WUBL 1EGJA 1LEKB 2MCPL 2GSIB 3FF8A 4MNGA 3ZDYB 2B15A 5I66B 4MNQB 1Z5HA 1HSBA 1C7TA 5TH2A 1XF4A 3NRFA 3L2NA 4ORZC 4MKMA 2C26A 2H1XA 3I9GL 2QVTA 5GRXG 2VN3A 4Y5VB 5KSBF 4LIQH 5LAXB 2VO8A 4DCQA 3CZEA 2WZPD 4H8VA 4HIEA 3IF1A 5TD4A 2OTUA 1XZ0A 5T1KB 4KKLD 4OZFG 1KMGA 1I9IH 3B5HA 1CCZA 3BWUF 3SEPA 2NY7L 3A47A 4U1LB 5AL0A 3CFKB 1F8TL 1TEGA 4H20L 3VM5A 2FQEA 3HS0B 1LE5A 3N43B 1MPAH 2FCBA 4U7KA 3NK3A 5E9DD 1CG9B 4N90D 1FN4A 4N0UE 2AEIT 3KL5A 1A5FL 1FG2A 3F12B 1OLZA 4KK8D 3B9KD 1SOSA 4NUQA 4ZXBA 1EGJL 2C7UB 3PIQB 3NIFE 3TO2A 4EUPH 2V5MA 1I9RH 2JXMA 1AY1H 4JQVC 1PEZA 5F7NC 4LVNB 4X6EB 1T4KA 5EUKB 5FUCC 1XSJA 3OR6B 1AP2A 4O2CA 4OIAA 5C08A 1PGRB 2K6WA 1INEL 2CRYA 4WFFE 4WI9A 3QJTB 4WHYG 5TE7L 4JL1A 3UG3A 1EZUA 3FH7A 2XTSA 5CZKA 1V3KA 3E8UL 1KGXA 3FFCE 5MP6L 1UWEL 2X41A 3D05A 3IS1X 5EOQH 1BREA 4QXUL 3ZTEA 1BZ7A 1MOEA 3ZY7A 3EYFA 1PIGA 1M1SA 5DJYB 2JB6A 2EKJA 5IMKA 4JFSA 5AB1A 3GUTA 1QRNB 2HRHA 4L4VD 4NP4H 4ZMOA 3U83A 1MJJA 4WK0B 1E50A 1N5AB 1BQSA 4FF9A 1KYFA 1KXTB 3HAEG 5DD5L 3NJIA 2FNBA 4WK4B 2ZOKB 2R83A 2APWA 3I75B 5MI0C 4OD2B 4PJ9C 1H3GA 1X5KA 3NK4A 4I48A 2A5UA 1T2JA 4ZX3A 5E00B 5DRNA 1ZT7A 4K71B 3TASA 2DIBA 3X14B 1TZOA 1Q4NX 1GOGA 4MASA 1QSEA 2PYFB 1DZ0A 3RVWC 3DTXB 5ESQB 3U2SA 2G9KA 1F58H 5GS0L 3GJFH 4NO0A 5D4IA 3KXFE 1WGVA 4EOWL 3QHFL 1ZT1B 1H8NA 3ARFA 4KO6A 3EO0B 4UANA 3N9GL 3S97C 1ZGLP 3FU8A 4AIXA 1WJ3A 4M1CD 3WIHH 1N0XL 3PHOA 3HUJB 4H5SA 3W11D 2XWXA 3ZU8A 5D7JB 3DOIA 2NZIA 1Z3RA 3AVEA 4AM0B 5I6NA 2D3LA 2ZWKA 1N4XL 5KSVA 1SF5A 1CGVA 1GC1L 1OCZB 4NYLA 3MRKA 5BS0E 2QHLA 2WLLB 3BPCB 4M8VA 1E42A 5E1AB 2BFVH 3WO4C 5IHUL 3BDBA 3D0LA 1AIFA 2G60L 3N41F 2NY4D 3V6OE 2PNDA 1KB9J 5FHAL 3BQUD 1KENH 4P3WA 2DYPA 2X4RA 4RWYL 2VDKH 1QTYT 3C09C 3X13B 4CSSA 1WO2A 3DXAB 5K9OA 5TQ2H 5J4MA 1XH0A 3RGHA 2VXQH 5T3ZE 2F53E 5D4QA 1ZXQA 1RIHL 1A7BA 1A1NB 4XPFL 4YBQC 4ZODA 2MOQA 3DLQR 2OM5A 1JCVA 4E5XA 1RSFA 4GXVH 2Y22A 3VMNA 1LE9B 3B37A 1TMCB 4DP9X 3HG1D 4ANUA 4DGIH 1WBXB 1SGKA 5CS7A 4X6DA 3UTPE 1YEHH 2B08A 3H7BA 4CVUA 3LRKA 5I30H 1T1XA 1Z3GH 4HA1A 3WNKA 4BH8A 4CC1A 3QZLA 4PTTB 3WIAA 3D2UD 5FEBA 2J4WL 3FB6B 1OALA 2A0LD 2CMRH 2FJHB 1A1OB 4APQA 2GEEA 4YZFE 4OLUH 4BHUA 1KYDA 3V5DB 1MAMH 1ZCRA 1OAZH 3CH1A 4UAOC 4XVUC 1IEHA 5IFJA 1HHKB 5I1IL 2A9MH 1KCUH 4QHNA 4AJWA 2IXQB 3DX4A 1TCRA 4N5ED 2Q2EB 5GZNA 3GI8H 5G55A 4QRUB 4Z7WF 3GIVB 4LSPL 2YARA 5ICXB 4U6YA 5T5NG 3D87B 3MUY1 3VH8B 3SCMD 2J2ZB 4B95C 1IE5A 1IL1A 4NN6C 5T1KD 5DZ9A 4YS4A 1AGBA 2G0KA 2ZKMX 2Q87A 3D18B 5ITBH 5SWZA 2VDRH 3C5ZD 3FTZA 5MEPB 2BNQE 3OPZL 2WXHA 2ORBH 3PL6C 4BFRA 3TF4A 4R7NA 1AO7D 2RBLA 4AIZA 3FQUA 1YMMA 4NUGH 2UWEA 1XR8A 1QKZL 2G2RA 3NIGB 4QTIH 3VXRD 2BNUA 2ZXGA 3DK0A 3SGEI 4Z7OE 2NY6B 2WZ5A 2F15A 1J0YA 2GJRA 3FH5A 4F3FA 4PQXA 2XN9B 4NCC1 4XGZA 3VVVA 5CEZE 2XY1A 3MV11 3MRRB 3AU1A 4R2GD 1FFOA 3GLZA 1CU4H 5EHFA 3BAJA 2X6MA 4HUNB 4HEMA 1KJ2B 1BD2A 1T0MA 3PQYA 1FH5H 1HINH 3CHRA 4P2RD 1OSYA 1U2YA 1UD2A 1ZHNA 3GM8A 4TNVK 1HQRA 1U3HC 2CH8A 3MLXL 4DP4X 4HUUB 3WO3B 3U1PA 1MI5B 2DWXA 1ITCA 1FH2A 1KTCA 4PFEA 4ABVA 5A6LA 5C3IA 4TQIA 5F97E 3T09A 2UYLA 1ZV5A 3HRZC 4DEUA 5J06A 4M8QA 5JW4R 3EOAB 1G0XA 2B5IC 3ZKQD 5C9KA 2AXGB 5FYLL 2V3DA 4GW1A 2RIKA 5D70H 4LCWE 1QZ1A 4IKIA 3RB5A 2C9SA 2W9EL 1A6VH 1RZPA 1ZLDA 4MD0B 3UCQA 2XTJE 4KUZH 4BEIA 4CW1A 1YNKH 1F2XK 3P0YH 1Y18A 1WUZA 3BSZH 3L9RB 1YY9D 4GUOA 2NUPA 1K4DB 1A3LL 2WUBH 2MCPH 4KX8A 3QUMB 5JDSA 3GNML 4PRAA 3RWIB 1WWAX 1QFUH 1CGXA 4U1KB 3ZKND 3JVGA 4X9IA 4KKPA 1L3NA 2BWQA 3G5YA 2X2HA 3I9GH 3UBXA 5D7JD 1N26A 2R2BA 1HL4A 1HNFA 1IBHA 3LEYL 4D8PB 2IBZY 5MI0B 3DHUA 1F02I 4ELMB 2NUTA 1UENA 2ZAGA 3HVNA 3T0EB 1GZPB 5I8OL 5GZOD 3CDGA 2L7EA 4MDJA 4P99A 5FYKE 3RWFA 1M2VB 5ILTL 2NY7H 4BK4A 5F9OL 1F8TH 2R29L 4H20H 1RUKL 3FUDA 2Z93A 4OAWB 1AIZA 4PJFF 3WNMA 2JQMA 2ZXBA 3APNA 1XF3A 5HGBB 1BVKA 3V0DA 4XXDA 4K4KA 5D7LA 1A5FH 2CBOA 3AG3B 1S5IL 2F54E 3OAYH 5IEKA 3UEZA 2P49B 5AW2B 2V2XB 4G9DB 1EGJH 2HH0L 3NSYA 5C0JA 4JNXA 4FCHA 1I85A 1QVOB 2P24B 1TXKA 1Q9OB 3JUZA 1XXDC 1FFPA 2GUYA 1B6DA 1U2CA 4PCTA 2HSIA 4HHGA 3STLA 3KPRE 2QQNL 5TE7H 2ZCHL 4Z77A 3TC9A 5IB1B 3E8UH 5MP6H 1UWEH 4U1MB 4K7FA 1NCIA 2K3TA 4PI0A 1NPUA 4QXUH 3VXUA 3WO4B 1YJDC 2CXKA 4Z78B 3ZZQA 3DX8A 4F37K 4JKKA 3I85A 1TENA 2OJ1A 3N1MC 2QADC 3RL1B 4JE4B 1FYTE 5MEOA 5FYJD 5GGSA 3REVB 4WW2C 3BMWA 4G6AD 5DD5H 3VDBA 2GT9A 2BVYA 4F5CE 3QCUL 1RJLB 4MDRA 1H6FA 3LH2L 2X6AA 1XIWA 4MVBD 2IAND 1M53A 3SD2A 5BOZG 4MZRA 2DPKA 3LX9A 1UHVA 1MG3C 1C08B 4R7DB 4FOMA 2PWFA 1W0VB 2NNCA 3CZNA 2NW2B 4QTHB 4ZMWA 5GS0H 4JGMA 4H0LC 3QEQB 2C8NA 4L5FE 3VXMB 4ELKA 3BGMB 3G04B 4EOWH 3QHFH 2WB7A 4QHPA 1L9TA 4BZ2A 3BUIA 4PJDE 5B38B 3N9GH 3OGCA 3JTSA 3DRQA 2BS9A 4KOCA 5HY9A 1N0XH 2NY6D 1E9OB 1BIIA 1H6EA 3KPOB 4ZSOA 2EYTA 3CLWA 4Y1AE 5FHBL 4PYGA 3SGKC 2FQFA 1IAIH 2HMID 2ICWI 1N4XH 3ZKXB 2X4QA 3BUYB 1GC1H 5F1KC 5HHPA 5IHUH 2EZ0C 2G60H 4AE1A 4CC4A 5FHAH 4GRWE 4JRFA 1Z0MA 1P2CA 1TYRA 3FB5B 2FH8A 4RWYH 1SF3A 3B1TA 4NBXB 5E1HB 4YSDA 4Q97A 3QJOA 4QRTB 2NCMA 5CSGA 5EZOL 4HLEA 4KITB 4BZ2L 1MI5D 4PRIB 3ZPDA 1RIHH 3QZMA 4OJDH 4XPFH 2KLSA 3DX6B 1P7HL 3ILPA 3ZTJH 4F7EB 3OKMB 5J8OA 4MZ2A 3KLAA 3UFIA 4NCDA 2G2NA 3QCVH 1RI8A 3FT2B 4ORGB 5AKRA 3SDCC 3F7VB 1QRKA 3WUZA 3H2QA 1FZMA 5LAPA 2TAAA 1G7LA 1I7ZA 3QIUA 4HJ0C 1KPVA 2ZUVA 3A6OA 3NCXA 4HKXA 4YO0B 3FPYA 3HR5B 2J4WH 1XVSA 1ILSA 1XMWA 4PJAB 3T2PA 4U3HA 3FK3A 5AAMC 3NQKA 1U3HB 5DQDL 1PNCA 2GBTA 3PV7A 4JMNA 2LVEA 5I1IH 3MRPB 4AYMC 2BM3A 3IDUA 3SDXA 3SGJA 1X5ZA 4LKXB 1SLXA 3K91A 3MNVA 2Y24A 5BZWB 4FFVC 1A4KB 1C7SA 2NTSP 5CNHA 1BLNA 4LSPH 3II3A 4ODBD 4L0ZA 3BKMH 1XGPB 4PW4A 5BQDA 3GUFA 1JI1A 2P4AB 3FONB 3MBWA 1RY7B 1NIEA 3B6SA 1BQUA 4GUCA 3EGDA 3OPZH 4EO5A 3A4AA 3QUXA 2JLLA 4N2EA 2NQCA 2FT8A 4HT1L 5IMOB 3H0TB 3ZGHA 3H9YA 4TLKA 3T4YB 4JPWL 1QKZH 3WUWB 4JKMA 4A67A 4P2OC 1MREL 2VXVL 3T77A 4NENA 3QRLA 4XCNA 4KQ4L 1Q9LB 1HWWA 2HT2C 5AKTA 3NDYE 3RWJA 3T3PB 2PO6B 3DKHA 2LFEA 3MLYL 4GXUM 2VDML 4C83B 3HI5L 2ADIB 1IQDB 4AKPA 4Q9CA 1DJGA 4JDVA 4JG1L 1KWKA 3S8WA 1F13A 1Q0YL 5C09B 1N6VA 3L13A 3GKWL 2RALA 1LILA 1CLOL 2Q3AA 1PS3A 3BH4A 3EO1A 3UC2A 3ULUD 4JO1L 3KW8A 1HXMB 4I18C 4LEBA 1FFNA 4N3TA 4OCRH 5DVOA 3E2HB 4JM2D 3S5LA 4BXVA 1J5OL 2R2EA 1M9WA 3MLXH 1TSHA 1ZJAA 3UTZA 5IBTL 2A83B 5AOLA 4F15B 1ZAGA 1LO5A 2TSBA 1ZHBB 5I8EA 1JN6B 5F0MB 4Y8DC 1MCFA 1DQVA 3MGTA 2Q7NA 5ALBL 2WIMA 2WXMA 3U0PB 5EORL 2XVGA 3GMRA 4F57L 3VX0A 1U8NB 1CICA 4KNTA 3OKKB 3KPTA 5FYLH 3FMGL 5IB3A 3FT4B 3LQAC 4PJBE 2NW3A 4TS6A 4CN4A 1YQ2A 3VWKA 4L9LC 2WIIB 3LRGA 4GH7B 4MMZC 2UV3A 4OF3A 1IEAB 1QLFA 3NCCB 2W9EH 3UYRL 3FU3A 3QDGA 2VDLL 1CGTA 1GYUA 1EHNA 1F1AA 3VXMD 1QO3B 2R7EB 1JGVL 3BFWA 4QOKB 5I24A 1A3LH 1UH4A 1V7ML 2ADJB 4ETYA 3P0VL 4KNSA 2J8UE 2Q76B 3GNMH 4RAUA 2C3GA 5A2LH 1U3ZA 1RJZB 3KM2A 4IDLA 4P46D 4WW2B 1RIUL 3EBIA 5KVFE 4PJ6A 4I77L 3RKPA 3N2JA 3QI9A 5H35B 4Y2OA 3LEYH 3BZ4B 1JNLL 4XRCB 2L7JA 5I8OH 2FEDD 4EBQL 2VC2B 2A9AA 5ILTH 5F9OH 3MQIA 4OVVA 3QXVA 1T1WB 2R29H 1JXJA 1RUKH 1LGVA 4U2ZA 4X6CF 2JSFA 4PJIE 5I0ZA 2WC7A 3WAJA 4ZDHB 4ZW5A 5JZ7C 1ET5A 1S5IH 5C7ZA 2V9UA 4KU1A 2MKWA 1HNYA 1WVZA 4AITA 4GKNB 5BO1L 4OZIF 3HG3A 4HIHB 2GHWB 2Z7UA 2HH0H 5JIDA 3PP3K 4Y4FA 4P9HL 2ZKYA 5AVSB 3TYFA 4AGQA 1R5IA 1TDQA 2W0FA 3IFOB 3B2UD 2CDEA 3WY1A 1J1OL 3JV5A 2QQNH 3IAGC 2ZCHH 4NC1E 1QFOA 1E4WL 2OMXB 5J3HD 3KBHE 4FXGC 3EG9A 3L7FB 5DHYB 3LZFL 1D9KC 4UOZA 1JD9A 1PKQB 2O5NA 5B7EA 1BXXA 1BVZA 1ZWIB 1CBJA 3E80A 1JWSB 1VFUA 1WFOA 1LNUA 2CKBA 3KDPB 4FQXA 4LIQE 4OFVA 1X5AA 2AI0L 4UI2A 4ZMQA 2BOBA 4XCFL 4HUKB 3H3PL 4LPXA 1IZJA 1PDKB 4RWHA 3QCUH 3UYPB 1HK6A 3NRQA 2A9CA 4KJQD 3LH2H 4NDMA 3LPOA 4HD9A 4Z95L 1JZ4A 3OWRA 5CU5A 4ZD3L 3IJ7A 4MA7L 8FABB 2V7HB 2Y0SA 3IJEA 4OW6A 3MBEC 4ZFGL 5E6ID 2WWMC 2CGYA 1EDYA 2O4EA 3FO2A 3GXUB 4XNMA 1AOZA 2FSEA 4AGMA 2QQKL 4NS0A 1ZD6A 4HMEA 4NO5B 3VI4F 3CCHA 1KV3A 1M56B 2RFXB 4BH7B 3APMA 3F05A 5C0AE 2GJ6E 1CLVA 3JXAA 3OHXB 1U21A 5DUBB 4POZD 5D5MF 1X9UA 5DO2D 2UXTA 2WXOA 3GXFA 4MJIA 2VUYA 2WQAA 5GRVL 3UEQA 1KIPB 1WZMA 4FQ1L 2GJZA 2KDYA 5FHBH 2R2HB 2PO6D 2R15A 1EDQA 2VLKE 4J8QA 1RAMA 1OY3B 3W9EA 2GTZB 4ZPTA 3OMIB 5KYWA 2HVJB 3DARA 5C09D 5DFAA 2OX5A 5FO8B 5LGHL 2M1KA 2ZKXA 1FIEA 4F93B 2X1QA 4PJCF 4GOSA 3QIBA 1ORQA 2LGNA 5I5JA 5HBBA 1N0LA 1LTXA 2OMVB 5IVXA 3VCLA 4LPUA 1PFCA 4KV5F 4JM4H 5LDSA 3QEUA 1OCOB 5G4MA 5EZOH 4BZ2H 5JMRA 1KGCD 5DT1L 5AYTA 1ANUA 3ESVF 4JR9L 4JY5L 1G7IB 3TCLA 5EN2B 3AUWB 2ID5A 1K4CA 3LRHA 3IK2A 1INQB 2F19L 3RPKA 3S96A 1CFTA 1ZLUK 4P4KC 4BGDA 3L81A 1CDGA 4F33B 4E68A 3R06B 4TUOA 3FCUB 2EYRA 4JRXA 3GSXB 1QPPA 4OGQC 2WNKA 4K8RC 2BIIA 2HLFC 5FGRA 4Q6IC 3SKMA 3ULVE 2GYSA 4L3EE 2PCFA 1U8MA 3TBSB 2A1WL 1IBZA 5DQDH 2X7LB 5CJ8A 3JV4B 4LL9A 3D1MC 1E7UA 1RZKC 5C0EB 4J3WA 3CSGA 3QULA 3ESPA 4KXCA 1SYVA 4KTEL 3SE3C 3SGDI 3W39B 2CJ3A 1IC7L 1LJMA 5B1KA 4AMWA 4CGTA 4FFYL 3TN0B 2PYEB 5AD0A 2H2SC 1XAUA 4JFYA 4KI5C 4OFIA 4XP5L 4ZW3A 3ZE0B 1MCIA 1XCQA 3O4OB 3O3EA 3UL4A 4S11A 4KC3B 1L9SA 3OSKA 3QDMB 5E56A 5IHZB 4IMLA 1CD0A 2Y6SD 3MRHA 3DBXA 2VKXA 3ZT7A 4DVRL 1OSEA 5CJXA 1UJ3A 4HT1H 1ETJA 2J43A 1T1ZB 1J11A 1CXIA 2DM3A 4XNYL 2FO4A 4JPWH 4DVBA 1GTFA 3L3KA 3EYOB 4NAQA 3UIYA 4NI3A 3D4ZA 1UGKA 5C0BE 4W9IC 4YIQB 3O3DB 3FULA 1MREH 2VXVH 2V2WB 2CNZA 4P3CL 4KQ4H 2CRMA 2WXJA 4LLVB 4Y7MA 2HTKD 3QZPA 1PG7L 3BXNA 4CC0A 1HC1A 5K39A 3MLYH 5D1XA 2VDQB 3H85A 3HI5H 4N8VB 1BOGB 2OJEA 5HGDB 1UFGA 4JG1H 4Z7UB 3EJSA 3GMPB 2VAAA 4GIPD 1Q0YH 3ARGC 4JUTA 4XTRD 3U0TB 3U2JA 1DUYA 1XGQB 3GKWH 3RWCB 1H3VA 2X4OB 1CLOH 3WTVA 3HPLB 4M93C 4JO1H 4I4WB 3R0NA 3L4TA 3U30C 3SY0B 1J5OH 1L9QA 4JBSA 1NFDB 3V6FB 5LNDA 4KDVA 5D7SL 5IKCA 5IBTH 3QXDA 1J8HB 4GKOA 3HR6A 3BYYA 2GABA 4JRYA 1KCLA 2IVFC 3EUUA 1NZRA 4TF4A 2R0LL 5DEGB 5ALBH 4ALAL 5I0DA 5JIMA 4C4KO 5EORH 4F57H 3LS4L 3RDJA 5F7AA 4KXDA 1YZZA 3I02B 4S2SA 1VA9A 3UJIL 1IGYB 3FMGH 5A2IH 5BUAA 4E41B 3N44B 4YHIA 3U9PL 2QLYA 3EGSA 3KPSE 2SODB 1CXEA 3IETB 4OM1L 4PGDA 4ZMZA 3BH9A 3SZKC 3UYRH 4EN3A 4L1DA 4DN3L 2PTTB 5D93C 2VDLH 4KKLC 5DTFB 1WA2X 2XWTA 4OKVA 5DHMC 1YDPA 3VFTB 5CBAA 1D9KB 3G9AB 1JGVH 2EDNA 3L1GA 3CSYB 1V7MH 2XFXA 3P0VH 4FULA 3QDJB 1K2DA 1R3JA 3IDGA 3CZKA 3B2XA 1E27B 3KJ6L 1ZDQA 1TO5A 4WLCA 5KG9A 1RIUH 1E8WA 4N0FA 5EU3A 3PGFL 4I77H 1GYWA 4CVZB 1A8JH 3AB0B 1OCRB 2VQUA 3HE7C 4J1UB 3QQNA 2AS5M 1JNLH 2AQSA 2WXRA 3LH9A 5BV7C 3N43F 5EZIL 3LJ3A 4NI6A 1YEGL 5DDHA 1AHWA 4EBQH 5EO0B 1AMYA 3QPQD 5E4AA 1P5UA 5I1CL 3KNBA 1KIQB 3X1EA 5KS9A 4D0BB 4PLKC 1I8KA 2P5WA 4XO3A 2KI6A 4WGKA 4O5LL 2H1LM 3I74A 4H1LA 3A23A 5CSBA 1J9RA 2OFQA 5EU7E 4P23A 4RMQA 5KN5A 2ARJQ 4HUVB 1AQKL 1M05B 2BVOA 1CYXA 3FSZA 1FNGB 1RJYB 3P9LB 5BO1H 4IIQB 1ZY9A 2Y9RT 4DZ8B 2W91A 3FQRA 3NH7L 5FLUA 4P9HH 1A4CA 1S7UB 4X9YA 5SWQA 2F61A 1Q94B 3LKSB 4IMKA 3V6OC 1J1OH 2KERA 5ERWA 4WO4A 4AK2A 1E4WH 2UXGA 5LWYL 1T4WA 2NLJA 1KT2B 3DNKA 1EXUA 1N8ZA 1I3RA 2YEZA 1LD9A 3LZFH 4LCUA 2OCCB 4W6YB 3QE5A 3T0DA 1TQVA 1R75A 3CDFA 5CBEA 3H2PA 5J1AB 2G75B 1ZHLB 4WHTB 4U6VL 3KAAA 4Z0XA 1DLHA 2Q1EA 2AI0H 4I0PA 2H6UA 2IV9A 4XCFH 4KKAD 3H3PH 3MVSA 4QCIA 3H6JA 1HX0A 4R96A 2HX9A 2NXYB 5CLTA 2WKOA 2Y7QB 4Z95H 4ZPVB 1G7PB 3TN0D 2PYED 4Q8BA 4ZD3H 2FLBT 3HBZA 4MA7H 2Y1VA 1NKGA 2NZ1A 3E1ZA 1SDDA 3V0EA 4XBPB 4ZFGH 3ZT6A 5IJKA 4PN6A 2DZEA 3MZGB 2CHDA 2FT7A 2EVFA 4E0RB 5FO9B 1CDJA 2JIXA 3VI3A 4BFNA 2ZKHL 2ERJB 1WFMA 5EF1A 2QQKH 2DM2A 2Y7MA 4MNGE 1OANA 2IAMC 4G3YL 4QXVA 2EXYD 4K5NA 3ZK0A 4DJMA 3VGAB 5DC2A 3D69B 1IGTB 4PUBL 5T1LB 1FVCA 3H9SB 3AT0A 3HUJF 4JHWL 2H0EA 1F42A 4HZLA 1X5HA 4QT5B 1O6SA 3BQUC 1ZIBA 2ZYRA 4IKNA 4X9BA 3IXAB 1A9EB 5DMJB 4MCYB 1NDMB 1E5ZA 5I16A 5IMLB 1HI6B 3KYNA 2WNGA 5LBSH 5IQMA 4FQ1H 3IJYB 4KMLB 2GUOB 5AOKA 2J20A 1P9MA 2OW7A 4J4PD 3TH2T 3CFJA 5IVOA 5DK2A 3T3MF 1BXUA 1PNDA 2BOLA 2AXJA 1DN0B 1XO8A 5J13C 5DWUL 1JGUL 1KFAL 2BSRB 5LGHH 3DGGB 3GTTA 2CIIB 3IFPA 2HT4D 3P4MB 1U8KB 4Y5XC 2QSVA 5DZJA 1VLXA 5DS1A 1GSKA 3NIDF 3WD5L 3LQZA 1IFGA 3EOYG 4X7CC 3VM7A 4AXWA 4KROC 4MD4A 4FJZA 3L2LA 4DGWC 3AWGA 4LOUD 1MXDA 5C08E 4GG6F 4NM8L 1VJSA 2WK2A 4FADA 4JR9H 3DGDA 4JY5H 5A3ID 3RX9A 3IMSA 1IFHL 2QPFA 1RZ8A 1HWGB 4ODXA 1S46A 2F19H 1K5NA 4XPBL 4MKTA 1EAOA 3GSRB 3V9FA 4OUUA 5EBWA 3W2DL 4E41D 4X5QA 3MCYA 4UZUA 2W94A 3UXFA 3ARGB 3CHSA 3EHBD 2GC7C 2OTWB 3CHQA 5ESVB 4N0UB 4HCIA 4M93B 5L2JB 3C5ZC 2E8YA 4N1EA 4XMZA 1AD0A 3MJ7B 2W80C 3EGXA 2A1WH 5AFAA 2B9AA 2OMZB 3QDJD 3WKYA 1ZMYA 3T0VA 1CTNA 2YSTA 1U8OB 4KTEH 2ZG1A 1UYWH 1IC7H 1QSEE 4FFYH 4JO8A 2IDTA 4DWHA 3NGBC 3UPRA 2IDQA 2XTJC 2L4OA 4XP5H 5J9PB 1WFIA 3QGVA 3FFCB 3FOLB 2CK2A 5ESAA 1QSFE 2A74C 2YLHA 4G6JL 5CN1A 3RKDC 1OLLA 3KBEA 4R2GC 1Q8MA 1CGYA 4RA0C 5F1IA 1R24A 3SDAA 4PJ8A 5AVYB 1TVHA 4LHJB 1UVQA 2PWHA 4DVRH 1VGKA 2X2JA 5DXWA 4AEIH 2CBMA 3GWJA 4H0HB 3N40P 3D4YA 4PG9A 1F90L 1XF1A 5DA4A 2WLJA 4PJ7A 4XNYH 5F7BA 2GW5A 2X4SB 5FYKU 1ROWA 3O3AA 2BDNL 4G11A 1JWUA 4UM9B 3QT2A 4P3CH 2VXUL 3BD4A 3UJJL 2FX8L 5D1QA 2ZG2A 4OJAA 1PG7H 1GS8A 1NEZA 2D7NA 2FWUA 3ATAA 1FVEB 2H8PA 3BCFA 3IM1A 2B3RA 2DV6A 4J3OD 2ZICA 5DS8B 3K4DA 1OIOA 3HE7B 5D7IA 1AXSB 4QJ4B 5FGCB 2W59A 1DJWA 3H6AA 3H42L 2FIKB 5BV7B 5HYSA 3WNNA 4KJYA 3JYCA 4WNQA 3O2WL 4FC3E 4I1PA 4V2CB 5HSFA 4BRJA 1KB9K 5I8CA 2FT6A 2FR4B 5D7SH 2O5ZL 4NKOA 3CQPA 2EINB 3SKOA 4W93A 2VYRE 1RUQL 4U3CA 4ALAH 2R0LH 4HUWB 3RNQA 1Z5LA 3GBLA 4M9PA 3LS4H 4AH2A 1BVLA 5JHAA 2NXYD 4X6DE 4PG2C 2FQGA 3UJIH 3MA9L 3FYIB 3ZKNC 3VDCA 1LQBC 1T6BX 4BIKA 4PVNA 1BWMA 2IGLA 4XX1E 2WYTA 3U9PH 4F8NA 2IDSA 1QHPA 1MW1A 4DZBA 4OM1H 3DOSA 3OR7A 3IDNB 4NQVA 1C5DB 4BXSV 1N59B 4I85A 5DHVB 2YKKA 4OFYA 4DN3H 3H9HB 5CD5D 4XZUB 3MRLB 2VUOA 1NGPL 4O02A 1C12B 4L8SC 2IPKA 4UU9A 1MF2L 3QVAA 1BD2D 1HILA 3BDXA 1OXYA 3GDBA 3K4AA 1RUPL 4URTB 5B3SB 4PJGF 5CZRA 2QSCL 5DI8A 3MAWA 4ELMF 3KJ6H 3MUUA 3DJSA 2WYZA 1I1AC 3PGFH 2ZP0T 4GI8A 5FFLA 1I7TA 5SWZE 4WI7A 2GSGA 1B2YA 2P46B 1G7JA 3KVDD 5SV3A 4G6KL 5EZIH 5B39B 1YEGH 5JOFB 3EYQC 3EJYD 3O8XB 1YMME 1AR1D 1Z1WA 1NFIB 3X12B 2UWEE 4OU3A 2Y5QA 2XG4A 4GMSL 3VSVA 5I1CH 5BCAA 4WWKA 4E9SA 1GRWA 3KPQB 5E2UL 4UUJB 5F70A 5GS1A 5FYLE 5C07A 4O5LH 3MJ9H 3PWPA 4XP6L 2FBOJ 1J87A 4JHBA 4Q9QL 5C6WH 1AQKH 2WM0A 4LCYB 1R46A 3V52H 1OB1A 2IADB 1TUPA 3RTQC 1U8CA 3NH7H 1R5VA 5D4JA 4JFEA 4G6AC 1IX2A 1Y0LB 3FQTA 4HEME 1FZJB 3IYLW 3L4YA 3PQYE 3ULSA 3VTMA 3ULUF 4JFFA 3VGBA 1JGIA 4X7SL 4XXWA 4MVBC 4JM2F 2FEJA 3TJEL 1G84A 1TJGL 4TLTA 3VJ6B 4YSQA 4U6HB 5LWYH 2BVQA 4WI8A 2WP3O 1N68A 4X6BA 2IV8A 4E9QA 2QHRL 3VXSB 3SOBL 3K71A 1P4IL 4X8CA 2WVVA 3CZSA 4Y5XB 3CBKB 4NRXB 1BMWA 3BN3B 4LB8A 4U6VH 1UCTA 3KYMA 1F4WL 4HDIA 4CADB 4Z7OB 3VW3L 5CMAA 4UYQA 1U8QA 2XPYA 1PZBA 5D1ZA 2Q6WB 4KROB 4YSOA 4BDVA 3OJDA 1NCHA 2R23A 1UXLA 2R56L 1EUUA 3OQ3B 4OGZA 4Y4KA 2WTRA 4OV5A 4RAHA 1HH9A 4HJEA 1IIKA 1ETA1 2V7NB 3QJHA 4FABL 1NM4A 3MRCA 7PCYA 4OZFA 2R1WA 2OKMA 4OJCA 1PJ9A 3TNMB 3LKOB 2ZKHH 3LHPL 3ZLQC 4G8IB 5J6HA 4UIMB 3BOVA 4G3YH 1UD5A 3U6RB 1BJ1J 1IEBB 1MHCB 3GRWA 4M03A 4PUBH 4WW1A 5KBLA 4B50A 5DJXB 3OC5A 1NCAL 2BFGA 4Y16C 2WY3B 3GJEA 4ZUSB 1T66C 4UQAA 1L6PA 5F7DB 4NNXA 3FW6A 1QMUA 2YA1A 1H3TA 1G1CA 2CBTA 2D0GA 4LOFA 2Q7YB 1TTGA 5ADOH 1PVHA 4LEOA 1A7OL 2LW3A 5E03A 5BZXA 4PM1A 1I8LA 3B2DC 3E8VA 4KK9D 3B1UA 5DD3L 1V54B 4NSKA 2XTJB 3T0XA 1Q0XL 1JGUH 1KFAH 1T3FA 3FCSB 5D7LE 5DQ9A 5DWUH 4ODUA 2AQQA 2B39A 3LKNB 1B0GB 5FK9B 4HUXA 1NUDA 3NA4A 2JKTM 2D31A 3WD5H 4KKZA 4PR5B 1YECL 1Y6NR 2C9UA 4A2GA 1G9HA 3D12B 3HAEA 4MJ6A 3GRWL 1FL3B 2YD5A 4NM8H 4AV0A 2PTUA 3NG5A 2VN7A 3MZTA 2L0DA 2YO3A 4XC1L 3BP6A 5IG7B 3TXAA 1IFHH 2D3NA 3FUHA 4FLOA 3MJ8B 5I0VA 5ID1A 2ZF9A 2N0MA 1SJHB 3VXUE 2JQZA 2GVYA 1JK9A 2B16A 3C08L 1J0ZA 2ZX9A 4IOFD 4XPBH 4RDQF 3W2DH 4E42B 1Y07A 3EJZD 4RX4A 1FO0B 1XGUB 2VJ0A 3L45A 1ZOXA 4NBZB 5E4EC 5EBLA 4LCCB 2EICA 5B1JC 1S8DB 4EI0A 2LE9A 3L3GA 4YBLC 5DVKA 3PWVB 2F54B 3W9DB 2EDKA 3V95A 5I23A 1SY6L 4PGBB 3UERA 1GPOL 4PB9L 3GSQB 3FTSA 2NY5L 2HJFA 5D6CB 5DJ2B 3LPGA 3PWJB 5DQJB 4NKDB 3CFEB 3ME0A 4TM9A 5F44A 3BWSA 5I19L 4FLQA 1T5WA 3TFKD 4JM0A 3HW7A 2QKIA 4YGAB 5F3HA 4LLMA 1WC7B 2CDFA 4G6JH 4W6XB 3LNFA 5ENWB 3O8XD 2K4WA 3UMNA 3V79C 4HMDA 4PWHA 3BP7A 4G7RB 3CXFA 3VD2A 1E28A 4ZSOE 1R3HA 1F90H 3WEAA 3QNZB 3VWJA 2FIRT 4L8SB 1N64L 2G30A 1EFXA 2AW2A 4LHUB 4LO9A 2BDNH 4BQBA 1SJMA 3E9TA 5JQ6L 2VXUH 3DX7B 2FX8H 1FV1B 2J1WA 3FRUA 4WWNA 2HG0A 3NPSB 2VMJA 3IDJA 1OSPL 4ACTA 1ORSB 3V4UH 5KSAA 1VEOA 4GNKB 4PJXA 4RISL 1IAKA 1XEUA 1UWXK 5KWYC 1N2RB 1ZTMA 2VDOL 3DTUB 2HLEB 5E5MA 3WXVL 4Z7VA 3H42H 3OG6B 4MHHI 1PD0A 2IFFL 3QJSB 3QUZD 3K6OA 5F1NA 3VH8G 4EDXB 2QVIA 2R1XB 4CJ0A 3O2WH 4WCYL 4O2FB 3U7YL 3B9AA 4D9RE 4PJDB 2IQAA 3WFEL 4JN2B 4JGJA 2NPLX 2O5ZH 5AW6B 3GRBA 3RWGA 4AJVA 4Z3TA 4KZEL 1Q9KA 1QABA 1XCXA 1Z9PA 4MA1C 1U3YA 3P3YA 4HCGA 1ZA6A 2JTDA 3MRMA 4MD5A 2Z0UA 3IPFA 4BRVA 4NC1C 4QI3A 5EOTB 2YXFA 3J2PA 2UXFA 3MA9H 4BFIA 4XN8A 2DS4A 1TJXA 4UZGA 1B0WA 5I6LA 5IWLC 3ELAT 3GSNB 3UAJD 2XZQL 2VDPB 5EC1A 5FECA 1RZGA 1QWNA 2VLMD 5I1KL 1QWUA 5DK0A 1QAWA 1GAFL 2RQ8A 3TF7C 3RWDA 5A6MA 3WTWA 1NGPH 4W9GC 3X11A 4M7KL 1MF2H 1YEJL 2IDUA 4K23L 5F3BA 3SO3C 3SDXE 4D0DB 3CUPB 1RUPH 3VGGA 5GRYA 5F88B 3HE6C 4AYDC 2QSCH 1QG3A 4F9PA 1FBIL 5BRZA 2FQDA 2HRLA 2J6EL 3L3IB 4OF0A 3VE0B 4BA8A 1D5XA 1OTTD 3F7QA 4ZFZA 4DW2L 3RAJL 3MUGB 1QLRA 4JMXA 2BMKA 2H45A 1OGTB 5KAQF 1HWHB 2CBPA 3VXQA 4G6KH 2AP2A 3MLPA 1O9ZA 4QTFA 3WJMA 4DKDC 5BJTB 3QJQB 4NQXA 4A38A 1JXFA 1JZDC 3WHXB 43C9A 5HYJD 2HG5A 1OTUD 4GMSH 3ZL1A 3DPDA 4XCEB 5EZLA 5IHBA 5E2UH 4Q74A 1WYJA 5JHLH 4NQUA 4WGVB 4XP6H 3P0GB 2FYVA 1S9WB 4JZNA 3QDGD 2ARWA 1L0QA 4Q9QH 1IUZA 3SQOL 3QQ4B 1Y1UA 4X5XA 2IF7A 4FZ8L 4F80A 3NJLA 4RBPK 2YLKA 4G8AC 4Y16B 5FS5A 4V33A 4UQ3B 3DIVA 1QATA 2YQ2A 2E7CA 1ETZB 3E1F1 2BINA 3TBWA 3FFDA 5TDPB 4BE5A 1YPZA 5JPMA 4X7SH 4M5YL 3S35X 4B9KC 3TJEH 3M8OL 1TJGH 1NCTA 5ICZA 5A2KH 1A22B 2VE6B 1E3XA 4Y7OC 1JERA 3P73A 2R9HC 5TF0A 3KM1A 1AZZC 1CFNB 1XF5A 4PRPA 3SOBH 5BRQA 1P4IH 1WZLA 3IDYC 5CHNB 2EC9U 3FC8A 4GRMB 4P5KA 3GB7B 4ZMNA 4JPIB 3C6SB 3FUJA 1F4WH 3B43A 1LWHA 4PRBA 5FCUL 1W6WA 1OGAB 4RZCA 3F6LA 3TBYB 1DLFL 1B90A 5E23A 4LOVA 2YRLA 1ACCA 3TWCL 4LLWB 2Y36L 2R56H 4R0LC 4J5VA 2ADGA 4DUVA 2XQBL 4O58L 2R1YA 3VFOA 4P04A 4JFDA 1AGEA 3DROA 4LP5A 4AX3A 4FABH 4ZS6C 2I07A 4Y4FD 5KVGL 4O2EB 4JCWA 3WI9A 4FN0A 5B22A 4UT9A 3VMOA 3ULVC 4MQ7A 4HIJA 3FXIC 3LHPH 3RE0A 2FRGP 4OCYL 5CIPH 4HK3J 1EHAA 4PEEA 4FNRA 4YEFA 4KY2A 4ZG1A 1V7NL 1NCAH 1QPKA 5DGRA 4Z8FL 3SDDA 2XWJA 2K78A 3LZQA 3AT9A 4WU5B 5L88L 2HN7B 1G4RA 1JTTA 3LKRA 4HWBA 4O51A 1NLBL 3DIFA 1FNLA 3PHQB 3MV9D 4PJBB 4AW7A 1A7OH 4TN9A 3V10A 5F9DC 1FNAA 2MHAB 1J1PL 3I9IA 5BZDB 3MYJB 1NGYA 5EEZA 1MCRA 4WZ9A 1ZK5A 2IWFA 1LEGB 1UOKA 3RZCC 1HEHC 5DD3H 3CX5J 5DFWH 1G9NC 4ONHB 1FVDA 4W4NA 4MCZA 4AUYA 1L5GA 1Q0XH 4PWFA 2HT3C 4X99B 4IEFB 4TLSA 5KSBA 1JRHI 1QI4A 5IQLA 4AG4L 3L9BA 2N0KA 4UT9L 4DP0X 1EA9C 1DFBL 4JRWA 5JPNA 4W9DC 1YECH 4FA6A 3DI2B 1AQDB 2Y5TA 5B38G 5KZCB 3QEGL 3GRWH 1KLFA 4BINA 3D34A 5M94B 4AUUA 1SVZA 1JZGA 5BOPA 3C9NB 4I1RA 4BJLA 3DPBA 1BQHB 1MLCB 4K9JA 4XC1H 3SQRA 4AGOA 4DP7X 2V37A 1PW3A 1T5XB 3PJSA 3U9UA 1EVUA 4JANB 4PBWD 4MX7B 3C08H 5J1TC 3HBGA 3EDKA 2H0PA 4AE0A 4WU7A 3D3VA 3PL6A 2VN5A 3BWAB 2BW4A 4JJ5B 2DWTA 4G1MA 4U1IB 4K3HA 3F7YB 4R4NC 1GMEA 3BIKB 4PJIB 1UURA 4KDTC 4RMVA 2RR3A 3WDIA 4AYID 5HGAB 2XTLA 4GO6B 3D8MA 2GCYA 5SWSD 1SY6H 3QIBD 1MFBL 4PB9H 4AZUA 5DMYA 5KYXA 2NY5H 3H2WA 3JWNG 5D9SA 1M42A 3HAEH 3MRGB 1GGBL 2UZXB 3V8CA 1XBDA 3L7EA 5CP3A 5I19H 2GBAA 3AADB 4WWID 4KZDL 2HTKC 1T0NB 4YHYC 5HI5C 5GGTA 2GPZA 4Y88A 3MRFB 1TTAA 2WTPA 3IT8D 4W70A 1KJMB 1X5GA 5J6GB 4Z3GA 4AV5A 5B8CA 4KXZH 5EU6E 1GW0A 4QJ5B 2O6PA 4YSUA 5JXAL 2F74A 2D7PA 1I8AA 1LP9E 4MJIE 3BPLC 4YSCA 2F1BA 3G6AB 4N4YB 4RDQG 4WTZG 3ARBB 1NTDA 2YAFA 2XX1A 1N64H 5A1AA 3QUYA 1BZEA 4TUJB 4CDHA 2XV6B 2A3TA 5IMMA 3L3OA 2J5WA 3EO9L 4GKSB 4OD3L 2MH4A 3HE6B 3Q2VA 5ICYB 5JQ6H 3MOQA 1X5LA 4JDEA 1L9RA 1A6ZB 2F5AL 4NFCA 1OSPH 3OB0K 1ZHKB 4RISH 5IB2B 2JKSA 1BFSA 4LF3A 3RGVD 3UG5A 1G0DA 2VDOH 1JVLA 5F7KC 3NT0A 2OMYB 5IVXE 4GBXD 3QQXA 3RIFF 1HOCB 1KUMA 4GAAA 5DC9B 3WXVH 3KR3L 5E94A 2IFFH 5EU7C 4WCYH 5TE6L 3VFNB 3U7YH 1SJEA 3FT0A 1OZUA 3WFEH 3ZDZB 1H6UA 4P3DB 4FYQA 4XN9A 3TZVC 1G1OA 2IH9A 4Y4HA 3O11B 5E8PB 4QGYA 5IQ9B 2HX8A 4UDTB 1LVEA 1RULL 2EVHA 1AXTL 3WUWG 3DHPA 3ZYOA 3N44F 5GSRB 5ID0B 4A68A 1G6VK 2GHZA 4PVLA 2ZAIA 1HCFX 3LKPA 4DPCX 4KKBD 4JRXE 2QBWA 4A2HA 4FQQB 5IW1B 2Z9TA 2LT9A 5I74B 2DEXX 1KULA 1MFNA 1SMAA 2XZQH 3CBJB 3FBKA 5JW4M 4XN4A 3PGCB 4P5SA 2UX7A 4X5WA 2OZ4A 5I1KH 4GW4B 1YEFL 1GAFH 1B9ZA 2EIZA 5F9JB 1WSST 4PY7B 5FAAA 1WBZA 3V0HA 4ZO9A 1TITA 3QNYB 4M7KH 1YEJH 2D7QA 4K23H 3ZYZA 3BPNC 1II4E 3IDYB 3VRIA 3IWUA 1JNHB 5DRXB 2ZJSL 2P5EA 3SPJA 3ETTA 2PWDA 1KDJA 4IRSA 1CL7I 4Q6YA 3MNZB 5D96B 3GJFB 3FRPB 2J6EH 1WH0A 3W81A 1BJ1H 3Q5YA 4KFZC 2H3NB 3BQVA 4JK0D 4DW2H 5EO1B 3RAJH 6TAAA 4PREA 1ES0A 2WNWA 3BHBB 3EJCA 1EHXA 3DX9B 4CN1A 5CSZA 3M1BA 2YPLA 1QPXA 9PCYA 2Q5BA 4Z7WA 1OM9A 1SJXA 3MC0A 2YA2A 3K8LA 1F18A 4L3EB 1IAOA 1QTSA 4ZQKA 1O7VA 4G6FB 3CPLB 1GGTA 5G2NA 5D1XE 5DU7A 5DZNA 4J3OF 3SQOH 1QQDA 5KZCD 1IRAY 1NCNA 4FZ8H 4MA3A 4MS6A 3BZ5A 1DANT 2EECA 1TQSA 4OGYL 4A7GF 1DBML 2ITDB 2VDKB 3TA4D 3BD3A 1TFPA 5IBLC 4LKCA 3DHJA 3U6XS 5BO0D 2G9HB 4LLUB 5D71L 4ZBJA 2OMTB 3M8OH 3WS6A 4ZXBC 2NRDA 2ADFL 1F6LL 5DRZA 3RZCB 5DFVC 1T2XA 1XD0A 1FF5A 4NKMB 2L04A 2IMMA 3CAFA 4JRYE 1NOFA 3DSNA 1SJVA 5KAQG 3U4BL 4JAMA 2YOAA 5C0BB 5GS0C 1DJZA 5HDBF 2NX5D 4APXB 1WAAE 2A6KB 5FCUH 3Q05A 3D7PA 3ZUNC 1DLFH 2WLYA 4KGJA 2X10A 1R5WA 1I1CA 3CZFB 4BFBD 1MJUL 4L0YA 5LGYA 2YRZA 5DD0L 3TWCH 4JHAL 2Y36H 4DT2A 3P3RA 1T04A 2VLRB 3VNZA 5B1BB 2XQBH 4O58H 1SXNA 3I6LD 2VZSA 4MMXA 5F3FA 3EJRA 3CGTA 4PHXA 5KVGH 3Q44A 4YAQB 2AERT 1FZKA 1Z9SB 2WJ5A 4YDVA 4ZFOA 5I1AA 3BEVA 3BP5B 4GIAA 4IRJB 1HQ4A 1GC1C 3NVQA 3VFRB 2Y7SA 1M7IA 4OCYH 4EVNB 1CFQB 2NSQA 1A4AA 3ARBD 3