2J43A

Alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
ASHHLRMHFKTLPAGESLGSLGLWVWGDVDQPSKDWPNGAITMTKAKKDDYGYYLDVPLAAKHRQQVSYLINNKAGENLSKDQHISLLTPKMNEVWIDENYHAHAYRPLKEGYLRINYHNQSGHYDNLAVWTFKDVKTPTTDWPNGLDLSHKGHYGAYVDVPLKEGANEIGFLILDKSKTGDAIKVQPKDYLFKELDNHTQVFVKDTDPKVYNNPYYID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structural Basis of Binding to Host Lung Glycogen by Streptococcal Virulence Factors.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Carbohydrate-binding module
molecule keywords SPYDX
total genus 38
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A02
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A01
2YOCA 2J71A 2J43A 2YA1A 3N0AA 2FHCA 3V0JA 3V0HA 5BZXA 3V0FA 2FHFA 2J72A 3V0DA 5BUGA 1D5RA 3AWEA 2J44A 2FHBA 5BZZA 3AWGA 3AWFA 2J73A 3V0IA 3V0GA 3V0EA
chains in the Genus database with same CATH superfamily
4RISH 3ABLB 4KX9A 3RVTC 4G6FB 3U30B 3D0VA 3QNYA 4HGMA 2F74B 2HFEA 2VO5A 3C5ZA 3GPSA 4DZBA 5E6IB 3V7AG 2VLMD 4J3OF 5FOBB 1DQLL 3LH2H 4DGIL 2GJRA 3ATEA 2AXGB 3JUYA 1IFGA 4PP1C 4DP9X 1OSZA 2VQ1A 1BPVA 3LTVA 3IJHB 1RUML 4YDIH 3GXMA 1YN7B 5D72L 3UMTA 4Y4KC 2ED8A 2Q87A 1HINH 2BZ7A 3GIVB 3IU3A 1CR9H 2WXHA 1DVYA 1WFTA 5E5LA 2IANE 1AKJD 1KB5L 3I84A 3ARXA 4JFEA 3KH3A 3B1TA 3FONB 5IB4A 1H3UA 3TO2A 3SD2A 3PDGA 4P2RE 3LRSB 2GW5A 3QXWA 2BOCB 2NY0B 5H37H 3VUAA 5C3IA 2ITCA 2VLRD 3WXWH 4PJ5A 4NP4L 1BF5A 1ZLVK 2A6JA 4V1DB 2G9HB 3MV11 5C09B 4LCCB 2AVFA 1LEIA 4LCCC 5J0BA 1MF2L 1UATA 1G7IA 3QHZH 2M8XA 2AEQH 5E24E 2FL5A 5DFWH 4S0HA 1G0YR 4DUWA 2CBTA 3HG1D 1OB1A 2XY2A 3TJHC 3QT2A 4MNGE 4BQ6A 4YK4C 5DCCA 1JK9A 1CYXA 4WW2F 5TDOB 1J18A 1LQSR 4B5ZA 3CV5A 1XXFC 2K3TA 3MNWA 4NNPH 4DESA 3QUMH 2OMBA 5MEOA 2PCFB 1LEKA 4B9FA 1RIVL 1JZ4A 5LNGA 1GS7A 1WT5A 4JFFA 2ZP9A 3KXFE 2X1PA 3S37L 1HZHH 1NIEA 1WF5A 2Z34A 3N91A 4AX3A 1T04B 4KMTH 4QO1B 3T0BA 3AMKA 4YH6A 3WIIH 2YC1B 2EVGA 1WAEA 2MIZA 3Q5OA 4WUUB 1H9DA 5K39A 5JQIB 3V0JA 2N7SA 5JHDB 4ANVA 2QSVA 3QNZB 4UV7H 3TBCA 4TVPL 1S9WB 1BMZA 3ZHKA 4BQBA 4F9LC 2YIHA 3D3VA 2NZIA 5D1ZB 3IKCB 4PJBE 4YFEA 2XDHA 2X87A 2JK5A 1EK3A 4J23A 1L3WA 3FB6B 1TU2A 2FHBA 5E8PA 1PCXA 3N41B 4G71B 2OMZB 5L9DL 5I1EL 4M6OH 2YKLH 4R4ND 1OY3B 2ARWA 1RMFH 2Y6SD 3QEQB 5I15L 3MJ8A 2NXZD 4O58L 5E7BA 5T5NG 1E5BA 2R4SL 1JHTA 1VADB 2C3VB 2WSPA 4Z76B 4Z7WE 1NEZG 5F0LB 2DLGA 3BVVA 1INDL 4R90H 1M53A 3NGBC 1BM3H 2HFTA 4AK1A 1I53A 4DCQA 4UTBA 5FYKE 1HHJA 3PAVA 4OJFH 5F1OB 2ZKHL 5GPRA 2AJYL 4FG0A 2VUKA 5D96C 1F6FB 3EFDL 5D5MF 3CVHA 4K55A 1JYVA 3CZEA 1NMCC 1A7RH 4G1MB 4PJXE 1A4AA 3PQYB 4PJ9C 3V8OA 3GJFA 3TBWA 4MMXB 5HDOA 4HIIA 2LAAA 1H9VA 4K23L 1BBJA 4FQLL 3P9MA 4RLDA 4ALAL 4IHOB 2P48B 2NQCA 1J9CT 4ZO6A 1S8DB 2UWEF 1CICD 3SEPA 5AB0A 1WCBA 1Q72H 4HUVA 4ORGB 2R59A 3C5ZC 1IAIM 4GRWB 3TT3L 3GKZA 5EUOA 3U25A 4MCMA 5KYWA 1NGXA 1X5JA 2CLZA 3P0GB 2QTEA 3QIWB 1DEEB 1DYZA 4YHZL 3QJVB 1Y0LB 2CDGB 5HD8C 1I31A 2ALAA 2XA8L 1QFOA 5J3HC 2F61A 2CO6B 5EEVA 4CAGA 2MQ0A 4F5CA 4LEOB 1UXSB 3L08A 5ID1A 2RA1A 1CT8B 3RAJH 3CLFL 4PREA 4OZGF 2WTPA 5HDRA 3EO1A 4KTGA 4KX8A 3Q8BA 2VLJB 3V4VA 2BNQD 4YSUA 3CZGA 3ZR6A 3Q8FA 3AWGA 1DBAH 4HF5H 4KJWD 5F70A 5TDPA 4AV4A 4PGBB 2J73A 1GZHA 1O7DC 4G3YH 4Q9QH 4PRHD 1KLFA 3EOTH 4BA8A 1W8OA 3O4OC 5K9JL 4JVUA 3IGAA 4HZLB 4AGMA 3CFEA 5ECJE 3I3EA 1SYVA 4S2SB 1A4JA 2IO5A 3KPOA 5JIMA 12E8H 3D5OF 3W5NA 3CFKB 1BD2A 4RMSA 3RA7H 3GMNA 3UC0H 3NMEA 3MBXL 2BJML 4LCVA 2XJKA 3FUJA 2OMNA 3MUGA 4LRIC 1NCJA 2A4EA 4XHQA 4XVOA 3T5WA 3U9UB 4F7TA 2W9EH 1ICTA 1AS8A 1IEHA 5F9WB 3QDAA 4PJ6A 2BSSB 2ZXQA 3HAEG 35C8H 3S5LA 4XBGB 3VG9B 3CDZB 2HJFA 3VG9C 5D9SB 3MJ9A 5D2NB 3U9PL 1XDTT 1YZZA 3JSSA 3TZVA 1XH1A 2PPFA 2UZXB 2CR3A 1JPST 4KX7A 2K0RA 5KVDL 3QXAB 1IBFA 4Z78A 2VITB 3HNSL 3O6FB 3GMPA 4O5LL 5JIDA 3ARTA 3A0OA 2MQCA 2EICA 3TS8A 4CMHB 4MJIE 4EKJA 4C83B 4XAWL 2OSLA 2YXFA 3IDYC 5HYQB 3TONA 1ODAA 1SOSA 1PKOA 2OQJB 4GBXC 1SY6L 2XICA 4HKXA 4M4PA 4HGWB 2MCG1 3TCXA 2W5PA 3MJGX 4MMYA 4NO3B 5HVWA 2WWMD 2FB4H 4DO6A 1OF2A 1YEDB 2JB5H 2DQTH 4YHOL 3G5YB 4E9RA 1YN6A 2XUWA 2X4UB 1X9RA 2UY7B 3MRKB 3KS0H 4P48A 2B3IA 1JVOA 4FZEH 4GO9A 3EYFB 2X2UA 2VDOH 3QJSB 5B4MC 3HE7B 1FNEB 4KKLC 3V0FA 1S7XB 3KPSB 4R2GC 2YA0A 4QRUA 1NBZB 4BFKA 2OZNA 1RKRA 3Q1SL 2J8UF 1IKOP 3S6CA 4Z7UE 4N0FA 4AYBA 2V17L 4JCLA 2A9DA 1KXVA 2H9GA 4TOYH 3DX0A 4L4TB 2R2HB 4U0RC 1FVDB 3SE8H 3VQLA 3HZYA 3ESOA 2ZAHA 3LZNA 3SO3B 3SZ6A 4G8EA 2IGLA 2H4EA 5HYIA 3LIZL 3TBSA 3EGSA 3QPXH 1UCBH 1TEGA 3IKKA 4P46A 4JL1A 4X4YB 3WY2A 1L9PA 4G8IB 4ZTOL 4Y2LA 3NFNA 4FQ2L 5CJXC 3O8XA 3AY4A 3HKFA 3GQFA 4PI0A 2CG9X 1JNNH 4Y19D 2AW2A 2WYZA 1A3RH 1JPTH 2PWFA 1UM5L 2ZP0T 3IDGA 3O2DA 2XN9A 4XP9H 4PJ9A 3BX7C 3FN0L 4WU5B 1ZHNB 1G7LB 2HFFA 4XCYA 1NPNA 2AJ3B 5TDNA 3HFMH 4TQPA 1MHPL 2BNUA 1E9QA 1H3VA 2P80A 4L37B 5I76A 4U6XB 5HI5D 2QDWA 2CUHA 3W39A 2DI9A 1AXIB 1P4LB 1TQTA 1ES0A 1GSKA 4IJ3B 4W9DC 4AJVA 1QR1A 4TNEA 4E2OA 4HLJA 4ZUWB 3W0WE 2X40A 4H26A 1AY1H 5LJYH 3OMNB 5I8KH 4XN8A 1ZT4B 2PPDA 3H9SA 4UQEA 4LQ1A 4B3VA 1D5BA 4S1SH 1UZGA 1DVSA 2V9QA 1WRFA 2CCVA 3TIEB 1G9EA 1J5IA 3QXDB 4JGJA 1HZKA 3CFBB 3NJJA 1IBHA 4OD2B 6PCYA 4OFKA 3KYAA 1TYEB 2W60B 2ZF8A 3GRWL 3QQDB 3FU3A 5CGBA 3RDTB 2FIRT 1MZZA 1WE5A 2BSBA 3CSYA 3BESR 2YKLL 4X2UA 4FZ8H 3HZ3A 2DMKA 2IH1B 3WGVB 4PRIA 5I66B 3NUKA 3UJIH 1S7TB 3HR5A 1IARB 3V5DB 3ECBB 4M5YL 2PO6A 3BJLA 3IVKA 3CXHK 3IMVA 2H41A 2WYTA 4DVRL 4WVRA 5CXPA 1JG9A 5DRZA 3ENEA 2G3NA 2WM0A 3KPNA 1IJ9A 2LLLA 4RFOL 4XMXA 4BINA 1XIWB 3GZKA 3A4AA 3TZVD 4NBZB 4C4BA 4DP6X 1LO0H 2GJPA 2IWEA 1Y1UA 2VZVA 5CLYA 2RCSH 5ABAA 1DJIA 1J0ZA 2QMJA 4UQIM 4LEXH 3SO3C 4OCRH 4F8NA 4GG6A 1G87A 4K8RL 1I9JH 4XNBA 3S7GA 1QWNA 2QKIC 2YXMA 1RJLA 3AS2A 2P26A 2GG1A 1A9BA 4BWTA 2NW3B 1EA9C 2BIHA 2O4EA 4NQCE 4MXVF 3BPLC 4NJAH 3C09B 4PJ7E 4U3SA 3DA0A 4UANA 2I9TB 2CGRH 1GGCH 4HIHB 1OT2A 3U7WL 2QPEB 2VXVH 1M1XA 1QABA 4OLUL 3AADB 4PWFA 3Q43A 5B3JF 5C6WH 2E47A 4OF8A 4NT6B 1U42A 3UJIL 1Q0YL 4F91B 4NPYB 1JBJA 4D9QD 3FFCB 4XNXL 4E41B 4EI6B 4M03A 3G6DH 5DJ8B 4MLIA 2ZIDA 3GBEA 5FM8A 3NVQA 3MRHA 4Y9FA 1OCOB 3HNVL 1RUPL 3GSRA 4M43L 4ZAKD 4MB4A 3OXSB 3S98A 1NMAL 3T3PE 4LSTH 2BNRB 1CXKA 4PRDB 4TSAL 5DK0B 1H5BA 3MV7B 5LLIC 1OAZH 1EERB 5TH2A 1QI5A 3VFRA 2XTJC 4XPHH 2DLEA 2DMCA 3HHSA 1UKSA 1P1ZB 2CDFA 3RB5A 4RFEA 1QW8A 1E4KA 2DQFB 3RU8H 1JF6A 5L4MA 3T8MA 2W07B 5FCUH 1QG3A 2NLJA 3EOAA 5HJ3A 4LLDB 4FMVA 1EEZA 3WEXA 1FE8H 3FT0A 5GS2D 3SYOA 2JXMA 1B4JH 4WEEA 3OKOA 3HVNA 1GGYA 1WBYB 1DL7L 4HJGA 4P46C 1BFVH 3VU2A 4LHUG 3OKYA 3BP6B 1I7RA 5E7FA 3UPRB 3T2NL 1J88A 2WLHA 5F96L 3W81A 2ICWB 4KGLA 3Q6FB 1FRGL 5HHVH 2FWSA 3G08A 3IB4A 5HHQB 1BGXL 4PJDF 3OAZK 4KTYA 5F0MB 4MJ6A 1LO3H 2JKJA 1U4EA 1J0IA 5EFIA 1TDQA 5LXGL 1BQSA 4Z8FH 1W72H 4PJAB 3ARQA 2QKIB 4PJHA 4JFHE 2WVVA 3LEVH 3O4LD 3NJIA 1KLGA 1LM8V 4PV8A 3SE4C 3WTTA 4J8RA 3VYOA 2EDYA 3HMXA 4CC0A 4GXVL 5JA9A 5CSGA 5BZDA 1MFEL 4WI5A 1KXTA 2P1YA 2YK1L 5BOJA 1FN4A 4OGYH 4LIQL 1NGWB 2EDWA 4JN2B 3U4BH 4O51B 3T8XB 3QULB 1X4XA 2BSTA 4N1CA 4OIFA 4KUCF 1WC7A 2BSCA 4KNQA 2D7MA 4ZOCA 5C07A 4I77L 2ZCKL 4N85A 5DC0A 4AW4A 2JB5L 3VFPB 1AKJB 4GB9A 2NY5H 3LPWA 5CLWA 1MH5B 3PHOA 4QXUL 2WWMC 2YLKA 4PV1C 2CGYA 4QAMB 5I30H 4L4VA 3LY6A 1XGUB 3APDA 1QNIA 2X4PA 1ADQH 1DQDL 5CILH 4RGMC 3C6SB 3D18A 3DYPA 1FQ9C 2OI9B 5DK2B 5AYUH 4XVJH 1PZ2A 4KJPD 4DGWC 1U30A 4KROB 4ZFOA 4KFMA 4XN5A 3SPVA 3MLRH 4V33A 1X9QA 4K7PX 3APNA 1JNLL 4TSAH 5I15H 1TMQA 1LYQA 1JWUA 4ZODA 1KTLB 3C5SA 1K5NB 3PJSB 1TZIB 2BXZA 3LQAC 2BIMA 3ZE0E 4AE0A 1RVFH 3FOLA 5E6RB 5G5DA 5CGTA 3U9WA 2R1WB 1M05B 2LVCA 1HE8A 1JUFA 5E8NB 4ZTPL 3MLTA 1T5KA 4ZFOL 1PY4A 1QW9A 4OUUA 2R0ZH 1G7JA 1ROWA 3Q2VA 4DKEL 4BEIA 4ENED 5HYSB 1JD9A 1ZA3A 4K5OA 4P9HC 3LV3A 3H9HA 2KT6A 5D1XD 4X5XA 1YMMA 3VRLF 1A7QH 2NUTB 3IFOA 1KN2H 5JHLA 1T3FA 3NSJA 4GUPB 3VI3B 4JO4L 4PRNB 2WBJC 5A2CA 3CFUA 4GXUN 1L7TH 1EGJL 1YCSA 1MW3A 4AQ1A 5DLMH 1LE9B 1V8HA 1F0LA 3BAIA 2PO6D 3E9TA 5C0BA 5F9JB 3PS6A 2QFRA 3L9EA 3QUMA 2XWDA 4R0LC 3K71A 1MQKL 2JJWA 3IRCA 3LKSA 2COQA 3UGUA 3ZDYF 4R0LB 2DAVA 3OMIB 5KZCD 1EXUA 1C08B 5F7HA 3L4VA 2HSIA 3N1PC 1ORQA 4CN4A 2FSDA 5GS1A 4OZIE 2FQGA 5I18L 1OP3K 5AW5B 1AGBB 1YPZA 5EU5A 3H42H 3LKPA 1C5CL 2HYMA 2YMXL 4NCC1 5DO8A 1D9KB 1YPZE 4L1LA 5AW4B 3BPOB 3II2A 4G8AC 3V0IA 3N50A 5EPMB 1BP3B 3B5HA 3EDEA 3DSNA 2WXLA 4WKXA 4AT6B 2R69L 3L2MA 5DRWB 5E2UH 1U6AH 4U1KB 3KH4A 4HOWA 1RK7A 4JO4H 5H37A 2AK4D 4RDQG 5I8KL 5GRXG 1KJ2H 1BBDL 4XXDB 4D3CL 5T33L 3HBPA 1NGQL 3VXMB 3FQ2A 5KEZA 1Y6MR 1KPRB 4HSQA 3N2JA 5D4IA 1A6ZB 15C8L 2IANA 1KEGH 3ZHNA 1MCCA 1UWFA 2FVNA 4PU2A 4PLOB 5CZRA 3FQ1A 3PRZA 4ZMNA 5I71B 3QUYA 4OLVL 3NCXA 2GIXA 3FB7A 3KR3L 4OGAC 1FNAA 1XSKA 4PRPB 2IDCA 1MFCH 5L8JB 4HA1A 4HFWB 4Z95L 1QUNB 2GKIA 3A6CL 5B1BB 4K3HA 5I6PA 1BFTA 1D6VL 2J4WL 1CE1H 3ECQA 4MQSB 5DMJB 1N18A 4RISL 1MFDL 2EXWD 4KAQH 5BQ7B 1EZVX 2DJMA 1A6TB 5JORA 3RWFA 4GOSA 5D7SH 2XQBH 1KT2A 4I5BB 5DD0L 4UYQA 2X9WA 3MRLA 1HTYA 4JPWH 1RZ8B 2WBJB 2XCMC 5BZZA 5HVHB 4MNGA 1L9SA 4Z7WA 5IB3A 4KRMB 4N2EA 4KZDL 3ARYA 1YEGH 3NP3A 1KEMH 1G94A 3V5KB 3RNKB 1SBBA 4ETQB 1ZLWK 1KBGH 4LBEB 5T3XH 1F13A 4G7RB 4UOW1 3N1QC 4N8VB 3X2QB 4YWGH 2CSPA 4R6UA 3S37X 4HOMA 2DOCA 2VZTA 2WIMA 2WUBH 4YE4H 1VENA 4XB7A 4B6ZA 4PB9H 4RGNE 5FR3A 3PXHA 2QPSA 2VE6A 2RQEA 4Z0XB 1N64L 2P5WB 2YD1A 4ZZFA 3TCLB 5JHAA 2ENSA 4XMKH 2OJEA 4DVBB 5CMAA 3S2CA 3S8WA 3RHWK 4MNQA 1HHHB 2WWKO 4XX5A 1G7QB 4OKVA 1KF9B 5BRZA 3VWJA 3C6LA 3E1F1 3VI4A 5AW1B 5HJBA 2FATH 1BLIA 3SGEI 1V3MA 3QCVL 1QO3A 5D1ZC 3BPNC 5DRNB 5B38A 3QZOA 4NQDE 1XCWA 3O3DA 1KFGA 1X5AA 4NSKB 1CN4A 1D5RA 2NZ9D 4M93B 2NY5C 5I1DB 2I60H 3HE7C 2DEWX 1MCPH 1CYGA 4YDVB 5EUKB 3TBVB 2IXQA 3QJUB 4OLZH 3MNDA 4DETA 1NCCH 1I7TB 4U1LA 4YPGB 3CCHB 4JM0A 2Q8BH 2IH8A 5CSZA 3CGTA 1RIUL 2HT3C 3BZFA 4U6YA 3WS3B 1KB5H 3ARBB 4U33A 3VXRA 3CPLA 5ANMB 1E28A 1NC2D 5E8DL 3STLA 2X44D 4G8GE 5KVFE 1TYRA 2ZKXA 1CB4A 2EINB 5GHWL 5KSBF 4S10A 1DJXA 3NDYE 4N20A 4WHYH 5IHLB 1U8QA 4MD5A 1KY6A 1H6FA 3VXNB 4A7GA 2F19H 2XXMB 3BAXA 1OAQH 3ABGA 4QTIH 4JE0A 4LF3A 3UTQA 2XN0A 2OYPA 4QCIB 4TQ8A 2XI9A 2G3XA 1W16A 1IC0A 1J5CA 4O5LH 4XT1C 2CDEA 2F9BT 4IJTA 5MHSD 1RURH 2TSAA 4QOKD 1N59A 1RL1A 4MCNA 5FV2A 1G7MA 1RZJH 3C12A 3BAKA 3V9CA 2D3LA 3K80A 2NR6A 5HI3D 2GCYA 4XO3A 4PLKC 2JJTC 4OV6F 3Q2WA 1HCZA 4C54A 5IMOB 3VYNA 3VRJA 3HC2A 4OM0L 4QR7A 4FFVC 4X7DC 4LPXA 4PVNA 2FZ3A 4FJZA 1NANH 1T20B 1P2CA 3WI9A 1FFPA 3BEWA 3ZZLA 2XHNA 2CKNA 2OA9A 3QRBA 1UOVA 4IGBB 1ZV2A 5GHWH 4IGBC 5EU7C 1KWKA 1HOEA 5ISZE 1DBAL 1TVBB 3ALPA 4LDCA 3X3FH 2ED6A 3QO0A 4HHAB 1NIDA 4LDLB 3GSVB 3CBKB 4CW1B 1S7SB 4P23C 5JUEL 3EYQD 3ET9F 1A4KB 1E9OB 1W8NA 4WSGA 4HIEB 3T77B 1RJZA 3AMLA 1Z9SB 2Z65C 3AUVA 4B27A 1PG7H 4QIRA 3V4UL 4EI5D 1BD2E 1O7SA 4ELMB 1SHMA 2EDRA 1UZ6F 1L0YA 2AEOA 2I60L 2KI6A 2H1PH 1LMKA 3BUQA 2W1NA 1I7ZA 3EZJB 4Y2NA 3C60B 4KO7A 2Z7WA 2E9IA 3BP4A 4OM0H 3P73B 3B2MA 3VFGL 1OGSA 1CICC 1KCSL 1M2VB 2A77H 4HS6A 5KJRH 2O5NA 3AY4C 1QBMH 3LZLA 3SQBB 4FQXB 1KJMB 1MFDH 4JHBA 1H19A 2Z7ZA 1XMWA 1CFQB 1S7UA 3ZKXB 5HHOE 3RPKA 2C9XA 3WXWL 3TU6A 1GHFH 2BFVH 4GI9A 3MODL 4OJDH 5B1AB 5JOPD 4LPYA 1FP5A 1FO0L 4GKNB 3P30L 5GJTH 1XV8A 3KXFB 3RGVA 3I9GH 5F7DA 1T66D 4A1RA 1XTLA 1L7IH 4OFQA 1JWMA 1OT4A 4HLEA 3BJ91 3E9UA 4AMWA 3AM8C 2EO7A 3IAQA 2Y3AA 3DHMA 3QQ9D 1EHLH 3QCTH 3FKUS 5DZOA 3FDWA 4ZXBD 2OX5A 3H2QA 1IV8A 4KV5E 1A3ZA 3BYTA 3HN8A 4M4RA 1OE1A 5EOCJ 4JY6B 4JRYA 2OXHA 1H15B 4MB3A 3QIWC 1OCWH 2XQ0A 2RD0A 1TJIH 4R90L 3MTXA 4R4BA 2DRUA 2VCOA 4HV8A 5KS9B 4G9FD 2VDML 1K4CB 4PJIF 3DRTB 1CXLA 1EFQA 2NCMA 3FFCD 4TQHA 5DI8A 3N42B 2JWYA 3B6SB 3QSKB 1U8KB 5F1SA 1M7DA 1F2QA 4K8RC 4OGAD 1IBGH 1RZIA 4TUUA 1JI2A 4YDLC 4WFEE 3HRZB 4XAKE 5D4HA 5F8QC 5IHBA 3LRGA 4U0RB 2L8AA 3HN5A 4FQ2H 3QUXB 3UACA 1SJHB 4P57B 3BW9B 1Z3RA 3ZMNA 4KZEL 1FJ1B 5EOTA 3JWDC 2Y6SC 5C0FB 5JNYA 4LDEB 3HI1B 3JV6B 2JQZA 1WEJL 4JW3A 4LP4A 3NCEB 4XP4H 4PWJA 4JPSA 1PW3A 4QEGA 4LHJB 1GVIA 1AH1A 1AHMA 1A9EA 1TKWB 2OTWA 3TBBA 2Q2LA 3FZUC 3V52H 3F7YA 2J5WA 4U1HA 3L95A 4M3KB 3FBQA 5EZOH 3TX4A 1LE5B 3GM0A 4Y4HC 4ZNEA 5JIHA 2WTOA 3DV6B 3CZSA 4HULB 4O02B 5EU4A 2ZUSA 3FB5B 5ACZB 5IQ7L 3HOGA 3H53A 2OZ4L 3OKLB 4LPVA 4KHTL 2VUOA 4M61B 1CQYA 4CC4C 1FNSL 3LCYA 2ZXBA 4PJ7A 1R1CA 4ICXA 4NHUA 1JF5A 2NW2A 4S1QH 4X80L 5IMMB 1XFPA 5KWYC 3D2UD 5DZLA 1HN1A 4WJG3 3BQUA 3TFKC 1XF2A 1DCLA 4FF9A 1NZRA 5EEWA 3MROA 4YHML 2DWEB 3O41A 3RVTD 1IKFH 3HNSH 1PNDA 1KY7A 1QASA 4CA4A 3HI5H 2ADJB 4CU6A 4C59B 4B97A 3L4UA 1SDDB 1G1OA 4XHJD 4XXWA 2EUZA 1QFWL 4KKBD 2X0UA 4JM2A 5ESVA 5HHPA 4TNWF 1I8KA 1URLA 1H5BC 1Y6NR 3KHQA 3WFEL 3KNBB 2BVEA 3LJ3A 4JKWA 1PNCA 3GO1L 4W9JC 4UT7L 1C7SA 3MYJB 4OZGB 4XO4A 1Z6JT 4KHXL 3IDXH 4RWHA 4F3FB 1TJIL 3K6SB 5AD0B 3RWGB 3UBXG 5JHDD 5DHVA 1CFSA 1GOHA 2JCWA 3HE6B 5HGDA 4NKIH 5FB8B 2XQYA 5CZXC 1PZDA 4IU3B 2YLHA 4R7NA 1V3KA 1KJVA 4JKPH 5GZNC 1I1YA 1NM9A 1QOKA 5AB2A 2UZPA 3ASNB 2ENQA 1DBJH 4FD0A 4YDKL 4Z5RB 1GZPA 5I2IB 2J8UE 4TVUA 4HJTA 4X6CE 3DXAA 1AZCA 2J8UA 3S34H 4W9FC 5TFSH 3UL4A 4YMPA 2NDFA 2OTUB 2GEQA 2G3MA 4IRSB 4HWEL 4M48L 4D0BB 3Q2NA 1BWMA 1HILB 4HMDA 1YRKA 4G9FE 1WCQA 1AGEB 1PMYA 1ZHBA 2WVTA 4A7UA 1Z0MA 4NCC2 5DUJA 4G9FA 3MRGB 4Y4HB 2V5YA 5K9QI 4WJ5B 1RJYA 4FA6A 4I85A 5C8JB 1Q0XL 4HALA 2WBXA 3FPXA 5JIPA 1CFNB 4MXVE 4LGSB 4WFED 1CURA 2DW5A 5H35B 4JREC 4UMGA 2GIMA 2A74A 5AAWA 5E8EA 2P3YA 2UWEE 3IK2A 4K94L 1UFGA 3BKYH 4F7KA 1FZKA 35C8L 3X11B 1XF4B 5IHUL 4JUSA 4WIQA 1NL0H 2G9KA 2V6HA 4K3JL 4NC1E 3O2DL 4G59C 4I1RA 3X17A 1JHKH 3EF4A 2CK0H 4DP1X 4E41E 2E7LA 1ZTXL 3D39B 2VDPH 3RDTC 1G9MC 3IT8D 2KUTA 2VXUL 3E1ZA 4OSUH 2A9NH 1KCRH 4HJJL 4E9TA 2L7EA 5C08B 2EYSB 3LOWA 4RGMB 2GSIA 4L4VE 4KO9A 2BOLA 1DBKL 2FQEA 2PYEA 2UX7A 4UM8A 3KBFA 3LXBA 5KBPA 4P3CL 4C4UA 3MLVH 2P28B 4ORZC 3NZSA 2RHEA 1AIFA 1G7PB 2P8LA 4MQ7B 4YHZH 5FO2A 1NFIB 3ARDA 2K7QA 3C8HA 3QDME 2NR6D 4ZPTB 4ZAKA 1XIWC 4BK5A 4CU7A 3LPFA 5FUZH 5D70L 3DX8B 2OMVA 2X2JA 4RETB 4DQAA 3HNVH 2XTSA 3CLWA 4KK9D 4UT9L 3MZTA 3MRRA 4MWFB 3ROLB 3ZUCA 1Q1PA 3D33A 3BN9D 3C08L 3C9NA 4DKFL 2DIBA 2MHAB 1WBXB 4PJFA 2OL3B 3LRMA 2WV3A 3L5XL 4UZUA 1ETB1 1NA8A 4Z7QE 4FFWD 1TQVA 2FEJA 3EHBB 5JQ6H 2VN7A 1DBJL 5EG6C 4ZFGH 4O9HH 4WJKB 1IFHL 4JDVB 3PREA 3U7YL 1CK0H 1OLZA 4FXKB 4BXSV 1N6VA 2ENPA 4FQXD 5A2FA 3DRQA 1AQKH 3G5VA 3NJXA 4YL9A 4M48H 4JG1H 1J1XL 3TN0D 4X4XB 3MCLH 2ZXEB 5ANHA 1U3HA 4NUGH 2YQGA 2R4SH 3MNVA 3ZL4H 1BJ8A 3LHPL 3FCBA 4FNTA 5TQ2H 1GCFA 3BZ4B 1CGSL 4GT7A 2ZICA 5GGUB 4XC3L 4KJWC 1CVRA 3BVWA 3RWIA 4XXWC 1YY9C 4JM2C 4FEMA 2DD8L 4PWIA 5LWYH 4YBQC 5EZIL 4LSRH 1CZ8L 2R0WL 4JG0H 1YYMH 3D06A 1KGWA 2VISA 5CIPB 4LSPH 1G9HA 3ULVC 3DROA 4P9HL 1MCLA 2QZQA 4LNRA 4XNMB 4U1SB 1OTUC 3FSAA 3FQWB 1NGYA 1U8OA 5I17A 3GSWA 3QEUB 4MD4B 3UAJA 4QKXB 3TJHD 3HZVB 3NZ8A 3SGEH 1X5KA 4H8PA 5C0IA 3AAZB 4CKQA 2APBA 5JPNB 3TVMA 4IU2B 4FQCH 3DARA 5JW5A 2BP8A 4H0LC 5C3TA 4KRPD 4YDJB 2ADIB 4ODHL 1E90A 1NBVH 4UV4L 4NS0A 3FSWA 4L9LB 2N4IA 3NP4A 5I0ZA 4WW1B 3QIBC 1F11A 2W0FA 1BQHA 5FM5O 2CR0A 1G1KA 1LNUA 2D8KA 2R2EA 5AYQA 1CFVL 5SWSE 4QGTA 4E5XA 4RDQF 1CGTA 4OCXH 3IS1X 3W11D 1MREH 1YMHB 4XXCC 4G42B 1YEIH 4DP7X 4AYID 4L05A 3TEWA 3PHAA 3FB8A 4KZDH 1KACB 1MCBA 1ZDSA 2PMZA 5C0BE 1V7NH 4PRHB 4FHJA 2RIKA 3L7EB 5KJ4A 1IGYB 2ATAA 4L8BA 3VJ6B 3LKOA 5CCKL 1RVFL 5E0FA 1WFUA 5BRQA 1UM5H 4KROD 4XP9L 3RVVC 3KJ6L 1YDPA 4XE5B 4MXWL 1KYUA 4EMZA 3MV7E 1U8MA 4IOIB 3CXHJ 1H0DA 1LK2A 1LK3H 1R3LA 3OSVA 3O11A 4ZQKB 5HGGS 1KIPA 2AF2A 2DICA 2DIEA 2XZCL 3KPPB 2IFFL 4N87A 5JOFA 4HS8L 1PAZA 3KR3H 5C0DA 3RKDC 3EOBA 2VC2B 4TQEH 2ZYSA 1CU4L 3I6GB 5EN2B 5DD6A 3ARFA 4RQQA 5JW3H 4IKLA 2HLAB 3FRUA 5FIEA 3JT0A 4HYTB 3QI9A 5L7XH 5EBLA 1FHGA 1T5WB 3STZA 3NCJL 4E9SA 5KSBE 2WQWA 3F8UB 4OV5B 4Y2OA 3TJEL 1ZANL 4OZHB 4P5RA 5AKRA 3QEGH 3MJ8B 1T66C 1F4AA 4KNTA 3GXFA 5BS0E 3K0WA 2OSWA 5G4MA 3U30C 2Y6TE 3NCWA 4BZ2H 2I5YH 3NDZE 5HI5C 3HBZA 2G75B 4X8JB 1Y18B 1FFQA 2B5IC 3GXUB 3IFLH 4I0PB 4PV9B 2HX9A 3OWRA 1QX1A 6FABH 1HIML 3GSXB 5IJCC 2JQAA 3P0VH 2DJUA 2PP9A 4NUJB 4ZSOA 1W0WB 2J43A 3L3KA 1RI8A 4HUWA 4NP4H 1F6LL 3PQYA 3UTSD 3BN3B 4AENA 3WJMB 4OQTA 1I85A 3UTPE 2V5RA 3L9YA 4MMXA 4XH2B 5DHYB 1MEXH 2ZKWA 1KBBA 4YN3A 3V10A 3APMA 3DNKA 3SKUD 3HPJB 5CJQH 2PYED 3LN9A 3GXTA 1SDAB 1WUZA 2Z3FA 1I1CA 3GJEA 2B2XL 4EPSA 1WHOA 4DSYA 3VG0H 2CR6A 4L2LA 1G6VK 2OMUA 4GP4B 2IPTH 2LAGB 2XBDA 3K81A 3UZQA 4ACPA 4Y88A 4DN3H 1V5JA 3VFOA 4U1GC 1HKFA 4H1LG 3D85B 1E6JH 2XTLA 2BZDA 4ZW8A 4D7PA 5GGVY 1WO2A 2IBZY 4Q7DA 3PP4H 5F97E 2ZCKH 5B3SB 3GTTA 1G84A 4GUCA 2DLHA 1J87A 3BEVA 1KGUA 1UT2A 2NR6C 2ZF9A 3GBMH 5KAQF 4XOAA 1FG2B 5T5NF 5JQHC 1TZGH 4JFZH 1FIGH 4YSRA 5I6OA 1UOKA 3G9AB 3KLLA 1Q8MA 5AL0A 4BH7A 3PWLB 1OTSD 2AXFB 3VSQA 2P5WE 1URIA 3UIZA 1ASOA 3NIGB 3QNFA 4S2SA 3WN5C 5I0XA 4S0TD 4RGOH 5F7EH 2F53D 4WWKD 1DUZB 5CU9A 3MREA 5DZJA 3TO4B 3C75A 2BY0A 4LLQA 4ODUB 4F20A 1BZ9A 1RZJL 2YOAA 4DGYH 5CLZA 5BXFB 2ZJSH 4OVUA 1KCRL 2Z0UA 5AOKA 1YVLA 3U36A 2CIIA 3TNNA 4XNZB 1N64H 1OEZW 5GSRA 4ODXA 1CBVH 4I4WA 5D9SA 2HRPH 4J6RH 3DO4A 2ZNWA 3N43B 4A2DA 3BZEB 3QIUA 2G2PA 3TN0C 4J3VA 4LSSL 1XGZA 1KENL 1SPDA 1NDMA 4Z78B 5AENA 4M6ML 3UGXA 5SX4I 4HS3A 2PN5A 3MGTB 2EVFA 2NNCA 2WLMA 3GUTA 4B41A 2DQJL 2BP0A 4OZIB 1NCWH 3ATAA 1DBBH 3DVFA 3IDNA 3BLKA 2CBPA 3MJ7B 2BY3A 4Z7OF 3FT2B 1TXKA 1BQRA 5FYJH 2XVLA 4X9BA 3AREA 3O6KL 2YD7A 3AT0A 5CGYC 3DECA 5CJQL 2D7QA 1QZ1A 4QRPB 1DJHA 1AO7A 3F12A 3PHQA 5SWQA 2QGBA 2NSQA 3EG9A 5I1EH 3SPJA 5IEKA 2CIKB 2FQDA 5HYJB 1QRKA 3A67H 2ZOKB 2VAAB 4L18A 3EYFA 2J72A 3L3JB 2DQDH 3II3A 4Y4KD 1FL5A 3BGFB 2ZOTA 5EO1A 4RX4D 1QKZL 3FUEA 1W6WA 2G5RA 3UOAB 1RSYA 3P9LA 4TVPH 4HWZA 3MFFB 2KDGA 5CIPH 3FC8A 3IS0X 2ED9A 1FVDA 2F19L 3RTLA 3ML8A 2FX9H 2Y07L 1JFHA 4FADA 5GGVL 7FABL 2OW7A 3ZE1B 1G5AA 1ZAGA 2AJYH 2IAMB 1XF3B 2GABA 4CDGC 4J39A 2V37A 2GVYA 4NRZB 4P05A 4XCFL 3VH8G 3VDCA 3LRHA 4PRPE 2D7TL 4IIQA 5K1NA 2H32H 3BZDA 4EZKA 2R69H 1HHGB 2LHAA 2G4EA 1K4DB 2HJKA 4M1CD 3MBEC 2D03L 4GMTH 1CFTA 4I0KA 1U6AL 4H5SA 1PYWB 1QFWH 4KXZH 1EANA 4N86A 4WWPA 2HVJB 4YDLB 1RULH 5E2WH 1MJ8L 1G7LA 1DJYA 3K0YA 1P7KA 4XCYB 4XP6H 5T1LA 4BGLA 1VFOA 2AJ3A 2NNAA 4ILDA 4JFDE 5E5UB 5AVSB 3Q2CA 5TDNB 1XH3A 5IUCA 4LHUA 1XB6A 4XBPB 2DL9A 1R5IA 2FLBT 5IM7A 2C1OA 4XNZC 3X12A 4NZTH 3TEZA 1AGCA 1FCGA 3LKNB 1AR1D 1P9MC 9PCYA 4LEEA 3REWA 5JZ7C 4DQOL 1EJ6A 2GJ6B 1TQBC 1EHAA 1UZ6E 4UV7L 3RYMA 5KUMA 1BVLA 3FU8A 5C0RL 4IRZH 1DVQA 3PWPB 3ZKXC 1P4IL 1BREA 1WS8A 2LABA 2NOYA 5CINH 2KC0A 3ARZA 4YHIB 3MR9B 3FL7A 3IDUA 4LRIA 2X2HA 3O4LB 5FWQA 1OPOA 4Y2DB 4IGBD 1TJGL 2JF1A 5CHNA 1ZJAA 2V2XB 1ZKAA 3GLZA 1JWSB 1ZHKA 3QDJD 4DP0X 1SY6H 1PZBA 4PG9B 1N68A 5T3ZD 3LZRA 3KLSA 1T2JA 4JQIH 1KYFA 5B4MD 4D7BA 1QSFB 1J9QA 2GFBA 3KPNB 3UZVB 5FDYA 1UXWA 1MRDL 5EEXA 4GSXA 5D1XC 3CHSA 1TZOA 1SFHA 5D55A 4ZUTA 4QLRA 1DDHB 1PLBA 1TENA 2GY7B 2NX5B 1J05A 4GAAA 1R5VA 4GRMA 5I1LA 1A4BA 3V5HB 2RACA 3FBKA 1XF5A 1ETZA 1S7VB 3L5XH 1SGKA 2WPGA 1MWOA 4XGZB 4YOKA 2EUVA 1WGOA 1CLZH 4XMPL 5E2TL 5E8OB 4P3WA 5B22A 3NA9L 3H7BA 4PS8A 1DQJB 2YAHA 3NFSL 2MFNA 3LD8B 3CFCL 2MWCA 4MLSA 5LAXB 4CDHA 3INUH 4KQ3L 2EDTA 5FO7A 5FK9B 5F3HB 1N3NA 3X1EA 4Y16D 3ARSA 4XVJL 2JNZA 2NY2C 3RTQA 5BUPA 1CO1A 4YO0B 3VFVA 1ET7A 3IMUA 3LRLA 5H4YA 3BPCA 4KXDA 3F7VB 2VMJA 3KYKL 1KN4L 2MNUA 3MLVL 3ZE2F 3GT6A 4DK3A 1JPFA 3SGJC 2XQYG 3LXAA 4GSQA 2F15A 5IZ7A 3FFCA 1L6PA 4JM4H 2DQEL 3GMOA 1KGXA 1MVUA 4MMZA 4JFQB 2UXVA 3GSOB 1AFVH 3CK0L 4P3DB 1RK1B 1TT6A 1YNKL 2G2RB 5D8JL 2CO4A 3L6FA 1ZLEA 3GMQB 2GI7A 2K45A 2PXYA 4ZD3L 1U2HA 3GO1H 2I7OA 4A6YB 2A0LD 3PWNB 2O93L 5FYJD 3NZHL 4R8WL 5ESQA 2E7BA 5CP7A 4BSWB 3ZDXF 3EGXA 5DMIL 1KCKA 1WAAF 4H20H 4IIZA 1PY0A 3FUDA 4CGUB 3IJ9A 2WXPA 2LE9A 4ZFGL 1CD9B 4JFWA 5EBGA 4L3AA 4BSVA 3NFPB 4FNUA 3UAAA 4OH2A 2V9TA 5HI3C 5JHBA 4P2RB 4NXSA 3OBAA 5FDWB 3CFMA 4ZI8A 1QAWA 4MX7A 3V4UH 5ISZB 4MA8L 4F7EB 5C2BH 5FYLL 2JXMB 5CKAA 1T0PB 2VDOL 3C6LC 3CFDA 3CMOH 3SCMC 5K9OA 5T8IA 4UNIA 5DC4B 3SCMB 5E94B 2CGZA 1W0VA 4KXAA 2C1PA 1FO0B 1OARL 4KVPA 2OZ4H 1T1YB 4AEEA 4BKTC 2VL5B 2KERA 1A02N 1SVZA 3L3OB 4ONGL 3DVGB 1II4E 4X50A 2YPVH 3PL6B 1KIUB 2Q7YA 3LS5H 3KWWB 4FQHA 5IBLC 4YLQT 1KCVH 5IF0B 5I16B 4PJHB 1JNHA 1WAAA 5FYKL 5BUGA 1U3JA 1O0VA 1VIWA 3N41F 5JHMA 1W72B 4AYEC 1UB6A 5L6YL 2AITA 5C7ZA 4HJ1A 1CGYA 3UG4A 3LIZA 5KSUA 3OM3B 2JH2A 2JKTM 1XGTB 4OZGE 4APQC 3S8FB 1JGDB 2X89A 4KTDH 4I77H 1SXNA 5T1KB 4APQB 1B2WL 3MV9E 2K9UA 4HCRA 2UZYA 3M7OA 4V11A 1RZKH 5C07B 4X98A 1SOQA 2JCCA 3MI6A 2Z8SA 4LPUA 3S3DB 3PGCB 2VL4A 1NCHA 5D1QC 2Z31C 2W9LA 4QHNB 4NZFA 1WWBX 1UADC 3A22A 3LX9A 4XO5A 1M2OA 2CBMA 3LPOA 4Z3JA 2BJMH 1PD6A 3VWJC 2VDNL 7TAAA 3EBHA 2H8PB 4XMLL 2X4PB 4Z77B 4B9GA 5C0CD 2UWEA 1GYWA 5BPPA 2EUXA 1BX2A 2WVSA 1TJMA 2WINA 4R7DA 5DK2A 1W72L 3K2IA 4Y4KA 1Q9WA 3DJ9A 3T6VA 3DXAD 5IW3A 2H1XA 3ERXA 4WY7L 4AEHL 3O2VH 3LDBB 2PABA 4TUJA 3KGRA 4DNLA 4E9VA 4YHYB 1ZTXH 4DTGH 2O30A 4UIMA 4P99A 3GDBA 4EE2A 3QJFB 3D69B 3TA3A 3VXUD 4X9YA 3SPHA 1WZ1H 1KFAL 2YARA 3D48R 1DVFD 1FFOB 4YGAB 4MSWB 1OGAE 4HBCL 2FO1A 4UUJA 3VQ1C 5BZWB 4H4NA 2CLRA 3W56A 5HY9A 4TTGA 3GTNA 4XMTA 3QXTA 5GGQL 1OSZB 2IFFH 5DXWA 2FEEI 1TTUA 1M6OB 4XP5H 4UQ2B 4ZW5A 3K6OA 1T80A 4XN2A 3D39E 3K74B 1DFBL 2VXQL 4HEPG 4JO5A 4JFED 5TPWL 2NZ1A 5EA0L 5EZJA 4NJ9L 2Q10A 1N5YH 4FQIH 5C08E 1Z9MA 4NBXB 5BVJA 3LB6C 4YXHH 5JO5A 5FAAA 4Z7WF 4IS6A 1ZV5A 1HU8A 1IBYA 1EVTC 3BGMA 1HXMA 1UJ3A 2IDQA 4I88A 1IBGL 2FYYA 2W0PA 2I9LB 5HGBB 2V2TA 1FL6B 1ZGLM 1VLXA 4M1DL 4XNUL 1ZDQA 3B2VL 1IB5A 3HI6H 2W59A 1LE9A 5KVGE 3QEGL 4DUXA 2WTRB 3SKMA 4MCZB 1CICA 4PEEA 2A6JB 3LEYL 4V1DA 5E6SB 4L9LC 4LCCA 4WAFA 5C6TL 1KFAH 3APFA 2A83A 1T1ZB 3DUUB 5C09E 4XBEL 4JDEA 3X3GH 2FEDC 4X7SL 1YEFH 4ZMPA 3PV6B 3X13A 3ZBMA 3BWUC 4JPQA 2E5EA 2FBOJ 3B9KC 4JGUA 1AGBA 3DOIA 4FC3E 3TA4D 2H0EA 4PCSA 4KJYB 2WZPD 3HTLX 1NUFA 3V6ZB 4UNVA 4XNDA 4N0RA 1P5VA 3V2AR 5A43C 3FRPB 3GMMB 4HEPA 1AZBA 4GXFA 4KQ4H 2QKSA 4HK0B 5LUMA 2APXA 3SYCA 1QFWM 1MCWW 1RZPA 4Q2ZB 3EDDA 3KDMB 2Q3AA 3UYPA 4AIZB 3HMWL 4J27A 3R0NA 2Y2YA 3BP5B 3ABKB 3SE9L 2C3XA 5C9JA 2J3SA 3T0VA 3T08A 1F8TL 2EH8H 5A2AA 2B15A 3D2TA 4S0SD 4NN6B 1T04A 3JV4A 3QG6B 3KD4A 4OM1L 4ZTOH 2YC1A 2HT2C 3HW7A 4PR5A 1FFRA 1IILE 4ONFH 3VACA 1BVNP 5FECB 4QRSB 2ZAIA 4IBVA 1SJMA 2EKSA 4PCKA 3MLZL 4Y16C 3OKDA 4F15B 4IOSA 4FTDA 4EBQL 3CSTA 2VM4A 5A16A 3DX9B 4KZCA 4PHZA 3L5HA 2VDRH 4NUMA 4QRPD 4FXTA 3VFUA 4NUGL 2QHRH 2VDMH 1VCBC 2Q76A 3LPGA 2AKRA 3O9WC 4PRBA 4KVNH 4QTHB 4O2EB 4NO5B 2BVOB 5AW9B 5JORB 2Y5TA 4AQAA 2PWEA 1QD0A 1XR8A 1RUQL 4BFEA 3WN5B 4LPCA 1S7QA 3LNGA 3MRLB 1IM3B 3QCUL 1Z9OA 3GJFK 3JWNC 3V6BR 32C2A 1BIIB 2Z31A 2RCSL 4GKLA 1A6UH 4PGDB 4NYLB 4TMPA 4Y19B 2ZQKA 3OAYH 1NKGA 3H4HA 3US1A 3SDCC 1WD9A 3QIWD 1IKNC 4PIRF 4XP4L 2XWTB 2X7LB 1L7IL 1R3KA 3ARDD 4RA0C 6CGTA 5D2LE 4B9ZA 3WMSA 2J6EL 3LH9A 3LZFH 1HWGB 1JTTA 1HCFX 3CVHB 3P02A 4L8SC 3S8GB 3IDMA 4HIJB 3QDGA 5L4IA 5CCJA 5J57B 3WD5L 4NCDA 7PCYA 1E30A 2BCKB 4AWJC 3SJVD 4AJWA 1ETJA 3QUZC 1SJEB 4OY9A 5JDSB 4R9HA 4UM9A 5FKPA 1G9MH 5GIRB 1EWHA 3MRDB 3A6CH 1IBDA 4BXVA 3OD3A 1FVEA 1OSPL 2D7NA 3FT3B 4L4TD 5EF3A 1X5XA 2OJEB 4NNXB 4PN6A 3SKNA 5IJVB 4JG5A 1CI5A 3VXSB 5AYUL 3BWAA 2VYRE 1IZKA 4ORGA 4XMZA 4LVNC 5C1MB 3LIUA 4G80B 4M9PA 5FHAL 4PBWD 2WWKT 4U1GB 1OWWA 3OX8B 1WZMA 1UA3A 4JFFE 3B4NA 3DMMC 2GJ6D 4P2QB 3EADA 5EORL 3LQZA 4NKOA 5E1GA 1O75A 5KG9B 4LEOA 1N9PA 5BS0A 1IEAA 3GZOA 1T7ZA 3CFIC 2XPGA 5ESAA 4X7CC 3U0PA 4WLCA 4AUUA 1ZSDA 3PL6D 4JJ5A 5DYFA 2N3JA 4R5TA 3IXAB 3W0WB 1AGFA 4PJBA 1QFUH 2XFXB 3ULUH 8PAZA 4YHNA 4YEEA 1OGTB 4Z7QB 1MCEA 4FQCL 2P4AB 3FT1A 2WLLB 4XB3A 4YNYB 3STLB 5CFHA 1P7QA 2AJZB 4G7VL 1ED3A 5KW9H 5T1KD 3O9WB 5IOPB 2W9DH 4LCUA 1EZSA 2WAHA 1F00I 1F4HA 3HPLB 1M6UA 4JO1L 4Z7NF 1SYVB 5CBAB 3MBEB 1QLEB 1B0IA 3MJ6A 5C7XH 5IQOA 2NY6D 1A64A 4KI5F 5F7NC 2Y06L 5JR1L 2EDXA 1E6OH 4WV1C 2VRQA 4ZJ9A 1BGXH 4TXVB 5E6YA 4JN1H 5BMFL 3ETBF 4MAZA 3SPCA 4HUNB 3VXRE 4D8OA 5E5RB 4C56A 4JKNA 2AEIT 3PWUA 5K9KA 3H56A 1U3YA 5EU3A 3JXAA 3WXVH 4BD4A 3DI2B 1JAEA 1NFDB 2VLLA 1IGTA 3TIDB 3EYQC 4W6YB 4WTQA 1WZ1L 4TLUA 3U4AA 4FXGA 1BZQK 3HBQA 4Z3EA 1KCUL 1OZUA 2QADD 3QXUA 4N8VG 4CVZB 2I26N 4U4BA 4YHPB 3CVDA 3N43F 4HUXA 2AZUA 1IE4A 1U95B 3DJSA 1UCTA 2X9XA 1BFOB 1RZJC 4N6RA 2DWDA 3LZPA 2ZX5A 5GZND 2VDKB 2YJQA 1LEGB 2V3EA 4M7ZB 1L0XA 1XGRA 1MFBH 2IALB 2D9CA 4HD9A 5IEHB 5EUOE 2MMXA 3V6OE 3R06A 5D1ZD 4A2HA 3L54A 3PCYA 2CCLA 5IW6B 1Z0NA 3QUHA 5ADOH 1J5OL 3ILPA 3CFTA 3Q06A 1EDHA 4UBDC 3EH4B 3QC5X 2PTTB 3G5WA 5DJ6B 5C0EB 3O45B 3WJJA 4JE4B 2F7RA 1KXVC 1AE6H 4B7IA 2ATPB 1SFDA 4GW1B 4JANB 5F71A 5L2KA 3ME0B 4P3CH 4P5MB 4PGEA 4L4TE 4WO4B 4B95C 4K0OA 2QTVA 2OM5A 1YEFL 4OJFL 4WGKA 5JW4M 2MSPA 4GSRA 1NLBH 4J3OC 4U6HA 3GRWA 3LD8C 5IMLA 3WY4A 1MJJA 3K6DA 3GXNA 2WB1A 1L4IA 1I9IL 4J4PA 4LLUA 1B88A 1PZUB 1KJMA 4KVNL 1EJFA 4BKLA 2ZUQC 3HB3D 3ETBJ 4F9PC 1I9JL 4KITB 1FFTB 2NY2B 2NUPA 1CD0A 1CLOH 1PF3A 3A6BL 3CTTA 4PB0L 1WA1X 5CLXA 1ZLSL 4IRZA 2PP8A 3MRQA 5GRZA 1X7TA 4P06A 3RDTD 1UQSA 4NDMB 3NSCA 5A6MA 2XFGB 1SJVA 3RWHA 5IBLD 5DTFB 5B7FA 1E6OL 5IWLA 2DPKA 2FO8A 2B1AH 2EE3A 2QQLH 4U6XA 5FYLH 1IC4H 1AXSB 2J6EH 4BCZA 5T3XE 3QWNA 4BFIA 1AO7E 4FQQB 4LCWA 3S3BB 1G9NH 4JRYB 5FF6A 3DPDA 3GM8A 4IRSD 2YUXA 4IEFA 1ASQA 1XIWD 3G9VA 3E6HB 1HAWA 4NRYA 3FH5A 3N1MC 3VH8A 4ODSL 5CCKH 4UOW0 4XZUA 1IGFL 2VABA 3BVXA 2GAZB 1KCUH 3DRTA 4OD2A 4Q6IB 4WW2A 3BCDA 4A2FA 4N2HA 1E4KC 1JVLA 2YN3A 5KOMC 3P9WB 2BPBA 3ARBD 1E5CA 3BVTA 3P4OA 1H3WM 3WSQL 5JLZA 2MOVA 1HHIB 5DC9B 1XXDC 2J57A 1CU4H 3BW9A 4CSTA 3ESNA 2AK4B 4AL8L 1A1MB 5JW3L 1HHKB 3DC0A 4IKJA 1J7VR 4AG4L 4R4NC 1Z9PA 3JVFC 1FUNA 3IYLW 4QHUA 1D6EA 1BZEA 3B2UD 4N9OB 3VTMA 4TPRH 3QH3B 5G2NA 3OKEA 1TVHA 1KTDB 3VO0A 3RX8A 5DEGA 4KY1L 4YZWA 1V7MH 1U91A 1MW2A 4HDIA 1ID2A 1F1GA 3L8QA 3QZMA 2ARJQ 4P23B 1NWOA 1RFDL 3EDJA 4F1SA 1UVQB 4DP5X 1JK8B 1WFIA 1H8LA 1FZJB 2XN2A 5EU4B 4ZMTA 4RH4A 1XR9A 2ICWI 1L6ZA 4EEEA 1MFVA 5A1AA 3U4KA 1MCOL 2NCEA 4GAGL 4FXGC 4KK8C 1QR4A 2EO1A 3PGDA 4XCNB 1M1XB 4OD3L 3I75B 5SWZE 5LCVH 3SODB 2WBJD 4JDTL 1AANA 1CF8H 2ODHA 2ZX7A 3N1GC 2DQCL 2DWEA 4ZOAA 3LB6D 3SBRA 1F90H 3L3HB 4JEGB 3M86A 4E9XA 2DB8A 3VXQA 3O0RL 1JV5B 3QISA 5FA3B 3OLDA 1JOIA 4O02H 2B14A 2FWUA 1LO2L 1M7IA 1EQWA 2ZSVB 1HEZB 4OCWH 2AERT 4YSPA 5E4EC 4OFYA 1CJYA 1SMDA 4FA8A 5AAMC 5EEYA 2CMRL 3WE6A 1CK0L 4OU3A 2HN7A 1FGNL 4PJ8A 1QWUA 3BKCL 5CUSL 1P4BH 4TVPE 5DFTA 3VA2C 3PG2A 4FCAA 5I0YA 4WFHE 1LD9A 3GLAA 3K8KA 3LIZH 2KLTA 5I18H 1JERA 1PSKH 2CRMA 2HVKA 4X0KB 5JYLA 1EZVY 4NENB 4N90D 2EJ1A 1KYAA 3AXLB 3FHEA 4RAVA 2CUAA 4HCRH 3Q3GB 1AO7D 1CGSH 1GZPB 4KK5C 1XCTA 3ZIMA 5I2IA 3MLPA 2O61A 3BIBX 4OF0A 5JZ7D 1QWHA 2X70B 1MOEA 4UU9B 1EAQA 3QZBA 3RVVD 4F7PA 1RPQA 4IRSA 1Z3GL 2JE8A 5I8CA 1VJSA 4MJ6B 5CZKA 5EFIB 3PJLA 4RESB 2DQEH 1NAKL 1B0RB 2V7NB 1N2RA 4WJ5A 3KEHA 4YX2H 3VD0A 2JJSC 2EIZA 4I9WE 4NPJA 3T2QA 4Y9GA 4J8RB 4GI8A 2VLKE 1B3IA 2QVKA 3WU1A 3BH8B 5FA4A 1XQ4A 2R8SH 2CUIA 1LO4H 4WU7B 4H8WH 5DURD 2VQUA 3NIFE 2WYIA 3OV6A 5IB5B 3ZRSA 2CPCA 3MLYL 4RNRA 4CMMA 2EE2A 2VN5A 1R24A 2XTJE 2Z8WC 1CFBA 3SIKA 3RTQD 2XC8A 5C0GB 4JZJB 3LN5B 2OLDA 3SPIA 1NBCA 1BECA 3G3LA 2I85A 2JCCE 3QO1B 1RP8A 4RIRB 5EDXA 5ADOL 1J5OH 4H0IA 3EFFA 1A14L 3MFGB 4OQ1A 1K8IA 4S1DD 2GITA 4XN4A 1IM3D 3O2WH 2EYSA 1G9NL 3LNDA 1DBBL 2DEYX 4M02A 1VEOA 2ZE0A 4AM0B 4TV3A 1FZMB 4EDWH 2D7OA 1ZT1A 2VLRA 4MDIB 3DIFB 2I7SA 2XG4B 1HK6A 4UOZA 4DP2X 3ZDZF 4J3XA 5J11B 4JHWH 5ABDE 4EJ1C 2ERJB 4S1RL 2XV0A 2N1TE 2OXGA 5C0GA 2ERJC 1NMBH 1USZA 2VKXA 5E2JA 1X5MA 3VD3A 4QAWA 5BQDA 4CADB 1EIBA 1OXYA 2JB6B 2L7QA 3MC0A 1KB5A 2X4OA 3RKPA 4N2AA 2P52A 2UVEA 1Q94B 1B9ZA 4RFNC 1CS6A 4X4ZA 1A7RL 5G5DB 4NBYB 3NCYS 1U58A 3NIDE 3F7KA 3OB0H 3CDGB 5BUAA 4K7PL 2L4OA 1OGAA 2O26U 2Y1AA 3SBWA 5DQDH 2IG2H 1PPIA 3CJJA 4PG2A 2OMXB 4HKJA 4WEBH 3QDMA 4ZMAT 5I6XC 3MUY1 3B3IA 5LGHH 5L8LB 4HSAC 2HWZL 4BFOA 2RMNA 5L2JB 1O6TA 2FIKA 3H6JA 4OLXL 3U6RA 2XKUA 4QRRD 4RGOL 1SEBA 4JKKA 4ZDHB 3T0ED 2EIBA 3DIDA 4G7YL 1IGJB 3NQIA 3TT3H 4NQQA 3CMGA 4R96A 4OCSH 4B50A 4J7RA 5E2WL 3MLSL 3G6JA 4QWWC 1A65A 1NLDH 2FCBA 5LBSH 1NEUA 2Z4TA 4AZ8B 3MRJB 1F97A 4OI9A 2WNGA 4XVTL 5KSAA 3AU0A 1UZ8B 3Q8EA 4NQDB 3WEBA 5HYFA 3EYSH 3MV9B 5ERWA 3VXMD 4B0MB 1J8SA 3ARGD 4HXAL 5DJZB 5C07E 2YD0A 3GTVA 4X5LA 1YEEL 1DBML 4D9RD 3F65A 1YUKB 4QYAA 5DK3A 1KBGL 3IDJA 1DN0A 2BP5M 5DT1H 3W1ZA 4Z3GA 5B21A 2QGCA 2AMGA 2KLRA 5IW1B 1O6SB 4H8QA 1ZS8B 3O3AB 5I19L 1WBZB 1D9KA 2VIRA 3FQUA 3HLAA 1A6VL 3D12B 5D6DC 2I25N 5I8EA 4XMWA 4F8OA 2UXFA 3NJHA 3ZDXE 1T2QL 4I8DA 4GRLD 4ONHA 1T89C 4D9LL 2YFNA 1THCA 3QRGL 2H32A 4AT6A 1YYCA 1FYHB 4XE0A 3BSZH 5FOBA 3AGWA 1IX2A 1JNNL 2P8MA 1ZT7B 5KVEH 3T65A 3DX3A 2ZWZA 4BZ1H 3N0AA 5E9NA 4ZTEA 4ZX6A 5TK4A 3M45A 4QHLB 3FH7A 4ZX3A 5IHHA 3H3PH 5KTEL 4X80H 1EBPA 3ZKQD 3L3DB 4ZRGA 1BAFL 4F15C 1MCFA 1WFOA 4YVNA 3NZHH 4R8WH 5K93A 2WAQA 4DIXA 3ZDYE 4NNYA 1LWRA 1RK0A 2OZ4A 2HH0L 4HFWA 4EUPB 1FL3A 4V1DE 5T5FL 4BK5C 4ZG1A 5F88A 2OPCA 1ADQA 5C09A 1S7WB 1KLUB 2FJSA 1KC5L 3KAAA 3O0RH 4ODWA 3OTTA 5F1NB 1X7QA 5DRXA 3RWFB 4FNPA 2Q8BL 2E75C 4JFPB 1TMCB 2BVQB 2PW1B 2VJXA 4KVCL 3T2OA 3V52L 4ANXA 1CE6B 1KIPB 1NCTA 3CH1B 4MNQD 4FMKA 4EN3B 2BNQA 2A0LC 3SDCA 1TEFA 1HESA 1MF2H 2KYIA 2FYVA 1YY9D 1INDH 1FI8C 3KPLB 5CJBA 4K2UH 4M8VA 1QA9A 1U2CA 2VMDA 3EJYC 4L8SA 3FUNA 2XWJB 4XPTL 4YBLC 2RR3A 5DD3H 1SYSB 3HC0A 1YAZA 1FYTA 4GUQA 1B6DA 4TRPH 1T5WA 4ZMOA 3CSPA 2JKSA 3QZPA 4RVBA 5FUCC 3S48A 1CDHA 3FUIA 3R0MA 5KYUB 3RIFK 2VE6B 4Z0XA 1V7NL 2DQUL 1A7OH 1HH9B 2VXTH 3LEXA 5GGTL 2VW7A 3FCTB 4OF7A 5CR1A 4OF6A 3L4TA 4NFBA 1JPSL 4MAYD 3MACH 43CAB 1TZHB 3X1GA 1UGNA 4N2OA 4KK6C 4OCNC 4OIBA 2AABH 5DUML 1ND0A 3QFJD 2EH7H 2FX8H 3KCPB 3P3UA 3DMMB 5KSBA 5IROA 2B4CL 4KVCH 3QB7C 5DVLA 4YX2L 5HJGA 1EAJA 5EBMB 3O3DB 1B0GA 1E5ZA 4LRNL 4RMVA 5IY5B 4PJIB 4I0CC 4HISA 3VD9A 3P3YA 1R5WA 3MBWB 5EUKA 1B0WA 2FX7H 1KXQA 4KHXH 3QS3A 1A22B 3OPZH 4KMQA 2EILB 1F56A 2WXQA 3CCHA 2X3AA 2VO8A 3ROOB 3US0A 1ESOA 2NSMA 4C58B 1IGML 2QJDA 1HFUA 1VGKA 2G5UA 2TAAA 3LKQA 1SRDA 1P4IH 2VDLB 4UIKH 4WKZB 5KVGH 4IBTA 1E28B 2XVGA 1RMFL 4DCQB 3QORA 5HDBB 1HHJB 3QPXL 1ZLDA 3RB7A 3CX5K 3O4OB 1PQZA 4FG6C 4MRCA 5I1KL 5KS9E 2AXHA 3PQYE 4P9HH 1U8JA 5B8CB 3QIBB 5IBTL 4R3SA 5EU7E 1LMIA 3G04A 4KI5C 2EYTA 4G6JH 3MRCA 2F54D 4KGJA 3GGWB 4X6EA 4ZNCD 3HUJA 1XAKA 4M6NL 4QT5A 4F8LA 1OOAA 3GJFB 1FA4A 2XKNB 3L4XA 1N4XH 2P47B 4BDVA 5DD1L 3LZQA 2DH3A 1IAOB 1E5YA 4JAMB 4A55A 2AJXL 3SDXF 4LMQI 3IJSB 5AOZA 1JPGA 2WWNA 3G7TA 3AB0B 4K5LA 1HEHC 1VERA 1WCBB 4Y5XB 2OP4L 2CO1A 4TNWK 5E1AA 1YNLL 3QJQB 1NGXB 2CLZB 3H3BC 3QBTB 4H1LA 4OCYH 5GRYA 4CL7A 3W38A 2IADA 1KN2L 3Q05A 5J06A 1MHHA 2CDGA 5B1KA 1XX9C 2D9QB 1F4YL 4C57C 2HJLA 2AQRA 2HTLD 4KKBC 4MMZC 4CVXA 2AJSH 3IAGC 2O6FA 3RQ3A 5ICZA 4M7ZC 3C2AH 3VRIB 3RUGE 5BJTB 4ESKA 4H25A 4ODUA 3F3HA 1BSIA 2WO3B 5ALCL 3DO3A 1EAOA 1XBDA 3T1FB 1KBPA 3ZHDA 5HYEA 1R3HA 3GJFH 1SXBA 2CIIB 4GAYB 4Y9CA 4HVBA 3SDCD 3C8KB 4L3EE 1I8MB 3ILQD 4QRRA 2F68X 2D3NA 3D0LB 4PP2B 4AH2B 5LN8A 3T0EB 4XNXH 5GS2H 4I4WB 4OZFA 1Z9SA 2DLFL 3FT4B 3KWVA 1OW0A 3L3GB 4HG4J 4HG4K 3HG4A 1BD2B 2OMYB 1KPUB 5DQ9A 3LQAH 2BP0B 3EH2A 5AVWB 4ECNA 2ZONA 5EC2A 1MRCH 1O9VA 3TFBA 1C16B 4G8GA 2CJTA 4YSTA 5DDHB 5BZXA 1MWAB 4HPYH 3ARGC 2NT1A 3BAWA 1A7PH 5H2BA 3HAEB 3RZCC 3S5LB 3UCQA 5CD5D 4QRPA 1EZLA 3M1BA 1WIOA 2X1XR 4ELKA 4DO4A 1IM9D 2J12B 3TZVB 3Q01A 4AITA 2WZ0A 3CN4A 4HETA 2CXKA 5DF0A 5HJDA 4OLWH 1QLFB 4MD0A 2AEPL 5GRVK 5A2JH 4FERA 4RMWA 5INDB 4ODSH 2H6UA 4B53A 3VFSB 5E08L 4L1TA 1JWMB 3EZ8A 2BWQA 4NM8H 1IAKA 4IBLT 2KH2B 4TQEL 3F5WB 3D8MA 3V95A 1R0AL 2ESVA 2OCCB 4MJ5A 5KVFH 2M1KA 2QQQA 4PRID 3QJTB 3SE3C 4X6CB 3EYVA 3T4AB 1CL7H 2XA8H 1IAIL 2EEDA 2AVGA 3OF6A 1EJOH 4HGWA 1HIMH 3IJYB 3IETB 5MENB 3PV7A 1BLNA 4YHLL 1H15A 3MLRL 3TNMA 3T0DA 4LCWE 4Z8FL 1N8ZA 3G5YA 3GF8A 1UHVA 2W95A 2Q3XA 2X4UA 1NCWL 1WHPA 2K78A 2ZCHH 3QC6X 4LLMA 1SHWA 1E40A 1KGCE 4J2XA 1CDJA 2YJLA 4QXWA 1INEL 2YWZA 1K4DA 2HJKB 4UQ9A 3ZMEA 5D1QA 4AXWB 1XB8A 1VFAA 2F54E 3RL2B 5DA4A 2XVKA 3FZUD 4OGQC 4EQ2A 1F3DH 1U8IB 3KJ4C 3MO1A 1S9VB 4NLHA 2DMHA 3MAWA 4PTUB 4JG9A 2CK0L 1MFUA 3DKHA 1XEDA 3RFZB 4ISVB 4IMKA 4KKAD 4BE5A 4PB9L 1MNNA 1L9QA 3BP7B 3ZZSA 2JKRM 1ILUA 4L1DA 3X12B 3RX5A 5I8OL 3ULVD 5F2FA 2AXWA 3O8XB 5EZPA 3V7MA 2O72A 3V4PL 2EXWC 4D0DB 4ODHH 1INQB 2Q5BA 3CZFA 1A7NH 4Q4IA 2F5AL 4XMLH 5BW7C 5KSVB 1TKWA 3B2XA 3FPYA 1URZA 3M17B 5EIQA 4NPKA 1WIPA 3Q48A 4WNQB 5ETUA 3WHXA 3QQ3A 1IMHC 5FM4A 5HDQH 1LE5A 2H2PD 5LXGH 3MRNA 4GFTB 4GEIA 4PJEA 4WK4B 3OQ3B 1DEDA 4A6YL 4XHJC 3GB7A 4E42B 1P84K 1QQDA 3NRPA 4XNYH 5FGBC 2ZUVA 2ZX6A 4AL8C 3DURB 1QATA 2FJUB 4X99B 5CEZE 3N40P 2F1EA 2W0KA 4PJGB 3VWKB 4WFGE 2MH4A 1WICA 3JYBA 2FTAA 5B39A 3MCKA 1NEZB 1XF2B 5SWZA 1EO8L 1GGCL 3GZPA 1MFMA 4XNQA 3W57A 3JTBA 2QV4A 4KZ0A 4NWUL 2Y24A 3U2SA 3DUHA 2D73A 5FW8A 2E7LC 4PLJC 1EEUA 1Y07A 3PWJA 2J21A 1IQDB 4ZS7H 3MCLL 3VNYA 2G60L 1KUMA 4JRYE 1NAMA 3O2DH 3S35L 5IROD 1I8KB 1ECYA 3D51A 3IKCA 4NHCH 5IHUH 2ZP8A 2FJFA 3TPUB 4GQ9L 2GBAA 1QI3A 1T1XA 3KLDA 4K3DL 4A38A 5E8PB 3RI5K 5GRJL 3RTQB 5KJ7E 3MRMA 1F58L 2AXJA 2DYRB 3CDYA 3JV0A 4Q52A 5JIQA 4ONFL 2E6QA 3BPCB 1XAUA 3QZNA 4KRPB 5E2VH 2JKIS 5I1KH 4KRPC 2LLGA 2EZ0C 1OAKH 4XP6L 1D5ZB 1NBQA 1MW1A 2ODIA 1U8LA 4M5ZH 5HHMB 5K1JA 3TT1L 1E8ZA 3OJDA 4JHAH 3EJPA 3QIBD 4KI5D 1KBWA 2J20A 1QPKA 4IRSC 1RUKL 5FUZL 1C5DB 4ZYKA 1WH0A 4UTAH 4HWBH 4LAQH 4YQXL 1MFAL 4LKCA 4HKZA 4PJDB 1OP9A 3BKJL 3MMEA 4ZUVA 1ZHBB 5ESQB 4AQ8C 4W4NA 1HQ4B 3FU7A 4Z7IA 1YEJH 3BWUF 3UG5A 5CINL 1QBBA 2Y07H 5J5EA 3BHBA 1I8LC 1S9YB 2NXZB 4CSZA 4OVVA 3BKML 2UV3A 5TF1L 4AG4H 3N1FC 4JZOA 3OXRA 1KCLA 3OJVC 5FDWA 4Q6KA 2FWOA 1IFHH 1FSKB 4L3CB 5DMGD 3GSRB 3KYKH 3VSUA 1ZPLA 3I74A 1I1AA 4K3EH 1FZKB 1P5UA 3N04A 1R17A 1HL9A 2P9RA 5DJCB 1NGZA 2J7LA 3IGUA 1HEJC 3SE6A 2X4RB 3E2HB 3KGUA 1QTSA 3BT2L 4I2XA 1G9ML 4FZ8L 5SWSB 4JLRA 4PRAA 2CDFB 3F7QA 5AOMA 3HLKA 2VN3A 4H13C 3L3OA 2V8MA 4GY4A 4TKWA 1S7RB 2IAND 4Q0XH 4HXBL 1ZOXA 5FW6A 3GI8H 3DBXA 4Y1AB 3TBTA 2GSIB 4LQFH 3WFCL 5GS0D 1FPTH 5MERA 2RTTA 3HBGA 3HZMB 4P23D 2VR5A 1JXDA 1O5PA 4M6MH 3OAUH 2W94A 5KVMC 1QHPA 1ADQL 2XZAH 5DC2A 4YGVB 2VLRE 2BRQA 2CLVA 4XPGH 3OGCA 5J3HD 2DQJH 5DJDA 4Q9RL 1U41A 2NY2D 2IQAB 3KCWA 5F89B 5G4NA 3OPUA 1YMMD 2YSTA 4MDRA 3HG1A 3KPOB 4D9LH 2DYSB 2FRGP 1NGQH 3CFKA 4HK3N 4HZAA 2VSKB 1PJWA 3HG1E 4HKBB 1WAAE 1DR9A 4G8GD 3SGDH 4JX0A 2N59A 3QUKA 4I3GA 3ZQXA 3B37A 2ORBL 1ANUA 1VACA 1QLRA 4AEIL 1IGFH 2AQTA 1MJUH 3HS0B 1ZHLA 1CWVA 5DMKA 2A77L 4D0CA 3LQMA 4LOUD 4ZTPH 3RVWC 5HPMB 5IVXB 4GEJA 3EYSL 3WLBA 3SDXE 3GBLA 3DGGA 3MX0B 1KGJA 1CDUA 4XVUC 3LSOB 2WQXA 3QE5A 4PCYA 3C8DA 1BEYL 5CEZL 2RGSA 1OK8A 4ZW3A 4U1IB 4YBHA 3KPQA 3OR7A 1U3HB 2WK2A 3QQ9C 4UT9H 3QGVA 4AGNA 3P0YH 4F7MA 1BCIA 1RD6A 5MP6H 1FSKC 2YAOA 1FFOA 1J0YA 2D0HA 3TM6A 3FQYA 2XV2A 5DHVH 1N7MH 5CEYA 2BSDA 2R4RL 5TE7L 1TLKA 4BKSC 4DUVA 3C6SA 1A3LH 4NO3A 1EGJH 4X6BA 2JIXD 3ZK0A 1ZGLB 3MBXH 4UAHA 4MA3B 3ELAT 4GAJL 5I6KA 3HG2A 3SYQA 3VSTA 2BW5A 3FSVA 3CHXA 2WIIA 2XTJB 5E03A 1JTPA 1FVCB 3VDBA 2CGRL 5J13C 4PYHA 3GKWH 4LLVA 4AK2A 1CXFA 5CILL 1NQBA 4P5TB 4KMLB 3AWEA 4KHTH 1X5FA 3VU1A 5I17B 4JY5H 3QZWA 5EZJB 1DSFL 4I18B 1BM3L 4J8QA 3HZVA 3NZ8B 5D6DA 4EXKA 3LS5L 3S3PA 3VXSD 3ZTEA 5EH1A 2AQ2A 2J8HA 2PXYD 4F2MA 1JV2A 3FUMA 1JDDA 4PAZA 3HG3A 4FDWA 5DHDA 2MCPL 4F2ME 1DLHA 1JUFB 3IMBA 1BD2D 4J3SA 4DOHE 3U4EB 1CYWA 3KPSD 3BH4A 1I1RA 3TH2T 2OW6A 4OUUB 2X6BA 2ZCHL 3D25A 5C0NC 1TQUA 1F11B 3S3SA 2XLLA 3AUWB 5A7BA 1ACCA 2Z4QA 2XN9B 5D1QD 1SN0A 4J12A 5F9AC 1AHWB 5AAPA 4YHKH 4WGWB 4N0UA 5D7IE 2WZPA 3KLAB 4Y4HD 3NIDB 1VESA 4Y7MA 3TA3D 3VFMA 2GK2A 2UUDK 3V6ZA 4BQCA 4L37A 5I76B 2BM3A 1EJ8A 2OP4H 3PWVB 4WO4D 4KMTL 1NJ9B 2PPEA 1ZVSB 4JPVL 5D7KE 5E70A 3RL1B 4E9WA 5IB2A 4Z7NE 1IGYA 2E6PA 2PYFA 4H26B 3FQTA 1JGLH 3KDMA 4FQPA 3X1FA 4UQAA 5I30L 3E8UH 4XPFH 1PS3A 4U1JA 3K71B 2HTKD 4XNAA 5LQBH 2G60H 4MDJA 1DANT 1T4KB 1H0DB 4JRWA 1JZGA 2X4SB 1PFOA 4G6KH 3RAJL 5MEND 1I8UA 4HPOH 2P80D 4U3XA 4N2LA 4W93A 1YPZB 5I1CH 2IDSA 1MI5E 4N25A 3GNMH 2DQCH 1MUJA 1PL3A 3ZRFC 5C2BL 3T04D 5C9KA 2NXYB 3NTCL 2WQSA 2BNQE 5GGRA 3CHRA 5F1IA 4JKMA 4FULA 3MNWB 2FECI 3OKDB 2UZIH 2YEQA 2HLAA 2YD9A 3FRUB 1QSFD 1AACA 5E1QA 4DEPC 2BLFA 2CKBL 1JZ7A 1OQXA 4NC0B 2TRYA 3UTSB 2CO2A 4G43A 2AKRB 4PRBB 3SDAC 3WMQA 3TLRA 3TV8A 3DK2A 4MXWH 2Z35B 3EBAA 4FFZA 5CP3A 4LK4A 5DJAB 1TFPA 4ZFZA 1SXAA 1GJUA 4GMSL 3WLWC 4DPAX 2QHLA 1MCQA 1U8CA 1M57B 3QNXA 3TBYB 1Y18A 3CG8A 2KDYA 2DS4A 2H3NA 4Y16B 3SKJL 4HPOL 5GQBA 3V0WL 5F3BB 2A5UA 1X4YA 5TF1H 1K3ZA 5JXAL 5BQ7A 1WZKA 1E9PA 4H8VA 3D09A 4TL5A 5GGSA 1F5WA 4JM2F 3JWNH 4PCTA 1ZLUH 3VG0L 5EO9A 3DUSA 4JHUA 3U0WH 1TUPA 1VADA 2C3VA 5GIRA 2EDJA 4PGCB 3CN2A 1U2YA 3NESA 4OLZL 1NCBL 1XT5A 2RBLA 2QL1A 2OULB 4W9HC 3KLHC 1F3JB 3GJEB 1WDAA 4NNXA 4YFLF 2WLIB 2ZYRA 4LZKA 4PI2A 5D2LA 3RNKA 1PVHA 1XO8A 2Z91B 1GKOA 3Q6GH 3P54A 3UTTB 2OMUB 4M5ZL 3FO0L 1K2DB 3VTAA 1LP9F 1EVUA 1NMCB 4OAWA 3AQXA 5KVDH 3WUWA 2W88A 1JMXA 2QQKH 3D34A 5J12C 2NQ3A 3PFQA 3VFOB 4URKA 2HLFC 3VFRB 5KBLA 3UZEA 3ULVH 3D85A 1CLVA 2BS9A 3B9KB 2N56A 3QHTC 2XA3A 5D71L 5C08D 1E4WL 2GYSA 3GXIA 3WV0A 2IJ0C 1D5IH 3TWCH 1T7VA 4G6KL 4E36A 4BH8B 3QRLA 4JJ5B 4OKVB 4AI7A 4HUVB 4TPRL 5D7KD 2CRYA 2YN5A 3OKOB 3QIUC 4YNYA 4LVNB 2LOEA 1LTXA 1QO3B 5CR8A 2LU3A 1HI6B 1NGPL 1DANU 3UPRA 5E95B 3FUFA 2EUWA 5HHNB 2FX9L 4QNPE 4JHZA 1SOKA 4FE9A 1VFBB 2WLYA 2AI0H 1A25A 2IXQB 1MLBA 2H26A 4JRFA 3ZGHA 1YEHH 3CUPB 1EDYA 1ZVNA 5CSZB 3C08H 1RJCA 3PXJA 4MBOA 2WXFA 5AWNH 3ETSA 3QDJE 5I5MA 5CM1A 4XRCB 3UX9B 1JGIA 4MVBC 1NGWA 2EE0A 3OLIA 3CFEB 3S96B 1A6VH 3VXNA 3D2UA 2VC2H 4NI6A 3SDDB 3UTZB 4UBDD 5AW2B 3G6JF 3PDOA 4ZUUA 1KOAA 4HMEA 1SZNA 1OD9A 1BXUA 1GCYA 1IQWL 3PLYA 3VFPA 1BYPA 5GGQH 2LGNA 1KEGL 1YHPA 3L5WB 1ORSB 2EYRA 3A24A 3AZUA 4NM8L 3JWOL 5GSVB 2Y7OA 4FP8L 3VQ2C 4XVSL 1QZNA 4JM2D 2FBJL 2X4QA 3ZDXB 1GC1C 5SWQB 2K70A 4H2CA 5IW6A 4FKHA 4PJXA 4QRPE 4K7FA 3F6JA 4U49A 5GJSL 3DMMD 2WJ7A 3BVNA 3D0AA 2NNRA 5KANI 5IMKB 3O6FA 4H8UA 2AQNA 1FG9C 4CN6A 3HI6L 5L2KD 1XGPB 3QARA 2HH0H 3O45A 4QHPA 1E4XL 4ERSH 4U1NA 1K5NA 3PJSA 4ODTL 5C0AB 4TULL 2ATPA 5E4AA 1I3VA 2G0KA 3NACH 4LXFA 3RUGA 4G6FD 3SYAA 1DQVA 3FOLB 1TVBA 3JTTB 5JQ6L 5LGJA 4NRXA 4HHAA 3FAWA 4GRWH 1AD0A 1OAXL 5DR5H 4OGXH 4JO3L 2V5TA 4FFZL 1A0QH 3GSNA 3SBWC 4H2AA 3MRKA 3ULUL 3ILDA 4F8TA 3X14B 3D50A 3VE0A 1W0YT 3DX1A 4JQVC 4OLWL 2LW3A 1S46A 5IOKA 1BW8A 3OG6B 1AQDB 4QRUB 4JFOA 5DVMA 3RTQC 1EX0A 3KW7A 2F54A 3B56A 2LTQB 1Y7VA 2XBTA 5DJ0B 4NLAA 3MHZA 1SMAA 3GLEA 5ENWA 2H9GB 4L4TA 5FYLD 2NNAB 3RWHB 2OTPA 1F45A 1NANI 3AGVA 4G8EB 1TJXA 4GIOA 5A3IC 2WMPA 3DVNA 3FFDB 3OZLA 1HXKA 2O1AA 3TO2B 1U8PB 3M07A 2V7HB 3WEAA 2NYKA 4AQ1B 2BOCA 2NYYD 2AV1B 1JZ8A 1ZV9A 1SHSA 3MRBA 1GOGA 4MJ2A 4PWHA 2H5UA 3IPEA 1S9XB 2VRAA 5FF6B 1HJBC 3K7UA 3RZCB 4YJZL 2BRRH 3VD5A 2QADC 1KJ3H 4Y5YC 1N5AB 4OIAA 3PWPA 3RU8L 3IE9A 1LDSA 4WV1B 1EXUB 1L9OA 3T71A 3IFPB 4QHMA 4WU5A 1C8PA 1UUNA 3KGTA 1MAML 3U79A 4JHAL 4JCMA 2ESVE 1HL8A 2CHDA 2WKOA 1EFXA 3VFNA 1E9QB 4KNSA 3S2AA 3KPRB 3AM8A 2YUWA 3NABL 3CVCA 4QXTA 3ULSB 4KXCA 2IMMA 3DSNB 3ILQC 1LEKB 2CCWA 2PCFA 2AK4A 3ARRA 2APFA 1ZT4A 4GQPH 4W9CC 5FGRA 3M88A 2K7PA 2GFBB 3IDIA 3RY4A 3MV9D 4MKMA 1IAII 4N6QA 4QXVA 4NN7C 2X53A 4XVUD 1JCKA 2WXKA 4GUOA 1VFUA 2A6IA 2QVIA 3IDYB 1A6ZA 1J05B 2VZUA 2QPUA 4Z7VF 3EW3B 1UUSA 4M8QA 1B3JA 3LN4B 3M8OH 4WUUE 5DVNA 4AVIA 5AB9A 5K59F 2IWKA 5I1GH 1BMWA 1IC7H 5F72S 2VZOA 5C0CE 4PHXA 4E68A 1CUOA 4PRPA 5FGCE 2VDRB 3ARUA 5FK9A 1G7HA 5FX3A 5C0CA 2EXTA 5EOTB 3T0EC 2ZG2A 1E4JA 5DRZB 4YSEA 4UQBA 5SWSD 1BM7A 1A4CA 3ULUF 1CF1A 1CF8L 1HH6B 2GHZA 5CD3B 1GTNA 3N40F 4MJIB 4Z7VA 2KPNA 3KPMB 1A6TA 4XOCA 3TPKA 1T0NB 1HNFA 1BQ5A 3BMVA 3F7YB 1QFHA 1SF5A 3W9DA 4Y1AD 4BWWA 1KEML 3QJHA 4FG6D 2ADGA 1EAPB 3BISA 1OANA 1UWGH 2G2RA 2DYPA 2GJZA 5IT2L 2PXYC 3NCCB 2IH3B 5IUSA 2SEBB 4M61A 1XD0A 1UA6H 3TVMD 3QA3A 3UIYA 3OZKA 3KYMA 2AAAA 4Y0GA 1MDTA 4J5VA 5GISH 3B9KD 1I3GH 3VW3L 5DEFA 5E2VL 1FZOB 2VR7A 5I8OH 4EOWH 2IGTA 4GSDH 3ATBA 1KN4H 1U4FA 1GOFA 2ADJA 2P5EE 5CFAA 1L9RA 4JQXC 4HW6A 2BWDA 5DHMC 4PUBL 4JRXB 3HFML 5F7BA 2KQMA 3FTUA 2XYBA 4GBXA 4GS7C 1BOGA 1JPEA 3Q3GA 3C6LB 1MFAH 25C8L 4KJQC 1BG1A 1QLEH 2HT2D 1P69B 2HX7A 1E42A 2AGJH 7PAZA 4RFEB 1AP2B 1HDMB 2ZWLT 4FS0A 3P77B 3U82B 4CJ1A 3W9EB 4P5SA 4W68A 5INCB 4F7CA 3GBNH 5J6GB 5JOEA 3LZFL 1T6VN 5EC1A 1I7TA 1PLGL 1JNHB 3QFJB 1HE7A 2DH2A 4KKQA 1F4XL 1KJVB 8FABB 1SEQH 4Z0BH 4ZMQA 4MJ4A 1AGDA 5ANMA 2VOTA 4B9KC 3WKYA 2B39A 4OLVH 4PGBA 1B2YA 5I1JH 1FAKT 2NZ9C 3MTRA 5E08H 4Y4FA 3DX6A 1J0KA 5I1AA 1XGTA 4YEFA 5CJXA 4XN1A 2ICWA 2C3WA 4UT9A 2YD6A 5AKTA 4IYKA 2UZYB 2VMFA 4DHLA 1R24B 1DCEA 4PJ8D 3BVUA 4RMRA 3UJTL 4K5NA 4DGUA 4GG6E 1JFQH 3D0VB 2DZEA 5FYKU 1OAYL 4ADGA 5CSBA 1L7TL 4RIRA 5L7XL 2LFGA 4QOKA 2VLKA 1PIGA 2OBGA 2VTFA 1GYAA 3PAZA 4RA3A 3GMRB 1TCMA 2H8PA 3SOBL 4MAUL 1WGVA 4NNPL 1ZXQA 4DTGL 2EXYD 5IROC 1CFMA 2OS7A 5IFJA 2WKGA 4KPHL 1P84J 1YN7A 4JHWL 3APCA 4AYSA 2XWEA 3ZL1A 3Q2LA 3UBXB 2GCYB 3X11A 3BO8A 2XG5B 1E7VA 2JVUA 4JKLA 3VRJB 1PAMA 2VITA 2OK0L 2AANA 1JGUH 4E9LA 2X3BA 4X6DA 1KTRL 3FJTA 1J8RA 2JB6A 4PIBA 4X6DE 3N55A 1RZFL 4C83A 2P42B 2COVD 4LNVA 3RIAK 4GS7B 4NQCB 4MSWA 1XSOA 1J9RA 2PYEB 3NOIA 3NSFA 1KV7A 3WNIA 2CD0A 4X7TA 5HY9B 1OCZB 2XOTA 3GSVA 1OF2B 2D7PA 4OUOA 4AC4A 1EJOL 4IBYA 4OLXH 1OE3A 3SPVB 4ZMLA 2KZKA 3K72B 4AUJA 4MA1C 2R23B 4LARL 1NDGA 1I1FA 2ITDA 4UQ3A 4MAUH 3SJVE 4WY7H 4J3TA 3L5IA