2J43A

Alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
ASHHLRMHFKTLPAGESLGSLGLWVWGDVDQPSKDWPNGAITMTKAKKDDYGYYLDVPLAAKHRQQVSYLINNKAGENLSKDQHISLLTPKMNEVWIDENYHAHAYRPLKEGYLRINYHNQSGHYDNLAVWTFKDVKTPTTDWPNGLDLSHKGHYGAYVDVPLKEGANEIGFLILDKSKTGDAIKVQPKDYLFKELDNHTQVFVKDTDPKVYNNPYYID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords SPYDX
publication title Identification and Structural Basis of Binding to Host Lung Glycogen by Streptococcal Virulence Factors.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 38
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03714 PUD Bacterial pullanase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A02
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j43A01
3AWFA 3V0FA 2J44A 3V0GA 2J73A 5BZZA 2FHBA 3V0HA 5BUGA 3V0JA 2J43A 2FHCA 3V0IA 3AWEA 2J72A 3V0EA 5BZXA 2FHFA 3AWGA 3N0AA 3V0DA 2YA1A 2YOCA 2J71A 1D5RA
chains in the Genus database with same CATH superfamily
4E42B 5ESAA 3TIDB 1RJCA 1BZ7A 2WWKT 1HJBC 3T0WA 2EDTA 3QUKA 5FEBA 4XPGH 1I7RB 4GQ9H 5EEZA 3F8UB 1AY1L 2WPGA 4OQ1A 2WJ7A 4FF9A 4ACTA 3AT8A 3QT2A 4HH9A 2PCPB 4N6RB 1WFTA 3NSJA 5I1KH 3TVMA 1Q0YH 5CGBA 5IOPB 5CZXD 1MXDA 3NSFA 3MGTA 5J57B 1MFAL 4JY5L 2FTAA 1EAQA 2IV8A 5GISH 4W9CC 6FABH 3RWEB 4BH7B 2AJXH 4NUPA 4B9YA 3SHSA 3QNZA 5DLMH 4JHBA 1CXLA 1EMTL 4M8QB 12E8L 3DA0A 4PJ8B 4G72B 1NDMA 3OKDB 5HVHC 4FQ1L 5CR8A 4MB3A 1ZLWK 3T0EA 4WO4C 3JT0A 4FG0A 4X2UA 1JNHA 4KFZC 3U9PL 1TCRB 4QY8B 4F58L 4Z5RB 1QO3B 1EBPA 3OJDA 3OZ9H 4HIXL 1NAMH 3RL1B 1CK0L 2AV7A 3UG3A 1QVOA 1YUKB 1EHXA 5A7BA 3ARGB 1R3LB 1ETZA 2UZXB 3VRLF 3ZR5A 2RJMA 1UUSA 4BFIB 3RTQA 1NAKL 1YQ2A 4DN3H 4F5CE 1GH7A 5EZPA 2QSQA 1WISA 1J8KA 2I07B 3LH2H 5A6MA 2IAMA 1WA2X 2HB0A 1WSST 4OJEH 5AVRB 1W15A 3TNNA 2W9LA 4NM8H 5FV1L 3OQRA 1FVEB 5GGQL 3K5SA 5KW9H 4G1EA 2XZCL 4N8UA 2WZ6A 2DLIA 3H53A 5E8DH 4Q9QL 2FJFB 1JWSB 4HK3N 1S3KH 4JPQA 3HHRB 4WUUD 1RJYA 3RWDB 2YMXL 3C60D 4NP4L 3T0VA 1KB3A 4PB0L 2PCYA 3FO2B 5F6IC 2AXJA 2CLRA 3W57A 4LAJH 1FE8L 5AAPA 4BQ8A 2EJ1A 3VFSB 1DANT 4UQ9A 5F96L 2Z7ZA 1HXYB 4KO5A 4TVSa 2D7NA 1OD9A 4X6BA 4I0PA 3FQ2A 3GI8L 4N2CA 2GABA 4XODA 3CZFB 5I1AB 4GSDL 4I8DA 4O4YH 2GSGB 5DD1L 1MRDH 5I6XB 2G4GA 3WS3A 3VGHA 5FOJA 3H0TA 2Q3AA 4XNUL 1LD9B 3O2DA 2EXWD 4ZYKB 3LRSA 4NT6B 1TZIA 1KULA 2D31A 5EF0A 2CH8A 2IPTL 3K91A 5FDWA 5D70L 1J0KA 1ZPLA 2F7QA 3KPRE 3A3YB 4NN5B 3TV3H 1JPTL 5IMOA 3GBMH 4W1TA 5GZOD 4FNUA 4Z3FA 1HS6A 3G5YA 4N8VB 3GTTA 4JY6A 3EGXA 4KK9C 5T1KB 1S9YA 1XZ0A 1QLEL 3H6JA 4G6KH 3IWUA 4GRMA 3MO1B 4V1DE 5E08H 3TZVD 3QEUB 2JTYA 1G0XA 4AYSA 1JD7A 1RIVL 3CZNA 5DYOB 1JTPA 2QQLL 3O3DB 4P46D 2UZIL 2ZX6A 2G75A 2FJHB 2W5PA 2OCCB 5KVDH 2WQAA 1DFBH 5BVPH 3CK0H 2E0PA 5JW3L 3P73A 1E2ZA 1H5BA 3ZHDA 2JKNA 3UTOA 1UWEH 3BFOA 2W0LA 1S9VB 4MD4A 4X9GA 1U8MB 3Q8BA 4G42B 2V2XA 3E1F1 4U4IA 4W9IC 4JN2B 1R34A 3ULVD 5EN3A 3T6WA 2JSFA 2YBRB 5TE6H 3LDBB 4UV4H 4XI5C 3UO1H 3L3OC 1T22A 5B3JF 3UBXI 2ZUTA 4ZTOH 3HB3D 2HRHA 3T8MA 3VWKB 4C56A 3EYVB 3LS5H 2ZYSA 3Q0HA 4MS6A 1N2RA 1D5MB 4P4KD 2BS8A 2BVQA 1W6LA 4F7MA 3WUWG 5DR5H 3SDAB 4NKIL 4DW2H 4UNVA 2C7UA 3K71B 4QRRA 4EZKA 5C71A 2FWUA 2HG0A 3VI4B 5I17A 1FGNL 4XXWA 3P0YH 3FB8B 4CKVX 4GP4B 5CWSB 1PSKH 4PW4A 3VW3H 3UTTA 3LSOB 3C9NB 1CE1L 3UAJA 1PZBA 4X6DE 1ZPUA 4U31A 4QXWA 1A14H 5D1ZB 3ARBA 5B1CA 4X9FA 4AIZA 4KX9A 2VM4A 1EANA 1U8KA 3FB6B 5EB9A 1P6FA 4ZX4A 4IRSD 1AS8A 4MRCA 1WHPA 3MV9E 3JWDC 5DJ2B 3DTUB 1LO4H 3VD9A 2IANA 3FW6A 4WSKA 1ZHLA 5JXAL 1T3FA 2XFXA 3DX4A 3FQWA 3D4GA 1QBBA 4DPRA 1SXCA 4PRHB 3UBFA 5I1LB 1O75A 2OV0A 2HVBA 2JI2A 4JKNA 1RAMA 1IL1B 1E67A 1BM3L 5E2VH 1OP4A 1HZHH 2AXGA 4JR9H 5G5DA 3LXUX 4KJYB 4NWUH 3SJVE 4ZXBC 1RUKL 2ICWJ 1CB4A 2OL3L 3QIBB 2HMIC 3SDXF 2Y69B 2ICEA 2C9UA 3B2DC 4HK3J 2AABH 2OP4H 3MBEC 3E80A 4GAFB 5IP4A 5FFOA 5F89B 1V7NH 1UKQA 2X4NA 3G5VA 4F2MA 4FTVB 5F7BA 2WM0A 1INEL 5DJ6A 4K9JA 5FYKD 3UGEA 1AGEA 1B0RB 1BD2A 2YBGA 2XY2A 3VDBA 4PHXA 4MA3B 3STZB 4YL9A 1GYAA 1KTDB 4F1ZA 4WENB 1G1YA 4D0CA 1U3HD 2NYYC 1RZGA 4EIUA 1D2PA 2ZUYA 3ASOB 1BZQK 4WWKB 6PAZA 3DGGB 2RH0A 2IVFC 3QPQC 7FABL 3O3BA 2ZCLH 2FYYB 3DPBA 4PJCF 5EC2A 2V3EA 4M62H 2LABA 5AVWB 3ILPA 4CMMB 1LEKA 3RPKA 1UD6A 1OGAA 3LOWA 1KF9B 1WFMA 1ASPA 1S8DB 2NY5C 2BOLA 1ZOXA 4QRFA 3RA7H 1ES0B 4ZOCA 2W88A 3FC8A 5C0GA 2ESVB 4OI7A 1KLFB 2DWXA 4G5AA 4Z7WF 4F91B 4KNQA 5A16A 1S7XA 4OZGB 3GXUB 4IRJD 3LQAC 5DDHB 5DRWB 5ICXA 3NABL 2G2RA 4L3ED 4Y2OA 3VO0A 1Z9NA 9PCYA 1P84K 3D06A 4DP6X 3LNEA 4QTIL 3V6ZB 1OHZA 5EFIA 2V37A 2DQCL 3WV0A 4JQXA 1BAGA 5CHNB 2EKJA 3IGAB 5J12C 4CADB 2P49B 2FATH 1QHQA 4LLDB 4JRXD 5HJ3B 1MIEH 3HUJE 1N7MH 4XB8A 3KGTA 2EO7A 2ZSWA 3QSKB 3LMJL 4XOEA 4WTWA 2DQFB 4X6CE 2O61B 1BQLH 2FO4A 1SHWA 4KAQL 3EO0B 5JW4R 2VXQH 2WBKA 3PV6A 1FBIL 2XQ0A 4FQCL 2AK4E 5CP3A 3B2XA 5TE4H 2YRPA 3PPSA 5I5IA 4TPRH 1D9KA 2V5RA 2YN5A 2CRZA 1RI8A 3EH3B 4E0RA 1X5XA 4ONGH 4L8SB 1OP5H 3DRTA 3SKMA 1NOLA 3IXAB 4JAMA 5AZ2H 1IGMH 3C5JA 1XIWD 2A73A 1EJ6A 1N59B 3GBDA 4LDLB 5D7LE 1EH9A 4ZS6D 3F65A 5KWYC 2GEQA 1N64H 2FIRT 4XO9A 3HOGA 1G84A 3QORD 1COBA 2B77A 1UXWA 1YJDL 5CGYC 4YDVB 3UBGA 2G3MA 4OLYL 3WKML 1OXYA 5C7XL 2K45A 2CUAA 4S2SB 3MTXA 2BCKB 3S35H 1CR9L 4DGWC 2V5SA 4RMVA 1JXGA 1X7SA 3P3TA 2X5PA 2FHFA 4XNZC 5HHMD 3T3PE 2ZIDA 5DJAA 3V7AE 4JANA 4MNGE 1YN7B 5C0DB 3K0WA 3QFJB 3V4PA 3ZPDA 3WKYA 5EF2A 1JD9A 4QTHA 1B0IA 2R4RL 1CGXA 3DX6B 3E8VA 4F9PC 1F00I 5ENWB 5FR3A 2HFEB 4XHJD 2A4CA 3RFZA 3ZDYE 1RHHA 4PJDE 1P7QA 1MLBA 4N9GA 5I5JA 1VPOL 3DUHA 2NLJB 1UB5B 2N0KA 5DFVC 5KSVA 4MJIB 2M1KA 2EDOA 4GAJH 5CEZH 2O6EA 4N0YL 4LLYA 4PIBA 4QI3A 3BVVA 2A0LD 4XO8A 4A7TA 4ENZA 1FH5L 5K9QI 2Q86A 3PQYA 3SDDA 5E9DD 4PJBF 1DVFA 4G6AD 1U91B 1BW8A 3WL9A 4U1NA 4ZG1A 2R0ZL 2LOEA 4BD4A 2GHZA 4HQQH 4JGJA 1BQHA 4UTAA 3SOBL 4PLNC 2JF1A 2XN0A 1FL5A 1WFUA 4WI4A 3ARFC 4Q4EA 2AQPA 4JGMA 4A6YA 3QC6X 1VZIA 3GUFA 3ZYIA 3LPFA 4J3XA 3D0VA 4PRIA 3V0GA 4B3EA 1GZPA 4JRYA 4X5WA 5AZUA 1UEYA 3GSWA 1HEZA 1QNZL 4L2LA 4P5TC 1BREA 3DLQR 1LP9E 5ISZE 5FYJD 2ZOUA 5I30H 4UQEA 3RQ3A 4JFDE 4YC2C 5B7MA 2BS71 5EOCJ 3VNYA 1UD8A 3UTSE 5IR1A 3HI1B 4WW2F 1ED3B 4WY7H 5FUCC 3UTQB 3FQTA 3IXTA 3H42L 1NCAH 5F7NC 3ERXA 1ZT4B 3T2QA 1G9NH 4OKVA 5IHBA 4HAKA 3MRRA 1BOYA 1VCAA 4AEEA 3K5RA 3KYOB 3FU7A 3VRJA 5L0QB 1YNLH 1WH0A 4PJ7F 3A22A 1NCDH 3MNDA 5AW6B 1IQWH 1KFAL 3FS9A 4DKDC 3IFLH 2V2TA 2X4TB 3TBSA 2ZT9C 4GKLA 3L4CA 3MJ7B 3AXHA 4BGLA 1PMYA 2P5PA 2R1WA 4JBSA 1E5UI 5TH2A 2V7HB 2R29L 4PJHA 5DO2D 3FRUB 4NQDD 4Y0GA 1S7VB 3QJQB 5FGCB 2F54B 5K9OB 2P48B 1NQBA 2OJZH 4GS7B 4FFZL 5F0LB 1CVSC 1EZVY 2OXGB 2E75C 1UVQA 4JHWH 1KBGH 2AQ2A 2NUTA 3RX8A 2BNUB 4P3WA 3CFJA 3LZOA 1QACA 2IMMA 1E4HA 3PUCA 5F7MC 3I50H 3IDJB 4A2FA 2AKRA 5EBMA 2WXJA 1SFDA 2ZAHA 5CP7B 4NKMA 2EIZA 2A74B 1A02N 5E5UB 4F8QA 4KHXL 2EDJA 4N0UE 2WZ0A 3LEXB 5B3SB 1UTDA 2AJYL 1E8ZA 1CYGA 1BJ1J 1YO4A 1OB1A 3CCHA 4R4NC 1URLA 3CFNA 2XI9A 2VSKB 1IT9L 4GT0A 1QRND 3MOAH 1ESOA 2CKBB 4H2CA 3QJSB 1ZIBA 2YPLB 1J5OH 3SKNA 3MV7B 2YWZA 4O02H 3TO4A 5J1AA 5TFSH 3BWAB 3QO1B 5KVEE 4IKKA 1TTAA 5T33H 5I15H 5HVWA 3QPXL 3B9DA 1NFDF 4XP5L 1T5XB 3LN5B 5D1QE 5BV7L 2H6OA 2EC8A 5TK2A 4U1IA 4B9JA 5F44A 4OGAC 5DFAA 5TQ2H 5MEPA 5MEQA 1FC2D 3BHBA 1DJWA 1FFTB 4KQ3L 1E8WA 2YUZA 3G08B 3II1A 2NXZD 3DXAA 3N0PB 4RDQF 5DC0A 3MLTA 3KYKH 5DWUL 4LEOB 4A2DA 3IS1X 1MVUA 5DZVA 4GUPA 3OX8B 5ICZB 4EQ3A 1MJJB 5IEKA 2ZCHH 1SEQH 4CNIB 5JYMA 1XGTB 2R2CA 1L9TA 1YEEL 2DMBA 3TH4T 4LCYA 1NC4B 3ZDZE 4KV5E 3UTZB 4MD5B 2UZPA 3H7BA 1YECL 2A3TA 2Y7NA 3WJLC 2OI9C 2QGDA 2EEXA 4GMTL 3JYBA 5DJYA 4DHLA 1ZSDB 5C86A 2I85A 4WFED 3OKKA 3CPLB 1UZ6F 1N0LA 3X2QB 3VXSD 1OT1A 3QUZA 1J1OL 1WFNA 4M02A 3GM0A 2IDUA 1Q0EA 4NZUL 1L9PA 2CGRH 2GJPA 3QXUA 4FHKA 4X98B 1WCQA 1B3JA 1WBYB 3OC8A 2G3NA 1G9MH 2F19H 5ACMA 4JO1H 5FM8A 5DJDB 1SEBB 5L9DL 3IFPA 3F5WA 4MJ4A 1F56A 1IGJA 5I74B 1E5ZA 3PWNA 3R06A 3K2MC 4L3CA 2ROXA 3VXRD 5IG7B 3DTDA 3QR2A 2K3HA 5DVKA 1UGKA 4AM0A 3UZQB 2R15A 3GXFA 3SGDI 5FGSA 5JA8B 4HX1A 3LEYH 4HU2A 3S4SB 1P69B 1XCQB 1DQLH 2BXYA 5KJ7E 3VQ2C 5F7LB 1E28B 1OY3B 1AZNA 2F1AA 2VZUA 2F0CA 3FFCB 4NN6B 3QXWA 1CF8L 2MRYA 5MI0C 2PYFB 2VR3A 1A4KB 2C3WA 4GNKB 4XWGH 3RZCB 4JO4L 2F8OA 4NCDA 1U4EA 3SDXB 3LXCA 1OF2B 5AKTA 2ZXDA 4J3OF 3L9RA 1BVKB 5T3XE 3LPOA 2D7QA 3KR3H 4JB9H 1B0WA 4NWTH 3UZVB 4X8GA 3I02B 1FSKC 1NIAA 4D8OA 1XB6A 1PGRB 3QNFA 5JDSB 4XGZA 1UWFA 1F2XK 5ECGA 3WN5C 3V8CA 1KCSH 1LK3H 3FO1A 1QSFD 1T0MB 3V0WH 2Y1VA 1AO7E 3S88L 5CJQL 3N1PC 4Y1TA 2CO1A 4DWHA 4P2QA 2VXUL 1HKFA 4G6MH 3DYPA 3KPMA 5IROA 3T0AA 4BUQA 5CFAA 5IMLB 5ID0A 1E9PA 4XVOA 4HUUA 5EEWA 2YAOA 1KBWA 3ME0A 4IRZA 2P3YA 5F7YC 2DM2A 5EU6D 4JFFD 5K9KB 4PJCB 5INDB 2PW1B 2NXYB 4AYEC 2FLRT 1OSPH 3NJKA 5IESL 4XVUD 3OAYH 3P77B 1F0LA 43CAB 1VACB 2ATAA 4H8WH 4MDJB 4WHTB 5CN1A 3D39D 3M07A 4JDZB 1J8HB 2F5BL 4AMWA 2G5BA 4JO8A 1EHKB 3B1TA 3EHBB 3LRLA 4MCZA 4Z7WB 3OHXB 4PP2A 5J9PB 3EAKA 2YOCA 4V33A 3I3DA 3BEVB 2FZ3A 4KROC 5D7IE 2R2EB 2AW2A 2G60L 3AGWA 3OMIB 43C9B 3CX5K 2G0KA 5GGSB 3RWJB 3S3CB 1CXEA 2BLFA 2CPUA 4WJG3 1MAKA 4ZQKA 4AG4L 4DZBB 5EBWB 1GS8A 3EOTL 3IDGB 4OFPA 1TO5A 4WWNA 5HYQB 3PABB 5I1HH 5KVEL 2BSED 4AIOA 5SX4H 3FBKA 4JS7A 1U4FA 5FC9A 2B4CL 2UZYA 5EC1A 4PR5B 4G8EB 1BZOA 5C0ND 3UJTH 2CHNA 1IARB 2MQCA 2SODB 4NHCL 5DRXB 4PCSA 3VFTB 3GGWB 1ZVNA 4M4RB 4XN7A 3S96A 4NXKA 4Z95L 3MR9A 4N24A 1X5AA 5E4EB 1JI1A 3RNQA 1CGSH 5JHBA 5JW5A 2BNRB 2LQRA 4HOZA 3UG5A 1TJGH 5TDOA 3LH9A 2X41A 3HC0A 3QQNA 4MMZC 3DSNA 4KZEL 4XPHH 3ETBJ 5KG9A 4UV7L 4G3YH 5CJOH 4ACPA 5C0CA 1RK1B 4HWEL 1YY9C 3UC0H 3WLBB 5I1GH 1LJMA 4Y4HD 2DI8A 3RWHA 3SBWA 4N0FA 1OO2A 2X4UB 3OR7B 2YZ1A 3L7FA 4GINA 3S5LG 3ZKXB 2K6YA 1HHHB 2WLMA 3QIWA 3L7EA 5CP3H 2PNDA 2I25N 1CVRA 1PZCA 3FONB 1HVXA 4M7ZC 2EH7L 4NN7C 3UPAA 4Z0XA 1OAKL 1ECZA 1VEMA 4TN9A 2JH2A 4AQ8C 2CNZA 4AH2B 3BCDA 3CVHA 3CXDH 2Q5BA 3WYRA 2Z92A 1AOHA 4NRXA 2EXSA 1JV5B 5TE7H 5LQBH 4FLOA 5ID1A 1CFBA 2E59A 5J3HC 2R23A 1A47A 3WS6A 4WF7A 4ODXA 1TJMA 1SXZA 1FO0B 1QSEE 4GXVH 4PJ5D 5HHOA 1S9WB 1YJDC 4D3CH 3VM5A 2CHWA 5DZAA 2NY3C 2WK2A 4OCLC 3WTXA 3ML8A 1OTSC 3STBA 3QC5X 3QZNA 4NQVA 1WC7B 3L16A 2KDGA 4MGXA 1CLYH 4G9FE 4U1KA 3V52H 2NT1A 4PJBB 4XN2A 1KN2L 5FYLH 4QHNA 3T6XA 4BA0A 4J23A 4Y1AD 4YUEH 5T3XL 3WNKA 4TF4A 5EF3A 4QMEA 4E41D 1ZRUA 5HGAB 1MWAL 2VDPH 3O3UN 5CIPA 3D3VE 3P4OA 4OLWH 1BQ5A 1QPPA 1I4FB 5F3HA 5LGYA 3CLEL 5LNEA 4PI2A 1WIUA 1SNRA 1XEUA 3WE6B 4KVNL 4KMTL 2BP5M 4RFNC 4XVJL 4A37A 3CFCH 4J3WA 3M88A 4PJXE 3O8XC 4KVCL 1REIA 1TQCC 1OGTA 4PH8A 1WCBB 1BLNB 3BKML 3QIUC 3V5HA 2R69L 3TBTB 4WW2B 4UTAH 2OMTA 2Z31A 1MCWW 5FCUH 3NSDA 5GRJH 2C9QA 3NDYE 5F7EL 5B38A 3BP6B 5JZ7C 2WLNA 2H3NA 2OKMA 1NBYB 4AEHL 4TNVK 3PWPA 1TJHL 1XF3B 4G1MB 4XCFH 3WO4C 4PJ7B 2N0MA 1P7KA 2NY0B 4P59L 5JHLL 2L7JA 2WLIB 4HJIA 1BZEA 3EADA 1L9NA 2WTPA 5JW4N 4G7VL 2DLGA 5IEHB 3OF6D 3DV6A 4QTFA 3DX8A 3UAFA 1GVIA 3SE3C 3WD5L 2O5YL 3C8HA 4EDXA 2KC0A 1XD1A 1AE6H 4GEJA 3VX0A 4IS6B 3R1GL 4HS6B 2LVCA 3SBPA 2XZQL 3WY3A 1WGVA 2CXKA 3VH8B 2J8UE 2GJ6A 1H0DA 3GLEA 2A77H 4P9MH 2X70A 1MRCH 1A6TB 3P2DA 1I9RH 5DUBB 4LT7A 5EO9B 5F1IA 4NZJA 2ZG3A 5FXCH 4PJAE 4P2OA 4L3EE 1J7VR 4TUKH 4R7XA 1Q38A 4AV0A 5CAYB 1D6VL 1DBMH 4LLQA 4PJ6A 4AYID 1BSIA 2WINB 4MXVE 3HG1D 4YHLH 4NO5A 4M43H 4JFUA 5F6HJ 5KYWB 3ZIYA 4C83B 4ZUUA 2WBJB 4UB0L 5CEYB 5C3IA 1FLRL 1TF4A 2G9KA 1YDPB 4JM2C 4NPYA 3LKRB 4QKXB 3W39A 4MNQE 3WFCL 4BH8B 4JRXE 2X2IA 4MAYB 3O6LH 3MVSA 4EZLA 1D7FA 3SCMD 3SPVB 2DMGA 4Y4FA 4OZHA 1GGIH 5F1NB 4YEFA 2FO1A 1YEJL 1F97A 2E56A 4IEFB 5E70A 1I7ZB 3NA4A 1NFDB 4PGBA 4GO8A 5KAQF 3W0WA 3HKZA 4R26L 3S8GB 2ORBL 4L05A 4L4JA 3II3A 4PGEB 5D2LE 5I16B 3LRMA 1MJ7L 4ZPTB 2EE6A 3SDYL 2EDLA 2MEJB 4QRPA 3SDCD 3TGXA 4B9FA 3ARXA 3ZRCC 4GSRA 4MS8D 1G9HA 4ILDA 4FHJA 2XTJC 3IJEA 1JGEA 4P04A 2P5WE 4XXDB 4O00A 1KB5A 3GMNB 2YJQA 5E2UL 5BV7C 2Y06H 3UOAB 3WLWD 3UL4A 2JIXA 2IWGA 1VA9A 3CH8A 4Y2DC 1GYWA 4IOFD 3HG2A 3V7AG 4UTBL 3EXJA 1UACH 4R7DB 1CD8A 1SXBA 1XGUB 3TYFA 3WGVB 2IBZY 1V27A 4HPOH 1GS6X 4G82A 1DVZA 5D6DA 4I3RL 4MD0B 3VFMB 3R0MA 2CGYA 1ZVSA 5F72S 2UWEE 1NC2A 1QYGH 3BCFA 3B9EA 3HE6C 5FOBB 5KSUB 3WU1A 1DVSA 1HKLH 1RPQA 1CPUA 3GMQA 4HPYH 1UM6L 1A65A 2J21A 2AERT 4MQ7B 1A3RH 3PDOB 4NO3A 3BMWA 1WV7T 3UBXA 5E6ID 1A6UH 1NUNB 4ZMTA 4KHTH 4E68A 3RY6C 2BNQA 4WI0B 4N2FA 2FDBP 3IDMB 1W8EA 4XNYH 4LLUA 4XPFH 5ERWB 4TVUA 3E2HC 3O11A 4Y5VB 2AAAA 3VB9A 1F8TH 4G8GB 4UQ3B 1K8DA 3KCPA 4YN3A 2OMZA 4CSTA 2A6IA 2W1NA 4OVUA 5AAMA 4IBUA 4FHBD 4IHBA 5FYJE 3JUZA 2E9IA 4IM8A 5LNDA 5EOQL 1CIDA 4KK8C 4K3GA 4QDGA 1N12A 1IBFA 4WNJA 3EGDA 1IQDB 3S3JA 5ESQA 2IH9A 1GGUA 2FEDD 4XNXH 3U83A 3RGVA 3KE0A 1R3IL 4JJ5B 3L8QA 3JWOL 4K7PY 3FTXA 4CMHC 1RIUL 2I27N 3CD4A 2PW2A 5A2LH 1JMZA 1ORSA 4OKDA 3CN3A 2VC2H 3HRPA 4PN6A 3VFVA 1NINA 2WVVA 5CR1A 3QAZB 3B9KC 5L8KB 4YPJA 2C4XA 3QUMA 3RVXD 3ZYJA 2MSPA 4LL9A 3VFWB 2B1AL 4N1CA 1BIIB 3ZO0A 5D7JC 3WCYA 4PJ8D 1CO1A 1P1ZA 4DEPC 4LSRH 2W0PA 3ZUNC 1AFVL 3FTWA 4IRZH 4CVUA 4L9DA 4F9LA 3E9TA 5D55A 4LBEB 4E9RA 2I24N 1SY6A 2E9BA 3AB0B 3UIZA 2RFXB 1ORQA 1GMEA 1KGUA 1FL3B 2MCPH 3N9GL 4K94L 1Q1JH 1MZYA 2ZWKA 1JZ2A 5JW4Q 3L5WA 4DCQA 3ARTA 3LKNA 3GHPA 1OALA 3ARGD 2HLAA 3Q3GA 1WWCA 2AQNA 4IU3B 4KKBD 1A1NB 4KNTA 5C0BA 2MQGA 1U2CA 2D7OA 3D34A 4YWGL 5TQ0L 3CXHK 1TQSA 1JWMB 2W0KA 2DWTA 4XBEH 3IVKB 3W9DA 2MNUA 2BOCB 4YHPA 3M17B 2M2DA 3LPPA 1KPUB 3IPFA 2PO6B 4LNRA 1LWHA 3EJSA 3HW7A 4JUSA 1QRNE 2XZAH 2Z7YA 3V9EA 2HT3D 1WDAA 2EEAA 1YC7A 3FSZA 3O4OC 5DJXA 4AUYA 4CC0A 3JTSA 2R39A 2B4CC 4ICXA 3K72A 1E4XL 2HJLA 4OLEA 3MRPB 5JHMA 3TFKC 4EI6B 3GMMB 5D1QC 2EICA 5ESAB 4X5XA 1FAKT 3UJJL 5AW1B 3QUKB 2BDNL 4Z0BH 4XMUA 5T1MA 1BWWA 4MVBD 3K46A 1SLWA 4BFKA 5E7BA 2VDKH 1LDPL 2ARWA 3TVMB 3CH1A 2P45B 1OAZL 4MLSA 3QYMA 1HL4A 3HI5H 3MGTB 2E4FA 5KYNA 5E8NA 2FBJL 3FOLB 3PGCA 4F8TA 4RGNB 4DUVA 1ND0A 3US9A 3B7RL 3NCWA 4HXAL 1R0AL 1K85A 3R7QA 5IHZA 3A5VA 5E0FA 1A0QH 1NDMB 4MJ6A 2DIJA 3QNYA 3DX1A 4JDEA 3ECBB 3T0EB 4HSQA 4JRFA 3PL6A 4C8XA 3VXSE 1JNHB 5IFHL 3QDMB 1YEIL 3CVHH 2ZAIA 1I7UA 4Q58C 1NWPA 5T1KD 3OKYA 1HIMH 2CO6B 3L5JA 3OJDB 2Y23A 2JKRM 1IKFH 1WA0X 3B2PA 1C5DB 1CI3M 2EILB 2AV7B 1MFCL 2Z0BA 3B9AA 1CFSB 3L9EA 4KDVA 4M5YH 2B2XL 4WFFD 1SJEB 1ETZB 4KXCA 4UOQA 1KCUL 4NAMA 4HDIA 1U42A 4NYLA 3RTQB 1J12A 3QEQA 4X7SH 2F7OA 2XN2A 5BRQA 2X9WA 2IAMB 5D8JH 3D9AH 3INOA 3TNNB 3IE9A 4OQTA 3CDZB 4J4PD 3BPOB 4YGVA 3L2MA 2CDGA 2B08A 2QQNH 5SWSA 1RJYB 2MKWA 4RWYH 3WXWL 2AANA 3T6QC 4JGNA 4IBYA 1TSRA 4L8SC 3DGCR 1M1SA 1OQOA 4JZNA 4YE4L 4O9HH 3BZEB 1KENL 4LCWB 3D87B 4HCRA 5E0QA 3UJIL 5B39G 2X7LA 1S5IL 3VWKD 4S1SH 5CIPH 4DQOL 4R3SB 5DS2A 1IUZA 1QWUA 2B14A 4MQXD 1YC8A 4I0PB 4D0BB 1UT2A 3AS3A 2B1HH 4KKRA 1KCVH 1DJSA 5JIDA 2Y25A 4G7YL 3SDAD 4P2AA 5GRWA 4WW1A 3WS3B 4Y5YA 1AMXA 1HH9B 3H0TB 4RBPK 3EYSH 2X4SA 4PJHF 3AS0A 5EO1A 1JXDA 5JPMB 2XXCB 3V0EA 1TUPA 3MRCB 3T2LA 1YPZE 3GIVA 4JFFE 1TZIB 3N3EA 1JNNH 3EBAA 4XMKL 3FCGA 5FDWB 3FTSA 5F9JA 1KEGH 5IMOB 4R6UA 5D1ZD 3G5YB 3O6KH 4A68A 4NQXB 4JY6B 3EGXB 1KTCA 3G3LA 4PMFA 4J3SA 1S9YB 1XZ0B 4WEBL 1HNGA 2VLRA 1ZEAH 3RI5F 3WJJA 2VLME 4GRMB 4OIIL 2FWOA 3X12A 1AI1H 3BSZH 5E4AA 1Y07A 5JW4M 4E9YA 5ADPH 4PRHD 1MIMH 5DUPH 1SPDA 3DI3B 4BGDA 4OGYH 2GHWB 1QFOA 4KDTC 5E2WL 1G7IA 4FQJL 3C5ZA 3I75A 2BWIA 2K8MA 4ZFOL 3F58L 1T1XB 1AQKL 2WUCL 3QIBD 1FUNA 1RURL 1Z0NA 3QUXC 5DQDH 3ZL1A 3BGFB 1PIFA 4WU7B 5C3LD 3FULA 4HS8H 3ZR6A 5DJCA 4MD4B 5LHDA 2N1TE 2ZJSL 3DK0A 3V6OC 1OLZA 2CBMA 1YEHH 1BFVH 3MV11 1ITBB 1NMCB 2MTAA 1SZNA 3U7YH 4UQBA 2OW6A 4PLKD 1T22B 3BUIA 4ZW8A 4JPSA 2V8MA 5BS0E 4C56B 2YEQA 3L3IA 4KUZH 1N2RB 2B59A 3X1EA 1R4XA 1YLBB 4RFOH 5F21B 2BVQB 4WWKD 2H41A 4GBXC 2H2PC 4DJMA 2IMNA 4GO6B 3MXVH 1JUFA 1OTTD 2MPAL 3K74B 4F7MB 5C8JA 5CN3A 2AJZA 1HAWA 4ZW6A 3QP3A 3F7LA 2C7UB 2WXIA 4TNGA 2J8HA 4QRRB 5JPNC 3TTSA 1PZ2A 4OLUH 4OCSL 2XWCA 1FF5A 1G7QA 2OMWA 5EWIL 2FB4H 5GGVH 2ESVD 2R0KL 4NGHH 2OLDA 2AV1A 2WZ5A 2OJ1A 3CIAA 2VDOL 4KI5F 2BY0A 2QV4A 4AIZB 5ESVB 1M71B 2KMWA 1FHNA 3Q9QA 5CCGE 2PCXA 2CAKA 1ZCRA 3S6CA 5GZOA 4UIKL 3M1BA 4EKJA 4XNDA 3C09B 4NQSB 3RVUC 3I9GL 1KB5H 3DJRA 3G9VA 5L4MA 1AQMA 2Y07H 4OCXL 3NJIA 1GJIA 2IANB 3ALWA 3GI9L 5JHAA 4B7LA 1ZHLB 5J1SC 2EDYA 1F3RB 4PLJC 1GCYA 4OB5H 4N4YB 4HUXA 5D7SL 3FQWB 4KXBA 3S5YA 1EV2E 3CC5A 4IGBB 2AQTA 5A1AA 3TXAA 4WTZG 2A74C 1L5GA 1LE5A 2W60A 5F7DA 3KLKA 4FFTA 2AXGB 5G5DB 3TN0B 4D9QD 3ZW3A 2DTSA 2LFGA 1T7VA 4UF7C 4NQCD 1UOVA 5IGXH 4N2KA 2QGBA 2ICEB 4O2FB 1KGCE 4JFTA 1C8QA 5I1EL 1VEOA 2CBOA 5GGRB 2X4NB 1OGPA 3G5VB 4FFYA 4E41E 4OV5A 3TONA 1I3RA 3QJXA 1AJ7L 3E6FB 3HC3H 4M48H 1XSJA 2V5TA 3DIFA 5F9WC 1MCOH 4PRPA 1A6AA 1BEYL 2NZ9D 3FHQA 1DSWA 1WZMA 3NJFA 4MQSB 1BD2B 1TTGA 4NBYB 1KC5L 3HE7C 3DROA 4I9WD 4D0CB 2BZ7A 2BVOB 4KKZA 1RZGB 3FUMA 3OD3A 1UD5A 3V2AR 4G8FB 4W9HC 5HHXL 4YLBA 4OLXH 3GJFA 2NR6D 4APQB 3NIDE 4EJ1C 3BKJH 1J87A 3CFTA 3UYPB 3BUDA 5EC2B 3DPBB 1J9RA 3KD4A 5EDXA 3VMPA 2YPKA 3ILPB 4K3DH 4IDLA 3I2CL 2DI7A 1OGAB 2P5EA 2AZUA 2QADB 4I7ZC 4LLVB 4ZFGL 2EYSB 2DYRB 5I5MA 2EDQA 2WOBA 4YDKL 5C0GB 1QUNB 4UM9A 3QFJD 5I2IA 3A67L 2NY7H 2WIIA 3HC4H 5DUJA 2DL9A 3QQ9D 4KJQC 5A16B 4KITB 1S7XB 3HR5B 3WTWA 5AVTB 2K9UA 4PWIA 5ELIA 2WP3O 4AXWA 1HCYA 3HLKA 4FA7B 2G2RB 3PPEA 1SN0A 2E7LC 4OH2A 4Y2OB 3T08A 3MRMB 3IPBA 1EFXA 4MJID 1MFDH 3AG2B 4HFUL 5DEGB 1WFJA 2LFEA 4WO4A 5TDPB 2VLKB 3AMKA 4M6NH 5D5ME 3RWIA 3UDWA 4UT6A 3B2UD 1IZKA 3JWOC 3IWVA 3IFNL 4HXBH 3V9FA 3MRHA 5HHVL 3VX1A 2W94A 4X6EA 3BYTA 4Q6YA 2ZSWB 2OK0H 1NMAL 4HAFA 1OV8A 2Y1AA 3LZRA 2I7OA 4N87A 1N0XL 2FO4B 2ARJA 2R9HD 3U2JA 4N2IA 2VDQH 4L0YA 2N7BA 3IU4L 2YD5A 1CXIA 2OW7A 2HT2D 3TT3H 3KPSD 3PV6B 2H6PA 2VERA 4OM0H 4L18A 2R2HA 4HOWA 4PPTA 5C09A 1UXLA 1GTFA 4L37A 4J2QA 3KPQA 1D9KB 1C5CH 5KYXA 1AGDA 4YBLC 1D6EA 3NJXA 5J89A 4E0RB 4FKEA 1SY6H 1B0GA 4N1EA 1PKQE 1X5LA 3WTVA 4YGAB 3DRTB 1AMYA 4HS3B 4K94C 3SKMB 3ULUH 1P84J 4JAMB 1B4LA 2A73B 4KXZI 4XBGB 3TYGL 2VNCA 3NYKA 1KGYE 1DQMH 1MW2A 3WFBH 5F3BA 1MVFA 1N26A 5T1DL 3R8BB 4Z3JA 2HVKA 3U4EB 4BZ1H 1GC1L 2QGEA 4HEME 1U3HA 4JHAL 4XH2B 4EI5C 3S8WA 4R2GB 1PD0A 1ECYA 3EF7A 4CVWA 1JTTA 1OP9A 2ZKWA 2JI1A 3QG7H 1OGSA 3HHSA 3ISRA 4HIHA 32C2A 3F7VA 4O51A 5DJAB 3ZE2F 4IIZA 4JANB 2ZSVA 3EG9A 1IM9D 5ALCH 4Z77A 3DX9A 3V4PB 3G7TA 1ERNA 1P9MC 1AIFA 1G7MB 1TNNA 3IRZA 1EBAA 1JF5A 4RIRA 3RFZB 3CN1A 1NGPH 2F54D 2QSCL 4IRJA 5KSVB 1HSBB 4KKNA 2VDPB 4L4TA 5BQ7A 4OJAA 1JGVH 3X11A 1T2QH 3D25A 4LLYB 3KGRA 5FW7A 2Q86B 3PQYB 3SDDB 1CL7L 4CVXA 1DVFB 4NUGL 3WL9B 2HUHA 1EUTA 5IHLB 4PJFE 1SXSA 1JVKA 3SD5A 1A7NH 4FZ8L 4LGSB 2AITA 1Q72H 5L4JA 3H85A 3P4LA 1R19A 1XH0A 4A6YB 5IV2A 5AW8B 1KXQA 3BZDA 4EKXA 1OAXH 3DX3A 4PRIB 2OMVB 2YPLD 3D0VB 5L8JB 1GZPB 2V0AA 2K4AA 2OZ4L 3MV7D 4X5WB 4EIZC 1HSAB 2DTMH 3PWLA 4JEGB 5BMFH 4EAEA 3IF1B 4WKXA 2I9TA 2R51A 4X4KA 4AJWA 5IR1B 3EO1B 4PJEA 1CFTB 2UX6A 3FQTB 2DM7A 2DQJL 3L3OA 4DP2X 4OKVB 2VW7A 5KZCB 2NYZA 3ARZA 2F8IA 3GHEL 3LHPH 3MRLB 3MRRB 4OD3H 1IAIL 4O58L 4QYOA 2OR9H 3IDXL 3LQZB 2XQYG 4U1MA 2BFVH 3FU7B 2CMRL 4S10A 5IHHA 5JQIB 4OQTH 1NCWH 2EXTA 2OMYB 4WFGE 5C0AE 4FQPA 5AUMB 3KPLB 1M05B 3APDA 5TDNB 4XCEA 1E2VA 1IFHL 4HH8A 2ID5A 3OB0K 4RX4A 3MRJB 4JO3L 4K8RL 1RUQL 2V2TB 1NC4D 2C9VA 2VXVH 3TBSB 3U46A 3MA9H 3EBHA 5KSAD 1VAHA 3TCLA 3SBQA 2R1WB 5TF1L 4HCRH 4PJHB 1NGWB 5MENE 3W11C 3TJEL 4HBQA 4Q0XH 1LWJA 1UVQB 1PYWB 4GAGH 1NCCH 2NUTB 4IOIB 1T1YB 3CFJB 3IDIA 1IJNA 1CGVA 4TVPD 1J5IA 2YQBA 4FABH 3P2TA 3L2NA 3OXSB 1RY7B 3A6BH 2AKRB 2ZKYA 2BY2A 4AM0Q 3BC9A 4KTEL 5IFAL 3LKSA 1EZLA 2EIZB 4WTQA 2NY1C 2VRAA 1KPRB 3QK0A 2JJVA 4UU9A 2QSTA 4HJ0D 4XO5A 5HI5D 4DK6A 4OCRH 2F08A 1P2CA 1OB1B 3CCHB 3K6FA 1Q9WA 1KT2B 2RQ8A 5IB1A 2FQDA 2NW2A 2KH2B 4HHAA 1OSZA 1RUML 4NO2A 4X9IA 4ZXBA 3ARDC 3TV8A 3TO4B 1ACZA 1IJ9A 3QXTA 5D4QA 5C9KA 5J1AB 1RULH 4S0SD 3MBEA 4K5LA 2L4OA 4OZHF 2VDLB 1GZQA 1D2OA 4S0TD 5E95B 2VN7A 2Y0SA 5AKSA 3RZCD 4I1PA 3MLWL 1GGBH 1ZIAA 2D3VA 5MHSD 1A1OA 2WQRA 1MUJB 3N41B 2RD0A 4XBPB 2R0WL 2X40A 1LEIA 1G7PB 5MEPB 2GIXA 3ZSTA 2IPUG 4W9JC 2YXWA 1JPSH 1DVUA 5HYJE 3H9SD 5KTEH 4XPAL 3DXAB 4CBZA 4OLVL 5KS9A 4FKKA 3P9MA 1DCLA 2WCSA 3VWJC 2CJUH 1DQQA 1MVUB 3LZLA 1JXKA 5D93C 1RZJL 3BDYL 1KYFA 5HY9B 3ZKMD 4OF6A 3EJYC 2XCMC 2DD8L 2NXYD 3N1QC 4KRPC 5T8IA 1RL1A 5DJYB 3WHXB 4XWOC 3DC0A 3MRKA 1NIEA 2PR4L 1TQVA 1AZUA 4GW1A 1UT9A 2EDRA 3OKKB 1J8HD 1UA6H 2BX5A 3TEZA 1IV8A 1NFIA 4NQDA 3QUZB 4UT7L 4KH2A 4YHYB 4OFIA 1BJ8A 5DMIH 5HPMA 3V5KA 3HN5A 5IQ7L 4G7RB 4S1QL 3BPNB 1RZPA 1E50A 3IFPB 2OTUA 3F5WB 2HFGL 1IGJB 3EF4A 4BUGA 3R06B 2OSXA 3PWNB 4L3CB 3J27A 3P30H 3MCKA 3HNTL 3CMOH 5DJ0A 2F58H 1K5NA 1OHQA 2LU5A 2D7TH 2HLFD 2EDBA 4P48A 1CUOA 1K6QH 1MEXL 1NEZA 4M1CC 4WNQA 4WSJA 4JHUA 2EEBA 5C0IA 4WFFE 3DVNA 1XMWA 3K6IA 3CJJA 3FT3A 3HR6A 4KKCC 1I85C 2FYVA 3NFPA 2Y72A 2YAFA 35C8L 2BNRD 3HCVB 4LQFH 4MAYC 4Y19E 4GI6A 1CS6A 2K6ZA 2IIJA 3HMWH 1JPFA 3Q8FA 2VUKA 4FG6D 5I8OH 3U48A 3DV4A 1S7QA 2E7HA 2VT0A 1EHNA 3GSQA 1LK2B 2KERA 1DJYA 1NCBL 4YMPA 1U36A 4R96A 4H8VA 4HAGA 5I8KL 1CBVH 3FO1B 1NIDA 3QULA 1DANU 2QHLA 3BWZA 4YXLH 1Q0XH 5C08A 3FFDA 3OGCA 3KPMB 1F02I 3OAZK 1E2WA 4HIQA 1MCPL 1E9PB 5A6LA 4HUUB 3BD3A 4FFYH 2PPAA 5T5FH 5BPPA 2Y5EA 4P4RA 2CO4A 5HYIA 2YLHA 3O9WC 1SJVA 3ZDXF 3E38A 3ZMNA 3TA4D 2Q6WB 1MFNA 4DGYH 2WMPB 5K9JH 3ULVH 2EIBA 3FT0A 5TJWK 5ITFA 1BAFH 1N6QL 3MRQB 1XBDA 4I3GA 1X5ZA 2G5BB 3TIEA 4FULA 4MCZB 4A67A 4G6JL 2WXGA 2CXGA 4B5EA 2FZ3B 2PKDA 1GPOL 4G43A 2FCBA 3P9LA 2ADFH 1QFWI 4ZBJA 3VFRB 3D2TA 4CILA 1RZ8A 3BWUC 4X4MA 4ERSL 2W9EL 3PNWA 2A7BA 3QJFA 3BDXA 4ENED 2ZG1A 2X6UA 4YH6A 2K0RA 4TS6A 3VXRA 3KLHC 2DQIH 3LS4H 3NSCA 5DTFB 3SGDH 3NOIA 2UZYB 1RUPH 3KH4A 4HKJA 1WP6A 4JFEA 4UOZA 1V7ML 5J4MA 3B3IA 3ARFA 1MCJA 4YR6A 2K4WA 3RTLA 3IJHA 5CF3A 1VGEL 3S96B 1RZKL 4NC2B 1R1CA 2AXHA 2MTPA 5ADOL 1TZGL 4Z3GA 4Q9RH 5JW5B 1KTBA 4NOBA 2GITA 2ITDB 5TDOB 1K8IB 2DYPA 3HC0B 4FZEH 3G6JE 3DSNB 2Y5TB 4E5XG 2X6BA 3CMGA 4WEUD 2AI0L 3CX5J 4RESB 4GT7A 4M93B 5HD8D 1XGYH 5GSRA 1L7IL 1Z3RA 2G2PA 1WAEA 2D7MA 4GRLB 1MFEH 3DURA 3RWHB 4N0FB 3BGMA 4HSCX 5E1AB 3TEYA 3GBNL 1XSKA 2ZOKB 5FHAH 3N42F 1QPKA 2WTRB 3QIWB 2ZKHH 1Q90A 1QSFA 3L7EB 3MMEA 1WBZA 2W92A 3U4BL 5E2TH 3W2DL 2WWKO 4K2UH 3KH3A 25C8L 3WJMA 4N2EA 4IMKC 4Z0XB 3NZUA 1YEFL 4NRZB 2NY0D 4CW1A 2DEYX 5TTRA 3FQXB 3CVHB 5LWYH 2FEJA 3GSRA 5EU6A 5B7FA 1FZOA 3FQRB 2Z92B 5FYKH 4ALAL 1OF0A 4MA1B 3RE0A 5I66A 4MJHA 2OCJA 2CKNA 4ZNEE 3ZE2B 2XBTA 5T5NG 1XL6A 4TNEA 5ID1B 4XAWL 2R23B 1OM3L 1KXTA 4H1LG 4FNLL 1CDIA 4ODXB 1G7HB 1Q9OA 5HHOB 1GC1C 4KK5D 2QMJA 3U0WH 3SPIA 2EDKA 1EAPB 1DJZA 3QDJD 2HFFA 4M29A 4NQEE 1FFPA 4L4VA 4Y16C 2CUHA 4QCIA 3V4UH 4ZMAT 4TSAL 2Q7NA 2J1YA 4NQVB 1I8LC 1TMQA 4WI5A 1ETJA 2O5ZH 2GG1A 3K0YA 2DQHL 2CWRA 2TRHA 2X9ZA 2JJTC 2R83A 2EEDA 4LEXL 1FIGH 2WBJD 1U6AL 3MBXL 4NNYB 1IGTA 2W0FA 1KXVC 5CIPB 4UWQB 3M6DA 3P4OB 4RRPG 1X6LA 1S4IA 1HX0A 4ODUA 4UANA 3DO4A 1B6UA 2EVGA 3I85A 5K1NA 2WQWA 5JMOC 3L4YA 1E3ZA 1PLAA 4NQCE 1LWRA 3D30A 1OGTB 2DQGL 3GK8L 3AU1A 3MROB 5AVXB 3MJ9L 4XMLL 4NKDA 4ZSOE 5A6IA 5CJBA 3KYMB 1ACXA 3GIZL 5B38B 4LSUH 2H3NB 5KOVC 1KJ2A 1CZ8H 3PWPB 5GS3A 3BI9X 2CR0A 4LXFA 1QAWA 3QDGB 4ODHH 4CBPA 2IH3A 1N4XH 3KEHA 4W4NA 3HI6H 1XR9B 2Z0UA 1KYOK 4FQQB 1NM9A 3DV6B 3I74A 3KYAA 1QHOA 1KCRH 5IQ9A 3UEQA 2O5XH 3WJLA 4C54A 3DX8B 4DO4A 2H2SC 3CVBA 3S37H 5LGHH 4EPSA 4JKKA 4KGLA 5T3ZD 4N8CL 4JVUA 1XCXA 4EDXB 3ZE0F 5A40E 1P4BH 1PJ9A 1U0QA 4U0RC 3L5IA 4KFMA 1H0DB 2HJKA 4P06A 3SOTA 4Y5XA 4PJ5A 2NSQA 5F1IB 3T8XA 1UHVA 3TESA 2D4DA 4HLJA 4UZUA 2YJLA 4K8RC 4P2OB 5E99H 4B50A 4JK0D 4U6TA 1ZLSL 4JG0L 1WS8A 4LLQB 1JDDA 2FL5A 2VL5A 4NO5B 1CN4A 4OF8A 1QFUL 1XEDA 4GRWF 2EABA 3QZWB 4IK7A 4NPYB 1I75A 5CUSL 4KZDH 4NXSA 3ELQA 4I18C 1FZKB 3IB4A 3LYRA 4OBSA 4XCYA 5JOFA 4PRNA 1E4WL 3JWDH 2WLJA 3VE0B 5D1XC 3MLRL 3ATFA 3GHBL 4Y4FB 3TEXA 4OZHB 2X0UA 3KPSE 4HJJH 4G8GD 4HJEA 5DHYA 4PGBB 1LHZA 1NGZB 2FUTA 2BFGA 2NY4D 4G80A 4MJ5A 5F9DC 4J3OD 1RPKA 1EXUA 2VDRB 3NPSB 4D9RD 4LKCA 4P2RE 3WN5A 2BK8A 5AD0A 3WEBA 3A4DA 3CFEA 4UILH 3PUUA 3AREC 1H3PL 3V0JA 4QRPB 3POCA 4XMPH 2OL3A 3FB5A 3PGFL 4MDIB 2F6AA 3GMLA 4FGMA 4PAZA 1E3FA 3FAXA 2Y7MA 3IJEB 2KT6A 1JGEB 2WLLA 1IBYA 3LN9A 3V4LA 3TA3B 1BLIA 4PY7B 4BXSV 4H0GA 1EQWA 4F3FB 4M6OH 3I6GB 3OLIA 2JIXB 4Y88A 5IBUG 3SPJA 3VD5A 3T04D 1E8YA 1KB9K 3UX9B 1U8JA 4MJJA 1ZA3B 5E51A 3OM3B 4I9XA 2XPGB 4HLZG 3TYFB 5JPMC 5DHDA 4MXQD 1RZFH 1OE3A 3DHMA 3BT2H 2YC1A 3RAJH 1U8IB 2VMCA 2ZICA 1ZVSB 3MV8B 3RX5A 5BO1H 1NC2B 1RZJC 1F5WA 4YSAA 2H8PA 4PGDA 2ZUXA 3BVDB 1J8SA 1JHLH 4BSJA 3GMQB 3MCLH 2DQEL 2NY5H 3CSYB 4ODTL 3UYOD 3S3SA 1TYJA 4N5ED 3VCLB 2VM9A 2WTOA 3UXFA 4L8BA 1SYSA 4R8WH 2IAAC 4NHUB 2XICA 3I6SA 1E4XI 5B8CC 1IO4C 1YQVH 4ODWA 4V1DA 1KNOA 4BKSC 4HALA 1J86A 2A6DA 4YOKA 4AUUA 4R5TA 2BNQB 1S78C 2H32A 5ACZB 3EJPA 5IFJB 5KYYA 4HCIA 3CNKA 5I19L 2CU9A 4KK6C 5IQNA 2BWDA 1X9RA 4JM4L 2OPCA 3O11B 2PO6D 5EA0L 4PVLA 4MMZA 1CTOA 3SCMA 3IT8D 2YA1A 1K8DB 4N2LA 3BGFC 2JKWA 2PETA 2OMZB 2A6IB 2W91A 3P0VH 4UAOB 4NZ8A 3HAEB 1OAUL 4ZOAA 4P23B 2ZX7A 4LHJB 4G5ZL 4L1DA 2DQDH 3RVWC 3OLDA 5CCKH 1AKPA 3EGDB 2BCMA 3ABLB 2J4WH 1FFRA 4ICWA 15C8H 4LSSH 1JF1A 3MJWA 5H8DA 5ESQB 3HZ3A 1P6WA 3RHWK 2Y2WA 3RGVB 3TVMD 5C70A 4LCVA 1TENA 4AQ8A 4DKFL 5JQHC 5J6GB 3QQ3B 4GOSA 3ZDXB 2PW2B 1PG7H 3L3KB 1R3JB 4J6RL 4R5VA 3VFVB 2WVVB 1MCFA 1DBKL 4M7JH 4UBDD 3LJ3A 3QUMB 3CU7A 3T77A 1AGFB 3BD5A 4RGND 4UQ2A 1QATA 2J73A 4TNFA 4NI3A 2X4QA 4YHKL 1WPCA 3G5ZA 1N5AA 1TU2A 3PHOB 3D33A 5IWLC 2VDQB 1ZGLB 3HFML 3L4VA 1YUHA 3GUTB 4AMKL 2R56L 1YEWA 4FL4B 1JHKL 4LHQB 4P07A 3T0ED 4X6DA 1KV3A 4NCC1 1K2DA 3QDMD 3LKOB 4JUTA 4EN2A 4JFSA 1G1OA 5B21A 1PTZA 1SMAA 3L5WB 4DCQB 4ZDHA 1DFXA 3MV9A 1N5YH 2ODHA 2HLAB 1WIOA 4DGIH 1MG3C 3LCYA 1A7RL 3P69A 3EGSA 5AG8A 2WZPA 5DHEA 4Q2ZA 2HX9A 5C0BB 3RTQD 2GBAA 1XSIA 2CDEA 3QRGL 4IGBC 2L7UA 2KQNA 2IAMD 2PWEA 3QQDB 5CILH 3QZOA 5I18H 2HJFA 1R5IB 2VQUA 3W9DB 4YHPB 2ZYRA 1O6SA 4LNRB 1XQ4A 2RCSL 3SJVA 2ZWNA 3T6ZA 5CKAA 1G9EA 4N2BA 4QKTA 1MLCB 1QRKA 4KMQA 1OCWH 2BSRA 3C2AH 4GEIA 4UT9L 5DJXB 4QOKB 3JTSB 1UG9A 2HJLB 3SN6N 1T0PB 2WW8A 1HQ4B 4X5XB 2DWEB 4WJ5A 1F6LL 4RGOL 1RZKC 3D51A 5EEVA 5T1MB 2HA1A 3B5HA 4W68A 1KG0A 2YAPA 3N42B 4XCCL 1U8HA 3IMSA 3KPPB 4ES9A 4I0PD 4F58H 3H9SE 2FSDA 1QWHA 3OZKA 2W81C 3GBLA 4JFZL 2PCPA 4HIXH 1LO5A 3CXHJ 4WCYH 4BHUI 4XBMA 1BQSA 1P4IH 3L3DA 4RMRA 1DDTA 5E8NB 1AGBB 4FNPA 4JM0A 3PGCB 5FM4A 3SE3A 3WMQA 2VERN 1CE6A 1ADQL 4A2EA 1ND0B 2Y6SC 4G8IA 4S1DD 3B37A 3MFFB 3RWEA 3FTVA 1SYVA 5IHZB 2HTLC 2HH0L 3VXMB 4PU2A 4DN4L 5ILTH 2XZCH 3QNYB 4M8QA 4Q9QH 1J8HE 4LHUG 3FN0L 3OKDA 2OZNA 3EOAB 2VLJB 2YMXH 1I7UB 1IC5H 4Z7WE 2ZKMX 4L1TA 4LOVA 4ALAC 4PS4L 4QY8A 4Z5RA 1TKWB 2PR9A 1FE8H 2R29A 3NPZB 2E7CA 4XX5A 1GAFL 4HDIB 4XC1H 4NYLB 4Y9CA 3QEQB 1R3LA 1AKJA 2UZXA 4GMSL 5CGTA 3AT9A 3G6AB 3EFDL 3HUJA 4JM2A 4UI2A 4RLDA 4FFZA 4ZFZB 1T7YA 3INUL 2YXFA 2HRPL 2BVPB 4UINL 5I9QC 2EECA 2I5YL 2FBOJ 5HJBA 3JTTB 1L3WA 2CDGB 3H6AA 4GSDH 3FT9A 1T66D 1BMZA 1ZS8A 5SWSB 4HJSA 4PJGE 3NH7L 2AK4A 3CQQA 4PJEF 1FVCA 2FJFA 4JHZA 1XH1A 2CZNA 3D7PA 2H47C 2P26A 2NY6C 3A6CL 4E9XA 1EGJL 2IPTH 4PUBL 3QEHA 5AL0A 1A22B 3CE1A 3WEXA 1JPTH 1AR2A 2N7AA 4JFWA 3THML 1X5IA 2RACA 4C56D 5D7LA 3V8OA 3VFSA 5JIHA 4EN3C 3QE5A 1UWGL 1TEGA 2APSA 5FFLA 1HXYA 4IOSA 1IKNC 1FFOA 1PLGL 2VMEA 4RETB 3VSTA 1LQBC 1QLEH 4YHZL 5AW7B 2N7SA 3ZL4H 2XWZA 4JG9A 1EJOL 4X7DC 5E6SB 1UM4L 3D69B 3CZFA 1G6RB 4HWBL 4LIQL 1MI5B 5I1AA 4TQEL 4QRRD 4Y5YB 4Y2DA 1HCZA 2ZX9A 2X4SB 2GSGA 1NOFA 2QQLH 5H2BB 1CLOL 1SDYA 4KJPC 4M1DH 5EOCL 3SGJA 4BDVB 4CUCA 4EUPG 2YUWA 4RFEA 2X0WA 5A3IC 3FUNA 3QVAA 1KJ2H 4MCYA 4MNGA 3UTTD 3ZE0B 1U8LB 1Z32X 5F9JB 3UAJD 3K4DA 4JDTL 4QRAA 4I3SH 4XPBL 2G2NA 5GS0D 3AWEA 2JCCE 5AFAA 5K93A 1W72L 1AVAA 1UFUA 3HE6A 5F0PB 3ULSA 1RVFL 2VLRB 3CG8A 5EZOL 4U1SA 2IAND 4K9EL 4LSQH 2FWOB 2G5RA 1BYOA 3UMNA 3X12B 2WXMA 4PJ9C 1DBAH 3MI6A 1D3CA 3DKHA 4R4FL 5F7KC 3RWCA 5I6MA 4YXKL 1BVLB 4KMLB 4N8PA 4XZUA 1G7IB 4GRWB 1ZK9A 2FSEB 3C5ZB 3MGAA 3I75B 1MSPA 3FUKA 2SEBB 3TN0D 1PF3A 1RU9H 2VSDA 2GIYA 3H3PH 1IGCH 2ZZUT 1MFBH 1TEFA 2ZPKH 4G8AC 5DJCB 1HYSD 1F1DA 3DVFA 5FUZL 1FGNH 3KGSA 4KZCA 4AQAB 1LP9A 2ZCKH 3OMZA 4MTMA 4JFDA 4JO2L 2CUIA 4JN2A 3VTTA 5KS9F 3ATBA 1BD2D 5CINH 5ICUA 2H0EA 2GW5A 3ZSSA 2R0LL 2QVFB 2A83B 3L3IB 4P9HL 3REWA 4AV5A 1MCSA 3KXFA 5FO7A 3VWKA 4EEEA 2Z65C 4YHOH 3UYRH 3EYVA 3VFOA 1MF2H 4APQD 2G5UA 3ARRA 1JUFB 1MFMA 5C8JB 1T89C 3S36L 4RA3A 3MLYH 1AZRA 1OGAD 2CCWA 3K8LA 2Q3XA 4OFYA 4N90D 2QADD 3VGBA 3TT1L 5I1CH 2NX5B 3LD8C 2VDNB 3Q6GL 4ZNCD 3B34A 2AV1B 3QS2A 3FB8A 2FX7L 4ADJA 4HIJA 2DQUL 3VQMA 2JCWA 5CWSA 2OL3H 2ENSA 5D7JA 3C9NA 3N44F 3NK4A 2IQAB 2H3XC 2Q7AA 1ZLEA 3FH8A 3ARUA 3AAZB 1OTUC 1OVZA 5LCVL 2VR5A 3DUUA 3FB6A 4HHGA 3QR0A 2VLKD 2DM4A 4POZD 5KVDE 2DQTH 3FCUB 4HUXB 3BAXA 3QDJE 3O6ML 3W81A 1DO6A 3H54A 1X9UA 3CC5B 5ANME 1F90H 3FTGB 4DUXA 1UURA 4A63A 2VXTL 4M00A 4H8UA 3DMMB 1LE5B 1L5GB 2W60B 4XPGL 1OL0A 1MAML 4GQ9L 4U3XA 2VM3A 1IL1A 2ZUQC 4X4YA 7FABH 3SYOA 5I1KL 2XVKA 4OCWL 2BSSA 3EJUA 2XN9B 3QIBA 1D9KD 4MYPA 4OV5B 4LRIA 3S0PA 1I3RB 1X4XA 3TLRA 1V55B 4JFXA 5F89A 5KUMA 1L9SA 3DIFB 4FTVA 5C07E 4PRPB 5GISL 6FABL 2AJXL 2HFTA 3VXPA 5GGVY 5DD0H 2VJ0A 1FYTE 5D1QA 2XHNA 2H0FA 5D2NE 3DROB 1A6VH 4OJYA 2VWEE 2APVA 3STZA 3PCYA 1VZGA 5GZND 2CA3A 2CK2A 3GJFB 2W38A 1ZXKA 2YGPA 4R2GD 2Q2LA 4JE4B 2WKOA 1GA2A 3KWTA 1JXFA 1CDBA 4WWKA 2YPKB 4U6HA 1U58A 3QJRB 4M9OA 1NAML 4QJ5B 4ZMPA 5B7EA 2P5EB 4JJHA 3WNPA 3WNIA 2PP8A 3QZPA 3U36B 1CL7I 3LMJH 1A6PA 1JFQH 4NI6A 1QZNA 1TFHA 2FGWL 1S8DA 5IVZB 4DN3L 4KKPA 3KPNA 1ES0A 5FYLD 5I2IB 2WIIB 3FT4A 4KAQH 2Y36H 1KLFA 5IBLC 2OR7A 1FBIH 3TS8A 1VJSA 4QLWA 3OKEB 4NM8L 5KW9L 5SWZE 3IBOA 1AS6A 1THAA 1JZJA 2ZWLT 5EIIA 1P7QD 1EFXB 1TZOA 2WWMC 3ESVF 2IGLA 5DDHA 2P8LB 5HVHB 5E8DL 3ISWA 1S3KL 4WO4B 2AMGA 3EUDA 4J5VA 5GQBA 3ZRFC 4P0DA 2Q8BL 2RIKA 1NMBL 2VKWA 1KJMA 3PQYD 5FIEA 1Y6NR 2C3GA 3MRHB 3SDDD 4EDWL 7TAAA 1RHFA 1DVFD 3QCTL 4MA8L 1FFQA 3IGAA 4X6EB 2HUEA 2X87A 4OZFG 1HCFX 4X6FB 5E8EA 4CADA 5DZ9A 2XYBA 2PP9A 2ARJB 4Z7IA 2VDMH 3N85H 2JKJA 2BHFA 3HMXL 4HIEA 1IAII 3HS0B 3CZEA 4OLYH 2H6PB 3WKMH 3B4NA 2R2HB 3NRFA 3EO0A 2XA3A 4PY8I 5C09B 4CSZA 7PCYA 1UUNA 3ILDA 5C7XH 2W80C 4PRID 1YHPA 5KYXB 1AGDB 3X3FH 4OAWA 1D6EB 2D9CA 1OT4A 1CR9H 4O4YL 5AOIA 1MRDL 5D7KE 2GKIA 2Z8WC 3FT2A 5CJ8A 4QJ4B 2WKGA 3IDYC 4L8SA 1TVHA 2JTDA 6TAAA 5F6IB 3IXAA 4UQAA 3OMAB 4OFKA 1EAJA 1B6DA 2JWYA 5LXGH 1M57B 3TV3L 4TTDC 5KZCD 1FLTX 1N59A 2WVSA 1NBVH 2ZF9A 2TAAA 1VPOH 5F3BB 1MWAA 1M1XB 4NUMA 1JRHL 2JJSC 3EJRA 2HVKB 4WI6A 2XXGA 1T5KA 4M8RA 1LILA 1I1CA 2ADGB 3AUWB 4N0YH 4ZQTA 4YDVA 3IMBA 1AO7A 4G6KL 3KBEA 4CRPA 4UYQA 4H5SA 5E08L 1M56B 3HHSB 1GKOA 4HIHB 1C7TA 4J1UA 3W5MA 1BX2A 4O51B 4S2SA 4M6MH 1I3GH 2ZSVB 3Q05A 4MNHA 3EG9B 4WUKH 3I84A 3DX9B 1TXKA 2BP8A 2IFFL 1CURA 1AIFB 1YN7A 5KVDL 4RIRB 1DQJA 1ZTXL 1FN4A 4X9HA 3U1SL 5BVPL 3U0PA 3N1GC 3DX6A 5ENWA 3NAAH 4EE2A 2FLBT 2XETA 2HFEA 4OGZA 3L5XH 1QNZH 4L4TB 1B4JH 3UTPD 3EYFA 3SD2A 5BQ7B 1UWEL 4ZUVA 3X11B 5JHLA 4MJIA 4QXTB 5C0JA 1KY7A 1KYAA 1GY1A 3FZUD 1TCMA 4BFFA 3FTZA 1HHIA 4CVXB 1ZK5A 2YD7A 5TE6L 1UWYA 3H42H 4UV4L 3UO1L 2B16A 1XHHA 2D73A 3QUYC 4ZTOL 1QKZL 1PEWA 1FDLL 1BMGA 1QFPA 1ETB1 1R9FA 3UEZA 2RA1A 4KDTA 3AG3B 4XMTA 3MOBH 5ES4B 4LESA 1KFAH 1GYCA 2E9JA 2FK9A 4MMXB 3TO4D 3VUAA 5DR5L 4JCMA 3QUXA 1MQKL 1DQDH 3S34L 3U6RA 2IQ9H 3Q01A 3PWLB 4M5ZH 4WHYG 4DW2L 4KXZH 3V6OA 2J88H 5JOPD 3MLVH 4W6WB 1QUPA 4PJEB 3WMSA 2R29H 3M86A 4NAJA 1PSKL 4UTCA 4BFOA 1Q94A 3VW3L 3L3OB 1EZVX 1CI5A 4QYOB 1ZT4A 1IFRA 2Z8RA 3VXOB 3DXAD 4KKLC 4GRLC 3UPCA 3V0VB 4WGKA 1ZJAA 4OFVA 2AGJH 4TMPA 3KYOA 4Z9KB 1A6ZA 2V6HA 4GBXA 4XCEB 4G59C 4PWJA 5H37A 2VR8A 1LO4L 2B3RA 1CTNA 2XV0A 1F58H 2D2OA 4HF5H 1ZA6B 1KGWA 1A66A 3ORJA 1LVEA 4KHXH 3TCLB 2X4TA 1N10A 1WA1X 4RAVB 5IF0A 1MG2C 3Q8CA 4M7KL 3GSUA 5A2BA 4AW7A 4ZMNA 5CEZE 4JR9L 1HZHL 4OT1H 1C16A 3BVNA 2V7HA 4NWUL 1U2HA 2B5IC 2YAHA 3QUZD 1NCOA 3GEWB 1THCA 1PBYA 2F54A 2OP4L 5K9OA 3CZJA 2JQAA 3DECA 1V7NL 3D4CA 2OXGA 3QPXH 4KI5D 5C7ZA 1QSEA 1CFQA 3ZQWA 1ZV2A 4IMLB 1XGZA 3WNMA 2BERA 4M3HA 1TOXA 4I2XE 1CXFA 4N2HA 3KYNA 3OWRA 3TEWA 3JTBA 3LKSB 4ZAKC 2F8XC 3BIKB 4KQ3H 4I77L 1CU4H 5CP7A 4UTBA 5D9SB 4G9FA 2A74A 3GTNA 3P11H 5DWUH 1C5BL 1Q9WB 3V4VB 4X5RA 1RMFH 2NW2B 2NZ1A 2ZCLL 2QSVA 5EBLB 3LQMA 5J6HA 4M62L 4YVNA 3MBEB 2YPLA 1EHLL 1B9ZA 3BWAA 5ALBL 4UZSA 1NGXA 1NCJA 1A1OB 4R4BA 5I75C 3RKPA 3TURA 1NUFA 1ZJBA 4EVNA 1H3VA 4I88A 4PJXA 3OMNB 1FNFA 2L7QA 1JK9A 3WY4A 2OMNA 2PWDA 1BVNP 5EF1A 1T0OA 3HE7A 1GGTA 5KS9B 2Q1EA 2HVJB 1AP2B 2QLVB 3U7WH 3G08A 1INDH 1XF2B 3DVIA 3AFLA 4HUWA 1DQQB 4FYRA 5LAXA 4P2QD 5IROD 2EC9U 4LEOA 2WB1A 1MY7A 4MXWH 5I1JH 3OPZH 1F42A 1MJJA 4DF9A 4A2GA 5BOJA 1KY6A 2BP0A 2JLPA 1MIEL 5I8CA 1FC1A 3AY2A 1EEUA 2EUVA 4MD5A 4I5BA 3MRKB 3V6FB 4YSDA 1Z0MA 1BQLL 1HFUA 4GW1B 2VXQL 1NJ9A 3VXUE 3EH4B 1N68A 1NFIB 3HRZC 5AB0A 4HZAA 3AM8C 4QHKI 2E7LA 1A8ZA 4MAUL 2Z93B 4HOXA 4R7VA 5TE4L 4TPRL 1RQ5A 3NESA 4KJWC 4LPYA 3V5KB 3BN9D 3N44B 1P1VA 4JO4H 1WAAE 3HPLB 4MFHA 2J8UA 2X0VA 5CU5A 5DHMC 2OTUB 1TITA 3SE6A 5AZ2L 5J12B 4OI9A 1IGML 3MCKB 2ZNWA 3P3SA 4MA7H 2YKLH 3CQPA 1K5NB 1OPGH 2PUQT 1FG2B 1KV7A 1L0YA 2ALWA 4L5FL 4PJAA 4JZJC 3OGOE 3HZYA 5LLIC 5IG7A 1N64L 3RKDD 1TLKA 1UB6A 1NEZB 5DVPA 2IV9A 5F7WC 5AYQA 2YD9A 3GXDA 2VIRA 3UZQA 2QKSA 3DO7A 2M26A 3K4AA 4HUCA 2A38A 5ABAA 5HBBA 2MNJB 3DVNB 5D72L 4KPHH 3FT3B 3NJLA 3S4SA 3OKNB 1XCQA 4MNQA 2VZTA 2QVTA 1E28A 2N56A 3FFCA 1Z66A 3ILQD 3O41A 5IESH 1A4KA 3FHAA 2NOYA 3SDXA 3Q2NA 4TV3A 1JPFB 4FQHA 4LOFA 1OF2A 3DV4B 3JBG7 1C7SA 3Q6FA 1S7QB 2R4SH 1PKOA 1BVKA 1WFIA 4HJUA 2XSKA 5C0CD 1PZSA 1WO2A 2BIMA 2ERJC 2X12A 3B56A 4N3TA 4R96B 4BRVA 4OIFA 4HD5A 4KI1A 2KLSA 4C58B 2JKLA 4KX7A 1H9VA 3FFDB 4Q9BA 1C8PA 3OGCB 3VI3E 3QIWD 4GAJL 4EI5A 5CEZL 4ATWA 2E76C 4XAKE 3CVIL 3ZRSA 5GS2D 4AG4H 2AMUA 3MKGA 3EOTH 4P4RB 1MCNA 3KCWA 5FK9A 2PYEE 1IGFH 3HLAA 4BQ9A 3TA3C 1FVDB 4PJCA 5INDA 4HQQL 2PW1A 5A2IH 2MOQA 3EUUA 5ITFB 1S9KC 4J6IA 2CNYA 43CAA 3KWWB 3TIEB 1GW6A 3SYQA 3QJOA 1Z5LB 4JDZA 4QRRE 1E6JH 5HHOD 4GP5B 4G43B 4X6DF 3P9LB 4YK4B 2V8LA 4FXTA 3TJPA 3UTTE 43C9A 3CZUB 5GGSA 3VD3A 3QI9C 3WIIL 3QJFB 1KCWA 3DVGA 2AVGA 5IMKA 4HU8A 3T4AC 2UWEA 3IDGA 2NPLX 1NCAL 4HWEH 2DIAA 4DFIA 1G9NL 1NSNL 5DS8B 2Q87A 2PPEA 2P80A 4JFEB 3RBSA 1R5WA 3GINA 4FN0A 1EK3A 2XC8A 3CAFA 3B3IB 1YNLL 3IU3B 3FRPG 1UH2A 3ARFB 3DUSB 4PR5A 4G8EA 5E5MA 1NCDL 3IJHB 1AH1A 1IQWL 3MZGB 4XVSH 1A7OH 3GGWA 4G9DA 4M4RA 3ES6A 4P5TB 2GITB 3L54A 3VTAA 4Z7NE 2DYPB 1PX3A 1L9RA 5FA3A 5CJXC 4FEMA 2BNRA 1WITA 1KGJA 4OGQC 4NERA 4YC2B 4ANXA 4JQVA 3EDFA 2ZKXA 1OT2A 2XWDA 4HP5A 3ZQ9A 3WXVL 3MUZ1 1ASQA 1E5AA 3CHXA 2C1OA 4KTYA 4UAOC 4F2ME 3D07A 2Z31D 3DURB 2OJZL 3C6SB 3WLBA 2EZ0D 4P23C 4HGWA 2NNFA 4JHWL 3FT1A 3QISA 3BOVA 1WBZB 3PWPD 3X1NA 3OR7A 3WJMB 4PRDA 3I50L 3QDGD 3VMNA 1MCCA 1HCVA 4CW1B 1D5ZA 1HEJC 1F1GA 4XP9H 4AKOA 2VR6A 1FZOB 5T1JA 3ZTNH 1XH3A 4R9HA 4AH2A 5I66B 3BMVA 3UFIA 4QHUA 5IUCA 2QQQA 2ZX8A 2XG5A 3NIFE 2FJGB 3A47A 3ZXAC 2GJZB 1W2KT 1Q9OB 3IGUA 3WNLA 3SPHA 1J5OL 4XB7A 3VSUA 3MJGX 1C1EH 1QFWH 2EYTB 4O02L 5TFSL 4ZX6A 2GJ6D 1G5AA 5T33L 2WAHA 4KMTH 1SVBA 4YXHH 3NIGE 5HGBB 1FFPB 4L4VB 2FHCA 5JORB 2C9PA 4FL4C 6PCYA 4P2OD 4DPAX 1LO0H 5TQ2L 3DGDA 1VFAA 3B7YA 1M3IA 1KBBA 1WC7A 4GW4A 3VH8G 3VQLA 2DB8A 4YZFF 4PJBA 4JM2F 3HUJF 5F7EH 1R6VA 1PAMA 3FSWA 4Z7AA 3AW5A 2BZCA 1GSMA 1IGTB 2W0FB 4X6CF 3ZGHA 3BD4A 4FG2A 1QWNA 3SGKC 4A2MA 3ARDA 3BZ4A 2ZCHL 3LVTA 1SEQL 3HZMA 3NZSA 1BMWA 4MSWA 1NLDL 3DO3A 4ODUB 1W0YT 2H1PL 4JO5A 2Q8AH 3IETA 3KWUA 4BHUA 1I4FA 1QLEB 4Y4FD 1BOGB 1Y1UA 1JK8A 3L3JA 2V17H 1YN6B 2O5YH 2J56A 3AU1B 3W0WD 1KXHA 3SKUD 3ZJAA 4NKDB 5I0VA 1RZ7L 1WCBA 4FXKC 1MHCA 1BLNA 4FYSA 3J7HA 3TBTA 2Q76A 4QRPD 3NCYP 4G7SB 4XT1C 5I8EA 3VWJA 4X99B 1G9ML 3BP6A 3RJDA 5D2NC 1SJMA 2VO5A 4FRWA 1PIGA 1WEJH 1XF3A 2VWEC 3D85A 1BQKA 4UCFA 2IH3B 2J6EA 5CBAA 4L2YA 4PJ7A 3KM1A 1UXSA 2YQGA 3DTXB 5AVQB 4BCZA 1JHTB 4IBWA 3ECQA 3RU8H 2EE2A 2OI9B 1FJ1A 3ENEA 3JSSA 4ZO7A 5DA0B 2JIXD 3BP7A 2CM6A 4A55A 2JLLA 1I1AC 3T3PF 2D4FA 3WFCH 4XOBA 4JLRA 3LEYL 1TDQA 5G2NA 4RNRA 4U49A 4LCUB 1KELH 3ZT6A 4N2NA 4IS6A 4HS6A 2HJKB 3BN3B 1H3UA 4YQXH 4PJDF 5H37H 2UYLA 5FYLE 4TKWA 3KVQA 1NC2D 1BF2A 4B9CA 2VMDA 2XNAA 1A6TA 3R4DA 4TTGA 4Z3EA 3W37A 5DUBA 5EO9A 4OF3A 2IALA 2DICA 3KR3L 4JB9L 4NWTL 5KVMC 1TTBA 4IK6A 2OXHB 2ORBH 3RVTC 2ATPA 4ANWA 2FL5B 2VL5B 2CA4A 1MJ7H 5IUSA 3HKFA 2D0GA 1KCSL 1SM3L 1KYOJ 4N9OB 5HJDA 1BFTA 1CDYA 1XSOA 4G6ML 1J1PH 4TL5A 3ZT7A 2WBJA 4XCYB 2BNQD 4UUJA 5ICYA 5JOFB 3RNKB 5FM5M 3K1KC 3V5DB 1WIPA 4LOUC 4PRNB 3U2IA 3NP4A 4MAYA 2ZXEB 1RJZA 4Y4KC 5I1DA 5KUKA 1MDTA 2HWZH 5IB2B 2ICWI 3SPVA 1LP9F 4HIIA 2DBLH 4H8WL 5DHYB 2A6KB 1JZHA 2D03H 2IBZX 5F1NA 1FSKB 4MJ5B 1P5UC 1E4KA 3CU1A 4JRYE 5FA4B 3T0XA 4IEFA 5FO8B 1MN4A 3BYYA 4LKCB 1NFDA 3WN5B 4JG5A 2D8KA 4I87A 1CLVA 5AD0B 3CFEB 2ZYHA 1GR7A 4AY0A 4ZPTA 4DQAA 1I3VA 4ZTPH 2OL3B 4FI8A 3FB5B 3DDFA 3SY0A 2VL4A 3LKPA 4ADIA 2DKUA 1I8MB 2WLLB 1AANA 1KCBA 4J3OG 3Q5OA 3U1PA 4NO0A 5I1HL 5KVGE 3BIAX 3O9WA 3RGVD 2X3CA 3ZYOA 2AJUH 1PNDA 4IW4C 1U8JB 2YGOA 1Z5HA 3UJTL 3NJJA 1JGUL 1AD0A 2IFGA 3BESR 2V3DA 1XGUA 2YC1B 1AGCA 1YPZA 4HC1L 3MSPA 1TJGL 3CFDB 2QJDA 2WOYA 4MD0A 3L1OH 3SQOH 3KPRB 3DJTA 1WUNT 2Z8VC 3LB6D 1UC6A 1ZVHA 1CTMA 4PVMA 2L8AA 4XPHL 1A4BA 4QD2E 2PLTA 2X89D 3LNFA 5FOBA 3RVVC 1RV6X 1TQWA 4G3YL 2VN5A 4ZT1A 3BRGC 1XZWA 3UC0L 3O6FC 3NTCH 1SYSB 5I1GL 3U4AA 4FFWC 4W81A 1YEKH 3N06B 5EOQH 4I1NB 3O81A 4V1DB 4ZMXA 1IAKB 2EIKB 1KLGA 1KNOB 1RUAH 2A6DB 4JN1H 5C0BD 3FH5A 1KB9J 2H32B 2FNWA 2N3JA 5KYYB 4TNWF 4RAHA 1G4MA 3LH8A 4UDTB 4WI0A 1R3IH 1IE4A 4TVPH 1RIUH 5D4JA 1YAIA 5ERWA 4NOFA 4YSSA 1Z1WA 5CCHE 5IJVB 2MHAA 4LBAA 4E5XA 5TE7L 5LQBL 1VRSA 4G8GA 4QOKD 5K39B 5AVZB 1FQ9C 5FF6A 6CGTA 4Y9GA 1EEQA 1MXGA 2WB7A 4GXVL 2B1AH 4D3CL 3CFQA 5JOPE 3X3GH 2BJMH 4LPVA 4Y2NA 4ONHA 2UXVA 2WKOF 3ROLA 5DVNA 1M7UA 1NIBA 2H1LM 1BPLB 2X28A 2WY3B 4IMKA 4M7ZB 5BS0A 1YCSA 4NN7B 5SX5H 1JAEA 3KPOA 4MLIA 4Y7OC 4DKEH 2JVUA 3TBVA 2VISA 2H9GA 1I1YA 4Y1SA 2NUPA 3ZDZF 4KV5F 1Z3GL 4YUEL 2FAUA 3BKYH 4FD0A 1DN0A 3EO9H 1ZLDA 4UQ2B 1T0NB 4C57C 2VAJA 2NQDA 4X0NA 1YUHB 4LVNC 2IG2H 3VXMD 2NY3B 4FG4A 3PXHA 4TUJA 3VFWA 1U93B 1BIIA 1X3DA 3OG6B 1L0PA 4X6DB 4Y16A 4KRNA 1HINH 3DBXA 5IHUL 4FYTA 4RMSA 1Q8MA 1A4CA 2IDFA 3CSGA 1IC0A 5AVSB 5DHVA 4E9LA 1IZJA 1I8LA 4ZO6A 3AZUA 4UTAL 5FKAB 4ZDHB 1QR1B 3MV9B 4LLAA 4H88L 2RFXA 1U21A 5FCUL 5AYUL 5GRJL 3UJJH 4Z78A 2QL1A 4Y89A 4GG8A 2BDNH 4GW5B 1KBVA 4M1GL 3QEQD 2CDEB 3MLZH 5HYSG 2N1KA 3VSVA 3QCVH 3MNWB 4IU3A 1KXVA 1CDGA 4XCFL 2HJFB 5I6KA 3F6LA 3S36X 4LMQE 5DT1L 1O6SB 2F2HA 1JWMA 3JWNH 3MQIA 2UV3A 4RFNB 3SJVB 3IPEA 1T1ZA 4PV1C 1KPUA 1OD7A 5G4OA 5SWSD 3T2PA 3O8XB 1DJXA 1A4JA 3GRBA 4BRJA 4YE0A 4CJ1A 3M7FB 3AROA 1G9NC 2O72A 4GQPH 3GRWH 2EXYD 3QIUB 1AE6L 5KVGL 4WJ5B 4U0QB 3MRPA 2A9BA 4JGUA 1QBLH 4YDIH 4DUWA 4FCAA 4GG6E 1MRCL 3C12A 5DUML 5E5RB 2W9DL 4J8QA 4S11A 2IH1B 1KG0B 1U8HB 3F85A 2OZ4A 2D0FA 3P4MA 3WO4B 1JP5A 2WHVA 3TEUA 2F18A 3BP4B 4TUKL 1ADWA 2WQVA 2VRKA 4AK2A 4OD2A 1LO5B 4GXUM 3WIHA 1DBML 3JVFC 3VYNA 3L3DB 4P2QE 3O45B 4ANUA 1MI5D 1A3LL 4BSVA 2XTLA 3LPGA 2CJSA 2XFGB 5FUOH 3SPGA 1CE6B 3NCCB 4YSOA 3FOLA 4G8IB 4WNSA 1QD0A 5LVEA 4IJ3C 4GSXA 1SYVB 2O1AA 1YMME 1AHWC 5L4IA 2OYLA 1QP1A 1F4HA 3RDTC 2NW3A 1CXKA 5D7IF 1GGIL 3BPLC 3ECBA 4YDNA 5FECA 3DETC 2A6JA 3QDMA 2VLRD 2CK0H 2CO6A 5DK2B 2Y3AA 3HG0A 4XE0A 1C5DA 4DKTA 3BDBA 1CFSA 3Q44A 1NDGB 3T6VA 1SJEA 1AKJB 2VH5H 1JYXA 4JM2B 3HUJB 1AZZC 2YN3A 4I18A 4AE1A 1FO0H 4NIYE 3C5ZD 3D0LB 4X6CB 4NZTH 3HS0C 1U8PB 2VQTA 3TJHC 3VGAC 2DOCA 3CDZA 2NY2C 5D1XA 4EMZA 1ZS8B 3IRCA 4FLHA 2AK4B 4HUNB 4N28A 2N4IA 1W8OA 5C0EA 1FVCB 3DRQA 2YFOA 3LV3B 4NLAA 1ZY9A 1MW0A 4NM4H 3BFQG 4YO0A 1UACL 1LO2H 4PP1D 1PKQA 3GMPA 3LZQA 1XWVA 3H1ZA 3C6LC 5FS5A 2WLYA 1HNYA 3QEHB 4HPOL 4XMKH 4C59B 2P8MB 3WEXB 3BZEA 5M94B 3AREA 1H5BC 4TSBH 3Q43A 4LCWA 3QJTB 3T1WA 1FYHB 4YDZA 3OAYK 1GXEA 3N40P 5D7LB 4MDRA 1SLXA 1QYGL 2KYIA 5C0CE 1SN2A 2X9YA 2XTJB 1FFOB 4R3SA 3KBPA 4JFHD 1TJXA 1FORH 1HKLL 3FOMA 4HPYL 4KNSA 5BZZA 4HEMA 4D0BA 3CSTA 5CCJA 4HWUA 3IMRA 4X7EC 5BV7B 5IQMA 1U95B 2UXFA 4OLZH 4AEFA 1DVTA 5AL8A 4Y2DB 4NPKA 1CGTA 1JGIA 2A4ZA 4KHTL 2FH8A 2WYHA 1HH9A 3PFUA 3T3PB 3GXMA 4RFEB 5E2WH 3GJEB 5JPMA 1CYXA 3MRCA 4MNGB 4MCYB 3U6XS 2B9BA 5KANG 4B60A 2YQ3A 3MRGA 1F18A 4XNYL 4OI8A 4XPFL 2C7FA 2NRDA 1JZ6A 1V05A 2J6EH 2ZQKA 4F37F 1S5HA 1F8TL 3HE6B 4PJDB 1NEUA 1SUHA 4JMNA 5E1HB 4NQXA 4RCAA 3ULSB 4DVRH 4U1SB 4ANVA 4R90H 1ZLVH 4K7FB 3CV5A 4DH2A 1E40A 5T1LB 1A3QA 2YS4A 3VG0H 1F3DH 2F53E 4DOHE 3ARBC 1QTSA 2JB5L 2GUOB 3RWCB 1L9OA 3DMMD 4DGVH 1EDHA 1JI2A 5DFTA 3SZKC 5JLZA 4XZUB 3FB7A 4Q9CA 4XNXL 1A9EB 4F8OA 2VUOA 1T1XA 2XN9D 3E2HB 4AYDC 4MMXC 3MC0A 1R3HA 3MA7A 1CCZA 4NC1C 3CFUA 4WU7A 2VC2L 2K9FB 1LP9B 5ISZB 1NKRA 4PJXF 2QGCA 2YD4A 4JFDB 4PRPD 2A1WH 3OJ2C 4PV9A 5EU7E 5F7UA 5I6NA 3UTSB 4POYA 2HX8A 3S3PA 2V5MA 4LSRL 3REWB 3SO5A 3EZJB 3KXFB 5FO7B 4Z18A 3VFOB 3OTTA 2GB2A 4ES8A 4JG1H 3RIFF 2CDFA 1ICTA 5C0AA 1KBKA 1Q1JL 1JERA 5D7SH 4H8WC 4CMHB 2P5ED 1HHJA 4RMWA 2HKHL 4N3UA 4H26B 3B9KB 2WGXA 4UM9D 4QNPE 3PWVA 1BYNA 4HIJB 1QSVA 4FX5A 4XBEL 2CCLA 5D7JB 4BQBA 1TMCB 1AHMA 4DEPB 4MX7A 1FFNA 2J8UF 3SGEH 1EFXD 5HHPA 2P9RA 5ESVA 1M71A 1BJMA 4HUKB 4L29B 2XZAL 3DUUB 4WO4D 1NLBH 3GZKA 1FNGA 3C8KA 4YSQA 1RZIA 4NQSA 2GJ6E 3QZLA 5I71C 4PJAF 1KSRA 1BEYH 4WZ9A 4FFVC 4W93A 3T2NH 5LBSL 4KTDL 4NSKA 4M7LH 5T3ZH 5DVLA 2X53A 4MXVF 2BVUA 4FQ2H 3ZK0A