4DQOH

Crystal structure of pg16 fab in complex with v1v2 region from hiv-1 strain zm109
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
239
Chain Sequence
EEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPIWHDDVKYDFNDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG16 Fab Heavy Chain
publication title Structural basis for diverse N-glycan recognition by HIV-1-neutralizing V1-V2-directed antibody PG16.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 239
sequence length 240
ec nomenclature
pdb deposition date 2012-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dqoH01
1JWMB 3PHOA 1VACB 1H5BA 1CXIA 1RJYB 1YEEL 3ZMRA 4ODTL 4KVNH 4N0FB 1F3JB 1O5DT 1M7DB 1G9EA 5HSFA 3CFKA 4FG6C 3KLHC 3O4LD 4QRUB 4MAYC 4R7NA 1JZ4A 4MDIB 4WV1B 4EI6A 5CIPA 5DJYA 4KDWA 1O7SA 4W6WB 5LG1A 4NFDA 3AU1B 3HZKA 1DR9A 2VWEE 4JRXA 4NSKA 2AXJA 1YZZA 4O2FB 5LXGH 2L7JA 3RBGA 3O45A 1JPTH 4RAHA 5H35B 4M9OA 1CIUA 2ICWB 1CXLA 2IAMA 3QULB 5B39G 3T1FB 4ELKB 2A6DA 5KVMC 1MFDL 4N9OB 3SCMC 4FABL 5B8CC 4QXWA 2NY6D 2ATKA 3MRGA 4HLZH 1FNGA 2VLKB 5C6TH 4P0DA 4G7YL 4YDIL 4LU5L 4NC1E 1CXKA 3ILPB 2V9QA 3B5GA 4ZFZA 4OQ1A 5AUMB 1JI1A 3AXLB 1BFOA 1HXMA 4F7CB 4L8DA 3K1DA 5DFVD 4JM2A 1IGFL 2GCYA 2HT2C 2V2TB 2R0LL 3LIZL 1KB5L 4WWKC 1NUGA 3VXPA 4U1IB 2HRPH 3B9KB 1DEEA 4Z0XA 2FB4H 3L5WB 2BNQD 5FYKU 1J5OL 4YDJB 4ZAKD 4MCZB 1EHAA 4TPRH 4ODBD 1AD0B 2MFNA 1C7SA 1FP5A 3LN5B 2JELH 2VZ3A 4ZD3L 4DN3H 2O5ZH 5F7DB 5AYUH 3VXUD 2V5YA 2IANB 2B1HL 3U9PL 4HZLA 2CRMA 2OR7A 4KQ4H 3VFNA 3S4SB 3QWRA 4NKMA 5INCB 1OARL 4HKBA 3QRGL 5IT2L 4XVTH 3FFCD 2FJFB 5EO0B 3QFJD 3GSQB 2ZSVA 1F6LL 4B5EA 4NKDB 5CD5D 3SQOL 4EBQH 4JJ5B 2DBJA 3RTQC 3C08L 3EFFB 1YEHL 2M8XA 3N1PC 4NPYA 5JXAL 4PJ5D 4UT7L 5TQ0H 1KB5B 4Q7DA 3S37X 4NUGH 1K2DA 5A2IH 1OGAB 3CLEH 3GMQB 4KV5F 1EV2E 1NC4D 1C08A 5BZDB 5E8OB 4ODWA 3MOAL 4I48A 2HJFB 2UUDK 4FNLL 1RZFL 3QNXB 1JZ2A 3QG7L 3PWUB 2R2BA 3W5NA 4PJHB 5C9JA 1DUYB 2Q7NA 5JNYA 3FN9A 4B0MM 1XGRB 4U1MB 4R90H 1F13A 1OVZA 2IPKA 2WBJA 2A0LD 3L3DA 4C83B 5FYLL 3SGJC 5C0JA 3EBAA 4KVCL 3KJ4B 4MQTB 4X98A 5EU5A 1JGEA 4U3HA 2ZUVA 1U3JA 3QB7C 5CHNA 4UB0H 5J3HC 2YZ1A 4X9BA 3KR3H 3I84A 3QEUB 2DLIA 3QQ9D 4TTDD 4PJCB 5C0CD 1P84K 5HBBA 1PLGH 2X4RB 3ULVE 3IVKB 5GISH 2R9HD 1N2RB 2WBWB 4JY6B 2D7MA 3EYFA 4P2OA 1ZHLB 4JO2L 3REVA 5GGSB 1IGIL 1N7ML 5EBLA 2I60H 1JTTA 5D1ZB 1CE1L 2JLLA 1DANU 2NR6C 4CMMA 3W9EA 1FFNA 4WY7H 1IQWL 4NCDA 5F1NA 3HCVA 2FO4B 3C8KB 3DV4A 3D39E 4HJJL 5DQ9B 3P9MA 3VRIA 2F8OA 4HXAL 4YHYB 4H1LH 3FB8B 3MCLL 4OF0A 5F9JB 5I8EB 5JA8B 4GKZB 4XCEB 3QCVH 4F15C 1U9KA 4GXVH 1IAIL 1YN6B 3ARDD 4IMKC 2F8XC 1KEGH 3RWFB 1KEMH 4ZOBA 3FO0L 3DVNB 4OZFG 4D0DB 2ZG1A 4G43A 3WFBL 4FN0A 4MD4A 5E1AB 4XPGH 4YDVB 5IVOA 4OI9A 5CILH 4G9DA 2A73A 1LK2B 5IVZA 3GKZA 4ODHH 5D7SL 1K4DB 2D9QB 4XH2B 3VXSB 4UNVA 4YHNB 4JO3H 3P30L 2DLEA 1QD0A 1OSZA 5IMOB 4Y8DC 1J18A 2X4UA 4X83A 1ZLWK 3ORJA 4UU9B 1J10A 3O6FC 4XXCA 5BV7L 4MSWA 3T4YB 4GQPH 5DK2A 1TMCB 5DYOA 3VMOA 3MGTA 3RA7H 5MENB 3ABZA 5FO7B 1CL7L 3HZYA 4UTAL 2HFGH 3T0EA 4ZPTA 1JGDA 3ZTJH 1QSZA 3DV6A 3MA9L 1BZ9A 5HHVH 2UV3A 3EOTL 4Y4FC 4U2ZA 5FF6B 4WO4C 3KPMB 4DQOH 5C0BB 3S4SG 3GB7A 2EXWD 5C8JA 1CWVA 1S7WB 2VXSH 4LCUB 4P4KD 3IDGB 3I50L 3VXUB 1E6OL 2Z92B 3LY6A 1JPGB 3MLRL 4JANA 3QIBA 4JQVC 3MRRA 4WFFE 3RY6C 4PRDB 4G7VL 4P2QB 4S1SH 2J1KA 3UDWA 3Q5YA 1NBVL 5KN5B 1KCUL 3H9SD 4G8FA 4WFED 1FGNH 4PY8I 4MA3A 3BWAA 1DZBA 4JE4B 4OZHF 3TIDB 1ORQB 1NGWB 2ZOKA 1ZLVH 4K7PH 3WKMH 1HIML 1RULH 1FFOA 1VADA 5GRVK 2QQNL 5IROA 2BSED 1A6AB 5BV7B 2AJXL 4MVBD 1ETZB 3ESVF 4DZBA 5IR1A 4JG1L 3QDMB 4YNYB 1ND0A 5HDBF 2YN3A 4I77H 4PJGE 3BN3B 3GSUA 5HHPB 4PJ5B 4H8WH 3AC0A 3LS5L 3C6LA 4V1DB 3KPSE 1RK0B 1KPVB 4MNGA 1C12B 3B2UC 5F6HI 5JLZA 4K8RH 5IGXH 3INUL 1SVCP 3S88L 4N9GA 4CJ1A 2YD7A 1JCKA 3IDJA 3T65A 1HINL 2X9XA 3UAJC 1GC1L 1FSKC 2DM2A 4U6YB 2I9TA 2VR9A 4NO2B 1Z3GH 5CJOH 4D94A 4Q9RL 5E8EB 1QBBA 2VN7A 5GXBB 3O2DH 3MV9D 1U42A 5EA0L 5E2TH 3TBVB 2O5XL 3O6LH 4BFBD 2YUVA 4YO0B 1UZ6F 4PJ7A 5D7LB 5ETUB 1UACL 3BKYH 1G7IA 2GITA 4EQ3A 1YC8A 4HC1H 5C0CB 4EDWH 3HMXL 4KUZH 4M4PA 4WEBH 3HI1A 1N4XL 1KTLA 1S7UA 2J3SA 2W0FB 1OF2B 4X8XA 4UBDC 4HS8L 4JFPA 5DJ2A 1AE6L 4I2XA 1KOAA 1CD0A 1OAKH 2C1OA 4UAOB 3RRQA 2C4XA 1F4YL 4L4VE 3VD4A 2ZKHL 1G7HB 1QRNE 2ILLA 4PFEA 2H45A 4HT1H 4A2LA 4WW2B 4D3CL 1RUMH 5C0FB 1ZWIA 4GAYA 4IIQC 3UEZA 1AO7A 1YNKL 2Q6WA 2XQBL 4QF1A 1S9VB 3W81A 25C8H 4CVUA 3S8WA 1YY8B 3MRPA 2XTJC 1X5GA 2BXYA 3MRDA 4Q6IB 3REWA 3ARDB 1A7NH 2XWTB 1MJUL 1HQRA 5F7KC 3V8OA 1DQQA 3CFDB 3KPOB 3VXTB 4PV9A 4NRYA 2JJVA 2D4DA 2ICWJ 1QFUL 4WV1C 1ZTXL 3RZCB 4KJPD 2B4CH 3DUUB 4OI8A 2JK5B 2CO7B 1CFBA 4UV4H 2R23B 4JZJB 2CDGB 3WJJC 4JHWH 4QHKI 4O2EB 3HFML 3BXNA 4MA8H 4HEME 3X3FH 4U6XA 2VXTH 4Z0BH 1GAFH 1N59B 1B4JH 3TBYA 1HYRC 3R06A 1BF2A 1IKNC 1QSFB 4K3JH 5CKAA 5C6TL 4Y19E 4LSPH 2WMPA 3BDXA 3KLSA 3QXDA 4I0PD 5JXED 2QSCL 3CZJA 4HF5L 4RGND 3UO1H 5KSUA 4TNWF 1T66D 4OZHE 3PV6A 5B3JF 4KKCC 2FIKB 3DTXB 4LVHC 4YGVB 1QNZH 3B9KC 1E4WH 3LMJH 3MLTB 3AMLA 3BMWA 3O2WH 4P4KB 5TH2B 4WUUE 3D3VA 1WGOA 2HRPL 2Y07L 1U8PB 2H1PH 4Z7QE 3KWWA 5HDBE 5IVXA 1VHPA 2IH3A 2IBZY 3TA3C 1II4E 1YQVH 5FO9A 4J4PD 3I9GH 2G5BB 3H3PH 1PKQE 2A2QT 4HK3J 4PJ9A 2JELL 3LKQB 2H32B 4U6VH 4YZFF 4N1EA 5AYUL 2NX5D 4WI8A 1GOGA 3DX6A 4F58L 1FVDB 4Z5RA 3CDGA 1XF2A 4QHUA 4OCMC 1SQ2N 4TULH 1JN6B 1MFAL 4IOSD 1NQBA 5EWIH 4X0KA 4OUUB 4YHOH 3C6SA 2OTWB 3QQNA 4L9LB 3NZHH 2D7TH 5JPNB 2DQFB 1P2CB 3M17B 3HAEB 3WFCL 2HH0H 1FL6A 1UZ6E 4HKXB 3QHZL 4M6MH 2ITCA 1P6FA 2R69H 1JGVH 1ULVA 1V3KA 2G9HA 3CCHB 4K9EC 1W8NA 4PGEA 2Q86B 1S7VA 4NQDD 3ZKMC 3K8MA 1FZOB 1KIRB 2XPGA 4LMQI 4M9PA 4PIRF 3SO3B 3JV4A 3SPVB 2F53A 2XZAL 2QHRL 1EDQA 2OQJB 3T0BA 4XC3H 1P5UA 3RI5F 4QRQB 4P4RA 4LGSB 3CXHK 3HC4H 1Q1JH 3KJ4C 2C3VB 4G6MH 5DJCA 4ZTOL 1AIFB 4CJ0A 4QNPF 4R90L 2F19L 3CZFA 2WLZA 4N0UE 1EHLL 4G8GA 4XAKD 4R8WL 3TV3H 1QYGH 4U1SB 5EC1A 4HDIA 1SJEB 3FRUB 3KR3L 3MLUL 4WFGD 1JZ6A 5DJAB 3MBEA 3HPLA 2AEPH 3QXTA 2CDFA 3DWTA 1UEYA 3WL9B 4DZ8A 2GK0B 1S9KC 3HNVL 5EZIH 5D1ZC 4Y1AD 5CMAA 1CGVA 3H2WA 5E1HB 1UB5B 4HZAA 1UM4L 4N68A 4U6HB 5GRJH 5SWQA 4XGZA 1A5FH 2VE6B 3QIWD 1DL7L 5I17B 2ZCHL 4G3YH 1I1AD 4K8RD 4LHJB 2DQGH 2E7BA 3BZ4A 3BYTA 1XIWD 3MTRA 3FT3A 3UTSE 3F7YA 1PD6A 3MLSH 1OTSD 3QCVL 4YAQB 4GXVL 2VR4A 2XTJE 5DVLA 2VDQH 1T1XA 3S35H 4P5MA 1N64L 1KEGL 1ZMYA 5INDB 1KEML 2HVJA 4QRSB 4P5TA 1UENA 4XPGL 1CU4L 2YD8A 1ZKAA 4XPFH 1YEJL 4M1CD 4LLWB 4YIQA 5LWYL 5B3JE 1X4XA 3GSNL 2NY6C 4CU6A 2G2RA 3TNNA 2BVPA 4OAWA 4PV8B 3MJ9A 1INEH 3WLBA 3GI8L 2SEBB 2M26A 3FQXA 3MRFA 3DROA 4H88H 1A6WH 5DFVC 1RZKH 4LEOA 2FX9H 3C2AL 2CLRB 5GJTH 5LAXB 3RZWA 2VLKE 4XCCH 4YZFE 5TE4H 1MCPL 2AI0L 3HHRB 3IFNH 1EIBA 1CE6A 4NWTH 2QQLH 2L7UA 3D69B 2NTFB 2WQ8A 4OD2A 1XMWA 3ALWA 4WCYL 1IGTB 1QFOA 4ZAKC 4LSVL 5HGGS 3IJSB 3KYAA 3QXAA 3MXVL 4KMTH 2OK0L 4W4OA 4DQOL 1I1YB 2V17H 5DK0B 2EDFA 1YNLH 1MWAA 4HH9A 2AKRA 2W91A 3QCTH 1G84A 4FZEH 4NZUH 4L8SB 5F96H 5GRZA 2FATH 5IM7B 1A6TB 2NX5B 4K3EH 4FA8A 1OAYL 5AAWA 4PYGA 3GSNB 2E9BA 2OL3H 4GRWB 3HAEG 4S1SL 2MOVA 2EYSA 2PNDA 2IANE 4XBEL 1AXIB 2OXHA 5CD5C 1UWEL 1FNFA 5I1EH 4P59H 3B6SA 5F3HA 2J8UB 4P9HC 2VB5A 2P5ED 1U3HD 5EZJA 4MNHA 2WSKA 4QNPE 3P11H 5I18H 3QFDB 4J3WA 1KTDA 3G04A 5L9DL 2BVOB 1LO2L 5T1KD 1A7PL 3RL2B 2GSGA 1E28A 5GGUB 1JHLH 3GBMH 3BEVB 3WDJA 2J88H 4J3TA 5F7FA 1RVFL 4CVXA 1VEOA 3QUMH 1INQA 4F9LC 3F7QA 4PJHE 4RA3A 3QQ9C 5EG6C 5HHQB 1Q94A 3CFEB 5DMJB 4TTDC 1VPOH 1H15A 3V6OA 5E2UH 3S3SA 1FFRA 2H26B 2R9HC 1K5NA 5DRXB 3ZZ1A 2X70A 5FM8A 4EDWL 3TVMA 1VGKA 1E27A 3HI5L 5BMFL 4Y7MA 4AYFA 4P2RA 4UIMA 3D6GA 1LNUA 3SY0B 1DQJB 4JRXD 1CXFA 4KGJA 1T1WB 1FLRH 4H0HB 4LCCC 5CZKA 3TYGH 2I07A 5DMIH 5I9QB 1EZVY 1EAJA 2XKSA 3L7FB 4QHNB 12E8L 5DHVH 2ZPKL 3H8NA 1OAKL 3SGDH 1HHKB 2XOTA 3QIWB 4WW2C 5A2FA 5HHOB 4I3SH 1I1AB 2DKSA 1GC1C 1A9EA 4Y4HA 1GZPA 5FGCB 3BO8A 4EQ2A 4I18A 3S5LA 4UZGA 1RD6A 4JR9H 4NKOA 3BIKA 4AEIL 4Q6IC 3ARDC 4D2NA 2ZUSA 4ZSOA 2F5AL 5ADPL 3DIFA 1IC1A 4HMCA 1FG2A 4L3EA 4U31A 2K1MA 2YHGA 1GGBL 4DKEH 1CFNB 2R1WB 3O4LE 5C70A 1RZ8A 1QO3B 2ED8A 3T1WA 3FRPG 1KCRL 4Y4KB 3CDFA 3S9DB 4HCRL 2RCSH 1FBIL 1P7KB 4WW2F 3OR7A 4JG0H 5EOTA 3VFRA 1DQTA 1YYMH 4JHWL 3LRGA 4YHZL 3FCTA 3QWRD 2DQEH 4HBCL 4GMSL 4MA8L 3RX5A 3FO2A 5C07A 5HYIA 4HUWA 2J5LC 4CW1B 2AJSH 3IAQA 3C60A 4AEFA 1DBBH 4K3JL 3WLWD 1J8HD 3RJQB 1UH4A 4GSDL 4X6CF 1N26A 2V9TA 2BZDA 1A9BA 1YEFH 4X7CC 1S7XA 2FL5A 5ACZB 3OKEA 4LKXB 3S35X 2PYFA 2EXWC 5ICXA 3R8BB 3RPKA 5DJDA 3NACH 4H25B 4U1JA 2BHZA 4P4KC 1JWUB 1MREH 1YY9C 4OB5H 4RMRA 1ONQA 3QDGB 4ODXB 1QNZL 2A74B 3LMJL 5C09B 3BH8B 1QQDB 1A1OB 1MCOL 2P44B 3KPRB 3NH7L 4MNQA 5C0BE 1ZLSH 3RAJL 5L8KB 1MPAH 1JWSA 4F9PA 4FXLA 1CK0H 3RVVD 5ITFA 3PGFH 2DI9A 3I9GL 2CKBA 2VDKH 4GT7A 5IV2B 4OZIB 3BKMH 3VXUE 4HHAB 4KMLB 3VFOB 4BZYA 3CSGA 4PRNA 1JZ7A 5I1DB 2VISA 3DMMB 4R97B 1G9ML 4M5YH 2P8MA 2YC1A 1C5DA 1KB9K 4P2QE 4MVBC 4F7MA 4WEUD 4P5KA 1MAKA 32C2A 3VXQB 4UQ3A 3PJSA 3HS0B 1UXWB 4GW5A 3FFCE 4L9LC 4WNQB 1FDLH 4HIIA 2P5EB 3VWJB 3MLPA 3MUZ1 2C3XA 5I76A 3H9YA 2O26U 4OSUL 5J0BA 2IF7A 4ELMB 3H7BB 1UZ8B 1G7PA 5I1CL 4M62H 1NCBL 2KZWA 3UTQB 4ZYKA 2QKIB 1J86A 3GSXB 3NGBB 4GRMB 3QEHB 2EYTB 4OM0L 4IMLB 1TJGH 3G6JF 4PJ5E 2GTWA 4PJFB 5I1KH 4RRPA 4V1DE 1MCHA 2A38A 5FYJH 3UTTA 5IB2A 5EULV 5KSVB 1AGDA 2BVTA 2V2WA 4DKFL 1EAPB 1O0VA 5HVFB 1QKZH 2DKUA 1A4JB 1I3RA 4XCFL 4NUJA 3WJLA 2C5DC 1QPXA 5E5UB 1R5IB 4DVBA 4WI7A 4ZO8A 1D9KA 1KCKA 1P7QA 3PHOB 1H5BB 3VH8A 3PP4H 4GW1A 1T0PB 2AJZA 2GJ6D 3JVGC 2KL6A 2XI9A 1WZMA 1WFTA 2CQVA 3EYVA 1G6VK 4UNTA 3KJ6L 3MRCA 2P48B 3WDHA 3CFKB 4G6ML 2FX8L 3KYMA 1B6UA 2XV6B 4L3CA 1NUFA 1F45A 1IAIM 4R7NB 1JHKH 3UJJL 4EI6B 5CIPB 5DJYB 1AH1A 2IPTH 1NANI 4OCYH 1QYGL 1XGPA 3HZKB 4NSKB 4JRXB 1C5CH 5H2BA 5C0CE 2NY7H 3O45B 5EBMA 5D5MF 4XPAH 2IAMB 2AEPL 5I30L 2A6DB 4XMLL 2ATKB 3MRGB 5J1AB 5EZIL 1FNGB 2NZIA 1I9IH 4YBLB 4L4TD 1BX2A 3F5WA 1DN0A 4ZFZB 3I3EA 1A5FL 3KXFD 1BFOB 4TVSa 1HXMB 1LO0L 1RIUL 1BJ1H 3OKDA 4G3YL 4L8DB 4LVEA 4JM2B 4XZUA 2GCYB 5F3BA 1MELA 3T0ED 1S8DA 2GI7A 3CVIL 2W9DL 1MQKL 1DBMH 2UVEA 3VXPB 3MLSL 3PUCA 1PFCA 4KJPC 1D5XA 5EPMA 1DEEB 2MTPA 5TQ2L 3ZO0A 3HUJB 2OMBA 5E9DA 4X6CE 5CBEA 2DI8A 3EYSH 5F72S 3TN0A 2C4FU 5J06A 4NWUH 5JUEL 5E24E 2IMMA 4HZLB 3SOBH 3VFNB 4MYWB 2VDLH 4HKBB 1E4JA 4WU7A 1N3NA 1INEL 1DQMH 3GIVB 3S96A 1CLYL 1G6RH 2JJWA 2P45B 2VTFA 3PP3K 5A3ID 4I0PC 5JXEC 2WK2A 2ZSVB 5A1AA 1QBAA 1JV5A 4RGNC 2P8LB 1T66C 4FFVD 5DQDH 3GBNH 3LS4L 3LOWA 2JTDA 3KPLA 1ERNA 5GGRY 1QSFE 4GRLD 2FYYA 5GJTL 4Y2DA 1PSKL 4OZ4A 2DYPD 4NPYB 1Y6KR 4F33A 3DYMA 1YJDL 3T2OA 1RIVL 4HG4J 1K2DB 2YS4A 4K94L 4J4PC 1GPOH 1C08B 4ODWB 4I48B 3NA4A 3P4MA 1QVOA 4L8SC 5KVGH 4CNIA 3T3MF 1YNLL 1NMBH 3M45A 4QT5A 1J0KA 3E3QC 3V7AG 4OLUH 5C9JB 5JNYB 4DGVH 3G6JE 1JK8A 4ZUWA 2X41A 2IPKB 2WBJB 3L3DB 5I75B 3H9SE 5DUBB 4WFEE 5C0JB 4X98B 5EU5B 1JGEB 2GJJA 5CHNB 3MC0A 1I3VA 1BQLL 2ZUTA 4MXWH 4X4XA 1YPZA 2ADGA 5I73B 2OP4H 4CU7A 2H2PD 3MJ9H 1ZGLP 5ALCH 2DQIL 3OV6A 1BGXL 4OCWH 3EYFB 5K59F 3UC0H 4P2OB 5IMLA 3P11L 3REVB 5CAYB 3RGVA 3MOBH 3SE4C 4QTHA 4JFFA 5EBLB 4CMMB 3W9EB 2PTVA 1FFNB 3AGVA 4RWYL 5F1NB 5I0ZA 4MD5B 3HCVB 3O0RH 3DV4B 4X6DA 3P9MB 2ESVA 5D5ME 3VRIB 4P2YA 3D9AH 5EU3A 3UCRA 5JIIA 1J05A 2MPAL 1B0GA 2GTZB 2D03H 3SKOA 1KELH 3MV9E 4YFLF 2J8UF 5JQ6H 1JZ8A 4G43B 3U2SB 1IC5H 4MD4B 4AQ1B 1IAOA 3ZKXB 1MEXL 3SGKC 1AI1L 4G9DB 2A73B 5E2UL 5IVZB 4S10A 4OF3A 2X40A 1UA6H 5J12C 2AABH 1NPUA 3F7RA 1Z9MA 3GNMH 3NCEB 4EVNA 4H8WC 1OSZB 1FLRL 1UWXH 2DIBA 2X4UB 2FEDD 3KDMA 3QIWC 3TYGL 2CK0H 1I1AC 4K8RC 1X7QA 3ZSTA 1YQ2A 2RQ8A 4MSWB 4Q0XL 1UJ3A 1XIWC 5DYOB 3MGTB 3SHSA 3OPZH 3PWPA 3HZYB 1OTSC 5FYJD 3CGTA 3T0EB 3DO7B 1JGDB 3P77A 1VENA 4X80L 5IOPA 3DV6B 2LTQB 2RFXA 1BZ9B 5GRUL 2D7QA 5LCVL 1M4KA 3O9WD 4GUPA 5F71A 2AXGA 2ERJC 2IG2L 5KVFL 1CFQA 3V4PH 2DJSA 4M1CC 1CGUA 3GMRA 4BFEA 5C8JB 2PYEA 2EDJA 4NQUA 1ZXQA 2OTUA 5DD5L 3RIAF 4JANB 3HNSL 3MRRB 4OGYL 1RPQA 4M93B 2L4OA 3LN4A 4Y16D 4PJ9D 4G8FB 4LKCA 5KVEH 1U6AL 4MA3B 3BWAB 1T03L 3I2CH 1NCAH 3ARBA 3V52L 1CFTA 5I2IA 1ITCA 2ZOKB 3PF2A 1QG3A 1FFOB 1VADB 3JV5A 4XP9L 2FH6A 2N56A 3EHBD 2UWEA 5GS1A 3CXDH 4DZBB 5I74B 2XQYG 5IR1B 3IAGC 2APWA 1X5LA 4P3CL 4X9FA 1MI5D 1ND0B 1NCCL 3BRDA 3GSUB 1T4KB 3X3GL 4RGNE 3C6LB 3LKNA 5I15H 4UIKL 5K9JL 4MNGB 2CK2A 3MUJA 3MV8A 5L2KD 4CGTA 4N9GB 1H3TA 4HIHA 2EDNA 3IDJB 2JF1A 3T65B 2ZJSH 3GMNA 5ITBH 5DGRA 1HWHB 4OCSL 2B4CC 1P53A 1ZLSL 5K59E 4ZOCA 1MPAL 4JEGB 3M8OL 3CK0L 1TENA 1F4WH 1Q0XL 3DMMC 3BP5A 1X5JA 4R97C 4MHHI 4JFEA 3PGFL 1NLBL 1YMMA 4ONFL 1P4IH 2E6JA 2AJUH 2NX5E 4PJ7B 4JJHA 3E3QE 4PREA 5LVEA 1INDH 1G7IB 4AY0A 1PZ5A 4GRWE 3VWJC 1U3HC 2GITB 1RJZA 1UYWL 2XFXA 3EZJB 4YHIA 1WTLA 2EZ0D 4PJBA 3JTSA 3S7GA 3HI1B 4F57L 3DSFH 1KTLB 1S7UB 1FDLL 3U30B 1A7OL 1HDMA 3O6MH 3TJHD 1RZ7H 3TPUA 4JFPB 4GBXD 4JPWL 4KC3B 4ORGB 5DJ2B 4AEHH 1CT8A 2J8UE 5DO2C 4I2XB 2MCPH 5LGJA 2C1OB 3MV11 2BHUA 5K9KA 5I6XB 1REIA 4XNZB 1F02I 5I8OH 4ODVH 3W11D 3SDXA 3RIFK 5I1KL 4OZIF 1A7RH 2WWMD 1ZWIB 4QXTB 4GAYB 4Z8FH 5CEZH 2Q6WB 4LFHG 4LLYA 4QF1B 1H5BC 3MRPB 1ZHKA 3MRDB 3ARYA 1JYNA 4YHKL 4JGMA 2LFGA 1JMXA 1G9MC 3PNWA 1HQRB 4KKLD 1SBSL 4PRIA 4QYOA 2DLFH 4OKDA 4HPOH 4PV9B 5IF0A 4NRYB 4ELMF 5DD0H 4U1GB 1AXTL 3RDTD 3TO2A 1R3IH 4UUJA 4XAKE 5GHWL 3V2AR 3TFKD 1QBML 1HXYA 1WIUA 1B3JA 5JHDD 4NNXA 1U8OA 5EOCH 5CEYA 2W9EL 2IPTL 2VUYA 5IW6A 4BFGA 1KN4L 2APBA 3OF6A 4KRPD 3R8QA 1CBVH 2AXHA 4KUCD 2QR0A 2P43B 3SE3A 4NYLB 1FPTH 5D1QA 3BXNB 1UXSA 4U6XB 4FQ2H 4Y1AE 4BQCA 4Z7VF 2P5WD 2R15A 4YBLC 2BDNH 4CRPA 3TBYB 3AROA 4HQQL 3R06B 4RMVA 4FQPA 4G80A 4DTGH 2VDPH 2Q8AH 3QXDB 3DI2B 3SE9H 4V2BA 3S3JA 3RHWK 1GGCH 2PUQT 5FGCE 4N1HB 3MRNA 5KSUB 4JFDA 4ZFGL 2AXFA 1UM5L 1QR1A 1CD9B 4JQIH 3LRSA 4NNYA 4HJGA 3UTPD 4Y5VB 4R3SA 4FQIH 3QIUA 5IMKA 4G6KL 3D3VB 4LLDA 3GMOA 3P9LA 4P9MH 5CINL 3HG1D 3KWWB 4DEPB 5IVXB 4XT1C 4LSUH 4BZ1L 5FO9B 4CN4A 1SEQH 4TSCH 4Y16B 4PJ9B 4JPIB 5HXMA 4EJ1C 4PLJD 4NWUL 1QSVA 2XQYK 3DX6B 4KZEH 4Z5RB 1FVEA 3CDGB 1XF2B 2VDLL 4QHUB 2J12B 2Z93A 5C0RL 2E9JA 3WLWC 4FTVD 4X0KB 1K3ZA 3C6SB 4YE4H 3LPWA 1FL6B 2HKFL 2ITCB 4FQLH 4M48L 5EOQH 1ZLUH 3HUJF 4MLSA 5GGQH 5KBNC 3QI9A 2G9HB 1KPRA 3Q6GH 4PGEB 1Q9KA 1S7VB 3BP4A 3TWCH 2X4TA 4B7IA 4FZ8H 4XVJH 3MJGX 4FQXA 2X4NA 2XPGB 2CRZA 5DHYA 1GPOL 1I7TA 3T0DA 1V05A 4WI9A 5C09E 4TQEH 3JV4B 4M7ZC 4U0RB 2Y6SD 4PJIA 4L9DA 2F53B 4Y0GA 1T2QL 4AG4L 5IKCA 3HE7A 3D2UA 4W81A 5I75C 1OWWA 4P4RB 5CCKH 4I9WE 4OLUL 1OWRM 3QUXA 3C09B 5DJCB 4P57A 1A6PA 1M1SA 2VO5A 1DBKH 4OZIE 5DD6A 4ZUUA 3CZFB 2FLRT 3S34H 4G8GB 5IB4A 5IJVA 3G6AA 5KOVC 3KPPB 3BMVA 4QRPA 5EC1B 4HDIB 1RZKC 4Y5XA 4MXWL 3D48R 1NAMA 2IPUG 2P5EE 3BAEH 3HPLB 1K9TA 3L95A 2CDFB 1PEZA 3MJ9L 4ELME 3LN9A 4DZ8B 3ZKSD 4OCWL 4K94C 3UC0L 5CMAB 4LHUG 3MOBL 3DXAA 5SWQB 1WISA 4XGZB 5E99H 1PX4A 1XF5A 2IFGA 4PJFE 1FZKA 3RKPA 3PHSA 3MLXL 1FCCA 4K55A 3O0RL 3BZ4B 1G7QA 3NAAL 1MLBA 1NLDL 3FT3B 3F7YB 2CR3A 4Z7VE 4X5WA 5I8KH 2NY1D 4GAJL 4OF8A 3RDTB 4XNXL 3OMZA 1A6VL 1T1XB 3VD9A 3ZKXC 4P3DA 3QNZA 4P5MB 4PG2A 2HVJB 3HR5A 1OT1A 5L2JA 1MWAL 4P5TB 3TJEH 1IM9A 5JMRA 5CP3H 4M6NH 2W65A 1T0NA 4YIQB 3O11A 3O41A 3CU7A 4WGVB 1BOYA 2XKNB 3DYPA 2G2RB 3TNNB 2BVPB 4OAWB 4JRXE 5F88A 3WLBB 3CAFA 2R1XA 2VH5H 4BKLA 4P23D 5MEPA 1DLHA 3U4EA 3MRFB 3DROB 5E56A 1UJTA 1H3WM 1FVCA 4LEOB 4N1CA 4LQFL 3QA3A 1YEDA 3P9WB 5DK3A 3T0EC 1OCWL 4M7JH 4F2MA 4F8TA 2AJVH 4RDQF 2ZUUA 3BUYA 3DUHA 3OPZL 1VFOA 1BD2D 1CE6B 2LTQC 5JHLL 4DVRL 3V4VL 5D8JL 4OD2B 1GYAA 5CEZD 4RGOL 5JPMA 3NN8A 3DETD 3WE6A 3NFPA 3MNWA 3ZT7A 5IK3A 3HG1B 2EIZA 4IJ3C 1IL1A 4EUPA 2DQCH 1AQDA 2GAZA 5SWSD 5TGBA 1F90H 3VGHA 1KXTB 1MWAB 4HH9B 2AKRB 3QNYA 5JOPE 5AWNH 5GGVY 4Z76A 4MNQD 4M93C 1TNMA 3W0WA 2Q7YA 3HUJE 3UDWC 3I3BA 1I1FA 3BZEA 4J2XA 5TF1H 3RVTD 1UADC 5T3ZH 2EYSB 2B5IB 1H3VA 4FFVC 5IROC 2P49B 5IW1B 2XN9D 2MQ0A 3NFSH 3I2CL 4HW6A 2O5YH 1NFIA 5FA4A 4RCAA 1RMFH 4FMKA 4GRLC 5TPWH 5F3HB 5TE6H 4KY1L 3UYOD 1KYOJ 4M3JA 3CXDL 3UPRA 3STBA 1WAAA 4MNHB 3CPLA 1J8HE 4ERSH 4HIJB 1KTDB 1W72A 3G04B 3IDYC 1S78D 4WU5A 3WO4B 2IFFH 5JR1H 3VA6A 1F3DH 1NJ9A 2GSGB 1E28B 5CZVH 3K2UH 2BXZA 1J7VR 1GGYA 2BNRA 3VGBA 5L6YH 3MBXL 1KENL 5IB1A 2EO1A 1N8ZA 1Z9OA 4JKKA 3EYOA 5ITBL 5KW9L 1IGMH 3EYUH 4GAGL 2QTEA 4XC1H 3RWHB 1DE4A 4JKLA 2HJLA 1INQB 3BW9A 1YYLL 4OLZH 3SGEH 1NCWL 5MP6L 1QLEL 1AGEA 2R0ZL 3LEYH 2PXYD 2CIIA 4HFUH 5T1DH 1Q94B 2IPUK 3E8UH 3MUHL 1H15B 4GLRH 4EIGB 1NBQA 3DVGA 1K5NB 2H2PC 5EU6A 5DD1L 3TVMB 1VGKB 1E27B 2HN7A 3L3GA 4P2RB 5EU7C 3VCLA 4UIMB 1LNUB 3N50A 3ZDXE 4B41A 5F9AC 5I6XC 2I07B 5C2BH 4M6OH 2P1YA 3QXWA 1K8DA 2ORBL 5DJ6A 5D2LF 3KYNB 1A9EB 1CIDA 3BO8B 4I18B 3S5LB 4NKOB 3BIKB 1A7RL 3HNTH 1Q9LA 2FO1A 2BFVL 5CEZL 2C3HA 4ZSOB 4Z7UA 3U6RA 4QXGH 1J1OL 3LHPH 1ZEAH 3BP7A 5ICZA 3DIFB 1KSRA 1FG2B 3BPCB 4L3EB 1GRWA 4U1GC 4F8QA 3VRJA 2DLFL 1I3GL 4JY4B 5ADOH 2NY5L 1TVDA 1S5HA 4KDTA 2OR9H 4WJ5B 3HE6A 1LO3L 2D2OA 2YD2A 1RZ8B 4OLXH 1B4RA 5DSCA 3AB0B 5AD0A 5E9DD 2X89D 2CKBL 1D7FA 2FEDC 1KPUB 2VMFA 5F7EH 5EOCL 5HD8D 1J9CT 1YEGL 2V7HA 3PXHA 1MVUA 4JLRB 5EOTB 3D87B 3TLRA 3TZVA 3VFRB 3VG0H 4NQEA 4XNUL 4LIQL 4TOYL 3FCTB 5FKPA 5T5NG 4JQXA 3QJHA 1I7UA 1KIPA 4KQ3L 1NAKH 5C07B 4GQ9H 3SDCA 5GZOC 4L4TE 4HUWB 1EK3A 5D70L 3C60B 2A83A 5EO1A 3FZUD 4FFYL 1T7WA 3O9WC 4UQ2A 3KXFE 3T8XA 3TYFA 2VDPL 1A9BB 3ESUF 3N9GH 4Y5VC 1S7XB 4LNRA 4CDGC 3UZEA 3OKEB 1GGCL 4Y2DD 5ICXB 3T0EE 5GJSH 2DQHH 2OJZH 5DJDB 1FHGA 3PL6A 1ONQB 5ISZD 4ZOEA 4JDTL 4DEPC 5I1JH 3GUTA 3FT2A 3W9DA 1FCGA 4PRHD 4MNQB 3GJFA 1JWSB 1H3UA 2VXUL 3MLVL 3EO0B 3VXMD 4Y16C 2OMNA 4PJ9C 4X7TA 3TESA 5ITFB 4YGAB 5FCUL 5TF0A 4K2UH 2CKBB 3FKUS 1NDMB 3LEXA 1XT5A 3P0YL 1VFBA 5IESH 4U49A 4PRNB 1I1CA 1NEUA 2P8MB 2YC1B 3EHBC 1I9RL 4F7MB 5BS0A 32C2B 3QG6A 4UQ3B 3PJSB 3GKWH 4GW5B 1BJ1J 3U7WL 3G5YA 3JUYA 5C0EA 1V5JA 4HIIB 5F8RC 1NCUA 4WWID 2FBJH 5I76B 3GFUA 2D4FA 2VIRA 3IJHA 2NY2B 1Q72L 3H6JA 4JHBA 3UPAA 2DBLH 4NHUA 4U0QB 5HJ3A 3H42L 1G7PB 1BWMA 4RAUA 1GL4B 5IEKA 2WWKO 4ZYKB 3JWOH 5DUPL 3NABL 2P46B 4XPBH 5IBUB 3KYOA 5IVXF 3CNKA 1MIMH 3VGAB 4Z7OE 3PDGA 1U3ZA 4AIOA 2GTWB 3I3DA 3UTTB 5GGQL 3H7LA 4XAWL 5IB2B 2BHYA 1AXSB 3Q6GL 3CDCA 1MIEL 1AGDB 2V2WB 4OV5B 4ZS6D 1I3RB 5CEXA 4NUJB 4I3RH 1WT5C 4DVBB 1D9KB 1UM6H 1EVTC 3GI9H 1P7QB 2X2YA 4TQEL 3VH8B 4DOHB 2PXYB 3C09C 4GW1B 4S1RH 2AJZB 3FN0L 3U82B 3EYVB 2EZ0C 1E4XH 5CCKL 4JCMA 2OR8A 2XY1A 3RL1A 3MRCB 2CKNA 4LSRH 5IWLC 1LP9F 2Z91A 1IZKA 3KYMB 5D6DC 2WW8A 3HRPA 3PGCA 4L3CB 4LLVA 3TJHC 4LAQL 2XRAH 3U0WH 2CUHA 4GBXC 4R2GB 5T3ZD 3UTOA 1EUTA 5EZOH 4AL8H 1CLZL 1L0XA 2FJHA 4JRYA 1Q9OA 5EBMB 2YK1L 4UT6H 1A8JH 1NFKA 2VZTA 3W11C 2FGWH 4O2CA 1OM3H 4TVPL 3GMLA 4OLWL 3GO1H 1GIGL 2WWMC 4MJID 5EU7E 1GJIA 3LAFA 4UINL 1C8PA 3MACL 4WENB 1BX2B 1JGUL 1WQVT 2XY2A 3VGFA 3F5WB 1DN0B 5FUCC 1SYVB 1T5XA 1V7NL 4D9QD 4ENED 4KKLC 4J6RL 4CKVX 2YOCA 4XZUB 4OLYH 1MNUL 4KPHH 1PY4A 4WHYG 3RDTC 3AAZA 3CFCL 3LKRB 3L9RA 1U95A 5I8KL 1D5XB 2HG5A 4PD4K 5EPMB 3WO3B 4NDMA 5ESAA 1RURH 3LQAL 1TNNA 4RMUA 3IJYA 5E9DB 5CBEB 4KRPC 3RVUD 3TN0B 5GS0H 2GQHA 2YD3A 2IALA 2IQ9L 1X9QA 4O5LH 3NCBB 1FLTX 1KG0A 4KROD 4WU7B 3GK8H 1M71B 1N3NB 5T1LD 5HDLA 1KJ2A 2AV1A 1TCMA 4LCIH 3S96B 3ARBD 4GXUN 5HHXH 3TBSA 3X14A 1FN4A 4WIQA 3HN3A 1EMTL 3SBWA 1JV5B 5ERWA 3RUGA 5D72L 4JZOA 5LKNA 5CBAA 3QHFH 3KPLB 4DGYL 1JF6A 3MA7A 2FYYB 4Y2DB 3WNMA 4PLNC 2V2XA 2AJVL 2UZIL 4FHBD 4OZ4B 5DC4B 2QQKL 3FTGA 1V3LA 4F33B 1CGTA 3K74B 1M05A 1NUDA 5ISZB 3A0OA 3HB3C 4W4OC 3UX9B 4F37K 4LHQB 3VXOB 1PY9A 4PRHB 4KUCF 2EDXA 3VFTA 1MHCA 3MRQA 4UILH 2Y06L 1C16A 3P4MB 4JO1L 4CNIB 4PLJC 3RQ3A 3D3VE 4QT5B 2DIAA 4X6EA 3UJIL 5IVXE 4CMHB 4X7SH 1DVFA 1JK8B 4ZUWB 1N5YH 3OR6A 3BRGC 3ULVH 5FYKL 4EN3D 7FABL 2Y23A 1IJ9A 5D93C 3IU4L 4AQOA 5BRZA 2HJKA 1UCBL 5IBUG 3ARXA 4HKZB 4RRPG 4X4XB 1YPZB 2ADGB 2YUXA 4NO0A 4Q74A 1G9NH 2XWJA 2C3WA 1MI5E 1PX3A 1CXHA 1CG9A 5IQ7H 1LP9E 5IMLB 3VGGA 2PO6A 4I13B 4EI5A 4LLMA 3RGVB 1S9YA 3B9VA 4QTHB 2OZ4H 3DGGB 3VH8G 1TJIH 2AEIT 1WITA 1RY7B 2DDQL 4FFWD 5ID0A 3QUYA 2Y6SC 1CDJA 4N0YH 4NJAL 5ECJE 1I8KA 4X6DB 5DT1L 2ESVB 3TBWA 5C0IA 3F62A 4PY7A 3F7PC 4M7KL 4Y5YC 5F9OH 4ONHA 1J05B 1HKLL 4D9LH 1B0GB 1IAKA 2YD4A 3SKOB 3VFWA 3WIHA 3WS6C 1UB6A 5BOZG 4ISVA 4J12A 3BQUA 2ADJA 4NZDA 3V6OC 3DRQA 4PRID 4PGDA 3LEYL 3BPOB 4OLVL 1IAOB 3T3PE 2CDEA 5FDWA 2ADIA 4OGZA 3WIFA 4NGHL 3ULSA 2CSPA 1XF1A 1TTFA 4XNYH 3EJYD 5IFAH 2VXQL 3EFDH 3ZE2F 1GH7A 5F7YC 2VZUA 3KDMB 3GMMA 3KGRA 5IBLD 2B39A 1JNNL 1X7QB 3MJ7A 2OCFD 4YXLH 4I18C 1UJ3B 3Q1SH 1BHGA 3PWPB 3DO3A 4JFXA 2NY1C 3IDXH 1WV7T 2HKHL 3P77B 3VWKA 4JCLA 5IOPB 2RFXB 5FUCE 5IB5A 4GUPB 4LF3A 2AXGB 3BRFA 1UC6A 4JFDD 1CFQB 1TFHA 5BJTA 3G6DH 5EO9A 1N6QL 4OKVA 2XT1B 3GMRB 1U8HA 3KVQA 2PYEB 4M03A 3UJTH 3FMGH 3AB0C 2OR9L 2OTUB 1U41A 5JHDE 1I8MA 4S1QL 3V4UH 5HHNA 2VLRD 4P23C 3LN4B 4YXHH 2ICWI 1KTRL 1KJ3L 4HWBA 4YLQT 1W0WA 3MRBA 4LRIC 4NCC2 2F54A 3ARBB 1CFTB 4XBPA 1UH3A 5EORL 5I2IB 2DJ4A 4QOKA 1HHHA 2P5WE 2UWEB 2KH2B 2YPVH 3DVFA 5GS1B 4PGZA 3MROB 2D0FA 4AENA 3O4OC 3BPLC 1CS6A 4XP6H 3DETC 2GFBA 4JFOB 1TQCB 3QQ3A 4PTTA 1D3CA 1HNGA 1ZHNA 3LSOA 3MRLA 3CVHH 3LKNB 4HG4K 3OKLA 3THMH 3UTPE 3MV8B 1SJHA 2DKMA 4DFIA 5EOCJ 4HIHB 4BJLA 4G8IA 1CFSA 1UEMA 5F1OB 1U8JA 1C1EL 5I66A 3BT2L 1RZJL 3GMNB 4Z95L 1BF8A 4FQXD 3HG1E 2B0SH 1DSFL 4PJDA 3NA9H 3VE0A 3NCJH 4KMQA 1EJOH 3BP5B 1JE6A 4JFEB 2HT4D 4K2UL 2VDRH 3D2UD 4YK4B 1TQBC 5GS0D 4PREB 3X12A 5FK9B 3CSPA 1JNLH 1PZ5B 1RJZB 2XFXB 4YHIB 4PJBB 4M8QA 2UUDH 5E5RB 2Q20A 3A6CH 1XR8A 1QA9A 3JTSB 2O93L 1OP9A 1FFQA 4QRPD 1BBDH 1CF8H 1HDMB 3TPUB 4KK9D 2H6PA 4NQVA 3ZE1E 2C26A 1S78C 3GZKA 4PYHA 4JFZL 1U8KA 3MOQA 1CT8B 1AGCA 1QFWI 1D5BA 5C1MB 5LGJB 4O00A 2DTMH 3R0NA 1SJVA 1BECA 1NCNA 4DAGL 4G9FA 3SDXB 4MB3A 4X9IA 4OZGA 3WJLC 2Y7QA 1BWWA 2R4SL 4O51A 1A3LL 1CQYA 2MSPA 3ZE2E 2E9WA 1FYHB 1ZHKB 2PXYC 4PJAF 1X5XA 3PNWB 4PJ8D 4PRIB 1PKOA 4QYOB 2BK8A 4S1RL 3VRLF 4LEXL 5IF0B 1OP3K 4XVSH 3TO2B 4LPVA 2X1PA 4LSRL 4UUJB 3MV7D 3U36A 1V3MA 3ULVD 3RNQA 3CDYA 3ARED 4NO3A 1HXYB 5JDJA 4BFIA 4NNXB 3V6OE 1U8OB 1CGXA 2PKDA 2C4FT 5CEYB 2I5YH 1I8LC 1L7TH 5IW6B 2WM0A 4G6JH 3IKKA 1FH5H 5EZOL 1X6LA 3RWGA 2A77H 3L5XH 4JAMA 2QR0B 2EECA 5D1QB 4PJEA 1CN4A 1UXSB 2FGWL 2LU4A 4RQQA 2ARJA 1RAMA 5EN2A 5F6IB 1S5IH 5SX4I 4Q9QH 4RX4D 1UQSA 3MLZH 1FORH 2FD6L 4G80B 4MDJA 4C56A 3BEWA 1SMAA 5KJRL 2RJMA 3MRNB 2R2EA 3EDKA 4KTEH 3LH2L 4JFDB 4PUBH 2AXFB 2BOBA 1QR1B 4NNYB 5ACLA 3LRSB 1ZLWH 4HJGB 5CJXC 3UROR 3IKCB 4NQCD 1QUNA 1F6AA 1AHWA 4R3SB 3S6CA 3QIUB 3PHQA 3D0LA 4GG6A 5IMKB 5F1KC 4BSJA 2BY2A 1L9NA 3L5JA 1I9JH 2F58H 4LLDB 3GMOB 1J1PH 3P9LB 3WUZA 3X13A 4XP1H 1JRHL 5HD8C 1W0YT 5E8NA 5CGTA 1MFBL 5GS0L 1LO4L 3W0WD 5TFSH 3V0VA 1RIHL 3GSVA 3J7HA 4S2SA 4L1DA 1LHZA 1FVEB 5KAQF 3SE8H 3GK8L 2Z93B 3KLAA 2JB5L 5HI5C 1CDGA 3FZUC 2NCMA 4NN6B 3EYQD 1S9XA 1L0YA 3G9AB 3I6KA 1NAML 4JPVL 4Y2DC 4ZQKA 3WYRA 3QHFL 4TNVK 1BD2E 4MJ5A 1LWRA 2YXFA 3BGMA 3VJ6A 1ZVSA 1URLA 1WC7B 3B4NA 3QI9B 5CEZE 1KPRB 1IGCH 1BEYL 3VGDA 1Q9KB 3BP4B 5H8DA 1NBZB 2X4TB 2NY3D 3BDBA 4FQXB 1CVSC 1MFEH 3RX8A 5GGRA 5DHYB 4X7EC 1I7TB 3H3KA 1DBAL 1NGQH 2EEDA 4XX1G 2K7QA 2BNRD 3TM6A 4CMHC 4PJIB 2E6QA 4MNQE 5IKCB 3HE7B 4BSWA 3D2UB 5A40E 4S0TD 3WXVH 4FQHA 4LASH 1MJ7H 5IFHH 3QUXB 1MRFH 4P57B 1S7RA 2BNUA 5DD6B 4ZUUB 4M61A 3I02A 2B2XH 5IB4B 3KPTA 5IJVB 3G6AB 4ZTPH 3OKNA 3PWNB 5FA3B 2J6EA 4E41A 4QRPB 1F42A 3U79A 4LIQE 4LRNH 4DK6A 2NXZD 4X6FA 4Y5XB 5KS9A 1MHHB 2CIKB 3UZQA 1NAMB 5L0QB 3KPSD 3L95B 1G9NL 4ALAH 3VRLE 3QUZD 1SBBA 5B21A 3OAYK 2LAAA 1Q9WA 3FT4B 4ZS6C 1SMOA 3CH8A 4WTXA 4ZNEA 5AZEH 3DXAB 1PYWA 1XF5B 3N1GC 3QQ4A 4P46A 5E4EB 1FE8L 4HUXA 4NN7B 1A0QL 1G7QB 2XZCH 3SJVA 1MLBB 1PBYA 1IEBA 3OJVC 1A3QA 4RDQG 1YECH 5F9OL 1CCZA 4X5WB 3D1MC 4RMTA 4IRZH 3BPOC 3JV0A 2EKJA 3HRZA 4P3DB 3QNZB 2R56H 3HR5B 5L2JB 1CFVH 2AJ3A 1XGYH 1IM9B 5J3HD 4OZFH 4AMKL 2W65B 1T0NB 3HE6D 3O11B 4FQCL 3O41B 4K23L 1F3DJ 4XNYL 3RPIA 5F88B 4ZO7A 1FNHA 2R1XB 4X6DF 1IAMA 1H8OA 3LDBB 5MEPB 1DLHB 1CTOA 5DZNA 5DHXB 4ENEC 4RWHA 2OX5A 3PE9A 1FVCB 3QA3B 1YEDB 1H3PL 1WBXA 5FDYA 3QXUA 1YEEH 4F2MB 1UGNA 3BUYB 2R39A 3MPCA 4JO4L 1T7VA 5F7NC 3MYJA 1W72L 1GGUA 1MFCL 1LVEA 1JJUA 1HOCA 1KLFA 3OGCA 1HILA 3MZGB 5JPMB 3NN8B 4RFNB 1L0QA 3WE6B 3NFPB 5SX5K 3IDNA 3MNWB 2QLVB 5B38B 5IK3B 2EIZB 4PB0L 3RVUC 1IL1B 1JUFA 1AQDB 2GAZB 3TIEA 3G6DL 1F5WA 4L3AA 4M3KB 2R1YA 4OJFL 3QNYB 1I7ZA 4JFQA 4JDZA 1I85A 4OIIL 4Z76B 4KROC 4LCYA 1J87A 3W0WB 1MFDH 5E9DE 4LPXA 4FABH 1I1FB 3BZEB 3V4UL 1D5MA 5JW4M 3ARBC 1DEDA 4G7YH 1HHJB 2WP3O 4XP4L 1AP2A 3KYKL 3ZE0F 4Y19D 1NFIB 4TVPE 5GS1C 5FA4B 2HFFA 4YHLL 2R0LH 4NN5B 5E6YA 3LIZH 3UPRB 1KB5H 1AKJD 3CPLB 3QT2A 4XP6L 1W72B 1J5OH 4WU5B 2DWEA 4R0LC 3C5ZA 2COQA 2IH1A 1CICA 4EKXA 1NJ9B 4Q6YA 3THML 5HYSG 2J8HA 1VFUA 2AEWA 5ISZE 1UVQA 1L9MA 2BNRB 4H5SA 4MB4A 5E03A 3X17A 2LQRA 3PWVA 5IB1B 1EO8L 2B1HH 1QLFB 4I5BA 4PRHE 4RISH 3U9PH 3VFUA 1TTUA 1N8ZB 4Y89A 3STLA 3EYOB 3VXME 1OARH 2B0SL 3QRGH 4EN3C 5IT2H 3GRWA 1DE4B 1U8QA 2HJLB 3BW9B 1A47A 1AGEB 1CQKA 3U9UA 2CIIB 3OXSA 3RU8L 4K3DL 5D2NA 3SQOH 2XXCB 3DVGB 1DFBL 5J13B 5EU6B 3C08H 3WFDL 1YEHH 1EPFA 1LD9A 8CGTA 2JIXA 2HN7B 5JXAH 4UT7H 1KNOA 2YN5A 3QUZB 1J0JA 3VCLB 1YPZE 3WNOA 3E2HC 5F7UA 2F5BL 1ZSDA 4JRYD 5F7HA 2EIBA 3WD5L 3O3DA 3MOAH 1K8DB 3BZFB 5DJ6B 4FNLH 1RZFH 3QG7H 1RZJC 2VAJA 3GSWA 4Z18A 4L5FH 4K71B 5JW4Q 2JCCA 3UAJD 1B2WL 5FYLH 2MCG1 3SDDD 4M7LT 3WCYA 4GKSA 4KVCH 4X6DE 4Z7UB 2ESVE 5HGAA 4G6AD 3UZVB 3BP7B 4OI7A 1IEHA 5ICZB 1VDGA 2P7TB 5IG7A 3VRJB 4R4ND 4JGUA 1EH9A 1S5HB 1X5AA 3V95A 4BQ8A 5FYKE 2JJTA 3EJYC 3F8UB 3HE6B 1OD9A 4G5ZL 1KIQA 5T3ZE 5DSCB 2NY4D 5AD0B 1LEIA 1WZ1L 4JO2H 4POZD 4NCC1 4X6BA 1N7MH 3SE3C 1L7TL 1CE1H 2V7HB 5D1QC 1MVUB 2EIDA 2A9ML 4YDKL 1KCLA 1IQWH 3JWOC 3TZVB 4NQEB 1ZT7A 5FKPB 4HJJH 3QJHB 2X1WL 4YBHA 4HXAH 1DN2A 3AM8C 1I7UB 3MCLH 1KIPB 1HHGA 4WHCA 4EUPG 2A83B 1IAIH 5EO1B 4D9QE 4OGAD 5FAAA 5EU4A 4MGXA 3T8XB 3TYFB 2W0PA 2YPLD 4WUKL 5JDSA 1WFUA 3FO0H 4MD0B 4LNRB 3WFBH 1MY7A 2Q3ZA 4YJZL 1K6QL 3IT8D 1XR9A 3ZE0E 4KTEL 3QRFM 3JTTB 5A43C 3QHTC 3KPQA 4FRWA 2YRPA 4F7PA 2V7NA 3FT2B 3W9DB 1T5WA 5F1IA 5DF0A 1EHXA 3FQNA 3IRPX 3GJFB 4X7TB 1WZLA 1WUNT 4XP1L 2PYEE 1FO0H 3LEXB 5LJYH 2IGFL 3OHXA 1SYSA 1MAMH 1VFBB 2FCBA 3ARFA 3D5OF 3OJ2C 1DVFD 5BV7H 1FIGH 5TFSL 1VERA 1X3DA 2CPCA 1EGJA 2FWOA 3LCYA 3QG6B 1CL7H 3QUKA 3EAKA 4NN6C 3FHQA 4UTAH 3SE8L 5C0EB 3G5YB 2HWZL 2X4SA 5BRZD 4X4ZA 4HUUA 1CGSL 1B0RA 3MA9H 2C3GA 3SCMA 1W8OA 5B8CA 3IJHB 4YPGA 4HUVA 2QL1A 3EOTH 4NO0D 4NHUB 5HJ3B 2I9LA 4LSSH 1U3YA 4RAUB 5IEKB 1XFPA 4OQTH 3HZMB 1I9EA 5EFIA 5GSVA 2I24N 1CDHA 1F6FB 4KKCD 4U7KA 3ZTNL 5E08L 4FQXC 2NQCA 1SEBB 3MLRH 3MV8E 3ETBF 5GRVL 4OFYD 5CD3A 1MFEL 4G7VH 1NBVH 2HT4C 1KCUH 1AR2A 3IDUA 1QSEA 5HVHB 1NGQL 3HE7C 1EHNA 5GS0C 1G7MA 4IRJA 3CMGA 2IAND 2VAAB 3QUXC 5C0DA 5D7JA 1HIMH 2VNCA 2E7HA 4LOUD 5FB8A 2AJXH 3RL1B 3QCUL 4KRNA 5IFHL 4JFEE 2Z91B 4HPYL 4HFWA 3PGCB 1MJ8L 1S7TA 4LLVB 4KK9C 2IEPA 1I75A 5DJZA 4Y5XC 5EC2A 5FOBA 5C7XL 4R4BA 2DI7A 4ZTPL 43C9A 5L0QC 3LS5H 3OKMA 4YFLI 3DHJA 4QHMA 1IC7L 4JRYB 1Q9OB 1NMCB 1IC4L 3INUH 4O2CB 3GMLB 3IU3A 1KJ2L 5I1GL 4RBPK 2VLJD 2X4PA 3KNBA 5DRNB 4KKNA 3RTQA 3MNVA 3ZSSA 5J9PA 1OGAD 2AGJL 3I85A 1YDPA 3LKOA 4Q9RH 4XB8A 1PW3A 1T5XB 3SDXE 4C54A 3SDDB 4NT6A 4PJ8C 1NC2A 3HMWL 2O5XH 4HSQA 2I25N 4JN2B 1UACH 3AAZB 3L9RB 1U95B 3MXWH 3HMXH 3AREC 2HG5B 1AJ7H 4ZFFA 1HQ4A 3MYZA 4PRIE 3UXFA 5DJ8A 5ESAB 1OLZA 3IJYB 2NY4B 3SGJA 4W6YB 4J23A 5E6IA 4BH7A 4KJQD 2IALB 2R0KL 1QRKA 3C87A 5D7KE 1F4YH 1G9NC 1KG0B 4WI4A 3FFDA 3FL7A 3LDBC 2Y72A 4D3CH 1KJ2B 2AV1B 2N7AA 4KH2A 1MVFA 1YNKH 4L4VA 2XQBH 3B83A 3N1FC 3TBSB 3X14B 1FN4B 1A6UL 1ZANL 4N8PA 5ERWB 3L3HA 3RUGB 5JORA 4U1HB 5CBAB 4ZFOA 1JMZA 1MJUH 2EH7L 4MA7L 3ULVF 5JOFA 2V2XB 2V5RA 4HIEA 3FTGB 5TJWK 4RFNC 1QFUH 1ZTXH 1M05B 5FYLD 4JFDE 5CLWA 2OBGA 1F8TL 3VFTB 4BSVA 1MHCB 3MRQB 1FL5A 4Z7WB 1C16B 2NTSP 3D85A 5FIEA 3G5ZA 1F2QA 2H32H 4IMKA 3VXRA 1IFHL 3VXSD 4X6EB 3HFMH 1H0DA 4J3UA 4OZFB 4E5XA 3TPKA 1DVFB 1IKFH 3WIHL 2VLRE 3OR6B 5MI0B 1N5AA 3F6IA 3BUTA 3EYQC 1HNFA 2CRYA 2QSQA 5BRZB 2HJKB 3QDJA 4YUEH 2X4QA 3HI6L 5DD3L 2CRIA 3HAEH 4LCWA 1U8LA 2QSCH 4HF5H 5C92A 5MEND 4NO0B 1RU9L 1RUKL 1WBZA 2XWJB 3O6FA 2GK2A 1CG9B 5ESQA 2NY3C 2X05A 2PO6B 3EOAA 2VABA 1LEGA 4LLMB 4EI5B 1S9YB 2Y07H 2HTKD 5TDPA 4YEEA 1FZMA 3JSSA 5C0BD 3OSKA 5TDNA 1T21A 1HH9A 5ID0B 3QUYB 4WUUA 3CIQA 4G9FD 3MNZB 2XG4A 1I8KB 4Y4FA 4NIKB 2HA1A 3TBWB 5C0IB 4WO4A 4JREC 4PY7B 3CSYA 2ARWA 4RISL 4ONHB 4F58H 1IAKB 4P2QD 1MFAH 3VFWB 4PJIE 4B50A 4J3XA 3BQUB 2ADJB 3FO9A 3DRQB 2ZUWA 1HWGB 4JQVA 1UH2A 4ONGH 4PGDB 2NXZC 5HVWA 1MRDL 1WAAF 2D3VA 4NM4L 5J13C 2CDEB 5FDWB 3WFCH 2ADIB 3WIFB 2P42B 4RA0C 3QHZH 4EXKA 3ULSB 5D96B 3QUZC 1L7IH 4IS6A 3QDMD 4QRPE 1DQDH 2VLJB 4HWBL 1YC7A 1T20A 2BC4A 1ORSA 1UKQA 3Q6FB 4V1DD 2YD9A 3MO1A 3GMMB 1NL0L 1GXEA 5CFHA 2AW2A 5F9WC 2CLVB 3MJ7B 3QDHA 2NW2A 4LLQA 2XZAH 3P4LA 2QHRH 3U7YL 1QFHA 4G6FD 2DWDA 1PG7L 4JFXB 4L5FL 3NCYP 4ZTOH 5DJ0A 5HGBA 4C56D 2F19H 4J3OC 4PJGF 4LK4A 5D7IF 1EHLH 5IB5B 15C8L 4JM4L 4LMQE 4R8WH 4HK3N 3L3OB 4LF3B 3GDBA 5BJTB 5EO9B 4NRXA 4OKVB 5D7LD 3MLUH 2DRUA 3K1KC 3HE6C 4LSDA 1U8HB 1T3FA 3MLWL 3WN5C 3O6KL 2JJSA 3MV7E 5E7BA 3NCMA 4PRBB 1ZAGA 1I8MB 3HNVH 3BJ91 5MHSD 3A67L 3UMTA 4ZOAA 1UM4H 2YD6A 1W0WB 3MRBB 2F54B 4PB9H 1DL7H 1P84J 4XBPB 3HLAA 2ZCHH 3C8HA 3GJFK 5BVPL 3AS2A 4QOKB 1HHHB 3DYOA 4Z7UF 3EGSA 5KTEH 4AENB 4XI5D 4LLAA 3QQ3B 4PTTB 2NLJA 3LSOB 1ZHNB 4NZJA 3MRLB 3UTSA 4KAQL 1N64H 2WWKT 5FGSA 2GIYA 3OKLB 5FO8A 4NQCE 5SV3A 1SJHB 3BE1L 1CU4H 3BH9A 3PP3H 5DA4A 1RJYA 3PDOB 1YEJH 4ETQA 3BPNC 3VW3L 5LWYH 3GM8A 2ZCLL 4G8IB 1CFSB 3CU1A 3RZCD 4XMKL 5I66B 5ELIA 5DQJA 5BVJA 3GSNH 1M7DA 4PJDB 3VE0B 4OIBA 4GRWH 2K9UA 3GI8H 4PPTA 2LU3A 4L29A 5AG9A 1WWCA 4IOIA 5KSBF 1JYWA 3IETA 4O9HL 1FO0L 5MEOB 4PTUA 3W0WE 1UWGL 1MAML 3X12B 1BFSA 3C2AH 5IMMA 4IM8A 1FIGL 2ICWA 4RMQA 2EDYA 1MCPH 2AI0H 3BZDA 4M8QB 1XR8B 1QA9B 3QJFA 1QSFD 3RNKA 1EXUA 1KT2A 2BERA 2XIDA 1E4KC 4NQVB 4WCYH 5GSRA 1RFDL 5K9OA 4LSVH 3WFHA 4A6YA 1U8KB 3MXVH 4MQXD 3P4NA 4OBRA 1AGCB 2OK0H 1IKNA 1D5BB 3CX5K 3AXLA 4LSSL 1WAAE 4NJ9L 3PQYA 4FXKA 3NPSB 4OQTL 1CDBA 5HHMB 5E2WL 3WNPA 4G9FB 3GEWB 1YY9D 4OZGB 2Y7QB 4O51B 2R8SH 1OAYH 5HVHC 3NZ8A 1EUUA 4P46D 2BNRE 1XCQA 1AD0A 1NEZG 4XBEH 4APQA 5B3NA 3LN5A 1RV6X 4MCYA 5C0ND 1FO0B 1UWEH 4Q2ZA 5C08D 3TA3A 2EE3A 4M5ZH 1I7RA 4N8VA 5I19L 2DMCA 1IT9L 3M07A 2RIKA 1FFPA 3U36B 3RNQB 4NZTH 3F7VA 4NO3B 2OSLA 4BFIB 4X9HA 4Z7QF 3BI9X 5D7IE 1N0XL 2R2HA 3IXTA 5L9DH 2VLMD 5EU6E 1LO2H 5D1XA 2M2DA 4BA8A 1A7PH 1A6ZA 5CGYD 4Z9KB 4JAMB 5EBGA 4RQQB 2ARJB 3R1GL 2DAVA 4WI5A 2HFEB 4ODSL 4RZCA 4DJMA 1RVFH 4G6FB 1UQSB 4QWWD 2DQUL 3SDDC 3WUWG 4G6AC 2DMKA 4MDJB 4C56B 3BEWB 5EUOF 3DX7A 5BZDA 1Q38A 2R2EB 1VESA 1CLOL 2BOBB 1OB1B 3PWLA 4R4NC 2ED9A 2W0LA 4QGYA 2DIJA 1F6AB 2DLHA 1AHWB 2KQNA 5E2VL 4L4JA 5HYQA 4GG6B 3PHQB 3D0LB 4Z7UE 3RP1A 2FRGP 4RGMB 2YBRA 4NHCH 3MXWL 3HI5H 2NY4C 5BMFH 1MCWM 3T0VA 1AJ7L 3RWJA 4POZC 4KK6D 3X13B 4NBZB 1PQZB 1RUPL 1LO5A 4W6XB 4XCNA 3B2VL 3IF1A 5E8NB 12E8H 3MRKA 2ZPKH 1HSAA 3V0VB 3GSVB 3V6ZA 3TH2T 1BJMA 4S2SB 1JNHA 4HEPG 4AEIH 5M94B 3KLAB 1BVLA 3SBWC 4OGAC 1S9XB 4IBLT 2F5AH 1WK0A 3C9NA 3I6KB 5CSBA 5ADPH 5KSBE 4R26L 2YUZA 4ZO9A 4IRSA 4WRLA 4ZQKB 5ALBL 5E4IA 3ARZA 3PABA 4LHUA 2AS5M 4HS6A 4ONOA 1BFVL 2GW5A 1EO5A 4MJ5B 4MWFA 4QKXB 3BGMB 3VJ6B 1GGBH 4JFYB 2CMRL 4FP8L 4U05A 4XCEA 1QBLL 3FB5A 3S36X 1Z9LA 4WTWA 1KCRH 2H8PA 1N6VA 1YN6A 5GGRB 5GGTH 2J4WL 1BZ7A 3O4LA 4HCRH 2Z0BA 1FBIH 5ICYA 2EE2A 3IGAA 4LL9A 1DVFC 1ACYL 1FC2D 4BSWB 2D31A 4YHZH 3W39A 4FQ1H 4EDXB 4FQHB 4GMSH 4HBCH 1IKFL 2VERN 1S7RB 2BNUB 1DCLA 2MQCA 4U1KB 2X6MA 3I02B 4YX2L 1R3HA 5DS8A 3OKNB 4E41B 4GSDH 3SGDI 4YUEL 1LDPH 4X6FB 5KS9B 5FM5O 5CZXD 1QHOA 3T4YA 4TTGA 6FABL 2WIMA 5FO7A 4EI5C 4Z7WF 3GJEB 5EBWA 2ZSWB 1Q9WB 1ZE3C 1MCOH 2CGRL 3NH7H 3RAJH 1KN2L 5IFJA 2DD8H 2YEZB 1SY6A 4N8CL 2AQ1A 5CJQL 2PW1A 4HUKB 2EEBA 3QQ4B 4MHHG 4P46B 2BNQA 1KC5L 3FQWA 3FOMA 1EEQA 3K80A 4OLEA 4ZAKA 3V0WL 1G9MH 1TZGL 4HH8A 5IHLB 1FC1A 3SJVB 4LOUC 3FQUA 5C08B 3ZT6A 4DUVA 1IEBB 1OQOA 3VXUA 2YUWA 3LZFL 5CIPH 1T83C 4PRDA 3N85L 4OSUH 3HRZB 5KN5A 1JTOA 4JRWA 4MXQD 4ONGL 2YWZA 2AJ3B 5EUOE 5IBTL 3FFCA 3DUSA 1FAIL 3QFJA 5I1CH 4POYA 4GW4A 1NCBH 4C57C 2VITA 2WUCH 4ZUSA 4OF6A 2LAGB 4OM0H 2XG5A 4MA1B 3X11A 1IILE 1L7IL 3RPIB 3U0PA 3VFMA 1OSPL 4QTIL 1ADQA 1KACB 1DQDL 4DKFH 1I3UA 3RY5A 4JRYE 5FYJU 4XCFH 2HYMA 5BO1L 4PJ5A 3VD5A 2IWGA 3N1MC 1FGVH 4J8RA 2GHWB 5J6HA 1JGLL 1NC4A 3LV3A 1WBXB 4L8BB 4ZS7L 1ZA3A 3KJ6H 4KRLB 3MYJB 2FX8H 1U8NA 4AH2B 1HOCB 3OGCB 1HILB 1PZUB 2LE9A 3SKNB 3UJJH 2QSVA 4AT6A 3IDNB 4EOWH 2YMXL 4ZPVA 4O58L 1JUFB 4NBXB 3TIEB 4KJQC 1TVHB 2Y9RT 2APFA 2R1YB 4F9LA 2M1KA 1I7ZB 3CXHJ 4JFQB 4OCXL 3WNKA 2E27H 5K93A 4LCYB 5I30H 3S36L 4XMLH 4GS7B 3GRWL 1ZVHA 5ANMA 5CUSL 1Q8MA 1D5MB 3V6FA 1T2XA 4PJHF 3ARFD 1AP2B 4PB9L 3SKMA 4OFIA 4LCCA 1LO0H 5HHOD 4YHYC 1HI6A 1RIUH 2HFFB 1U58A 3EW3B 1KLUA 3CVIH 3ULUH 1MCEA 2EXYD 5KTEL 2W9DH 1MQKH 4XPHL 4WW2A 3RUGE 1OT2A 5E5MA 5E8PA 1MH5A 2YPLE 4M02A 4PJCF 5TQ2H 2Q1EA 2DWEB 3LQZA 2J2ZA 1NCDH 3C5ZB 2UY6A 2IH1B 1CICB 3QAZB 4ZXBA 3E1F1 5ESVA 1UVQB 1BM3L 3H3BC 4H5SB 2A6JA 5JUEH 3PWVB 4I5BB 4X6CA 3VFUB 3STLB 4Z7WE 4Y4KD 4OT1L 2Q87A 1CLYH 4IRJD 3U9UB 3VFPA 3VI4E 3OXSB 1Z2KA 4P2CG 5D2NB 3L3IA 3EDFA 3LS4H 3N1QC 4S11A 1EA9C 1MLCA 5BRZE 1PSKH 2XA8L 4LGPB 1N59A 1XGQA 1KNOB 5GS2D 2HTKC 1YJDH 1RIVH 4K94H 4EEEA 1ZSDB 2H9GA 3O3DB 4RFOL 1BQUA 4RAVA 4JHAL 3E6FA 2X4OA 3QDGD 4HAFA 4WDIA 5C09D 3GSWB 4LSTH 4LDLB 3O3BA 2H41A 3KPRD 3MJ6A 2JCCB 2HMIC 2R8SL 4I9WD 5JIPA 3STZA 1T22A 3D25A 4GKSB 1WBYA 3ISWA 1NC2D 5HGAB 3G6JA 1JPST 1JHTA 3DMMD 1BQLH 3H9SA 5IG7B 1G1CA 2VDOL 5BV7C 4M5ZL 4I4WA 5DGQA 1A3RH 3VWJD 2DQIH 3C2SA 3DNKA 1KIQB 1EFQA 1BGXH 4NZTL 1LEIB 3QEQA 4X6BB 4OUUA 5E6ID 5HDOA 4L9LA 1YEKL 1DJSA 4OZGF 3OX8A 4PP2A 2QHLA 3ELAT 4RWYH 1F97A 5DO2D 3M17A 4Q97A 3HZVA 3OG6B 1ZT7B 2W38A 2VLJE 1G0DA 1Q0YL 5E94A 1P4BL 2R4RL 1B6DA 1OGAE 4LSQH 5BW7C 2MPAH 4IOFD 4KHTL 4QRRD 5D5MA 1KIRA 2Z4QA 1ODAA 5EU4B 4J1UA 5GQBA 4CN1A 1AHWC 1FIEA 1PAMA 3OGOE 1X6NA 1XR9B 1TZHA 3FJTA 3MV9A 1T80A 1MEXH 2LVEA 1AI1H 3KPQB 2RBLA 5ACMA 1QP1A 4F7PB 2V7NB 1OD7A 1T5WB 5F1IB 4NHCL 5EIQA 3FQNB 3ARWA 4LDOB 4U7SA 3MGAA 1ZGLM 2UZYB 4PJCE 5CJBA 4UAOC 1KJMA 2IAMD 3LD8B 2KQMA 3ARFB 2IMNA 4Q0XH 1H8SA 4DFHA 3P4OA 2FWOB 1QTYT 1BIIA 4XI5C 5C0AA 3QUKB 2CLZA 3BKJL 5B4MD 2X4SB 4HUUB 1TIUA 3QDJD 4GG8A 4QLRA 4X80H 1B0RB 5I8CA 4QOKE 5GRUH 3SCMB 5B8CB 2C1PA 5LCVH 3QPXL 4YPGB 2H3NA 4HUVB 2IG2H 4XCYA 5KVFH 5M7QA 4JM2D 1QACA 1CD1B 2I9LB 3BWUC 3V6BR 2LV4A 1R5WA 4MX7A 5EFIB 2FX7L 5GSVB 5DEZA 3RZCC 2WANA 1TZIA 1MQ8A 3ZDZF 5FYLE 5JOPD 1K85A 2YKLL 5DD5H 3HNSH 1PGRB 1KFAL 3ILQD 4OGYH 4YAQA 5CD3B 4XRCA 1T0MA 3LEVL 5GGTL 3RFZC 4JZJC 1XF4A 1QSEB 3QO1A 1U6AH 3VXSE 1T03H 3V52H 1G7MB 4IRJB 4PJDE 5F70A 5C0DB 1U92A 5D7JB 4XP9H 5FB8B 4FQ1L 1NGPL 4WI3A 4X4MA 4HFWB 1S7TB 1BFTA 2VDML 4P3CH 1JVKA 5DJZB 4DKAA 1NCCH 5EC2B 3WHXA 5FOBB 1MAJA 4R4BB 1F4XL 2A6KA 43C9B 1AC0A 4MQXC 2SEBA 4NKIL 3X3GH 1BJ8A 4MJ2A 1YNTA 5MENE 1EBAA 4UIKH 5K9JH 1LDPL 1SHMA 4QHMB 3TP4A 1VA9A 4I0PA 5JXEA 3IU3B 1WTGT 3ULUD 3BOVA 2BRQA 3WS3A 4HV8A 3KNBB 2EKSA 1JL8A 3RTQB 1V3JA 3MNVB 4H1LA 4M43L 5J9PB 4OCSH 3LKOB 1YDPB 2DD8L 4P46C 3M8OH 4TSBH 3CK0H 3IJSA 5HHME 4TSAL 1Q0XH 4QY8A 4G9FE 4ZFOL 4NT6B 5C0NC 5T33L 4OZGE 1NLBH 1UKSA 4ONFH 4MZ2A 1NC2B 3L5IA 4HXBL 3UYRH 1RUAL 4L8SA 4BK5A 2WBJD 1UYWH 2NX5A 4F57H 3BYYA 4ZFFB 1HQ4B 2ENSA 4OV6F 1A7OH 1D5IL 3ZDYF 5DJ8B 5L7XH 2C7UA 5D9SA 4JPWH 4YXKH 2EE6A 4KDVA 5CGYC 5E6IB 1T2JA 4BH7B 1KB9J 4MA1C 5J1TC 3CH1B 1YUHA 5D4QA 2WUCL 3QDME 1MUJA 2WQRA 3FFDB 2J8UA 1MHPL 4P2OD 4LVNB 4XVUD 4QWWC 1QFPA 2WP3T 3SO3C 5GGVL 5FFLA 1FJ1A 3G9VA 4NQDA 4QRRB 5GPRA 4WGWB 2ADFL 3OQ3B 1FGVL 3L3HB 5AZ2H 4JVUA 5FUZL 5JORB 2YRZA 2CO6B 4YHKH 4ZFOB 5C86A 1SBSH 2ATPA 1MCNA 5JOFB 4V2CB 4HIEB 2Y4SA 4C56E 1AXTH 3QEGH 1KGCD 5IB3A 2ZNXA 4FQQA 5DVKA 5GHWH 4OUOA 4KK6C 1QBMH 1MCJA 1TLKA 1MF2H 5DLML 4BSVB 5D7LE 4DW2L 2W9EH 4LFHD 5IHUL 4EOWL 3HPJA 3D85B 3L3KA 4H26A 3G5ZB 1KN4H 3UBXI 1I1RA 3VXRB 2R2CA 4GS7C 4OFKA 3O2VL 1H0DB 3TH4T 4E5XB 1T1YA 2E27L 2PW2A 4CAGA 5MHSE 3ZDZE 3WSQL 1N5AB 4U3XA 2FEEI 4HQQH 3OAZK 2X9WA 3ZYZA 3QDJB 4Y1AA 2X4QB 4B7LA 5FGRA 4LCWB 1U8LB 5FOJA 3FHAA 1B88A 4ZFGH 1UM5H 4HLJA 5K9QI 1WBZB 3FO1A 1I1AA 4OTXL 3O6FB 5JMOC 3ULUL 4YWGH 5ESQB 3BD4A 1XIWA 4YDLB 3EOAB 4G6KH 2VABB 3OKOA 3ALPA 1LEGB 3U0TA 5CSZA 3QAZC 3G5XA 5CINH 1I8IA 3ZHKA 4Z0XB 4BZ1H 1FZMB 1NCDL 3PQYD 5TDNB 1T21B 1HH9B 4WUUB 1KLGA 3O2DA 4URTB 4POUB 2QQQA 4Y4FB 2YZ8A 1OW0C 5FGBC 1P7HL 4HIXL 3CSYB 3QIBD 1CXEA 3ET9F 5GIRA 3HC3H 5H37G 3OKYA 4NKMB 1VFMA 3QO0A 1AFVL 5C0RH 1U36A 2VDNL 5FHBL 4HC1A 4APQD 5D2NC 1VGEL 4JZNA 3FO9B 4N0CD 1A14H 2AK4A 5CZXC 4OD1L 2OI9B 5FUOL 35C8L 2HKFH 5IP4A 2X42A 4M48H 4AIZA 4IS6B 3QWOA 2DMBA 4QXUL 4UTBL 1T20B 4D0CA 2BC4B 1ORSB 3C6LD 3QH3A 5D1XD 3ZDYE 3MO1B 3TO4A 2YR3A 5GZNC 2IBBA 3MZTA 2AQ3A 2VKXA 5D6CA 2NW2B 1T1ZA 4LLQB 1KIUA 1T2QH 4AG4H 4ZNEE 4YHML 5IHBA 2R2BB 4LSTL 4QCIA 1ZT1A 4JVPA 3BGFB 4GMTH 3SDYL 1IBGL 2BCKA 5HGBB 2Y36L 4Z6AT 4MXQC 5C08E 3ROLA 5K33A 4RSVA 2WIIA 3QISA 1A3RL 3W2DL 5DC9B 2UYLA 1U3HA 2VLME 3PGDA 3IS1X 4ODUA 1LQSR 3TEUA 2BSSA 4ELMA 2X10A 4OM1H 2JCCF 3HLAB 4WI2A 3MLXH 1GGTA 5T1KA 4KK8D 1XZ0A 3P40A 1OP5K 4GRWF 3QEHA 3EGSB 3NAAH 1NLDH 3K4DA 4NQXA 2VZOA 1AO7D 5DTFA 4KJWD 4LSQL 1NMAH 4UI2A 4GAJH 4RNRA 4A6YL 2QEJA 2NLJB 4XNMA 1NFDA 4XNXH 1A6VH 4IRSD 4RFEA 5DMGD 3UTSB 4LHUD 1R5IA 4Z7VA 4ZMAT 5FO8B 1MWAH 1KCSL 5HGHA 4DN4L 3BH9B 2XTJB 1NCTA 1XGTA 3IFLH 4ETQB 3L7EA 5BVJB 5DQJB 1B9ZA 3BGAA 4NOFA 1ZK9A 2QSTA 5IJKA 4L29B 1OAZL 5DUML 1TJHL 5I9QC 1OGTA 4IOIB 3LD8C 3IETB 4LAJH 3ARFC 3DX9A 1IGYA 4PTUB 2VKWA 4UT9H 3RWCA 2FECI 4QHLA 3TT1L 3QYCA 4LQFH 5IMMB 4UV7L 1OCWH 5DK2B 3T2QA 2EXYC 2GT9A 3BFOA 3QJFB 5JHLH 4DVRH 1FNAA 3RNKB 3V4VH 1EXUB 1KT2B 4FQJL 5D8JH 2KPNA 5J1AA 4ZPTB 4RGOH 5GZOD 1ES0A 2DN7A 3CUPA 2DQJL 4JPKL 5GSRB 5K9OB 3WFHB 3DSNA 4A6YB 2PN5A 3P4NB 3DECA 3EUUA 5DI8A 3PQYB 3ARTA 3GB7B 4FXKB 1QFWL 4CVWA 5FKAA 1BLNA 2R29H 3OJDA 2VZVA 3D3VD 4Y4KC 1Z0MA 2GJZA 4LVHB 4LP4A 3QIBB 4K9EL 5A2JH 3NZ8B 2NY0D 3MGOA 4NM8L 4IRJC 5DJXA 1XCQB 2JJUA 3PDDA 1A02N 5D7JC 3HUJA 3WV0A 4APQB 1Y18A 2YA2A 4MCYB 2AV7A 4Q2ZB 3TA3B 1I7RB 4N8VB 3ZT5A 2E8YA 2WAHA 4OIAA 3EO9L 3GSRA 3H0TA 4KY1H 5KG9A 1FFPB 1JFQL 5MEQA 3F7VB 5D2NE 2OSLB 2A9NH 8FABA 3GIVA 3NMEA 2ZOLA 2R2HB 3IXTB 4NQSA 4M6AA 4HGKC 3BP6A 5D1XB 3LPFA 1J8HA 1A6ZB 1BOGA 2P8LA 4W68A 1R3LA 5JLZB 3C5SA 1FNLA 1TDQA 3MBXH 3ME0A 1KENH 4RZCB 2I9TB 5KW9H 2ID5A 3IFPA 3DLQR 4GAGH 3ARQA 4XBGA 4KZDL 2FHBA 4D9RD 4TSBL 1YYLH 1RSFA 1NCWH 3DX7B 1QLEH 5MP6H 3ZYJA 2R0ZH 2F53D 4N0RA 4JN1L 4M1GH 2JCCE 3PWLB 1BBJA 1ZV5A 2ZZUT 5HYQB 3UYRL 2DQDL 5DFWH 5KZCB 5DD1H 5DFTA 2YBRB 4WHYH 4G8GD 3RWJB 3TF7C 5DUBA 1J1XL 3BISA 5E6IC 1TCRA 4JB9L 5L7XL 3GM0A 1DDHA 1S9WA 2V5MA 1LO5B 4YXKL 1VFAA 4XCNB 4CUCA 3IF1B 3MBED 3NGBC 3MRKB 5JTWA 1HSAB 2ENYA 2ORBH 1GSMA 4LVNC 3V6ZB 2RB8A 3FQTA 3ARSA 1JNHB 3BDYH 3Q48A 4IOFC 2HTLD 2VSDA 1BVLB 2BFVH 1AO7B 2P4AB 4JGJA 4BZ2L 1RUQL 2MWCA 3OBAA 2DM3A 2IJ0C 3C9NB 3MUY1 1J1OH 5DRWA 3VDCA 3REWB 4HWZA 2B1AL 4IRSB 5AZ2L 3GHEH 2DS4A 3PABB 4LHUB 4HS6B 4MD5A 1H8NA 4MWFB 1DQQB 2EH8L 1I3GH 1S7QA 1WFOA 2NY5H 3MCKA 3MLYL 2GUOA 2ZUYA 1LO3H 3QEGL 1SY6L 2GJ6A 3FB5B 3AFLA 2GTZA 2H8PB 2Z31A 3SGEI 1AY1L 3JWDL 2BJML 4ZXBD 1MF2L 4P3WA 1RK1A 1BZ7B 2CKBH 3O4LB 4P5TD 5DWUL 5HVGB 1DBJL 4BM7A 2J7LA 4DGIH 2OL3A 4PJFF 3U2SA 1YEGH 5ICYB 3IGAB 2IAMC 4GLRI 4LVOB 1JPSL 4BYHA 5BCAA 2D31B 3PWJA 1K3IA 4LIQH 4XNUH 4TOYH 3W39B 4ESKA 5I1IL 5DVOA 5B4MC 1CTNA 4KQ3H 1HYSD 5JQHC 3BESR 5D70H 1R3HB 5DS8B 2NY6B 4FFYH 3BIAX 5HHOE 4HGMA 4JM2C 4L4TA 4H20L 3VMNA 3ZL4L 4NC2B 3ES6A 5E0QA 3KXFA 3PV6B 3CFIC 4YDLC 3EDEA 3SKJL 5LGKA 3RIFF 1ADQL 5EBWB 4YWGL 4JDTH 4P9HL 5T5FL 3ILQC 4Q9CA 1CDYA 3DO7A 5IFJB 3G08A 5AG8A 4D8PA 2VXUH 3MLVH 2PW1B 3HB3D 4XWGL 4MXVF 5J6GA 3QUMA 2IH3B 5FV1L 4N8VG 1L6XA 5FCUH 2NY0B 2BNQB 1RJCA 3FQWB 1WEJL 3FOMB 5D71L 4ZAKB 3P0YH 5DEGA 4P48A 3BSZH 1FQ9C 3FQUB 2P24A 4GAFB 1MCLA 1I9RH 1DUZA 1NGZA 3PV7A 3S37L 1EBPA 1QSEE 3HC3L 3U7WH 1D6VL 4JM2F 3WFEL 3OB0K 1BIHA 3A6BL 1S3KL 3VFVA 2OI9C 1Q72H 3UTZA 3FFCB 4KV5E 1A14L 3ZHDA 3DUSB 3H42H 3MV01 3QFJB 4GW4B 2VITB 4XXDA 3NABH 5DUPH 2HT3D 3MODL 4KXZH 4ZUSB 4NFBA 3ULUC 5DHVA 3X11B 1QOKA 1CI5A 4Q58C 3QEQD 3U0PB 4GRLA 4XAWH 3VFMB 1NGYA 3VFSA 1MIEH 2DYPA 1A1NA 1OP3H 4FFZL 1T4KA 3VFGL 1EVUA 4J8RB 5J6HB 3FN3A 3RHWF 3QDGE 4PRAA 3LRHA 1NC4B 3LV3B 3Q5TA 3BGFC 2ZCKL 3KPRE 2WBJC 1WJ3A 3FN0H 1D6EA 5HYSA 1ZA3B 1U8NB 4GMTL 4LAQH 4GOSA 4OD3L 1NUNB 1FYTA 1LK3L 5D2LA 4AT6B 1FG9C 4ZPVB 1Y0LA 5I73C 4PP1D 3VDAA 1QEWA 2JJSC 1CLZH 3ULUF 4O02H 5FXCH 1JYVA 2YK1H 4HWEL 3MBEB 3V7AE 3TVMD 2CUMA 4P2OC 4TVPH 4U4BA 4OLWH 4KI5D 4P2RD 4XVUC 1GIGH 2AJYL 5ANMB 1YJDC 1T89A 4UINH 4HBQA 3CX2A 3MACH 3V6FB 1JGUH 2YD5A 4ORGA 1V7NH 4OM1L 3SKMB 1DTUA 2OS7A 3G5VA 4LCCB 1OAXH 4UOW0 1HI6B 4TNWK 3K2MC 4J6RH 4MQ7A 5C0AD 5F1SA 1CDCA 4Y4HD 1MNUH 1U58B 1KLUB 3MSPA 3O3UN 4QRRE 2XXMB 3CFCH 1CGYA 4PG9A 3WXWH 3GSOA 5E5MB 5E8PB 3MRMA 1NMAL 4QXTA 1MH5B 3VI3F 3ZDXF 4MB5A 3CJJA 2BY0A 2W59A 3LQZB 3LQAH 4L3ED 4ZXBB 1MCWW 5ESVB 1JTPA 5DURD 2K3TA 1E4XI 2IQ9H 3IFLL