3U9UB

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
molecule tags Transferase
source organism Mus musculus
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
total genus 52
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB01
3BAEH 4Z78A 1KCVH 4G8EB 3E6FA 5IM7A 3BKYH 1QPXA 3B6SA 1SJEA 4I2XA 1UKTA 3D39A 1MH5A 1X5GA 1DFBL 4EVNA 1BX2B 4ZXBD 2AXFA 5GRYA 5EOTB 1U93B 2XWJB 1TTGA 1UXWA 1X6LA 1AE6L 1BJ8A 5JXAH 3LEVH 2OR9H 4P46B 2XZZA 2LE9A 1Y0LA 3WBDA 1BQHG 3UYOD 2DQDH 5DD3H 3HTLX 4Z9KB 1KTDA 4ONGH 4BUGA 3PDOA 2CIKA 3ESUF 3QUYC 4M6OL 4NQDB 1XGQA 2J2ZA 4OCSH 4X99A 3UTQA 2YUWA 4EUPH 5J6GB 3VCLB 4HGKC 5FKPA 4NUGH 1OF2A 3S34L 1UJ3C 1GSMA 4K07A 3QG7H 1T04A 3DX6B 1NCWL 3QDME 4EKXA 3LQAL 4BZ1H 2DBJA 1OTSC 3EYVB 4N5EC 1IM3A 2H8PA 4U1MA 4FG6D 3ZLQC 4QGTA 5E2TL 1HZHL 4Z7WB 3GMPA 5DHYA 4UV7L 1QHOA 4AG4L 2PYEA 5E8OB 4M5ZL 4PB0L 1PDKA 3U4BH 3DYPA 4NRXA 4X4YB 1SQ2N 5B4MD 3BWAA 4GRWB 1JIBA 4G9FE 3ROLB 2GJ6B 3VDCA 4KKLD 4AL8L 5F7LB 4IRSB 5CILH 3KPRB 1RZJC 4ODWA 5SX4H 3NAAL 2DMCA 3VXRD 4U6VL 3I3BA 5CEZL 4DZBA 1H3XA 4XTRD 2F5BH 4CNIA 1A6WH 2FIRT 4O4YH 2IMNA 3Q6FA 5ICXB 3LPWA 4KY1L 2BSRB 4P3DB 8FABB 4KVNL 4PG2C 1D9KB 2R2EB 2YPLE 3GSXA 1JGLL 5F7MC 3M17B 4GQPH 3DV6A 4PGDA 3GK8H 1HKLL 3Q5TA 3C6SA 2HVJA 4QNPF 4XNUH 4PRAB 1H5BB 4PG9B 4U6YB 4MJ5B 3QPQD 4ENED 1K4CB 4QRTA 3QNZB 1M71B 2IALA 3E3QE 2LU3A 3HS0B 5KVDH 4DFIA 1RZFH 1XMWA 4H20L 3GJEA 2C4FT 1XF4B 3TNMB 1RHHA 4AIZA 5DMKB 4IIQC 1UC6A 1RUPH 3NGBB 5F7HA 1J7VR 4WFGD 3TA3A 4MYWB 5CEYA 4KJPD 4E0RB 3O4OB 1EAPB 1BD2B 1HHJA 2XQYK 5D93B 1CLZH 1KPRB 1ZVYA 2UWEB 4B7LA 3S5LB 4NQVB 1CDYA 4OUUB 2Q7NA 4CVZA 1OW0A 4R2GB 2H6PA 2Z0BA 1CL7L 1MEXL 2BX5A 5D1ZB 1KLFA 2GAZB 1GZPB 4JHWH 4D0CB 4R3SB 5FEBA 1KN4H 1XF3A 4JAMB 3WEXA 5DFVC 2FJHB 2A9MH 2GK0B 5I9QB 3M8OH 5D1XC 5EO1A 1PLGL 1HOCB 2YXMA 2IWGA 3MA7B 4P5MB 1BAFL 4XCEB 5A2LH 4OF7A 3S7GA 3T0EE 4XWGL 1UWXK 4XPHL 3S88L 5FK9A 1YEJH 4X6DA 2DQHH 4JY6B 3REVA 4PJ8C 3RZCD 2BVOA 1JTTA 1G0DA 2V7NA 5DRZA 4I0PD 1CLYH 4I3SH 4UTAH 3TO4B 1NEZG 3QUMH 1FNEA 4JKPL 5JORA 4NRYB 2BSSB 4P5KA 5J1AA 2R9HD 5I8OH 1H8OA 5I1IL 3KPNA 4FTVB 1RSFA 1RJLB 3O11B 4Y1AA 2R8SH 1RK0A 1TETH 4DGYH 2Q1EA 2IG2H 2G60L 4I5BA 1AGBB 1HSBB 5L9DH 2NY6C 2Z35A 4MJIB 4P2CG 5EPMA 4M43L 4ZSOE 2MJWA 1F8TL 2NY5H 4OLVL 5FDWA 1M7DA 2HVKB 4M1DL 1XAUA 3PWPB 4IHOA 1RUQL 1KUMA 3DXAA 1EFXD 4PRHE 2J1KA 4FXGB 3SO3C 2DM3A 2CDEB 3ARFD 2IANE 3GI9L 4BQBA 2Z31D 3V6BR 3T1FA 2OR9L 1A7RL 3MGAA 5DJ6A 3BUYA 3GSVB 5IMMA 3BN3B 3RHWF 2FSEB 1LEGA 4Z7QF 1NC4B 4DUWA 5FYLD 4IEFB 3GNML 1NSNL 4Y2DA 2VZSA 2G9HA 3HC4H 3OXSA 3V4VL 2R0WH 3D2UB 4RMQA 1MJUL 2DD8L 2ZUQC 4HKBB 4KK9D 4PJ9B 1NGXB 4X5WB 5FM5M 2EDWA 4XNMB 3O4LA 3FL7A 3QDHA 4XVUC 3O6ML 4QHUA 2DJSA 2VDPL 1CK0H 1TCRB 3MFFB 3T8XA 1UACH 1M7IB 4YX2H 1BF8A 5GRXG 3QIWD 4PJIA 4W68A 3ARWA 5HDQH 5AZEL 4XVJH 3DROA 1YNKH 4EDWH 4FABL 5E2UH 2VDOL 5TH2B 5EZIH 3NABH 5MEND 4U1JA 4PGEB 5TE6L 2XYCA 3U9UA 3QI9C 3KXFB 1P4IL 3C5ZB 4YWGH 4LPXA 4ZUUA 2X5PA 1I1AC 3N85H 3G04B 5DS8B 2QLVB 2R69L 1PKQB 4BK4A 5JQ6H 2OK0H 1WBXA 5DT1H 5DD1H 4X6EA 3HLAB 3HUJF 5A2FA 3QEQA 1IGML 1T1ZB 2VDLH 4XPTH 3ARGC 4NN6B 1YMMA 5GGRB 4QRRD 1LO5B 4Q6YA 1BFTA 4TULH 1AHWB 4NHUB 1PZ5B 15C8L 3OJDB 2J88H 1TNMA 3VRIB 1T7ZA 3FQWA 1J8HE 2GFBA 2VXUL 1UXSA 1IKNC 3QIUB 2IFFL 4GXVH 3CMGA 2X41A 3CFJA 3SE3C 2VLLA 5IMKB 4YHPB 3QUYA 3TT3H 4GRWH 4N5UA 4ZFOL 1U8OB 1LO2H 5JLZA 4P2OA 3MJ7B 5I73C 5E08H 2JJVA 5L0QC 3HE7D 3O41A 2IAMC 4NQTA 4OZHA 5EULV 2FJGB 4WUUD 3T04D 1H8SA 1WV7T 3VXRE 1T21B 4G6JH 3MLTA 4IIQA 1FVEB 1FLRH 4Z7WE 1IGIL 3UTTE 4PRNA 5CMAA 1AI1L 2A6KB 4WHTB 4I3GA 5CHNA 1RUPL 4MJ6A 5CWSA 5DRNA 5DURB 3L9RA 2AK4A 1OCWH 1I3VA 3PIQA 4ETYA 4J1UA 3L7FA 3QFJB 3VGAB 4OCWL 4QRRE 3CUPA 1W0WB 3MNWA 4XNUL 4K7PL 3UJJH 3I6KA 3ARZA 1QZ1A 3WIFB 1FZMA 1X4ZA 1A6UH 3THML 2BMKA 5IQ9A 15C8H 5F6IB 5T5FL 4OLYL 1FGVL 3OHXA 4KTDL 1OM3L 4L8SC 2FNBA 3WO4C 5D1QC 1I1FB 3D85A 1KJVA 2HT2C 3Q48A 4PJGB 4KI5C 4OV5A 5HD8C 2YD6A 1RZKC 4QWWC 3T0ED 1NBZB 5JNYB 3LKRB 4KV5F 3AAZB 3FHQA 4LKCB 4IJ3C 3HR5B 1WFOA 5CD3A 2G5BB 3IGAA 1TITA 5F8QC 1NC2A 1BPVA 5KVGH 3CFDA 3EYSL 2VLKE 1RUKL 1YEKL 4JCLA 4Y8AA 2EE9A 4YHOL 2UZXB 2IGFL 4ERSL 4U1GC 5I15L 3FZUD 2BSTA 4NKOA 2PW2A 1UCBH 5F7WC 1D5IH 3I75A 3BZFA 3ULVF 1YMMD 3ARPA 1WISA 3QIWC 2XXMB 2BJML 4NQSB 4WGVB 1LE5B 2BNQD 2VDMH 3WNMA 5I9QC 2NY0D 1SM3L 3MNVA 2HFTA 5IBTL 1KPVB 2BOCB 1S8DA 3BGFC 4BZ2L 3DYOA 3V8OA 1NAMA 1BQHA 4OCSL 5E8EA 4KTEH 5F9JB 3UDWA 4KAQH 1BD2D 3VGFA 3H9SA 2NY2C 7FABH 2OX5A 4FQIH 4OCXL 3VFPA 2OTWB 5BVPH 4L8BA 2DLEA 4Q7DA 3FT3B 4F9LC 2IBBA 3EYUL 5HDLA 4IS6A 4EN3A 2CK0H 3F7VB 4UAOC 1SEBB 3SBWA 4G3YL 4XB8A 3BOVA 5DZLA 2FX8L 4Y0GA 5DRWB 1QFOA 1MLCA 3BKMH 3H9HA 4FZEH 4YDLC 4NCC1 2Y72A 4JZJC 2XRAL 5D7LD 4QOKA 2HWZH 5A2IH 5HGDB 4J7RA 3L3OB 4RZCA 3BUTA 3QEQE 2NY6B 2QHRH 3IB4A 1SY6A 4UINL 3E6FB 5IM7B 2VDKL 5E99H 5CEZH 4JRXA 1FSKC 3QIBC 5F9OH 4GG6A 3FT2A 5EOTA 1F90H 2VITA 2NY6D 4WHDA 1X44A 2RAMA 5T3ZL 4XMPH 5IW6A 4F9LA 1U2HA 3NMEA 3F6IA 2C7UB 3PWLB 4WWKB 4M6NH 1EBPA 3RVXD 3FFCE 2P48B 5IV2B 1MJUH 2BY1A 3S37L 3RWDA 1F4WH 5KSAA 5DJ0B 3ZE1F 2YR3A 3TZVB 2PCPB 1NCAL 3MX0A 4QTIL 4OLZL 1U8JA 5E6ID 2X4PA 4S0SD 2BERA 4JRXD 3DUUA 4GS7B 4YNYB 4ONFH 4IRZH 2PNDA 5B3JE 3I6GA 3MO1A 4MAYC 4G8FB 4WFFE 5B8CB 2CKBA 5HDQL 1NAMH 1NAKH 4JRYA 1F11B 1UKSA 1YUHB 4QHKI 4KQ3H 4LLAA 3L5JA 3MOQA 3SDXA 1LP9E 1NGZB 3QDGB 4RRPG 3QI9A 4WFGE 4K23L 4R4BB 5F6HJ 1IT9L 3VGAC 2OTPA 4NKDB 2KDGA 5FHAH 1AXTL 2P4AB 2PYEE 2FGZA 1BLNB 4P99A 3Q5OA 2D0GA 5EIVA 1MWAH 5AUMA 3UJTL 3PP4L 1UQSA 4D9LH 2NR6C 1Z6JT 4WENB 4RFEA 4P59H 2BNQB 3EO0A 5HYFA 4JHWL 1EBAA 1DN0A 4N8CL 4QHNA 4X6CB 5IMLB 1GH7A 4H0GA 4JY4A 1MUJA 3HPJB 3SO5A 3JSSA 2NY1D 5BCAA 3OGOE 3SKUD 4NWTH 5JR1L 4WWID 4M93B 5TQ2L 2Q8BL 3LRSB 1D6VH 4M8QB 4Y2DC 5HYSB 3BJLA 1FVCB 5IVXB 2IPTH 5DUBB 1EVTC 1CFTB 3O2VH 1I1AB 3O9WA 1I1YA 5F1NA 3U46A 1SYSA 2ARJA 4XC3L 1M05B 2P7TA 3VRLF 3QQ4A 3IT8D 2VXTH 3C6SB 3RUGA 5C2BL 4IMLB 3FQTA 4X7SH 3IS0X 5IW1B 4Y16D 2VDRL 3ARGB 4NN6C 3U36B 2AJZA 5I1KL 3JV6B 4U1IB 1WFTA 2W9DL 4JKPH 3L5WB 4IDJL 3EGSB 3MYJB 1M71A 2JCCF 1HKLH 4LDOB 4LSSL 2Y36L 4NM4H 1QPPA 4J2XA 3RWEB 4JFEE 4KQ4H 4PJCA 4PGJA 1RZIB 3ME0A 5E94B 4ODVH 3ZKND 2AP2A 1YNTA 4BSJA 1BWWA 1KB9K 1NLDH 3FONB 3X17A 4YUEL 4MLSA 1YEEH 3L3KB 5E00A 1W0YT 1FYTD 1X5LA 4YE4L 2B5IC 2X4TA 3LAFA 4PGBB 4ZAKB 2WBJB 1D6EB 2W9DH 1AKJA 3VXPA 4WFED 1ZMYA 5B3JF 4S1RH 4F7CB 3AFLA 4BFBD 3VD5A 3K3QA 3WN5B 4K71B 3GUTB 4FG6C 2YA0A 4M7KL 2LQRA 4GMTH 4HV8A 1MCNA 4R0LC 4UQ2B 2BOBA 3VFTB 4JFYA 1FHGA 5C71A 3WO4B 1L7TL 3OKLA 4FQ2H 1EIBA 4XCEA 4PD4J 4PJ5D 2OSLA 3MJ6A 1FCGA 4MDIB 2I07A 4N8PA 4EUPB 2AGJH 4JANA 4HSQA 4GXUN 1R6VA 1P4LA 4JG1L 4MXVF 1P69B 4TSCL 5FGBC 3NZ8B 4KZDL 5HPOA 1AO7E 1GAFH 1A02N 2YN3A 1TJIL 4JO4L 3EYSH 2DM2A 1K9TA 3QIUD 3QIBB 3P0GB 3VI3E 1QLFB 4XCFH 1WIOA 4GMTL 3I2CH 4O2EB 3ARBC 2B4CL 1RURH 3VG9C 1NAML 1DANT 1OHQA 2ZZUT 1EJOL 3V0WH 5DHVA 4CKVX 1CE1L 1U8NB 2AXHA 3QWOA 3VWJD 4ZG1A 4YQXH 3QFDA 5GGUB 5FGBA 2ZCKH 1ORSA 3ECBB 3VFVB 3KPOB 3UPRB 4KVNH 5EBMA 2EC9T 2DLIA 4PJIF 4XXDA 3SQOH 3MCLL 4FQPA 4JZNA 1P53A 4DCQB 4P2QE 5E8DL 1KEML 5K9KB 3KJ4B 4IHOB 4OIIH 3V7AE 4LCUA 1ERNA 5F96L 3UAJD 1HHIA 1CIUA 2R0KL 3FCTB 3VG0H 4PBXA 5I71C 1DLHA 4KJQC 4MMZC 4HULB 4PJFE 1OLZA 1A3LH 1RMFL 1NC4A 4UQ3A 1YMHA 2BCKA 5FHBH 5JOPD 2AV7B 2R0WL 2EDLA 2LABA 2G9HB 4DN4H 5DI8A 3L1OL 1INEL 5DVKA 4LLUA 4C56B 4X6FA 3V6ZB 1JNNH 2Q86B 5JXAL 4JFED 4UINH 4EDXA 32C2A 2I60H 1UM6L 1G0YR 1M7IA 4MCZA 2IAMA 4HW6A 1RULH 1JE6A 3GJFA 1FIGH 3PWPE 4JFXB 3D69B 1F13A 1OGTB 2FO4B 2GEEA 1JMZA 4ISVA 4YC2C 4HX1B 4K7PX 3KHQA 1YECL 5ITBL 5SWQB 1ZGLA 4PGEA 1A5FH 4JKKA 3SCMB 4KK5C 4RGMC 4HKJA 5ISZA 3CDFA 5MP6L 1WCQA 4YDKL 1OTTC 4J8RB 5DS8A 5IOPB 3BPNB 3NA4A 2D3VA 5FGCB 4PLNC 4KZEH 4IRZL 2R0LH 4GKZB 3WJJA 2NZ9D 4JHZA 2YEZA 1FIEA 4M03A 3P30H 4IRSC 3GMQA 2FEDD 2R0KH 3CCHA 5HHVH 3TGXA 4IRJB 1PEZA 3WKMH 2IH1A 1S7RA 3MA9L 2YPLD 1TQCB 1CU4H 5JW5B 4F7PA 2CSPA 2HH0L 3ILPA 2WZPD 4WTXA 5CIPA 1NKOA 3PGCA 2W92A 1LO4L 1TNNA 1FE8L 3VD4A 3SKMA 1KCSH 3G5ZA 3KPQA 4M62H 1FC1A 4YXKH 1QBLH 3QDGE 3BP7A 1H3VA 1X9QA 1OWRM 4PGCB 2HN7B 1QSFD 3T2NL 1OLLA 4S1SL 3Q2CA 3KR3H 4XCFL 5I1GL 4WJ5B 1R3JA 2IPTL 3JWDL 3E6HB 1HILB 2LTQC 2GUOA 5IVZA 4J1UB 3TCLA 4Y7MA 2YPLB 3BPOB 3P11H 1NCDL 3NZHL 2X1OA 4FZ8L 3ZE0F 2WNGA 1WC7A 5F1IA 4H25A 5C9KA 4OJFH 3RGVC 3ILQC 3HC3H 4ZTPL 4U1LA 1FYTA 2MNUA 4LCWA 2UUDK 3T77B 4KK8D 2FLBT 4RX4D 2HG5A 3UEZA 3MRPA 4WDIB 1FFRA 1AJ7H 43C9A 5B38A 3MZTA 3G5XB 4W4NA 2ZNWA 3MNZB 2R1YA 2CO7B 2B2XH 5CGTA 1DLFL 2MPAL 3IS1X 4PJGA 1QR1B 5JDSA 1HQ4B 4WCYH 3KWWA 3TA3D 1RHFA 4G42B 2DIBA 2AV1B 3QEUA 4P4KB 4NCC2 4ZTPH 4D9RE 1QFWH 4R2GC 1HNFA 4JO3L 1KLGA 2J8UE 3OTTA 3MLUH 2ICWI 1NGQL 5CSBA 4B53A 3OKKA 3MV8E 4HFUL 2OYPA 3TIDA 1D5ZB 3LS5L 4ORZC 4KXZH 2AJSH 4NN5C 3IU4H 3BN9C 3MOAH 2OQJB 2EEDA 2PXYD 4U1NB 3RY5A 4L8SB 1LILA 4OZIF 5DQJB 4KVCH 4UNVA 4LOUD 1JWSA 3QXVA 3QJFA 4JFZH 5H35A 2H32A 1LE5A 1G7QA 1MHHB 2DYPB 4BSWB 1S8DB 1OTTD 1D5MA 4BFIB 1CLOL 2SEBA 4MVBD 3ALWA 5IK3B 4YHML 2EH8H 4JQVA 4M8VA 2Y5TB 3MLYL 3NOIA 4ZS7H 3U7WL 3H9SB 1VEPA 4EJ1C 3S3PA 3B5TA 3GRWH 4MXQD 4BELD 4YH6A 4FQLL 1Q9LB 3PXJA 2OXGA 3DVNA 3H7BA 1HHKB 4L3CA 4OGYH 4FQQA 1HEZB 5FO8A 4NQEE 1GGUA 1MWAB 2ICCA 1R3HB 1N6UA 4WHCA 3AM8C 1RVFL 5EBWA 3HC0B 4QTHA 4UV4L 2FDBP 3QXAA 4Z78B 4DGVL 4GUPA 1B2WH 2E27L 2V5TA 4I1NB 5I1CL 1F45A 5I18L 3ETBF 1NGWA 4GG6B 3QULB 5JA8B 4PJDF 3UTOA 5T1LD 1MI5E 1A6ZA 1RZ8B 4JKLA 3IU3A 4HH9B 2HMID 1TZHB 1DQJB 1SVZA 1YQVH 3MJ8B 4DUXA 1GCFA 3MUGA 3GSUA 5IP4A 4GG8B 4CAGA 4DVRH 4KV5E 4LNRA 2GTZA 1A14L 3QPXH 4KRLB 4JFHD 4Z95L 2ENYA 3FN9A 2DQFB 2P5EB 1MCDA 4MB4A 5D70L 3ZKQD 3K7UA 1MI5A 4RNRA 4MHHG 4GRMB 4MA1C 4N8VA 5H37H 3RJDA 1IM3B 2H8PB 4BYHA 3A6CL 3NBNA 5I66B 4NJ9L 1EPFA 2I24N 2ITCB 3HN3A 3S37H 1NGZA 5L6YH 3MC0A 1N8ZA 4YZFE 3U2SA 5JPNB 1ZGLP 4XNYL 3S8WA 4GSDH 3BPOC 5LGHH 4C56E 5DJYB 5DFTA 5LKNA 1MCKA 1Z0NA 4NC1E 2WWKO 3CX5J 2N56A 2CO6B 1B90A 5DJZA 3Q6GL 1PG7H 1BEYL 4Y5XC 2VLJD 2XWTB 4I0PB 3FN0H 3FFCB 1YEFL 1H0DA 1MRDL 3KPRA 2PN5A 2GI7A 1DEEA 3MODH 5B39G 4UIMB 5IJVB 3TBSB 1ZLVK 3HNSL 5FUZH 4AEFA 3AU1A 4MAUL 4I77H 5D7IA 5HHXH 5EO9B 3Q6FB 1CDCA 5ICXA 1T6WA 2I9LB 4OZGE 4Y5YC 4AL8H 1I1AD 3O3AA 4JLRB 4PR5A 2P5WB 2PXYA 4TVPD 1TQBC 4JJ5A 4J12A 4U6XB 4KKCD 5J6HB 2IC2A 1XF1A 3PABA 1IQWH 4NNPH 4PJXA 2QQQA 2CJUH 3NIDF 4HG4K 1I1AA 3MR9B 2CKBL 4O58L 3WFHB 2ARJB 4NWUL 4LLDA 5IB5A 1LEIB 4OIBA 3MRGB 4LASH 5FOJA 3HC4L 2F19H 3BP6B 3V4VH 2IALB 2ZKHL 4JR9L 3HAEB 4M7ZB 1NBVL 3QUKA 5E2WL 3CFBB 3MBXH 1QFPA 1H15A 4S1QL 3UZVB 1IAIM 3LH2L 5DVNA 2IGFH 4R8WH 1QRNB 5GS0H 4ZOAA 4NZTH 4KJPC 5HHPB 3OZ9L 4WVRA 2ENSA 3U7AA 4OCWH 3EDFA 1DZBA 1JL8A 1BREA 4LVHB 1OAKL 2FCBA 3O3EA 4QCIA 2VJXA 4PJXF 1L9NA 4OJFL 2GAZA 3Q0HA 1EMTL 4D0DA 2X70B 4NKQB 3TBWB 1MI5D 1TXKA 2F53A 1ETZA 2YK1L 3RQ3A 3PDGA 5EORL 3S35H 3B9DA 5A2JH 2ORBH 4G8IB 1A2YA 1EH9A 2ATPB 5FF6B 4NNYA 1RV6X 1RZJL 4HV8B 4LARL 1JP5A 4JPIB 1SEQH 1E6JL 5DEGB 1AGEA 5KSUA 1DVFB 3O6KH 4TQEL 1ZT1B 3PG2A 5KSVA 5A40E 2OSLB 2AABH 3AC0A 3AS1A 4YHMH 1UH4A 4JFEB 5DC4B 3BP4B 3FQUB 4PB9L 2N1KA 4C56D 2M1KA 3VFUB 1G7HB 2JIXB 4UT6L 3JZ7A 1CTNA 3X3FH 1FAKT 3UTSE 1P1ZA 3F6LA 5HHNB 3P9LA 1UWGH 2XZAL 3O4LE 5DR5H 4GLRH 3AB0B 3ZYIA 1ND0A 4PJHE 5DMGD 4NJ9H 1PYWA 1CI5A 2CIIA 5GGTH 1JWMA 2QSVA 3VFGL 5H2BA 5D7KE 5GJTH 3UXFA 4XNYH 4HZLB 2FEEL 1C12B 5L8KB 4XX1G 4R0LA 4TTDC 3P9MB 5HI5C 3PGDB 4U3XA 4E42A 4DW2H 2E9IA 5EUOA 2VZTA 3OAZK 5BS0A 1ORQA 4LVNC 1PEWA 2E27H 3FTGB 3S37X 2NX5D 3CC5B 5CZVL 5I6XB 3PWVB 4XNQB 4Y5VB 1NCTA 3MQIA 4M43H 3IFLH 4X0KA 3SO3B 5HJ3A 1MCIA 5M95B 5MHSE 5JXEC 4DZ8B 4PJ5E 3SKJL 1IC7L 4OZIE 3IVKA 4UIKH 2QQNL 2RFXA 5D1ZC 1KELL 1KCVL 1JHTA 1IT9H 1NUFA 1E4KA 4XI5C 4EN3D 3CX2A 1BFOA 5T3XD 2W0KA 1WJ3A 1NCCL 3IAGC 1GHFH 1QFUH 4DGVH 4UV4H 2ERJC 2W60A 2XY1A 4X6FB 3V6ZA 3IDYC 4HWNA 3SKNA 2VZ3A 1T1WB 4OFKA 4ONHA 2EXYC 1A3RH 4EI6B 2ZSVB 1ZT7B 3Q1SL 5ANME 2ZSWB 3ROOA 4XMPL 5A1AA 4L1DA 4N5ED 1IGFL 3CVIL 1QYGL 4Y2DD 2Z8WC 4PJBB 2O61B 4LIQL 3WUWG 3FAXA 4TUJA 5FOBA 1I3UA 3L1OH 4Z77B 2Z92A 3NCYS 4QRUB 2FECL 5FO7B 3H7LA 1GC1C 4YR6B 1BMGA 5C0BD 5LQBL 1S7QA 4U4BA 3UTSD 4XWOD 5DDHA 4ZO6A 4BKLB 1UWEH 1QG3A 1V3KA 4LIQE 4DN3L 3GKZA 2EH7H 3RKPA 3B9KA 3FO9B 5GRJH 2GFBB 5TDNA 4BJLA 4DK6A 1F3DJ 2BDNH 3QCUL 4F57L 2MKWA 5D2LA 4JVPA 4Y4HB 5AD0A 4Y1AD 3DBXB 1HHGB 1WAAA 4NUGL 1DLFH 2MPAH 4Y4KA 5KG9B 4OCXH 3O8XB 3V5KB 3MBED 5DGRA 1QQDA 3ZDZF 3ARBA 3HCVB 4LSVH 3WNOA 1J87A 4NSKA 5SWZA 4K3HA 5C70A 2BNRA 3G5ZB 3LHPL 3KLSA 3WDHA 3ARRA 3C09C 4FFYL 5CHNB 5BZWA 3RVVD 3TO2A 2VKWA 2F5AL 5HHXL 5AWNL 3SDDC 5BRZB 5E24E 4TSBH 3OZ9H 3OQ3B 4M6ML 4XAWL 4AY0A 2DQUH 5LXGL 1DFBH 4I9WD 4OGXH 4P2QA 4H8WC 5EC1A 2NY3C 2DLTA 1MCPL 4G8GA 4Y5YB 2HTKC 1QKZH 1W0WA 3RIAF 5HGBB 3H0TA 4HGMA 2X9WA 1CGSL 1HI6B 4PRPB 3BZEB 3RP1A 2V7HA 2BMKB 5IQ9B 5J1SC 5CEZE 5FUCC 4DN4L 3UP1A 2JB5H 3U7WH 3C5ZC 4MNQB 3GHEL 5IKCA 3OL2A 2AJVH 3KYKL 2W9EL 2A0LD 4NQEB 2XT1B 3PQYB 3ZKMC 2HT2D 3MRFB 4RDQG 2YD8A 3LEXA 1NCDH 3NZHH 3I02A 1S7WA 1G0XA 3C08L 4XVUD 1OM3H 1JPGA 2BZDA 2F15A 2J8UA 4TVPH 4WEBH 3BN9D 4X9BA 2AEQH 1KYOJ 5D5MF 5E1AA 3V52H 1BOYA 5GGSB 1A6TA 5DEFA 1IILE 4G42A 3T0XA 3EOAA 4KMQA 1FH5L 5D7LE 3RWHA 2VWEE 3WS6C 2VR5A 2ZWLT 4K8RL 4PJ9D 3QUZB 1OAYL 3C6LB 4LBEA 3P4MA 3I75B 3PE9A 4UBDC 2FHCA 1P9MA 2XN9B 1J0KA 1OT2A 4MHHI 3ARDA 1J10A 1NFDB 4LHUB 5I0ZA 4UUJB 4CU8A 4ONOA 2AJUH 2UY7A 3S96B 2NW2B 4OFIA 4P4RB 5IEHB 3R0MA 4RISH 4L4VD 4M48L 2DMBA 1MHHA 2DYPA 2R23A 3VXUD 4G80B 1FH5H 3N9GL 3PNWA 1FYHB 3MRQB 1LO3L 3BWUC 4MX7A 5C6TH 3G6AB 3SE9L 5EO0B 1NSNH 2AERT 1AO7B 5ERWA 2NY2B 4JDVB 3SY0B 3C2AH 3N06B 5L9DL 2P8LB 1F00I 4J3VA 3W11C 5CBEB 1MJ8H 3T0WA 4TOYH 1WBZA 4LLWB 5FFLA 1Q1JL 1SEBA 1YYLL 3ULVC 5DMGC 1R0AL 2EICA 1O7VA 3INUH 5C1MB 4OLXH 5F7YC 1HEZA 1T66C 4F9PC 4IRJD 2MHAB 4LDLB 5BW7A 4RWHA 1XFPA 2L7UA 4TN9A 3H2WA 4ORGA 3D39B 2D4DA 1FLTX 4MMXC 4QTHB 4HUKB 4UZGA 1I9EA 1OAXH 1K2DB 2DQHL 5T1LA 2A9NH 2LVCA 3Q1SH 5F1SA 5FHBL 3GMNA 1QEWB 5DTFB 4FQCH 1S9YA 1ZVSB 4GKNB 1JZ7A 4O5LL 5E2VL 5HXMA 5CIPH 2I9TB 3ULUE 1EJ6A 2DQEH 4GBXC 4WI2A 4JRYE 5HGHA 3CMOH 2YD1A 3VXMA 1P7QD 1XGQB 1TVBA 2CR3A 3HI6L 5HYQA 1AD0B 2IBZX 3HZMB 3MV8D 4N0CD 4L3ED 5F96H 2HTKD 3BP5A 3STLB 4HJGA 2YA2A 1TZHA 1Q0YL 2OS7A 3BSZH 1H3TA 4UU9B 2ED9A 4Z76B 3MJ8A 1CDBA 2X4PB 4XP4L 3EO9L 3AROA 2V5RA 1T7YA 5EU4A 1A1MB 2IANB 5I8CA 4G6KL 3H42L 1OGAA 1VGKA 3SDDB 4JRYB 3UC0H 4S1QH 4HIHB 3SDXB 1A3RL 1EXUA 2AJ3A 1KEGH 3MSPA 2C1PB 5CJQL 2WQ8A 1LP9F 3KNBB 4NRXB 3A67H 1RIVL 5I17B 5FCUH 2QSCL 5JTWA 4WI9A 3ET9F 4G9FA 2O5YH 3M45A 4K7PY 4V1DE 1WWBX 1IZJA 4V2BA 1WCBA 2V9TA 5KSBF 1LK2A 3BQUA 1UQSB 2QSQA 1PW3A 2O5YL 5DWUL 2CDGA 5I74B 1IKNA 1YNLL 2XZCH 3TVMA 3BXNA 5C0JB 4JKWA 2OR8A 1MWAL 3NA9H 1F8TH 4OKVA 3QQ3A 4KTYA 4XPTL 1D9KA 3UO1L 4XVSH 4GMSH 5D7IB 5HYSA 2ESVE 3WLBA 1KYOK 5IVXA 4JLRA 4PR5B 2Y7QB 25C8L 1U3ZA 2VXUH 4PUBL 4NP4H 3MXVH 5FA3B 1W72L 1J88A 1A6AB 3QQ4B 4HS8L 1WWCA 1IL1A 2HKHL 4NC0B 4NCDA 1T2QH 4D3CH 3MJ9A 2DTMH 4KMTH 2BXYA 1KGCD 3KPRD 4RCAA 1TFHA 2AJZB 4E41E 4FZEL 5IB5B 1LEIA 3AREA 2ITDA 5C09B 1G6RL 3C2SA 2W9EH 3MPCA 4N90D 4QRSA 3D25A 2P49B 3DGGB 1EZVY 3PHSA 1TJHL 4QY8A 2VC2L 1JGVH 3S5LA 4U31A 3P4OB 3C09B 2X89A 3DHMA 5GXBB 3D0LA 3HB3D 3WFCH 8CGTA 5D2NE 3TN0B 1SY6H 5D1ZA 3WIIH 3T65A 5KAQG 5FYLL 2V6HA 4ZAKA 1GZQB 1G9NH 4EXKA 1MAJA 5JOEA 5DJ8B 1EV2E 5EO1B 3T2PA 2DKSA 4CN1A 1SM3H 3I50H 4WFFD 1OAKH 1V3JA 1FNGB 3ABZA 4G8IA 2OJEB 5HY9B 4ZOEA 2ATPA 4XNXL 3VFTA 4NN5B 2BNRD 4LP4A 2EYRB 1LQSR 2GIYA 4X6CE 3CAFA 2AVGA 2KZ1B 4JY6A 2H2SC 4QRPE 1JHKL 1AHWC 1AGEB 4EIZC 4EUPA 2BRRL 4L4JA 1VHPA 5F6HI 4UB0H 3TT1L 4F3FA 2A6IA 4MA8L 4JDTH 5JQHC 1HE7A 3MRMA 3VGEA 5TDPB 3BP4A 3FQUA 3CSYA 4X7FC 1QA9B 3NGBC 1P6AB 3QO1B 1U8KA 1F4XH 3X12B 1G7PA 1DTUA 2DLFL 1ZWIA 4TQEH 5C8JB 3HE6A 4LCCA 2GITB 4KJYB 4QHLB 4I5BB 1AGBA 5C08D 3CSPA 4DKDC 2Z31B 2O5ZH 5DFVD 3KPLB 1KIUA 1BIIB 4QRRA 4QXTA 5HPMA 4Z7NE 4GAJH 3MRLB 3TBVB 4XXDB 2QADC 2ZOKA 4KKNA 4YPJA 3RWCA 2H2SD 5JUEH 3DNKA 3MRDA 3PGDA 2R2HB 4YAQB 4L8CB 4JPVL 4WUKH 1LMKA 4E5XA 5IMMB 1ORQB 3IETA 3FCTA 3FO1A 3NH7H 4TOYL 5HJ3B 1BQLL 1RIHL 4OLWH 4PY8I 3PHQA 3IVKB 1T22B 3ZSTA 3VWJB 1TJIH 4JO4H 4ZUTA 5J9PA 2O5ZL 3RUGE 5MENB 3O4LB 5E99L 5IMOB 1XH3A 1WITA 2ESVA 4UB0L 4D0BA 4RFNB 3NTCL 1NMBH 5TJWK 1F90L 2VAJA 4FFVD 1JGEA 5FDYA 3EYUH 3E8UH 4ALAL 4D9QD 4ZXBC 4OQTL 3SDAA 3DRQA 4P2RA 2BHYA 3GZKA 4LEOB 1EHLL 5L2KE 4K3GA 3GJFB 1RZGA 3DMMC 4X98B 4GJTB 1S7UB 4Q2ZA 3STZA 1Z9OA 3C5ZA 2R15A 2JLLA 3D2UD 4HS3A 2O61A 3RBGA 2VSDA 4JFPA 4CDGC 5DMJB 2A38A 1EGJA 4ZFZB 3W9EB 5DJXA 3WNNA 4C83A 3QEHA 1AE6H 2D9CA 4KPHL 3B5HA 3ZDYF 4U7KA 4YHNA 2QKIA 1ZLUH 2ZUTA 1PZ5A 2OZ4H 1EX0A 2GY5A 3KVQA 1BVLA 3HNVL 4P4KD 4Q9RH 4HIXH 1HQRB 3FOMA 4OLWL 2NY1C 2H32H 5MERA 4PJ8B 2OL3A 4I4WB 4NBYB 1J18A 3MRJB 3QUYB 3GBML 2YWZA 5LGHL 2YC1B 4ZODA 1QBAA 4QTIH 4Y19A 4JRXE 4MA7H 3ILPB 1VFMA 4DJMA 1VERA 2VDRH 4WUUE 4XVJL 3UJIL 1JNJA 2V2XA 4MA7L 3WNLA 1MFEL 1GVIA 2Z93B 5C7XL 3MV11 4RGMB 5KOMC 4E41D 5GZOD 1ZHLA 2YBRA 1JMXA 3BESR 3UBXI 4TTGA 1NCWH 1MFCL 3C87A 3KLHD 3RUGF 2WBWB 1FE8H 5E9DE 5IQ7H 3S35L 1LHZA 3L7FB 3IFOB 3W39B 2GUOB 4LCWE 1JF5A 1W72H 1RZJH 4BA8A 3MXVL 5EUOF 3U0TB 2WQRA 3OKEB 4G8GB 2PXYC 5FYJH 3OKNB 3ZKXC 2NY3B 1FO0H 1CE6A 5D6CB 2W0LA 3BZ4A 3AS2A 3B5GA 4L3EB 5CUSL 4C57C 2HKFH 1J5OL 2VXSL 3VA2C 1FAIH 4GBXD 4XC1L 3W9DA 1RQ5A 3LKQB 3PWJA 2NNAA 2HG5B 2VIRA 3RNKA 1R3KB 1DBKL 4OV5B 1MCPH 2JJTC 1Q1JH 1IAOB 3TCXA 4LAJH 3FT4A 1K8IB 3OXRA 2D31A 1YN7A 3L7EB 3MCG1 1VPOH 5JDJA 3ARFC 2VSCA 2BSED 3MBEB 2XNAA 4G9DA 4H20H 4ODBD 3RWGA 4JFFB 1DQML 4Y4FD 3SDAD 2G5BA 1DE4B 1JPGB 3IGAB 4R8WL 1WBYA 1PGRB 5T33H 2V2WB 3BQUD 3R8QA 3VFNA 4F7MB 2HYMA 1Q94B 5KTEH 3BKYL 4KUCF 1OCWL 3D0VB 5IG7A 5EZOH 4LNVA 3EAKA 4LSQH 4OLUL 5LGKA 1YJDH 3MFGB 4JY5L 1HSAB 4OD1H 3T3PE 4XH2A 5E2JA 1A4JA 1MFBH 1A7NL 4KROB 3BKCL 3V5DB 4LSPL 3QQ9D 2NXYD 2VQ1A 2AJYH 2YWYA 4LPWA 1ZA3B 4L8SA 1KPVA 3ULUD 4OLYH 1H5BC 5T5FH 1JGDB 2ADIA 3KLAA 1FJ1B 2DL2A 2VLJA 4KHXH 4LL9A 1JZ5A 2AABL 3LS5H 4PRIB 2W65B 1G7MB 1ZHKB 1D5MB 4BFIA 3LKNA 4GRWF 3DIFB 2M8XA 3PWUA 1JVKA 4MD0A 3VJ6A 5F9WC 3VRJA 1EJOH 3RWFB 1P7HL 1UWEL 3PNWB 1J0JA 5T1KA 5T1DL 4DKEH 2DWDB 4IS6B 2A73B 5LWYL 3TFKD 2WSKA 3LKPB 2JJTA 1T0NB 3O6MH 4P9HH 5IVXF 1G7LA 5HYJB 1ZTXL 3M8OL 1GAFL 2XG5A 3CLEH 4LLYB 4P48A 3GSWA 3VXSB 1MRFL 5GSVA 1C5DA 2KZWA 5MP6H 2EKSA 1MH5B 4P9ML 3X13B 1I8KA 3MROB 4OCLC 4P23A 2XWJA 3KHOA 5DHVH 4N1HB 4KZEL 2V9RA 3GSQB 4TUOB 4O02L 4S1DC 3VFGH 1QFWI 5FYKE 2R1XA 3GGWB 3HE7C 2NXZB 3EZ8A 2IADB 4KKAC 3RIAK 4YXHL 2IJ0C 2A0LC 1HK6A 1EEYB 2D7PA 2W0FA 4UNTA 3W0WD 4HFWB 4ZTOL 5I2IA 4TULL 1XGRB 1AJ7L 4FQIL 2Y07H 3NAAH 4UT9H 1LD9A 1U3YA 3OJVC 4ZUWA 3EJYC 1RULL 1I9JL 3SGKC 2F53D 3DWTA 4NZUH 3NTCH 3GJFK 2IEPA 4H1LA 2GTZB 4U1MB 3L3HB 4LSVL 3ARSA 4WEBL 5EU4B 3RZWA 4RNRB 3MGTA 1BVZA 1RUQH 3VFOB 4MLIA 3LD8C 3QZWA 5BRZD 3BPCA 2FBJH 3GI8H 5T3ZE 4UBDD 1JGVL 4KMLB 3V0AC 5C0RH 2ICWJ 3ULUL 3JWDH 4X7SL 1ZS8A 5F3BA 1C7SA 3H42H 1G7JA 4Y4FA 1OQXA 1T0MA 1CDJA 4KJQD 2R2CA 4MA3A 5AG8A 2VLRE 1EFXB 3BIAX 1IEAB 3NABL 5FGRA 1INDL 3HMWL 1XCTA 3CFEA 4HK0A 3WJLC 4Y16C 1V7NL 2WBJD 5EFIB 1SYVB 5EU7C 1FDLL 4QNPE 2X4QA 8FABA 3U1SH 3JBG7 1Z5LB 5EU6E 3JTTA 4TVPE 1UACL 4OD2A 4POYA 5F93C 2VYRE 3VFWA 3FB6A 5C9JB 2NYYC 3QQ3B 2VZUA 3GKWH 3MCKB 4GMSL 4U1KB 3P30L 2XOTA 2NY4B 3OB0H 3DTXA 3ULUC 1HINL 3WLBB 1M05A 3D6GA 1DQQB 5CZKA 1PY9A 1U3JA 2XTJE 5GGVH 4PJXB 2XTJC 3ZYZA 1I9JH 2FHBA 3IKCA 2VDNL 3QFJD 3MMEA 3U7YH 1UB5B 1K8DA 3CFCL 4U1IA 1XF4A 3SDCC 1E6OL 1AXTH 4OFYA 4AEIH 4U49A 4WHYH 1V5JA 4Y5XB 3HG1A 4QHMB 4HCRL 4NNPL 2BNUA 1HHJB 4NQCD 1H3GA 1BIHA 4XZUA 3I6LE 4XCCH 4NQVA 3D85D 3ZTNL 4Z7OF 3RWEA 2X10A 4HUVA 3TESA 1FFPB 5T3XL 4DKFL 2EDNA 4JHAH 2Q76B 1DDHB 4AEHH 1VADB 3QI9D 3MODL 1N0XL 2EYTB 4WW2A 5E00B 2ZJSL 5HHQA 1FQ9C 1RZKL 5D1QA 1D5BB 3N1FC 1HWGB 4GAGH 1I8LC 3ISWA 1AKJB 3VXPB 5FYJD 4ZQKB 1SVCP 4R4NC 1KN2H 4NM8L 3TBTB 3CD4A 2J7LA 5DJ8A 3LRGA 1IEBB 4NNYB 1I9RH 4UOJA 2OP4H 3FFCD 5BV7H 2ICWB 3J8F7 4FQCL 2CGRL 4JPIA 1A7OH 3QFJE 3BEWB 4HHAB 5BV7L 3GHEH 4NO5A 4PJEE 2DAVA 4XPFL 2ADFL 4OM0L 3LN4A 5I1GH 2DWEA 5I19H 5FA4A 5L88L 3PV6B 4XWOC 4HGWA 1OAUH 3ZDZE 4P5KB 1R5WB 3LS4L 3CVHB 1S78C 4KRMB 5D7LA 3TJEH 2EDQA 3MRMB 1FCCA 3O11A 3QUYD 4KUCD 1TCMA 5F44A 3IXAB 1B6DA 1QLEH 4LSPH 2DN7A 1I1CA 1U8KB 3P9LB 4BH7A 5A16A 3MRKB 5C8JA 4XT1C 3U30B 3FB8B 1XF2B 3VGHA 3QDJD 4KJYA 3IJHA 3EO1A 1RJZA 1UM4H 3SPVA 3QHZL 3VGGA 4NIKB 3SJVD 1KCUH 4LSRL 4K3JH 1TENA 3KPSA 3ZMRA 5C0GB 4H1LH 1H9VA 3N9GH 5CJ5A 4GQ9H 4GT7A 1BX2A 5KVEH 1CN4A 1JYXA 2V2TB 1MHCB 2CLVB 2Q87A 4XBEL 3ZHDA 1A14H 1L7TH 1XF5A 5E5RB 3V6OC 3K4DA 1GIGH 4WV1C 2XKUA 2E7BA 3LVEA 4X0KB 5D9SA 3QNYA 2X40A 4NYLA 4R97B 3SOBH 4S2SA 2WBJC 4KJWC 4PJ9A 1EEZB 1JHTB 2QEJA 4GOSA 4XNMA 1YPZE 1RU9L 2ED7A 4ZUTB 3MTRA 1C16B 1CZ8H 4XI5D 1H3PL 4GW5A 2L7JA 5D71H 1NL0H 2GT9A 3ES6B 5DR5L 5FCSH 2EDRA 5IWLC 5F88A 1E4XI 2A77L 1IM9B 5DHYB 4NQED 5DD0L 3LCYA 3V4UH 3TO4D 5ICZB 2CDFA 3CPLB 1X5ZA 1ZT7A 4MNQD 5I76B 4LHUG 4Z8FH 1HH6A 1DL7L 1MJ7L 4L4TE 4TNVF 3FB5B 1PG7L 3NIGF 3STZB 2CK2A 3JWOC 1PKQA 4YFLF 5IVXE 1WWAX 3BSZL 1ADQH 4HFUH 4Z77A 5ISZB 5E95B 2XQYG 4WY7H 1IGYB 4UDTA 5TF0A 2YPKA 4HDIA 4ELME 1SEQL 4S1DD 1LO5A 5GS2D 4AEHL 5HVWA 4NZRL 3VWJC 3IDNA 5B3NA 3MLVH 4V2CB 1AQKH 4CNIB 4HEPG 4XAKD 4L5FL 2FL5B 2QKIB 1S9KC 3GMLA 2BRRH 2VXTL 3HFMH 4LHUD 4K7PH 3DV6B 4PGDB 1IBGL 4M6AA 3Q3GA 5J13B 3FOMB 5JLZB 3QUZD 3MJ7A 5F89A 5CIPB 4K94L 1OP3K 1EGJH 4Y19B 1C5BH 4M6OH 2ZKHH 1REIA 1A9EB 3Q5YA 4HD9A 3ARBB 3DVFA 4LCIL 4NQUA 2RQ8A 4U0QB 1U58B 4U2ZA 4NSKB 5SX5K 2Z93A 5DXWA 1KACB 1WZ1H 5DRNB 2H1PH 2BNRB 4ONFL 3T4YA 1B4JL 5J57B 4QYOA 35C8H 3JV4B 3P4NB 5BQ7A 3D9AH 4LVOB 1ZHLB 3I6LD 1KG0B 4ZMAT 3VXNA 5KZCD 3T08A 3FMGL 1NAKL 5JHLL 4FQJH 3FQRA 3Q6GH 2H6PB 3F65A 5KVGL 4PJFA 5DD6A 4K23H 5C0BB 5F1IB 4NUJA 3P0YH 1P4BL 5MEOA 4M7KH 1XF3B 3E3QC 3MREB 3G5YB 3EJJX 5BZDB 2HJKB 1UADC 3HFML 4MNQA 5IKCB 3LIZL 4LHQB 1E6JH 4GKSA 5GISH 5L2KB 1JTOA 3ARTA 4R96A 1FZJA 4NQEA 1LEKA 4TUKH 1HH9A 3RNKB 3IFPB 2OJZH 2J5LB 2EZ0C 1MREL 5HVFB 5H37G 1CDIA 4LKCA 5HHME 1NCBH 5KS9B 2R1WB 2IQAB 3OXRB 4DOHB 1RI8A 2J8UB 2OL3H 4X4ME 2DICA 4MSWB 2E9JA 4PV8B 3CFDB 5EH1A 4XC3H 1IGJB 2F8OA 3MLYH 1E4KC 4MXQC 1II4E 1FNEB 1ZANH 2Y5EA 4KK8C 3RTQA 4F7MA 5C2UB 2F54B 2CQVA 2VL5B 4YBQD 1CT8B 2H26B 4Y1AB 1QRNE 1YEDA 5CINL 5BJTA 4U1NA 2NY7L 3KYOA 3FHAA 2WLYA 3KDMB 5F9DC 2NXZD 3IFNH 1G6RA 4NQDD 5HVHB 3OR7A 3UZEA 5FDWB 3JVGC 1N26A 1X5IA 2YK1H 4YHIB 2ADIB 2VH5H 5EC2A 3MV8A 4X4XA 4DUVA 4I9WE 2ZNXA 1F4XL 4P46D 1W72A 4JO1H 3DIFA 2UZYB 3FT3A 5D2LF 2XWBA 4EI5D 4HLZG 1S5HB 2FSEA 4WCYL 3W82A 4JDVA 2EIZA 4MQXD 5EIIB 3WHE1 5HYJD 3C8KA 5I16B 4NFCA 5C08E 3TBYB 2YPVL 2EDOA 5KJRL 3UROR 2PYFB 1EHLH 5I15H 3SDDD 5J89A 1M6OA 1N6QH 5L8LB 5D72H 1ZGLM 5E8NA 1NANH 2AEPH 2R29L 4PJEA 3DI3B 1BZ9A 4EN3C 1FFOA 1KTLA 4DKEL 1GOHA 4ZYKB 2B39A 3X13A 1FNFA 2ZUUA 4JFZL 2JELH 4FQHB 5FUCE 2NW3B 5BMFH 3RDTC 4HMCA 4PTTA 4GSDL 4OCRH 1WFNA 1XIWA 4W4OC 2EH8L 3BPLB 3RWDB 3UDWC 5KSAB 1X7QB 1RURL 1A6ZB 3DX7A 3B8YA 3JTSA 3TZVA 2W0FB 3LV3B 4PRBB 3FQXA 1U8JB 4K8RC 4YBHA 1RU9H 4HFWA 4J3XA 1CL7I 5E2TH 1T03H 4HJGB 1W0VB 4GG8A 5GGRA 3X11B 4ETQA 2E5EA 4LNRB 2ARWA 1MF2L 2XPGA 5HYJE 4Z76A 3FFDB 5D7IE 1CU4L 4J23A 1GRWA 5H94A 1CVSC 1UM5H 3B2VH 3FQWB 2D7MA 3GSNA 3QYCA 3WS3A 5B39A 1R0AH 2AI0L 4OZ4B 5I66A 4FN0A 4P3WA 4JREC 1WK0A 4NKDA 2XRAH 1KB5A 2KKQA 1HYRC 4XC1H 5E9DA 1OP3H 4YHPA 4NQCA 5BVJA 4PBWD 4PJ9C 2Z8RA 3HHRB 1CFNA 2FATL 4OZGA 3S3SA 4APQB 3MRBB 2ICEB 1QBBA 2LV4A 2BVPB 5ENWA 5L2KD 5KN5B 3LKOB 4NZDA 1S3KH 3BISA 5ALBL 1J1OL 4AENB 3EHBC 5FV1L 5HGAA 1BOGA 4O2CB 1T0MB 3A67L 2PO6B 4A6YA 3BAEL 3RPIB 4QXUH 3BEVB 4GBXA 1GGTA 3PIQB 3O9WD 4ELKA 3O3AB 3ESVF 5ISZE 2BHZA 1DBJL 2COQA 3SCMC 4I2XE 2P7TB 1K3IA 2OR7A 2NZ9C 3I6KB 4QRPD 2H9GB 3TVMD 1JF1A 3DTXB 2EEAA 2OM5A 2PTTB 3HAEG 2CLRB 3VXTB 2EEBA 4U0RB 1G1YA 4X5LA 4F7EA 3T0BA 3R4DA 2IPUK 3HE6C 3B2VL 1MQKH 5BW7C 3EFFB 3CLEL 2VDPH 3FRUB 3AREB 4WI6A 4NBXB 1JI2A 2VO5A 2XA8H 5C6WH 2JB6A 1INQB 4N8VG 1JUFA 4JFHE 5C7XH 1F02I 4XP9H 3MLXL 4E41A 5CSGA 1NBYB 4H5SA 4Y16B 5E94A 1ACYH 3MXWH 3VFMA 5F1KC 1A6PA 4PP1D 4CADA 1HKFA 4QCIB 1NGQH 4RFOL 1I7ZB 2AKRA 3LQMA 3MLSH 1B9ZA 2D0FA 2ZUYA 3TH4T 3VH8G 1WT5A 2ICES 1R5IA 1MCOL 4OAWA 1KJ3L 3RWJB 4KHXL 4YDIH 5AZ2H 3C60A 1R24B 3HMXH 5E6IA 2BSTB 5K9OB 4NKOB 4KKCC 2HRLA 4ZQKA 5I30H 2FIKB 3WUZA 3GNMH 2BOBB 4ODUA 4AMKL 3C2AL 1RPQA 4KPHH 3WIHA 1ES0A 4N1CA 3MACH 4XPGH 4MDJB 3AMLA 5GHWH 2VLME 1XGPA 3U83A 5HHOA 4R90H 3GMMA 3DSFH 4P23D 1LO0H 4HJ0C 1XGUA 2A83B 1T1XB 2BDNL 1OP9A 3QCUH 2Y07L 2VAAB 1FZOA 2KQMA 1UVQB 4X4MA 4M61B 2JIXA 3VFPB 2HTLC 3NFNB 5GIRA 1FNAA 5FUOH 4O2EA 3NVQA 1CLYL 4GRLB 1UJ3B 4ZUVB 2XTJD 4Z7UE 5D5MA 2AQ2A 5EWIL 1RZ7L 5HHNA 3X12A 4U6HA 4R7DB 1FGNH 1EHAA 2DBLL 2I5YL 4RISL 5HBBA 1CLOH 1U8NA 1PYWB 4I0PC 5L88H 3NIFF 2D03H 4RFOH 2RBLA 5EU6D 2R8SL 4M7ZC 5DD1L 2ESVD 4HZLA 3B6SB 1ZHBB 2VLJE 4FFWC 4JZNB 4KGJA 1QHPA 2A1WL 4N1EA 1NLBH 4QXTB 1CVRA 1UXWB 3IU4L 5EBLA 4LCUB 2DLHA 1ED3B 6FABH 3RNQA 3HZVB 1YYLH 1HXMA 1NC4D 2CLVA 2M2DA 1KB5H 4YO0B 1S7TA 1TIUA 4JO2H 4WIQA 4PJGE 4WWKA 5C86A 3X14B 4JO2L 1X4XA 3KYMB 5EOCH 3QDJB 2P45B 4RA0C 5SX4I 3V95A 2AJSL 1KTKE 4LLUB 3U0PB 1NBQA 1QSEB 1OF2B 2AK1H 1XH3B 2ESVB 1E4WH 3CLFH 4MD5A 1AFVL 4OI7A 2VDOH 2W60B 3DRTB 5MEQA 2CKBB 1FG2B 1I7RB 4OLXL 1RUMH 5DSCB 3SKNB 3SOBL 4FFVC 4Z7WA 3DRQB 1C08B 1N7ML 3QDGA 4EI6A 1OGTA 2B0SL 3L3JB 4ISVB 4R7NB 5BRZE 1RZGB 4LSTL 1QUNA 4Q74A 4M4PA 3DECA 3GHBH 1TVHB 1TPXC 3FMGH 2DB8A 5ILTL 5ICYA 2VQTA 3ROLA 3RDTB 4OQTA 4OSUH 4Z7UB 3TV3H 3EJZC 3IF1A 2E6QA 1B2WL 4Z5RB 3WHXB 3VW3H 5FYKU 5JPMB 1F4AA 5DDHB 4P2YA 3DO7B 3RVWC 4ELMA 4RMUA 3HUJA 1T5XB 5D7JA 2AI0H 3BGMA 1DUZB 2HMIC 1RIVH 2DQCL 1DN2A 3HNTH 5F3HB 1FVCA 4XHQA 5HHMB 3LS4H 5CLTA 1S7VA 1A0QL 5E5MA 1I1YB 3U46B 4YDLB 4NC1C 4XPAH 1ZE3C 2NY1B 2W91A 4KKLC 2JE8A 2V5MA 1J8HD 1CGSH 5E8PB 3BH9B 2V2XB 3GJEB 5SWZB 3QUXB 2P8MB 5SV3A 2A6JA 1P6FA 2QL1A 3K2MC 3VWKA 3MYJA 2L0DA 4WUUA 3TA3B 2VABB 3HR6A 2GTWB 5BOPA 2DKMA 3EJYD 3OR6B 3OBAA 2UWEA 4NT6A 1R3JB 3O2DA 2R39A 5LQBH 4HS8H 1YNKL 1Y18A 2PO6C 4LSUH 4PJCB 3TCLB 5BXFB 2YPLA 3LSOA 4P2QB 2EDFA 4ONGL 1KOAA 3VXNB 3MA9H 1IGTA 2LAGB 4V1DB 1IKFH 4NN7C 4FFZL 1RUAH 5GS3A 1QLRA 3U0TA 1ITBB 4PJ7B 1D6EA 5I8KL 3UTSA 1DBBH 5IEKB 3K8LA 1VFAA 1CE6B 3MOAL 3QG7L 3T3MF 3C8DA 2Y06L 1A6UL 3THMH 5AG9A 1S9XB 2L4OA 3MA7A 2NYYD 2CMRH 3NCJL 5GRZA 2GHWB 1FZKA 5E4EC 3PF2A 3MRFA 1T3FB 2Q6WA 5MI0B 5FYLH 1S7WB 1J1PL 3LHPH 4L4TB 3DSFL 3O8XC 1J0YA 4L4VE 4YHKL 3LQZB 3T2QA 4XRCB 4OZHF 2IAND 1K5NB 1RVFH 1S9VB 4N0UE 4JDZA 3QG6B 4CDHA 1Q94A 43CAA 3EOYG 1QLFA 1N59A 3OKKB 4JG0H 5EU3B 2VLKD 4TUKL 4R6UA 3V7MA 1U3HD 1CT8A 4JM2F 4NZRH 4MS8C 5GSRB 3DURA 3R06A 4K9EH 5KW9L 3HRZA 4BQ6A 4UUJA 4RQQA 3MRCB 4NZJA 4DVBA 5CZXD 3GK8L 1OPGL 1T4KA 3F58H 3RVUD 4XPFH 5BS0D 5I8EA 2ZG2A 1BQUA 1KIPA 3G08B 1G1CA 1MRCL 3MJ9L 5FB8A 4R26H 5LGJB 3TPKA 4JPVH 4PJHB 1XIWD 5CBAA 4G6ML 1MF2H 4G3YH 2OP4L 3A0OA 3RL1A 3BUYB 4JJHA 4Z95H 4QXGL 1AO7A 4UT7L 1KELH 3PHOB 1U8LA 4JQIH 2E8YA 2M26A 4U3HA 3SY0A 1MFDH 1KPUB 1X6NA 5C0AD 2BNRE 2CLZB 2P8LA 1A1OB 4OM0H 1FNSH 4EBQH 2ZUSA 1XR8A 1LGVA 2I5YH 5CBEA 4OCYH 4JM4H 1J1PH 4X80L 1MWAA 3DV4B 5CEXA 1M4KA 1R3HA 2DOCA 4TNVK 3B2UD 4UOW1 1F6AA 2FATH 2NY2D 4Y1AE 1FL6A 1JK8A 2ADJA 3F12A 4C56A 2YD3A 3MFFA 4KGLA 1IAKA 2B1HH 4ORGB 1NLBL 2R2BB 2ILLA 3VXUB 4L9DA 4CUCA 4OIAA 2VKXA 1BZ9B 4WI3A 3I3DA 3OG6B 3WXWH 1HDMA 1CICA 3IDGB 1ZA6B 3DI2B 4IOFC 5D72L 2H1PL 2FWOA 5JXED 3KYAA 5DUPH 3ARFB 2PTVA 3QR2A 1T7XA 3O3BB 5CP7A 2FR4B 2XKNA 2EE2A 5KANI 1LNUA 2HKFL 3DETD 4X9FA 1YN6B 4HJJH 4NHCH 1G9NC 5GGTA 3V6FA 4NO3B 4ODSH 4LPVA 5SV4A 5HYQB 4DW2L 1NGYA 4ZAKD 3S36H 1IC1A 4ZPVB 4X5XA 3AVEA 3EIFA 4G6AC 3UX9B 4B50A 1DUYB 5LBSH 1VPOL 1QOKA 2D7OA 1MI5B 4B7IA 4OLZH 3GMQB 3V4PL 3PGFH 1PKOA 3FFDA 1JGUH 3RU8L 4JM2D 2VUOA 3F62A 2ID5A 4KDWA 1BGXL 2VLLB 1EXUB 4WHYG 2F58L 3E1F1 5EOCJ 5C3TA 4HKZB 1NDMB 1IE5A 3H9SD 5FGSA 2DM4A 4O2FB 3L3DB 1T2JA 4JB9L 4TVSa 1MCWM 1QRND 4NOFA 1KBGH 4L9LC 5IB2B 3AY4A 2HFGL 4ZFFB 5C0EA 4M4RA 4APQA 1IC5L 2FRGP 1PVHA 4HWZB 4D8PB 3OKMB 1VACA 5JO5A 5FUZL 1ZLUK 2VE6A 1U42A 1I3GL 1YMME 2X4SA 7CGTA 4F7TB 1XGTA 5IHBA 4TTDD 5HI5D 3IRPX 1XCTB 4HK0B 1YPZA 1Z0MA 5EFIA 2H3NA 4U6XA 1QBML 1JZ3A 3FB6B 3AGVA 2ED8A 4NZUL 4QF1B 2VRAA 3MCKA 1D6VL 4JREB 2QADB 5FA3A 4HWEH 3ZT5A 1MNUL 2HP4A 2ZUVA 4LLMA 3B3IB 1BQSA 1S5IH 3HI5H 2F5AH 1FL3A 5C09E 2PTTA 4FRWA 1CK0L 3BE1H 3T77A 4M7LH 4HLJA 5KVFL 2ITDB 5C09A 5J8OA 3MRPB 4WDIA 1UENA 4UI2A 4AIXA 3N50A 4QY8B 3U7YL 4M9PA 5JNYA 2JB6B 4ZUSA 3BVNB 1KXQE 4P3CL 5TGBA 4PIRF 4JVUA 2H2PD 3D0LB 5FO9B 2A2QT 5I1AA 3QIWB 3CSGA 2AV1A 3MV7A 3MRHB 2CXGA 4ODXA 3NCFB 4AT6B 3O45A 4IBLT 5F1OB 1PBYA 4Q6IA 1L7IH 5FF6A 1T20A 1J05B 5DK2B 4UTBL 1I7UA 4NQSA 4YK4B 1P9MC 3U4BL 4NPYB 3UMTA 2FJFA 1MY7A 4GKOA 5DQJA 2XFXA 1NAMB 2DTML 3BIBX 3O6KL 2CUIA 4KMTL 4HIEB 5KSUB 4XCNA 3QJFB 1ES0B 1KN2L 4NKMA 4PP2A 2SEBB 1ZEAH 5JIKA 4ODVL 1KTDB 5KBNC 2C3VB 1AGDA 4ZXBA 5ISZD 1A6WL 1Z3GL 4O4YL 1I9RL 5F7DA 3GSRB 2OTWA 1ODAA 5CLWA 4U6VH 3V8CA 1I4FA 1F3DH 4MNHB 1CE1H 2UYLB 4YQXL 5AYUH 1EMTH 5CGMA 3QJHB 3HZYB 2APXA 3L3IA 4P2RD 5DVMA 4EI5A 1D5XA 3O6FA 5K9JL 1J0ZA 4JE4B 5DRWA 1OAQL 1E27A 3DPBA 4HZAA 3H9HB 1WTGT 3MGOA 4NJAL 4I2XB 1RJZB 1GYAA 1V8HA 5C07B 4RZCB 3ULVL 4CU6A 5KSBB 3I84A 4OD1L 1UYWL 3CIQA 4X8JA 3KPSB 3SN6N 4ZNEE 1ZHBA 4CVUA 4WI4A 4XNXH 3ZE0E 1BF2A 1E28A 5EWIH 3AUVA 1JRHI 1Q38A 2NMSA 2HRPL 5GRUL 5IIEA 2CIKB 1JZ2A 2V5SA 3FO0L 4MJIE 4K3JL 3OPZH 4X99B 3QNYB 1CDGA 1ZLSH 1S7TB 3QIUC 3ARVA 4M93C 3VCLA 1DSFL 5EU6A 5FKPB 5C08B 3X14A 6CGTA 4EQ2A 5MEPA 4G8FA 1U95B 5HGGS 1CFVL 5CCKH 1IMHC 4D9RD 4OT1L 4EZMA 2YZ1A 1A4KA 5CKAA 5F9AC 1X5AA 2ZSVA 1DVFD 4Y19E 5C0DB 1T0PB 4OZHE 4X98A 5ESVB 4C55A 1L4IA 2R29H 2CDFB 3U2SB 5JPNA 5D6DC 4LVEA 1ZANL 1FRGH 4R7NA 2OI9C 4ZOBA 4YDJB 2WWMD 4PLOB 4JB9H 3FB5A 3HB3C 4XPBL 3RL2B 2JELL 4POZC 4E0RA 4LLQB 1S7QB 3PL6D 4PBVC 4ODWB 5D1XB 2G75B 3BRGC 2NY4D 3INUL 4PB0H 4JY4B 1U8MB 3IF1B 3JUZA 2YPKB 4I48B 4KROC 3HPLA 2HAZA 3WHXA 1KJ2A 4HUXA 4X6BA 4L3EE 4UIMA 3HRPA 4UILL 2XZQL 5IJVA 2ADFH 3HUJB 4MD4B 2GJJA 4HF5L 1WLHA 2AXGB 4ZD3H 3LKSB 2AS5M 5IVOA 5C0IB 3GMLB 5DURD 3HNTL 4X7TA 2OL3B 4I4WA 4Y4HA 5AD0B 3DBXA 4R3SA 3MRJA 4PRAA 4UDUA 1H3PH 1WFUA 4FXKA 2CK0L 5A2KH 4Y4KB 2GK0A 1JPFA 3KLDA 5C0CE 3QIBD 4O02H 1PQZB 1K85A 2GJZA 5E5MB 4WRLA 2P44B 1A9EA 1RHHB 3DUSB 3G9VA 5E8PA 2GJ6D 5C09D 1EHXA 4M7LL 2A74B 3QNXB 1EAPA 2BC4B 3CFBA 4RGNE 4XVSL 2ZCHH 3LEVL 1PFCA 5DA4A 4PS4H 4X83A 1NDGA 2XQBH 5I1LB 2GTWA 1MJJA 3I85A 4N0FB 1MIMH 4NT6B 1G7IA 5ITFB 1T7WA 3V6OE 5JW4N 3IDJB 1GGBH 2VDQL 4D0CA 1RJLA 3OKEA 1RK1A 4P23C 1R5VA 1OP5H 3BZEA 2I27N 3TJHD 1V3LA 1R3LB 1N2RA 2IQ9H 3TBWA 4KU1A 5MEOB 4PJIE 4P5TA 1ETZB 1CFQB 3E0GA 2DQTH 4ZS7L 4PJ7A 1Y6NR 2Z35B 4MJIA 4WFHD 5GGVL 4CBPA 1UM6H 1VFAB 3G5YA 3L6FB 1YY9D 1M7DB 2HVKA 3RI5F 1FFNB 3DXAE 5D7SH 5SWSA 3SCMD 1T66D 3P0YL 1RUAL 4M02A 3EHBD 5FK9B 5L2KA 2X9XA 2ZJSH 1MHEB 4MDIA 4U05A 3U82B 1GJIA 3WL9A 1YN7B 3L7EA 4HAFA 4R9HA 1TJGH 4J6RL 3IYLW 2APVA 1ZHNB 3OKOA 3QCTH 5JHDE 1BFVH 4O9HL 1HYSC 5AAMA 1KXVC 4L4TA 4JFEA 3ZTNH 2VOTA 3PQYE 4MSWA 4NP4L 5ANMB 1C5CH 25C8H 3OAUH 3PUCA 4FMFA 1CL7H 1MEXH 1N64L 1KLUB 1LK3L 3JUYA 1CFBA 2BK8A 4JO3H 4FQXA 4KVCL 3D18A 3L5HA 2XN9A 4HWBH 2H2PC 3CJJA 1ND0B 1Q9WB 3FQNB 4PRHB 2XKSA 2CIIB 1CFSA 4ZFGL 4DFHA 5H2BB 1PLGH 1X4YA 2O5XH 2WIIA 2F8XC 2FX7H 1IBGH 4U1JB 5GZND 3V0WL 2CDEA 5C0AB 1U6AH 1U2CA 4K3DH 4MX7B 4E42B 1DBKH 1Z2KA 4C54A 5EO0A 3D48R 3VRJB 3B2UC 1U6AL 1P2CA 1LEGB 4PJHA 5ERWB 4PFEA 3PWVA 4S10A 5CJXC 5T5NF 2DWDA 4K8RD 3RL1B 4LOUC 1T1ZA 1N5AB 5I75B 3QUML 1SJXA 5I16A 1A3QA 5INDA 1D3CA 1AHWA 1CLZL 4NHUA 5H8DA 1XT5A 5LCVL 3TJEL 1BFVL 4JFFD 5E5UB 1F6LL 3ZKNC 3NFPB 3GSWB 4HH8A 4PTUA 3VXSA 1MIEL 4XVTH 3U4AA 3CDYA 1F6AB 5L0QB 3OGCA 1RJYA 4UT7H 3EOBA 2IAMB 3MUJA 6FABL 1AO7D 3BJ91 3SDXE 1N3NB 3O3UN 2R2BA 2B20A 5D5ME 4FNLH 3BPNC 2A9ML 2B8OT 4OD3H 5DTFA 2NW3A 3REWA 2H45A 1ZA6A 3IDGA 5DO2C 1L9MA 3VI4F 5ETUB 3ARDC 3EBAA 5FOBB 3C9NB 2R56H 2XKNB 3HZMA 4GAJL 4AQ1B 2NY5C 1MIEH 3LV3A 4PRBA 2XN9D 1G9MH 1SJHB 4PY8J 4I18A 1NGYB 1UGNA 4LVNB 4JG1H 3HI1A 2X2YA 2AGJL 3X11A 4ETQB 5CCKL 2XICA 2F9BT 3UO1H 1TMCB 4U3CA 4HMDA 4U2YA 4U6TA 1CG9B 3DOSA 5TDNB 4X9GA 2QV2A 3WIFA 5EZJB 4U1HB 3HG1D 2MQ0A 4V1DD 1C5BL 2B4CH 4EQ3A 1KB5B 5E9DB 1VEMA 5BVJB 1BBDL 4PJHF 3M1BB 3PGCB 4D2NA 2QQNH 1BZ7B 2BFVH 3WDIA 4KI1A 5L7XL 3TF7C 4XVTL 4CU7A 1NMAH 3VW3L 4AH2B 3MRNB 5CMAB 4HEME 5L7XH 4I13B 1CGWA 3BZDA 4YXHH 5CWSB 4PJ8D 1LDPL 3GIVA 4L9LB 5ILTH 3ARGD 4HWZA 3C5SA 5BZWB 3I3EA 3SGDI 4U33A 3CGTA 1WAAE 3BW9A 4HS6B 5BRZA 3I50L 4PJDE 4K3EL 1IQWL 4X9HA 4EI5C 5IR1B 4GBXB 1MCSA 4ELKB 5MHSD 5DFWH 3WIIL 2F19L 3EOTH 2YUXA 1KIRA 4DWHA 3LY6A 3B9VA 1RMFH 1KEGL 1QNZH 4QF1A 2DJUA 4LCYA 3V4UL 4TPRH 3WV0A 5IB1B 4WV1B 4X6DF 3D85B 2NZIA 5E8EB 3RAJH 3BDBA 1YEIH 2BNUB 43C9B 5B38B 1CZ8L 2JJSC 1NBZA 3IJSB 3LEYH 3MNZA 4PJBE 1YDPB 3OSKA 2GY7B 1B88A 5JMOC 1HQ4A 1MQKL 5DVLA 2Z91B 1I1RA 3KWWB 1AGFA 1U0QA 1DDHA 4I3RH 2VTFA 4Y4HD 4CW1A 3QEUB 4FFWD 3HMWH 2VDQH 3C60C 2ZCLL 1DBAH 3F7VA 1PKQE 5D1QB 3HE7A 2XIDA 3CU7A 3KG5A 4Z8FL 1AR2A 3PP4H 1IAII 1F4YL 1I85C 4F37K 1P7QA 1R5IB 4KRPB 3LD8B 4ODXB 5LAXA 1DBJH 5DA0B 2GSIA 4AZ8A 5A3IC 1V3MA 3TH3T 5FHAL 5HY9A 4KRNA 4EVNB 1ZT4A 5F97E 4APQC 1BVKB 5DK2A 3TYGL 3O3DA 4YHKH 5JR1H 5T1KD 2NY4C 3I9GH 3V4PH 1WZ1L 2FJFB 4P46A 1ONQB 4F9PA 4YDVB 5EOQH 3H9YA 2WMPA 4HHAA 3TT3L 3QRFM 3FT2B 1VGEH 1NCCH 3OV6A 1JPSH 4OKDA 5C0FB 4OQ1A 3HKFA 1HYSD 5ABDE 5TE4H 5JZ7C 3PV6A 2VAAA 4PJAE 3TYFA 2ATKB 4JZJB 1MFNA 5IBUG 3NFNA 4YHZH 1P84K 1FORH 3QWRA 1PX4A 4RAVA 3S4SG 1G9NL 5GGQL 4HPOH 3MLSL 2C3WA 3EYVA 3RKDC 5GQBA 1NEZA 1OAQH 3GFUA 1T2XA 4IMKA 2X4RA 2VB5A 4HUUA 4RGOH 3N1PC 5K9QG 4R4BA 4L4VA 3RVWD 5DYOB 2BJMH 4GUPB 2ZOKB 1IQDB 3O6FD 2ZCKL 3VFRB 5DQ9A 3WJLA 1BLNA 3BWAB 4H26B 1MCFA 2NX5B 4RAHA 1QTYT 1MREH 1FN4B 3CXDL 2FH6A 1YEHH 4XNZB 4ZFOA 3GSOB 3GMNB 2NR6D 4W81A 1S9YB 4GKNA 1NMCC 3ZL4L 4YO0A 2Y36H 5DD5L 4OF8A 3IU3B 4HH9A 2R56L 1AXSB 3BKCH 5BVPL 1QRKA 1T04B 3DUUB 3P73B 4YNYA 3QDJA 5DC9B 2NX5E 4QRQB 3I6GB 3MO1B 3ZZ1A 2MCPH 3G5VB 5C08A 3SGEH 1JGEB 3FJTA 5FM8A 2HVJB 5BMFL 1YECH 2A6DB 5ITBH 4MD5B 1N6QL 2F8VA 4HIXL 3FO0H 1XCQB 2PYEB 1A7QH 4PG9A 5IB3B 3N1GC 3MOBL 1UH3A 2GK2A 2MOVA 2VZ1A 4QLRA 1MVFA 5I1EL 1D9KC 5KVFH 3TIEB 5JOFA 1MAMH 5T3XE 5IW1A 3EFDH 1QO3A 2FBOJ 1DQLH 5HVGB 5C0DA 4BZYA 5I76A 2GJ6A 1HHHB 1KNOB 5DMKA 4JFOA 3SGJC 4AIZB 4RX4A 4CGTA 4XP5H 5GRVL 4IRSA 5ICYB 1I9IL 4P57A 3RDTA 2Y25A 4YDJA 4I0PA 1I8IB 1A64A 3FFCA 3WFEL 5CINH 4P9HL 2VLMD 1JYVA 3U1SL 3WUWB 4AIOA 4GRLC 1G84A 4HUWA 3F7PC 3BXNB 2E7MA 4HJJL 3DO7A 4PB9H 5HI3C 5CJBA 2X1WL 3G6JA 3M17A 2RCSH 4POUB 4LP5A 2IH3A 4C59B 1HQRA 5ALCL 1N4XH 4WNQB 4LKXB 4BUHA 5ESAB 2X4TB 1JBJA 1WEJL 1GXEA 3PJSA 3LKSA 4M1CC 4X7TB 2P24B 4QRTB 3B83A 3WN5A 1CYGA 3PL6A 3V52L 3LZFL 1JPFB 3U0WL 2K1MA 5CJ8A 4TPRL 5TFSL 4P9HC 3IXTB 5CEYB 3SKOA 3D87B 4Y19D 3LQAC 1H3WM 2EKJA 3WSQH 2RGSA 1KV3A 4P2OD 4O51A 3U4EB 3B9KC 2LFGA 3T4YB 1UB6A 4WUUB 4JANB 5IUSA 1Q0XH 4GW4B 3TNNB 2BC4A 5BQ7B 3IKKA 3MLRL 3H9SE 1RZIA 3UTZB 4K3EH 1CGYA 1I3RA 1R3IH 4D3CL 2BSSA 2DJ4A 1DQMH 1I9IH 2BVYA 1A8JH 1G7IB 1JHLL 3M07A 4PJBF 5BS0E 5I1HH 2GQHA 2X70A 4RWYL 2VXQH 2C1OA 3O4OC 3BT2L 3EYQC 1RK1B 5EZIL 4XTRC 2D9QB 3VXQB 4GLRI 4R2GD 5ADOL 4LRIA 2WUCH 3W9DB 1ORSB 3ECBA 4JFYB 3VFVA 3UPRA 3ZE2E 3S36L 3PWPA 4Z0BH 1ZSDA 2OJEA 4R96B 4HIIA 1JNHB 1XR9B 2YSSB 4DGIL 1FFNA 3OAZH 4RGNB 4GG6E 5KSVB 1S9WA 4PY7B 5KANG 2Y06H 5TF1L 2BVQA 5ID1A 4NRYA 3CH1B 3BT2H 2F54E 4XRCA 3TM6A 5IQ7L 2E6JA 3MV9D 2AV7A 1AGCB 5TDPA 4U7SA 3CSYB 1EHNA 4Z7WF 4HC1L 4W6WB 2V17H 4ZPTB 4M1GH 3MZGB 1O0VA 1HSBA 3OJ2C 2E9WA 3WD5H 4S0TD 3TYGH 2XV6B 5HTSA 3K8MA 2JIXD 4LF3B 1CTOA 5K9QI 5EBMB 1JGDA 1JN6A 5I1HL 4PRIA 3U9UB 2B1AL 1GC1H 2EXWC 5GJSL 5CILL 1KIPB 3MRLA 5EUOB 3TBVA 3T2NH 3MV8B 2HTLD 1YEJL 2B1AH 4QXWA 1AP2B 5C0AA 1MOEA 2DBLH 4XNQA 1X5JA 4Y5VA 4Q0XH 5DJCB 5LWYH 3NCEB 1T1YA 4AJ0A 3V0VA 1OW0C 1BBJB 2ERJB 1YMHB 3QXWA 4ZO8A 1W2KT 3BFOA 4PRIE 2R4RH 4TSBL 1CLCA 3OJDA 1N4XL 1J8KA 4F33B 2WW8A 5J9PB 5IT2L 1NFKA 3QIUA 3D39D 3IDMA 3QXDB 1S7RB 5D1QD 3KYNA 3O81A 4FTVD 4F8QA 5JW5A 4F7PB 4MCZB 1U36A 3DGCR 4WTZA 3RZCA 4HUMB 3SDAB 3ORJA 3BD3A 1EUTA 3EOBB 2VN7A 2R1XB 1YQ2A 4ZUUB 3FRPA 2YD4A 3C8HA 3LDBC 1N3NA 3VXSE 3QXTA 4Q2ZB 3TPUB 2FWOB 4QT5A 5I1CH 3QHZH 4IRJC 3O3BA 2FR4A 4FQ2L 4YBQC 3BP7B 4WFHE 1C8PA 4DQOH 2HN7A 1YN6A 5IFHH 1YMMB 4RIRA 4HXBL 5KVDL 1LD9B 1AKJD 4M7JL 1IFHH 5J11C 2HRPH 3DX8A 5GRUH 4UTAL 4CJ1A 2EDYA 3QFJA 2DQEL 1FYTE 1EA9C 3SQBA 5E03A 3QA3A 3LN9A 1D5IL 1DUYA 3L3HA 3EYFB 3B9KB 3RGVB 1JNLL 1Z9MA 2X4NB 3MGTB 4F15B 1YZZA 3SBWC 1LDSA 1TETL 1WC7B 5MI0C 5E70A 4PJ8A 4P4KC 4NQCB 2GW5A 4NDMA 5EB9A 3O41B 1FYTB 5EZJA 1P7KA 3RFZC 4HKZA 5GS1C 3QUMB 4TSAH 3SGKA 1BWMA 4MS8D 1CFNB 5KZCB 1E4WL 4Z7OE 3LOWA 1SY6L 1G7JB 1Q72L 4WU7A 3RU8H 5KS9F 1OGAE 2FX9H 4I3SL 3A6BL 3LRHA 2ZUXA 4W4OA 2FB4H 1KXTB 4AH2A 3LKRA 1KULA 4EDWL 1HNGA 2CR6A 4JFQA 1SYVA 2PO6A 4XGZA 3HR5A 1NL0L 5CGYD 3E6HA 4JM2A 2GSGB 4ODSL 2FD6H 3UTTB 5D70H 1WEJH 4HS6A 4WO4D 2WP3T 1QACA 5INCA 5LBSL 2CGRH 4Z7VE 4IJ3B 5HGBA 1N7MH 1NCUA 5E56A 3OHXB 2X7LA 4YIQB 2OQJA 2YKLH 5LXGH 2IPKB 1E4JA 1ZKAA 4NNXA 3TT1H 2BOCA 4L3EA 2HKHH 2WK2A 3MV01 5J12B 3FRUA 1S7SB 5TE7L 1AH1A 4L29B 1CDHA 4XZUB 2J6EL 5JW4Q 5GRVK 1QLEL 4N9GB 4YPGA 3AAZA 5GHWL 1DANU 2O26U 4NWTL 1GOFA 1HN1A 4PLJC 4F80A 5JDSB 5K59E 1LP9A 2E7LC 3O0RH 3WYRA 3H9ZA 2Q76A 1TTFA 5A3ID 1A1NA 3JVGA 5J56B 5EU5A 4EN3B 3KR3L 5CJOL 4Q9CA 1NCNA 4ZDHB 1AGFB 1ZXQA 1DE4A 1JJUA 1KCUL 3QPQC 4ENEC 1A9BB 2JCCE 1IM9D 4KXZI 4L3CB 1X5YA 3GDBA 1C1EH 3PDDA 1WQVT 3ZKMD 3UBXB 1CR9H 2MWCA 3AMKA 4HWEL 1BQHB 1PJ9A 4KKBC 3QXAB 1X5XA 1FGVH 5H35B 1M1SA 4HXAL 5J13C 3CU1A 4JRXB 1HXYB 3KPSE 3FOLB 1ZT4B 4F57H 3RY4A 1TJGL 4J6RH 2ZCLH 3BMWA 4NM4L 4HXAH 4XCNB 2YD2A 5TPWL 1BEYH 1GGIL 3GMMB 2AEIT 5I19L 2FYYA 1NGWB 2A83A 4L8BB 1LO4H 5D7SL 4HGWB 4EXPX 4MD0B 1R5WA 4DKFH 1BD2E 2CRZA 4Q0XL 3CX5K 3K1KC 4XP9L 3CDCA 2PCPA 4G6FB 5CP3A 3BI9X 4GRLA 1I4FB 3OWEA 4YEEA 1CCZA 4M5ZH 2A73A 3ARDD 1JTPA 3SDYH 4GAGL 3SJVB 5F21B 4JZOB 1N5YL 1MCLA 1RZKH 3QJHA 1BAFH 1B0WA 3L3IB 1JPSL 3LH2H 1JFQL 3RX8A 3EO1B 2X42A 3W2DL 1VDGA 5D71L 4KI5D 4OGXL 3RPKA 1CICC 1AIFA 2Z4QA 2JJSA 3QWRD 5B8CC 3WE6B 1F5WA 3JWNC 4PG2A 5DYOA 4ZO7A 1K2DA 2B0SH 3KS0H 2BNQA 3EO0B 4H26A 4RA3A 4A6YH 3BQUC 4MJID 5FM4A 5EN2B 4QHNB 3KPSD 1VKXB 4PPTA 1ROWA 3HPJA 4S2SB 5FECA 4BQ8A 1X5KA 3SKJH 3BP5B 3LMJL 4YFEA 2HT3C 4LAQH 4M8QA 3U0PA 5EO9A 3NCYP 4NO2A 4ZUWB 4NRZB 3LEYL 3P73A 3WXWL 4GAFB 2GT9B 3ES6A 4OCYL 4JJ5B 5SWZE 1FG2A 4MZ2A 2APTA 1GL4B 5EUKB 1C7TA 1CQKA 1IM9A 4WI7A 1NEUA 5DRXB 3D3VB 3MRRB 1BHGA 1XCQA 1IEHA 3HS0A 4QGYA 3JV6A 5IGXL 1A0QH 2LU4A 3BPCB 3U30C 5ESVA 4G6MH 5JOFB 3H6JA 4KI5F 3LN5A 4TSAL 1OAYH 4G9FB 4Z7UA 2IMMA 1KNOA 4X6CA 1OB1B 5T3ZH 4UDTB 1EO5A 4FS0A 4P57B 4G8GD 3VXOB 4M5YL 1DQTA 2CD0A 4LHJB 3QHFL 2VDKH 1OQOA 4YGVB 3WIHH 2FL5A 2AEPL 3WFDH 3GBMH 1VEOA 1Z5LA 1LO3H 1MVUB 3JWOL 1B0GA 4OCMC 4WO4B 5ALCH 5F1NB 2AK4E 2RB8A 2QQKL 5C0IA 3BH8A 3R1GL 3QUZC 4FXKB 1HOCA 4DK3A 4P5MA 2X1XR 3SE4C 5E6YA 5F72S 2RR3A 1K6QL 2KBGA 3CZFA 3IKCB 3ULVE 4BFGA 1L0XA 4IOIA 3PL6B 3QUKB 1KIQA 4YHYB 1FL5A 2RCSL 3EYOA 5CP3H 3IXTA 2I07B 1DVFA 2ZG3A 3PQYD 5CZVH 3NZ8A 4FMKA 4MCYB 3OF6A 4P49A 3GB7A 3CFKB 1J0HA 4I8DA 1AQKL 4YZFF 5I1LA 3JXAA 4HMEA 1AXIB 3IDIB 5GRJL 5GS1B 1JWUA 1RIHH 5DD6B 3U79A 4NO0A 4FXLA 4DEPC 1E6OH 3RA7H 4V1DA 5C0BA 4P59L 3TO4C 3AS0A 1Y6MR 3G6DL 4KC3B 4OGAD 3I9GL 2J12B 5DHVB 1D5BA 1R5VB 3WSQL 5F6IC 1FAIL 2Q7YB 5BO1H 1WVZA 3QWOB 3VMPA 1A2YB 2P42B 3J7HA 4R4ND 3O6LL 4OFPA 5F7UA 1FO0L 1FNGA 4G6KH 4R0LB 4LIQH 5I1DB 2EH7L 4YJZL 5DEGA 5K9KA 1HH9B 3CVIH 3T1FB 3WDJA 1VENA 1ZSDB 3W0WB 4WW2F 3SE3A 3BEWA 3PGFL 2LAAA 2R1WA 3CC5A 2IQAA 2YSSA 4NO5B 5CKGA 2UUDH 3GJFH 1I8MB 5IFAH 1TLKA 1DLHB 3OXSB 2J6EA 3F5WA 4OGZA 4XBPB 3RWIB 4DN3H 4Y88A 3QRGL 4YHLL 5J0BA 4MXVE 2BCKB 2BVQB 3O4LD 1DQDH 4FQXC 5ID1B 4UTBH 1YA5A 4GRLD 3QO1A 4OTXL 4FTVE 2H26A 1I85A 2R0ZL 4LVOC 5JIIA 5KS9E 3WFEH 1YEDB 1KLUA 2DKUA 4BQ9A 3KAAA 4QEGA 1YJDC 2MMXA 4ZPTA 2X4UB 5TF1H 3VXSD 3IFNL 32C2B 4HQQL 4ZTOH 2Z31A 5IFHL 1BFSA 2OLDA 4PRHA 5KAQF 3V79C 4LF3A 5TE4L 2WM0A 4DAGL 2C5DC 1DSFH 4YHIA 5HPMB 1JPTL 2YHGA 3BGAA 2WUBH 3NCJH 3FTGA 4PJ5B 4OZIB 5CBAB 2V2TA 5E7FA 3TEUA 5IHZB 1U8HA 2C4XA 3BDXA 4X6DE 1U8LB 4ZFGH 4P5TC 5CSZA 1NBVH 1KPUA 3DHJA 3HI5L 4K7FB 3TFKC 1WWWX 1XR8B 4XX1E 1CWVA 5DI8B 3CSBA 1H3UA 1L0QA 2EDDA 2ZOLA 1J5OH 3C6LD 3CLFL 4ZO9A 2G60H 4IRJA 3DV4A 1OP5K 3MV7D 3IFLL 1UJTA 2QQKH 3X3FL 4LRIC 3CFJB 5C0NC 1QSVA 2DL9A 2QQLL 1U41A 4OLVH 2AJUL 4FP8H 3QXDA 5F70A 2J8UF 5TQ0H 3OMZA 2DI7A 3SDXF 2JB5L