3U9UB

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 52
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB01
3MLSH 3T09A 2FZ3B 1KJVB 5ILTH 4BFIB 2XFXA 4NO5B 4BH8B 2D9CA 5H35B 1YMMB 2J88L 2N4IA 4XGZA 2GTWB 4BFBD 2VRAA 4NFDA 4PJAB 4G6ML 4RZCA 2FX8L 4ORZC 1DZBA 3O6FA 4YHNA 2Z4QB 5DVMA 2JJUA 4F7MA 4WU5B 1DBBH 5A2IH 5KANG 4XCYA 4R6UA 4YNYB 1EEUA 5F7YC 3VE0A 4WI9A 1K3IA 1QEWB 4OZGB 1M05B 2CDGA 5C3LD 4F9LC 3RWDA 4CU7A 3GSNA 3S4SA 3PHOA 2VLJD 4F7PA 1OOAA 2FO1A 3MRMB 3UTSE 4ZXBC 3BRFA 3QI9A 4QOKA 5JIKA 4NQCA 4WHYH 4ZD3L 3MV9E 4O00A 1SM3H 4P9HH 1HN1A 1CDIA 3QRGH 4RMWA 5JPNB 8FABB 5DJ8A 5GRYA 3HE6A 1AFVH 4MA3B 4F57L 1T1WB 4OAWA 2EIEA 4YHOH 3SGDI 4JPIB 4DZBA 5E8NA 2ATKA 5T1KD 4MLSA 3P9WB 5DJDA 2DI9A 4LIQH 4WEBL 1WAAE 2D9QB 2V5RA 4YZFE 2VXSH 4RSVA 4DEPB 1KXTB 2XTJD 3HUJB 3ZO0A 1MPAL 4LKCB 3MLUL 2NY5C 3WFDH 2ADJB 4I3GA 4L5FL 4QRQA 4R0LB 1KB9J 2AS5M 3T2OA 5D1QB 3RWGB 1T66D 4KMLB 2DI7A 2IBZY 4ONHB 5D93C 3QEUA 4QRRB 5FB8A 5CD5C 4YWGH 3PJSA 3CX5J 1GAFH 2QSVA 4BFEA 4UDTA 3RZCA 3KYOB 3J7HA 3ZHKA 5I76B 1F45A 3GMLA 1LP9F 2Q8BH 5HHNB 5CGYD 3OKLB 5CSBA 3I6KA 4NOBA 2F54A 1FYTE 4HKBB 4JM4H 5A2JH 3O3UN 2UZXB 4PLNC 2BC4A 3NCCB 4K8RL 1HHJA 3RIFF 2X4PA 2VLRA 3G5VB 1MHEB 2KL6A 5C08D 4J3UA 3G6DH 3BRGC 4QHMB 1NFDA 3HNVH 5FM5M 3ESUF 3P4MA 1XF3A 2W65A 4X6BA 1FG2B 1YECH 3C08L 4PV9B 3MBEA 1WWWX 5AD0B 1HH6A 2FJHB 5ACLA 3L3OA 1P7QA 4HUUB 3H2WA 4OFDA 1VEMA 4X7FC 1OAZH 3QFJE 3RVVC 1X7QA 5GGVY 3VXRE 3SDDC 1RHFA 4G80B 1CIUA 1MQKH 1DE4A 3FFCE 2Q7NA 4F37F 4XNMA 5GGSB 4JFEB 2JF1A 1LO3H 3B2UD 1EXUB 4H0GA 3ARQA 3LN5A 3GHEL 5EZIL 1N64L 4P9HC 5JHDB 3K3QA 4KUZH 4APQA 1UWXH 3MLVL 5DT1L 2K1MA 4YBHA 2YD1A 3DOSA 1UVQB 4MJ5B 4PJ8B 4NSKA 3RKPA 5CD3A 2F74A 4OZIA 1CICC 3SDCC 1PG7W 4XBGB 4RA3A 3SJVB 3IU3A 2GIYA 3ALXA 2XRAH 5EO1B 3HZKB 4U7KA 4IJ3B 5C0JA 1WC7B 3CFKB 1YEDB 1X5YA 5KVDH 4RFEB 4WI8A 2GHWB 1YY8B 4FXGA 2HFGL 3W5MA 3RGVB 4ODSH 5L6YL 1R0AH 3LKOA 4PJ9A 4X8JB 2CIKB 4J4PD 5DK0B 1RK0B 2ICCA 5AAMA 1T5XB 1NMBL 3RX8A 4AH2B 1H3VA 3CZJA 1HNGA 5HI4D 3I6LD 1JTOA 3RGVD 3VXNB 1RAMA 1C5DA 4PY7B 1T2XA 4J3WA 3K46A 5E2VH 4X5XB 1BQHB 4JFHE 5KVMC 4W4OC 3CFIC 4KJYA 2ESVE 5LCVH 1A7PL 4IRJD 1JWSB 4P4KA 4MJ6A 5LAXB 1RJZA 2QQNH 3QO1B 4U1LB 3QDMD 5HYSA 3ULUL 1UACL 5CZKA 1HILA 1BM3H 4ZPTB 2D7MA 3MLTB 3RTQD 3T8XB 4EQ3A 4P2RB 5F3BB 4JO3L 4LVNC 3L3GB 1ZLSL 4M8VA 3FQXB 2DJUA 1MJ7L 5FKPB 3WFBH 2DM7A 5FHAH 3D85A 4PJFF 1BX2A 1W0VB 4X4MA 3V5DB 5JDSA 1PQZB 4QXTB 3B6SB 3TO4D 4F7CB 4X9HA 3AS2A 3QCTH 2NY6C 5EA0L 5EIVA 3ARFB 1ZT7B 1IFHH 4M4PA 5J6GB 4CW1B 3H9HA 1IAMA 3ILQC 3P73B 2ZKHL 2XN9D 2Y9RT 2FJFB 5IG7A 4Y4FC 2QQKH 1NLBH 5EN2B 5EU6B 3EYQC 1JPSL 1MOEA 1OTSD 5E9DE 4XNQB 5D70L 1F58H 4ZO8A 1R5VA 1FFNB 1FL3A 1QRNE 4NQDE 1JUFB 3CFDA 5DQDH 5JXAL 5D1ZA 3ZSTA 3RFZC 5IW1A 1B0RA 4P99A 4DCQB 1J05B 4HC1L 1UZ8B 3O4OC 4J3XA 4MGXA 5C9JB 4QF1B 5EC2A 2VR5A 3S8WA 2V6HA 4K3DH 3BT2H 2UUDH 3RL2A 1TVBB 5C0BA 3O6KH 4C56B 4ZAKC 3IXTA 3T08A 2FLRT 4OFYA 3G9VA 3NFSL 3HLAA 1HIML 4XC3H 5C70A 1IILE 3CK0H 1BIIA 4NZRH 1S9XA 3TA3A 3DIFB 4XP4L 4WCYL 1MHPL 5FK9A 3D25B 1FZMB 5GGSY 4OQTA 5CBEA 3VRLF 3P4NB 1UM5L 5I66A 3PGDA 3BHBA 3STBA 4M7JH 1N26A 4LAQH 5I15H 3REWB 4U3HA 2E7BA 1JWMB 2J6EA 3QXDA 4H25B 4YXLH 1C16A 3TJEL 5F88A 2VDLH 2YRLA 5T1LB 4BUHA 5I8OL 4OI9A 1P84K 5AG8A 4YO0A 5SWSE 4NO0B 4MJID 1MVFA 1DP0A 1KENH 3TBVB 5C0IA 3RY6A 1J0KA 4DGIH 1YEEL 3UCRA 1F00I 4BA8A 4LP5A 2FGWH 4K94H 1MVUA 5CSZA 4Q6IA 3T65A 1LEIB 1NGXB 5GS1C 5FA3B 3MRBB 4IBLT 3TBTA 3HMWH 1DSFL 1WT5A 2MJWA 4NRZB 3MNZA 3BDYL 3V6OE 2BNRD 1N3NB 4NQTA 1CGSH 5D8JL 3IFOA 5FGCE 3SCMD 5LWYH 1YEKH 5IQ7L 5IQ9A 5D2LA 1JNHA 3IJHB 4HWBL 4EI5A 3OR6A 3NPZB 1BJMA 4HLZH 3VD3A 3ARED 4H5SB 2CPCA 3D0LB 2PN5A 4HV8B 4IM8A 1MEXH 4DKFL 2ICWJ 1G7PB 3GSUB 1JHLH 3LN4A 4M3KB 5KW9L 5CP3A 1FZKA 3HRZA 1JHKL 1NEUA 1PJ9A 3IKKA 2MKWA 3IF1B 4I5BA 4AEIL 3D1MC 4Q9BA 3FT3B 4Z7QE 4ZSOB 5IOPA 4EUPH 2X2YA 3NCYP 3QDHA 2AJZB 2UZIH 4MD4B 3GMOB 3VXQB 5ICZB 1K85A 3O9WD 4L4VA 3IFPA 4ODVH 2QKIB 5EZLB 3O6LL 4NM8H 4JZOA 5JIHA 3QNXB 4Z0XB 4LRNL 1QQDB 3LPGA 4NN7C 1FFPA 1Q72H 4LKXA 4R4FL 3ZDYE 4N0CD 1HYSC 1EEZB 3MRIB 4GSDL 4HPOL 3OXRB 3MGOB 5HYEA 2F8VA 3IDYC 1XF2B 3D9AL 5EZOL 2NY5L 1A7NL 4G7YL 4O58H 2PCPA 4N8CH 1Q9LB 2CUMA 3OKMB 4G8GD 4ZOAA 5FUCC 3VG0H 2B1HH 2YSSB 4LLDB 1A6VH 3O4LE 4ZXBB 1W0WB 3IS0X 3ES6B 1AHWA 4K94C 1E4XL 4I2XE 1T2QH 5E7BA 1IT9L 3BW9A 1IMHC 1LDPL 4R4ND 5F9WC 3SOBH 5INDA 4PREB 1OT1A 4JFZL 4LF3A 2BMKA 1A1OA 4FQHB 4ZXBD 3WMSA 3GMRA 3ROLA 4JFQB 2I27N 2BVPA 2E6PA 2D7PA 3LAFA 1A7QH 2P5EA 2Y06H 4NC0B 5FUOL 2VQUA 3BPOC 1TZHB 4GG6B 5DD3L 5I30H 2VZSA 3MLSL 1JF1B 1TTGA 5DRZB 4NQVB 5ILTL 2J1KA 4KJQC 1TMCB 4ELKB 3MYZA 4P2QE 5EUOE 1T1ZA 4ZS6C 5I17B 3O2WH 2HAZA 4H26B 1I9RH 1PKOA 4IIQC 5D93B 1DQLH 3VH8A 3BDBA 2HA1A 1DBBL 1AP2A 1LO0H 4GAFB 1HSBB 1A9BA 2VL5A 4YHMH 1OP3K 4WHTA 1QBBA 1FV1B 4CAGA 1G7JB 4XTRC 5DYOB 1I9IH 4FMKA 1CGUA 1KT2A 4HUVA 4P9HL 3QRGL 4MNHA 2Y23A 3TF7C 1AFVL 3FB7A 5FGRA 3CFJA 4Y1AB 3VMPA 4YHOL 4RGMC 2Q86A 3L5XH 2DMCA 5GQBA 4XMLH 4XCEA 1IQWH 2JJSA 4LIQL 1I7ZB 1B9ZA 1R24B 2UYLB 1CE1H 2VXSL 3S36X 1DLFH 5CBAA 5HJ3B 4ZTPH 5KTEH 3GMNA 1II4E 2P8LB 5CINH 3VI4F 3WFDL 1GZPA 5I1CH 5HPOA 5C0AA 3G08B 3KPMA 4U1MB 4OB5H 3SDDD 1KGCE 2EDWA 1K8DA 3DMMD 4JB9H 4WFFD 4KDTA 3ARDA 4YWGL 1GGIH 3GMPA 1GAFL 1NBYB 1UCTA 2LAGB 3OKNB 5CIPH 2C26A 1HXMA 1IEHA 4XPAH 5AWNH 5AUMB 2VZUA 1BREA 2OX5A 2Q8BL 4X99B 4PRIA 1XZ0B 3AMKA 1CICB 1QSEA 4JM4L 4Q74A 3KWWB 3SDCB 4Y0GA 4U2ZA 2FNBA 1VFAB 1AQDA 3UTTA 3V6OC 5DRNB 4R96B 4Z95H 5JA8B 3G6DL 2P5WD 3HNVL 4PJGF 4PR5B 1I3GH 4JEGB 4N1CA 2XKUA 1FNLA 5C92A 2XWBA 1RJYA 3DV6A 1U92A 4PGEA 5IV2B 4PG9B 1G9MC 1P6FA 1OAZL 2VXTL 3U9UB 4S1DC 1N6QH 5EBWA 4PJBB 2OXHA 1U41A 1MQKL 2UWEF 4M03A 2H2SD 5IVZB 3VGBA 1U6AH 4PRHB 2V17H 3UPAA 5HYJB 2Z31D 4MXWH 1LO3L 3QIWC 4XXCC 1S7RB 3DBXA 12E8H 1U8NB 2FZ3A 4NZTH 1W72H 1KJVA 4UT6H 3W11D 2IAND 1R3IH 3DRQB 4KUZL 2QSQA 4NO5A 4CN4A 4ONFH 5H35A 1CDCA 2GTWA 3C5ZC 4GLRI 5DJ6B 2IMMA 4PJAA 3QISA 2VLJA 1A14H 4PJ5D 4LVNB 5DUBB 4YNYA 5FDYA 4Y19D 3W0WD 3FOLA 2FH8A 4HGMA 4N0FB 4Y4KC 4OZGA 5DZOA 1MCQA 1M05A 3V0VB 5DEGB 4JRXD 4WI2A 2X4RA 3MRMA 3BYTA 5KVDL 3UJTH 2XTLA 3WDHA 1A1NB 2NY6B 3EUUA 5B21A 4K71C 4ODSL 4LBEA 5JPNA 1UM4H 4KK5D 1T0MB 8FABA 5KS9F 4MA3A 5FOBB 4Y4FB 3CX2A 3DVFA 1ZSDA 4JJHA 4JPIA 3JUZA 4Y2OA 1WQVT 2QL1A 3RPIB 2NY6D 43CAB 3C5JB 3TFKD 2F5AH 5E2VL 5F7LB 1VKXB 5E8OB 3ILQD 1SBBA 1S8DA 3HUJA 1EAPB 1QG3A 4LKCA 3N85H 1KYOK 1LNUB 4RCAA 4YXHH 3EYQD 2ADJA 3O4OB 3TZVC 4OZ4B 2QQNL 4QRSB 4FABL 4R0LA 5DQ9B 4EI6A 4QEGA 5D1QA 3RWGA 1EGJH 1T04B 1BM3L 5CEXA 1QSVA 4ONHA 4QRRA 1BVLB 1C12B 1P4BH 3C87A 3TT3H 1A7OH 4LDLB 3MV01 3KYOA 5C08A 3JUYA 5I76A 2R2HB 3WFBL 4MNQD 3CZFB 5FHAL 3OKLA 3LPFA 4HKBA 3QHFL 2PYFB 4ZAKD 3C09C 2DQJH 3QCTL 3G5VA 1MHEA 4HZAA 4LEXH 3WFEL 1J10A 4QHMA 1XIWD 1IFHL 1FYTB 3DVGB 1A2YB 1FG2A 4ZNEA 2QQKL 1NLBL 4PV9A 3ZYZA 5AD0A 3EHBC 1YEIH 1TDQA 5HYIA 2FJHA 1NMCB 4HUUA 5T3ZE 1F58L 5DS8B 3EDEA 2OL3H 4HIHB 4QGYA 5DQDL 2X1PA 4Y16C 3VXPB 3SE4A 3QQ9D 3IDNB 4S2SB 4LCUB 1LEKB 3G5ZB 2BVEA 3QFJB 5EO9B 3GK8H 4OCXH 1SMAA 5GGSA 3VXRB 3RDTD 2X4QB 3JBG7 4U6YB 1U3JA 4TYUA 3FFCB 4CNIB 4K3DL 3BT2L 1F6AB 5ICXB 5C0NC 1EBAA 3O6KL 5JHDA 5GS1B 4X9GA 5F7MC 4NC2B 2C1PB 3K4ZA 2JCCB 4XC3L 5F1IB 3CK0L 1UT9A 5C0RH 2Q3AA 4MJ5A 2HMID 2GFBA 1E6OH 4XBGA 5HGHB 2NY4C 4LVEA 3DX9B 2GW5A 2YWZA 3PUCA 5EO1A 3WDIA 3NFPB 4M7JL 1Z9SA 2VWEC 4J4PA 4KH2A 3K80A 4JGMA 4LAQL 5I15L 1YEDA 1X6LA 2HH0H 1RZGB 1BIHA 3DWTA 3ET9F 3UAJC 4Q2ZB 5ID0B 1YY8A 3KLAA 3RGVA 1T7VA 4PJ7A 1QFPA 2WP3T 4KVCH 2CIKA 4X8JA 4E41E 4IRJA 2ZG1A 1RK0A 1T5XA 1JNNH 3LKSB 4AH2A 1KENL 4RMRA 1ED3B 4DGIL 2GCYB 1FZOA 3QDMA 3K8KA 4PY7A 3BQUD 1BF8A 1BQHA 1T1XA 1ZLVK 4K94L 1JFQH 1JWSA 5LAXA 3NPSB 1WBXB 1TZIB 3R0MA 1MFNA 4U1IB 4U1LA 2ESVB 3HMWL 1Y18A 2APFA 4M62H 4ZPTA 3T8XA 3UTPE 3MLTA 4NN7B 1LMKA 4OTXH 4JFFE 1CGSL 4S1SH 5IFJB 1J1PH 3OQ3B 4ZO9A 5F3BA 5LWYL 1YEKL 2EDEA 3L3GA 4FA8A 3IDYB 1FHGA 4DJMA 3FQXA 4NUJB 2A74B 5FKPA 4XPTH 2XN9A 1N4XH 5AEAA 1W0VA 1HYSD 5EULV 4KKAD 5CP7B 1FGNH 1PQZA 4QXTA 3B6SA 3CFEB 4F7CA 3U0TB 3RWFB 3EYUH 1JHTB 5JQHC 3GFUA 4P3DB 1ZT7A 4FXKB 1MEXL 1BZQK 4CW1A 4PJXB 4PYGA 5GGQH 5F9WB 2FJFA 1WWBX 1I1AD 4PJDE 5HD8D 5EN2A 1NGPH 4EN3D 5F6HI 1I8LA 4XNQA 1FFNA 4NC1E 2ITCB 3MO1B 1JUFA 1Z0MA 4JCMA 3H42H 2UZIL 1CE6B 2E8YA 2UY6A 3B9VA 5E9DB 4JDZB 4DCQA 1J05A 3GB7A 1UZ8A 2IQ9H 4JFDB 2YD8A 1J7VR 4NQDB 3RKDC 4ODVL 1ZGLP 4NM8L 5C9JA 1NCAH 5L7XH 3F65A 4QF1A 4IIQB 4ZO6A 1K4CB 1Q72L 1SMOA 1TVBA 4S1QH 4C56A 3Q2CA 4PP1D 4NKIH 4M6AA 3OHXB 4OCYH 3E2HC 3DIFA 4N8CL 2R69H 1RHHB 2PXYC 4XP6H 3D25A 2BY3A 3VG0L 2B1HL 3U0PB 1A6VL 1FZMA 4EUPB 3P4NA 2ATPB 1YEGH 1MFEH 1G7HB 2C4FT 3L7FB 1T2QL 3REWA 5EBLB 1K5NA 1JWMA 1RJLB 3MRRB 4MJIA 4XHJD 3SOBL 4G8EB 3H9SB 3VFRB 2WLYA 4RGMB 5D2NC 2VAAA 5T1LA 3KYAA 1JBJA 5ANMB 5BV7H 1ZT1B 4JY4B 4WV1A 4Z9KB 5C2BL 2Y06L 4AIOA 4NO0A 2E6QA 3TBVA 4NBYB 1ZLWH 1X5IA 2AQ3A 5I30L 3OB8A 4ZODA 2IH1B 2BNRA 4JHWH 4LGRB 4NOFA 1RZIB 1XF5A 3OGOE 2Q3ZA 1LEIA 3O2WL 1G9ML 1I9RL 3PQYE 1J1XH 5AYUH 3EJYD 1RMFH 1T7YA 5F21B 3MRBA 3T0XA 2B1AH 3AB0C 1LO0L 1J8HD 3L95B 4WU7B 4YHML 5C0CD 2ZJSL 4DVBB 4CN6A 5C09D 1MCWW 5EO0B 3I75A 3AREA 5FA4B 1L0YA 4Q9QH 4OZFG 3EYFA 1I9IL 1JTTA 1EO7A 3T0ED 1GGBH 1I8KB 1T22B 3QWOB 2ADFH 3IJHA 5BVJB 5FGCB 3NFNB 5IHUH 2X9WA 5HDBF 3QSKB 2R1XA 3B9EA 3QQ3B 3FRUB 3T0BA 3D0LA 1G9NH 4HV8A 3L5XL 4X7SH 4XMLL 5IBLD 2BOCB 4PTUB 1IQWL 3L3HB 1G7PA 3GSUA 1EK3A 2XY1A 1CE1L 3G5XB 4PTTB 1DLFL 3O9WA 5D96B 4ZTPL 4LK4A 5KTEL 1IKNA 3IF1A 5CINL 2EKSB 2VJXA 3FT3A 4ZSOA 5I1CL 1SJHA 4QRPB 2X4OB 2EH7L 4X5WB 2AJZA 4MD4A 3GMOA 3VXQA 3QIWB 3UYRH 5ICZA 4OB5L 4L8BB 1OAKH 2VZ3A 4JB9L 2VOTA 1GGIL 4HWBA 5EZLA 2QKIA 4NKQB 1YYMH 1WLHA 3QNXA 1PLGH 3C5ZB 1UXSB 4XPAL 5AWNL 1QQDA 3T3PF 3HS0B 3NABH 2PYEE 1EEZA 2X4UB 3OXRA 3MGOA 4Y7MA 4JCLA 1XF2A 4Y4KB 4DAGH 2XWJA 1NBVL 4F9LA 4Z95L 1Q9LA 3OKMA 4KZDH 3N1QC 4RMQA 3U4AA 4PRBB 4LLDA 1I3GL 4ZXBA 1W0WA 4PD4J 5BJTB 4X7EC 3ES6A 5CLWA 1BQSA 2VE6B 4K71B 2QADC 4DW2H 2NY2C 5D7KD 4OV5B 3GIZH 3O4LB 4PREA 5CIPB 2QQQA 5B3JE 4I2XB 2L4OA 1IZKA 1U6AL 4MS8D 4N8VG 2G60H 2V17L 4IOFD 1NL0H 4MXWL 4J3SA 3U4BH 1TZHA 4GG6A 1CLYH 4M48H 2NXZC 12E8L 3ZYIA 2APWA 3CSGA 1JF1A 4NC1C 4NZTL 5DRZA 4KJPD 4NQVA 1W72L 3VD9A 4MDIB 4UT6L 1GOGA 1R3IL 1S7XB 4I0PC 5EOCH 4ONFL 2VR9A 2R2EB 5I17A 4H26A 1BFOB 1G9NC 1A14L 2ZNWA 2COQA 2VDKH 3TZVD 2Y1VA 4P2QB 1HSBA 5HVGB 1KIPA 3MA7B 4QTIH 2IEPA 1MFDH 1H5BC 3EDDA 1BHGA 1FV1A 3FB5B 4F9PC 3LY6A 1CVRA 4WRLA 3T4AB 3C09B 3MGAA 3UJTL 2G75B 2ZCLH 5DD6A 2FRGP 1CK0H 3E3QE 5LXGH 3O6MH 1FH5H 1UM4L 1OSZB 5FCUH 4PRDA 4PJEB 3SBWC 1W72B 2JLLA 4Y1AA 4QTHB 5F9OH 5F7FA 4UOW0 1CLOH 3BE1H 3ARBD 5C0EB 3KHQA 1O5DT 4HCRH 4I48B 4PGBB 3KHOA 2DYPD 1I7ZA 2F5AL 2V9RA 3SDDA 1ZWIA 4Y16B 5ECJE 5I1AB 3ZZ1A 1I4FB 1K6QH 3N85L 1Y6KR 2P8LA 4GXUM 4G6AC 4YPGB 4YXHL 5C71A 3G08A 4GRMB 1KJ2H 1CXKA 2NY3C 1YQVH 4KWUA 4U1MA 4NIKB 1AKJB 1EGJL 5K9JH 1AR1C 1X3DA 3OKYA 2DJSA 1RZ7L 1P4BL 1NBYA 3TT3L 2DQGH 1A7OL 3OKNA 4PJCF 5HPMB 2P5WA 1X9QA 3ZKNC 1Q0XL 3MUZ1 4X99A 4MXQC 1CICA 1J11A 4Z5RB 3SDCA 5IGXL 1VFAA 2JKXA 2NY4B 1BBDL 2DQJL 5DRNA 4R96A 1QFWH 1T1YB 2VKWA 3L7EA 1BJ1J 4LEXL 4LSUL 1MH5B 4PR5A 2V9TA 4WO4C 3C8DA 5TJWK 4WWID 4LCWB 3H7BB 3V0WL 1IGJB 1CFTB 1YEIL 2F53E 5IV2A 4PG9A 4TSBH 1JYXA 3S7GA 1KIRB 3U9UA 2NY7L 2OL3L 4PJBA 1UZ6E 3ESVF 4LCWD 5IVZA 5JO5B 3GK8L 4OCXL 1MCKA 4Z0BH 4W4OA 1MCBA 2XG5A 1BWMA 3TO2B 1S7RA 3BVNA 2A0LD 1U8NA 3LRHA 4Q7DA 3W0WA 3HC4H 1XGPB 4L4TB 5DJ6A 4FQJH 5HHME 1UENA 4EZMA 1Q0YH 5C0RL 3MFGB 5DUBA 4G3YH 2OL3B 3FQTB 4N0FA 3P11H 3V9FA 1E6OL 4L4TD 2IADB 5DRWB 4JHBA 3ARGD 1LO2H 5DEGA 5F7KC 3F7VB 5HDOA 5KSAC 4PLJC 2ADIA 4CVWA 2HH0L 4L3EE 1A1NA 2PF6A 1ZOXA 1MELA 4PLKD 43C9B 3KPOB 1T0MA 4KVCL 4Y4FA 3R1GH 4XCCH 1MHHB 2X44D 3AU1B 2Q76A 4KKBD 1JNNL 3RPIA 3JWOH 5JZ7C 43CAA 5DZNA 5DHYB 4NJAH 2P48B 5E8OA 4GKSB 3QEHB 5DVLA 1JFQL 2HLAA 5GZNC 5IFAH 3LB6C 1LNUA 3GSOB 4EOWH 4OZ4A 3VRJB 1WAAA 4ODWA 1EUUA 4QRSA 3LEYH 1YC8A 1J18A 2OMNA 3QPXH 4MNQA 1AH1A 3CSPA 3TH4T 1ZKAA 2W1NA 4M43H 1T04A 3G6JE 4M62L 3SQOH 3U7WH 1VPOH 2KBGA 4FFVD 4S1SL 1BVLA 1C12A 3O3DB 4Z7UE 4ZAKA 1J1PL 1N59B 5I1KH 1UJ3C 1XR8B 3H3BC 2C5DC 4ZFOL 2R2HA 1CDUA 4JANA 1DUYB 2XZZA 3CZFA 3E2HB 4XPTL 2PXYB 1N4XL 4XCNB 2W9LA 3MJ8A 2PYFA 4MZ2A 1FGNL 4I18C 2UV3A 3ELAT 3KXFD 3FO1B 3EYUL 2R23B 1Z6JT 4R2GC 5A2FA 1FYTA 2AQ1A 3DVGA 5GGQL 2C9AA 2K3TA 5FXCH 5D2NB 5E8PA 5IHBA 1D6EB 1NGPL 5KSBF 5BRZE 5A1AA 3S5LG 1GC1H 2R39A 2VXQH 2XPGB 5DS8A 2NLJA 3PIQB 3VMOA 1JGLH 4HIHA 1U36A 3D39E 4PRPD 3VXPA 1P1ZA 3H42L 5LKNA 4ZFOB 3HB3D 3IDNA 2G5RA 4QYOB 4S2SA 5HHVH 5IB3B 1HOCB 2IQ9L 4I9WE 1WIPA 3VXRA 2KPNA 2X4QA 3KS0J 4TTDD 1T3FA 1OGAE 1KOAA 1NCAL 5JOEA 4CNIA 5L7XL 2GJ6E 1F6AA 3I6GB 5ICXA 3CXHK 4S1QL 3QCUH 4JFOB 3ZT7A 5GS1A 5HI5C 3AB0B 1KNOB 2C1PA 5KVEH 4ZOBA 2JCCA 4NKIL 5ENWB 5F1IA 3ZE1E 5IB2B 4JRYE 1L9NA 4OCYL 4XNZC 2R69L 3JWOC 4XP6L 1FNEB 1AGCB 5HGHA 3DX9A 5DD5H 3NFPA 1YEGL 1MFEL 1UJTA 1P5UA 1KLFA 3M8OH 1RZGA 4Q2ZA 4ZS7H 1PW3A 3D6GA 1OAYH 2DIBA 4KRLB 3VXUE 1RV6X 1QBLH 5IB1B 4YHYC 5GZOC 1N5YH 3RVUC 3OWEA 4ONGL 3LKSA 1ED3A 2GCYA 1TITA 1JPFB 4E41B 3O45B 3P40A 1BP3B 1MSPA 1MIMH 2NZ9D 4JHWL 4OI7A 1L4IA 3CJJA 1ZLUK 1WBXA 1J1XL 1TZIA 4GAJH 2YPLE 1RMFL 4Z7QF 1F90H 2B1AL 4U1IA 3RQ3A 2ESVA 1NBQA 3VI3E 5JUEH 4P2OD 4FOMA 1NCWH 4ODBD 5IFJA 4YH6A 1T89C 4G8IB 4WUUD 5ETUB 3B5TA 3S37H 2BSRB 4Q9QL 4NUJA 2A74A 3SN6N 5K59F 1GGBL 4JFFB 2QJDA 2VZOA 4G7VH 3ZDYF 4RIRB 5IHUL 5CP7A 3TNMB 4FQQA 4P23C 4EN3A 3CFEA 3ZKMD 3U0TA 3RWFA 3GI8H 3IETA 1JHTA 1JV5B 1G9NL 2QADB 1KPUB 4CADB 4P3DA 3P77B 2XWTA 4FXKA 3HAEH 4CMHC 4X7SL 1KCUH 2DJ4A 4PJXA 2NY2B 3WFHA 3P9LA 3WKNA 2AXGB 1SY6H 3LOWA 5C0DB 5ITFB 1T80A 3MV11 1NGQL 1C8PA 2Z0BA 2ITCA 3MO1A 2OR9H 1TQBC 1KACB 1P4IH 4LQ1A 4UI2A 2DL2A 3LHPH 4PJDB 4KY1H 1PY4A 1U93B 2FIRT 1BOYA 1CE6A 1YYLH 3UYRL 2DIAA 4XBPA 1NCUA 4ODXB 2NXZB 1OAKL 4JFDA 2HKHH 1IL1B 3OJMB 3QDJD 4NQDA 1DEEB 4I0PB 2VZ1A 1YYML 1PLGL 5DJYB 3FQUB 4IIQA 1K4CA 3DYPA 3LKNB 4Y5VB 1JZ7A 5C0GA 5E1AA 2NXZD 1INQB 3OX8B 2YD9A 4JFPB 3MZGB 4JM2C 2EDLA 5D7IB 4Y4HD 2EC8A 3S3SA 4DAGL 5EUOF 1H5BB 3OHXA 3GMMB 5IW6A 2FGZA 4LSPH 5D9SA 1NQBA 1RHHA 4KZDL 5HGBB 3WJJC 4ZG1A 3OKEB 4EUPA 4IMLB 4ZPVB 1D5ZA 3WS3B 2PKDA 2Z35B 2Z8SA 5E5MB 2ATPA 5GXBB 3L7FA 3PXJA 3DXAE 4FG6C 1EERB 5EBLA 3GIZL 1RJLA 3KAAA 5DTFA 3H9SA 3VFRA 1TVDA 4NYLA 4HGWB 5TQ0H 3C60D 5ANMA 1RZJC 4JY4A 2KDGA 3QIUD 4KK6C 3INUH 2G60L 2IAMD 1K8IB 1YC7A 3QIBB 3LQMA 3U4BL 1CLYL 4M48L 1V7NH 1VFBB 1P2CB 5M95B 2ZUVA 2IH1A 4P0DA 1FLTX 2NY3B 5EOCL 5F6HJ 1U8JB 4U1KB 1CG9B 1A7BA 1RZIA 3NGBC 5C09A 4HKXB 5C86A 1HHIB 2AJVL 4G6AD 2VDKL 3D2UB 4WU7A 3RAJL 4QTIL 1MFDL 2NY3D 4DVBA 3PQYB 4BQBA 1AR1D 2D3VA 5EO0A 3LEXA 1S9WB 1DJSA 4RWYH 5FA4A 4Z77B 4K7PH 4D0CA 1WTLA 1T22A 1I8KA 2VN7A 2ZCLL 3QWOA 1NBZB 4FRWA 1CR9H 1CK0L 3ZKND 5BVJA 5LXGL 3NFNA 3O6ML 1FH5L 4UAOC 4X6EB 5FCUL 1WIUA 3ZT5A 3QQ3A 1U8OB 1K9TA 1FL6A 4WW2F 1CLOL 3BE1L 5J57B 2BOCA 4HCRL 3L3HA 1TFHA 1ZVSB 3GIVB 2WANA 2NTFB 4K3GA 3WNMA 2X4TA 4WO4D 2WBWB 1FVCB 1TIUA 3TYGL 1P9MC 1K6QL 1J0HA 3KPSE 2EKSA 3QPQD 4FXLA 4QRPA 2EDDA 1OW0C 2X4OA 4X5WA 1KJ2L 2AABH 1S7SB 4U1JB 4XXCA 5DJCB 1YQVL 1KTRL 1FNSL 4L8BA 5K9JL 3ARXA 3AXLB 5ALBH 2HT3D 1OARH 2DQGL 3L9RB 5HHOE 5D7JC 3C5ZA 4CU6A 5JLZB 5EOTB 5SWQB 4QOKE 1ZLWK 4WFGD 3ZE2E 2FIKA 2FYYA 1NFIB 2JB6A 2J5LB 1CDHA 3SDXF 4Y4KA 4WI3A 2GEEA 2PYEB 5KSAB 4W6WB 4OZHF 5BJTA 3VFUB 1KJ2B 1I7TB 4HK0A 1YEHH 4XHQA 2M26A 4MDJB 4OV5A 4PLJD 3O4LA 5JIPA 5CIPA 4UMGA 1KUMA 4BFGA 4ELMA 1E4KC 4B7LA 1IQDA 5EUKB 5HBBA 4XI5C 1O7VA 5DJ0A 4WUKH 4Z0BL 3LS4L 1A02N 4LRIA 3MJ7B 1PG7L 2AGJH 4M3JA 3TZVA 1M7DB 4MDIA 3HC4L 3TVMD 1S7XA 4NUGH 2NCMA 1CFBA 3HG1E 3ZTJG 4RX4D 5DGQA 3HA0A 4FQJL 2R2EA 3MLXH 4P3WA 5GJTH 3SE9H 1BFOA 5MHSD 4U49A 2VLRE 3NCJH 5D5MB 1DBMH 1UJ3B 1Q0YL 1BFTA 4F3FB 1FDLH 4KKCD 4G3YL 3MA7A 3P11L 3MNWB 5I8KL 2R8SH 1LO2L 4OUUA 4W6XB 5B39G 3T4AA 4I18B 1V3MA 2RCSH 1KELH 3T1FB 2DLTA 5BS0D 4S11A 3GM8A 2G75A 1KN2H 3RHWK 2AV1B 4R2GB 4NBXB 2Z92B 3B8YA 1OSZA 5CUSH 3MRNB 3K8MA 4PJEA 4OM1H 4R97C 1W72A 2V9QA 3CH1B 3R1GL 4XCCL 2A6IB 5JOPD 2VQ1B 1HCVA 1ULVA 5C0EA 4BM7A 4NFBA 3JWOL 3NA4A 1CN4A 3FQWB 3GSNH 4I48A 4PGBA 2RFXB 1OLZA 1K4DB 4U6VH 4NJAL 4HX1B 4OM0H 4Y16A 3T2PA 5I1AA 4XX1E 3VXSB 1I4FA 5IFAL 2P47B 4YPGA 3PWPD 4EOWL 4P5MB 3LEYL 4GRMA 1A4JA 3RVWC 3DYOA 3QPXL 1MQ8A 5EWIH 5I1DB 3WHXB 4WFHE 1DEDA 5BOPA 1XGTA 3JTTB 2WINB 1AKJA 4LGPB 4M43L 3SQOL 1VPOL 3C5SB 4LSDA 5DC0A 5I0DA 3VXSD 3BP5A 5J1SC 5I1KL 4F8TA 1B88A 4IS6B 1A3RH 5HPMA 4PJHA 1FFOB 4I8DA 3JV0A 4PPTA 3PP4H 3U48A 4I0KA 3EYSH 2D4FA 4Z5RA 4TUOB 4D94A 3LQAH 1G0DA 4FQCH 1OHQA 1T1YA 1MH5A 3IDJB 5CEYB 4ETQB 1JGDB 4OGAC 3FAWA 5HVFB 2VSCA 2BNQD 3IDIA 4JY5H 4LCWA 3H7BA 1IGJA 1QFOA 1CFTA 3QXUA 1HSAB 1EGJA 1GC1L 2VXQL 3RIAF 3T0VA 1JGLL 4YHYB 1FVDB 5IVXF 4U3XA 5D72H 2E27L 2ZG2A 5HHVL 2NNAA 5JO5A 1NGZB 2CGRH 2HN7B 5IVOA 2GITA 5TE4L 4MHHI 5E56A 3BISA 3PWJB 2EICA 4RBPH 3TO2A 3C9NA 3CUPA 3MLYH 4OSUH 1ZMYA 3I3DA 3QCUL 4GMTH 4X98B 4JQIH 1XGPA 4L4TA 4X4ME 1NUNB 1T03L 3IB4A 1FCCA 4D3CH 4NZUH 3DUUB 2OL3A 3EDJA 1QFWM 3MUGB 5HHMB 4XP9H 5DRWA 2IADA 1OTTC 4K07A 5DD5L 5FFLA 3F7VA 4JQVC 4MQTB 5MI0B 4X6DF 4P23B 3H0TA 3OJDB 3MOAH 1OP5H 1PG7X 4ZS7L 3BH9B 1YNTB 4HWUA 1OAYL 2AJ3B 1M1SA 5MEND 4KGJA 5ESVA 43C9A 4CMHB 3KPOA 4E5XB 4X4YB 3VFPB 1A1MB 1MHHA 3VGGA 1N5YL 2EDOA 2XACC 2CUHA 2WIMA 1A5FH 3KPNB 1NCDH 3QJFB 5JW5B 1TQBB 1U0QA 5DHYA 3QUYC 5EU4A 1JPGB 2W0PA 4OI8A 4JDTH 1C08B 4GKSA 3BAEH 1T0NB 3QEHA 3RVTD 4LP4A 3Q5TA 4PG2C 1MIML 4LEOB 3TBYA 3SEPA 3MRLB 2JJTC 3LQAC 2YD2A 3GSOA 5E4EC 4GAJL 3OV6A 4EBQH 1F90L 3Q5YA 3QNYB 5EH1A 4PBXA 5IBUG 1UB6B 5JUEL 3EOAB 4AQ1B 1NCWL 3O3DA 1N59A 5FM5O 1XR8A 3VDBA 3S37L 4JM2B 2EDFA 3P30H 4JN1L 1VERA 2AV7B 2PXYA 4Z7UB 1IC7H 1A8JH 2BSED 4XCNA 1MJ8H 2E9BA 4IOIA 3W9EB 4PGDB 3D18B 4HF5H 4MQSB 1JRHH 3PWUB 3FO1A 3GI8L 4HW6A 2R23A 4FN0A 3MXVH 3P0YH 4LQFH 1KCUL 3FOMB 3V5KA 4PRPA 4RA0C 3JV5A 3WD5H 2HJKB 3UMTA 5D2NA 2QEJA 1SY6L 1D6EA 5I6XC 4PRAB 3QNZB 3V79C 5AG9A 3RI5F 1NDGB 3PIQA 1U3ZA 5DI8B 2OR9L 4P5TC 4LOUD 1P4IL 3OKDA 4DKEH 3LHPL 3EBAA 4KY1L 4BK5A 4ZFOA 5CMAB 1CL7H 1YYLL 4QYOA 5IB3A 3TH3T 5L0QC 4X80H 1HOCA 2HKHL 3QO0B 1C7SA 3D39B 2FEEL 3NGBB 1FAKT 2VLLB 5L88H 2ZG3A 3I6GA 3ALWA 4JFOA 3HAEB 2DLFH 3X3GH 3MRHB 2MQ0A 3LKPA 1KNOA 1WZKA 1JWUB 5ENWA 5IB2A 3FN0H 4LSPL 5SWZD 1FNEA 4OGXL 1AGCA 4ZUWA 3BP4B 4JRYB 3VXMB 1CZ8H 1BPVA 3DURB 4UAOB 5GGRB 3DUHA 3Q6GH 2IJ0C 4NRYB 1RIHL 3QH3A 5DFVC 1PYWB 1PBYA 2XA8H 5TQ0L 2QSCH 3IKCB 3VXMD 4L4VE 5IB1A 1QRND 3JV6B 2RQ8A 3INUL 1X4XA 4BKLA 3DTXB 3DGCR 4ODTH 1V7NL 4P4KC 1SEBB 1JPFA 4E41A 5J3HD 3BZ4B 3O45A 3QUZD 1Q9OB 4UILH 3GZKA 2DLIA 2C7UA 4LCIH 4WUUA 5T1MB 4GFTB 5J4MA 4KUCD 5F1OB 5D7JB 2G2RB 5EC1A 3F5WB 2Z8VC 3D0VB 2YPLB 4HBQA 1TVHB 3PDGA 4G8IA 4OKVB 5ETUA 1IGYB 1AGDB 4RWYL 2BSRA 3BP6B 4K7PL 5E7FA 4CN1A 3O2DL 4G9DB 1QFWI 1CR9L 3JSSA 4GBXC 4RIRA 3TNMA 1XH3B 3JXAA 4MMZC 1DQJB 3M17B 2P5EE 5F9DC 4B53A 3P77A 1KTLB 5DO2C 2OQJB 1OAXH 2HTLD 3BMWA 4NP4H 4HK3J 3SGJC 6FABH 3EKCA 2AXGA 1G9EA 3SY0B 2VITB 4NN6C 5C0DA 5ITFA 5E24E 3K74B 2F58H 3KJ6L 3QDJA 4NT6B 3U82B 1GJIA 1F3JB 4PJDA 2XNAB 1D7FA 1U93A 1SYSA 4RAUB 2AABL 3GSWB 3PE9A 4JFYB 3U36B 1MREH 4ODXA 5B3JF 1UKTA 2LU7A 1IL1A 1P69B 5ALBL 3RJQB 1OARL 4I0PA 1D9KC 1EFXD 3IDMB 3U7AA 5GRUH 3VWKD 5LGKA 5CP3H 5DJYA 3FQUA 2CK0H 4DN4H 4ZOEA 5ID1B 5IMKB 1U8MA 1A6TB 3OX8A 3UXFA 4JFPA 3VGAC 3BN3B 4YFLI 5D7IA 2BXYA 1TENA 3T1WA 2HLFC 5BCAA 3GMMA 4HJ0C 4YFDB 2FHBA 1ZAGA 4F9PA 3ALPA 3VJ6B 3BIAX 3OKEA 2VDNH 2EIBA 4IMLA 4ZPVA 2V2XB 5JNYB 3WS3A 2Z35A 2NY1C 1EBPA 2PO6D 3HHRB 4AJ0A 1YEHL 4J3OC 1XGUB 3WJLC 5IHZB 3SBWA 4R97B 2NY0C 3MLWL 5DRXB 5C0AE 3LKQB 4HGWA 3DXAB 3WXWH 4WUKL 5E8EB 1TLKA 4OJFH 4H88H 1K8IA 2R4RH 1UKQA 1NUGA 5LGJB 1JI1A 2BVTA 2AGJL 4JKPH 2AVGA 1P2CA 4MD0B 3NCBB 1S7WB 2W0FA 3MRJB 4PRIE 4NUGL 1QSEE 4W6YB 5L8LB 1U8JA 4U1KA 4RRPG 4HKXA 3V4PH 3MLXL 4HJGB 3SE9L 5GJTL 3UO1H 3UTTE 1S3KL 3NCJL 1D5XB 4Y5YC 4GKNA 4DN3H 5T3XE 3MRKB 2GJJA 1IE5A 1JPTH 5FF6A 2R8SL 3ECBB 2A73B 3RL1B 3UBXG 3PQYA 3T4YB 3PL6D 1P7KB 4Z77A 3QXAB 1PGRB 2N7BA 2RCSL 4XC1L 1KELL 2EXYD 4XPBH 3OAZK 1KN2L 1NBZA 3DX6B 5JPMB 5ELIA 4I77H 4X6EA 5CUSL 1NEZG 4WO4A 4OM1L 1JMXA 3U4EB 3ZTJH 1LE9B 2CH8A 1U8OA 3SPVA 1TJIH 4HHAB 1B90A 4DGYH 1LK2B 4AENB 4TSAH 1TXKA 2A6JB 1ZVSA 3L3DB 3OG6B 1FVCA 5CJXC 3SKMB 5K9KB 2VLJE 3U30C 2VXUH 4LGSB 4M1CC 4KZEH 2XIDA 2XYCA 4K7PX 2ZWLT 5EWIL 2O26U 2YN5A 1KG0B 1S7SA 4U1JA 5DJCA 3OKKB 3KPSB 3OF6A 1FZJA 4KV5E 4OZGE 3OXSB 4RZCB 3PDDA 2DQCH 3L9RA 4NFCA 4K9EH 4XCYB 5JLZA 1A3RL 5EOTA 5J1AB 1OWRM 3PP4L 3DGGB 3RWDB 4HCRA 3GSNB 3S4SB 1PEWA 3EYSL 5HHOB 2XTJE 3IDUA 4ZUVB 3LQAL 2VIRB 3QI9B 4FQCL 4QOKB 3W81A 2PYEA 4GH7B 5KSAA 3VWJC 5DJ8B 3VFUA 1CQYA 4HIIB 4P2YA 1KJ2A 1CS6A 4JY5L 5DA0B 4DZBB 5ADPH 3OGCB 4WTXA 3S34H 3BIBX 5A3ID 2ICES 1DN0B 1KEMH 5GRJH 1LQSR 4MDJA 1I1YB 5IMOB 2H8PB 3TCLB 1D5IL 5D72L 5ESAB 5EUKA 2CK2A 4N0UE 5T3XH 2CGRL 2EDHA 2AKRB 3FAXA 3QUYB 3OKOB 1BD2D 4GOSA 3FMGH 3MJ7A 2R0LH 5C08E 4OFKA 2B20A 1KGCD 3MXWL 1EVTC 5E4EB 2ITDB 3MLYL 4OSUL 5FB8B 4ZYKA 3RUGF 4GMTL 4PP2B 2X10A 3OBAA 4LNVA 1ZHLB 1T6VN 5IUSA 5D5MA 4D3CL 3VU2A 4HG4J 5INCB 1UJ3A 2AW2A 5BS0A 3I6KB 4NZUL 4YAQA 4F3FA 3HG1B 4OLWH 3NOIA 4JM2F 3MNWA 4XP9L 3BXNB 1HHJB 1JN6B 4ZNEE 3G6JF 4JQXC 1CD9B 1DUZB 2MCG1 1Z0NA 4LHQB 4I18A 3T1FA 3MOAL 3TV3H 1T5WA 2OZ4H 4UQ3B 2AV1A 3GHBH 3MBEB 3TP4A 2Z92A 1HH6B 3VFTB 4AK1A 3TN0D 3MRNA 1P7QB 2APVA 2R0ZH 3HTLX 3CH1A 1X7QB 4P9MH 2A6IA 4G5ZH 5BOZG 2VQ1A 4K9EC 3PWPA 3AVEA 3REVB 5IEHB 3FQWA 3S5LB 1A5FL 2RFXA 15C8H 1NCDL 4P5TB 1K4DA 5CKGA 4OCSH 4HX1A 3AAZB 4M5YH 2BY2A 4JDTL 1CU4H 3BAEL 3VXSA 4IEFB 5GJSH 4KQ4H 2BNUB 1I75A 1U8PA 5L0QB 1Z5LB 3LN5B 3QFDB 3NBNA 4P5MA 4RAHA 3X13A 1KTKE 1RPQA 4EBQL 3WHXA 3NZ8B 4KI5C 2P44B 2FEEI 3JTTA 2WINA 5SV3A 5GPRA 4MSWB 2A9NH 1ZK9A 1KCRH 4IS6A 4CJ0A 4NSKB 5DVNA 5HGDB 4F33B 1FFOA 5KAQF 1KJ3H 3P30L 2DD8L 5K33A 2H26B 4WWKD 3I6LE 1IC7L 1KFAH 2PW1B 4PJ7E 5IBTH 3W9DB 1VA9A 5H37H 4MAYD 4TUOA 4HF5L 1JRHL 4LFHG 5DDHB 3BD3A 3NCEB 1FRGH 4XVSH 3MXVL 3M1BB 5CEYA 4ETQA 1JGDA 3NIFE 3P0YL 1BZ9B 3LKOB 4LQFL 2BVOA 3V2AR 3WD5L 2RHEA 3QDME 4QXGH 3OG4B 2L0DA 4KFZC 1HSAA 3RBSA 1HKLH 5D7LD 3H9ZA 1FVDA 1EH9A 4LMQE 4DKEL 4LVOB 2ILLA 1HYRC 2Y6SD 1CL7L 5DFVD 2AK4D 5A2LH 4P4KB 3BH8B 1NGZA 4U1GC 3T04D 2HN7A 4X80L 1WICA 3PGFH 5CSGA 3WFZA 3PWJA 2W59A 4NQED 4CVXB 4FFYH 2XICA 5L88L 3B9KC 2A6DA 2HJLA 2XN9E 3BJ91 1YPZF 4X98A 3X3GL 3V6BR 3MGTB 2VLMD 2YKLH 1JGEB 1DLHA 1A6UH 3FN0L 3TYFA 4BSVA 1A6WH 3DUUA 1D5BB 3MUGA 3IGAA 4A2LA 1URLA 1MCNA 4UZGA 5FM8A 3ULUE 4GBXB 1CZ8L 5GRZA 4P23A 1YMHB 2ZOKA 3OJDA 4KPHH 3Q6GL 5E8DH 3V7AG 4U6XA 1YNTA 2ZP0T 3EOTH 3WNOA 2XA8L 3RU8H 2QSCL 4AEFA 1XMWA 5T3ZD 4E5XA 1B6DA 3EJZD 3T2QA 4X4YA 3VFPA 1A1MA 2DM4A 1X5AA 4U6HA 4NN6B 4C55A 5D1ZB 1P53A 4J23A 4ODTL 3KPNA 5JW5A 4ZUTB 4H20H 1C08A 3VXOA 3WNPA 4UILL 4BZ1H 3MRLA 4JVUA 4QKXB 3SDAD 5CGYC 4LCIL 5EBMA 4CJ1A 5FEBA 5EZIH 4ZUSA 1N64H 2E5EA 4KMQA 1D9KB 1E4WH 4GW4A 3QNYA 1W2KT 1UB6A 3EOAA 1IAOB 3GSXB 3PGCB 1U95B 2H45A 2ADGB 4OFPA 4Z7NE 1VACB 4Q6YA 5DJZB 5C3TA 3VGAB 3BO8B 4JM2A 1YEFH 4N8PA 4MJIE 5CZVH 3IJYA 2HYMA 5CBEB 4RBPK 2AV7A 3KPPB 4UT7H 3RBGA 4Z7UA 2DB8A 1RURH 4LLUB 3BHBB 1AO7D 3WJJA 1SQ2N 3W9EA 4PGDA 1NAKH 5CEZD 3D18A 1AE6H 3QA3B 4V1DD 3PWUA 1KPVA 2NY1B 3WDJA 1Q1JH 2HLFD 5DLMH 3FOMA 1IGFH 2NY0B 4KI1A 4NNPH 4NP4L 3MCLH 6FABL 2DKUA 4LLYB 3FL7A 2BNRE 4PBVC 4PRAA 3QNZA 2DRUA 2F58L 1NDGA 4KMTH 2X1OA 5DI8A 3STZB 2X1QA 3QYCA 4X6CA 1CVSC 1MREL 4JLRB 2W07A 3QO0A 3P4OB 3VCLA 5SX4H 4MCYA 5GRUL 4O4YH 4YBLC 2VLLA 2CK0L 4DN4L 1F3DJ 4GMSH 4QT5B 3C8KB 5DQJB 5FV1L 3HAEA 4Y5YB 1RSFA 3MRHA 2D0HA 2Y5EA 3V6ZB 1LD9B 2ZUQC 3KPRD 1WEJL 3LSOB 1A3QA 4E9LA 4KXZI 4Z7OE 4UINH 3BP4A 2VDNL 4OZFA 3R4DA 1DBAH 5E5RB 1JF5A 4JRYA 3VXMA 1V7MH 2HVKB 5HI4C 3DURA 3CMOH 5DUPH 5GGRA 5ISZB 2PETA 5FGSA 2CLRB 4ZSOE 2ZKHH 2PW2A 4NRYA 1WZLA 4JPKH 2V5TA 4IRJC 1PYWA 3PWVA 1FZKB 3IKCA 4HGKC 3QUZA 3WXWL 1EJOH 4I5BB 4QHNB 5F7WC 3JV6A 4BZYA 2X42A 4OJFL 3UDWC 2X4NB 4H88L 2R4RL 3DTXA 3I2CH 1P9MA 3RTQC 1R3LA 1QO3B 1OP3H 1EAJA 5ADOH 1WWAX 4G8GE 4JKPL 4YHZH 3U30B 1OW0A 1SEBA 2NMSA 5GS2D 1Q9OA 1KBGH 4JZOB 2GAZB 4PS4H 4YEEA 2BRRL 4MQ7B 3V4PL 3UO1L 3EYVB 4OD3H 5T1MA 4E42B 3KYMA 5E2UH 2VUYA 5D7JA 4DN3L 3TO4C 2G2RA 3F5WA 4MJ2A 2BERA 4HUKB 1YQ2A 1JPTL 1RULH 1UCBH 3EOBB 3ABZA 5DHVH 5DURD 1TVHA 2J8HA 2QQLH 4OKVA 1IGYA 1Z3GH 1X4YA 1WTGT 1U2CA 2ENSA 4XPBL 4QHKI 1OTSC 4G9DA 4ODUB 4TNWF 3V4VH 4HXAH 3VWJB 1B2WH 4I77L 1XH3A 4AMKH 3AMLA 4K3JH 3ZE2F 1DQJA 3M17A 2B0SL 5BW7C 3FQRB 1TJIL 3BX7C 1BVZA 4LSTL 1KTLA 4GG6E 4DGYL 4GRLD 1R3KB 4TSAL 3ROLB 3QEQB 2BVPB 3MQIA 3SY0A 2VITA 4I13B 2FX9H 2AK1H 4FFZH 1KIUA 4NT6A 1IGTB 3WFCH 2VXUL 5F3HB 1EVUA 4MB3A 2XNAA 3BFOA 1INDH 3U36A 3LD8C 3O2DA 3FN3A 2GY5A 3VGHA 2DQCL 5EU5B 4K9EL 3IDMA 2HG5B 2IF7A 1EDQA 3S36H 5E00A 5ID1A 4JO4H 1QRKA 5IMKA 2NXYB 2VL5B 2JE8A 3GNMH 4GRWH 5C6PB 4RWHA 3BGFC 1TCRA 2RIKA 5IQ7H 4OGZA 4Y1AE 2FATH 3LCYA 1UADC 4OLZH 1FVEB 4CDHA 4LAJH 4HUVB 1GOFA 5DK2B 5E1HB 3NZHH 3STLB 5B39B 4L29B 1MWAH 2C3GA 5JNYA 1NFDF 4U1HB 4WFFE 3QZWG 5ADPL 1XGUA 3N0PB 5GRJL 1KEML 5IHZA 2GUOB 5F8QC 4P3CH 5DRXA 2BOBB 5CBAB 4J2XA 3LKQA 4Z7WA 4C58B 1U2HA 1GZPB 3Q0HA 5E8EA 4LL9A 1KB5L 2I60H 3FMGL 5LGJA 1DANU 2R0LL 2P5WE 2CJUH 4P2CG 3SCMC 3GDBA 1SHMA 3MRJA 1FJ1B 2BVYA 1YNKL 2ZCKH 4NHUB 5TF1L 4HJGA 4R4FH 5I1IH 4GKZB 2Q6WB 4GSDH 1QSEB 3MRKA 3AREC 4OLWL 2MOVA 4OZIF 3ECBA 1AQDB 2A73A 4KI5D 3RL1A 3T4YA 3UTTB 4X6FB 5DSCB 1P7KA 4IDJH 3QXAA 1A0QH 1PX3A 3TV3L 3MFFB 1IM9B 4PJBE 2EIDA 5GS3A 2OZ4L 1E4XH 5JPMA 4L1DA 3GHBL 2XWBB 3DV6B 4WVRA 2R1YB 1U92B 3B2VH 2IANE 2R0ZL 3U4EA 1LE9A 2BHZA 4P9ML 4G5ZL 4HHAA 5EBWB 4KRNA 4BK4A 1LK2A 15C8L 4Y19E 4OCSL 3W0WE 3L3DA 4M5YL 1S7VB 2RGSA 1CU4L 1HQRA 1UKSA 3GJEB 3SKMA 2J8UE 4C54A 5EFIB 5GJSL 4EJ1C 1CL7I 4N0CC 1H8SA 4U1GB 1U91B 3MV8D 1HINL 2AXFB 3P4LA 1F4YH 4I3SH 1KG0A 3PHSA 3OKKA 1GGYA 5F9JB 2DQHH 3KPSA 2BVQB 3OXSA 2VLJB 2A9NL 3RZWA 4NO2B 1KCRL 4B0MM 4Q58C 1YY9D 3FOLB 5J1AA 1KJ3L 2B4CH 4LASH 3DGGA 3B9KD 1KFAL 4TNVK 4R4NC 5HHOA 5IBTL 1QOKA 3GSRB 1YDPB 2X4RB 4ZUVA 5I1JH 2VIRA 5T1KB 4H0IA 1FRGL 4WFED 4XVSL 4JQVA 4RGOH 4LBEB 4M9PA 1QHOA 2XTJB 2YA2A 3S6CA 2CKBL 4HIIA 2O5YH 4QXGL 4OD1H 1ZSDB 3DLQR 3OGCA 1RZFL 4AIXA 4C83B 1DN0A 2NW2B 1BD2A 1HKLL 2FR4B 1I1YA 3ULVF 3CIQA 5IMOA 2H8PA 2D7TH 4IRSC 3TCLA 1MNUH 5ESAA 1S8DB 4MNQE 4XT1C 4ZO7A 1FC2D 2WBJD 2Q87A 2AKRA 3PGFL 3QUYA 1WIOA 3OKOA 3D3VD 3LPWA 4PG2A 3C8HA 4EI6B 1H3TA 4FFYL 2JJTA 4WTWA 3ZE0F 2CRMA 2FECL 5CEXB 4N0UB 2ITDA 3TEUA 1NC2D 4AEHH 1J88A 2CQVA 4XP5H 4PP2A 1ZHLA 1RUMH 1N8ZB 1LO5B 5C08B 5IBUB 1HNFA 2YKLL 4YFEA 3HPJB 3SGKC 1A6UL 2E7CA 5INCA 4ISVB 1A6WL 1V05A 3HG1A 3RWHB 3BXNA 3SO5A 1JN6A 2J3SA 1OAUH 2VO5A 1DUZA 3Q5OA 4KQ3L 2RJMA 1Y6MR 4KPHL 5E8DL 1ZLVH 1FL5B 5DFTA 4UQ3A 3EOTL 2VZTA 1MAJA 3VFTA 1C1EH 1MJUH 3RU8L 4DZ8B 2NX5D 2MFNA 2VXTH 1CIDA 1K3ZA 1LILA 2KKQA 4J8RA 3DMMC 2HT2D 3REVA 5IEHA 3IT8D 3S5LA 4TRPH 4P5TA 4U1SA 5TGBB 2DIJA 4YHPB 2GI7A 2B4CC 3AAZA 4H20L 5E08H 4BZ1L 2BNUA 2JCCE 1Z5LA 3QFDA 3N50A 1E4WL 3WCYA 3NZ8A 4YHKH 4YBLB 3RNKA 5FYJU 4LVHC 4MSWA 4DUVA 4MAYA 1Q9WB 2HT4C 1YEFL 2WMPA 3DPBA 4P4RB 4E0RA 2UVFA 3O3BA 5HGDA 1IGCH 4F33A 5CZVL 2YOCA 2GFBB 3SO3C 2H26A 4UT7L 3L5HA 1AXTH 1X5HA 5D2LF 4XZUA 1RURL 3U0WH 4B41A 2PW1A 3W9DA 1NAKL 1AE6L 1LP9E 4L3ED 2CSPA 4U6TA 5DDHA 2EYRB 3KLAB 1Q1JL 3M1BA 3FO2B 2H2SC 3VGDA 1JZ2A 5DLML 1BZ9A 1IGFL 4PJ7B 4YC2C 4NNPL 5D6CB 1ETZB 3MCLL 2Z31C 4HDIA 2BFVH 1B0GB 4IRJB 2AJUH 1RUKL 2VDOH 4H0HB 4I0CC 1CXEA 3MV7D 4KMTL 5HDLA 4NQEA 1P5VA 3W11C 2HJFB 1ZGLB 2QR0B 2OI9C 1FZOB 3QDMB 1BLNB 1QSFB 1FPTH 1SVCP 1T1XB 3RTQB 3K4DA 4G43B 1CTOA 4UQ2A 5GS0C 1ZHBB 3BH8A 3D5OF 3WXVH 4FABH 2C3VB 5DXWA 1FGVH 3P0VH 4CVXA 1U3YA 4O4YL 1Y18B 1QSFD 4GMSL 1NC4B 3GM0A 2X1XR 4XBEH 5MP6H 5FUCE 3TO4B 3MGTA 3DETD 3WUWB 3TJHD 3PF2A 5MEOB 3UTQB 1JGEA 3QCVH 4NWTH 4KK5C 2XN9B 4KTDL 1NC4D 5SX5H 1D5BA 3QHFH 4PJXE 4UINL 3LH2H 1SJEB 3EO0A 1DBAL 2X4SA 1V7ML 4GBXA 5H94A 5LG1A 2VUOA 5DUPL 3CMOL 3WFEH 3TFKC 1YMHA 3EZJB 3W2DH 4JPKL 5HTSA 3P3YA 5BRZD 3G6AA 3SKJH 2DLEA 1EJOL 4JFDE 3SGJA 1F6FB 2EO9A 1XGRB 4TUJB 3T0DA 2Q8AH 3VFWB 3I2CL 3OAYH 4QWWD 1PAMA 1CDGA 5ADOL 4ZUTA 4YHZL 2G9HB 3O3AB 3QP3A 3GB7B 4BZ2H 1DTUA 1KTDB 1RQ5A 3DV4A 1WGOA 5KN5B 4CBPA 1KBGL 3H6JA 1OGAD 4PS4L 1X5JA 4JR9H 1NPUA 2GJ6D 4YBQD 4OD3L 3TNNB 2APXA 2HP4A 5E2UL 2P42B 3CLEL 1D9KA 2D7OA 2GKIA 4RMVA 2DICA 1IAOA 3GSXA 1RULL 3PGCA 1UCBL 1U95A 1AO7A 4OCWH 2ADGA 4JHAH 1XIWC 1P6AB 4F7TB 1VACA 4V1DA 5DJZA 3TH2T 1QZ1A 2QQLL 3BGFB 3BO8A 1FNGB 2ID5A 1Z3GL 4Z7VE 3A6CH 4FQ2H 3KPPA 3H9SE 3V4VL 4HXAL 2Z93B 4LLUA 4MA7H 3F7RA 3FQNA 3TGXA 1B2WL 3S96B 1F4HA 5ANME 4AMKL 4K3JL 4TVSa 3QA3A 2E8ZA 1K5NB 4YDLC 4ORGB 4EQ2A 3QQ4B 4MJIB 3QQ9C 1KB9K 1FNFA 4DKDC 2VAAB 4HSQA 3WJLA 1G1CA 3VXUD 3U83A 1CD0A 3RDTC 3CX5K 5FECB 4WV1B 1J8HE 4LLYA 1HHGB 5C0CE 2FX9L 2AK1L 1PY9A 4FFZL 2GQHA 4ETYA 4HUXB 5C09E 3WFCL 3STZA 5DHVB 3NIDE 3C6LC 5DWUH 1TNNA 2Y5TB 3BI9X 5EZJB 2CKNA 2WWMC 2AEQH 2BNRB 1QFUH 3T0EE 3QUXD 1INDL 1ACYL 4JLRA 3WIFA 4UNTA 1XF5B 1A7RL 3SCMB 2DQIH 2V5YA 3P4OA 2HMIC 1ES0A 2VLKB 3MUY1 4M1DH 5F96H 1KIQB 4JZNB 5HVHB 3S36L 1ORQB 3C2AL 1JZ4A 1ZGLM 4JO4L 3L3KA 4QT5A 3DSFH 2FBOJ 5CHNB 3C8KA 3GNML 5DQJA 4Y5YA 3I75B 2IH3A 1UQSA 3AREB 1QACA 4X9BA 3EYFB 3V6ZA 1LD9A 4Y5XC 2VLKD 2FATL 3LSOA 4OLZL 4NCC2 2VAJA 3NZHL 5D1XC 1MWAL 4O51B 4UV7H 2R1XB 5K9QG 1GXEA 1DBKH 3TESA 3PDOB 3MRDB 2HVKA 1JNLH 5ISZA 2V2WB 2CLRA 5DEFA 3BQUC 5L9DH 1KLGB 3MJ9H 4QRPE 1VCAA 3VRLE 4P3CL 2GK0B 5F6IC 4KK8D 4WHCA 3FZUD 3O9WB 3W5NA 3CXDH 4GQPH 1IGMH 4QHNA 2ZNXA 4GRWB 1SJHB 4UNUA 2X4NA 2I60L 4C4KO 5CJXA 5DD0H 4PGZA 1HDMB 1QO3A 3ARSA 2CJUL 5ICYB 4BQ6A 3DUSB 1PSKH 2GAZA 3B43A 1MWAB 3V5HA 2ZCKL 4MQ7A 4G8GB 3EYVA 4Y2DC 1HXYB 5I1IL 4KKAC 4E42A 5D7KE 4PJAF 5E6ID 5J06A 2CLVB 1IC4L 3A6BH 4CMMB 3BZFB 2XWJB 3EOBA 3MLZH 3RVXC 1AQKH 3CU7A 3ILPB 4KV5F 4OZGF 5TE7L 1I1AC 4IDJL 5HD8C 1A0QL 1J0IA 4EN3C 3SHSA 1NDMB 4ODUA 3L1OH 1VENA 3VWJA 4ELME 3JTSB 2HRLA 3B2VL 1QTYT 3F6LA 4OF7A 3FQRA 3KNBB 3IAGC 4LCCC 1R3KA 4QHUA 4ENED 4OLYH 3QEQA 1I8MB 2MPAL 1DCLA 3CAFA 5C2BH 1JZ6A 3UP1A 4OKDA 4HEPG 4U7SA 1IGTA 3HUJF 3SGEH 4PP1C 5F3HA 1F4YL 1NKOA 4I3SL 3KGRA 5HXMA 4FZEH 4IRSD 5M7QA 2DQHL 3P2TA 4JKWA 3CSYB 3UJIH 1G9MH 1MCEA 1OSPH 5EU5A 2XZAH 3IYLW 2HG5A 5JW4R 5ACZB 5BVPH 1KIPB 2ZJSH 4KRPC 2B4CL 4LASL 3TCXA 4UOJA 4JRWA 4XHJC 4YDVB 1RK1B 4PJEE 1I1CA 1QR4A 4PJIA 4LSVL 5I1JL 3MROA 3UEZA 4G8FA 4LSRL 5GIRB 3HZYB 4JQXA 1FVEA 1KCVH 1MI5B 5DD6B 5J6HB 5ABDE 4RGOL 1VSCA 5DK2A 3FCTB 4DUWA 3STLA 4PRDB 5J12C 5B39A 4L29A 2O5YL 5GRXG 4U1HA 3FB8B 4OD1L 3CVHL 2EH8H 1RZKH 4NGHH 5DMGC 2HVJB 2GUOA 1MI5D 5JHLH 4LPCA 3HC0B 2D7TL 2NYYD 2BOBA 4M00A 3SDDB 1MNUL 1ZWIB 3DMMB 3BPCB 4FQLH 3BN9D 1AXSB 5HDQH 2WWKT 5FCSH 1ZHKB 3EJYC 4AL8H 1HCFX 4X4XB 2EH7H 1NUFA 1KPRA 4XXDB 1AC6A 5C0FB 4PJHE 5JW4N 4JKLA 4GAYA 2Y4SA 2OLDA 4AEHL 2WZPD 4XP5L 1FJ1A 2XKSA 1RUML 3IFLH 4YPJA 3T0EC 4NHUA 4LVHB 4G9FD 1JZ8A 2P5WB 2D2OA 4U4BA 4NQCD 4GKZA 5A16B 2FL5A 2Q6WA 3ZT6A 1M71B 2VWEE 2VN4A 5HYQA 2Z8WC 3QG7H 5GS0L 4HS6B 3SO3B 4L3CB 5L8JB 5D6DC 1NBVH 1OAUL 4LCWE 5I0ZA 5IBLC 2LU3A 3L7EB 3OZ9H 2QTEA 4X6FA 4LMQI 5DSCA 2FHCA 4GW1B 1QYGH 2HT4D 4MX7A 3MFFA 1KB5A 4O9HH 2MWCA 3I9GH 1IM9A 3RY4A 1S78C 4L9LC 2R1YA 1C1EL 1MJUL 2YA1A 4YC2B 5FO9B 4FTVD 3W82A 5IK3B 2Z31B 5TH2B 1CFSB 4PJ7F 1JYNA 5C07B 1CGVA 1X5GA 1U8KB 4LFHD 4TRPL 1A9EB 2IANB 2C1OA 2KZWA 2OI9B 4NRXA 1SYVB 5T5NF 1S7VA 4LLVB 4L4TE 3GJEA 5EFIA 3BEVB 4EXPX 5E08L 2DQTL 4PJ5B 4WI7A 3RZCD 5EBGA 3DJ9A 1U91A 5C07D 4N90D 2F5BH 3BVNB 2AXFA 3BKJH 3K1KC 2DQDH 4Y19B 4NQUA 3W0WB 1J12A 2F54D 3X17A 2FEDD 2J8UB 2P49B 4YHKL 5F9JA 5SX4I 1AY1H 2BVQA 4LNRB 3B9KA 4JRXB 4RMUA 2OZ4A 2VLRD 5GS0D 1ZHNB 3DSNA 1RZKC 2ERJC 4NO2A 4Z6AT 1T4KA 1IGCL 2CRYA 5JTWA 4LCYB 2PNDA 1AXTL 1ZANH 1BFSA 3U0WL 4ODHH 3UZVB 2ADIB 3GSRA 3WLWD 2IFFH 1YDPA 4ALAH 1IAIL 1ZVHA 5T1KA 3O3EB 1A47A 5E03A 4XB8A 3MR9B 3TBWB 4MS8C 1N0LA 2CIIA 4IOFC 4S0SD 1Q9KB 3O8XD 1AC0A 2BFVL 3LMJH 2AJUL 2Q76B 2VDOL 4O5LH 3UTZA 4C83A 2NW2A 3LV3B 2FR4A 1WSST 4KJPC 3ULUF 5DJXB 4XAKD 1FPTL 4APQD 4LRIC 1NC2A 1NLDH 2HLAB 2WBKA 5IVNA 1VESA 3RGHA 3H3PH 3WXVL 3KXFE 4ODWB 3T0AA 5IP4A 5HHXH 2UWEE 1FGVL 1OP9A 1R3HB 3P0VL 5CZXD 2BJMH 4MNQB 5E6YA 4CU8A 1F2XK 2ARJQ 3AS1A 1WV7T 1RFDH 4N0UA 2BXZA 1RZ7H 4ZAKB 4XBEL 5ALCH 5MP6L 3X14B 1N8ZA 2CKBA 1LO5A 5BZDB 5JXEC 1Q0XH 1XIWB 3QCVL 4JANB 3H3KA 3HPJA 4NWTL 3ZTNH 4ISVA 2FO4B 3MJ8B 3RWHA 4PRPE 3LH2L 1BAFL 4PJ9D 4MA8H 3TT1H 5IGXH 3ARBC 2D7QA 1BBDH 4HWNA 5D2NE 4LSUH 4OBSA 1AIFB 3IS1X 3BOVA 3W2DL 4MB5A 4YDLB 1FL5A 1MFBH 5E8PB 3V0WH 4NKDB 1QP1A 3BESR 1ZLUH 1BJ1H 4DZ8A 3SKJL 3EFFB 1QFHA 3RDTB 2NLJB 1MCCA 2NY7H 5CJOH 4BQCA 3O2VL 2Q8AL 1P1ZB 4WTZG 4G42B 3DO7B 5TGBA 4YHPA 3C6LB 4BZ2L 4TTGA 1MHCB 2D4DA 2AEPH 2DN7A 1T3FB 3M45A 4JR9L 4AYFA 3RWJB 5J7CC 1WJ3A 3D85D 3U46A 5K9OB 4WDIB 1MLBB 3C6LD 4UU9B 4ZTOH 5LBSH 3QWRD 1EEYB 4RNRB 2WWMD 4OCWL 1NCCH 5I2IB 4JHAL 1Q9WA 4M7KH 4MCZB 1K2DA 3C2SA 2BK8A 2YUVA 4P4RA 4LARH 1JZ3A 1RUPH 3KPTA 4Y5XB 3A6CL 1TQCC 2P1YA 4FQ2L 4O02H 2QBWA 2OXGA 3ULVD 4MA7L 4ZFGH 3V8CA 1R5WB 4NQXA 2XZQH 4UTAH 1BBJB 3EDKA 2H6PA 2EYRA 1GZQB 3BYYA 5BV7C 2R15A 4WI6A 3FO2A 3DRTB 5B4MD 4D9QD 3BQUB 5D6CA 1ETZA 5C8JB 1FORH 4Z7OF 4LLWA 1B0GA 1LP9B 2DKSA 2R0WH 5F6IB 1Q8MA 5D1XD 2E3VA 2A0LC 2JELH 5DEZA 4KAQH 3ARTA 4N9GA 2R29H 1DVFC 4WUUE 3WNNA 2HJFA 1ZGLA 2QR0A 3AS0A 3EAKA 1T0PB 5DWUL 2YUWA 3UDWA 1BLNA 2GSIB 1QSFA 5C0BD 3RTQA 2AEQL 1QFUL 4G43A 1S9YA 1QLRB 1ZHBA 3UC0L 3K81A 2PTUA 3OB0H 2DQIL 3TA3D 2WK2A 2C3VA 2XZCH 5DA4A 4M1DL 5F96L 2XG4A 3ARGC 4LDEB 1NC4A 3DSFL 3TO4A 3WN5C 1G7MB 3WUWA 1MLCA 5MEOA 3GBMH 3UTQA 4PLKC 4Z8FH 4YDKH 1JNJA 4Y2DD 1I1AB 4QGTA 1SJEA 4FQQB 2BRQA 2P46B 4KKBC 4NCDA 4EN3B 4UV7L 2R2BA 1DBKL 5FYKL 1E27B 3IETB 2DWEA 1MFCH 1E4XI 4BJLA 1UGNA 3QDJE 1JNLL 1OF2B 2XWTB 4YQXH 1UYWH 3RVXD 2X7LB 5L9DL 2Z9TA 3MJ9L 5DJAB 3WFHB 5BW7A 3AY4C 3P9LB 4HKZB 2F8OA 3CXDL 3FHQA 3SQBA 1IGML 4D9LL 4RGNC 4PJ8C 1MCHA 4DWHA 1J0YA 1UWEH 1XGRA 2GTZA 4TUJA 2AQ2A 4N5ED 3VFWA 5DD0L 3BPOB 4FFVC 4XBPB 3S88H 1I3RA 2G9HA 3O3AA 4IJ3C 4GG6F 1KTDA 2OMBA 4R4BB 3B9AA 3WO4C 1PSKL 5KN5A 3ARPA 4OT1H 4XVUC 5D7IE 1TJHH 1RY7B 1EZVX 4KKLD 3TNNA 2MCPL 4HPYH 4N0RA 5C0GB 3PWNA 5E1AB 4OGYH 1WWCA 4EI5D 3KS0H 5BZWB 2DLHA 1CD1A 3WNLA 3A6BL 1DANT 2C3WA 4KRPB 1V3LA 2CDFA 3MLZL 4F7TA 5IW6B 3ARZA 4V2BA 5D9SB 1AQKL 5FYKD 1FNGA 3MOBH 1KN4H 5B22A 1D5ZB 3TBSB 4K23H 2BVUA 3L1OL 2Z93A 3R8BB 3D69B 3S96A 5C1MB 4KRPD 5J12B 4F2MB 4N1EA 5H2BA 4Z7VB 4ORGA 3QQ4A 1DBJH 3HB3C 5DTFB 3RA7H 5C6WH 4HIJA 2AEWA 3NCFB 2OK0L 2X9YA 4O2EB 3N06B 4NYLB 4AQOA 2HTKC 1DDHB 4L4VD 4OLYL 5SX5K 5FECA 4TTDC 5IM7B 2VABB 4MAUH 1HHGA 2OR8A 1MF2H 2ICEA 3MNVA 4ONGH 4GAGL 2OTPA 3E6HB 4HUXA 4L8DB 3QDGB 4RQQB 5DHVA 2BDNH 1J8HB 2Y5TA 2W60B 5DMGD 5EZJA 5C0CB 4FZEL 5JMOC 2YRPA 5C09B 3SCMA 3UJIL 5ESQB 2H1PH 1ITBB 4X4ZA 3CCHB 1OSPL 2EE2A 3X12B 3QDGD 2VLKA 2PUQT 2XZAL 5FHBH 3HPLB 3T0EB 1KIQA 4JZNA 1ORQA 3NACH 3B8SA 4BYHA 3BEWB 3F12B 4RRPA 4ESKA 5BVPL 3OAYK 5CHNA 5JOFB 1GHFH 4LPYA 4HT1H 1KXVC 3LEXB 7CGTA 1I9EA 2NTSP 1NAMH 4D0CB 3UBXA 4U33A 1KCVL 4O51A 1RJCA 2DAVA 1QPPA 3LS5H 4HLZG 4JPWH 1FL6B 3PDOA 3MRDA 4OQ1A 4L9LB 2EH8L 1RZKL 4NGHL 2V2WA 5L2KB 4I1NB 3U6RB 1KLGA 5JHLL 3RIFK 1NEZA 1BEYH 2GK0A 2NZ9C 2L7UA 2DMKA 1W8OA 2X4TB 4FQLL 4WFGE 1NGQH 4PJBF 5HDQL 5F7NC 3BGAA 1S78D 4AL8L 5E99H 5IMLA 5L2KD 1GIGL 4P2OC 1HDMA 1JI2A 2UY7A 4MLIA 5ICYA 4YXKL 1OM3H 4UNVA 3PHQB 3PABB 1Q38A 3DUSA 3OJ2C 4F37K 1MWAA 3IFLL 4G8GA 2J8UF 1NSNH 4MVBD 1HXYA 2Y07H 3HZVA 1IJ9A 4D0BA 1IKFH 2FIKB 1AJ7H 3ZKMC 2FYYB 2JB6B 2X41A 3UPRA 2CLVA 1E4JA 2F9BT 3QG7L 5HGAA 4CMMA 5LQBL 3BZFA 1MCPH 3GKWH 1LE5B 2UZYB 1SVZA 3OZ9L 1BF2A 3FONB 3ILPA 5FYLD 4D0DB 4P57A 1QYGL 1A6ZB 1UA6H 2ICWA 4O9HL 3I9GL 1J0ZA 1NDMA 4F7EA 3JTSA 4HK0B 2VYRE 4HFUH 1PKQB 4KK9D 1MCSA 3MA9H 5FGBC 3KNBA 4ELMB 5MHSE 3MCG1 2E7MA 3QULB 2X89D 1EJ6A 1IQDB 3O0RH 3ULSB 1I8MA 3ARDD 4IRSA 5DJ0B 4ACPA 3MUHL 5IT2L 4ZDHA 3N1FC 2OCFD 2F5BL 5GISL 3BKJL 3TZVB 2DQDL 5D5ME 4PRID 5BS0E 4Y4HC 1WAAF 4YZFF 5FYJH 1AY1L 3CSYA 2AJVH 1EO5A 1C5CH 1CFVL 4TPRL 5JOPE 4X0KA 5ACZA 5DMKB 3RAJH 5IIEB 3B3IA 3SGKA 3SDYH 3ZKSD 1UEMA 4M7ZC 1ZANL 4YDVA 4ODHL 4UIKH 1B0WA 1RK1A 4OUUB 4ZFZB 3RWEA 3ISWA 2IFFL 1NCBH 4ALAL 5HHQB 2ED7A 3ARBB 3CDCA 2DF3A 1LHZA 5GIRA 5KZCD 3HZYA 1MI5A 1RZ8A 3C60C 2RBLA 1IC5H 3PWPE 5J6HA 2WIIB 4L8CB 2DYPB 5JXED 3FCTA 1NCTA 3LQZB 3QIUC 2IAMC 1GGCH 3FB8A 3LMJL 5I1EH 4HIEB 2EO1A 4O5LL 3VXSE 2BSTB 5KSVB 2KUTA 2HVJA 4KHTH 3HC0A 1B6UA 3F58H 3BIKA 4KKNA 1R5IB 2E7LC 5T5FH 3DMMA 3BPCA 3TYGH 1GH7A 1AXSA 1NLDL 1YMMD 1F02I 5CWSB 1ZHKA 4X4XA 3H3PL 4WW1B 3X11B 1CYGA 4G9FA 4XXDA 1A4JB 5HHXL 5BV7L 2BJML 5T33H 5C0FA 1XGTB 1FNSH 1RFDL 2W91A 5CJ5A 3BP5B 2P24B 1LO4H 4UTBH 5HI3D 2EECA 4L9DA 2IBZX 2BNQE 5ALCL 4DKAA 4LPWA 2H2PD 2DQEH 5GGUB 4PJHB 3CVHA 5A16A 2JCCF 1M71A 3ZTNL 2AJYH 2DQFB 2OP4H 1B4JH 4MA8L 3TT1L 1CXFA 1TQCB 4HS6A 1CFNA 4L3CA 3UROR 4FTVA 4TVPL 2YD7A 4AM0B 5MERB 1VGKB 4GW1A 3SKOB 5AZ2H 3IDIB 1MFBL 4LPTA 5BV7B 3QPQC 5FO9A 1N6UA 3WO3B 5IK3A 4XPGL 1IEAB 1P84J 3MTRA 2Z31A 5TH2A 1CFSA 5CJOL 5C07A 4P5KB 2G5BA 5D1QD 2EEDA 1MUJB 2V2TA 2HT3C 3OSKA 1U8KA 2NNAB 1DVFB 3VW3H 1A9EA 2IANA 4QRRD 2GITB 1SYVA 3K2MC 3LS4H 2AERT 4LLVA 3U9PH 2AEPL 3BEVA 4MQXD 4PJ5A 1PG7H 3C9NB 2DBLH 3CUPB 2YUXA 3HMXH 4Y19A 3WEXB 3DNKA 1DVFD 3IAPA 4ZTOL 2J8UA 3F7YB 5LBSL 3ARGB 4LNRA 5MENE 5KBNC 4JRXA 1G7QB 3CPLB 1NCCL 2YK1H 1ZHNA 4M7KL 3WN5B 2OYPA 1EHAA 4WGVB 1AD0B 4TVPD 4LARL 1RUPL 5DD1H 2V5SA 1CXIA 4O2CB 1U8LB 1ZT4B 3ARUA 2I5YL 4LCYA 5I8KH 1H3GA 4O02L 1CFQB 3T77B 5IR1B 4ZFGL 3O8XA 3I50H 1RIVH 3OL2A 4PJCE 1PD6A 3KLDA 3H0TB 5D4QA 4NZDA 4GJTB 2XZQL 1TTFA 1Z9OA 3O3EA 4UTAL 1F13A 2IBBA 3RNQA 3MR9A 5ESVB 3TBWA 4JZJC 1ORSA 3NA9H 1Q9KA 1FORL 4PJXF 2R0WL 4JFED 2JELL 3LV3A 4K8RD 4KAQL 3GEWB 4RGNB 3TVMC 2R29L 2Y25A 3RJDA 5DJXA 2YEZB 3A0OA 3EJJX 4ZMAT 5EU4B 2D7NA 5JHDD 3TBYB 1QA9B 4U2YA 1FFQA 4PJGB 5I73C 1U58B 5DJ2B 3TWCH 1YN6A 1UWGH 3MJ6A 4KKCC 5I8EB 3WO4B 4RGND 4PJ8D 2XZCL 3DHMA 1R3HA 4RDQG 3RX5A 4PD4K 3RX7A 3EDFA 5TQ2H 1KCSH 1PEZA 1VEOA 3SJVD 2EZ0D 3BKCH 1QD0A 5B8CC 4HS8H 3KXFB 1N5AA 1IZJA 2UWEB 3X14A 5BZDA 3GBML 2BY1A 1XIWA 2YD3A 4Z8FL 4XVUD 4YDKL 1E28B 1WCQA 2FO4A 4JFXA 2R9HC 4LHUG 4IOIB 4OIIH 3MLRH 1FAIH 3WHE1 3VFNB 5DC9B 3AROA 1MFCL 1AIFA 2AEIT 1CDYA 4YQXL 1UYWL 2RAMA 1ZS8B 3V5KB 4PRPB 1X5FA 2IG2H 2M8XA 1VGEL 3M07A 4X6CE 4Z7VF 1FNAA 5TDOB 4NKDA 4YR6B 3EFFA 3HNTH 3RDTA 3G5YB 5FKAB 2XV6B 5DVOA 1UWEL 3OKDB 3BD4A 2E27H 3S97C 4G42A 3DO7A 2D0GA 2IGFH 5SWZE 5EG6C 3S88L 1RI8A 3S98A 1WVZA 3C6LA 3SGEI 3QWRA 5TE4H 2HTKD 4P2RD 2DQUL 3GO1H 1MHCA 3FO0H 2WAHA 2CLZB 4OT1L 5KS9B 1TJHL 2X09A 3RWJA 5EOQH 4HPYL 5K9OA 4WDIA 1A3LL 2FSEB 1MLBA 3NIDF 4OGYL 4UU9A 2GSGA 1TJGH 3LKPB 1EEYA 4RNRA 1T03H 4QLRA 5I2IA 3VXME 4MCZA 5HY9B 3ARFD 2ZSWB 3IFNH 3MOBL 4Y5XA 1EEQA 4ZUWB 1KN4L 2LVCA 5IF0B 1DQDH 4LPXA 4K23L 3ULUD 5EU6D 1JZ5A 1R5WA 5D1XA 1BBJA 1DBJL 3QH3B 3RA7L 1GZQA 5IMMA 3DRTA 2D31B 1QKZH 2VDPH 3CGTA 4GKOA 1I1RA 3BQUA 5C8JA 4WNQA 1LP9A 5KANI 2F15A 4CVUA 4MAUL 1UEYA 1MF2L 4BKLB 2F8XC 1OCWL 2BDNL 3DVNB 4C56D 2GSIA 4I3RH 5L8KB 4JVWA 2C4XA 4P2OB 5KSBE 3KLHC 4IMKC 1QLRA 1CF8L 2CDEA 2I24N 4K2UH 2C7UB 2B5IC 2H1PL 4WUUB 1G84A 3O81A 5FHBL 5HYFA 2XQYG 4A6YH 4YGVB 4MYWB 5EC1B 3NACL 4Y2DA 5ERWA 5L2JB 1NMCC 2YR3A 1RZJH 3BUYA 1GHFL 5J13C 3X3FH 4HT1L 4M7LH 3CMGA 1D5MB 1G7MA 2A6KB 2LE9A 1NAML 4JN1H 2IWGA 5E94B 2OTWB 3MCKA 5D71H 1H3PH 1I1AA 5T1LD 4A2MA 4YUEH 3LS5L 3KDMA 4JPWL 1E27A 4YX2H 4NO0D 2MKLC 3VG9C 3LRSB 1OF2A 3PWLA 2OJEB 2X7LA 3HZMB 5DJAA 3RVTC 4J1UA 1BEYL 4M7LT 1HE7A 3QT2A 3QDAA 4HKZA 4LCCA 1DL7H 3QDJB 2NR6C 4ELMF 5C7XL 4N0YH 2EIZB 4OZFH 5E99L 2X6MA 3UJJH 2E9JA 2YPVL 1SYSB 4X7TA 4FP8H 1NAMB 5JIIA 3BKMH 3QEGL 1OM3L 4QO1A 4R4BA 1YNLL 1YUHA 4Y4HB 3OAZH 4N9OB 4WY7H 2O61B 2WUBH 2P43B 1NSNL 1U8MB 2Y07L 4TOYH 1IKFL 1AJ7L 3QUKA 1FBIH 3MJ9A 5BZWA 4P48A 1IGIH 4YHIB 5JDJA 1MCPL 3FO9B 3GKWL 3IRPX 3WUZA 4M7ZB 3OB0K 1S7QA 3WS6C 4POYA 4OGXH 4R7DA 1UA6L 3TBSA 3C60B 1EFQA 2WNGA 3JVGC 4K55A 3NPSC 3S35H 4UBDD 2YD4A 4LSSH 4XH2B 3D69A 4Z7WE 3IXAB 3QIUB 4LOUC 4YJZL 4F2MA 2IAMB 4X8XA 4Z7VA 4HFUL 1RIHH 1HK6A 5K59E 4PJEF 3MA9L 4POZD 4O2EA 3QZWA 1GSMA 4XMKL 1DDHA 3O0RL 5IM7A 1OY3B 2VABA 2CD0A 4PJFA 1KYOJ 5E70A 3PG2A 5J9PB 3E6HA 4L8DA 3QDGA 4RQQA 3EO1A 4MHHG 1FE8H 5E2TH 2FWOB 1J8HA 2W60A 2W0FB 5C0CA 2KQMA 5FYJL 3CH8A 2Q7YB 3LEVH 5ESQA 3FTGB 4HS3B 2BCKB 4D9RD 2VDQL 1C5CL 3CCHA 4MWFB 3X12A