3U9UB

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Fab Heavy Chain
total genus 52
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB01
4YHOH 4JQVC 3PWPB 2BJML 1A7PL 4NN6B 1UQSA 1KJMA 3TBYA 1F58L 1ZT7A 3AB0B 1ZLUH 1KG0B 1F4HA 3T3ME 1H8NA 3VDBA 1UFUA 4L8BB 5IP4A 4ELME 1Q72H 1JGVH 2VISB 4LNRB 3V8CA 2R9HC 3GMRA 3K0WA 3KAAA 1CDYA 1RUML 2FGWL 4QXUH 1OP5K 5DWUH 4R3SA 1A6TB 3OPZH 1MLCB 2DQIL 3MLWH 1WCQA 1U8QB 4R8WH 2RBLA 5EOQH 4OLVH 3VXRE 3FQNA 5E7BA 1W0WB 5IMOA 5LAXA 4JFXA 2CLZA 3D39D 3CSBA 1JPFB 5K9JL 3OR6B 2DJUA 2WM0A 1RK1B 1RUAH 1XF2B 3DUHA 5GGVY 3O8XA 3OL2A 3TM6A 4OZHB 4PJEB 3D85D 5CD5C 3MRGB 4WWKC 5K9QG 1YJDL 4L8CA 3IJSB 4EVNB 5FB8B 1XF2A 1S8DA 1JGDA 4ZUTB 1IGJA 5D9SA 4GG6B 3HZVB 3O3AA 3RZCC 4I18A 4QHUB 3HI1B 5HYJD 2C3GA 4Z7WF 1ZLSH 1VADA 4KC3B 3KPRB 4U1HA 4DOHB 2MCG1 5F9AC 2LTQC 4WENB 1S7RA 5J6HB 2MOVA 5IHBA 4RMQA 4C56D 4YHYC 1BQHB 5FA3B 4WIQA 1IGJB 5D9SB 4M1DH 3UAJC 1QSZA 1XCQA 3O3DA 4LPTA 1G9MH 2VL5B 2ARJA 1U8MA 3AU1A 1GGCL 3NMEA 3OB0H 2Q87A 5KVEL 5LQBH 2R1YB 4O51B 3GNMH 1NCDL 1EERB 4JGMA 4YXLL 4HCRA 1A6WH 1INDL 1R5VB 1I1YA 3Q3GB 1FO0L 2H3NA 1AFVL 5MI0B 3SJVB 2NX5A 2E9JA 3RWEA 3RWFB 1FSKC 3GDBA 3VXRD 3X13B 2X4UB 1IMHC 4G8EB 4WGVB 4M8VA 4YUEL 3PQYE 2XQBH 4HUUB 4NNYB 3VJ6B 5EIIA 3GZKA 3JWNC 3ARFA 3NPSC 4OGYL 3W9DA 4W68A 1GZQB 4K9EC 5EZLB 3M1BB 4G6FD 3DVIA 4PB9H 4IMKA 4WI5A 5TF0A 1IAKB 2WANA 3D48R 3QI9C 4MJIE 3MLUH 2ZSVA 4PJ8A 2IBBA 4J8RA 4JDZA 5J12B 3S36L 1ROWA 3BWAA 1DDHA 3G08A 2L7JA 1QLRB 5A2KH 5FF6A 4AH2A 1X5GA 1WLHA 3O2WL 2OSLA 4JFDE 3SO3B 5C0DA 1T1WA 2ENSA 5IHZA 2QSCL 3RAJL 4IMLA 2VDNL 5IVOA 1C5BL 1MFCL 3DX6A 3WUZA 4QWWD 3D3VE 4K8RH 5EB9A 1GGBH 4M1DL 5EC2B 3MRNA 5ERWA 2B0SH 5EZIH 4L8SA 5E2WH 3N1MC 3VFMA 2DDQH 3TO4C 2G5BA 4LVHB 1YNKL 2A6IB 4JHAH 4DEPB 1LD9A 1MFDH 4NP4L 5J1AA 3FHQA 5CILL 4HGWA 1KJ2A 2NY2C 3W5MA 5HDQL 2DLEA 1T1YB 5T3ZE 2XRAH 5CHNB 1CDGA 1I1FB 1KB9K 4FQCH 3A0OA 4PY8J 1UT9A 3OJDA 1KN4L 3O11A 3VXPB 3O6LH 1Z9SA 4P23B 3KPPA 5CLWA 4X6EB 3U4AA 4N5UA 4Z7UB 2JJVA 5LKNA 1T22B 2PR4H 3LH2H 4O51A 2DQEH 4H1LH 2ED8A 3GJFA 4PJFA 2VDRH 4YAQB 3R4DA 5F6IB 2GFBB 3RDTB 3RUGE 3O4LA 3KR3H 4FFVC 2X4OA 5D6DC 5MENA 1A4KA 2P5EA 2BSED 3C5JB 2R29L 1ERNA 1JGEB 1QEWB 2B2XL 2O5YL 4TTDD 4UU9A 2J3SA 3DRTB 1YEKH 4XC1H 1ACYH 4DEPC 3U4BH 4BFEA 3IDXH 2DMBA 3VGGA 3R1GL 4W4NA 2N7AA 3DUSB 3OR7A 3ZKQD 4LLQB 4HK3N 4GKSB 3HR5A 1S7WB 3ZDYF 1GGBL 4XCNB 1SYSA 2VXVH 4PJCA 5ADPH 4I1NB 2XPGB 4GS7B 1PY4A 1TVHA 2BVQA 5I66A 4P2OA 4JQXC 3W11D 3CMGA 3LB6C 4UQ3B 4JY5L 1JMZA 1AGBB 5I8OH 1DR9A 1CFTB 1NAKL 4QTIH 2NTSP 1F4WH 3WFHA 4K3DL 2GITA 1UWXH 1C08B 2Q7NA 1RUPH 1MREH 5GS0L 4CVUA 5D71H 1NCCL 3TJEL 1RZFH 2J4WH 2F19H 1FCCA 2ATPA 4GQ9H 3CXDH 5A3ID 5BRZA 3PL6D 1SEBB 2ZCHL 3QDJB 4HUWA 1HHGB 3O6LL 5EU5B 1B88A 1FGNL 3KPRE 2GITB 2R56H 3U9PL 1WTLA 2WSKA 2PR4L 5EC2A 4U1LB 4P9HC 4HDIB 3RIFF 1A14L 4NIKB 5AZ2H 4NOFA 4P2RE 3FKUS 1BBDH 4NQSB 1FAIL 3O8XB 3LSOA 1WV7T 5C6WH 4XPFH 4ORGA 2MNUA 1CWVA 1VERA 3F7YA 2UYLA 2AXJA 1NGPH 3EO0B 4EN3B 5H35B 4U7KA 3RNKB 3B4NA 5F7NC 3T0EC 3NN8A 4U4BA 1RIHH 5L7XH 5EZOH 4LFHD 1RURH 1PFCA 4AZ8A 1S9WB 3WSQH 3LDBB 3QDME 2ICEB 1VGKA 1VSCA 1WWCA 1X6LA 4GBXC 4H1LG 4JLRA 4Z95H 2XA8H 3I3BA 4R2GB 1A7OH 5E8PA 4P4KD 1X4XA 3TNNA 4WU5B 3SHSA 1OGAB 4ELKB 2EDFA 4RMRA 2F5BL 2LAAA 2VXQH 1F4WL 2XN9B 1R5WA 2YHGA 5CGTA 5JQ6L 1SYVA 1ULVA 3TPUA 4TTGA 1QR4A 3L3HB 1T3FB 3IFPA 1LO2H 2Q76B 4C54A 1HH6A 1I1YB 3Q3GA 4JFDD 4YHZL 3U7YL 4JFHE 5I15L 4O2CB 3KPLB 4QRRB 1BOGB 4NUJB 4NQUA 4P2RD 3WJLA 1XIWA 4NC1E 3SDXA 2OTUB 1JZ7A 1PLGL 1IEHA 4WDIB 3D0VB 5IW1A 1E4WL 3BP4A 1Z6JT 4NNPL 4RQQB 2ADJA 3WFCH 4HJ0D 1NUNB 4RWYH 4BQBA 4KKLC 5KW9H 2C7UB 5DZNA 2VDOH 3RL2A 4WCYH 3FFDA 3HKFA 1OTUC 1IT9L 1P7KA 5I9QC 3JWOL 1MFNA 2GI7A 3BO8B 1QNZL 1UQSB 3L3IA 3EFFA 1N3NB 5K9KA 4LVEA 5C2BL 1XF5B 5JXED 4KROD 1B2WH 2PXYC 2XNAB 4L8BA 5DC0A 1YQVH 3GMNA 4FQJL 4J3OC 1C8PA 8FABB 1Z0MA 3WSQL 3QPQC 4WWKA 2CPCA 1MRDH 4MHHG 3QNYB 2F15A 1BLNA 4XAWH 4P46A 1Q94B 5EU6E 4OZ4A 3SKNA 3HUJE 5HI4C 1YMME 1Q1JH 4N0CD 3GGWA 3FQNB 2ZUXA 3MJ9L 1F4XL 1P6FA 3PHQB 2Y06L 3JV5A 4XX1G 5ITFB 4WFGE 2ZUYA 3TYFA 3GBML 3F7QA 2PO6C 4XH2B 1V7MH 2VB5A 2N7BA 2X10A 2X4RA 1U2HA 4K3JH 3GHBL 5HHPA 3LKPB 3CSYA 5KOVC 1T83A 1KPRB 3P0VH 3BAEH 1NMCB 4IDJH 1GGTA 3UTPD 4ZS6C 1G9NH 4RZCA 1NCBL 1R3JA 4HMDA 4QT5B 1KN2L 3MLZL 4V2BA 2G2RB 3WBDA 5JNYB 5GS1A 1D6VL 1WBXB 2D0HA 1J12A 4MJ6A 4X9FA 4L5FH 3FO1A 5DMGD 1LEIB 4JZJC 4OLVL 1MF2H 1F11B 5I9QB 1QLFA 3QNZB 3JWOH 4JJ5B 3ROOA 3JVGC 1GOHA 5JNYA 3M07A 4AT6B 3D69B 1X7QA 3VXUA 1J1PH 4I0CC 5CKAA 2DTSA 2NCMA 1L4IA 2XY1A 3LEVL 4HIHB 2VIRB 4RGOL 3P77A 3V6OA 3ULUD 3Q6FA 25C8L 4PFEA 2NTFB 1L0QA 2IADB 3HZMA 1HE7A 2MSPA 2J6EH 1AO7A 5I1HH 1O7VA 3O0RH 3BXNA 3V2AR 1RJYB 1W72H 4UAOB 4UAOC 5HHMB 1DQQB 2VLKB 5C0NC 2JCCB 2UUDH 1XGPB 2VRAA 4JFQA 4G6AC 5ADOL 5FM5M 1UZ8B 3CH8A 5HDOA 4I3SH 4M5ZL 3D3VB 4Z78A 3GBMH 1K8DB 1DBJH 2Q6WA 4FOMA 2A6JB 4BZ2L 2E9IA 5IT2L 1T7YA 5D2LB 5FYLD 4U1JB 1IEBB 4FNLH 3IDYC 3LS4H 2RCSH 1SYSB 3CGTA 4O2FB 3EOBA 2VN7A 3GRWH 4B0MM 1AR2A 1G7IB 3NOIA 4F3FB 3BESR 1K8IB 2NXZD 1A02N 2D7QA 4GW5B 4AIOA 5D1ZB 3DX6B 4PGCB 1X9QA 2Q7YA 3ARDB 1JWSB 3GUTA 3C08H 4Z76B 4NHCH 3ZE1E 3RX5A 3W5NA 1VA9A 1CG9B 5IG7B 3V4VH 4U0QB 3IDUA 5F1KC 2PO6B 4DVRH 1H15A 3MXVL 1JNLL 3T65A 4KPHL 3FN9A 1AR1C 2VDPL 1U8JB 3DTXA 3BMWA 3LRGA 5T3XE 2IBZY 1AQDB 4Y1AD 2JB6A 1F90L 1EVTC 3SBWA 4KFZC 1FSKB 3GSWA 3H9YA 2D7TL 4OLYH 3SE9L 2VH5L 1OW0A 3CVHA 1SY6A 3GMQA 3V7MA 3P4LA 5B22A 4XCYA 1DQDL 1F11A 1BF8A 3QDJE 3MNZA 3O3AB 2VITA 4ZUWB 4DKFL 1ZGLA 4BZ2H 4X9GA 3B43A 4ODBD 1S5HA 4QXTB 3DXAD 4WTXA 5DZOA 3VXSE 4HKJB 1IGIH 4MJ6B 4ZXBB 3BZFA 3VFOA 1AXTH 1RHHA 1PX3A 3S37H 3QEUB 4JHAL 1K5NB 1D6EA 1T2QL 2CK0H 4KK5D 2P5WB 3TWCH 5C0BA 3UO1H 2Z8RA 3RVTC 3VXPA 4IDLA 2J5LC 4LCYB 3R8QA 1XIWD 3LVEA 1XR9B 4UOW1 4XGZA 5C7XH 5D7LA 2BNQE 1F8TH 2NPLX 2HLAA 3M8OL 1G0YR 1OY3B 4L4VD 3NFNB 1H3TA 5F6HJ 2I07A 5LCVL 4MQSB 4PP2B 3OHXA 3NZHH 1NBYB 2YRPA 1U6AH 3KGRA 3QNXA 5HD8C 3RHWK 2PCPA 1I8IA 5DUMH 2A6DA 5C08A 5GISH 3VFUA 1RK0B 1S5IH 1L0YA 2ZUSA 1EFXB 3N0PB 1MFEL 1J1XH 4HKXA 5DA4A 4LU5H 1HILB 4NDMA 5IF0B 3OGOE 3C2AL 2ZUVA 2GK0A 3T8XB 2RQ8A 3IKCB 4NZTH 2ADIA 3ARWA 4G8EA 2D7TH 3SOBL 4B7IA 3VWJA 2D7OA 3P0YL 3N1QC 4CL7A 1HILA 1T0NB 2VLRA 2NY1D 2B1HH 4HUXB 4BELD 3QEGH 4GSDL 4KRMB 2E27H 1JNNH 5AAWA 4BFIA 1QSFE 2H9GB 5FAAA 3HE6D 1I1AC 1T2JA 2XTJC 4OTXL 4B41A 2VLKD 3MYJA 3WDHA 3KJ6L 4WFED 3QXWA 2XKSA 3TZVD 4EUPA 3PDGA 4NZDA 1NUFA 4P4RB 4ZNEE 4W4OC 1J0KA 5SWSA 5HPMB 4LRIA 4LCIH 3HCVA 4M7LL 4NO5A 2C3XA 4PRAB 2BSSB 4DUWA 5IVXB 3DO7B 5I1DB 4DGIH 4MCYA 1MQ8A 3H9SD 4W4OA 1U6AL 4CW1B 5DS8A 2OMNA 2YPLD 3O81A 1NGWA 3Q6GL 3T09A 3RJQB 1P9MA 4HT1H 4PJ9D 5AZ2L 4HIIB 4Q6IA 1DLHA 3S35L 3IXTA 5C08D 1J8HD 1YEIL 2AEPL 5AYUH 3X14B 4JG1H 4Q2ZA 1WZLA 3ZDYE 3PG2A 5IJVA 5EU7C 5EG6C 2BY1A 4J3XA 3C5JA 3HZVA 5TF1H 2X1XR 5CSGA 4OLXL 3TBWB 3SE4C 4U6YB 4N68A 5GZOD 4EVNA 1YEEL 3JTSB 3QEUA 4NFBA 5D7IE 4JZNA 4NM4H 4F9PC 2XZAH 5CKGA 1E27B 1LK2A 2EC9T 3O3EB 1NFIB 3H0TB 4YGVB 4JQIH 5BS0B 5DD3L 1E6OH 1KT2B 2NTFA 4C59B 4S2SA 4OTXH 4XHQA 5DFWH 5C0EA 4PJXE 3EDFA 3QHFH 5F3BB 3QQ9C 4KZEH 3U9UB 1KIQA 4XNXH 4OF8A 2JIXD 1JBJA 4OT1H 3VCLA 1IILE 1UH4A 3RVWD 3SCMC 2WV3A 3GEWB 1UJ3B 1DBKH 5KJRL 3KPMA 1MNUL 2BOBA 1N2RA 1KJ2L 32C2B 1IQWH 3C5ZC 4P99A 1NKOA 1FNEB 1JWMB 4WI4A 3AXLA 3V6OC 3BZ4A 3LN9A 1GC1C 3FJTA 5HI3D 3UJJH 2EDWA 4S1QL 4UNTA 4BH8B 2WP3O 3QIUC 4O2EA 1QFWI 2W59A 5D1XD 3VWJB 2YD9A 2R9HD 1YEIH 2AEPH 1TLKA 4HEPG 4KJPC 5EOCH 5I18H 1AD0A 3CFEA 5HHOA 5IW3A 2Y07H 1TZIA 2D3VA 3WKMH 5DK2B 4AJ0A 4WEMB 1EUTA 1T4KA 1TPXC 5JTWA 4OFIA 4AG4H 1N7MH 2IALA 2HJLA 4OZ4B 3WNLA 3TH4T 3H3PL 4GW1B 4DZBA 2IG2H 3I85A 1UKQA 2PTTB 4DFHA 3FRPG 4Y2DD 1YNTB 1MAMH 5KOMC 3WDJA 1HINL 1B3JA 4GAJH 4BSJA 5IMLA 3W11C 4XPTH 3CK0H 1I3VA 2R0KL 2V6HA 3ARFC 3F6LA 4YHML 1UVQA 3T4AB 3PP4L 2GJ6B 2IPKB 3NBNA 3L6FB 3IAGC 5CEZL 3QP3A 3PQYB 4K7PL 5ANME 5B39B 4XTRC 3ARGC 4BK4A 3UZVB 5IMLB 4X80H 4RMVA 2V2TA 3BQUD 1MHHA 4LAQL 2R69H 1R3HA 3KYMA 5JDJA 2HT3C 1EEYB 1NLDL 2MCPH 4GG8A 3JTSA 3UYPA 2E7HA 3PABA 4LHJB 1YY8A 1HHKB 1W0VA 5TQ0H 2FIRT 2CLZB 2RFXA 2VABB 4UINH 3FMGL 3MXWH 5C2UB 1LVEA 1MCBA 4JY4B 2IPUK 3K80A 5F44A 1ONQA 4C4KO 4Y2DC 4WFGD 3U36B 3VA6A 4LDOB 3FRUA 3BZEB 3KXFA 5KVDL 2EH7H 2YN5A 5ETUA 3IJSA 5T33H 5EBLB 5HYJB 2P8PB 2NY6B 3F12B 3MJ7B 3QUKA 1RJLB 1REIA 2YPVH 2JJTA 1KJ3L 3MRJA 4MNGE 5DJAB 3AS2A 4D9QE 1BFTA 3LKRA 1FJ1B 4WTWA 1IFHH 1A21A 5E8OB 3MCKA 3KYOA 1I8IB 3CFDB 4GFTB 3VXRA 1I7UA 2AK4A 4AQ1B 3KWWA 2GSGA 2VQTA 1FVCB 4ZAKD 3C60B 3ILQC 1IGCL 2ZJSH 1EHLH 3L3DB 5D7JA 3C9NA 3SDYL 3TA3B 4J3UA 3V7AG 1QQDB 3GMRB 4NZUL 5FO7A 1RUQH 1M1SA 3MO1A 2B1AL 3F62A 5EUOA 1B6DA 1D9KB 1J05A 4R96A 3ARZA 1VFAB 5BV7H 5CZXC 2VDKH 1IM9B 3T0DA 5FO9A 1S7TB 1UB5B 2F53E 3NFPB 2QBWA 4L4TB 2V5RA 4LHUA 1NDMA 2CKNA 5J57B 4HS8H 1Q9LA 1NGZA 2EZ0C 2OLDA 3QWOA 2HVKA 2BMKA 1DDHB 2VLMD 5SWZB 3VG9C 5E4EB 4WEBH 1A3LH 4KROC 2R2HA 3G5ZB 4YLQT 1JGDB 1V8HA 1YY9D 4FMKA 5L9DL 3MLXH 1NMCC 3IDJB 2EDOA 3BJLA 4F33B 1MHCA 1B4JL 4D0CA 1KJ3H 2DQHL 4RGNC 2BC4A 2WUCL 5I8CB 3ETBF 3BJ91 4YHKL 4ISVA 3O6FD 4LCCA 4EI6A 3OG6B 4NN7C 1MHEA 3WUWB 1U0QA 3BRDA 1GRWA 2XZQL 2ZUWA 4FZ8L 4OCWL 4G9FE 1UKTA 4OD2B 1EH9A 2IH1B 3GMMB 4EQ3A 4MJIA 3L7FA 1MJ7L 4NKIL 4PY7B 5TFSH 4KK9C 1H3XA 5B38B 4PGBB 4OCSH 2OI9B 3LKSB 5B39G 3TIEB 5BRZD 1KBGH 4LSQH 4JFDA 1GC1H 1MQKH 1SY6H 3TBTA 5JDSB 3EFFB 5MEOA 4PLNC 2V9TA 4JFED 3WJLC 2GTWA 3MRMB 3QXAB 5EU4A 5FCSH 2QL1A 1OAXL 4YX2L 3MSPA 4HV8A 1U8NA 4XPBH 3SGJA 5IR1B 1VKXA 1OD7A 4CNIA 3BHBA 3KNBA 1CZ8L 5HGAB 1U3HD 1MRCL 3S5LG 3QUYC 5GGTH 3HS0A 4P9HH 2W0PA 4PJIA 4XT1C 3NPSB 4PV9B 3KDMB 2WBJC 2X4QB 3U7YH 4Z5RB 4N8VG 5F8RC 1AGFB 1D5ZA 1EMTH 2E7LC 5TJWK 4G7YL 1UM6H 4PGCA 4Q6YA 2VLME 4GMSL 1WVZA 5EWIH 4QRPD 4KJYB 5JXAL 3P4OB 4U1KA 5HHOB 1DTUA 3QIBC 3SY0B 3JTTA 1EEZB 4LLDB 3NFSH 1M7DA 2PW1B 3LD8C 5IOPB 1T6VN 2BNRE 1KNOB 1JHTB 3QDAA 4J6RH 4WWID 5CUSH 3S5LB 1II4E 4MWFB 5F7HA 4NQDB 1JPST 2CK2A 1PYWA 5GGQH 3KYKL 2VDLL 1WCBB 1MFDL 4R4BB 3U0TB 5ESQB 3KPPB 4X9IA 1QBAA 2B5IB 3VXQA 1U93A 4R7NA 1MCRA 1OAXH 5D6CB 1IGMH 5FCUH 4F7MB 3MJ9H 5TH2A 1T89A 5HHQB 1MWAA 4HAFA 3ORJA 5AUMA 1EO8H 5CEZE 4BKLA 1VGKB 1OAKH 1B6UA 5E2UL 3RL1A 5C9JB 1TDQA 2KKQA 1RZ7L 4ETQB 5JHDD 4JPWL 2J88L 5KS9F 3MGTB 1D7FA 4ZUSB 3S35H 1NEUA 4CN1A 1NFDB 2O5YH 1N4XL 3GJEB 3RWJA 2V5MA 4JG1L 3SDAB 2P8LA 2GCYB 1B0GB 4K71B 3K3QA 4UV4H 2Y72A 4WV1A 4GAGL 3ZYZA 5BOPA 4K2UL 1T83C 4LIQH 5ILTL 5DA0B 3N85H 4YNYB 4M1CD 1G6RL 3HTLX 4M6MH 3VGFA 1ZT4A 3HZKB 3NCJH 1CGWA 4P5KB 2X70B 1VEMA 2E8ZA 2GAZA 1JRHI 3BWUC 4POZC 1CTOA 2FIKB 3DGGA 3OKLB 4ZAKA 1PZUB 2VR5A 4M62H 4N8PA 3L95B 3K8MA 4GXVH 3VG9B 2E7MA 3EOAA 2CRYA 4PJIB 3W2DL 3ZHDA 3BP7A 1KLGB 1DQMH 5IFAH 3LPFA 3CX5K 1UA6L 3U2SA 1Q9KB 1AHWA 2P5WE 4JN2B 1U95B 4TPRH 2XTJE 4Q97A 3RA7L 2DYPD 2R2EB 5L8JB 4Q9CA 1R3KB 1BVZA 5DHYB 5FF6B 3HS0B 3QDMA 5IB5A 5IWLC 5LWYL 5GSRA 4OZFA 2ZOKB 2X1QA 4MJID 2QLVB 5GS0C 4X6CE 1CDJA 4G9DB 4J3VA 1FFPA 3A6BL 2WINA 4OQTA 1KCRH 1EEQA 2A0LD 2FATL 1PJ9A 4JRWA 4KRPD 4PJFF 4Y4FB 1N4XH 3TO4A 5CSZB 2IBZX 1KCUL 5GHWL 4ODXA 2BSTB 4TVPH 5KVFL 1TJIL 1S9XA 1DE4B 4MA7H 4ZDHA 1NEZA 2VDQH 3QRGL 2V5YA 1JFQL 1RIHL 3N85L 1FL6B 1XFPA 3QO1A 3V79C 1CK0H 1K5NA 4U1MB 1KC5H 2CKBL 2V2WA 4MQXC 3QJHB 4MAUH 1JTPA 5AG9A 2P47B 2BX5A 2YBRA 4UIMA 5BO1H 5IBLD 3CUPB 3WO4C 1FGVL 1NBZA 1QKZL 3GMPA 4UI2A 3R8BB 2AV1B 4TULH 3L6FA 1EBAA 4XVSH 2IQAB 4GKOA 1TXKA 1JL8A 3STLB 4Z7QF 2FX9L 4DKAA 4XX1E 4YHOL 1SM3H 2JB5H 2IANB 3RA7H 4I18B 3GSRB 4QY8A 5HJ3A 1C1EL 1JHKL 1QBMH 1F58H 3CH1A 3D6GA 1G7JA 5C9KA 5J12C 2OTWA 2PUQT 3TCLB 1Z9LA 5BW7A 4MA3B 2ZPKH 1NLDH 4UUJA 3PWPE 3MJGX 1B4RA 3FB5A 4MQ7A 4QXUL 4OD2A 4UQ2B 1RAMA 1RIUH 4DVBB 2YK1H 2NY2B 4GXUM 2IAND 3U4EA 1CVSC 3FCTA 4ERSH 4LCWE 4CAGA 4H1LB 5IROA 3DI2B 1AHWB 3FO9B 4GRWH 1UJ3C 3F7VB 4PBVC 2BHZA 4XP6L 5FM4A 5D1QD 1ZLVH 1JPGB 2GJ6E 2EXYC 4HAGA 2GTWB 3MRMA 3REVA 1X5AA 4GBXB 4E42B 4JKPH 1ZHNB 1MEXH 4ODTH 4YZFF 3UBXG 1MI5A 4P46D 3LOWA 3U79A 1FNEA 4G9DA 2VYRE 5TE7H 4M6OL 4I5BA 3SCMA 4XMKL 3UTOA 4FA8A 3RVUC 4NWTL 1U8HA 1MAJA 1JF1A 3PV6A 1CDIA 2VE6A 3DRQA 4NC2B 1GCFA 4BZ1L 5CD5D 4XPHL 5DUML 5DR5H 4FS0A 2OMBA 5HHME 3VFSA 3PHOA 4Y5YB 4OSUL 2E6JA 3D39E 2ICES 5D4QA 3I6GB 4HQQH 5E2VL 3EJZC 2Q1EA 1RULL 2IFGA 3ARED 4KK8D 1ZLWK 4JZOA 2A73A 3HE6B 4WHDA 5E6IB 3E3QC 4NRXB 1OAQH 3CSGA 4UT6H 1MFCH 1NCBH 3GIVB 3M45A 5D7KD 1XGQA 1NMBL 2LABA 2Z4QA 1EVUA 4YZFE 4WO4D 3HC0A 5TH2B 4NKDB 5KSBF 3NTCL 2G9HB 3D69A 4NQTA 1MPAL 2GJ6D 3WYRA 4JAMA 3CVHB 5H35A 4M03A 1DBBL 3PQYD 3DUUA 2XICA 4Z7VB 1U92A 2YC1B 1I9JL 3DVFA 4X98A 3EBAA 4WEBL 5B38A 3GJEA 1YYML 4OF3A 1GGUA 2EEAA 3O9WA 3C5ZD 3H9HB 3RTQC 5FKAB 4PJIF 4Y88A 1A2YA 5T3XH 4ZXBA 2AJXH 1QSED 1Y18A 3DX7A 3T0AA 5EBLA 4YDKL 4HIHA 4K3EH 3EFDL 4HUVA 3VH8G 4IS6B 4XP1H 2ZG1A 5IIEA 4KQ4H 2P1YA 5I8KL 1EXUA 4S1RH 2D31B 2YD7A 3KR3L 5C0FA 1ACZA 2P5WD 3GMLA 3VGHA 4HW6A 2W9DH 2VLJB 4M9OA 3VCLB 3VXRB 2B2XH 1DCLA 3O41A 5JW4Q 5HYQA 3DI3B 3MLSL 3REWB 4KK9D 4XC1L 2GY7B 3S6CA 4XVJL 1NCTA 5CJ8A 4PJ8D 4XI5D 4NHUA 4G8GE 3IDGB 3ARRA 4KI5C 1HWGB 4MSWA 2HP4A 4I18C 4KVNH 5GSVA 5JOFA 1VEPA 5FYLE 3ULVF 3DSFH 3QUZD 5I1EL 4U1SB 4MQTB 1WJ3A 4Z0XA 3UTQA 4NC0B 2OBGA 1UCBL 4JQIL 3TVMB 3TBSA 1N0XH 3ARBC 3FFCD 4PIRF 1DBBH 4LCUB 1RU9H 4LKCA 4D9LH 2DLIA 1IARB 3CDCA 3C6LB 4IOFC 3CZFA 4GKNB 2VLKE 5D1XA 2FWOA 3NCCB 1TZHB 4X6CF 2Z4QB 5MP6H 5J06A 1GVIA 1CFTA 3T3PF 1HKLL 3JWDC 5CINL 3BIBX 1YYLH 5ANMB 4JFOB 4FXKA 1OP3K 3MOBH 4Z7UF 3CXHJ 3PWUA 3NIFE 5DD5H 1RZIA 1S9VB 4F7EA 2C1PB 4GMSH 1L6ZA 5D5ME 5KSBB 2NXZB 4KV5F 4RGNE 1RD6A 5T1DH 1T66C 4CBPA 1RZIB 1F4YH 1WBXA 1NBQA 1M7XA 2DYPB 1U8KB 1YNTA 4P0DA 3QUXA 4PGDB 2EKSA 2JIXA 8CGTA 1CXEA 2Z31D 2NY1C 1AJ7L 3SKJL 3MRQA 2E5EA 2UWEE 4I77H 4MD5A 1U3JA 4NOBA 3V0VA 1JGUH 4AMKL 4LOUD 2IEPA 4MJIB 3BDYL 2BRQA 1K4CA 1HIMH 1VADB 3K2UL 3Q5TA 5DFVC 3MFFB 3T2OA 4HD9A 2CO6B 1LP9E 3BQUB 4LEXL 5BCAA 5C09D 4ONFL 1CQYA 3P9LB 4G6MH 4ZOCA 5DVLA 1JV5B 4JRXD 4FMFA 1BWWA 3IDNA 5EFIB 5EU6D 3V8OA 2OYPA 1WC7B 2A9MH 3MV11 1E27A 1MCHA 1YMMB 3QUZA 3OGCA 3CX2A 3BP7B 2NMSA 3KVQA 3GBNH 3S34H 3HAEB 2OI9C 2R39A 3VH8A 2V7HB 4PRBA 1T04B 4QRTB 1QTYT 2F8OA 4U7MA 4ZNEA 4X9BA 5B3JE 2R69L 4N8CH 1UC6A 5EC1B 3ARFB 3H2WA 5DEGB 1X5HA 3G6JB 2EE6A 2HTKC 4OKVA 1BD2B 5LGKA 5SX4I 3LEYH 4NUGL 1BQUA 1HYSD 1G7QB 5E0QA 2O5ZH 3L9RB 1R5VA 4XNMA 3HE7B 1R3LA 3MR9B 2Y7QA 4KJQD 4RGMB 4Z95L 1QLRA 4XXDB 4Z7OF 5KVGH 1VACA 3IGAB 1T89C 4KJPD 3D85A 4G6FB 4L3EB 4BA8A 5E9DE 4LQFL 3HAEG 4J8RB 4JDZB 5GRXG 1K8DA 1QSEA 2VZUA 4QLRA 4HWBL 3K8KA 5FM8A 1U8PB 3ARFD 5KS9E 3KPSD 1UA6H 1QQDA 3M17B 1F6LL 1HHJA 4PRIA 4TOYH 1GZQA 3B2UD 2OQJB 2AKRB 3QI9D 5C0CE 5FYLH 4HKZB 2GQHA 3NIFF 4ZQKB 3QAZB 4U6VL 4C56A 4MA1C 3P11L 4PJ8B 4EUPH 1KFAH 4OUUB 4ZFGL 1DLHB 2WINB 3ZL4H 2J7LA 3BH8A 3DMMA 4M6NH 5KSVA 1DVFB 2NZ9C 2B7DT 1N5AA 2HG5B 1NC2B 1OGTB 5J13C 1PAMA 2NR6D 3PWVB 4OZFH 3WN5A 4HWNA 5FDYA 3HPLB 3QDGD 3WNKA 4JFZH 1ITCA 1CD8A 3H9HA 3OZ9L 4IDJL 3GKWL 4MGXA 5F7EL 1KIRB 3QIUD 5GJTH 4H26B 2FZ3B 2J12B 2PXYD 4RISH 4OM0H 3BN9C 1UH3A 4PJDE 5FYJD 1QPPA 3OG4B 4PGJA 5JPMA 3ELAT 1TNMA 4X7CC 3GSQA 1KB5H 4XCCL 3D2UD 5C0BD 4Z7VA 3DVNB 5L8LB 1AGDA 1JZ3A 4JPIB 1A7BA 1JCKA 2A83A 2HKFH 4G6JL 5FV1L 2F74A 1L9MA 5DJ2A 4FRWA 2R4SL 3AROA 1QFUH 2V2XA 5GRJL 5DHXB 4M1GH 3G6DH 2NLJB 4QHNA 2QQKH 4WV1B 3CPLB 3PGDA 4FQXD 3RPKA 2X4SA 2IAMA 4PS4L 1A6AA 5ITBH 1P7QA 5LGJA 1G6RB 3VXTA 5SX4H 2J6EA 3O3UN 1ZLWH 2VE6B 3DRQB 3PV6B 3QA3A 5BV7C 4PJCB 4G8GD 3V0AC 2VZSA 5D2NC 4FABH 1A64A 1A6AB 3GSUA 3F8UB 3RU8L 3IETB 3U2SB 2JJSC 4ZD3H 3N1FC 2Q6WB 1Q9WB 5FIEA 3SGJC 4PJ9C 2IQ9L 1OQOA 2FGWH 3SE8H 3UX9B 4N0RA 4NCC1 1IQDB 5F96H 4UT7H 4ENED 3LZFH 2VQUA 3MLWL 3VXSB 4LASH 3RUGA 4A6YB 2YUVA 5TE7L 4S0SD 4BZYA 5ESAB 4LMQE 5MENE 1FZOA 2IG2L 3L3JB 4DGYH 1WSST 1D5MA 2NY6C 5IVZA 2WNGA 1FLTX 5BS0D 5HGHA 1MAML 2HAZA 1TPXB 2DQUL 5HY9A 5DZLA 5D96B 5CBAB 4V1DD 2PW1A 3ZHKA 5BQ7A 2B5IC 4RX4D 2KBGA 4HCRL 2ARJQ 3OAYH 5L88L 5F97E 1FO0A 4DFIA 2AQ3A 2UZXB 3D5OF 3Q48A 3DXAB 4H0GA 3EYSH 1MOEA 4OLYL 1R6VA 5DD6B 4NQCD 3QB7C 1BFSA 1BZQK 3DTXB 4PJEF 4MXWL 1UM5L 1F2XK 3F6IA 4F7MA 3HI6L 3KJ4C 5ID0B 1NMBH 4JFFD 1SJEA 4I2XA 3CX5J 1D5XB 3QWOB 4OKDA 4CVZA 1BZ7A 1I85C 4W6YB 1CLZH 1MPAH 4QEGA 3L5WA 1BQHA 1BBJB 1BJ1J 5ACMA 2DQJH 1Q9OA 1OB1B 4JB9H 4PUBH 4YXLH 1T2QH 2VLLA 1KJ2B 5CSBA 2V7NB 4HKBB 3QEQE 1AFVH 1CU4L 3NABL 2ICCA 3UTZA 5FYJL 4OQTL 1IC1A 1HXMB 4X4MA 2XQBL 3GSUB 4H20H 4WO4A 3LQZA 4QGTA 5C92A 4OAWB 3JWOC 3GJFH 1BD2A 3SDXB 3U30C 2NY2D 3QA3B 1X7QB 4FFVD 3VXUB 4Y2OA 4N0YH 3FZUC 5L2KA 1CFVL 1KTDA 4PJAF 1TTUA 1X4YA 2XY2A 2ZWLT 3UMTA 3WXVH 4P2OC 2N4IA 5EBGA 1ZVYA 2X41A 5T1MA 4PYGA 3UROR 4QRSB 3SDYH 5FYKL 1BQLH 5IMKB 4K3JL 2PTUA 3TVMC 4WWKB 2FEDC 1WICA 2B1AH 3NH7H 2QSVA 3OKEA 4JHWH 2DM4A 2DQTH 3L9RA 4P2RB 2OL3L 1IC7L 3QUYB 1UM5H 5EORL 2XWJA 2UZIL 4DKEL 5I1KH 4HEME 2JJSA 3QJFB 3RGVD 5HI3C 1R3IH 5D8JL 5DFTA 1I9RH 5IKCA 2X7LA 3Q0HA 5EZIL 3L3GB 4JO1H 2DTML 2VXUH 4QRPA 4YH6A 3UP1A 4U1NB 1CR9L 4MDJA 4N5EC 3FQTA 4LLMA 3DARA 5E8EB 4NKDA 1RSFA 3NFPA 3S37X 4Z5RA 2D0GA 2HFEB 5DHVH 5GISL 4NCC2 5CFHA 5D72H 2YPLE 3IVKB 2F5AH 3BKCH 4OZGF 3QQ9D 1N5AB 2CQVA 3BKML 3T0EA 2DQHH 2P44B 1IE5A 3C2AH 3O0RL 5LWYH 5D7JD 4KAQH 1M7DB 4L9LA 5CD3A 3MFFA 1CFVH 5F70A 4KK6C 3T2NH 2R23A 5I1GH 3VFPA 3WCYA 1LGVA 1OAUL 1INEH 1JE6A 43C9B 4NQED 2B39A 1XF3A 3S36X 4YHNB 1QLFB 3QNZA 4ZTPH 3ULUL 2PTTA 3EHBC 2IQAA 2DMCA 3CFKB 3H42H 4GRLA 4RFOL 2G5BB 2ICWI 4G43A 5DEFA 3TPKA 3X11A 3QEHB 1WT5A 3PWNA 4XBEL 1BJ8A 2AEIT 4UTBL 4WY7H 1QSFD 1LP9F 3NN8B 4HPOL 1MAKA 4R7NB 1M4KA 4NP4H 2GT9B 2UZIH 5I2IB 1H8OA 1RZJL 5I1JH 4S1SL 5JLZB 5DXWA 2XWBA 3E2HB 3VFNB 4OD1L 3F12A 1AKJD 3LRSB 4ALAL 2YD8A 5C3TA 3OR7B 4XI5C 4NJAL 4GRWF 5DUBB 4LEOA 5HHNA 5EO0A 1DEDA 1OGAA 4ELKA 5EU4B 3TN0C 4IIQB 2YSSB 1Y0LA 4LPVA 4M7ZB 4PBWD 2NY4B 1PKOA 2P5EB 2XV6B 3V4VL 1NCAH 5GS0H 4LLVB 2VDRL 3EDDA 5H8DA 4JANB 4CMHC 1BF2A 1IAIH 3I9GL 5CGYC 3CXDL 3S4SG 4PJ5E 3E8UH 2UWEB 1MIEH 4XCFL 3BPNC 2FLRT 2NYYD 3EUUA 1YY9C 3X12B 2YEZA 4GKSA 2OL3B 1FZKA 3MLRH 2Y36L 2A74B 1ND0A 5D7IF 3VXUE 4X9HA 3QNYA 4HIXL 5CIPA 1F3DJ 3LKRB 4O9HL 1MJ8H 5GJSH 2EE9A 2XIDA 3K4ZA 1BBDL 4LIQE 3VDAA 3H42L 1EIBA 4Y8AA 1MVUA 1F6AB 5M7QA 4R0LB 1D9KA 3BZ4B 3C8HA 4X99B 3ALWA 1NGQL 3IJYB 1JN6B 2NW2A 4WW1B 4JR9H 4O4YL 1M7IA 2APWA 3W39A 2AV7B 3LRHA 1E4JA 2JLLA 1MCWM 5EDXA 3HE6C 4U1NA 3L3KB 4B7LA 4R0LA 2CD0A 1KXTB 3VFTA 3GMQB 4FTVD 1KYOJ 4AL8L 4L1HA 1H9VA 1QOKA 1CGSH 2F19L 4JHZA 1BZ9A 5E6YA 1DUZB 3EYOB 3KPSE 1TTFA 4Z7NE 2MHAA 2DJ4A 3T4AA 4J1UB 3NZHL 4CU8A 4OM1H 4XVUD 3SN6N 1U8KA 5E8PB 5E8NB 2ZCKL 4I3GA 4Q6IC 1A14H 3FT4B 4BKLB 1HQRB 4LVNB 2DS4A 5CJXA 2CIKA 3X3GL 1HEZB 5F7EH 2IPTL 4JO3L 4MXVF 1V3JA 4UV7H 5J9PB 1XGTB 2D7NA 4D0BB 1PZ5B 4PTTB 3C8DA 1PLGH 2EECA 4UINL 5ILTH 4HIXH 4LDLB 3IXTB 3MXWL 3TJHD 1LE9B 5FHBL 5JIHA 3DECA 4LRIC 5KW9L 1QA9A 5IW6A 1RJCA 1YMHA 4OV5A 1KCSH 1ETZA 2H3NB 3OTTA 3ARVA 2AK4D 3FOLB 5GSVB 5JOFB 3MCLL 3T08A 4JVWA 4POYA 3IB4A 5EBMA 4HKXB 1FYTB 1MIMH 5DK0A 3RWIA 5ICZB 2VL5A 1OSPH 1GHFL 3L7EA 1I85A 5ENWB 1J9CT 2VKXA 5HHOD 2ZNWA 1TQCC 3SGEH 5IGXL 1T66D 3QIUB 4YHIB 4OCRL 4ZXBC 3H3KA 4JANA 5IW1B 4ZFZA 5A3IC 4GQPH 4JCMA 5E5MB 2IGFH 1FJ1A 1EHAA 5EO9A 4QCIB 3G04B 5FK9A 2IMMA 3OAZH 2GSIB 1E4WH 5C0BE 2Q8BL 3L5HA 2HJKA 5GGUA 1FVCA 1ORSA 3DX9B 2X40A 4NO2A 2NW3A 4U49A 4XVJH 3X3GH 1E4XL 1I8MA 1FBIL 4KZDL 1A7RH 4L9DA 5LAXB 4J23A 4LFHG 4JM4H 3DETC 4CKVX 3GM0A 1XF1A 5T33L 4WGWB 3SE8L 4ODHL 3G08B 1NAMH 5C07D 5ID0A 3IRZA 4XXCA 3MTRA 4W6XB 4OZFG 4X5WA 1KCSL 1FYTE 3DLQR 1FL6A 5E4IA 1S7QA 4CN6A 1DQTA 3HRZA 5JO5A 1LNUB 4NNXB 3MV7A 4RFEA 1CL7L 3MV8D 5J11B 5ERWB 1EEZA 3SDCD 3QH3A 3C09C 4EDXB 5F1IA 1GL4B 5C0GB 1KIPB 1FO0B 2A73B 4Z0BL 3BW9A 1U93B 2ICWJ 3PF2A 4OT1L 3I3EA 1E28A 1Z3GL 5I1DA 3N1PC 1Q0XL 3RIFK 5B3NA 1F00I 1FRGL 4P2QD 4NZUH 3ESVF 5CHNA 1NGWB 2I9LA 1NEZG 3HFML 4L4TE 1A2YB 1P4LA 4Y16D 1ZGLM 4HHAA 4HKJA 2EH8H 1FZJA 3CVHL 4FZ8H 1NGXA 2VDKL 3ILQD 1D9KC 4JN1L 5CJXC 3FB8B 3VA2C 1ZGLB 3OJDB 5HVGB 2K9UA 3DUUB 3DO3A 4WVRA 4MAYD 4U6XA 3MUZ1 4LSSL 3RPIB 4M7LT 3CAFA 4YIQA 3BX7C 3INUH 4OKVB 1HZHL 4J4PA 2FX8L 1CGXA 3LKNA 3D25B 3GB7A 5DD1L 1WFNA 2J8UA 1CICB 2Y5TA 2G5RA 5DDHA 2Z8SA 3GI9L 5SWQB 3IRPX 4MCZB 3FCTB 5E9DD 2PO6D 4PG2C 3DURA 2OK0L 4P2RA 1T04A 1U9KA 1YA5A 4TRPH 4PRHB 2W07A 5JHLL 4IRJC 2FEEI 4RAVA 1S7WA 5FOJA 5E00A 1GIGH 2WBJB 4HXBH 4J2XA 5H94B 1AD0B 1UZ8A 4QRSA 2K7QA 3SDCC 3LV3B 1T1WB 1F45A 2GK0B 1QFWH 5DR5L 3UYRH 4JPVL 4KTEH 4H0IA 1HSBA 5IQ7L 4I0PD 2Z31C 3HMXA 4ZSOE 3SGDI 5KVMC 1OGTA 3VXNA 4EOWH 2BCKB 1P1ZB 3FT2A 4OCLC 4LVOC 2R1WB 3LS4L 3MV8E 2D7MA 3HRZB 4KHXL 1DN2A 1RJZB 5ALCH 2JJWA 3WIHA 3MLYH 2FHFA 1T0NA 2VLRB 1XGYH 4Z7WA 3L5XL 1J1OH 2C1OA 4WI8A 5D93C 1KPUB 1KJVA 5DHYA 5DRWA 1RK1A 5T1KD 3UZEA 4APQB 4MD0A 4IJ3C 2GUOA 4LLDA 5HPMA 5F9WB 1RFDH 4Y4HC 4L9LC 1KPUA 4IOFD 3WFBH 5B4MC 2CIKB 2QR0B 5C0AE 1LNUA 4NNXA 4ZUTA 1RIVH 1MVFA 1EGJA 3BP6B 2YPVL 3MRQB 5D1ZD 2VIRA 5JHLH 1JWUB 2PXYA 1IFHL 2PTVA 4KWUA 5F21B 4HXBL 1ZA3A 4WFHD 3GB7B 5C07A 2BOCA 3QWRD 3W0WB 3VXQB 1X4ZA 4OF0A 4LLWB 5C71A 2LU4A 3QCVL 3QXDB 3O11B 1RZ7H 1G1CA 4P9MH 3RZCB 5E24E 5DJ6B 5CP7A 3RY5A 4JRXA 2VLKA 1FZJB 1AKJA 5EU6A 3W0WA 1WZ1L 3HG1A 1YMMA 5K9QI 2DKUA 3SOBH 4HPOH 2B8OT 3BE1H 5L6YL 3ARQA 2Z0BA 1RZGB 3RWHB 5EO1A 1G7HB 5A2JH 3W9DB 2K1MA 4W81A 4GBXA 1CICA 4FQHB 4LP4A 1XZ0A 1IKFH 3FB7A 5KSAD 5EPMB 5DEGA 2FJHA 1E6JH 3FO9A 4I3RH 4OF6A 2XQYK 2IAMC 5JPNB 1A7OL 4R2GC 4CRPA 3X13A 4WWKD 2C26A 1EX0A 3H9SB 3KJ6H 4BFIB 3ULVL 4IMKC 3QO0A 1FVDA 1QFUL 1YC8A 4FFZL 4WW2C 1X5JA 2UWEA 3N1GC 3WO4B 3QIWD 4HIJA 5IB5B 3V0WH 1AIFB 1LILA 4ONHA 1XCTB 2QQNH 1K4DB 1U58B 5ITBL 3GMNB 4M7JH 4I0KA 5CCKH 3MNVA 4KHTH 2W38A 4DGIL 4TUKH 4C4KT 3KXFE 3BGFC 4IHOB 3DXAA 3VFVB 5J6GB 3RAJH 4F15C 1EO5A 1N64H 4FABL 2I5YH 3DOSA 3STZA 3QH3B 4HC1H 1U41A 3G6JE 5FOBA 3FQRA 2DJSA 2HWZL 1UACH 5E2TL 1ZT1B 5TFSL 4Y5VA 4CVXB 4E5XB 2IALB 1RV6X 2JE8A 3WJJC 5J3HD 2OP4L 1DP0A 5CAYB 4R90H 4A6YH 2AKRA 3V52H 3DIFB 3J7HA 4KKBD 5L6YH 1IM9D 5DVOA 1KIRA 3CSYB 1W0WA 5DMIL 2DAVA 5IMOB 5I19L 3TC9A 2YS4A 4FTVE 5TPWH 1NANI 5DLMH 4K94H 4EI5B 4HPYH 1PQZB 3BIAX 1QKZH 3OKMA 2WIIB 1HHHA 1WISA 2R0WL 4N0UE 3RRQA 4B5EA 3ULVH 4TNWK 4K3DH 1W8OA 5T1KA 3J8F7 3MRFA 3MRBA 2X9WA 3EOTL 4S10A 1H3VA 4CDGC 1A9EB 1RZFL 2J4WL 3ZSSA 1A1NB 4L4VE 3QUZB 5CCKL 2W9LA 4K3GA 3KPMB 5CZVH 4ZSOB 4PP1D 1YEKL 1G9NL 1W0YT 1U8NB 3IFPB 3K1DA 5JUEH 1NJ9B 2CO7B 2H32B 4LCWD 4QF1B 3RI5K 1OPGH 5BS0A 5D5MB 5KSBE 1NL0H 4OCXH 3DSNA 4JRYA 5SWSD 4JDVB 2DQCL 3NACH 3U7WH 1SBSH 2B4CL 3Q1SL 3RWDA 5ETUB 4LBEB 5A2LH 4MCZA 3RNQB 1QFHA 1FNHA 3MUHL 3ZTNH 2FJHB 3QDJA 1A3QA 1A6PA 3VWKC 1RURL 6CGTA 3FQXA 5IBLC 2R2BB 5IFJA 3QG6A 5EIVA 3V5DB 2GSGB 4PJBA 4XMKH 4LVOB 4QRUA 4Y5YC 1SMOA 2DIBA 4Y1AE 2WBKA 4N0UB 3ARDC 4Y4FD 5HHVL 5FCUL 4IOIB 5DRWB 3QQ3A 2R56L 4YBLB 1U3HB 4JPKL 1IGTA 3ZKNC 5TGBB 4RCAA 5L0QC 3MRCA 5IT2H 1LE5B 4V2CB 3MO1B 4YHYB 1P1ZA 1FAIH 3I6KA 1ORQB 4QXWA 1TQBC 2YOCA 4ODUB 2GK2A 3MRLB 2DQTL 4RDQG 4EN3C 2BFVH 3S9DB 2MCPL 2OL3H 5GRYA 1KB5B 2BDNL 4JFPA 4GAGH 4L9LB 4DN3L 1KCKA 2JCCF 5GS1C 2AV1A 4APQA 2ZOLB 1WBZA 1NCWL 4Q9QL 5F7DB 2R2HB 2QR0A 3GJFB 1KB5L 4XCCH 4XNQB 1JHLL 3QUMA 4M61A 2FNBA 4NRZA 1A6ZA 1UXWA 4S1DD 4DW2H 1SEQL 1F3JB 3AVEA 1SJVA 5E1AB 3WE6B 2BP3A 4ZFOL 3WFEH 5DO2C 4D3CH 2IFFH 1H8SA 4DVRL 2AJYH 3MNZB 2H2PC 3V4UH 4FXLA 3O2DA 3UAJD 4EI6B 4Y19A 1Q0XH 1ED3A 2VAJA 4NO3A 2PYFB 4H0HB 5A16B 2O26U 2CKBB 3JV6A 4ELMB 1G7HA 1J18A 4OFYD 4X80L 1OF2B 3D18B 9CGTA 3HMWH 3QZWG 2RFXB 1INEL 2VABA 3VRJB 3RX8A 5CEZD 3EJJX 3CZJA 1JRHH 1QR1A 3CJJA 4JN1H 4NM8L 5DRXB 4YHIA 3FMGH 1AKJB 1AXSB 1I8LA 1FVDB 2VDOL 4G9FD 3WHE0 3BUTA 3PGCA 4QRRD 1BEYH 4XNUH 4BUHA 4R4ND 1OP5H 2QHLA 4UTAH 3G5XA 4OI8A 4X5XA 4JCLA 4WTZG 3S3PA 1B2WL 3MRJB 5DJAA 4MA7L 4PJ7E 4DN4L 1V05A 4FQHA 3UTSB 5IQ9B 4XP5H 1ODAA 5F96L 1NC4A 1YEFL 3HLAA 2ESVE 1JUFB 3O6FA 3ULVE 4O2FA 1QVOB 3VW3H 1P4IH 2DWEA 4PLOB 4DZBB 3WS6C 1MRDL 3MLTB 2XKUA 4DZ8B 3MBEC 4DW2L 5BRZB 1CDBA 3TH3T 3MRHA 1TCRB 4TULL 5L2JA 5JMOC 2AJYL 2BSRA 4JRYD 3RWCB 4KTEL 1J11A 4ODUA 4YO0B 1NCNA 2HFTA 1HXYA 2VR4A 2AJVL 2I9TA 5CBAA 1QO3B 3LKQA 3T04D 3QCUH 1TNNA 4I4WB 4HG4J 3GHBH 4Y5XC 4X4ME 3QIBD 4Z7WB 2YBRB 4N9OB 4LVHC 4HWBA 1OTTC 1LEKB 3NIDF 2MPAH 4XHJC 3MRIA 1Q8MA 1XEDA 1I75A 3PQYA 1P5VA 4J1UA 5JO5B 1KN2H 3MLZH 5AEAA 3L5XH 2VZOA 3B9KD 1U92B 2E8YA 1AD9A 4YBQC 5C09A 3UJTH 1DE4A 3HAEH 5J89A 2BVPA 4FQ1L 4U1HB 3FQUB 4AEIH 3V7AE 1UXSB 1XH3B 2FEEL 1JI1A 2L0DA 1NDGA 1MELA 2FSEB 3HC0B 4H8WC 4MS8D 1I9IL 2VL4A 2YR3A 4PG9B 1S9WA 1TZGH 1XGRB 3DVGA 1RZJC 1J87A 1R3HB 3KYMB 4LCIL 5ISZB 4FQCL 3AS3A 1CGTA 1KN4H 1DQLH 3U6RB 4CMMA 4HS3B 4U2ZA 4BQ9A 1G7LB 4JZJA 3FN0H 4U31A 1KOAA 4GRLD 2ICWB 4N0YL 3D3VA 3S4SA 1P7QB 5LGJB 1IC4H 1KIUA 5CP7B 3TBWA 5JPNA 1D9KD 3KPQB 2IMNA 1YEJH 4KVCL 2D9CA 3SKOA 5D5MF 1NSNL 1QACA 2YN3A 1DQQA 3CDYA 2NY7H 5CMAA 5IJKC 2BJMH 4ZG1A 1XMWA 1MRFL 4OCYL 3G04A 2AK4B 2JF1A 3GI8H 4MVBC 1SVZA 4IRJA 1OT1A 1QR1B 3EDKA 4XNYL 4PLKC 2D9QB 3EHBD 1S3KH 3BIKA 4EN3D 2FIKA 5E03A 2FYYA 1XT5A 4YC2B 5I1IL 5BZDA 3BI9X 5C6PB 1G6RA 1HIML 3OSKA 1YEHL 3UJIH 5E5UB 3KLHC 5DWUL 1R3IL 3G9AB 5D8JH 1U8IA 3QIWA 2RGSA 5IVNA 3JWDH 2CUIA 3T3MF 3FB6B 5DD3H 2EO1A 3MZGB 3L3OB 2BSRB 4ONFH 5I8OL 3ISWA 5K9JH 1F2QA 2CDEA 2A9ML 2DOCA 2FCBA 2UVFA 4E41E 4UIKL 4I0PC 3TNMB 4Y0GA 4P9HL 4D8PA 1I3GH 4YDJB 4WHYH 4Y4HD 3DNKA 4X7TA 3ESUF 3ZDZE 3BPOB 1EMTL 2A9NH 1V7NH 5JMRA 2CDEB 3F65A 1XF3B 1BHGA 5E95B 4IRJD 1UZ6E 4Y2DB 4ZPVA 3GSNB 3SE4A 5E2UH 3UPRA 1R24B 2XZCH 4MHHI 5TDPA 3OR6A 4G8FA 4UB0H 3RVVD 1N6VA 3RIAF 4KGJA 1A6UL 4X0KA 5KSAB 4MNGA 1DQDH 1NBZB 3GMPB 2ITCB 1HYSC 4IBLT 5HGHB 1J1XL 3MBXH 4J6RL 3K81A 5DS8B 1HN1A 2V9QA 4RZCB 1GJIA 4NZTL 3O9WB 2AK4E 4U1MA 3SDCB 3WKML 2YMXH 3VWKB 3U46A 4PJ5A 3ALXA 2AXGA 5T5NF 5IK3A 4L3EE 4ODHH 5I1IH 1DUZA 1BFVH 2FD6L 2X4PA 1NAML 3ULUC 3D18A 1CIUA 2DYPA 2ED7A 4PGDA 5KSUA 1H3PL 2Y5TB 3KPRA 3OHXB 3UJIL 4F9LA 3D39A 4KU1A 1KF9B 3RNKA 1A1MB 4P2QB 1G7MB 3OAZK 3ABZA 2F74B 3O6ML 1PG7X 3KPQA 3H7BA 1IGML 4U6XB 3P11H 2Y9RT 1ZSDB 4KXZI 5DVKA 4Y8DC 4K55A 4NQVA 4ZAKB 4XPTL 4RAVB 5DMJB 1I8KA 4EEEA 3MLVH 1NFDA 4JVPA 2QADC 1RUKH 1YN7B 2F53A 5DEZA 1HKLH 5CINH 2W0FB 5D2NB 4CNIB 4YJZL 1JTOA 4NFCA 4PJGA 1CCZA 5DD5L 4QRUB 3C9NB 2FHCA 5EU3A 2QSCH 2KL6A 1KGCD 3MODL 4UOJA 5ALBH 1VFMA 3O3BA 4PJAB 4NCDA 4JY6B 1JF1B 5CZKA 3TVMA 4HS6A 1I7UB 4HT1L 2B1HL 1OHQA 3RWDB 3RY6C 1C5DA 1KCUH 1NCUA 5JW4N 4AYFA 1C7SA 2YUWA 2DLFL 5SWZD 2EH7L 4F7PB 4BQ8A 4ONHB 1JPGA 3MMEB 1M6OB 2HN7B 2HJFB 2NY5C 1DQML 1IEAA 1A47A 5KG9A 5ESVA 1BFVL 1A6VL 4X6FA 1ZT1A 1CK0L 5GGRY 4G8FB 4M1GL 1SVCP 4ZDHB 5A2FA 4BH7A 1GSMA 4ZPVB 1GOFA 2LAGB 4F37K 1KJVB 1E4KA 3VFTB 2X6MA 1A6TA 2NY0D 1T7XA 1ZHLB 2JCCE 4YDJA 5FM5O 4KZEL 5C6TH 3T0WA 3RBSA 4N8VA 2UUDK 3MROA 3BYTA 3MRPB 4CGTA 3ZYOA 4LSTL 3MBEA 5KAQG 3E1F1 2HVKB 5DURD 5JZ7C 5AAMA 3VFPB 3OKOB 4HK3J 3FAWA 1X5KA 4LRNL 3V6BR 4HWEL 1ACYL 2HLFD 2Y6SC 2CR3A 4P57B 1ITBB 3U4BL 4L8CB 5AG8A 3CDGB 3T0EB 1D6VH 1EEUA 3RKDD 1DEEA 1Z0NA 3HUJA 4HZLB 1DSFL 5DRXA 5ELIA 1RZ8A 1I4FA 4YDVB 4P4KC 2X4PB 2CIIA 1A9EA 5F9JB 5IUSA 4I0PA 3UTTB 1BVKA 1MIML 4M00A 5DO2D 4LQFH 1AGCB 1BIIA 4IIQA 3R0NA 3G6JF 4NJ9L 2CDFB 3IAQA 4N90D 1CXLA 4M48H 1NJ9A 4CU7A 2ICWA 4UDTA 3BP4B 3ZKMC 1J8KA 5JLZA 3UBXA 1PEZA 4BZ1H 3KHOA 3RDTA 5BOZG 5MI0C 1BVLA 2APBA 4UQ2A 2H1PH 4UQ3A 3IFLL 4XZUB 4JO4H 2XPGA 1EBPA 2CMRL 2VMFA 2QADB 1DJSA 2ENYA 1AQKL 2XNAA 3SDDD 3BSZH 1MJJA 4KY1H 1EAPA 4HJGA 5HGBB 4PRPD 1IGFL 1MWAH 1Q9KA 4ERSL 2Z91A 1I7ZA 1BEYL 2H26B 2KZWA 4LPWA 5ABDE 2L7UA 3QPXL 5EOCJ 1LMKA 1P7QD 1NGYB 3QUXD 3MUJA 1QRNA 3B8YA 4JFOA 5DJZA 5DQDH 1CU4H 3NABH 4Q7DA 1F6FB 4LSVH 1MEXL 1HYRC 3D0LA 1ZVHA 5LBSH 3MGOA 2GJZB 1C5CH 1QSEB 4DK6A 1U3HA 3O6KL 3UTTE 3GSVB 1I1RA 4GMTH 3T4YB 2XA8L 1WQVT 5KVDH 6FABH 1CZ8H 3Q5YA 1HINH 4G6JH 4FFZH 3D0LB 1HXYB 2NY1B 5GGTL 4MD0B 1BZ9B 4P5TB 3GM8A 4NO5B 4XBPB 5E94A 3ROLA 5IHZB 1AI1H 4JFPB 5HYJE 3GSVA 4HQQL 1SJEB 2EIEA 4GLRI 4HGWB 3UBXI 2F54E 3EYFA 3VXOB 4BSWA 3PWLA 4Y4KD 2ESVD 2ZKHL 3BP6A 4LF3A 5C0ND 1FYTD 5F3HA 2ADGB 4P2OD 1GZPB 2BVOA 1EJ6A 3MUGB 5J1SC 2PNDA 4GKZA 2XTJB 1UACL 4U05A 1ZAGA 2EIBA 3CDGA 4CUCA 4XBEH 5HHMD 3MJ7A 2AEQH 4JM2A 5C0CA 2X4SB 3LKOA 4UTBH 4WY7L 4CVWA 2XZZA 3NPZB 4RIRB 4O58L 3RZCA 3S37L 2XXCB 1T21B 4PV8A 1QBBA 5GGSY 3OQ3B 4KMTL 3LS5H 1EAJA 3RWIB 3SGKC 3UO1L 3D25A 4GG6F 2VZ3A 2ORBL 1A1NA 4Y16A 1YQVL 2YA1A 5FKPB 1OSZB 1T7VA 2A83B 5DFVD 3ZDXE 4U1GC 4YPGB 2D4DA 3BKCL 2P8PA 1AH1A 1S78D 2BY2A 4KH2A 1M71A 1HOCA 4TUOB 3UYOD 1UGNA 4TSCH 1ZHNA 4XP1L 3RGVA 6FABL 3BO8A 4URTB 5I16A 4YNYA 4KROB 3EGSA 3B9KB 5CBEB 5GS2H 2X5PA 4RWHA 3QUML 1E0OB 1KB9J 3MLUL 4M8QB 5I1LA 1C16B 2AS5M 4NKMA 4X4YB 3CFDA 4PJDA 5IEHB 3LV3A 5L88H 3CVIH 1TVBA 4ZPTA 3AMLA 2W9DL 3DMMD 5C0AA 2I27N 5ESVB 1BAFH 2NZIA 3LN4B 4LSRH 3MOAL 3CMOL 2DF3A 4GAYA 1M05A 2DM3A 4M5YH 1LEGA 1FC2D 5JUEL 5INCB 2GJZA 3E6HB 3QQ3B 2H8PB 4H25A 4K7PX 4KRPC 4ZOBA 2BNQB 1YEHH 3UPRB 5J3HC 1MFAH 5D7IB 3RDTD 1DLFH 3FAXA 4NQEE 3RTQB 2DQCH 5C08E 5BJTA 4K9EH 3VMPA 1SJHB 3LPGA 1ORQA 1CXHA 4EKXA 2Z93B 4JEGB 4XP4L 2DBLL 3IYLW 3LIZL 1J5OL 1NCAL 5DC4B 1TIUA 3T4YA 1EEYA 3BZFB 1QPXA 2G2RA 4N1CA 3VFOB 1LEKA 5F9WC 3OB8A 4KMQA 5HI5C 3KPOB 4PJGF 4PRHD 4LCWA 1NC2A 5H37G 4N9GB 4PJHE 3UPCA 3DVGB 4XCFH 3FQRB 3GK8H 3IS1X 3WIHH 2D0FA 2H32H 1CFQA 4HUMB 4ZTOH 1OF2A 4OZIE 1QSFA 4P9ML 3HPLA 3OF6D 5FYKU 4MB5A 1BIIB 4OLUL 2IWGA 4M3KB 4Y19B 5EIQA 3RKPA 2BFVL 3AM8A 5EULV 1AJ7H 2V7HA 2X89A 3CMOH 3FT4A 4P5TC 5TQ2H 4OCSL 5C0AD 4NN5C 3GRWA 3KLDA 4DN3H 4CMMB 2WUBL 4KI5D 4LSUH 3BPOC 2YZ1A 1PQZA 3OKMB 4J3SA 5DJ0B 3MA7B 1ZS8A 1J7VR 2I9LB 4GW4A 3IFNH 4X5XB 4MAUL 1ZSDA 4U0RB 2P46B 2EDNA 4HGMA 4OIBA 1U95A 5F7MC 2B20A 3O8XD 1H5BB 2JJTC 3KS0J 2O5XL 4K9EL 4PB0H 4BSVA 3SDAC 4WU7B 5DSCA 4NHCL 3MR9A 4XVSL 1HK6A 1ZEAH 4XP4H 4MNHA 4XWGH 4MA8H 3EOBB 4NYLB 1SM3L 4I2XE 3V0WL 4UT9H 1EFQA 4FHBD 1UENA 5EZLA 3QG7H 1H0DB 3L3DA 2MQ3A 3H7LA 4Z8FL 1T1XA 4UV7L 3ZE1F 4NZRH 4FTVA 4G5ZH 4HLZG 3W0WD 5D7IA 4LKXA 1TQCB 5ALBL 2BSSA 3QEQA 5MERB 4N0UA 3OXRB 4B53A 2YK1L 1QHPA 2OJEB 2VXTL 5C0DB 2ZUQC 1CTNA 1J88A 2C1OB 2YXMA 5INCA 1NLBH 2O5ZL 1FYHB 2HWZH 3PWVA 3GKWH 4XNUL 3MRHB 2P48B 1OARL 3E0GA 1F42A 3VG0H 1JNHB 1MHCB 4JFEA 3UZQA 4ELMF 4MNGB 5TQ2L 2DD8H 2Z92A 5I17B 2HFGH 4X5WB 2FB4L 3TZVC 5DQJA 5IESH 3CU7A 4RA0C 3I50L 2W91A 3WMSA 4Y4KA 1NGZB 3D9AL 4FQXB 5BQ7B 5GRUH 4DUVA 1R5IA 5BS0E 3ZTJH 3BD4A 1VHPA 1IC5L 4NQEB 1T6WA 5F9JA 1ZEAL 3MRNB 3QUXB 3VFWA 4JGUA 3QUXC 4N1EA 5C6TL 3DYPA 2OJZL 3DBXA 3PP4H 4L4TD 4TPRL 2VLJD 4JFHD 4X83A 1NFKA 4XRCA 3ZSTA 4OD3H 3QG7L 1CLYH 1UVQB 2Z8VC 4QRPE 3CPLA 2EDDA 1Q72L 4DQOL 4PTUA 2EH8L 3CVHH 2I07B 2VZ1A 4W70A 2I60H 4QHMA 1EZVX 1GOGA 2CKBA 4QY8B 5TQ0L 3U0WH 3BXNB 3P0YH 3NTCH 1MJ8L 2BHYA 3OKKB 1G84A 3NCJL 1EFXD 1S8DB 3CFBB 3NCMA 4WDIA 4GSDH 4ZYKB 3T0EE 1HXMA 1OSZA 5CMAB 4HSQA 4PRID 1YN7A 3RP1A 4S1DC 4ZUUA 5I66B 2CUMA 4XPGL 5D5MA 3SKOB 4WUUE 3DHJA 2V5SA 1A0QL 3AU1B 4ZOAA 5FGBC 2FB4H 4H8WH 1YMHB 4Z77A 3ULSB 3MV01 5FUOL 4OZHE 4TSAH 3O41B 1YEDA 4XMLH 3V9FA 3TA3C 1QBLL 3CCHA 3T8XA 2KDGA 1A3RH 5F7KC 1HKFA 2AJ3B 2V17H 2VERN 1FV1A 3C60A 1JI2A 3IF1A 4WI7A 1P53A 2ATKB 2Q8AL 3T0ED 4MD4B 1DN0B 1F4XH 3QUZC 1QFWL 3I6KB 3BT2L 4S1RL 3MNWB 3OWEA 3NCFB 1YNLH 1KYOK 1MHPH 4PD4K 4X6DA 3LEXB 2D2OA 4OB5L 1JN6A 2AI0H 4KJWC 2JK5A 4X8JB 4XPAL 5K9OB 4APQD 4XNYH 4BQ6A 3RGVC 3INUL 5ITFA 1NFDF 1ZE3C 3QULA 3O45A 1KGCE 1OGAE 4BH7B 2XQYG 4LLYB 1YDPB 1XGYL 4MDJB 3K4AA 4LSVL 1ORSB 5E7FA 1WCBA 1A6ZB 3KHQA 4OLXH 4U6HA 2BXZA 3V6FA 4FXKB 4HF5L 4QT5A 1U91A 1WK0A 3JWDL 5J1AB 1IVLA 1FVEA 3DMMB 3PNWA 2ICEA 4LARH 5CEXA 1MCKA 4ZOEA 4F2MA 1E6OL 5JORA 1K3ZA 5FOBB 2I25N 5IM7B 1YN6B 2VTFA 3HZYB 4XH2A 4R6UA 2V2TB 4KMLB 1F02I 1A9BA 1K9TA 3HI1A 3V4UL 1I3GL 1AI1L 3X14A 2R23B 3HG1D 1NPUA 7FABH 1B4JH 2QV2A 2XKNA 2VSCA 4M6OH 5DMYA 3GSNH 1JHKH 5JORB 4HUKB 3S96B 1ZLVK 2ADFL 1S9YB 3U82B 1QSEE 2DLTA 1FN4A 2FLBT 2XZCL 1TJGH 5KS9A 1OCWL 5F9OL 3THMH 4NO0D 3GMMA 2EIDA 4FFWC 5EU6B 3VFGL 1J1OL 4L29A 3ZYJA 2BNRD 4G43B 4XPAH 3ARBA 1Y0LB 3QCTL 4OLZL 2CXGA 4GW4B 5IVXE 5DI8B 4YHLH 2CDFA 1CXKA 1RQ5A 4LGPB 1E4XH 1ZANL 4RAUA 1DUYA 4LSPH 4LDEB 2HLAB 4XBGB 5I0DA 5DUBA 1HQ4B 3LS5L 4P3WA 3QFDA 4CN4A 3N50A 3LQZB 3VD5A 5MEPA 3VH8B 1X6NA 1WWBX 3OKLA 3E6HA 3O6MH 3SKMB 4ODVL 4KKAC 2HMID 3IDGA 1IZJA 4BQCA 4E41D 4H88H 4XPBL 4NWTH 4TSCL 1MLBB 3CFIC 1KTKE 2WBWB 3ILPA 4G9FA 1BQSA 3MGOB 2QHRH 3DUSA 5I0ZA 4PLJD 3QCVH 1RPQA 3G5YB 5T3XL 1S9XB 3HI5L 4CJ0A 2DM2A 2HJFA 1Q9WA 3E3QE 4WFHE 1AP2A 2J2ZA 5FYKH 4K8RC 1QG3A 1T1XB 1C12B 3MROB 5FGRA 2XN9E 3MJ9A 4MXVE 4L4VB 1XF4A 3IDXL 1OAUH 4NKQB 3PHSA 4U2YA 4DKEH 5I1KL 1D3CA 3P9MB 3KPTA 4WNQA 1NKRA 43C9A 2EEDA 3D2UB 3WLWD 1I9RL 3UJTL 2OXGA 1S7XB 5IV2A 3KPNB 5CGYD 2NY4C 1AHWC 5ESQA 3U83A 4FG6C 5F7FA 3GNML 1IGTB 3KYKH 4PJIE 5KTEH 5E6ZA 4PJ9B 3Q2CA 3ZO0A 2EXYD 1OL0A 4TQEH 1YYMH 2DN7A 1TENA 3LIZH 3EDEA 3WFZA 3A6CH 5DMIH 1MH5B 3KLAB 3HNTL 3IU3B 4YUEH 4NJAH 2E6QA 3IXAA 2DQGH 4UNVA 1N0XL 2BHUA 2H2SC 2FHBA 3MRFB 3MRRA 4OBRA 1SMAA 4LPXA 4YDKH 1NGXB 3GSQB 4Y16B 1GIGL 3CD4A 1N0LA 4JFYB 2QHRL 5EO0B 1N64L 4YIQB 1JZ2A 1M71B 2VWEE 4TUOA 5GZNC 4G7VH 5MP6L 3MRRB 2AQ1A 5T1MB 1KLFA 3RTQD 4JVUA 2OCFD 5HHXH 5IK3B 4Z6AT 4AM0B 5E6IC 4RFOH 2OTUA 5GGSB 4E41A 4DVBA 3ZE0F 1CICD 1K2DB 1V3LA 1S3KL 1ZV5A 1MCOL 1OOAA 3VXMA 1P5UA 1CFSA 1T3FA 3SPVB 3IFNL 1F4YL 1DN0A 2PKDA 3OJVC 3TT3H 2VQ1B 2WMPA 1KLGA 2FO4B 3QHZL 3BGMB 1AGEB 2CLRA 4WFEE 5DRNA 3G5YA 2BERA 4HJGB 1RFDL 3W2DH 2LU3A 5GGRB 1NBVH 3DYOA 4HBCL 1I9EA 3DGGB 4M4PA 1U8OB 4N5ED 4RMSA 2Y6SD 3G6DL 1JNJA 5BW7C 5FHAL 1CD9B 4PREA 2BY0A 3HE7D 3TBVB 5JZ7D 4R96B 4XBPA 2D4FA 3WLWC 1KACB 4HUNB 1FG2A 4LNVA 1WAAE 2QTEA 2VSDA 4JM2F 1KV3A 5HYSG 2J8UE 3K8LA 3X3FH 3NGBB 2NNAB 4G7VL 4HIEB 3QQNA 2VXTH 3FO2B 5CD3B 1RJZA 1LWRA 2A6IA 3MBXL 2QSTA 4JFFA 3ULVD 4JE4B 2LV4A 4MZ2A 5GHWH 5L2KE 4RMTA 3MZTA 3QPXH 5F7LB 2HJLB 2P8MA 4NKOB 2IQ9H 2YMXL 2FH6A 4Q74A 5KN5A 5D6CA 1F3RB 3VE0A 3FZUD 3OV6A 1KBGL 1TETL 2X4TB 5JHDB 3BPLC 3QDGB 4NQVB 3ZT6A 1H3UA 2EDHA 1NUDA 4N0FB 4P3DA 4V1DA 1GPOL 2CDGA 7CGTA 4XAWL 4K71C 1VDGA 3QHZH 3LAFA 3P30L 1YPZB 3OXSA 2FL5A 1CT8A 4X6CA 2D03H 1NMAH 2XWBB 1MI5D 1R3JB 1IC5H 3MV8A 3TFKC 4KUZL 3LY6A 3HRPA 5FA4B 4EXPX 3L95A 3DVNA 4FP8H 1ZHBB 2KPNA 3AREB 4PGBA 1FG9C 1MCSA 2YSSA 3RVTD 2W0KA 4R97B 4GRWE 3MV8B 2HA1A 4PJAA 3FB7B 3WLBA 4MA1B 4WHYG 4N8CL 5HDBF 3EO9L 2AJ3A 4HUUA 5C0IA 4JJHA 4FFWD 3EW3B 3IDIB 4MZ3A 1FFNA 3UTSD 2CIIB 1UJTA 2WBJA 4MMXC 5IF0A 2JCCA 3HPJA 4OZIB 4S1QH 1BMGA 3LEYL 4I8DA 4NUGH 4Q9QH 4HC1L 3D85B 2R8SH 2W9EL 4FTVB 5DK0B 1NH6A 1RJYA 4OUOA 4NBXB 4JFDB 4X4XB 1F5WA 5I8EA 2DLFH 5GJTL 4YDIL 4WI9A 1G7QA 1CDHA 4MAYC 4D3CL 1A0QH 4IOSD 4OZIF 3O45B 3ULUF 2YD6A 5DHVA 3WD5H 1U2CA 1LO3L 4IRJB 1TETH 3GSOB 1P7KB 1ZXQA 3H3PH 4YGAB 1R0AL 1W72L 2GTZA 4N8VB 1UKSA 4OCRH 5E2JA 3I2CH 1BM3L 2FX7H 4ZXBD 1VGEH 1P2CA 3QZWA 5TE4L 2R0WH 1K4DA 1U58A 3WXVL 4NQSA 2OSLB 1S9VA 5C0RH 4KKCC 4X99A 4GG6E 1DANU 4Y4FC 4KUZH 4HJ0C 4I3SL 4M5ZH 4QKXB 3HB3D 3CVIL 2VUOA 4QHKJ 4Y5VB 4CVXA 3L3OA 3QCUL 2DL9A 5IG7A 3L1OL 4KK6D 2FZ3A 3CLEL 3TO4D 2GJ6A 4Z76A 4RBPH 3KS0H 4XCYB 2C1PA 3S97C 4YO0A 4QHLB 4X6BB 4EIZC 1U36A 4HBQA 3T2QA 3GJFK 3NCEB 2BC4B 5I8CA 2QKIB 1Q9LB 4I9WE 3FQUA 4QWWC 5I74C 3OBAA 4AEHH 4ZUVA 3WNPA 3VI3F 2AQ2A 3FOMA 1O5DT 5FO8B 3FB8A 3G5ZA 4AEIL 2A6KA 2DBJA 5DD1H 2QQLL 2DIJA 4KI1A 1NFIA 2APVA 3A67L 2ESVB 3QI9A 1S78C 1LO3H 4MB3A 3STBA 2AJXL 5DDHB 1K3IA 4CJ1A 1QRNE 3IKKA 3IAPA 3RKDC 4FQQA 3G6JA 4JKMA 5DJ0A 3OKNB 4M02A 5DJ2B 3FFDB 4Y7MA 3I2CL 1Q1JL 1QEWA 3SE9H 4HWUA 1TJGL 1YEJL 4PYHA 3MCKB 4WW2F 3HAEA 3DV4A 32C2A 3RY6A 4A2LA 1HCFX 2P42B 1MRFH 1INQB 4OCYH 5TDOB 1NGYA 4OFVA 3NFNA 3QXUA 3QCTH 5EC1A 2AXFA 2CRZA 5ENWA 5HYJA 5B4MD 1I7TB 1YMMD 4NRYA 4ZS6D 2WUBH 2X1PA 3S35X 4TVPL 3F58L 1INDH 1P69B 3NZ8A 5E8EA 3DPBA 1PY9A 4NO2B 4YXHH 5I71B 1D5MB 1MCJA 1PG7L 3C5SB 5LBSL 4NHUB 3I6LD 3QDGE 4IRSD 3EJYD 4FZEL 4QCIA 2WQ8A 4X6DB 4GJTB 5FUZH 5B8CB 5LCVH 1KPRA 1HI6B 3EYUL 4QRQB 3OF6A 1J0JA 2X1WL 3NGBC 1KELH 2NZ9D 3MFGB 1NC4B 2WLZA 3S7GA 4Y5VC 5C0GA 2C4FT 2QADD 4HUXA 4OQTH 3MLXL 4GRMB 4RGOH 1OTTD 3AREC 3EJZD 5J6GA 25C8H 5DQJB 1YYLL 2HVJB 2JB5L 4K23H 2G60L 2WUCH 4G8GA 2A9NL 5KSBA 5I1HL 4R4BA 3U0TA 3FQWA 5D1QC 4H25B 1DFBL 1FNAA 5GS1B 3WNNA 1FFOB 1X5IA 4MAYA 3TIDB 2W0LA 1CI5A 5DF0A 2AK1H 3S5LA 1A7QL 4NFDA 3UTTD 3PXJA 1WTGT 1OVZA 3H8NA 4PLJC 3RVUD 4NM8H 4MDIB 1JP5A 5GXBB 1FLRL 5I30H 5J56B 1WZ1H 3GBLA 1TMCB 1TJHL 1RZKL 4JR9L 1T1ZB 3BISA 3MRDB 1JYXA 2DQJL 4Y1AB 1VPOL 4PUBL 5HHNB 5EORH 1QLEH 3F58H 4P3CH 5CILH 3WV0A 4P5TD 3QXVA 3HZMB 3BP5A 1FNSL 1KLUB 1PEWA 4LPUA 5FXCH 3A6CL 2HTLC 4YXKL 3RJDA 1WBYA 4YDLB 3RVXC 3B9DA 4P2CG 3SQOL 2VDML 5J1TC 3UCRA 4MSWB 4JG0H 5CEYA 1WC7A 1I8KB 1QSFB 1I7RB 3G5VB 4ZMAT 2YD3A 5BZWA 4TUJA 5T1LA 1GH7A 1XGRA 4Z78B 1EZVY 1QFWM 2OJZH 4ODSL 1OTSC 3H7BB 3L3HA 3QUMH 2IF7A 3FTGA 4HS3A 3LQAC 4OD3L 5AZEH 3B9KA 4AEEA 3JVGA 3MV7E 1OD9A 1F90H 4HK0B 4L3CB 1ZOXA 4I5BB 3SCMB 1MJJB 5F3BA 3S88L 4MJ2A 1WEJH 2NY4D 5IFHH 4DGVH 1J0IA 5TF1L 4UILL 1JMXA 3GFUA 3EYVA 4RGNB 2ATKA 2BVQB 5FHBH 5BJTB 3OKEB 3QHTC 4MNQA 5JQHC 1H15B 3T65B 2MQ0A 3FFCE 1IKNA 1MFAL 1QFOA 2N1KA 3O2DH 1I7ZB 4OIAA 1KCVL 3CDFA 3RQ3A 4H5SA 5I1AB 3NZ8B 1GGIL 2HFEA 1CD0A 5CWSA 4FQ1H 2A74A 5EN2B 4L4TA 1CDCA 4QRRE 1IGYB 3AY4A 4KKCD 3DJ9A 2NY3C 1UEMA 3RWCA 3TEUA 3IVKA 4P49A 1I9JH 1AIFA 3IFOB 3RZWA 3RVWC 2JK5B 3BKJH 3BKYH 2J8UF 5CSZA 1TZGL 4XMLL 1CBVL 4OIIL 4OJFH 4O5LL 3VGAC 3C8KB 4WUUB 2X4NA 1CXFA 5FYLL 4JKWA 3IJHB 3IDMA 3NIGF 5J11C 4Q2ZB 5B39A 4PJXB 5I1GL 1FP5A 2ERJB 3MRLA 1OB1A 3HNSL 5GS2D 2XWTA 5DJ6A 3ULUH 5HBBA 3ARDD 5E9DA 4PJEA 2GT9A 4GKZB 3BPNB 3VE0B 4JQVA 3ZT7A 3V5HA 4X6DF 3VRLF 4ZUSA 1A7RL 4UV4L 4F80A 4DCQB 5IWLA 4FQ2L 2WWKO 3P4MB 4GS7C 3PE9A 1Q0YH 5ISZA 2EDBA 4AM0A 4J4PD 3X11B 3V52L 3WS3B 1FL3B 2ZOLA 5L7XL 2PCPB 1G7JB 2WZPD 3K2MC 1AE6L 4C56E 3DSFL 4QXGH 2FSEA 4LLWA 1MCEA 2VZTA 4XVTL 3PJSB 2HT3D 1UJ3A 4AT6A 4KJQC 4Y4HA 4NWUH 3RL2B 4TVSa 4JY4A 3RWHA 5EA0L 3RPIA 5BVPL 4QRTA 2ADIB 3GO1H 4G6AD 4Z7WE 5EZJA 5SX5H 4MJ5B 4RRPA 1G7LA 3B3IB 4QOKD 2WW8A 2R0LL 3E2HC 4HK0A 3O3EA 4HWZB 3JV6B 4Y19D 3N9GH 2DWDA 3I9GH 2HRLA 5C09E 4LSTH 3NA4A 3ZE2F 2FJGA 5ECJE 3WHXA 1RK0A 4OZGA 3EO9H 1FIGH 1WFUA 1YEDB 3IFLH 4XB7A 3PV7A 2WIMA 3AFLA 2EDKA 5FUCE 1A1OA 2Y36H 3BGMA 1DL7L 5ACZA 4KUCF 1BX2A 2H26A 4WHCA 3WFCL 2M2DA 4POUB 3LMJL 3LQMA 4NSKA 4OLZH 2R8SL 1FORH 3QJFA 5I17A 2FX8H 1NLBL 3RNQA 4JO2H 1ZANH 2B4CH 2M1KA 3Q1SH 5KVFH 3O6FB 4HLZH 1XCTA 1MVUB 4HS6B 4X8XA 1BX2B 4NQCB 1PYWB 4HUWB 1CF8H 2OR8A 2Z91B 3DV6B 3VD9A 1NCWH 5JXEA 4LASL 2R15A 3D3VD 4ODVH 4H26A 5CJQL 3HC3L 3CFEB 4XXCC 3W0WE 2BK8A 1ADQH 3VXUD 2IC2A 5KANI 3BPCA 5L2JB 1UWGH 4FXGB 3QHFL 4WW2A 4BJLA 5M95B 1GHFH 4FQXC 3U1SL 3SE3A 1FFOA 3IJHA 3HI5H 2YPKA 4UZGA 3ZKMD 1EHLL 2ZCKH 5L2KD 4S0TD 4HC1A 1S7SA 1H5BC 2CR6A 3SDDC 3BSZL 1ZHLA 1CLYL 2QKIA 4U6HB 2HFFB 3V6FB 5BVJA 2VZVA 2GKIA 4JRXB 2AJUH 3K1KC 4C83B 4G3YL 4M7KL 1HH6B 5IMMB 3P9LA 3QWQB 4R4FL 2JKXA 3U9UA 2YUXA 2CJUH 2Q8BH 1VFUA 1BJ1H 3SEPA 3JUYA 4DCQA 3OKOA 4OGAC 5ICZA 1C5CL 1IAOB 2F53B 5E2WL 4MQ7B 1P4LB 4MS8C 4PRNA 5JDSA 2C3WA 5FDWB 3DXAE 4X5LA 4UTAL 5KTEL 2AJZA 1XIWC 4KDTC 4YK4C 4KQ3H 3WFDL 1QP1A 1P9MC 3D87B 4DN4H 2X70A 1N2RB 5H37H 4ELMA 2HH0H 5JW3L 3LKNB 2IH1A 4AG4L 4OV6F 5E8DH 2Z9TA 4DAGH 4PR5A 4NPYA 4PBXA 4TOYL 4XWOD 2V5TA 2J6EL 3CFCH 5EU3B 2NQCA 4YR6A 2W60B 4OLWH 3LEXA 2KQMA 2NX5B 4MNQD 1EJOH 1ZTXH 2E6PA 5E08L 4L8DB 4U6VH 4PV9A 3HA0A 5DTFB 3ARUA 4NDMB 2HTLD 3PXHA 4PRPA 4L3EA 5D2LA 1M6OA 1B0RB 1IL1A 2E7CA 1ZVSA 3BHBB 2RHEA 3KNBB 1R3LB 1JF6A 3NCYS 4OB5H 2FYYB 3TYGL 2JELL 5F1NA 1YDPA 1WIOA 5EO9B 4HV8B 3RGHA 1IQDA 4MQXD 4GRWB 3JTTB 4GXUN 5IEHA 3WEXB 2DLGA 1JGVL 4HKZA 4ZQKA 4UT6L 1JVKA 4G3YH 4M7KH 1PKQB 1YEGL 1MQKL 2G75A 1KUMA 2NY0C 4LCUA 5IB2B 4ZNCD 4XP5L 4YFEA 1FL5A 2VXVL 4PJ5D 3GGWB 4WV1C 1IKFL 1YEFH 2RR3A 4DOHE 5KSVB 4L4VA 3MNVB 5F89A 1QYGL 3W39B 1HZHH 4G8IB 1FFRA 1D5IL 1H3GA 1LO5B 3NIGE 1WIUA 5IVXA 2OQJA 1X5XA 2CGRH 2CRMA 2UYLB 1YPZA 3OXSB 1KXQE 5IOPA 4X6BA 3IU4L 2ZCLL 3FQWB 4FQPA 4HJJL 3F5WA 2R4SH 4YWGL 4BK5A 4G42B 4F7EB 2P43B 3OB0K 1EGJL 2X89D 2F5AL 4DAGL 3BRGC 4JRYE 4M7JL 1A4JB 2AGJH 3I02B 1BAFL 4WFFD 1TTGA 3MV9D 2ADFH 2HG5A 4F58H 3ALPA 5IB1B 3FFCB 1ETZB 3O4LD 3WIIH 3IDJA 4JPIA 4LPYA 1EHNA 1AD9B 5I8KH 3VRJA 3UYRL 3BOVA 2GEEA 3JSSA 1I4FB 1L7IH 4IRSB 2J8UB 1FE8H 4DKFH 12E8H 3D1MC 3VI4F 4Y1AA 3TYGH 1UADC 4XPFL 2CSPA 4TTDC 1T22A 3ARSA 2WIIA 5GRZA 4J4PC 3UC0L 3RU8H 3MACH 1NGPL 5KVEH 1S7UB 5LXGH 4Y5XB 3CXHK 2VDLH 4LCYA 1FNGB 5D2NA 4LSUL 5EZOL 4XRCB 4HX1A 3LN5A 4S2SB 5DQDL 4YC2C 5L2KB 1HH9A 2R0ZL 4DWHA 1CD1B