3U9UB

Crystal structure of extracellular domain of human erbb4/her4 in complex with the fab fragment of mab1479
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fab Heavy Chain
publication title Proteolytic processing of ErbB4 in breast cancer.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 219
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3u9uB01
4KDWA 4POZD 2HTLD 1A2YB 3KPPB 4XAKD 3O0RH 5HGDA 2DQEL 2X4NB 5LKNA 1FO0L 2BJML 4PG9A 1A1MA 5F70A 4DUXA 1NMAL 3O8XA 4X6DF 2MJWA 4NKIH 2BVOB 3D25A 3RL1B 4LCCA 4OIAA 3GMPB 4X99B 2YXFA 1LHZA 3P4OB 2UY6A 1DQLL 1FO0B 3WXVH 3QUZA 2VLLB 5I8KL 1AXIB 5GS0L 5EWIH 1DN0B 1A6WL 3ZKMC 2EYRA 3D9AL 1JWMB 3L3KB 1FGNL 3PWPE 2P8MA 3RU8L 3OAYH 4M8VA 5B3NA 3SPVA 4BH8B 1NCDH 1WFNA 3MV11 5FO9A 4QNPE 3HE7C 3JWDL 2VOTA 4LHUD 3S4SA 3TH4T 4WHTB 4MHHI 2GCYB 2J88H 2JJUA 3BFOA 3BPOC 5IHUL 5DRZB 4H20H 2YC1A 1FFQA 3AC0A 4X6DE 5IVZA 4XPFH 1ONQA 3VXUE 5HGGS 2HVKB 3L95A 1U6AL 1AGFA 2QKIA 4FQIL 4KDTA 4M1GH 5CWSA 1QBLH 3BP7A 1VKXB 3RDTC 2EE2A 1FYHB 4ZG1A 4PJ5D 4ELMB 5E6IA 1WT5C 4NRZB 1CE1H 4OUOA 2BVTA 1LEGA 4ELMF 3IDNB 4Y4KA 4YHZH 2BOCA 5IESL 3LS5H 4O5LH 1HOCA 2Z4QA 4KTEL 4RFOH 2PW2A 4PJXB 3P40A 3MLSL 3WN5B 1YC7A 4ETYA 5DZOA 4MJ5B 1OP3K 2R23A 4PJXF 1IKNC 4MJIE 2DQTL 4TUJB 3O45B 4L9DA 4OCSH 1MIEH 4JFXA 5FHBH 4MQ7A 3EUUA 4L8SB 4X98B 2ICWJ 3QG7L 2VN4A 5T3XL 2VIRB 4G7YL 1J1PH 4JFEE 1DL7H 3BO8B 1F00I 4MD0B 1Q9OA 4KK9C 3RTQC 4EN3B 4DKFL 4KKBC 1FV1A 1GIGL 2Z9TA 5IBUG 3HAEA 4M1DH 3NCCB 2C3HA 1N0XH 4RSVA 4D0CB 4MDIA 5HYSA 4GRLC 3WIHL 3AM8A 1E28A 2AABL 1XT5A 2VDKH 4Z7VF 4HDIB 2FD6L 4R96B 1WAAA 3ZE2F 4D8PA 2EIZA 4ZO6A 2PW1A 2EC9U 1S7WA 1TPXC 1OPGL 4PJ8C 4XCYA 4Y5YA 3AREA 4EIGB 5D72L 4J2XA 5DFWH 3LS4H 5D6CB 2IAMA 4NQEA 4XAWL 1LK2B 4K94H 1N5YL 5C0CE 1PSKH 1AGEA 2ATPB 4P9ML 4HUWA 1YMHA 3FKUS 3I75A 3IGAA 4XNZC 5I15L 3KXFE 2XWJB 2VAJA 1KTRL 1XGUA 2DMCA 3QZWA 4EDXB 2G9HA 2OMBA 3H8NA 1HXMB 3W5NA 4Z7VE 2NY3D 4Y4FB 1VHPA 3BP6B 4BELD 4ZFFA 3L3IB 4M8QB 5KSAA 1V7ML 3ZE2E 3CSYB 5I30L 3DURB 1LD9A 1O7SA 3CMOH 1C5BH 5B8CC 2KL6A 2XXCB 3FO0H 4HF5L 4XBGB 2AJUH 5CJ8A 4ZFZB 1IC7L 3L7FA 1GGTA 5KOVC 4S2SB 3MUJA 4H26B 1BD2D 3LVEA 4ZUTB 5IKCB 4Y2DB 3IU3B 3OKLA 4MB5A 2WQRA 5HHVL 5JOPD 4PGEB 2R8SH 2F15A 4GW4A 3WEXA 4WFHE 1DDHA 1AIFB 1WBYB 4RGMC 1P2CA 4OSUL 2AS5M 5M7QA 3WFEL 3QDME 1D9KD 5JR1L 5DJ2B 4HWUA 4DCQA 4WV1B 2X4RB 3W5MA 1PZ5B 1U8HB 3GO1L 2F58H 2VABB 3FMGH 4G80A 2FX9L 3F8UB 1LVEA 5JMOC 2ICWI 2ZCLL 3RZCC 3S97C 3WE6A 1A7QH 3SQBA 3FZUD 4KC3B 4M6ML 4JFZL 1ETZA 3STZA 4HUUB 1J05B 4XP1L 4OCWH 1RU9H 5D7KE 2W9EL 5SWSE 1CF8L 5JW4R 1FAIL 3QIWC 1HZHH 4UV7L 2UY7A 4MMZC 1SEQH 2VXVL 4EVNA 4XP4H 4UV4H 3RJDA 4NRYB 2ZG2A 4HAGA 4MNQA 4P5KA 2R4SL 2R2HB 3EYFB 3S37X 3FQXA 4U4BA 3VRJA 2D7NA 4EDWL 1U8NA 3GHEL 1DBMH 1I9EA 1BQUA 3MJ8B 4JKWA 3S98A 2YA0A 5AD0B 4QRPA 3SO5A 4DK3A 4M7KL 1H3XA 1ACYL 2ZSVB 4PP2B 5DRNA 5FUZH 4JY5L 3SKJL 1OP5K 4LVOC 4XP5H 1KN4L 5LGHH 3O11A 4LSRH 1IM9B 2WIMA 3GKWL 4KK8C 1UT9A 5I74C 4E42A 4YHLH 4KHTH 2BMKB 2Q3AA 4NC1C 5D2NA 3UJIH 1WZLA 43C9A 2DIBA 1F97A 1P7QB 4AMKH 3MV8E 4K7PH 1KIQB 4MNGB 3BIKB 4JQIH 4TVPL 1VFUA 5HD8D 1DQQA 4XCEA 4C56A 5I76B 4JRXD 4PRNA 6CGTA 1T7VA 3D39D 4Z5RA 2DL9A 3BWAB 3DUSA 1MFCL 3BEVB 4PJFB 4P4KD 3V5DA 3T09A 3O81A 2GTZA 5L2KE 4PJFF 1B4JH 2XTJC 5EU7C 2O5YH 2UVFA 3I6KB 2BERA 3FONB 5HVHB 3T0ED 5ESVA 3AXLB 2NQCA 5KVEL 2LVCA 2A9MH 4CVXB 3VGEA 1EEZB 4AEHH 4WI9A 2GJJA 1MLBA 2H8PB 3GMRB 3D6GA 1HH6A 4U1SA 4BFEA 3EBAA 4U1GC 5AUMA 5EO9A 5EU6B 4Q9RH 5FKAB 1EH9A 1YEDA 1YEIL 3LRSA 3EGSB 2EDOA 3FT3B 3IDXH 4LCWA 1N8ZB 4HC1H 2ZUVA 5E99H 5GJTL 3U46A 1RZKL 2OI9C 3HHRB 5SWZA 2CH8A 3IU4H 1YECH 4TVPE 3T0WA 1AFVH 3S9DB 3SO3B 3O41A 4FG6D 4AZ8A 4NNYB 3STLB 2HJLB 1I1YB 1IGJB 5FA3B 3F7RA 5CCKL 5DHVA 5I1CL 2EYSA 2IPTL 1D5ZA 2O5ZL 2J2ZA 3KJ4C 1P9MA 1BM3L 4P2RE 3P4NB 5DEGB 4H8WL 2MCPH 4TUOA 4AH2B 2JCCB 4R97B 4JM2C 4YE4L 4OQTH 5CSZB 5B39G 2JCCF 1BZ9A 4WHCA 3TNNA 1K3IA 4HGWB 2WBKA 4AQOA 2IWGA 1VESA 3CFCH 1LDSA 3WBDA 4X6BA 2Z35B 5IOPB 4CU7A 4OD1H 4XPHH 1JHKL 2ESVA 4X80L 5DMIH 3WFBH 2GYSA 1YY9C 2QQQA 3GBML 2H26B 3V6ZB 1GXEA 4OB5L 3GSOA 4OCMC 4E0RA 3MRLA 3MRNB 3MV9E 3EOBA 3CGTA 2MPAL 1L7TL 3SBWC 1MH5A 2KQNA 4UOW0 1DBBH 3RWFB 4ONFH 3MYJA 3BGFB 1KLFA 3DNKA 3RRQA 3ZKXB 1I1AB 1OAUL 1OGTB 1BBJB 1EEQA 5JDSA 1GPOH 4ODWA 3LZFL 3UTSD 1UEMA 5FDYA 4MWFB 3DMMD 1Q9LA 4I0PD 3NCEB 2RR3A 1W0VB 2CSPA 2VITB 3QEQB 4MB4A 4PJDB 2YRPA 3BRGC 1CE6A 2XNAA 4PG2A 4PV8A 4M9PA 5DI8B 1N3NB 3QUKA 4L3EB 4RWHA 2XZCL 2EEBA 4CDGC 3TFKD 1C1EH 1NQBA 2HT3C 2YD6A 4AEIH 1FNSH 3MA9L 5IBUB 2ED7A 4MNHA 5FGSA 3SDAD 4Z8FL 4PRIB 3C08H 2FO1A 1MIML 5LWYL 3DYMA 1KPRA 4QHMA 4WI2A 2Y5TA 1BFOB 4QRTA 5HHME 3K4DA 1C7TA 3IT8D 3BKCL 5E2TH 4M4PA 2PO6D 5T33H 1CFTB 1UB5B 3LMJH 5DJZB 1XF5A 2BNRA 3SGJA 4HK0A 2X42A 8CGTA 5SX4I 1B6UA 3A6OA 2ZUQC 1DLFL 5FV1L 1A9BA 1BGXH 1H3PL 2ZSWB 5DS8A 4CNIA 3MRIA 4NO5A 1EFXD 4HWBL 2BDNL 1A2YA 2MOVA 1MWAL 1F02I 1JYWA 2X4NA 1T6VN 3BPNC 4O4YL 1RFDL 3T0XA 1QA9B 2MNUA 4QRUB 3RL1A 4ZUUB 1S9WB 4MA7L 3GMPA 4X99A 5IVNA 1KUMA 4Z0BH 1FO0A 4XAKE 4G5ZH 2VLLA 2FGZA 3N06B 4YFDB 1DN0A 2AGJL 3DX8B 1DQTA 5C3LD 4O2EB 3RVWD 1QEWB 3L3KA 1I7UA 5JQ6L 4PJAB 3FQTB 5ESAA 4BH8A 5J0BA 3FQUA 4KPHH 1KELH 4K8RD 1TZIB 3DX6A 1MJ7L 4PJAF 4R6UA 2IPUG 4WEBH 1OTUC 1MQKH 1E6OH 4F3FB 2GCYA 2ED9A 3BKMH 4K3DL 5DRZA 4WTZA 4XNUL 3CLFH 3L3GB 4H1LA 1CGXA 3O2VL 4NQVA 2HVKA 5T1KB 3U7WH 4GXVL 1SJVA 2PR4L 1BQLL 1ZS8B 1P4BL 2AK1L 4ZOAA 4O02L 1EHAA 4K94C 1LO4L 5CAYB 3P0VH 1S7UB 4RWYL 4ELMA 1DQDL 2XRAL 5DJAB 3MRHB 1CLZL 4NQCD 3IDNA 5IMKB 3D0LA 3PJSB 3S96B 4PJ5E 1G9ML 1I85C 4PY8J 3WN5A 4MJ5A 5HSFA 2HVJA 4POZC 2HTLC 4TUJA 3GRWA 5ICZB 3KYOB 3SJVE 4L8SA 4HIIA 4X98A 4NBZB 1EBPA 1HINL 4OLYH 4DGVL 5D7SL 4X4YB 4MD0A 3GJFB 4EN3A 3SCMD 4ODHH 2E6JA 3V8OA 3EFDH 5CP7A 3NAAL 1G7HA 4NQDD 1KACB 4YXKL 3FRUB 1U0QA 4JRWA 3HC4H 4D0CA 5F7HA 1UYWH 4PJEB 1NCBL 5CP3A 5DC9B 1K6QL 3OHXA 4HDIA 3VFPA 3CFBB 4R96A 1FE8L 3RIFF 4LNRB 1A5FH 3HMWH 3KPOB 1HILB 4Z77B 1UWGL 1R5VB 2NLJB 3HI6H 1EUUA 1S9VB 3STBA 1M1SA 3FJTA 5D6CA 1AJ7L 2FEEI 4R7DB 3W82A 1LK2A 4OF0A 4FTVB 3JVGC 4EUPH 5FYKH 2ATPA 4U1IB 2YEZB 4KHXL 1JI1A 3EOAB 4JFDD 3VWJD 3WUZA 2V5YA 3EFFB 1HXMA 2HLAB 2HT4C 3MROB 5HDOA 1KPUA 3L3IA 4PB0L 5KJRL 1T03L 5DK0A 3MRQA 2FGWL 5T1LB 4HPOL 3MLWL 4ZFZA 1OQOA 4BSVB 3OG6B 2J8UB 4W4OA 3RFZC 4S2SA 4H26A 1LP9F 2OL3L 1GGCH 2PYFA 2ZWLT 3PL6B 3IKCB 4ZUTA 5IKCA 1K5NB 4Y2DA 3WFCH 4S1QH 4ZPVB 2X89D 2O5XH 3BAEH 2DQJL 5GJSH 1AIFA 1WBYA 4PRHE 1BD2E 4PY8I 1JPTH 25C8L 2A73B 4KRPB 2L7UA 1LE5A 2WLYA 3F58H 1U8HA 3BZ4B 5A2FA 1VPOL 5JOPE 1CFVH 3FQNB 1CXEA 2Q8AL 1EGJA 3WD5H 5I71C 2BSSB 1BJ1H 1IGMH 4AIZB 4XPBL 1LP9E 1NAMA 4HUUA 1J05A 3GBNL 4NDMB 3TPKA 1RZ8B 2YOCA 4IOFD 2FIKB 3V6OC 5I16B 1Z9MA 5GGTL 3MACH 1I3VA 4N1CA 1WSST 4NRYA 2EECA 3S6CA 4H88L 2KQMA 3LQAH 5IQ9A 2BVQB 4HJJL 2R2HA 3IDYC 1R3LB 4ZFGL 1QNZH 1QRND 5C0IA 4JFPB 2HLFC 3MJ8A 1NCWH 4GKNB 1KB5H 1SY6A 5AD0A 1SVZA 2DQUL 2MWCA 4YFLF 1CDUA 2BC4B 4I18B 5BZWB 3V52L 2K1MA 3W9EB 2EO1A 1AR1D 4IRZH 4ZXBB 3V95A 2IAND 1NBZB 3KG5A 2Y1VA 1IM9A 4MDJB 5FF6B 4LPWA 3LQMA 3OAUH 3LKNB 5D8JH 2BMKA 5HY9B 4WVRA 4NGHL 3GMOB 3HC3L 4KRMB 5LXGH 1U95B 4LQ1A 4LIQL 1P7QA 3KPRB 4MNGA 3G6DH 3BIKA 5HYEA 2SEBB 4UIMA 4PJ9D 1D9KC 3GSQB 3JTSB 1XZ0A 2X9XA 4XNYH 5TDPB 5I76A 1V7NH 1FFNB 2JIXB 4L3CA 2Z8WC 3BWAA 1LDPH 3VWKD 1I3UA 2IJ0C 4PJFA 3FQWB 1FGVH 1A1OB 1WZKA 2C5DC 3I6KA 3FONA 4YNYA 4K7PX 2CKBH 4HBQA 3FZUC 4GW5B 1ZA3B 1U2HA 4JRXE 2D9QB 4M5YL 3D39E 5TE6L 1UFUA 1FQ9C 3IDJA 4FQJH 1EEZA 3SDDD 2DWEB 3QH3A 1SBSL 4XXDB 3QUYB 3SDCC 1PAMA 2H8PA 3P9LB 3GMRA 3I50L 3UEZA 3GSWB 1KCSL 1A21A 4IJ3C 3NCYP 4FQCL 4OLWH 4XCCH 5EU6A 5FKAA 1BJMA 4OTXH 4D9RE 5JUEH 2JJTC 1M7XA 3LEYH 5I6XC 3TZVC 3D85B 3A6CL 4WW2B 1YJDH 4Q0XL 3UDWC 4OAWB 2KZWA 5F88B 2FL5B 4WW2F 5I1AA 3HA0A 2NY2D 5DQ9A 5ICXB 1NCCL 3C2AH 2VDMH 3UTTD 1GJIA 4NNYA 1S7RA 5IVXB 2HJLA 4OZGE 2R0KL 5FKPA 1IGJA 1I1YA 5FA3A 4G6MH 2YXMA 5KVGH 3ZDZE 1A6TA 2P47B 3ECBB 3WJLA 3WFHB 4NKQB 3IFLL 3GK8L 1HHGB 1RJYB 1QHPA 5L0QB 4AH2A 2N7AA 3FFCD 5CSZA 4CW1B 3RA7H 5HPMB 3IDMB 5HD8C 1YUHB 4G3YL 4HGWA 4ZAKC 5E1HB 2OK0L 1YQVL 2CDGA 3N9GH 4W6YB 2AJZB 2JJSA 4WGWB 3L6FB 2Z35A 5IOPA 5D1XD 1AD9B 4KWUA 1DEDA 1BQHG 1DBJL 1UENA 3V6ZA 2H26A 3BE1H 3U4BL 3SE3C 3MRNA 4FRWA 4PJ7B 3T0EC 1H0DB 1UM4L 2WUBL 2CIIB 1FIGH 1H3UA 5I8OH 2DQCH 4F58L 1H5BB 1OAZL 1OGTA 3RY6C 5J4MA 4NQXB 4QRRD 4YHPB 4MWFA 1YY8B 2Z92B 4I3RL 1JHLH 4I4WB 3OF6D 5FK9B 1W0VA 5DDHA 2ZPKH 4K3JL 4PJDA 4NC2B 5DVOA 5DI8A 1N3NA 3LKQB 4L3EA 2FEDD 1K4CB 3DJ9A 3UTSE 1NDMB 2NY5L 3CNKA 3HB3C 5MI0C 3RWEA 4JJHA 5KVDH 3MFFB 4FG6C 5JHDB 1Z6JT 2EEDA 3RWDB 3MLRH 2DLEA 5EPMB 2CK0H 3HUJE 5I1DB 4OKVB 5HYQB 1BFOA 4MVBD 5IB1B 2UVEA 5DEFA 4G7VH 3SQOH 5KSBB 1WWBX 1HKLL 1CFTA 1T1XB 5KSBF 3FOLB 5D70L 4PV9B 1SM3L 4RA0C 1L6ZA 5IW3A 2Y6SC 2ZSWA 2CO6B 1I7TB 1RUQL 4WFGD 4MYWB 3QNZB 2GK2A 3OJMB 1N4XH 5GSVA 5E56A 3MNZB 1J5OL 1QA9A 3RUGB 2Y07L 1W72H 3OR6A 1FPTH 3FB7B 1S9WA 1RUML 3O2DL 3RUGF 3EYSH 5DLML 4LAQL 5EN2B 1KBGL 2J4WH 3DX8A 3HZMB 4O2EA 1QEWA 5DVNA 5I1IL 4JO3L 3VJ6B 2NPLX 4JO4L 4LLQB 1TCRB 3FQTA 4D0BB 2XN9B 1F4WH 1TZIA 3DMMC 1EO5A 4I0PC 2BHZA 1CFBA 1DQML 1TZGH 4R26L 1BPVA 4KROB 2AAVA 3MLUH 1Q0XL 1G6RL 4F33B 4F3FA 1AI1H 2F19L 5DYOB 1VGKB 2B1AH 4RRPG 3TFKC 1TIUA 3GZKA 5T1KA 2EDNA 1ZANL 1XGPA 1ZS8A 1I8KB 2P46B 2IGFH 4WWKD 1S7UA 1YDPB 2O26U 2EEAA 2DLFH 3VI3F 2C3XA 5DJAA 3MRHA 5E9DD 3MLVH 4I13B 3E3QE 2P5WE 3PJSA 3S96A 5E8DH 5C09B 1T21B 2G5BB 4K55A 2A9NL 1MCPL 4HS8H 4J23A 4WFED 3NTCL 1NUNB 2ZUWA 5ALCL 1WICA 4WU7B 1ZTXH 3GHBH 1JFQL 1ACZA 1FFOB 4CGTA 1WFTA 1X5LA 5F7NC 2ADIB 5ICZA 5A2LH 1TETH 2E9JA 4IS6A 1NKRA 2NXYD 1HQ4B 1SJEB 4JRYB 1NEZB 1X5AA 3HE7B 4CVZB 2AJ3B 2NYYC 4YPGB 3WYRA 1U3HC 4F57L 2DQFB 5J6GB 3FRUA 1LO5B 5C0ND 3CH8A 4ZYKB 5JXAH 3PDGA 4JQXC 1JGVL 3BPOB 5D7LB 3V0WL 3AFLA 3SE8L 2IBZX 3MC0A 1X5YA 2BK8A 4PRBB 4PJEA 4JFFE 4X7SL 1J1XL 3H9SB 1FYTD 2DIJA 4PY7A 4GBXB 2AJXH 4NQDE 3OJDB 5KZCB 3RDTB 3PHQB 2LFGA 3KPOA 3EOTL 4Z77A 5C8JB 3MR9B 4UIKL 2NLJA 5KS9A 4PIRF 4UBDD 2VXUL 4XPTH 1S9VA 4TSCH 1YEFH 5D93C 4BYHA 3U0PA 3D87B 2CIKB 3WLWD 2VRAA 4Z78B 1IT9L 3AAZB 4KY1L 4R7DA 5FHAL 1MF2H 1GAFL 1F6FB 4L9LC 2OXGA 2XZZA 4FTVA 4AT6A 2YEZA 3LQAC 3O4LD 1SVCP 1IAII 3VA2C 2AEQH 4ZD3L 1F3JA 3EFFA 2APWA 5GGVY 2HLAA 2V2TA 3MROA 4BSWB 3PGCB 4QO1A 2VH5L 3D69A 2HT2D 2X41A 4NM8L 5CBAB 5J11C 5KSUB 1E4XH 3KPSB 3QP3A 4YGVB 5T1LA 4JFDE 1FORL 2GJ6D 4JZJC 3X13B 3RTQB 2FX7L 4BSVA 1O5DT 2VXSL 2J8UA 2XY2A 1OGAD 3GB7B 3TN0D 1S7TB 1BMGA 5J1AA 4YXHL 1K5NA 4GQ9H 5TPWL 5FYJU 4ZPVA 1GH7A 1QFWL 3K80A 1ZXQA 3MOAL 4GRLB 1TJHH 3BT2L 3SCMC 3VMOA 3OZ9L 3S37L 1VACB 4Y1AE 2A73A 1KTDB 1ROWA 2NTFA 1SHMA 1TPXB 4GW1B 4X7FC 5GRJH 4PJ8B 1K85A 2I60L 4JPWL 3UROR 4LU5L 3FQNA 4JO2H 3D48R 1UWXK 2BSSA 3D5OF 4MXWL 4AIZA 4EIZC 4M5ZH 1U93A 4TQEL 4APQD 2ICES 2X1XR 3RWIB 1RZ8A 5CZVL 3NCMA 4DTGH 2FX8L 3KYKL 4RDQG 2FIKA 5ANMB 2EH8H 2ZZUT 5D7JD 3S5LB 1W8NA 4XGZB 3P0YH 3ARXA 2E7BA 4UT6H 2AERT 2DQDL 3ROOB 4J3WA 2BVQA 1UACL 4PRAA 1Q38A 1F45A 4JKPL 4YEEA 1S7SB 1JTTA 5B8CB 3VWJC 3VXMB 3NFSH 3REWB 1R3LA 4JHWL 4B53A 4JFPA 2V7HB 1YJDC 2AW2A 4LASL 5HGAB 4ZUVB 4NJ9L 1R3HB 2BC4A 1D7FA 3B83A 5BZWA 3W9EA 2FATH 4ZXBA 4NUGL 3BKJL 1V8HA 3O3BB 2DJUA 4N1EA 3VXRD 4ODXB 1QRNE 5KANG 4RGMB 2OSLB 4Q74A 5DHYA 3B9KD 4MDJA 3A0OA 5FF6A 3NH7H 5GGVL 1T1YA 5HY9A 1RJCA 4I0CC 1Z3GL 3H7BA 5BQ7B 3GMOA 1U95A 3O6KH 3HG1D 2IEPA 3TJEH 3ZSTA 1LO2H 3RVXD 1Y6MR 3L5XL 1IKFH 3NZ8A 3KPRA 5C2UB 4GG6B 5JIHA 2SEBA 1A7OL 5CD3B 3GSQA 1WEJH 3JTSA 1Q9WB 3RZCB 3T2NH 2YPVL 2WMPA 5ISZD 4X8JB 1AHWA 2DKSA 4N0UA 1FFNA 4MGXA 5CEXB 4F8TA 1Z0NA 2Q8BL 3NZHL 2ZCHL 1JGUH 1A1OA 5C3TA 3QIWB 3OB8A 4OJFL 4I5BB 3HFMH 4GAFB 3SEPA 4U1JB 5LGJB 2B20A 1ZA3A 1QSFD 1MI5B 1N6UA 2R0ZL 5CEZL 3AB0C 1D3CA 1F8TL 3U30C 1F58L 1HSBA 2P8PB 1PDKA 3HMXA 4RAUB 1FBIH 2NNAB 4IOFC 4XXDA 4YDKL 3PG2A 4P9HH 3BYTA 1J0HA 5A40E 3GSWA 4R90L 2J7LA 1EBAA 5MEQA 3NCJL 5A1AA 4MAUH 4S0SD 3BP4B 3BPCB 1HIML 2W0FB 2UYLB 4A2LA 1G0XA 2VQ1B 1K4DA 3ET9F 2BCKA 4P3CH 3ZT7A 4LVOB 4BQ8A 2QSQA 5I74B 4OAWA 2H32B 5F88A 2FL5A 3HTLX 4P46D 1MFAL 5ICXA 12E8H 1AP2B 4PJCF 5IVXA 2ZCKL 4AG4L 1T6WA 1VCAA 1OB1B 1RUPH 4AIXA 5HHXL 4JPVH 3WFHA 4N5UA 5GGUA 5FUOH 4KGLA 4I0KA 1HHGA 1RJYA 5CEZE 3WLBA 1CXHA 3QI9B 3EO9H 5CSBA 4RMQA 3KPQB 3HZVA 5F7YC 5HPMA 3IDMA 1JRHL 4Y89A 4U0RC 2XTJB 5ABDE 5IJKC 1QG3A 1YUHA 4PJ9C 4DKEH 4XHQA 2JKXA 2O61B 5B38G 2AJZA 4HJGB 1ZWIB 1CCZA 2E8YA 3VWKC 3L6FA 5BV7L 1A7RL 3ZL4L 4EI6B 1CICA 2X6MA 4X4MA 4HLZG 3FFCE 4ZS7L 3RBGA 1AD9A 3C8KB 5DT1L 1D6VL 4PJCE 2NY1D 4I8DA 4JFOB 4U1GB 2ZG1A 1IEAB 2W60A 2CK2A 5FYLD 4PJ7A 1H0DA 1T20A 5DMGD 2CIIA 3SDDC 2FZ3A 2OI9B 3OJVC 4NQXA 2Y9RT 5JLZB 1GVIA 5EA0H 1CD8A 2Z92A 4XMPL 4I4WA 5JXED 1KSRA 5FK9A 4OZHE 1J0YA 4OM0H 3BDYH 3NIDE 1K4CA 4Q6IC 5EORH 1SYSB 4PRPB 4YPJA 5A2IH 3KJ4B 3TBWB 2DAVA 4MMXC 2FNBA 3MFFA 4Z7WE 5JHDA 5MP6H 1S5HB 2OCFD 5ACLA 4JM2B 1AGCB 3QHZL 3O0RL 4OKVA 1N7ML 5HYQA 5D1QD 4LVHC 4B41A 3WNNA 5KSBA 3DUUB 1KJ2L 3BISA 4WI4A 3G5ZB 1T1XA 2FO4A 3O8XC 1GRWA 4LRNH 4R0LA 4YFLI 3G6JF 3FOLA 3TCXA 4PV9A 4TSBL 3K4AA 4EI5D 4JDVB 2VLRA 3AU1B 5GGSB 1XGQB 4MSWA 2RCSH 5E2JA 1KT2B 1I7TA 4I3SH 4Y19E 5D1XC 5GHWH 3MJ9H 4ONHA 1NUDA 4GS7B 5ENWB 1DBKH 2XQBH 1TVHB 4R8WH 4OV5B 1EHNA 4F15C 5IMLB 1CD1A 5EN2A 4G6KH 2UZIH 3HZMA 4M1GL 3G6JE 1RZ7H 3VJ6A 2V17L 4OFIA 2OBGA 1Q72H 1CZ8H 4D0BA 4H0GA 5C0BD 2OLDA 4JE4B 3VH8G 3KPMB 4HKZB 1PKQB 1LILA 4F33A 4Z7UA 5DYOA 4OV6F 1ERNA 2FLRT 4Y4KC 3QIBD 4YHZL 4E41A 3LS5L 4NHCL 4YDJA 5TJWK 4XVSL 1I8KA 4GMSL 4HCRA 3KYMB 3BUYB 2ZUQB 4PRDB 1NCAH 4GMTL 5FGCB 1YDPA 4MVBC 4XC1H 5EU5B 3T0BA 3GUTA 1AD0B 1KV3A 2ZNWA 4WHYG 1QSEE 3HPLA 3L3HA 4TPRH 1KYOJ 3KYNB 4G8EB 4JO1L 1FRGH 4QGTA 5DRXB 3UJTH 2P5ED 1S9XB 2OTWB 3T8XB 4HG4J 3HI5H 1B0GA 3BPNB 4WCYL 4XCNB 5C09A 2DD8L 4KJPC 2G5BA 2AK4B 2AJYL 1UA6L 1YYLH 4M1DL 2GFBB 4RDQF 1ZHBB 2A0LD 2PYED 4WU7A 3WUWG 5F7WC 3VXSA 1MJUH 1P53A 2OMNA 1EIBA 3ZKND 4GQPH 4BFGA 1XMWA 4UTAH 3UTPE 3P3YA 2CRYA 4WFEE 1KCVH 2C1PB 5EUKB 1SJEA 4JRYA 1NEZA 3CVHH 3HE7A 4H1LH 2JLLA 4CVZA 5EZJB 4Y5YC 2AJ3A 5IF0B 2NZIA 3BEWB 4WW1B 5DMYA 5J6GA 5C0FB 5DRWB 1LO5A 3U4AA 4ZYKA 4YHML 1T4KB 2VWEE 2MCG1 3LS4L 2MTPA 5E2VH 1ZVSB 1RPQA 2IAMC 4K9EH 3H9SA 5IHLB 3KR3L 4QRQA 3EO0B 2YK1H 4C4KO 4KZEH 5I1GL 3D3VE 4MXVE 5CJQH 3OJDA 3BD5A 3RDTA 4G9FE 3PHQA 5D71H 3ROLB 5C8JA 3MR9A 4RGOL 3LV3A 5F89B 4OFVA 4ZFOL 1CI5A 1PQZB 4F7TB 3VGAC 4K7PY 2CIKA 5IMMA 1C5BL 1OARL 2VUYA 2YPLB 3FO0L 2XA8H 3TA3D 4HXAH 5GRVK 4WWKC 2Q6WA 4YHKH 2E9IA 4GLRI 1GZQB 4WIQA 2R8SL 2WW8A 4DKDC 5INCA 2A1WL 4JHAL 4V1DB 5KSUA 5CBAA 4PD4K 2VDQH 4FABL 3KPSA 3WXWH 4JPIB 3RGVD 2HFGH 3N85H 3X13A 3RTQA 1ZLWH 1X4YA 3OXRA 3GB7A 3PP3K 4KMTH 4PS4H 4HZAA 4QF1B 4X9FA 3DUHA 1A8JH 3OJ2C 6FABH 1A7QL 5JPMB 3ESVF 1G1CA 4G6JH 2GJ6E 4GRLA 1YEHH 2NXYC 3VU2A 4OCWL 3VXUA 5C71A 2X1PA 4LNVA 3ULSB 1OGAE 1VACA 4LHUB 2ZOLB 3QQ9D 5AAWA 1KTDA 4RFNC 3AS1A 5C0NC 1SEQL 4XP4L 4GW1A 3B9EA 3C5ZD 4PJ8A 3NMEA 1RUAH 4M7LH 4OD2B 4M62H 3T0DA 4DW2L 1P69B 1U8QB 5CJOL 1N6QL 5LAXB 4NP4H 5E8NA 3C6LA 3W11D 4KKCD 3PWUB 1G1YA 1XGYL 4FZ8L 3RWIA 2BFVH 1BOGB 3MUGB 5F9JB 4P9HC 1CFNB 3B2VL 5ANMA 3R1GH 3W9DB 4TTDD 4YR6B 5FUZL 3U79A 1XR9B 3S5LA 4XGZA 1H15B 5C7XL 3OX8B 2EE9A 2M2DA 1ZVYA 4LSRL 4UDUB 3ROOA 4XZUB 4RGNC 3BRFA 2WV3A 1CTOA 3T08A 4ZSOE 3KNBB 1S7SA 4YHLL 3U9UB 5B8CA 3VXMA 3REWA 5LVEA 3MGOB 4HKBB 2L0DA 4N68A 2NY0C 4S0TD 5HGAA 1OAXL 4ZUVA 2HT2C 1RULH 4K7PL 2R1YB 1R3HA 4RMSA 4UQ3B 2BY0A 4N5EC 3N0PB 3O3BA 4ODXA 3PWJA 3TVMD 1J88A 3TN0C 4Q9CA 3GSRA 4FNLL 4KQ4L 1ZOXA 1EGJH 1B4JL 1S7XB 2H2PD 4YWGH 1NMBL 5EC2A 4IHOB 4PJHF 5D6DA 4RA3A 4B7IA 2GHWB 3VXRE 5CMAB 1NAMH 4G8IB 5F9WC 1G6VK 4GG6A 4OCYL 5ITBH 5I71B 5CD3A 1MCWW 5DJCB 1OLZA 3RZCA 1Q9WA 4O2CB 2DMBA 5C6PB 4X8JA 5CEXA 4CJ1A 4Q9RL 1YEEL 2QQKH 4ODBD 3QXTA 9CGTA 2DLTA 3MGTB 4W4NA 3PDDA 3QIWA 2ARJQ 4I5BA 3I6LE 1IAIM 3QXWA 2GQHA 4G8FB 4OIIH 1JPSH 4U1JA 2YBRB 4ZTPL 3TEUA 3VXOB 3TO2B 5LGJA 3BZEA 2BY2A 2PCPA 3MTRA 1MI5A 2DM7A 3IU4L 1YECL 5HHQB 5J9PA 3MSPA 2NNAA 1AFVL 5IFAH 4GO6B 3IDYB 4JREC 1SY6H 4PJHE 2J6EH 5D7JC 2H1PH 4QEGA 4XPGL 5CFHA 5F8RC 4CVUA 5DMKB 1QSFE 2EC9T 3RJQB 1L9MA 3BPCA 1I8LC 2W0FA 3A6BH 5TFSH 3VFRB 5DD3H 1VADB 3U9PH 1JZ4A 3PGDB 2LTQC 3JWOH 2VQ1A 2VLJD 4XXCC 2W0PA 1I3RA 1XF3B 4PGJA 4ODVH 2VTFA 3IF1A 1NC2D 2H32A 2RB8A 5E0QA 3K2UH 1RAMA 4OZIE 1AP2A 4KUCD 2BHYA 1CGTA 1M7IB 4QHUB 1T1WB 1CGYA 3CFCL 5F7DB 1OB1A 4M9OA 2VKWA 5LCVH 1BX2B 3T1FA 4DQOH 2I5YH 3B9KC 3CX2A 4XNXH 4XB7A 4OD1L 1D9KB 3WFBL 3E8UH 3VH8B 3K46A 4JPKH 1I8IB 7CGTA 5BXFB 4Y16D 3DXAE 4MS8C 1ND0B 3UJJL 3VD7A 3KPQA 1DVFC 1DBBL 4Y88A 1NANH 4ZNCD 1FLRH 4FXGB 1UQSA 3VXNA 1F5WA 3DRQA 4V2CB 2NCMA 4HJGA 2CXKA 1ZWIA 5BVJB 1QR1B 3C8KA 3SDCB 5DQDH 3C6SB 2XZAH 3N50A 2M8XA 3CK0H 5D96C 1IEAA 3LDBC 4IJ3B 5JORB 3GIZH 3ZDYE 3H9HA 1T5XB 3ARFD 1IGFH 3O6LL 5I6XB 3TZVB 1QFWI 3QDJB 2ICCA 4I1NB 4WO4D 1PGRB 2NXZD 5FYLE 5JLZA 2OJZH 3MNVB 4L5FH 3C08L 5DFVD 3OXSA 1I9JL 1I7ZB 2JF1A 2M1KA 4NO0D 5I8EB 3TT3L 2EDYA 1FNEB 2UUDH 3P77B 1FNGB 3Q1SL 2FBJL 1MFBL 5LBSH 3U0TB 5JZ7C 4PTUB 1SEBB 5IK3B 3DETC 4LSPL 2AXGA 1TDQA 2IBZY 4XMLL 1YNTB 2QQNL 3HNSH 4N0CC 3RNQA 3MV8A 3EYUL 1SYSA 3SGJC 3MA7B 3DBXB 4U1HB 4QTIL 1C5CL 3TBWA 1ZE3C 3N1MC 1BGXL 4NQSB 5DUML 1VSCA 3INUH 1S5HA 1FL5B 4JM2A 1KCUH 2BXZA 2XOTA 4YBHA 3RQ3A 3WCYA 3QXVA 5L2KA 1KXVC 2VO5A 4ZAKB 2P1YA 3MV7B 3DUUA 3V79C 3G5ZA 5EU3B 4M7LT 4H5SB 2PUQT 1FHGA 3KPNB 4UT7L 5ETUB 1GL4B 5IV2B 4G5ZL 2AV7B 4JDVA 4LGPB 3AU1A 4HWEL 1A3RL 5GGSA 1XGQA 2ZUTA 1QHOA 3OKEB 4LSVL 3T0EB 2WUCH 4P5MB 1KT2A 4XX1E 4ZQKB 1SMAA 2NZ9C 1IC4H 4XCFL 2IFFL 3SBWA 1EO8H 4Y5XA 1B90A 1IEHA 4NO2B 5CBEA 5ENWA 3OKMA 1CVSC 1UXWA 3C8DA 1KULA 4WUUE 2YD2A 4OV5A 1Z9SA 3S35H 5DMGC 5IMLA 1ZLUH 2EYTB 1HK6A 3ZTNH 3X3FH 3GFUA 1NLBH 3VFWB 1FLTX 3U7WL 2X05A 5GISH 2HRPL 3PWNB 1C5DA 4NZRL 4K9EC 1V3JA 3TBVA 5MI0B 2F54D 2X4OB 1A9EB 5HI5D 5EOQH 2VDPL 3PP4H 3KPMA 5LQBL 1PKQA 3HS0B 1JZ6A 2BNQD 3QO1B 3CUPB 3BH8B 1R0AH 5C0BE 1MVFA 5TF1H 4HH9A 3QEGL 5TQ2H 4JKKA 2DM3A 2FHFA 3QCVH 5BRZD 1WV7T 3ZHDA 4C59B 1G84A 2H6PB 5IBTH 5DEZA 3KYMA 4PRDA 3V0AC 5DUPH 3TO4D 3MRKB 5D1QC 3EAKA 5EU5A 5GS3A 4WI6A 1AD0A 4JFHD 3KYNA 1A7NH 1AQKL 5JNYB 4OLYL 4G8EA 4U33A 5DRXA 4FFWC 3T2QA 3NBNA 1S9KC 1A22B 3IDIB 1S9XA 3QO0B 2OTWA 4ODHL 3T8XA 3EFDL 5FECB 1EK3A 4XCNA 4EI5C 3MLYL 1JPST 2AK4A 1XIWD 5DO2D 1CQYA 3EZ8A 5F7EL 4DAGL 2K7QA 5DWUL 4F7MB 4D9QD 2GFBA 3HC4L 1ZHBA 1NFDB 1UYWL 1WC7B 1OT2A 5GSRB 3IJHB 4JZOA 3U0WL 4N8VG 4OM1L 3F7VB 1RIUH 4FFZH 4X8XA 1JPFB 3TM6A 2C1PA 5EUKA 2X70B 3G5VB 2P48B 3DMMB 3KPTA 4LSUH 4I0PB 1T66D 1S7VA 5EZJA 5IF0A 3BEWA 4WW1A 4HT1H 5DRWA 5FFLA 1F2XK 1T4KA 5F3HA 1HYRC 4G8GD 2QBWA 4JJ5B 4M02A 1ZVSA 2YUVA 3QDGB 2XWBB 1JRHI 1RIHH 5IBLD 2CR3A 3EO0A 3CC5B 5FYKL 5HVFB 5CZXD 1FZKB 1B6DA 5KTEH 1UM5H 2DTMH 2YUXA 1FZJB 4OGXH 1PLGH 1EDQA 4F7PA 3ROLA 2CLVB 4ONOA 5T5FH 3QDHA 3ZKQD 1BFTA 3PV6B 4EUPB 3CLEH 1UZ6F 1WCBB 3BKYL 3QIBC 5F89A 5F9DC 5K9JH 3L7EB 4HPYH 1PQZA 1R3IH 2CDFB 1KCKA 1TCMA 3CH1B 4IRSD 2YUWA 4M43L 4HV8A 3ALXA 3ESUF 3DX7B 1PG7X 4GKZB 1I85A 3ULVD 2PTTB 2AKRB 3QCTH 3E1F1 4PGBB 1XF2A 1CXFA 4LMQI 4NRXA 1JZ2A 1GZQA 2VLMD 15C8H 4HKXB 4GAJH 4V1DA 1ADQL 1TQCB 2D7QA 3UMTA 1JPTL 4JPIA 3RPKA 4YQXH 2BSTB 5HVWA 1UZ6E 1P4LB 3F62A 2A0LC 2H2SD 4FS0A 1U92B 2P42B 1IEBB 1U3HB 3ZKNC 2E27H 5HI3C 4NOFA 4HIEB 3EDEA 4CMHC 5JPMA 4Z76B 4DGIH 4MA1C 5J1TC 4KMQA 4YLQT 3ULSA 4RNRB 2GSIB 4OUUB 4LHUA 2ZOLA 1GZPB 4GRWH 4M03A 4U49A 2X10A 2VAAB 2VR5A 3MACL 1HKFA 1NGWB 4OD2A 3DVGB 5K9KB 5ALBH 4H25B 4BM7A 5D93B 5LAXA 3LQAL 2VNCA 5E2UH 2DLHA 3LQZB 3H3BC 4L4TD 4S1SL 3LRGA 3PWUA 2D3VA 5FUCC 3C5JB 4L9LB 3JVGA 4OIBA 3BH9B 1NCWL 1BOGA 4PJ5A 3MUGA 2I25N 5AZEL 4M93C 1JGLH 5JW5B 5E95B 1BFVL 2R29H 1CFNA 1KCRH 5GGQH 3S4SG 3W9DA 4GG8B 2B1HH 4YR6A 3R0MA 4NQCB 3ZHKA 1XR9A 4IRZL 4LCYB 4PJGB 4YDLC 3TA3C 3CX5K 2B39A 4U1NB 5KSAD 3W0WB 1KB5B 4UDUA 2R9HD 5J11B 1NC4D 2D31B 1JUFB 4P2QB 4PJGF 4XZUA 4OGAD 3JWOC 4PGDB 3SE9L 5D8JL 1J7VR 4JZJB 3MOBL 2AEPH 2LABA 5LXGL 5DA4A 3MGOA 5FYKU 3VGDA 3Q6GL 4PJBF 4UQ3A 1I1FB 2R1YA 3G6DL 1T7YA 2X1WL 3ULUH 4KXZI 2HMID 5DJ6B 4L4VD 5BZDA 3I3BA 1S78D 2PETA 5E2WL 3DO3A 5EBLA 3TIDB 1FGVL 5ICYA 4PTTB 4I2XB 5E1AB 5E5MA 3V4VL 4IHOA 2H45A 5C9JA 4GOSA 2XXMB 4OF5A 5CMAA 4G8IA 4NUJB 1MCCA 1FNAA 4FQJL 3ALPA 1EVUA 1N59B 2NW2B 5DJCA 1QBMH 3F7PC 4FFVD 4LVEA 4O2CA 1RZGA 2CKBB 1YYMH 2CJUL 4OZ4A 4PJBE 4OLWL 2IG2H 1XH3B 3MGTA 2D7MA 4Y7MA 4PR5B 4QXWA 4DVBA 4G8FA 2EDLA 3LEYL 3M8OH 4UNTA 5D2LB 1LNUA 1PG7W 3HAEG 3VXOA 2DBLL 3W11C 3TO2A 4KKCC 5BS0D 5D2LF 2B5IC 4K3GA 5HYSG 5HHQA 2DYPD 1DBAH 2VZVA 2HWZH 4C83B 4OCLC 1K8IB 4HC1A 4JZNB 4YK4C 3VWJB 1Z0MA 3C2AL 2GTWB 1FH5H 4MJ2A 5IUSA 5DMKA 4PLNC 3HZYA 5C0DB 2EIBA 3VCLB 3VFRA 3OG4B 1KNOB 1VADA 1Z9OA 3RAJL 3ULVH 3PGDA 4ZPTB 4LQFH 3I2CH 2AI0L 3VXPB 2ADGB 3S88L 5JIIA 3LAFA 3CSPA 4JN1L 5F96L 1BD2A 3TF7C 1LGVA 4KI5F 3AY4C 4D9LH 1QKZL 4NO3B 3T4AA 2YA2A 5BVPH 1M7IA 4QHUA 3VGFA 1D5BB 3QZWG 5EUOF 1T1WA 5F7DA 3QQ4B 5MENE 5L88H 4KV5F 1DCLA 4KTDH 4OQTA 1BX2A 3TVMC 3VXTB 1A3LH 3JTTB 3GBLA 3VD3A 1D9KA 2V9RA 2H2PC 1I8IA 1UJ3C 1EV2E 3SGKA 2OZ4H 4DZ8B 1ND0A 3IKKA 2MQCA 1FIGL 4QRSA 4HXBH 3UYRH 2VDNH 4FXGA 1RZFH 1WTGT 2NY4D 4O58H 3AB0B 1JNLH 5ACZB 3U30B 1UM6L 4KI5E 5BVJA 5FB8B 3SDCA 3FN3A 2N56A 5EUOE 5TQ0H 4HLJA 5C08D 5JORA 2G60L 4HEME 4ACPA 2Z31B 1T5XA 3VI4F 3X12A 2JJTA 4OFYD 3MJ7B 3QDJA 5F93C 1FNFA 3HRPA 5SWZD 3ARBC 4HFUH 5AG9A 4UB0L 2XPGB 4NM4H 2OR9H 5HHOD 1E4JA 1OOAA 1CS6A 1I7ZA 3MLRL 4CADB 5BMFL 2BP3A 5I8EA 4C57C 4YFEA 5H35A 3IXTB 3P77A 4N8VB 2CGRL 2CRMA 3BGMB 4HIHB 3PQYD 1SEBA 1UB6A 2IANB 1YNTA 1FC2D 3MA7A 3DBXA 4U1HA 5I19L 1I1CA 2KZ1B 4NQSA 5MHSD 2LVEA 1WITA 4LLWA 1S9YB 1FFRA 1C16B 1FL5A 1KCLA 3VI4E 3GGWB 4U0RB 3GMMB 4PJ9B 4ZAKA 4NZTH 5M94B 4YH6A 5EU3A 3D39A 4NN5B 4PJIF 1W72L 3FAWA 1QFHA 3KPNA 2X4SB 1M6OB 5IV2A 4P4KA 1RUKL 2AV7A 2ESVD 2VL4A 3G04A 1ZLSH 2VN7A 2VSDA 3OKEA 3SE3A 5ADPL 1W72B 3T0EA 4P5MA 4ZQKA 1X4XA 1OWRM 3OV6A 3SDDB 5A43C 5IMOA 1JNNH 4NO2A 2FJFB 3PGFH 3CSGA 1FVDA 3C09C 3RY6A 2CD0A 1J10A 3MLUL 5DD1H 1FZMB 4P59L 3W2DL 1AI1L 3U7YL 5CD5D 5E7BA 5JA8B 2O93L 2EYTA 4LSSL 3L1OH 4XP9L 3WKNA 5DTFB 4RX4D 2VLKE 4PJIE 3VFWA 2GK0B 4RQQB 1JP5A 1CDJA 4WO4C 3S36X 4Q6IB 3PWNA 4G6AD 4KZDH 2NY7L 5DFVC 5SX4H 2X4OA 4DEPC 1A9EA 3S35X 3UTTB 3EW3B 3HS0A 3WSQH 4LARL 4RFEA 1NLDL 3QO1A 3CUPA 4U3XA 4CU6A 3V4PL 4OGYL 1A6PA 4LVHB 4ZNEA 1DUYA 2PF6A 3ARDD 4LEXL 2Y06L 4KKAD 3O8XB 2X9YA 3PWPD 4Z7OE 2H6PA 2ID5A 2BNQE 2ADJB 4QYOB 1F11B 4LGRB 3UBXB 4KUZH 4X5WA 5BRZE 5JNYA 4QXGH 1RD6A 3IDIA 4L8BA 2FHCA 1RMFL 5FECA 1A14H 2YKLH 3LHPH 4W81A 1RV6X 1QLEH 5FA4A 2OXHA 3O9WD 2HJFB 4F7MA 3QUMH 3TV3H 1NFDA 4F15B 3UTZA 1WC7A 5GSRA 5KSVB 1MCBA 3IJHA 1KEMH 1UCBH 2C3VB 2J5LB 3F7VA 3GSNH 2QKIB 1AGFB 4JDZA 4RISH 1JPFA 4IBLT 3UTSA 4QRRB 4D9QE 5GS0D 2X70A 3G5VA 4M48H 3DMMA 4I0PA 1NUFA 4XPTL 4M6AA 1A6VH 1YEFL 3SOBH 3MXWL 1MCFA 3V8CA 2VR9A 3GM8A 4MJID 3HUJA 4DN3H 4JJ5A 3QDGA 2XWBA 1HSAA 4Y4KB 1NJ9B 3TYGH 4U6YB 4HCRH 5GS2D 4BSJA 1PZUB 1IGCH 4TSAH 3QXDB 1WBZB 5HI5C 1U8MA 1KN2L 4G9DB 1FZKA 1KXTB 3BD4A 3TBSB 5IFHL 2DL2A 4JFED 1EAPA 2CLVA 4ELKA 1INDL 4G8GE 4EUPA 1WCBA 4M6OH 4MXQD 1I4FB 4XMKH 4PP1D 2CDFA 4U05A 3WHXB 5I1KL 3CH1A 4HBCH 1F90H 4LLYB 2XI9A 1Q9OB 1GOHA 4AL8L 1YPZB 3TO4C 4NKOB 2AXHA 2PTTA 1OWWA 3HLAB 1EFXA 3WO3B 4PGBA 1YPZF 3RHWK 2YN5A 4NN6C 5EZIL 5HYSB 4HKXA 4F7EB 1CL7L 5F6IB 3ULUC 1VFBB 2ITCB 5IGXL 5F1NA 1N26A 1XIWC 5DO2C 1JE6A 1GSMA 1KENL 2EIZB 4ZODA 1P4LA 5FDWA 3MBXL 5GRJL 1P6FA 5C0CD 5E6ZA 1WAAF 2VLME 3MJ6A 3MLPA 2VC2H 4XCYB 4Y5YB 1IEBA 3KXFD 5FCUL 4JO2L 4WNQA 5T3XD 1VFMA 3UP1A 4J8RB 4HIEA 4Z76A 1UKQA 2FDBP 1QLRB 5TDNB 3DSFH 1CD9B 1RJLB 2IAMB 5IWLC 3ZE1E 1OW0C 2AJVL 4M5ZL 3CVIH 1T3FA 1PYWB 1MCQA 4RNRA 1TZHB 35C8L 4OUUA 1NMCC 3ARVA 2VDOH 4LAJH 2VAAA 4NJAL 1E4WH 2IFGA 1NGWA 3DVGA 4ZFFB 5IBLC 3VGAB 1TXKA 3NA9H 5CZXC 1KJVB 1LD9B 3WDJA 4LCIH 4ZO9A 1WAAE 5FO7B 2HTKD 3C5JA 4L9LA 4TNWK 4WTWA 4BQ9A 3L7FB 3BH9A 3SKMB 5DD5H 2EKSB 4UT9L 3QDMD 1S7QB 5F21B 1DQJA 5CINH 2UWEE 3FT2B 4YX2L 5B3JE 1OCWL 1MREL 1WCQA 4GG8A 4IRSC 3SKUD 4NQCA 5E9DB 5CGMA 3OKLB 4NFBA 4Y4FD 4NQEE 4WTZG 1NCNA 4H1LG 1KB5A 1CFQB 4OCXL 2D31A 1JUFA 4XVJH 4UILL 5H8DA 2Z8SA 3ULVC 4PGDA 1YEGH 4DCQB 3WJJC 4CAGA 4JZJA 2DRUA 4N8PA 1MRFH 1NDGB 1T1ZB 1IKFL 2WBJD 4DN4H 1I1FA 4GAGL 2NX5B 4Y2DD 4UTBL 3WS3B 5DJ6A 2YD8A 4FOMA 5C6TL 2N1KA 1R6VA 1AHWC 2DQEH 2NXYB 3STZB 1ODAA 3SCMA 2H2SC 1BF8A 2P7TA 3TIDA 1WWWX 4PTTA 4I2XA 4NQDA 4RFNB 5J3HC 5E1AA 2W9LA 4DOHB 2QADC 3GM0A 5HDBE 1H3VA 1DQLH 4G43B 1MSPA 5GS0H 4NUJA 1FYTB 2RIKA 1A6WH 3D9AH 2CKBA 1FGNH 3AUVA 5GRYA 1GC1L 1MCKA 4XNMA 2BZDA 3O3EB 3O4OC 1XH3A 1R3JB 3SKOB 3JWDH 4PR5A 5GS2H 3TPUB 4NOBA 2DM2A 1KPVB 1BZ7B 4QRPB 5IHUH 3MCKA 4CN6A 4DKAA 1U6AH 4FQIH 4RGNB 1J9CT 3O4LB 4C83A 4XBEL 4JZNA 4JFDA 4E42B 3RWCA 2DMKA 3VWJA 2GTWA 4NZDA 1CLCA 5BS0E 2NY0B 1HCFX 5C0DA 2AXJA 3L3OB 1RUPL 1MLCA 3VCLA 5I1JL 4MNQE 3WHE0 1KNOA 4OGAC 2X9WA 4TNWF 2BOBB 4K7FB 4ZPTA 4C56B 2BX5A 3ILQD 4X6CB 4I48B 2FCBA 5IESH 1OVZA 3HN3A 4L8CA 1HDMB 3TN0B 2NY6D 2FH6A 3MLSH 4W68A 5I73C 4NO3A 4DKEL 2HMIC 1T89A 3BJ91 1D5BA 2DQTH 2X89A 3ZTJH 3QQ4A 1NFKA 1MNUL 4Y5VC 3RKPA 1S78C 2VDRL 3VXTA 5F9WB 1K2DA 4EBQL 3JTTA 1U3YA 4F37K 3NCBB 1MLBB 3HNTL 4G7YH 1OTTC 5D2NE 5B4MD 2ENSA 4N0YL 2OP4L 3QSKB 5EO9B 1BREA 1NSNL 4DZ8A 4DKFH 4TVPD 1GIGH 1ZGLM 5CJBA 4LKCB 4LCWB 3BMWA 1M7DA 4DJMA 1GYAA 3WIHH 4DGYL 4C58B 5ACZA 2AABH 4NPYB 5I1EL 3QFDA 5FB8A 2FD6H 3VFUA 4R2GC 3DWTA 4JREB 4P2RD 1MY5A 4HMCA 5HI4D 1DANT 3VRLE 4OM0L 5D7JB 3SY0A 3BDYL 1OPGH 1W8OA 4J1UB 3H3KA 4DUVA 1A7PH 5D72H 1D5ZB 3S8WA 1CWVA 4NN7C 2HP4A 3MJ7A 2LTQB 3KPLB 3X3GL 1KB9J 2FJHB 4XAWH 3FCTA 5B21A 2D4DA 4TUOB 2HH0L 4TYUA 1JHTB 5IT2L 4Y8DC 4CADA 5I15H 1JK8B 2C1OA 3IXTA 4HIHA 1F3DH 4RAVA 3WO4C 3MV9D 3PUCA 2IANA 5SWZE 3DARA 3NPZB 4LRNL 4R0LC 3B9KB 5HHOE 5I30H 3CX5J 3KHOA 4HF5H 1IC7H 2RCSL 3WNKA 3HG1B 3GGWA 1OP3H 4A6YA 2YD1A 3EOBB 5E4EC 1DVFB 4LHJB 4MD5B 5AWNH 4ETQA 5IJKA 4PJ9A 4X9BA 5ISZB 5MHSE 2COQA 5HHVH 3VWKA 4AYFA 4ODWB 1HYSD 4OSUH 2X4SA 1M6OA 3WFEH 5JW3L 1YNKL 5JR1H 4LDEB 1BIHA 1VEOA 2HG5B 1VEPA 1CE6B 2XNAB 3LDBB 2V5MA 2D03H 5IB4A 1FVEA 2VMFA 4PV8B 3GO1H 3OKNB 5IB5B 2NY4C 3VG0L 4F37F 2DDQL 3SDDA 2FX9H 5HHMD 2OTPA 2ZCLH 2ESVE 2EKJA 4Y2OA 1I1AD 4JFZH 1NGPL 4PFEA 2C4XA 1FZMA 4XP1H 4N0RA 1FIEA 4NBYB 3MLXL 4JG0L 5J57B 1T2QL 1FAIH 1RHHA 4LFHG 3QEQD 4UV7H 2PXYD 5DTFA 2YPKA 2VXVH 2CO7B 4JN2B 1PY9A 5K93A 1WIOA 4DWHA 2P8LB 2JELH 1NFIB 3UXFA 4B7LA 2R4SH 1BVZA 3UTTA 3GIVB 4EDWH 1MJ8L 4CNIB 1G7PA 3EJZD 3GHEH 4TPRL 1OSPL 4PRID 1ZV5A 3QULA 4C55A 5F9OL 4W6XB 4M7KH 4J4PD 1ACYH 3PXHA 4JY5H 4WFFD 1JZ7A 4LL9A 4JANB 1KN4H 2QSCH 2ZNXA 3GKWH 3FFCA 5A2KH 3JUZA 3NA4A 1BBDL 1DFBL 1QBAA 2ADJA 3OKYA 4QYOA 1F11A 2FECL 2ZUXA 2YWYA 3UBXA 2A74A 3N1FC 1WFOA 4LPVA 1I7UB 2BNRE 2YD3A 1KCVL 3MRCA 5ESAB 5D1XA 4TVPH 3FQUB 4X7TB 3UTQA 3DX6B 3BN9D 1J0KA 3NABL 1KXQE 2HJFA 3E2HC 1MFCH 1PEZA 2MQ0A 3CVHB 4H1LB 4OZHA 5KSVA 4K9EL 2BVPA 1AGBB 2C3VA 4NQVB 5F72S 2KBGA 1QFUL 5CJQL 4EQ2A 5KVEH 1UWEH 4QRRA 1PG7L 1LEIB 3KLHC 1T0MB 3OF6A 2XTLA 3VD5A 4Z7WA 4ERSH 1IILE 2UV3A 1REIA 4WHDA 4OLZL 2HFEB 5E6YA 5C0AB 3WNMA 1TVDA 1YEIH 2XA8L 4G6AC 1NJ9A 3UC0L 3GMNB 3HE6D 4HXAL 4OF8A 3D0LB 4U6YA 5AZ2L 1OD7A 3QXDA 1WBZA 5EZOL 3SJVD 5GJTH 4PUBL 1RZKH 4G9DA 3GRWL 1QVOB 4YHKL 3U1SH 3GI9H 2E7MA 3TBSA 3FL7A 2F5AL 2HVJB 5EBWB 1NGQH 5D1QB 1I4FA 4S11A 3ARDC 2ZJSH 3WHXA 4HIIB 3ORJA 3BSZL 3R0NA 5I1CH 2DJSA 2Q7NA 2IPTH 5KBNC 4WI7A 4LLYA 1OAYH 2XKNB 2O5ZH 2PN5A 4N9GB 1P84K 3MBED 1OP5H 4EI5B 1YPZA 1G0YR 4KMTL 4PS4L 5CP7B 4HUNB 4NKOA 1G7HB 5CEYB 3HLAA 1LK3L 4H8WH 4ELME 6FABL 4JKLA 4YE4H 4G6JL 3R8QA 4X0KA 2XQYG 1MFNA 4F7EA 2UZXB 2Y36H 3OHXB 3VFPB 1VFBA 3M17B 2ITCA 4PJXE 4KVCH 5FOBB 3O9WC 1MCOH 3L5WB 4PB9L 5L9DL 4LLUA 1JHKH 4IDJL 1RUAL 4M7LL 1AY1H 3K8MA 1QYGL 3MLZL 1INQB 2X40A 4OB5H 4J8RA 3C6LC 5ECJE 1QP1A 1QLRA 3MPCA 5TDNA 3ISWA 1RJLA 1J0ZA 1L7TH 5ADOL 1PYWA 4XT1C 5T1DL 5GS0C 1NEUA 3I9GH 2D7PA 1TZHA 1OAUH 4AQ1B 1AXTH 1IAIH 1LE9B 5T3XE 1DEEB 3HNVL 4F9LC 4IRJC 5GPRA 4Z7NF 1ZGLA 2VZSA 3MO1A 1KPUB 3V6FB 3JWDC 3QIBB 4F7CB 4HKJB 2DQHL 2Q3ZA 1KJVA 2YZ8A 5DK0B 5F3BB 4MHHG 3MRQB 1NBYA 3KDMA 5FO7A 2XZCH 1GGBL 4QXUL 1WGOA 4Z95H 5HGHB 3MLTA 3SKMA 4PRHD 4WWKA 1CLOH 4WY7L 2EKSA 2J1KA 2PYFB 5HHNB 1S7QA 3BIAX 1RULL 5BO1H 1X5IA 3FT2A 1XF4B 5E9DA 1OAKL 1MIMH 5LWYH 2P5EB 1CFQA 4I77L 5K9OA 3SDXB 4AK1A 1QPXA 3BKCH 4FQXC 2YN3A 4KJQD 2CDEA 4Z7NE 1LE5B 5JW4Q 1EGJL 2PYEB 1DLFH 1ITCA 3CXDL 5D6DC 1NDGA 3PL6D 1H3PH 1T1ZA 1NAML 4BK5A 4M7JH 2NX5A 5K33A 5I1HH 2LQRA 1JBJA 3WS3A 4D94A 4HWBH 2BDNH 5DK2B 5J8OA 1MCLA 4CMHB 1MWAH 4BUHA 4O9HH 4MA1B 3QAZC 5F7MC 1NAMB 3OPZL 4PLKD 2QQKL 1PBYA 4O4YH 3IFNL 1RFDH 1JIBA 3VDCA 4LLMA 3KS0H 4Q9BA 3LEVH 1JPSL 4MA7H 2QQLH 1MRDL 4G43A 3P30L 4L3AA 3ARZA 5D1ZD 1FYTA 4MB3A 5IQ9B 4NSKB 4HHAB 2XZQH 4FQ2L 1SY6L 5JQ6H 5EH1A 3Q0HA 1V5JA 4FZEL 5C0IB 3SN6N 1TQBC 3O3EA 1MJ7H 4JFYB 1R3JA 2GITB 4LPCA 3SKOA 4D2NA 4M93B 1P7KB 2VJXA 3TPUA 5KAQG 3A6BL 3O6FD 2XY1A 4LOUD 7FABL 1KPVA 1BZ7A 4J6RL 1MHPH 2IH1A 2XT1B 4K3DH 5BW7A 2CR6A 4XNUH 3GI8H 4YDLB 3TA3B 2HTKC 3NGBC 4YHYC 3O2VH 4P2OD 3VE0B 3H0TB 1LWRA 2RAMA 4GXVH 3O4LA 2PR4H 5DZLA 1RQ5A 1BQLH 1P4BH 2AK1H 4O02H 1LO4H 1MCHA 4HK3N 1TJIH 3L3OA 3GDBA 2E9BA 4DQOL 1QLFA 4U6VL 1DQDH 2XRAH 4IIQA 4UIMB 1CLZH 4ZTOL 1MEXL 1XZ0B 2BOBA 2GJ6A 4K7FA 3NFNA 4X6CA 1BZQK 4I48A 4L3CB 1G9NL 1H3WM 1MVUA 1L0QA 1IQDA 1OGAA 1HDMA 3TN0A 1G9MH 2WBJC 1HQRA 3CDYA 4J7RA 1JWUB 4UAOC 4U1LB 3K1DA 1A7BA 4YNYB 3SHSA 3G6AB 5IB2B 4D9RD 4NFDA 1ZT1B 4MCZB 2IADB 4UZGA 1ZHNB 1R5WA 2XKUA 3IDJB 3RGHA 5DQDL 1MPAL 3QH3B 5IIEA 1QACA 1HINH 4DGVH 5D7SH 2R0WL 2XZAL 4NWTL 4PLJD 3CK0L 2JIXD 3OGCA 5K9QG 1L7IH 3BGAA 2E7HA 4JM4L 4E9LA 2V7NB 3NAAH 4MNGE 4YXKH 1UKTA 1GGYA 4LKCA 2D0FA 2OR7A 4XRCA 2LU3A 4MZ2A 1RZJL 4ZOEA 2B5IB 2XQYK 1NCBH 5JHLL 3LOWA 1K6QH 1W0WA 3VGHA 1CL7I 4NPYA 5DQJA 5D7IB 3RKDC 4PJFE 4YK4B 1FE8H 3QUYD 3TJHD 5I1AB 5DQ9B 1XR8A 1UXSB 5D7JA 1S7RB 3K8LA 5KW9L 4J1UA 5FKPB 1AQDB 5FM5M 1I8LA 4XPAH 1A6TB 3ZLQC 3MUZ1 1ES0A 4BA8A 2R0LL 3KPLA 1AJ7H 2FJHA 3D85D 4XXCA 2B0SL 1QQDB 1ORQB 1KCUL 5EU6E 1JHTA 4FQ1L 3NCFB 1JK8A 3F7YA 4KHXH 5AEAA 5D5MB 1Z5LB 2W0KA 3HRZB 1QPPA 5TGBA 1BVLA 5KN5B 2CDGB 4OCRL 3BPLC 1PY4A 3VXRA 5KJRH 3TVMB 3IS0X 3B9KA 2DOCA 1T03H 1DUZB 1M71A 2NY6C 2FGWH 1E0OB 1J0IA 4HPOH 3MLWH 1UJ3B 4OGZA 3H42L 2WUCL 3HG1A 1U42A 1SJXA 2EE6A 2OL3H 2XV6B 1CR9L 5AYUH 4R4NC 1TLKA 1DVFA 4MD5A 4OFPA 4Y5XC 3S36L 3UZVB 5J13C 3U2SB 2A6DA 2D4FA 5DJXB 5ISZA 3MYZA 1NL0L 3QRGL 2DQJH 2AJSL 5B4MC 2H3NB 4P2CG 3OB0K 2JCCE 2JK5B 3S35L 3EYOA 4OF6A 3MJ9A 2Z0BA 1FN4B 25C8H 5DD0L 2VXTL 2HG5A 5DDHB 1ZLVK 4Z9KB 1BOYA 3X3FL 2ORBL 4XVUD 1VDGA 4PJDF 3OKNA 5IB5A 1TTUA 4NCC2 2QHRL 5LJYH 2Q8AH 1CGSH 3X11B 3E0GA 3THML 3DOSA 3RWEB 5EOQL 5EBGA 2NR6D 4XTRC 3ARBB 5HBBA 4N90D 3ZYIA 1VA9A 3WS6A 1YZZA 3VA6A 4YHNA 5HVGB 4RMVA 1VGEL 1KEGL 1IAKB 1IZKA 4OZIA 4MJ4A 4YHIB 4K2UL 5DEFB 5GGTH 4JN2A 2VLJB 5H37G 3QCVL 4JR9H 4TUKH 5FV2A 3RBSA 1FL6B 3QNYB 2P8LA 3NN8B 4LK4A 1GGIL 4WU5B 1NFIA 1SBBA 3I85A 2APFA 5IBTL 1J8HB 1IARB 1OM3L 5DUPL 1BEYH 4HJJH 4Y4HD 4P46A 3TWCL 1TJGL 3QEQE 1RZKC 5CGYD 4PJDE 4XBPA 3GIVA 3RVVD 4MD4B 3VD4A 4NZJA 4UU9B 3GJFK 4L3EE 3IRPX 1NBVL 2DB8A 5DR5L 3QHTC 4NT6B 2HKHL 4U1KA 1T7ZA 4WUKH 2EXYD 3V52H 5GSVB 2QSVA 2W9DH 1INEL 4JANA 3OR6B 4PRIE 3IXAB 3RIFK 3MXVH 4ORGB 4WI3A 2ADFH 3BOVA 3QPQD 3LH2H 4H8WC 1HH9B 4WEMB 3HC3H 4WFFE 1X5XA 1RHFA 3OGOE 1HYSC 1KF9B 4X7TA 4LSUL 4U3HA 3C09B 3B2UC 3IAPA 4HT1L 1Q9KB 5HGBA 2APBA 3HC0B 2WM0A 4UINH 3CVHA 4OLXH 1CFSA 3LB6D 4HGKC 1AGBA 5GZOD 3FN0L 3GMQB 1B0RB 5FAAA 4WO4B 1CTNA 4M5YH 5TE6H 1UM5L 4ALAL 1XGPB 1LEIA 2ZOKA 3V4UH 4MQSB 2XN9D 1T0MA 2P5WD 4ODSH 3P4MB 4KROD 2PXYC 3K1KC 3I50H 3EHBC 1R3IL 1KCSH 1XF1A 2HFEA 5C0AA 4FQCH 4YGAB 4ISVA 3D2UB 1OY3B 1P4IL 4JHBA 4PJAE 1AO7B 1B88A 5E5UB 2D7OA 3GMNA 4LCUB 2PTUA 3QISA 3A6CH 1QVOA 3OKDA 3WV0A 2GSGB 2WWMD 3EJZC 4Q0XH 2I9TA 3WDHA 2PNDA 3DGGB 5EBWA 3DVFA 4Y0GA 2PKDA 2Z8VC 5D1QA 1NCCH 2EDJA 1C08B 1LO3L 2R0KH 4XP6L 4YQXL 3OTTA 4JFFD 4IS6B 2GAZB 2XKNA 4R3SB 4N9GA 4U0QB 3D1MC 1RVFL 4EI5A 3IFLH 4KGJA 3GK8H 3UZEA 5CEYA 1JI2A 1U3JA 4BJLA 1Y18A 5KAQF 1QUNA 2VE6B 4S1DD 4NWUH 3CFDB 3R4DA 3OKOB 4PY7B 3M17A 1YQVH 4PJEF 1P5UA 5FOBA 1CT8B 1KIRA 3L5WA 1L9NA 3I6GB 1YNLL 4FXLA 5KS9B 1RK1B 1INQA 4GRWB 3U4BH 5KS9F 4Q6YA 3RIAK 3U0PB 5D7LD 4GRWF 4QTHB 1UM4H 2NMSA 2WUBH 1FNHA 5C0BA 3V0VA 2F54B 2VR4A 4GBXD 4AT6B 5SX5H 4F58H 1OAZH 1CVRA 1LE9A 1DEEA 3BW9A 3BDXA 3Q5TA 3QUXD 1MFEL 1F3JB 3D18B 4GLRH 4XH2A 3IETA 5C92A 3JV4B 4I3RH 1BFSA 1DZBA 2V2TB 4ZS6D 4PJEE 5ILTL 3V6FA 3QIBA 4K3JH 3HE6C 4F7CA 4HKJA 3D69B 3VW3L 3FTGB 3REVB 3HR5A 5F3BA 3SE4C 5JOEA 2R1XB 2NY5H 4FFYL 3V2AR 5HGHA 1F4YL 3L3DB 2L4OA 3TO4B 5HHNA 4Y1AD 3MRGB 2OTUA 3CZFB 2BSRA 5IQ7L 5J1AB 3ULUL 2VERN 2J8UF 2LU7A 4UOW1 4NN6B 4FA8A 1XF4A 1IC5L 2EDQA 2P5EA 3H3PH 3MBEC 4FTVE 3QWOB 3SDXA 3KPSD 1HKLH 1XIWB 3WIFA 3ULUF 3F12B 3G08A 2NTFB 5T3ZL 3RTQD 2PYEA 5D70H 2VZOA 3JBG7 5E94B 1NUGA 4YXLL 2DWDA 1G9MC 4K8RH 1FAKT 1X5FA 5DK2A 1YYML 1RUQH 2IQAB 2B4CH 4GRLD 1U93B 2D0HA 2J8UE 3EO1A 1J5OH 3QWQB 2V5SA 2ED8A 1T2JA 5BCAA 4U1MB 3QXAA 1RUMH 4KVNL 4GXUN 3O2DH 4K3EH 2V2WA 1F6AB 3KLAA 1JGDB 3L3JB 2CRZA 5EOCH 4JCLA 5ACMA 2FECI 1J11A 4NSKA 3QXUA 2P24B 2ILLA 4HHAA 4PRAB 4JO3H 4N0FA 5I1IH 1J1OH 5ITFB 2FHBA 3VFMB 5E08H 4JFYA 2NY3C 2GITA 2IPUK 1T0NB 1NEZG 4R26H 1P7KA 3RIAF 4QHNB 1G6RH 4DVRL 4IRSB 2J6EA 1EJ6A 2F19H 5T3ZE 2E8ZA 4FP8H 3BVNA 3TA3A 5IHZA 3TBYA 5DC4B 3VE0A 3H0TA 5DHYB 4YDIL 3X17A 4HWNA 2PTVA 1ZANH 4D9LL 3JV5A 2X7LA 3QHFH 1T1YB 2B2XL 2A77L 3H7BB 3OAZK 3W81A 3SGEI 3BQUD 5MEPB 4HWZA 3NZ8B 4L8DB 1CK0L 1PX4A 4KJQC 1XAUA 3RGVA 1AHWB 4N0UB 5E24E 3OBAA 3CU7A 1HNGA 3SGKC 3I02A 4BZ1L 2Q87A 2A9NH 1MCPH 1JWUA 1P84J 4U1LA 4CU8A 3NTCH 4J3VA 3HMXL 2FJGB 2QADB 3IJSB 1KC5L 4HXBL 3UYRL 5ALCH 3G6AA 1A6AA 1JFQH 3IDUA 5F44A 2CUHA 5IB2A 4PLKC 1ZT1A 4MCZA 5SX5K 2IADA 1HSBB 1ZHNA 2HRLA 3RI5F 5FGRA 3C5ZA 3O4OB 5MEQB 1L6XA 2V7NA 1AE6L 5D1ZC 3KPRE 4UUJB 1DSFL 4F57H 2EDHA 2BRRH 1JGVH 4L4TB 3SE8H 1K4DB 4HFUL 2BCKB 4X7SH 1NAKL 1C12B 1J1XH 4LIQE 2CPCA 1S5IL 5D7IA 3GSUB 3LY6A 3S3SA 1I3GL 1A0QL 1KYOK 3O6FC 5CUSH 4M6NL 1UXSA 5CEZD 3B5TA 2DI9A 1AQDA 4HG4K 2VXUH 5C0RL 5F8QC 4BZYA 4P2OC 5IVXF 1NC4B 1U36A 1EEYB 4WENB 4K71C 1JNHB 2DQGL 5GGUB 4IOIB 3DIFB 1IT9H 2J12B 4KY1H 4RMRA 5E5RB 5FHAH 3DVIA 4QY8B 1QQDA 3FB6A 3WLBB 1ORQA 2DKMA 4U6TA 4OI7A 2FB4L 5F1OB 2A6IB 1M4KA 3HZVB 3AY4A 1Z5LA 1CIDA 3PHOB 5D5MA 5I73B 3HRZA 4ZD3H 4L4VB 4GRMB 2YWZA 1X5JA 4JB9H 1KTLB 4HD9A 5KN5A 4TULH 3S5LG 4Y5VB 3TVMA 1F3RB 2VH5H 5I66B 3Q5OA 4NM8H 1DUZA 1CICB 5E70A 1WIUA 4P4KC 1FORH 2R1WB 1UJ3A 3LEXB 5DVLA 3QI9D 2W60B 5IVXE 1KLGA 3KLSA 4AIOA 2R2CA 2XWTB 1T20B 3EJJX 1U8KB 4YXHH 4PJ7F 2APXA 1JNNL 5TPWH 3PGFL 3U2SA 2Z91B 1QFWH 5DJXA 2FZ3B 2I9LB 2AEWA 1RI8A 3MOAH 4PLJC 3GSXB 32C2B 3BT2H 1NKOA 2H3NA 3OZ9H 2JK5A 4EZMA 1CIUA 1AGDB 3QPXL 1FN4A 4R2GB 3L1OL 3UTOA 2VISB 5JTWA 4HW6A 1WQVT 4QXTB 3J7HA 3BX7C 3VG9C 3I84A 5D9SB 5SWQB 5JO5A 1RJZB 4NNPL 2I60H 4JPWH 4LU5H 4KZDL 2DYPB 4NC0B 4X4ME 3X11A 4NN7B 1A1NA 2EDWA 3ARBA 4MXWH 4TOYL 3ZTJG 1EMTH 4TQEH 1WJ3A 3LN5B 2AQ2A 4PJ7E 5F97E 3RX5A 1B2WL 2IBBA 1U2CA 5CZVH 1KJMA 3T3PF 1IAKA 2FX8H 4NKDB 3CFJA 3KYKH 3T65B 3VRIB 4LDLB 4YHIA 5J06A 1GOGA 2ENYA 3WO4B 2VLJA 1G9EA 1FL6A 3QNYA 5KVFL 4N90E 2FO4B 3NN8A 1QR4A 1S8DB 2DQDH 3IFPB 2EC8A 5L6YL 4WU5A 4R0LB 4PRPD 4Y19D 2R2BB 1J8HA 5DVKA 4A6YH 1NC2A 1UACH 4YHOL 3G5YB 3QFJB 4JKPH 1MUJA 3OMZA 2VLRB 4KKNA 4JHWH 4MD4A 4MSWB 1PVHA 4UU9A 4LEOB 2EZ0D 5E4EB 4LASH 4NT6A 4NJ9H 5CZKA 1I7RA 4GAYB 3WMSA 1MRCL 4N8CL 1A14L 4ONHB 1QLEL 4NUGH 3BKJH 3MNWB 5JHDE 1QSVA 2ZG3A 4Y16A 3TV3L 2CUIA 2R2EA 3IXAA 4ORGA 3O2WH 4B0MM 1CD1B 1YY9D 5GGVH 1UCBL 3UO1L 3FB8B 3HZKB 1HH9A 4LSTL 1IQWH 3QQ3A 5KSBE 1T04B 5HTSA 2NY4B 4FQHB 5EIIA 5IEHA 2AXFB 4V2BA 4YBLC 3MRRB 1A7OH 5EOTB 2YS4A 1IBGL 3GSNB 1VFAB 5JIKA 2X4TB 1Q9KA 1Q94A 5C08B 4HIXH 1A4JB 4Z7UB 3HC0A 4DN3L 1WZ1H 3WIIH 3ARFA 4OJFH 3TYGL 4Z7UF 4HCRL 3RPIB 4E41B 1C7SA 3QT2A 4TTGA 4YDJB 1GOFA 1CU4L 1QSED 1B0RA 2NR6C 3GMQA 4WO4A 1UWXH 1XCQB 2DI8A 2D7TH 2R0ZH 3RUGE 5CEZH 1F8TH 3SDAC 4BQ6A 1F58H 5FYJL 1W2KT 2HT3D 3P4MA 3WKML 2G5RA 4YDKH 4M6OL 1QOKA 4MCYA 4NHUA 3PQYB 1B4RA 3GUTB 3Q5YA 3HPLB 3L3HB 2PO6C 3D2UA 5JOFA 1IFHL 1FDLL 1AO7A 1PJ9A 4XVTL 4HBCL 1HIMH 2XN9E 1NBQA 1YN7B 4LCUA 1B0GB 3NOIA 4Y4HC 3UTPD 2GSGA 1YEJL 2NY5C 3ZYOA 2F5BL 3IFOB 3DGGA 5I1LB 1T5WB 1HEZB 3P4LA 1MFAH 3VXSB 1C08A 2EXYC 2A6JB 3O3AB 3ILPA 4ONGH 4QOKB 2ZCKH 3T4YA 4AG4H 3I3EA 4LP5A 4MAYD 4OLEA 2GAZA 5EIQA 4R3SA 3VI3E 5DD6B 3QPQC 4NYLB 2EDRA 2W07A 2XA3A 3UZQA 2AK4D 3KHQA 5L7XL 3D3VD 3E2HB 3NPSC 4G9FD 3K8KA 2R69L 2CMRL 2M26A 1FC1A 3RVWC 3LKSB 3N1QC 5FYJE 3DSFL 2VE6A 2KPNA 2JB6B 3H6JA 1JRHH 1UGNA 3CFDA 4K8RC 3OKOA 4QRQB 3DYPA 4X4XB 3P9WB 2QHLA 1CT8A 4NBXB 3VFSB 2B4CC 3ZL4H 5BV7H 2RFXB 4ZS7H 5F71A 1YMMB 3I6GA 4ZO8A 5DT1H 1EEUA 4XC3L 1D6VH 3BP5B 3LB6C 1RK1A 5GZOC 1OTUD 3LV3B 4LCIL 5IMMB 1A4KA 4JDTL 4QTHA 3E3QC 4ZDHB 1JZ8A 2F54A 4JRYE 1ZMYA 2YMXH 4CJ0A 2Q86A 2Q6WB 5GZND 5CINL 3WNPA 2BNQA 3D18A 5D7LE 3UPRB 3JV4A 4XMPH 4F2MB 3O6MH 5INCB 3H9SE 3V7AG 2DICA 3FTGA 2EIDA 3ARDB 3REVA 5BRZA 4KRNA 2YPLD 3PWPB 5HYJD 2WWMC 5I8CB 2R1XA 1YEKL 2N4IA 3L3DA 4GSDH 3S34H 1AXSA 3KVQA 3TO4A 3OXRB 5E7FA 3MRGA 3CZFA 3JZ7A 1CLYL 1LO0L 3QHZH 2BSED 1HN1A 5C2BL 2IMMA 5DUBA 1N7MH 1HHIB 1TNNA 4X6DB 4V1DD 3VXUB 3QWOA 2YSSA 3PV7A 5MERB 1KJ2H 3ARUA 2ICWA 1XIWA 1J12A 1DANU 3O9WB 3F12A 1F6LL 2XKSA 4BFBD 4JQVC 5E94A 2F8OA 3BZDA 4TSBH 1U8LB 2F9BT 4S1DC 5FGBC 5E8NB 3C87A 3KPSE 1D5IH 1T7XA 3C6LB 3W39A 5EBMB 2C3WA 2IQ9L 2IQAA 2QR0A 4HX1B 5IWLA 1OW0A 4XHJD 3SKNB 1IZJA 5IFJA 5DURB 4XNZB 3CU1A 4IRJB 1U8PB 4U1MA 4OLVL 3WDIA 1E4KC 3WFZA 4MJIB 4G8GA 1F6AA 1JGDA 3L3JA 4JHZA 4P5TD 3K2MC 4GBXC 1G7JB 3FT4B 5JIPA 2P24A 3EKCA 2V17H 1ED3B 1EERB 3RWHB 3RVTD 4JFEB 4BFIB 5ITFA 3QUXC 2R56L 3D0VB 3VFMA 4C54A 4ZS6C 1T0NA 2LAGB 1DJSA 3FB5A 4X6FB 1HCVA 4QHNA 2MKLC 4KXZH 3MCLL 4IRSA 2HT4D 4R4FL 2VXQL 1VEMA 3PWJB 1UADC 4NHCH 4LVNC 4Z0XA 4FQXB 1WK0A 3GSRB 4EJ1C 3WJJA 4XVSH 2V6HA 5ANME 1VENA 3B6SA 4Q9QL 5EC2B 2ICEB 1T89C 4GMSH 4GMTH 5MEPA 3BXNB 5C07D 5GS1C 4L8DA 3I6LD 5TE4L 1HI6A 3CXHJ 4JO1H 4BZ2H 4GG6F 3VXME 1K9TA 3QAZB 1EXUB 5C0CB 4WCYH 1KG0A 2DD8H 3KXFB 2AJYH 2W59A 1UA6H 1JF1B 2FJGA 3IJSA 3T04D 5E03A 4Z7VB 2OZ4A 3BZEB 5E8PA 3TBTB 2PCPB 4ODTL 5J9PB 1JN6A 1ZA6B 1R5IA 3QJHB 3EYVA 1ZEAL 1JYVA 3DTXB 1RIVH 3P11L 1TQBB 1F42A 1CDHA 1MAJA 1MFDH 2BNUB 3GSVA 1A7PL 4UUJA 1BWMA 2UWEA 4JG1L 4GG6E 4YHMH 4L4TA 5CILH 4WRLA 3NGBB 4CKVX 5AAMA 1A6UL 1I3RB 1C12A 4YHYB 5GGSY 3KR3H 3BZFA 3GSUA 3IF1B 3QDMB 3QNXB 3U4EB 5I1GH 3IRZA 4LHUG 4OI9A 2OM5A 4MA8H 4JVWA 4R4BB 1AR1C 2HLFD 3DXAD 1MI5E 4AENB 1BAFL 4RGOH 3T1FB 1NC4A 4L29A 1EEYA 1JNHA 1OARH 3PWVA 5L8LB 4IOIA 3DIFA 1IM3A 4QY8A 5CKGA 5J56B 1PW3A 4YC2C 2VDLL 5SWSB 3BQUC 2WBJB 2A6IA 1HHKB 5DJ0B 4UAOB 3MMEB 5AWNL 3PHOA 4YEFA 3IJYB 4IMKC 4L4VA 3T0VA 1S3KL 3OAYK 4GRMA 3MUY1 1JZ3A 5J7CC 1KTLA 1UQSB 4ZUWB 3VXNB 4S10A 3DRQB 4Y5VA 5K9QI 1FCCA 2A1WH 5I66A 4JHAH 5CIPH 1E6JL 4FABH 3C60D 5LG1A 1IRAY 4K07A 4NC1E 2R1WA 3IS1X 3LEXA 2D03L 1LMKA 4U6HB 1Q1JL 3LKPA 1IAMA 2XWTA 3H9HB 1U8KA 1I9IH 1CD0A 4OT1H 2Z91A 3MRBB 2X2YA 2I9LA 4JY6B 4R7NB 3GSXA 32C2A 3TT1H 3U48A 1F4XL 1AGDA 3OXSB 5TE7L 3SDCD 1BVKB 2VISA 5EU7E 2XTJE 2UZYB 4QXTA 5BS0A 5D9SA 4HS6B 1FG9C 2AXGB 2OQJB 5SWQA 3VFGH 4DW2H 3LIZL 2JELL 1RJZA 4FQLL 3RNQB 5CJOH 3Q48A 3MV8B 3QCUL 1N6QH 2DYPA 5DC0A 4U2ZA 1EJOL 1CN4A 3TZVD 3QDJD 2NY2C 1XGYH 3LN5A 3NIGF 4FZ8H 5K59F 3K81A 4HLZH 4HFWB 4NKDA 4JM2F 3T65A 3VRIA 3B2VH 5L2KB 2GY5A 1EHXA 4LRIC 1ZAGA 1YA5A 3BPLB 5C7XH 4NKIL 1DE4B 1S8DA 3IFPA 4P23D 2QSCL 2R2BA 2GJZA 2NY6B 4QGYA 1W0YT 2E3VA 2EDFA 2IMNA 3G5YA 3QFJA 3WXVL 4YJZL 5EWIL 5I75C 1JF6A 2APTA 4WUUD 4LMQE 4LEOA 4M61A 1OAXH 4PRPE 4Y5XB 4GAYA 3K4ZA 4ZOBA 1NCDL 4ZAKD 3LD8C 3R06B 4HZLA 5J13B 3MV7D 5CBEB 1H8NA 2Y5EA 3NIGE 3MNWA 5K59E 3OKMB 1UXWB 1CXKA 2AQ3A 3QI9C 1EFQA 3MGAA 2J88L 4QCIA 1GGUA 4ZUSA 4FNLH 1JV5A 4H20L 4KQ4H 2X4QB 3MOQA 3FB8A 3PP3H 4XPFL 1NMBH 1OQXA 4EOWH 2IH3B 3HZKA 3QUMA 1T04A 4I3GA 4J3TA 2OYPA 4FQHA 1QBLL 1UWEL 1C5DB 3OR7A 1MCSA 2Y4SA 2AXFA 2JE8A 4OCYH 2XG4A 3MRRA 2Z93A 3TBVB 5EOTA 4BQCA 3GSNA 1VFAA 2X4TA 2MSPA 4P2RB 4ERSL 2FIRT 5C08A 5C70A 2J3SA 1IGIH 1YEEH 3VFTA 5BV7C 1CE1L 1A4JA 4EEEA 3ZMRA 2FEDC 1KOAA 4YUEH 5CSGA 3RPIA 4O5LL 4OFYA 4HH9B 5I2IB 4RFOL 4ZMAT 4ZTPH 4TN9A 3U1SL 1XCQA 3GI9L 3B9AA 5HHOA 1MQ8A 1P6AB 3HB3D 2MHAA 3ZKSD 4P49A 1F2QA 1NGQL 4OCSL 1MIEL 5FHBL 3V7AE 3PHSA 1VERA 3PQYA 3RWGA 43CAB 3MV9B 2ZJSL 4XPGH 3BIBX 2FBOJ 2ZKHH 1Q0YH 1J1PL 5IJVB 1DL7L 1OAYL 3OQ3B 3FFDB 1YN7A 1JZ5A 5GRZA 1PKQE 3IAGC 4HMEA 5FCSH 2EZ0C 1N0XL 3IFOA 5I1LA 1T5WA 1HEZA 4JZOB 2Y6SD 2Y36L 2VDKL 2A6JA 3O3AA 3VXQB 4QOKA