1ACYH

Crystal structure of the principal neutralizing site of hiv-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
QVKLQESGPAVIKPSQSLSLTCIVSGFSITRTNYCWHWIRQAPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLISVTNEDTAMYYCSRENHMYETYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex(antibody/hiv-1 fragment)
molecule keywords IGG1-KAPPA 59.1 FAB (LIGHT CHAIN)
publication title Crystal structure of the principal neutralization site of HIV-1.
pubmed rcsb
source organism Mus musculus
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH01
5IM7A 5EB9A 4Y16D 2V6HA 4UV4L 3VFGL 1J5OL 3DI3B 5DQ9A 5AZ2L 4XCNA 1RZ8B 3N06B 2EXWD 2ZKHH 3HNVH 4M6OL 1BZ9A 1H0DB 3VI3F 1G7QB 2APFA 3QI9A 4G80A 3BGFB 4FP8L 4M9OA 1JNNH 2BXZA 3VFMA 1LEIB 4DKFL 2C1OA 1BOGA 3T0EA 1G9NC 3ULUL 3SN6N 5H2BA 4X7FC 4CN4A 1WFTA 3MODL 5AD0A 3R0NA 3PGFL 4GT7A 2C4FT 3MRMB 4TTGA 1BD2E 4NO0D 2I07A 5I76A 3NIFF 1MCIA 4PS4L 3BJ91 1F45A 1D6VL 3P4OA 5D2LE 3WHE0 4YHPB 1FLRH 2AXGA 3VD4A 2VDOL 1A7NL 3UAJC 3VWKB 3UC0H 4QOKB 3PQYE 3RJQB 1OTTC 3BQUA 2IMMA 3EJJX 4LQ1A 2IMNA 4NZTL 3DX8A 1KB9K 4OIBA 3RKDC 3RUGE 3JWOH 2X4RB 4HEPG 4PRBB 1B2WL 3WMSA 4FQLH 4D9RD 4JLRB 4J1UB 1EA9C 5FAAA 1HQRA 3TFKD 1WAAF 3RWDB 1CU4L 4RGNB 4YFDB 3NFPB 1NC4B 1FSKB 2R0WH 5D6DC 3WUWA 1A4KA 1FNHA 4L5FH 4NNXB 2CJUL 2CK0L 1EMTL 3MV7B 3CVHB 1UENA 1I8MB 3MREB 3V5DA 1CFSA 2Q8BH 1V5JA 2VUOA 3QUYA 4ELKA 3O3BB 3OJVC 4YBLB 2W92A 5JO5A 1EEQA 4O58L 4P3DA 4FQCH 3MFFA 3OKLB 1S7XB 1T4KA 3DUHA 4Z9KB 3ZKNC 3W9EB 1CCZA 1F6LL 5DVOA 1P4IL 4WNQB 4YDIH 2FO4B 4HWEL 5IR1B 3L3OA 2GHWB 3PG2A 1KN2H 2I60H 4OD3H 5GGTL 1MEXH 2XRAH 2NTSP 4KRNA 1Z5LA 3K0WA 2BNQD 4JO3L 4M5ZL 5CUSH 2MJWA 4Z7QE 4FTVB 1Z9OA 4OGXL 2YC1B 5D2NE 3VWJC 4WJ5B 1T83C 4PRHB 1UXSB 1KBGH 2A6KB 1QSFA 4U1MB 4GW5B 4N1EA 1PFCA 2UY6A 1A4JA 5FA3B 4LLWB 4NN6C 2HFGL 3M1BA 1M6OB 1WFNA 3GNML 4U1JA 3CZFB 1FIGH 1LP9E 3MX0A 5JZ7D 3O41A 4YFLF 2R29L 4GAJL 4H1LH 3DX9A 4F7EA 1XCQA 4JFEA 3KPTA 5DSCB 2IH3A 4JKKA 1UZ8A 4ZYKA 4PJAF 3BW9A 1OWWA 3JV6B 2P8PA 1F3JA 4HS3B 5I73C 2XKNA 4BH8A 1QBAA 3LRGA 5D1ZD 4DQOL 4U2ZA 1YY8B 4Y16A 5HHOA 2IQAA 1YN6A 3VW3L 4XVTL 2EKSB 3DGGB 4A2LA 3GK8L 1KACB 5EBGA 4GKOA 3LKNB 4OCNC 5C07D 5CHNA 1WEJL 4G8EA 2AQ1A 3U82B 4GH7B 4CNIB 3BZFB 3KYOB 4PRAA 4NQEA 4Y4KB 4C54A 1JWMB 1T66C 4QRSA 4GSDL 2V9QA 3G9AB 3OGCB 3VFOA 4D9LL 1AGEA 1VB9A 3BMWA 1K5NB 2DLFL 4JR9L 4JPKH 1MJ7L 3T2NH 3U6RB 1EHLL 5FGRA 1N2RA 3D5OF 1QLRA 5SWSB 2Y4SA 2GJ6D 4G6JH 1H3VA 3FONA 4RIRA 4AENB 1BLNA 3B6SA 3L5XH 1M05B 1JV5B 5EORH 5GRUH 5DEGB 4NYLA 3QNXB 1JHLL 5I1EH 5ALBH 5F72S 1MCWW 1DVFB 1JBJA 1EO8L 5D9SA 2IQ9L 4L8BB 3O6LL 4ZTPL 3FO0H 5C9JA 3HR5B 4ZD3H 2Q7NA 4OKVA 2DIBA 2XXMB 1QYGL 4Z7WE 1WT5C 4FQPA 4DGYL 1AGDB 4JVUA 1RI8A 4K71B 1RUQL 3F12A 1OSPL 3PWPE 1VFOA 5GGVY 1XIWA 1C16A 2C1PA 2EXYD 1WBZA 3CSBA 4LRIA 2VABB 1P9MA 4TN9A 1OGTA 1REIA 4ZTOL 3IU3B 2CIKA 5EO9B 1F4XH 3SJVD 4JHAH 5JW4M 1PG7L 1KB9J 3Q0HA 3O8XC 3M45A 3TN0D 2FIRT 4DN4H 4NFBA 4G42B 5DD6A 4QHUA 1BGXH 1L6ZA 3T77A 3CSYB 1T6VN 4XPFH 2ZUTA 2HT3D 4ZNEE 2NY3D 1BQLH 1N4XH 3MPCA 5D5MA 5HHME 3EO1B 1MSPA 4R0LC 1K2DA 5EBLA 1UJ3B 4HMEA 2BNQA 3GSNL 2KH2B 4HF5L 4MVBD 5DS8B 4LPYA 1KJ2H 2PYFA 3HG1D 2NY2C 4UNTA 4F7MB 4KUZL 3VXME 3TJHC 2K1MA 3K46A 2RB8A 2MSPA 4M3KB 3U4EB 1MCSA 4EN3B 3S88H 4JPIB 1KSRA 4LU5L 4YE4L 5D71L 4Y19D 1FL6A 2AJUH 1PKOA 4LVHB 1XF1A 1NFIB 2FB4L 5E2VL 5BJTA 1JHTB 4G6FB 4YHZL 3D69B 1JPSL 3BN9D 1R3LB 4HWNA 4G6AD 5C0FB 3H3KA 4WW2F 1XF5A 2P5ED 1HYSC 1S7QB 3HI5L 3SGKA 1NFDB 3E8UL 4LSUL 3FQUB 3BP5A 1ZLSH 1WWAX 4L9DA 2R69L 3W11C 1IGYA 3S37H 5D1ZA 5EUOA 1TJGL 2VWEC 4XCCL 4P5TC 3LB6D 4NWUL 3VFRB 2EECA 4AYFA 2ENSA 3IFOB 1WF5A 4QRPE 2EDEA 4JZNB 4X6EB 3Q5TA 4GAYB 4QXUL 3BZDA 3QHZL 2R56L 5C07A 5CILH 3H7LA 1F3RB 2GY7B 4PJIA 1NMAL 2Y5TA 3K2UL 3UMTA 3VXPA 3OKDB 3SQOL 2FX7H 3R8QA 2BVEA 3BE1L 1TQCC 3NAAL 1BJ8A 1XF2B 4X6FA 1HIMH 3HMWH 1O5DT 5D6CA 4LLVA 2DOCA 4PLJD 3DXAB 5EDXA 4NOBA 5JOPD 2ESVD 4RBPH 2KUTA 1VGKB 3D85B 4LPVA 1VFBA 1X5LA 4HLZG 1AGCA 2D03H 2EDJA 4G8GB 1QKZL 1I7RB 2EDTA 4M1DL 2H8PB 1A6WL 2DQFA 5EO1A 2P5WA 1EGJA 4I18A 4F33A 2I5YL 2P48B 1YMMD 1CD1B 3QQ9D 4RFEB 2GJ6A 1FNFA 2Y9RT 3WIIH 5LBSH 5TGBA 5ISZD 5EZOH 5I19L 5JQ6H 3LOWA 1ES0A 5KVDL 3MRPA 3U30B 1BZQK 1RZKL 2UWEB 5D7KD 3OJDB 3P9LB 4UT9L 5FYLE 1DJSA 2ATPA 2AABH 2NY0C 5B39B 1RFDL 5JW4R 4R90L 4U49A 3O11A 1ZOXA 2PO6D 3R1GH 3VDAA 3HMXA 4YPGA 1RUKL 5ENWA 1U8HA 3C2SA 5E5RB 4WVRA 5F7MC 5T3ZD 1RUAH 4ZOCA 3KDMB 2XN9D 3VG9B 1NKOA 3PWLA 5CP3A 5KTEH 2CDFA 5KJRL 4J3XA 4PJGE 1MWAB 3SJVA 3T2QA 4PB9H 2WBWB 3C8KB 4HWBH 3DVIA 3TN0A 1NFDF 4ZUWA 4ONFH 4O51A 4QXGL 4ZO7A 4UT7H 4EUPA 3CU1A 4QHKJ 5HYQA 1J0YA 1YPZE 5J6GA 3WEXA 4JFFE 4ELME 1CZ8L 5IESL 4OF8A 4FQXD 2LAAA 5E6ID 4TUJA 5JPMB 1ED3B 1F4AA 5MEPB 2P24B 5KVMC 3RWJA 1T03H 2XWBB 2DQJL 4MXQD 5IOPA 5GIRA 3NTCH 5IVZA 3CNKA 1CT8A 5HGGS 3D3VB 2HAZA 3JV5A 3HRZB 2HJLA 4M03A 5EULV 5D96B 5IB3A 3O2WL 4MAYA 1YUHB 3VXRD 4PRPB 1UB5B 3IDGB 1QSVA 4JPWH 3WXVL 2B1HH 1UZ6F 2R1YB 4RAVB 4Y19A 1MI5B 3V8OA 5HYEA 1DQMH 2OCFD 5E2JA 1ZTXL 1A9EB 4CN1A 4WU5B 3UYOD 2FH8A 3QEQB 5D7SH 1OSZB 4OZGB 4XNUH 1WBYA 4LCIL 1TNMA 5D7LB 2DJ4A 1RUPH 4LCUA 3QFDA 4TVSa 4XCFH 2VZVA 2DI7A 2DKMA 3SHSA 4NZRL 3FB5B 4PB0L 4PP1C 3CX2A 5HI4D 2X42A 3S36H 3SEPA 4EI6A 1NBYB 1G7JB 1Y6NR 5LG1A 3PWJB 4GKNA 3OR6B 4K7PH 1OM3H 3TNMB 2EE6A 2VXTH 4KKBD 5JDSB 3WHXA 5DURD 5FB8A 3I3EA 4QT5A 4WI7A 4YFLI 2HLAB 4K3EL 1H5BA 3KS0J 1JGUL 2BVPA 4IOIB 2BXYA 1U8KB 5D70H 4P2QB 2GAZB 4WU7B 2VLRD 3QUKA 5D8JL 5IVXA 1T7XA 4GQ9L 4HT1H 5EIVA 1A9BA 1ZANH 4R3SB 4M6NL 4HJ0C 4OT1H 1EH9A 2Z8SA 5CEZE 1FAKT 4LAJH 5DVKA 4OGZA 4QWWC 3NFNB 2AK1H 1R0AL 3DUSB 5K9QI 1I8LA 4CVUA 1FYTB 4N0UB 3RY5A 5TH2A 4KJYA 3BGMB 3CAFA 3O3EB 4WHTB 2XZCL 5DUPL 5C7XH 1YMMA 5EZIL 4OCRH 4XCEA 4E9LA 2Y72A 8CGTA 2MQ3A 1SM3L 3SQBA 5ISZA 2VLJA 3EYSL 2A1WL 4F9LA 1TETL 1JGLH 3MUGB 1F6AA 3DBXA 3R8BB 3TIEB 1IGFL 1Q72H 3MA7B 1Q0YH 4P99A 2X4SB 4TQEH 3LQAL 1S7TB 3GI9H 2Q8AL 3E6FB 1FAIL 2PO6A 3FQXB 3ARFC 3HI1A 5C0AD 5T5FL 5I1GL 1B0GA 2YK1L 3VE0B 1GC1H 3MJ8B 1UWGH 4WI2A 1BECA 1FORH 1LO4H 4V1DE 2L7JA 3X3GL 3KYNB 2XN9A 4MDIB 1D3CA 4K8RC 3N1FC 3N1PC 1I7ZA 1KEMH 1TVHB 4JKLA 1EJOH 4JY6A 1E4WH 3UTSE 1PW3A 4RAUA 3MBEA 4C59B 1MIMH 4MAUL 3AMKA 1CL7L 3VD9A 1NC2D 4U2YA 3MJ9A 4PG2C 1EEYB 3FT3A 3NCJL 2Z92B 1CICA 4P59L 5LGJA 1CFQA 3ULVL 1G6RL 4P46C 3DRTA 3GMMB 1YDPB 4BKLB 3WKMH 1FZKA 1I3RB 1T5XA 3EZJB 1ZT7A 3M07A 4BSWB 4R2GD 4FQXA 4HDIB 4FXGA 5E6IA 2Y07L 1JJUA 5D1XC 5EIIA 2B8OT 4WCYH 3W82A 4R97C 2FX8H 5D1QC 4MS8C 4GG8A 3QRGH 4I4WA 3WUWG 2AEWA 2CGRH 4CRPA 1DUYB 1ND0B 5GRZA 4D9QE 3TA3C 3LY6A 1OAQL 5I8KH 1NMCB 4YAQB 1MLBA 3HZVA 3VFVB 4E0RA 3RWFB 4JQXA 3H3BC 3ZKND 5D72L 2RJMA 3I2CL 3V0VA 1MIEH 4OIIH 4FQIH 3FRUA 1SBSL 4R96B 3S34H 1CLOL 1FZJB 5KOMC 1RZJH 4OLZH 3MLSL 1CE1H 4Q9QH 4AH2A 1FV1B 1N5YL 3D18A 1A2YA 3V0WH 1P4BL 1S9VA 1AJ7L 3KPMB 5GGSY 3V5KB 1KTLB 2C9AA 3PHQB 4EVNA 2VAJA 1B6DA 4Y5XA 5J6HB 1CD0A 3NCEB 4N8CL 4I48B 1ZHBB 4OGYL 3BRDA 1H8NA 3O45A 3QIUC 1FGNH 1KIRB 1W0WA 3WE6A 5F6IB 2W65A 2XG4A 2V2XA 4L4TD 1PZ5B 1OAUH 4KPHH 5FUOL 2FWOA 4U1NA 4ZSOA 4UQ2B 2H3NB 2HJFA 4IDJH 3ILPB 3HA0A 3KJ6L 4TNWF 4DKDC 1R5WB 3T3PE 4FQ2L 1DE4B 2P8MB 5GS1C 2CLRA 1NLBL 1I9JL 5EPMA 4A6YL 5I1AA 4HGKC 4ZAKD 4EIGB 4NP4L 5GSVB 1Y18B 4NQSB 5DJ8B 2W0FA 4RBPK 4WHDA 3VG0L 1IVLA 4S1RH 3TVMC 2JTDA 4HKBA 3UTQA 5F9JA 5LXGL 4GRWB 2PN5A 4NC0B 4KKCC 5CP7A 3ARDB 1MHPH 3K3QA 3GBNH 4IRZH 5F7HA 3C08H 5ACZB 5J12B 5HGHA 4RMRA 1K6QL 3T4AB 5BOPA 3FAWA 3VXNB 1RULH 3B2VL 1YMHB 2JB5L 4M7KH 4MNGE 1JZ3A 4OV5A 2R4SH 5EU4A 3UTTB 2EE9A 3O9WA 2GFBB 4Q0XH 3T08A 3MJ7B 1A1NB 2RR3A 4ODUB 4AZ8A 5CZXC 4IHOA 4JKPH 4PRIB 3PGDA 5IEKA 3NN8A 1TIUA 5ABDE 4KJWC 4LSTH 5E4EB 1MREH 5AG8A 1U41A 1AHWA 1GVIA 4F7CA 1S8DA 4X0KA 3MGAA 4XH2B 3VXUD 1V3MA 4WTWA 5IJKA 5SWZD 3S37X 5EOCJ 1AKJA 4L8DB 4ZFFA 4WUUA 4LPWA 1KXQE 3P9MA 3IRZA 4NDMA 3BAEL 2XTJC 4DWHA 3KPQB 3FN9A 4OCMC 1DBKL 1S7VB 4H26A 4G9DB 3TNNB 3AREC 2A6DA 5EUKB 1KYOJ 5C0CD 1LEKB 2FIKB 5DDHA 4YHNA 1X5IA 1KJMB 1WIPA 2XZZA 1EEUA 1XR9A 4OZIF 3ZDXE 4N0FA 2M1KA 1I4FB 4PV9B 3LSOA 3SY0B 3CCHB 1KT2B 3O8XD 5K9KB 4NC1E 1QZ1A 2FSEA 4M4PA 5CZKA 4DFHA 3IETA 5M7QA 1U91B 5JPNB 1IC4H 1HI6A 4MJ6B 5B39G 5EU7E 1WBXB 3TO4B 2KZWA 2VR4A 4HZAA 4GRWF 3GSVA 2LTQC 2WUCH 3B83A 4LASL 1X9QA 4Q2ZA 3I02A 3IAPA 4X7DC 4U6HA 2C4FU 1H3XA 2A77H 1OT1A 2WLZA 4XX1G 1T89A 5IHZB 5GZNC 4AG4H 1W72L 2D31A 1ZHNB 1QSEA 3V4UL 3WBDA 5I8EA 5EZLA 1I1CA 1P6FA 4JPVH 1ZVYA 3ZDZF 1J1OL 1I8IB 3QDGA 4I2XA 5LKNA 2WBJA 2EC8A 4X9HA 4L4TA 1XGRB 3L6FB 1F4YH 4OSUL 3ZKSD 1P2CB 3P0GB 4ZUUA 3LQZB 2D7TH 1HYSD 4JFYB 5GS0H 2HTLC 2Z31C 1QBML 4UAOC 3FQWA 4OQTH 4WTXA 3FN0H 4W6XB 2QQKH 4NKOB 4ZAKA 4XHQA 2YD1A 1F13A 4HUUB 3BGAA 3W11D 1INQB 1B6UA 4C55A 3O3UN 4GKZB 3VH8G 3OR7A 4HK3N 5C3LD 1T5WA 5KN5B 4GJTB 4WWKD 4DZ8A 3G5ZB 4LP4A 3SDXA 5F3HB 1KTRL 1S9YA 2NY1C 1CTNA 2OTWB 4HKXB 2V5SA 5BV7L 2CMRH 4NBZB 4Z7NF 2BNUB 4OLXH 3EYQD 1IGIH 2DWDA 2BNRD 3KPRE 1L0QA 4U3HA 5FKAA 3GSOB 1S5IL 5IHUL 4EI5A 5C2BL 1I1AA 4N1HB 4XBGB 5TE6H 4XB8A 4R7DA 3N1MC 3KPNB 1RURL 4NQDA 5DJXB 3U4AA 1Q9LB 3T0VA 4W6WB 5MEOB 4LSRL 1IEAA 4X4XB 5IJVB 3P0YL 1MWAH 4PJ9C 2WV3A 1B90A 1MCQA 4LGSB 5FEBA 2A9NH 3I75B 1VEMA 4AT6B 1T21A 1T2QH 1DUZA 3WXWL 5GGQL 1ZVSB 1FG2B 4MA1B 5ESQA 3QCUH 4HC1L 4MJIE 3S36X 3TGXA 3UYPA 1R5VA 3RPIB 5HYSB 2WWKT 5SWZA 3HPLB 4K7PX 1TJHL 4JRXB 1DSFH 3IXTA 1HCFX 4RX4D 1Q9KA 1MJ8L 3QJFB 4H25A 1Q9WA 3BO8B 2IANE 1DFBH 2NY0D 3IDJA 1B0WA 3L9RA 2QSVA 1BFVH 2HWZH 5MI0B 3TPKA 5HHNB 5T1LB 2E9WA 3WO3B 5E2WL 4YDLB 3D39D 5DVLA 2DLTA 2BDNL 1RZ8A 4NZJA 4P5MB 3NFSH 2DLIA 2A6IA 4PJHB 1G7QA 3MV8D 5HPOA 3QCVH 3RVXC 3ZKXB 5IT2L 4CDGC 4P9MH 1LEIA 4ZQKB 2QQLL 2ZNXA 3MLZH 1A64A 3FMGH 3CXDL 4M62H 4JB9L 1VKXB 4XPAH 4WFGD 1HOCB 1KC5L 3WCYA 1HHHB 3AROA 3QCTH 1NCBH 4OLUH 4PBVC 1L7TL 4YEFA 4X6DE 4PV8B 3MRMA 2W9EH 4OZFB 3FN3A 1E27B 3RVUC 3VWJB 2AEIT 3QUXD 4ODHH 3DYOA 3VXQB 2Z4QB 4KY1H 4L1HA 1NEZB 2NY5H 1U36A 3C5JA 3QFJB 2AAVA 3QQ4B 1TPXB 2VDLL 2O26U 5K9OB 2OM5A 4NO3B 5KSBE 2X4OB 3GJEB 3GMLB 5IW1B 4GW1B 2VH5L 5INCB 4JDZB 3ZTJH 4V2CB 4YK4C 3QHFH 4FQ1H 5J13C 5L9DH 5BW7A 5D7JC 4Z95H 4P4KB 4JFQB 1ONQA 5IGXH 2X4RA 4PRBA 3BH8B 4POUB 1PKQE 4RGMC 4R6UA 4JLRA 4J1UA 2ENYA 1XMWA 4EXKA 3SKJH 2OBGA 3LVEA 1S5HA 5I73B 3MRFB 3NFPA 1AIFA 1RU9H 3PUCA 4CADB 2WWKO 3MV01 4NNXA 3WFBL 4UV7H 5GSRA 3MV7A 4ALAH 4PGEA 1SJHA 1I8MA 3ARVA 3MREA 5SV4A 5GJTL 3ZO0A 1JN6A 4QKXB 4PP1D 1N6VA 1VGEH 1X5FA 2F58L 4KJPC 2OX5A 5BS0B 4JDVB 4JO1H 3RY4A 3U79A 4YR6A 3MV9E 3O3BA 3MLVH 2ZG1A 3K1KC 4FZ8H 4KK5C 3ZTNL 4FABL 4OUUB 2YSSA 1DBJH 2YOCA 3MA9H 5HD8D 4HBQA 4WWKA 4DK6A 3OKLA 1S7XA 2H41A 1J12A 3H9SD 5F8QC 4F3FB 4Z0XB 1ZXQA 1A0QL 4WNQA 2NY6C 2FO4A 2NXYB 5E2UL 3MNVB 25C8H 3K8KA 5IR1A 1GHFL 1I8KB 3KPSB 5CLTA 2IBBA 5ITFB 3VRIB 1MFAL 4HJ0D 4PJHF 4BK4A 2GK0A 1DN0A 2AI0L 5F7NC 4KI5C 1E28B 4FTVA 4ZUVA 5MENE 4QWWD 4POZD 3T0WA 5L8KB 4WJ5A 4PRHA 4I77L 1J0HA 2A6KA 5AEAA 4U1MA 3QDJE 4GW5A 3QAZC 4QRQB 3RWIB 4ETQB 1D9KC 1ZA3B 4W4OC 2GUOB 1NMBL 4PREB 2FJHB 2W9DL 3RGVC 1M6OA 2F5AL 5GRVL 3CZFA 3D0VB 4HS6B 1JNLL 1Q8MA 2ADGB 3I6LE 3DARA 3ARGC 2JCCE 1WFUA 4RX4A 2HTKC 3SOBL 4HPYH 2H26B 2Z8VC 4DN3H 2EKJA 3ARFD 5IBUB 1YY8A 3L3IA 2CLZB 3ARUA 2DM4A 3P4MB 3UJIH 1UCBL 1DLHA 3DGGA 2B39A 5D2NC 4K8RD 1WUNT 4MDJB 4TSBL 3MV8A 3LKNA 5AZEH 2DQGH 4JFHD 5T1DL 2AK4B 5EOQH 2JE8A 3O4LB 4NQUA 5C0JB 1IKFL 3SE9L 3MO1B 2ORBH 1MFDH 1XH3B 2XZAL 3BZFA 3KYOA 4CNIA 4R0LB 1H3TA 2BY2A 3EYOB 5CCKH 1JWMA 4R26L 3WFEH 1Q1JH 3W39A 1NKRA 3OGCA 4JAMA 1G0XA 5T1MB 4JM2B 1UACL 5JW3H 1BVZA 2NY7H 4M7LL 4P46D 4DW2H 3LD8C 3K8MA 3ZKMC 3QUXA 1WIUA 3J8F7 2BRQA 2Y25A 4KROC 1AD0B 1K5NA 1C7SA 2E27L 3IAQA 4OM1L 4TUOB 5D1XD 3U6RA 3QDAA 1DQLH 5GS0D 4NKIL 4POYA 1MNUL 3CVIH 4LHUB 3MRDB 2UY7A 4O2FB 3U1SL 4MS8D 2F8VA 2XWJB 3NZ8B 4HIXH 4KV5F 4XNXH 3B3IB 1NBVL 4AEHL 3VJ6B 2CKNA 2GJJA 4HFUH 1J8HB 5DEGA 3TA3D 4EDWH 3QNXA 4BFIA 1N0XH 3F62A 1DVFA 1ORQB 4H1LG 1EFQA 4HUXB 3ETBF 4JFDD 3CFKB 4OM0H 4L8BA 3AS2A 5GPRA 3HR5A 4OF5A 5KBNC 4E41D 4BA8A 2BOBB 1F00I 3PWUA 1MRFL 1KPVB 2EDRA 4P5TB 3PV6A 3A6CL 3RZCC 1AE6H 2RIKA 3VFUB 4MSWB 2FHBA 3ZT6A 1U8QB 1A1OB 5DMKB 3ZE0F 1IC5H 3MCKB 4XCYB 1MCNA 4LMQI 4N90E 1V05A 3TV3L 3IU3A 3GMRB 1QSFE 4Z18A 1OGAB 4QTHB 1E0OB 3EGSA 2PNDA 2PXYB 2VDML 5DT1L 2GI7A 3H9SA 1VFAB 1GXEA 4G42A 2EIZA 1QFWL 3CSYA 3BRGC 3VI4F 1X6NA 3DMMC 4PUBH 2YS4A 1MRDL 2NXZB 3ZE1E 1S78C 1FN4A 1EUUA 1RZGB 3ULUF 1UJ3A 1A02N 1MCEA 4ZMAT 3EYFB 2XT1B 5DS8A 5E08L 1U8JB 4MD5B 4XPHL 1T3FB 4HGWB 4L4JA 1MCLA 5JORB 2RFXB 4FFZH 3TVMD 3WFCH 2FL5B 2APVA 5E8DH 3OV6A 4UIMB 3OAUH 1KCSH 1P69B 1AXTH 4JM2F 3U4EA 4EN3A 3L3GB 1IT9L 4KKCD 1KIUA 4JPIA 1LEGA 3SO3C 5TFSL 4L8CB 2BVTA 1DQJB 1KB5B 4R4NC 4O4YL 1CXFA 3WFDH 2X1WL 3NCYP 4MB3A 4NNYA 4NQEE 2QHLA 3D69A 3P11L 4H8WH 4ZUTA 1M7DB 3U83A 1S7QA 4FOMA 5I17B 1TITA 3FQUA 5CKGA 1OTUC 1OQOA 3EOYG 5DF0A 4J23A 4OLVH 4F57L 3QHTC 4PG9B 5CZXD 1IKNA 4LCWD 5C0RH 4P2RD 3IU4L 4UOJA 1NCWH 4KJWD 5CS7A 3D2UB 5FYKH 3IFOA 4IOFD 3B9EA 3FOMB 3RDTB 3ALPA 4HCRL 3LKQB 4FQQA 1IZJA 2H45A 2VISB 3G5XB 4OCYL 4ZXBB 1A6AB 3K7UA 3OKDA 4DVRH 5DD0H 2IEPA 4BZ2H 5DJ6B 5GGVL 4DTGH 4M00A 2FHCA 3KXFD 3P4LA 2VZSA 1J05B 1P1ZA 1IAII 3TCLB 3DXAA 1BVLA 4JRYB 4TRPH 1EJ6A 3U2SB 5FO9A 3IDXL 1VGKA 5IB2B 3IF1B 4PJ5B 5FOBB 4PPTA 1YJDH 1MCJA 2H8PA 3OKEB 3ARED 1MCRA 3H9HA 2R0ZH 4DOHB 4D0CB 2ZPKL 5F44A 2KQMA 5J3HC 1A6ZB 1YY9C 4OQTA 2E9JA 1CD1A 4RFEA 1FNAA 3V0AC 2JJWA 1BFTA 4UZGA 2C3VA 5LWYL 5J89A 1NDGB 2OL3L 3MRNB 1AQDB 2QSTA 2OTPA 3HNTL 3TA3A 1U8MB 3ZLQC 2UWEA 3OJDA 1PY9A 3GSWB 3L5JA 5EOTA 2JJTA 1IRAY 3RFZC 4QF1B 4E41A 3CPLB 2IPUK 5GISL 5EWIH 4CVZA 5DI8B 3LKSA 4M5YL 1M4KA 2HG5B 4C56B 3KDMA 4KHXL 5DJDB 2DQTH 4Z76B 4JY4A 4JFZH 4XAKD 3MOAL 1H3GA 4ZFGH 3LEXB 1XGUB 4YZFF 2Y6SD 4BQ6A 1MWAA 1OAZH 4KKAC 4MCYB 1ZSDB 2V7HB 3HS0B 3C8KA 1YEFH 2VLKD 1OW0C 3UTPD 3HE7C 5DRZB 1HHIA 1NBQA 4BYHA 3GSNB 4OZFG 3ZDYF 3C2AH 4PGCA 2Y7QA 4M43H 5F9AC 1Q0XH 3I50H 5IKCB 1P84J 3DROB 1NEZG 2ICWJ 4OBSA 3HHRB 4TULL 5DMIH 2HTLD 5MEPA 1CVSC 4PJEB 2P24A 4I9WE 4YHKL 2VC2L 4I0KA 4L1DA 1UWEL 2OK0H 5K59E 5EUOE 5FA4A 2KZ1B 1HSAA 1CFTB 1A14L 2DYPD 4KK9D 2NLJB 3ZYIA 3HRZA 1F8TH 1YUHA 1HHJB 4PRPA 1IQDB 1UB5A 2NY1D 3CDFA 3IDGA 2VLLB 4RAVA 4PJIE 1MI5A 4TUKH 2A0LC 5AWNL 1A9EA 1R6VA 4WU5A 4MA3B 3QEQA 4X4MA 4F7PB 1OSZA 3OPZL 4OZGA 4XTRC 3GSUB 5HYFA 4NKDB 5D7LA 5EZJB 9CGTA 2CKBL 5CJOH 4GW4B 4Y89A 5IFHH 2DQCH 4Z6AT 1C1EH 3BKCH 2VN4A 3QIWC 4YEEA 3VD7A 2G9HA 3HI6L 1NBYA 5JW4N 5F96H 2DQEH 1G7JA 3HE6C 3RU8L 4LCWA 3REVB 3OR6A 1JPTH 5HY9B 1ITBB 4PJ9D 2P5WE 4Q6YA 1CD8A 4IOSD 5JDSA 5FK9B 5ANME 2A74A 2HLAA 3BX7C 4OIAA 3N0PB 1XR8B 1V7MH 4IOIA 1U8KA 4P2QA 2GAZA 4WU7A 2JIXB 2YPVL 4D0DA 3ISWA 4X9IA 2NY4C 4PR5A 2O5ZL 3GHBH 5KVFL 1BQSA 1SY6L 2AJ3B 4R3SA 1TCMA 5FUZH 4UTAL 4Q6IC 1ZS8B 4MNQD 4XBEL 5TDPA 3EKCA 3HC4L 1A7PH 3NFNA 3BKML 1FGVL 2HLFC 4LFHG 4M8VA 2EIDA 2EIBA 3REWB 1KCUH 1K4CB 1FYTA 5JHDE 1I3GH 5F3BA 2F53E 5ETUB 5BRZB 5TE7L 3PXHA 1FPTL 1JPST 4OFYA 1IFHL 3O3EA 4WHTA 1MH5A 3RVXD 2Z9TA 5I18L 4OQ1A 4LCYA 1INDH 4YLQT 3PNWB 1FP5A 3MUGA 2NR6C 3TT3L 3JVGC 3AMLA 1QR4A 5FYJU 3TIEA 3WN5C 3WS6A 4KQ4H 2Z0BA 3GBML 1OAXL 4IRJC 2X4SA 3GB7A 3CIQA 4E42B 3RVUD 5E9DB 3E6FA 3BHBB 5GRJL 5M94B 2PYED 2W07A 3BESR 5KW9L 3NIGE 3MJ8A 1S7WA 4F9PC 3QPXH 3QIUB 4IIQC 3RTQC 4MA7L 1CK0L 2IAMB 1NCDH 3KYNA 3M8OL 1MFEL 4HS8L 2C3XA 5HDBE 2X10A 3UZVB 3V5HA 3QG6B 5D7JD 3RA7H 3O6FD 1S7RB 2VLKA 2ITDB 2WIIB 3ET9F 5C0EB 2AEPH 1EHAA 4XZUB 2FEDD 3ESVF 1S3KL 2GW5A 3MRRB 3MGTB 1FNSL 5DUML 1NGWB 2LAGB 1ZA6A 4YHLL 2P8LB 1KIQB 3FFCB 1BD2D 4YX2H 5HXMA 3D6GA 2WANA 3H3PH 2VDPL 1DLFH 1RJZA 5KSAB 1BHGA 5IROA 4DJMA 1IGCH 5L0QC 2OR9L 3MJGX 4MQTB 1AQKH 3HUJE 3X17A 4KJPD 5CLWA 3SKUD 3O6KH 1RY7B 4K9EC 3UPAA 3Q6GL 1SJEA 4G6KL 4U6VL 4YHML 4YAQA 3PQYD 4NRZB 4S0TD 4UV4H 4P9HC 3VFVA 4FA8A 1J5OH 1HDMB 1EK3A 1NGZA 2HKHH 3RWFA 3SKNB 1LDPL 1U3HC 2NY6D 4M6OH 3QG7L 4U0QB 5IVXE 5I15L 3C09C 2X1PA 4FP8H 2OMBA 4D8PB 2C26A 4U0RB 2QKIA 2YBRB 5A2JH 4NC2B 4DKFH 2BY1A 3ULUH 3W5NA 1FV1A 1GYAA 3MODH 3PGFH 2BSED 3RNKB 1OAYL 1P7QD 2AXJA 3KPMA 2NMSA 5KS9B 5IQ7L 4R8WL 1KTLA 3PHQA 1XAUA 5J6HA 3SE8L 5FM5O 4PS4H 1ZHBA 3MMEA 1D9KD 4DK3A 2XTJB 2CH8A 1L7IL 2VLJE 4DCQB 4X6CE 4QO1A 2VDOH 1A7NH 4L4VB 2CRIA 3G5VB 4XP5H 1BBJA 5DJCB 4NN5C 3MUJA 2H3NA 5GRWA 3ILPA 3U7YL 4KHTL 4NZTH 4LLUB 1R5WA 3ARGD 4C57C 2ZJSL 4DUWA 4KZEL 3T09A 1NBZA 1FVEB 1B2WH 1DE4A 4XHJC 4CJ0A 3AM8C 5J1AB 5I1HL 3QUZB 3IFPB 3PDGA 2X5PA 3FO2A 5GSVA 1Y18A 4NQSA 1CU4H 1B4JL 1B88A 4K3GA 5DJ8A 3I6KB 3F58L 3TT1L 3B8SA 2J5LB 3U9UB 4OLWL 3FQTB 3CMGA 4N0CC 4GXVL 4X9FA 2K7PA 2CJUH 2AJXL 3L3HB 1QA9B 1EMTH 4P2OC 5ACZA 5FV1L 2LTQB 3T4AA 1SVZA 3QNYB 1YMHA 3BD3A 5KSUB 4LSPL 1G1CA 4KI1A 2AKRB 4JZJB 4TSAL 1A3RH 4JGMA 4NZUL 3UTTA 4PJBB 5FYKU 3OHXB 4O58H 3RI5K 5CZVL 2GFBA 4U1GC 3MJ7A 1A1NA 5ACMA 1P4IH 1ZE3C 3SBWA 1EFXD 4HWEH 2C5DC 5C0IB 4I0PC 2HVJB 2FNBA 2RBLA 4HG4J 1WFOA 5GGTH 3L5WA 3D0LB 5FM4A 5I1JL 4C58B 4S2SB 4KAQL 4XH2A 4M5ZH 2EDHA 4JO3H 2PW1B 4CU7A 3T3ME 4OGXH 1KPUA 4PP2A 1G6RB 4MQXC 3BIKA 5HDOA 5KANI 5E00B 3Q6FA 3T65B 3O6FA 4L8DA 4WHCA 2NW3A 5ECJE 1UG9A 4WTZA 4YH6A 1BZ7B 5T3XL 4WW1A 3EOTL 4XGZA 4Y5VB 5KS9F 2VSDA 1YN7B 32C2A 4GG6F 3KPQA 2HFGH 2VXUH 3RVWC 3GNMH 3RZCD 2IGFL 1A7OL 4Q9CA 1KXTB 1BD2A 2QL1A 3TNNA 5JXEC 2FIKA 1DZBA 3VGDA 1KJMA 2R29H 4GAJH 4LKXB 3CCHA 4G7VL 1KT2A 1MCBA 2HFEB 5K9KA 4DQOH 3U7AA 3CVHL 3EAKA 3VW3H 5F6HJ 4MZ3A 1UYWL 4XVTH 1U91A 5JPNA 1CVRA 2BSRB 3ME0A 3DO7B 1LO0L 3MXWL 2BSTA 4IS6A 3DMMD 3TO4A 1BJ1J 1WEJH 1HXYB 4HHAB 1S78D 4GAFB 1ZGLB 3FRPA 1JNHB 4G7YL 1B3JA 3UYRL 4D9LH 4JO2H 3EYUL 3PWPD 4U33A 2BY3A 4CMHC 4LNRB 1ZHNA 4G3YL 2DLFH 4M61B 1UM4L 4JR9H 1MJ7H 1MJUL 3MV9B 4S1SL 1OWRM 1EHLH 4R4ND 4G5ZL 3V8CA 5IWLA 4GMTL 3QDME 5EBMB 3L6FA 2E7LA 3MLUL 1P2CA 4JFYA 3P9WB 5EU7C 1JHLH 3LEYH 1KELL 1FBIL 3ULVF 2KBGA 1WWWX 1OTUD 5HHMD 1EO8H 4NKOA 3AC0A 4HUVB 2IQ9H 3G08B 4HUUA 3O6LH 4AMKL 4OI9A 4ZTPH 1INQA 5A2IH 4IJ3C 2YXFA 2ZUYA 3D1MC 1QYGH 1V3JA 4DVBA 4Y8DC 4DGYH 3G5ZA 4HJGB 2F19L 2VZ3A 2Y06L 3VXMD 1OF2B 1RUQH 2V5YA 3F7VB 3A6BL 5IQ9B 4HKXA 4JEGB 1O7SA 5IMKB 2BNUA 3QDJB 5HHXL 4TOYL 2Z93B 4WUUE 1IAKB 3GSOA 4ZTOH 1EVUA 5JOEA 4XBGA 5CD3B 3UCRA 1PG7H 2Q87A 4FFYL 4YFEA 3KPNA 5DJXA 5ICYB 2OR8A 1Q9LA 4RFOL 1OCWL 2X7LA 5IJVA 3V6FA 2PW2B 5ID1A 2X4NA 4X99B 4AT6A 2NYYC 2ZSVB 4Y5YB 5J3HD 4BM7A 5IW6B 4ZO8A 1ZVSA 3GSNH 3FKUS 2QJDA 4HF5H 3STZB 5HYSA 3PWVB 3RPIA 2VDNL 2EYTB 3P3YA 1MCPL 5HYJE 4QRPD 4HXAL 2UVEA 4KUZH 3HPLA 4QRRB 4JRXA 5JQHC 3DIFA 3QJFA 3AU1B 3NCYS 3DV4A 3HPJA 1NCUA 4LU5H 5HHNA 5D71H 1QEWA 5T1LA 1CGXA 4XT1C 3N85L 2FB4H 5E2VH 3EHBD 2N4IA 1EERB 4YHZH 5IK3A 1MAML 1JPSH 4DAGL 4P5MA 3QXTA 3T0DA 1DCLA 1JHKL 3HI5H 3BKYL 3E8UH 1ZGLM 4LSUH 3KWWB 4ZQKA 1A3QA 5IHLB 1QSEE 1UB6B 4N5UA 4KKAD 5E99L 1VKXA 4LAQL 5C08B 1HOCA 1WZKA 3S35L 1KTDA 2BRRL 3QXDB 4N8VA 5MERB 4OCXL 2R69H 2VERN 1HHHA 1TJGH 1IAMA 4XCCH 3QDGE 4I2XE 4NWUH 4PV8A 1Z9LA 5D7IF 3UJJL 3VXQA 4BFGA 2N56A 3DMMA 3QHZH 2R56H 3QQ4A 1UM5L 3SGJA 3QAZB 5FYLD 2IPTL 2Y36L 1NMAH 1YC7A 1URLA 3SQOH 5JUEH 5K9OA 2P4AB 3BE1H 4NO3A 1W72B 12E8L 3D9AL 3NAAH 3QZWA 4ODWB 4XVSL 3QIBB 4Z7WA 2X4OA 5IW1A 3RGVB 4X5WA 5INCA 1PX3A 3ARSA 5I30L 4JQVA 3QWOB 3PWPA 1YA5A 4JFQA 4P4KA 3W0WB 3MGOA 3NIFE 4FZEL 3BH8A 1R3KB 3SDXE 1TENA 1SMOA 4TNVK 1QKZH 4M1DH 4RMUA 3MRIB 1A6WH 3AVEA 1FFPA 5F97E 3IDNB 2A0LD 3MRCB 2I5YH 5CBAB 1PBYA 4CADA 1L9NA 4XTRD 1GPOL 3BPLB 3PIQB 3S4SG 3BZ4B 5I19H 5HTSA 5KVDH 2BK8A 4NQDE 4O02L 4JFFD 1A7BA 2WQRA 1RZKH 3K4AA 4I3SL 4ZNEA 5BCAA 5C0BD 2VTFA 3QIWD 4CUCA 4QY8A 3ABZA 4X7SL 5J06A 5DQJB 4UT9H 1KULA 3CUPA 4JDVA 5BV7B 1RFDH 4R90H 2W91A 3IDYC 1MOEA 4ERSL 3VD5A 3EBAA 5F93C 1AGFB 1E4KA 1RUKH 3U4BL 2Q3ZA 1U8IB 4CVXB 5F9WC 4F3FA 2B0SL 3EJYD 4Z0XA 4KROB 4M93B 1TTGA 2DBLL 3EFFB 4KXZI 3MZGB 1I8KA 5KJRH 2RAMA 1AD9B 5ITFA 3RUGF 4G8FB 4FHBD 3VRIA 2M8XA 4N68A 4LLQA 4X4YB 3BMVA 2NX5D 3QNZB 1E28A 3L3KA 1DDHB 4QXGH 3VFWA 2HLFD 3HAEB 4KXZH 3S3PA 4CVWA 4N0YL 5E95B 1HHGB 2AV1B 5JW5A 4KI5F 5JMRA 2ADJB 1P4LB 1CZ8H 5IESH 1ZA3A 3DX7A 5KZCD 3QYCA 4RISL 4HD9A 2IPUG 3SDAC 3DRQB 4XNZC 2O5XL 4HS6A 2DQJH 4PJXB 5E5MB 1TCRB 2ICCA 2NR6D 4LIQL 3GI8L 2PCPB 3P77B 3B9AA 4XB7A 2BHUA 2ITCA 2FLRT 3NH7L 2D0GA 2H9GB 3O2WH 1EX0A 2H26A 2QADD 4P3CL 4XRCA 4P4RA 2DIJA 1I3UA 1TXKA 4XMPL 5DFTA 4Y4FC 3WXVH 4CJ1A 4LOUC 5CEZD 3QUML 2D7PA 5L6YL 1ZTXH 2CLZA 4WY7L 3ELAT 1HE7A 5T3XE 3P4MA 2ZP0T 3LKOB 5AUMB 1CDJA 3RTQD 3V79C 3G6AB 1IAIM 4QOKE 3L95A 5C9KA 5DJ0B 2EC9T 4NZRH 1A6TB 1D6EA 5FO7A 4IMLB 5C0JA 3DLQR 4LSVL 3DO7A 3CMOL 4HIIB 3QI9C 3EYOA 3DVNA 5HBBA 1PG7W 5DHYB 3VRLF 3TBSA 4RGNE 1G7IB 5T1MA 4JM2A 3EUUA 3O0RL 2V7NB 4K3EH 3LRHA 4Z78A 1JGUH 1AD0A 2OZ4L 3QO1B 3ARWA 3MV7E 1N8ZA 2VXQL 3SO3B 4JDTL 1VACB 1MVUB 5D8JH 3JWDC 2VXSL 4GQ9H 4LHUA 3MRDA 1GGTA 4M6NH 5CIPH 4O2FA 3JV0A 5DHVH 1RJLA 1I1FB 3GMOB 4V1DD 1MLCB 5H37G 1J8HA 2PTTA 1R0AH 3NA9L 3Q5OA 3KR3L 3BQUC 1T80A 3WJJA 3FOLB 3MRKA 1ORQA 5HI5D 5BQ7A 3UTSD 4PJGA 3VXSB 1BEYL 4PY7B 1XCTA 5IBLC 2XZCH 5DUPH 2DBJA 2BOBA 4HX1B 4KFZC 4UQ3A 5EZIH 2GY5A 1SM3H 2DTSA 4NUJA 4YXKL 3EYSH 3VFUA 4FNLL 2A1WH 4F8QA 2HN7A 4MSWA 1YPZA 1TETH 1XEDA 1U8QA 1A1OA 4JFFA 1IEHA 4FTVE 3GMNB 5DMKA 1JZ2A 1ZHKB 1IGFH 3MCKA 5EBWB 1QR1B 3FQRB 4PJXF 4JY5L 4KK6D 4PRHE 1NGPL 2Q8AH 3GMRA 3WJLA 1FAIH 4XBPA 4QTHA 2YD8A 5T5FH 1JF6A 3OAYH 5I1GH 1KNOB 2YK1H 4K55A 5M95B 5KAQF 1OP3H 4BUGA 2PXYA 3QUYC 4LBEA 3TBWB 1EXUB 1VDGA 4NQTA 2RQ8A 2EDBA 5GGTA 1VFAA 2B4CC 1CL7I 4YGVB 3X3GH 4D9QD 3W9DA 4PD4J 2C3HA 1U8NB 2ADFL 3LKPB 3LH2L 4U1SB 1MUJB 4IRSB 1RZGA 2CIIA 1U2HA 1ETZA 4XHJD 4MAUH 2C4XA 5EU6E 1CL7H 5HJ3B 3EYFA 1VA9A 4PLNC 1U8JA 4MD5A 4P59H 3NCJH 1FRGL 3ULVH 4HGWA 1K4DB 1G6RH 2EO9A 3ECBB 2RFXA 5JORA 3GKWL 2FL5A 1G7MB 3OKNB 3S97C 2FX9L 2BVUA 5I8CB 3L3GA 1DQDL 1LHZA 1RZFL 4J8RB 5J1TC 1JFQL 4YHIA 2Y07H 4L8CA 5IVOA 1DQJA 1M7IB 4P2OD 3IJSA 3KNBB 1FH5H 4HMDA 4JCLA 5DJZB 2WUBL 2A73B 3OXSB 5IP4A 5GGUB 1QLEL 2DDQL 3L1OL 1M7DA 1TZHB 1JF1B 3IJYB 5I17A 1OAQH 1CLYL 2R1XB 2ZUVA 2BSSB 1CDBA 2J7LA 5I75C 4PG9A 4DUVA 3QISA 5D72H 3HB3C 4S11A 2EDYA 4Y4HD 5EU3B 4PGBB 3I2CH 4I0PD 1MHEB 4IIQA 1SBSH 3HE7B 3L7FB 3S5LB 5I0ZA 5SWSE 3D2UA 4UOW1 4Y16C 4XXDB 1CLOH 3FOMA 3RDTA 1BQHB 1T2XA 3U0TA 5JHDB 3MLSH 5DHXB 5A2FA 3IS1X 2EDDA 2VISA 3G5XA 4UIKL 3TBYB 4ZXBA 1TQBC 4MQXD 5HDLA 1N5YH 1A6AA 1N64L 1YC8A 5DJ6A 3ARBD 1P4BH 4UB0H 1AJ7H 4XVUC 3ROLB 5AYQA 2YD3A 1J05A 1JL8A 4NUGL 4JRYA 4N8CH 4OGYH 1UJTA 4WI6A 4KMTL 4IBLT 2IBGA 4HV8B 2GYSA 4OLYL 3RVWD 5F70A 3I84A 1OVZA 5FUOH 1H8OA 3WNNA 3OKEA 4FQJH 5JXED 1LWRA 4K23L 4D0CA 3KJ6H 1PG7X 4YNYB 1A6ZA 4FQ2H 3IJHA 1KOAA 2X41A 1NLBH 4V1DA 4A6YH 3U0WL 1NDGA 4NP4H 5L7XL 4X6BB 4J3WA 1U8MA 3VG0H 4N9GA 3GSWA 2APBA 1NUGA 3JZ7A 2DQUL 3UTSA 1JMXA 5LXGH 5I74C 1IM9B 3HE6B 1RJYB 3CPLA 3C6SA 1K6QH 5FYJL 5DRNB 1KFAL 5B38B 2LFGA 2IAMD 5DJDA 4J7RA 2JB5H 1NAKL 4Z76A 3WO4B 2D9QB 5ICZB 1XIWC 4UTBL 2NY4B 1FL5B 4J6RL 4PGDA 4M7LT 4I5BB 2K9UA 4LRIC 5EA0L 4MCYA 1P9MC 3HS0A 1JUFB 4K3DH 4OCWL 1XZ0B 4TVPL 5CJXA 4XWOC 1MFCL 3HCVB 5DRZA 5KG9B 1JZ7A 1PX4A 5SWQA 3GSNA 3TBVB 4MX7A 4NQVB 4PYGA 5IKCA 3TO2B 4G9FB 1YNKL 4M3JA 2MNUA 1NFDE 3VA2C 4PJEA 2VDQL 4TSCL 1H9VA 1OLZA 7FABL 2OQJB 1G9MC 3BAEH 4HEME 4YIQB 1CFTA 2D4FA 2F54B 1EHNA 1IARB 3WN5B 5T33L 4IRJB 1DBKH 1QVOA 5CD5D 3MRQB 2O5YL 4KKNA 1HHJA 1IQDA 4LVOC 2VLLA 1EUTA 2VR5A 1W2KT 4K94C 2ZUSA 5HVFB 4F7PA 3BIBX 4WDIB 1D5XA 3GSUA 4NKDA 1QRNB 4AJ0A 3DXAE 4ONGL 2C3WA 4B5EA 4ONOA 4GW4A 5A3IC 5DLML 2V9TA 3OKOA 3QPQC 5JZ7C 1SBBA 2DN7A 3QH3B 4G43A 1UZ6E 5I71B 3AAZB 1XF3B 4HIJA 4G8GE 1UM6H 3SGKC 4Y4HA 4ELMF 3REVA 43CAB 5JXAL 3U36A 4JN2B 4JANB 5T3ZL 3G6JB 1LQSR 4FXKA 5D1ZC 4HWZB 4HIEB 5IBTL 4LASH 3SDCB 1XR8A 5B8CB 2JIXA 1TJIL 2BJML 2VL5B 4KUCF 4RMWA 5JIIA 3ARBA 4RA3A 1LVEA 3BPOB 1W72H 1QFUH 1UVQA 3V4UH 5AG9A 3KPRD 1ZS8A 2WINA 2P44B 5ITBL 1MCKA 4MNGA 4LSSL 3SDDC 2XFXA 3REWA 1J1OH 1L0YA 3HAEG 3OGOE 4HPOL 4MZ2A 6FABL 3GIZL 2NZIA 5ETUA 5BRZA 2DM2A 5DUBA 3L7EB 1L6XA 2VQUA 3MR9B 5I1IL 1U3HB 4LEXL 1QBMH 2R23A 4Y2OA 2ZUQB 4I18C 1LE5B 1CR9L 4X4ZA 2YA2A 2X4QB 4LGRB 4MJ5B 3SDYL 4MJID 4NRXB 5DR5L 2X05A 4UT6L 1PVHA 4E42A 1T0MB 3BPNC 5E9DA 2WAHA 5I0DA 1EZVY 5BV7H 1W8NA 4CL7A 4KRLB 4J3VA 2IAND 1IQWL 5TDOB 2VDKL 1WJ3A 2IAMA 1S5IH 5IHUH 5C2BH 3T0AA 3BZEB 1ZT1B 4NN5B 1RURH 3UBXG 3IYLW 3VXOB 3QG6A 3SPVB 3D3VE 1M7XA 4LSRH 4UU9B 1KENL 4Z0BL 3V7AE 4QEGA 3P0YH 1S7RA 3OAYK 4PRPE 5DRWB 3DOSA 1OP3K 2ITDA 3OF6A 1MI5E 1IJ9A 3O6ML 1FNEA 3TN0C 5EOCL 4M1GL 3QEQE 4X4ME 3WXWH 4RMVA 4OZGE 5HYIA 3MRRA 5D7LE 5GGQH 5EORL 3MGTA 2WNGA 3G6JF 2YKLL 4HC1H 1CS6A 2P8LA 2H32H 5ADPL 1JIBA 2HVKB 1R3IL 3FFCA 5I1DB 2J6EL 4OI7A 2HT3C 4UDTA 2FECL 5GZOC 5KSAA 2DQHL 1EEZB 3RWCA 1MJ8H 2HKFL 5LQBL 4PRNB 2QSQA 2IALB 3V4VL 1RHHB 4LCCB 1JPFA 3RWGB 4MVBC 3S96B 1VPOL 1FNGB 1GZPB 1MFBL 3H42L 3QQNA 4NRZA 4K7FB 5E2WH 4LHQB 4WHYH 4U1GB 3SKNA 2BDNH 3ZE2F 1QUNA 4P2QE 4MJ2A 4MAYC 2IFGA 3RWEB 3OMZA 1KG0B 2CDGA 3QXAB 1G9NL 5IT2H 2QQLH 1AO7B 4CBPA 3CXDH 3OTTA 4PJ8D 4JB9H 1RK0B 3UP1A 1XGQB 4DN4L 1KC5H 1KJVB 4G6AC 3VMNA 4QRTB 4D3CL 1L7TH 1GL4B 1VESA 2MKLC 1FYTE 4N0UE 5GGRB 1CDUA 3FT4B 2J8UB 1RHFA 2MOVA 3QQ3B 3GZKA 2XZQH 5L2KB 2XA8L 2VDLH 2JK5B 4HW6A 3T8XA 3O3AA 2JLLA 1KJ2L 4XP9L 1K3IA 5CIPA 3LB6C 4DCQA 5DHVA 2LV4A 2IBZX 3ARRA 3SDAD 2VH5H 3G5VA 5DJCA 1H5BC 5E8EB 1MJJA 3TPUB 4QCIB 1UH3A 4YHYC 2W9LA 5EFIB 1CDYA 1FVEA 2G2RB 3VRJB 3JWOC 4RWYL 4M8QB 3KPRA 3QUZA 3IFPA 4WO4B 5DXWA 3P4NB 3V4PL 1BFSA 4Y4FD 1OP5H 3I6KA 5HPMB 1DANU 4JREB 3U9UA 5MEND 4Z77B 3FQTA 1I8LC 3WFBH 1KN4H 1A5FL 3L3HA 1QA9A 1NGXB 1JGEB 5ICXB 2AQ2A 5DJ2B 5GJTH 3QDJD 3U48A 2V9RA 3IVKB 3QI9D 2F58H 1HINL 1U58A 5KSUA 1UGNA 4HXBL 2DS4A 4RQQB 3ZTNH 2AKRA 4MJIA 1EV2E 4JZJA 5TF0A 4F9LC 4W4NA 4PJBA 3MRLA 3OHXA 4Z7VB 1H8SA 1LE9B 4AIZB 3I6LD 4CMHB 3MYJB 1DTUA 5EU5B 1A0QH 4ZPTB 2M2DA 5E2UH 3B9KB 4Z7UF 5C0IA 2PO6C 2HVJA 1GHFH 7CGTA 1J7VR 3GUTB 3T3PF 4U6XB 1MFAH 3D0LA 1CXEA 4Y2DD 4S2SA 2ED7A 2AI0H 2RGSA 1BQHG 2PW1A 1FC1A 1VADB 1G6RA 5FYJE 5ESVB 3IGAB 3T65A 2PKDA 4JHWL 4F80A 3BQUD 5DZOA 4OV6F 4O5LL 2FATL 4I77H 3B4NA 1QTYT 1H3PL 3MBEC 3MLXL 5L88H 4Y5VA 3KPOB 5IBLD 3WIIL 4IJ3B 1GAFL 1YN7A 2J8UF 2MQ0A 2R39A 1NMBH 1CICC 1J0ZA 2W9DH 1AR1C 3KHOA 4TVPE 1JNLH 1TVDA 5CGYC 3H2WA 1KCLA 4J3UA 3CK0L 3M17B 5DMJB 2JB6B 5E6IC 3H0TB 4P57B 3SOBH 4F15B 5AYUL 3UPCA 1UEMA 4JHBA 5JHLL 1GOHA 1NEUA 2BZDA 3BYYA 3QUYD 1OB1B 4XMLL 5E56A 3WNMA 5ACLA 5TQ2L 5DK0B 1UCBH 2GJZB 2BSRA 3NACH 4TSBH 3KYAA 4JQXC 2ARJB 2CUMA 3H7BA 5T1DH 2WZPD 4HWBL 1HXYA 4HHAA 2FBOJ 2F74B 1IKFH 2OI9B 3SE9H 1PEZA 2XZAH 4PJ8A 3F7YB 5F1IA 1IE5A 4R26H 1U93B 5B38G 3T1FB 1JNHA 4L3EB 5DWUL 4J4PA 1MAJA 2PTUA 1UACH 3C9NB 2IPKB 4M7LH 2BX5A 3RY6A 3WLBB 3GMPB 4GRWE 4KRPC 5HI4C 1UA6L 1T1ZB 4JQIL 1QLFA 5GHWL 5I66B 4M61A 2E27H 3FO9B 4N90D 4AIXA 1R3JA 4C83B 4OM1H 6CGTA 5T5NF 2XOTA 2O93L 4Q7DA 3MV9A 1QSFD 3X14B 2EDKA 2IG2L 1MNUH 2YRPA 2P49B 4AEIL 5EBMA 4A6YA 4EUPH 2X44D 5H94B 5KANG 3U1SH 3RX5A 5HDQL 1NBVH 4RFNC 4AEHH 3NBNA 3UTTE 2ZOKA 3BDBA 3ZDZE 4GBXC 3RHWF 1DQML 4LLAA 3G08A 2ZUXA 3HB3D 4PRIE 2JJSA 3I6GB 1MRFH 1A6UL 2P1YA 4AL8L 3A6CH 4HJGA 4JFXB 5HHOD 3F7VA 5IQ9A 5D93C 5IMKA 4XWGL 5HGAA 3QDJA 2Z93A 5T1KB 1IAKA 1QFWI 3TV3H 2VXTL 4XVUD 4W6YB 5CD3A 1WLHA 1SYSB 3E2HB 4NQED 3FQNA 3GHEL 2VDMH 5DT1H 3QBTB 2YUZA 4Z7NE 1CLCA 2JCCA 1N6QL 1QFWH 3O9WC 4MQ7B 4LLMB 5FKPB 1I3VA 2PW2A 3B5HA 4X99A 2XQBL 3C8DA 2NTFB 1MRDH 4Y5YA 4OD2B 5F7LB 3PL6B 4FFWC 5IW6A 3LIZL 4Y2DA 3AY4A 3C8HA 2VXVL 1AHWC 1Q38A 2IFFL 3PWVA 5E08H 2EYTA 4JM4L 2DL9A 4XPHH 5GGSB 1A7QL 3AS3A 5FYKE 3X13B 4PJDB 4PJAB 1U2CA 4Y1AB 5I1LA 1CGYA 4XNQA 5IJKC 4GO6B 3S3JA 4NOFA 3V6BR 3AU1A 1IT9H 1CXIA 1KCRL 5E70A 5TFSH 3IDYB 2CO7B 1JGLL 4O4YH 1HQ4A 2Y23A 2B5IB 5F9WB 4JRWA 3P11H 1SEQL 3MLYL 4R2GC 4M1CC 2AVGA 1XIWD 4LGPB 4LKCB 4NPYA 1NJ9B 3RL1A 2XV6B 3QWRD 3KWWA 3E3QE 4F57H 1CGWA 3K81A 1CFNA 4KMQA 5MERA 3IU4H 2ICEB 4NQCB 1CFVL 4XWOD 1I1YA 1KPRB 3RNQB 4PJ7B 3D48R 4QGTA 2EC9U 1H3WM 3C6LB 4LPUA 2ZOLB 4HCRH 1QHPA 5IB1B 1IMHC 1HSBA 4BSVB 3IKCB 1W72A 4ODWA 3QIBA 4XP6L 5GGVH 3WDHA 4QXTA 1FL3B 5BXFB 3STLA 3BUTA 1S7SA 5I16B 2X4PB 1A6VL 4YDVA 2YR3A 5F88B 1X5JA 1YEEL 4MB5A 4ZFZB 1QQDA 1OOAA 4B41A 3OL2A 3IDXH 1R3KA 3HZKB 1T89C 5FGCB 3C5ZB 4JFPB 5IMLB 3VFSA 5LVEA 3IDNA 3UPRA 3EOBA 5E6YA 4JZOB 1D7FA 3MRCA 2ZPKH 3MJ9H 4PY8I 3N9GL 5CBAA 3IKKA 3QA3B 1DN2A 5H35B 4F37K 3PIQA 4QHLB 1GGIL 2Z35B 2WBJC 3BSZL 3BZ4A 5IM7B 5LWYH 2H1PL 2OL3H 2W38A 2DKSA 3HNTH 5A3ID 3R06A 4LSQL 2AGJL 3QPQD 4XCNB 3WIFB 4HULB 3QXWA 1KB5L 4NM8H 5DQJA 2CLVA 4G80B 3DSFL 4I9WD 4PJDF 1OP5K 5EU6B 4ZAKC 4NBXB 1I9RL 5GISH 1BOGB 1EO5A 1EDQA 3WS3A 3GDBA 4Q9QL 3T0EB 2EICA 4M5YH 4CVXA 5H2BB 4HLJA 5AD0B 4N8PA 1MAKA 1HN1A 4KHXH 1J8KA 2X70B 2R2CA 3EFFA 1AD9A 1HKFA 3MOAH 2I07B 4JRXE 5I76B 1LGVA 1MHHB 4X4YA 2YD6A 3TWCH 4EI5C 1DDHA 1I1AC 2R0LL 2R2BA 1OAUL 3SDDD 1WVZA 4JKMA 4ZOAA 5MHSE 1YEDB 1YEJL 3UJTL 1ZEAL 4L3AA 2AV1A 3ULSA 4HC1A 3SE3A 1P4LA 2H32A 5CSZB 35C8L 3RVVD 2ZG3A 4PJHE 4PJ7F 1KJ3L 2E7BA 4TULH 3I3DA 1HQRB 2P5WD 5FF6A 3PDDA 4X5XB 3F6IA 4YHKH 2VC2H 4WW2B 3DRQA 4WUKL 1UWEH 4EEEA 5E5MA 4PJFB 2PCPA 3CH1B 3P77A 3WUWB 1A14H 1F42A 3FZUC 3MRHA 2AW2A 2H9GA 3H9YA 1TZGL 4IRZL 1WTGT 5CWSB 1BIIB 4MD4A 1CFSB 4KDWA 4O9HL 3QFJE 4EDXB 1RULL 1S9KC 3KLHC 5AWNH 4IEFB 1VHPA 4YXLL 5GRVK 3LKOA 3SCMB 2CO6B 4APQB 3G6AA 3RIFF 2CKBH 1T4KB 5DJ0A 3LS5L 2F53D 2BMKA 3HR6A 2FR4A 1A6TA 3QWRA 3INUL 2NQCA 4IMLA 5DA0B 3HI6H 3L3OB 5ILTL 2OLDA 4N5EC 3RU8H 1BVKA 1G7IA 1T1WB 1Z5LB 2YPLB 1YYLH 4Y88A 4H5SB 3LV3B 2DMBA 4RZCB 1I75A 5T5NG 3T4YB 2VOTA 3QO1A 4BK5A 4MMZC 2YPVH 1VACA 5IIEB 3NCFB 2O5ZH 5KVFH 5DMYA 1DBML 5GZOD 1SY6H 1X5AA 5BS0E 5HHVL 1U8LA 4UTAH 1I1FA 3GMOA 3LHPL 2X9YA 4XBEH 2E9IA 1CF8L 3HC4H 5FM8A 3VWKC 3BKMH 1FGVH 4UNUA 3C60D 5BW7C 5E8NB 2H2SC 3FOLA 3O41B 4M48L 1T20B 3VXSA 1UQSB 4LVEA 2B1AL 5TE7H 5I75B 1FPTH 4EZMA 4WI4A 4MAYD 5CJQL 4JFEB 3PP4L 4F7EB 4KV5E 4ZYKB 3KPSE 5B3JF 3LS4L 3DJ9A 2DWEB 5I18H 2RHEA 4BH8B 1FSKC 1CIUA 4OGAD 4Y16B 5INDB 4KQ3L 1YN6B 3TT3H 3GMNA 1ZHKA 2HRPL 1GSMA 1OAXH 4ZPVB 1QR1A 3FQRA 1TQBB 4YXHL 4PJFF 3FB8B 3BEVB 1RUML 5CHNB 4G8EB 5GRJH 1B4RA 2I9TA 4RRPA 2K3TA 2XQYK 4PRAB 1HWHB 4K8RL 4QRSB 1GC1C 4OLEA 4YBLC 3ZE0E 4JHZA 4YGVA 4MA7H 1C5DA 1CK0H 1M71A 3M8OH 2UYLB 1MFEH 4WWKC 5F7FA 2P47B 5DD1L 3P30L 5E6ZA 1IBGL 4NO0B 1U8NA 4H88L 4RNRB 4U1SA 2FD6L 4GUPA 4BFEA 4UUJB 3EYQC 5HJ3A 4OI8A 2EZ0C 5B3NA 1IC1A 3SDDA 4U4BA 3ECBA 3VI4E 3G6DL 2VAAB 1S3KH 1G7MA 4LF3A 4A2MA 5DD5L 4ETYA 4ACPA 4MNHB 1FNSH 2VZ1A 5DUMH 5IFJA 5I8CA 5I74B 4NYLB 3ULUE 4G8IB 4J8RA 4YHLH 3KVQA 1PDKA 2AK4E 2VDPH 3O4LE 5DJZA 2VNCA 2OR9H 4OF0A 4RMQA 1LO3H 5ANMA 2NW2A 1JF1A 2VLJD 3EYVA 4TPRH 3QUMB 4NNPL 3IFNL 3Q6GH 5DFVD 1GIGL 4G6KH 1HZHL 4U6VH 4YHMH 2BC4B 1SEBA 2C1PB 1C16B 1D5ZA 2GSGA 4ENEC 2ZSWA 1N26A 2J4WL 3RJDA 1WBZB 2XPGB 2PR4L 2HT4C 5EC2B 1LDPH 5EU3A 3GSQB 4PGBA 4BZ1L 1YQVL 3QG7H 5GGRY 5I15H 1MHEA 2YD2A 2DD8L 3L7FA 1X5HA 3S5LA 1ULVA 4L9LB 4XXDA 1WV7T 2FGWL 4HUKB 3MCLL 5JHDA 5IW3A 3KPLB 1RZJC 2EYRB 2F53A 4RMTA 2O61A 5DD6B 1MCCA 1J8HE 4KDTA 3TBYA 2VLME 4QHUB 1TTFA 1KLUA 1A3LL 2Q20A 5I9QC 1OAYH 3NIDE 3ROLA 5IQ7H 4R8WH 3O4OB 5D5MB 4ORGA 2R0KL 3MBED 4NKMB 3STBA 3SE8H 1K2DB 2GSIB 2VQ1B 2BNQB 5F89A 1I85A 2VWEE 4U1HB 4HUMB 2AEQL 1CICD 4HV8A 3TZVD 1L7IH 1AR1D 4MLIA 3LQMA 3TH4T 4HLZH 1JGVL 3QUXC 4NHCL 4O2CB 4ZNCD 5CGYD 3EDDA 3NGBC 4LVOB 3F7PC 5HI3C 3U7YH 4KHTH 4YNYA 4KZEH 2ZJSH 3BT2H 2BOCB 4CW1B 1OGAE 4MGXA 1MF2L 5I1HH 4ISVB 4I13B 3BISA 5BJTB 1B4JH 1R5IB 1EIBA 4X6BA 3WIHL 4WEBL 2BHYA 3C60A 1L4IA 3F58H 3VH8B 2IADB 3S8WA 4OLWH 1IM9A 1UT9A 1O0VA 2AJXH 4OFPA 1DVFC 3ZYJA 4XNYL 1KLGB 1Z6JT 1CN4A 1IGYB 5SV3A 5D1ZB 5DRNA 4HZLB 4JVPA 3T1WA 4KTYA 3ZHKA 1Y0LA 5F7DA 1Y6KR 5B4MC 4LSPH 3B5GA 1WCQA 2XTLA 4K71C 5ESAB 3ZHDA 4TSAH 5AAWA 4NZUH 1JYXA 1FL5A 5CZVH 3BDXA 5C07B 4KRPD 2Y5TB 1QPXA 1JUFA 4FXLA 4I8DA 5C1MB 3HUJA 2DLEA 3FCTB 3G9VA 4X6FB 5CMAB 1XZ0A 5KG9A 3HCVA 2E9BA 4LLVB 5D6CB 3WDIA 2EIEA 5HD8C 4D0BB 4P49A 2VJXA 1II4E 3FJTA 5I1JH 4S1DD 4WV1A 4KAQH 4NQVA 4YZFE 3L3DA 1HHKA 1VFBB 4G9FA 3LN9A 2MKWA 4YUEL 4K3JL 1IZKA 2J88L 1CBVL 1V7NL 4GBXD 4NBYB 1FCCA 4U1LA 5T3XH 1UJ3C 2OQJA 1OARL 4OD1L 3EOTH 4YIQA 2GJ6B 2CSPA 3ZSTA 2MHAB 5D5MF 4UV7L 1JK8B 4POZC 1ES0B 4NT6B 2P42B 3QULB 2KDGA 3MRQA 2IGFH 4MCZA 3BPNB 1ODAA 3FL7A 4EN3C 4P23D 4HJJL 1EAJA 1CGSL 4OCLC 4WDIA 1QRNA 3ZYZA 4YPGB 5ENWB 4X6CA 4JRYE 2QHRL 3JXAA 3QDMD 1UKQA 1U42A 3QH3A 3X12A 3CVHH 4PJ5E 2VIRB 3AAZA 1XF3A 25C8L 1UYWH 4HCRA 3O9WD 2A9ML 43CAA 4X80L 1LO0H 3MXWH 4JN2A 2XACC 4CU8A 3GJFB 3FB7A 4DOHE 3SJVB 4P5KB 1IKNC 4HWZA 3TN0B 3BWUC 4FFWD 1D5BB 4B7IA 3SDCA 5B8CA 4G7YH 1Q9OA 1ZWIB 3QEUB 5DA4A 1NDMA 3R0MA 2VL5A 5EUOF 3WEXB 3HFML 4G6ML 3EYUH 2NY3B 3FHAA 3WL9A 5GJSL 4M6ML 4DEPB 4G3YH 4L8SA 1AKJD 1HWGB 1UM4H 2VQTA 5GS3A 4WUUD 4F58L 3RWJB 1MJUH 4S1SH 3B2UC 4P0DA 1MRCL 3HG1B 3TZVA 4G5ZH 1QSZA 1KEGL 5GIRB 2FJFB 4GMTH 1CT8B 4C56E 1QACA 3IDIB 1FZMB 2XY1A 2OL3A 3BVNA 2HJLB 4HPYL 5FFLA 1BQUA 3L7EA 3MLUH 3MR9A 1U6AL 4M1CD 4DUXA 5TE4L 1LE5A 3A67L 5GS0C 1KELH 1FBIH 4Y19B 1VERA 4DKEL 2QEJA 2X4QA 4XXCA 3PV7A 4OTXL 4AMKH 4B0MM 5DQDL 5E7BA 1WBYB 5BZDA 4URTB 1QO3A 3EO9L 3U30C 1CGUA 2P5EB 2AXFA 5HYJD 2DQGL 2F19H 2Y06H 5EOQL 3A6BH 2JJTC 1BPVA 4TOYH 4GKNB 5E7FA 4BQCA 5TDOA 3KAAA 4PJEE 2YZ1A 4GS7B 5ELIA 5E2TH 1RVFL 4EQ3A 3WHXB 5DEFA 1YEIL 1RZIB 1ZT1A 1M1SA 4FFYH 2I27N 1E4XL 3DUUB 3SPVA 1NAML 2BVPB 4RFOH 3VG9C 3AB0C 5I6XB 1OCWH 4UU9A 3QUKB 3I9GL 1WZ1L 4LPTA 5SX5H 2DB8A 5L2JB 1HEZB 1UKTA 1IC7L 1QSED 1G7LA 2ESVB 4F7TB 4UMGA 3QDGD 2WBJD 3QR2A 5I1DA 2VDNH 3VFTB 1RIUL 1MCPH 4OZIB 5DJYA 4HXAH 3PF2A 5TH2B 2CD0A 4GBXA 2APTA 2OJEB 4PRNA 1RHHA 1YMMB 1E6OL 2XYCA 5ERWA 3V9FA 3CLFH 4XAWL 5ISZB 1CQYA 2FJGB 3S96A 5J9PA 1G1YA 1FNGA 3MLTA 2SEBB 3N85H 1F6AB 3GMQA 3RPKA 4OJFL 3OKKB 4GRLD 1MAMH 2CKBA 2D0FA 5IG7B 3V2AR 4CAGA 3RWEA 3QB7C 4Z8FL 5HDBF 1NGYB 2W60B 1JHKH 2PO6B 4P23A 3BKYH 3HI1B 3QXAA 1MQKL 1X5KA 3DPBA 4R4BB 1J1PL 3P40A 1IL1A 3NCBB 5E99H 4LAQH 3S35H 4HGMA 2BRRH 3QDMA 4OCXH 1KJVA 4EI5D 4QRUB 1I1AD 2XN9B 2IC2A 1I7ZB 4NQDD 5GGRA 3ARZA 1MCWM 3IB4A 1JWSA 4JY6B 5BRZE 2A6JA 1V3LA 3G04B 4O2EB 3QQ3A 5L2KA 4RAUB 1UM5H 3V52L 2NY5C 1F4HA 2EDOA 2IPTH 2Y36H 2JK5A 1NUNB 2BFVL 1ZLVH 1SY6A 4RSVA 3D9AH 12E8H 4XVSH 3GFUA 4AM0B 3OKMB 4IOFC 3DHMA 3F5WB 3L5HA 4WFHE 2XNAB 3FO1A 4LDLB 3TPUA 5I30H 3QRFM 1P7KB 3FZUD 4FZEH 5EFIA 2K7QA 4X83A 4FQXB 5E6IB 1V3KA 5E9DE 4M8QA 5EIIB 5C8JB 4WO4A 4H1LB 2P43B 4I1NB 3P4NA 2LABA 3MUHL 1C12B 4NZDA 1CG9B 5HPMA 4GG8B 3KLHD 2L0DA 5IVXF 3TYFA 1QFWM 3IDMB 2V2TB 2R9HC 1GPOH 4UILL 3BDYL 4BELD 1QNZL 5CJ8A 1IGML 1VFUA 1NLDL 3HZVB 1JGEA 4O02H 5ICXA 3VXRB 5DJ2A 4I3SH 2MPAL 5BO1L 3IVKA 4X7SH 3V0VB 1JTTA 1CGVA 3FRUB 4N5ED 1K8IA 5CEYA 1NFKA 4RQQA 4ERSH 1WQVT 4Z7VA 5HYJA 1FDLL 3U4BH 4AH2B 4XPGL 1NPUA 2N7BA 15C8L 3TP4A 3WS6C 4AIZA 3D18B 4ZPTA 3WHE1 3B9KA 3FFCE 2DBLH 1S9VB 2AJSL 1ZLUH 4EVNB 4FN0A 4Y5XB 3GUTA 5DURB 1OQXA 3ALWA 5T3XD 3BI9X 1T0NA 5LGHL 5E4IA 1ZT4B 1W0WB 1PQZB 1VADA 3GGWA 5ESVA 3VWKD 2V2XB 4QOKD 2VLRB 2FWOB 1HNGA 4ZSOB 1IAIL 4N0YH 2AJZA 2H2SD 5F7WC 2HJFB 1QFOA 1J1XL 2Y6SC 1UCTA 2EH7L 4XI5C 3PHOB 4YO0A 2AJYL 1G84A 4ZODA 2XWTA 3KPOA 2CLRB 4LPCA 5EPMB 5EC1B 4RGND 2ZUWA 5TJWK 4X7CC 1NC4D 2O5XH 4LQFL 4HKBB 5DJAB 5C0DA 4LIQH 3UTQB 3DTXB 3GI8H 5F9JB 3M17A 3H0TA 3MV7D 5CP7B 1PJ9A 4P57A 3KYKL 3NH7H 5KS9E 1IEBB 2DKUA 3KXFE 3HZMA 4P3CH 5EWIL 2ARJQ 5IROC 3QT2A 4XMPH 1U3JA 1S9WA 3QUMH 5L6YH 2XTJE 2QSCL 4WY7H 4KK9C 1HKLL 1CD9B 4GRLA 4X7TB 1A1MB 5DK0A 2LU7A 3MNWB 2GJZA 4L4VE 4MB4A 3DSNA 1DBAL 4UBDC 4Y0GA 4LP5A 2ARJA 5C0AB 5GRXG 1ZVHA 2F74A 4IHOB 4LSVH 3CMOH 1J86A 2GTZB 3S9DB 1ACYL 3PGDB 5IEKB 3NN8B 3X3FL 2EZ0D 2FYYB 4U6YA 1E6JH 4F7CB 1S8DB 2BCKB 1KJ2B 3C9NA 3O0RH 3TIDB 2LU4A 4FTVD 3G5YB 3WLBA 2VUYA 4QHMB 1WAAA 1T1ZA 4C83A 2OZ4H 3MLRL 3B9DA 4PRHD 3FAXA 2VXQH 3LEVL 2MCPL 4JDTH 4NFCA 3KLDA 1NC2B 3BXNB 3HC3L 3P9MB 2VXSH 2DLGA 2OK0L 3IAGC 4NDMB 2HMIC 1W0VA 2QR0B 2PF6A 5F6IC 4GMSL 3CD4A 2EYSB 4R2GB 4PJBE 3NA9H 1ZHLB 3KR3H 1CE6B 5C0GA 4ENED 5DK3A 1J11A 5DDHB 4YHNB 2LE9A 1BEYH 5JTWA 2HT4D 4GAGL 3JUYA 5FDWB 4N0FB 5EU6D 4YHOH 4XC3L 2X4UB 3F65A 4YXKH 4JFXA 4FNLH 5IFHL 1C1EL 1EVTC 3ULVE 2N7AA 3CFBB 3RIFK 1H0DA 3MQIA 5T1KA 4JY5H 1NGPH 3GSVB 1PSKL 2LVCA 1MCFA 4KVNL 4EXPX 3PDOB 1GGCL 4Y4KD 1X4ZA 4WI5A 4ZUSB 4QYOB 1T7ZA 2V2WB 4FQHB 3ALXA 1NGQL 3RAJL 4MQ7A 5CGMA 4LLMA 2QQNL 3S3SA 2VSCA 2D31B 2ADFH 3LH2H 5HI3D 3EDKA 3SBWC 5I8EB 5EZLB 2R8SL 4OD2A 3K4DA 3PL6A 4YHPA 5JA9A 2BVQB 4NN6B 5SWSD 4EUPG 3CFIC 3VWKA 1DEDA 1FRGH 2AJVL 2UZXB 4L4TB 4QOKA 1U92B 5GGSA 1QD0A 3GKWH 4PJAA 1I9IH 4Y1AA 5SX5K 2WW8A 2AS5M 2FX9H 1ROWA 3O6FC 2DI9A 1DQDH 1RZFH 3FQWB 2I9LB 1DVFD 1JFQH 2FDBP 4DZBB 5I8OL 5HVHC 3RWDA 4ZAKB 1RIHL 1YNLL 2OMNA 2WUBH 2FEDC 1NC4A 1QLEH 4KQ4L 2DDQH 4V2BA 4P2YA 3L1OH 3C5SB 5B4MD 4H8WC 4OB5L 4DZ8B 1FFQA 3CVHA 1ADQL 4LKCA 1S9YB 1CLYH 3WLWD 3AUVA 1NH6A 2V17L 1X7QB 1C08B 5FHAL 3HC0B 5FKAB 2DQIL 2ICEA 4OKDA 3X11B 3BEWB 3LPGA 1KPRA 3BP6B 4PJCB 3RNQA 4PJ7A 1OTSC 3W9EA 2GIYA 4UIKH 5JW4Q 3OKYA 3E6HB 4BSVA 5HGBB 3GJFH 3IKCA 1N64H 3TO4C 1A6PA 5BXFA 1FL3A 3A6OA 3KS0H 1L9MA 1T21B 1YNTB 2X4PA 5F8RC 1FG9C 1DUZB 4NUGH 4ZFZA 3VXUB 3ZSSA 1R5VB 4KMTH 2GT9B 3HZKA 2YC1A 4OLYH 5SWZB 3C5ZA 1UXSA 1YJDC 4Q9RL 3E3QC 3IXTB 1Q9KB 2A38A 1ZLVK 1AXSB 4JZOA 1GRWA 4K23H 4EN3D 1NANI 3O6KL 4JFOB 3QA3A 3IDJB 5FA3A 2EDWA 4LLWA 5IF0B 5H35A 5IWLC 2EDFA 2Z35A 2DJUA 3U0WH 4G6FD 2BY0A 4M9PA 5L7XH 2FLBT 2HKHL 3WIFA 2MCG1 2E7LC 5CSGA 5C0CB 4KC3B 4MD0B 1NANH 2A6IB 2DQUH 2VDRL 1WSST 5DSCA 1PYWB 4H20L 2OXHA 3IFLL 5EU6A 3JV6A 1VEPA 4HS3A 4IMKA 3O8XB 2J1KA 5FYJH 1KFAH 2X70A 1NAKH 2EKSA 2J2ZA 3EJZC 4BFBD 4ESKA 5K9JL 4UTBH 4QRRE 2EE2A 4J6RH 2JELL 3C5JB 1KTKE 1AC0A 1FJ1B 3MUY1 5DC0A 5EA0H 1MHHA 3SDXF 4KZDH 4Y4KA 1JCKA 2V5RA 3T0XA 4OCWH 4TVPH 1MFCH 3B2UD 3DXAD 4XP5L 2D7QA 3U46B 2NY2B 4WEUD 1YEDA 5FYLL 5EH1A 2X1QA 4NJAL 3D85D 3MLPA 1ONQB 3BJLA 5CSZA 3EFDH 4PJCF 4G8GD 3MSPA 3O2DL 1ZLUK 1XGYL 1YNKH 3S35X 5JIPA 1T7VA 3LRSB 1Z3GL 1PLGL 4NO5B 3J7HA 1NL0L 4X5XA 4MA8L 2VDQH 4TSCH 1DBBH 4WW2A 3S98A 5C08E 1S5HB 5SWSA 7FABH 1OHQA 4RDQG 4PJFA 5BVJB 1AIFB 3CH1A 4MA1C 4WRLA 4KI5E 4AENA 4YPJA 1M05A 5GSRB 1JV5A 5T33H 3DV6B 4PGEB 4LK4A 1SJHB 4HKZB 5CWSA 1BIIA 2O5YH 1JN6B 1YYMH 4EDXA 2F9BT 1YEHL 2HH0L 2CRYA 4YR6B 5MI0C 3SCMA 4APQA 1A3RL 1N7ML 1FO0L 2YSSB 3P73B 1AGDA 4YDLC 4WWKB 5DMGC 4GRWH 4ONGH 4MXVF 3FB6B 1J88A 4KTDL 5IUSA 5DLMH 3W0WE 3WKNA 4Z7OF 4AY0A 1PD6A 3F7RA 1HXMB 5CKAA 2DMCA 3KLSA 2VABA 1U3YA 3ZKXC 3EDFA 5FGBA 1TQCB 2BNRB 4BSJA 3WSQL 5JXAH 1JTOA 5EO9A 5MP6L 1CDCA 5T3ZH 2CK2A 2GK0B 1T1WA 3DVGB 3QXUA 2YPLA 1DN0B 4H5SA 3LV3A 4RZCA 4ZUVB 5IBTH 3T4YA 3ZMRA 4U7MA 2CXGA 3GO1L 3BH9B 1TJIH 2BJMH 3EZ8A 5IIEA 3U0PB 3VRLE 3MZTA 3SGJC 1TVBB 2ATKB 1TPXC 1BREA 3EO1A 1TMCB 5DVMA 3EOAB 2VXUL 3QEGL 4R7NB 5ITBH 4XP4L 5IB4B 4LSSH 4F7MA 4JQVC 2OYPA 4HIHB 5E8NA 4HPOH 4P4KC 6FABH 1T20A 1PGRB 3GIZH 3D3VD 5E03A 1UQSA 1JVKA 5I1KL 1I1RA 5I1CL 5I1IH 4M6AA 1A7RL 4LEXH 5C86A 2NY0B 2CUHA 4PRPD 2DWEA 1JPGB 1MI5D 2BP3A 1CR9H 4GRMB 1NFIA 2DQDL 3OZ9L 1JHTA 5INDA 3L3IB 2C3GA 3QEQD 4NWTL 3SDYH 3D39B 5D7LD 1R3LA 2MQCA 5C0FA 1DLHB 4ZPVA 4WGVB 5DR5H 1S9XB 3MV8B 3FB8A 3BEVA 4UT6H 5I9QB 1NFDA 5CEZL 4MXWL 1QBLL 1OD7A 1AFVL 1IQWH 1F6FB 3W39B 2D2OA 2VDKH 3IT8D 4UDUB 4JAMB 3N1QC 1E4KC 2UYLA 3VFRA 4JO2L 4PJXE 1P6AB 4JZNA 4X6EA 4J2XA 3QUXB 4GAYA 4NO0A 4RNRA 1FLTX 3FT2B 3NGBB 2NXYC 4P2QD 4UUJA 1F90L 1KENH 4Z0BH 4MHHI 1JZ4A 1P53A 1XF2A 1LO2L 2ZNWA 5LAXB 4ODVL 2FECI 3GIVB 3O6MH 4JE4B 4RWHA 2VAAA 3DI2B 5EOCH 4M1GH 1OD9A 4NIKB 2R9HD 3D85A 1BOYA 4MNHA 4G8GA 2YKLH 3LEYL 4G8IA 4BFIB 5JOFB 1FYTD 5ADPH 1I7RA 1R3IH 2J6EH 4M02A 2XI9A 4K9EL 2Q1EA 4OFYD 1MPAH 4NHUB 2DQHH 2HKFH 5LCVL 5LQBH 3PWUB 4CMMB 3V4VH 2R2EB 4P9HL 3PV6B 3QUMA 3MOBH 3T0BA 1VPOH 4W70A 2BC4A 3O2VL 1MFBH 4PRDB 3H42H 1EPFA 3P9LA 2XPGA 3ROOB 4FFVC 5EC2A 3GSQA 3CGTA 3SKOB 5B39A 3EGSB 1G9NH 4L9LA 2D0HA 3EHBC 3PWNB 1LDSA 4WI3A 2EYRA 3KPLA 3H9SB 3RIAF 1P5UA 2EIZB 3ULUC 4D3CH 2OTUB 5CGTA 1T1YB 2OZ4A 4BQ8A 3VXSE 4OZHB 4NKMA 5IEHB 2YRZA 1FN4B 4XI5D 2GSIA 2FGZA 2VQ1A 2G60L 2XA8H 3NZHL 1JF5A 4EOWL 4U1HA 2X9WA 4XP9H 3K4ZA 4JM2C 4Q9BA 3UEZA 5GXBB 1B0RB 4O2CA 5E8OB 3GJFK 3BPCB 4U1IB 4X98B 1LEGB 2BOCA 5JPMA 1ED3A 4RWYH 4CW1A 3MRJB 4ISVA 4GKSB 4TNWK 2XWBA 3V4PH 1RMFL 1R5IA 4J3OC 4NNYB 3L3JB 3ZKQD 3VH8A 4ZUTB 1HK6A 2IADA 5FYJD 3D3VA 3H9ZA 2PUQT 4BJLA 4PYHA 3KJ4C 5FOJA 1A5FH 1AI1L 5EO0B 3WJJC 4UBDD 3LZFL 2KQNA 2R1YA 3ARFB 1KLGA 2X09A 3MNZB 2GK2A 2XKUA 4HH9B 4HZLA 2YD5A 3THMH 3KYMB 5HHPB 1HINH 5KOVC 3RBGA 2EO1A 3W2DL 5C6TL 4HXBH 4KK8C 5E8PB 5ESAA 1GGBL 4TVPD 3MC0A 2IH1B 8FABB 1LO5B 4FQQB 3FB5A 5JUEL 1BFOB 2FBJL 3PWJA 4I3RL 3FCTA 3WJLC 1YQ2A 5CMAA 3TNMA 3WD5L 1P1ZB 4LLDB 4ORZC 4JG1L 1BVLB 4D0BA 2PXYC 4WFFE 2HMID 4LARL 5FO9B 4P46B 3PJSB 3C87A 4OZFH 3EJYC 2ICWB 3P0VL 5JMOC 5LGKA 5FCSH 4JHWH 3HLAB 5D1XB 2NXZC 4O5LH 2X1OA 2FATH 3H9HB 1H3PH 1B9ZA 2X2YA 3EDEA 3MLXH 4R97B 5D1QB 3GRWL 5GRYA 2GCYB 2AV7B 2MHAA 1GAFH 1J9CT 1VEOA 2C3VB 4OZHF 1MCDA 1JK8A 3DUSA 4NT6A