1ACYH

Crystal structure of the principal neutralizing site of hiv-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
b'QVKLQESGPAVIKPSQSLSLTCIVSGFSITRTNYCWHWIRQAPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLISVTNEDTAMYYCSRENHMYETYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 59.1 FAB (LIGHT CHAIN)
publication title Crystal structure of the principal neutralization site of HIV-1.
pubmed rcsb
source organism Mus musculus
molecule tags Complex(antibody/hiv-1 fragment)
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH01
1MFAL 4P57B 4D9LH 2FL5A 4KDWA 5IGXL 4NYLA 4GXUN 1T1WA 1X5LA 3FFCA 4HEPG 4XVSL 1YEDA 4JFDA 5DK2B 4RGOH 1PGRB 2E27H 1J8HD 1EMTL 4UB0L 2Y5EA 5DD6A 5ADPL 1PJ9A 2E7LA 1IGCH 1I7TA 2C1PB 2GT9B 2X4QB 4V1DE 1XIWB 3LS4L 1RVFL 5JHLH 5D2NA 5EDXA 3DXAA 4MX7A 4ZPVA 1JNHA 4D9LL 4MMXC 5IKCA 4OM0H 2DYPA 2JB5L 2BC4A 2E27L 1RZ7L 1HYSC 3OKMB 4ODSH 1DBAH 4Y16A 5DJ0A 1IGCL 4IIQB 3OB8A 1JBJA 1N5YL 4PLJC 5JHLL 2I24N 3QIUB 4UOW1 4HHAA 2VIRB 1X44A 4S1QL 1P1ZB 2FL5B 3OKYA 1N3NA 2NY1B 2XKSA 4NYLB 1T1WB 1ZV5A 3FFCB 2HKHH 4JFDB 4WI8A 1X5FA 4MAYA 3GSRB 2ZNWA 3HE6B 3VFOA 2C3VB 4ODSL 1DBAL 5DZNA 1NFDE 1S9XA 3QUKA 4WTXA 3RUGA 4M8QA 5T1KA 3MV8D 1NGWA 3CLFH 1I7TB 4Y5VC 2AW2A 2B1AH 2E8YA 4Q9QH 3SCMD 5SV3A 2KKQA 3DXAB 3SE4A 4MX7B 4ZPVB 1JNHB 1AQKH 1OL0A 2OCFD 2V5RA 3V0WH 1V3KA 2HKHL 3D2UD 4MYWB 1IM3B 1U8PA 4PJ9B 4O51B 4RAUB 3VXUD 1IM9D 4NZDA 3V6OA 1R0AH 2CGRH 3K8KA 4F3FA 1IAII 4YFEA 5DJ0B 3CLFL 1T0MB 4U6HA 5HHME 1P6FA 2B1AL 1MI5E 4Q9QL 3DUUA 4NC1C 3JBG7 4J4PA 4JFFA 4HHAB 2XN9E 1AQKL 3N0PB 3V0WL 1BX2B 1FH5H 3LEVH 4XPAH 3TFKD 1S9YA 5GRJH 1CE1H 1IL1A 1DJSA 3HPJA 3A6CH 3F12B 4HS8H 3TA3D 1TETH 1R0AL 2CGRL 2G60H 1MCEA 5IQ7H 3RUGB 1JI1A 1JHKH 1HWHB 1NDMB 2C3XA 5T1KB 3ZSSA 4XHJD 1ZT1A 1NGWB 4UDUA 5JHDD 1JFQH 4PRIA 4YGAB 5E5MA 2OK0L 2AP2A 5FF6A 3RJDA 2EDXA 5CP3H 3LEVL 1KLGA 2XT1B 3HZYA 4PJ7B 3MNVB 3LAFA 4HT1H 4HBQA 1CE1L 2B5IB 3RU8H 4P9HH 3A6CL 1U8PB 3NPSB 1TETL 2J88H 1ZGLA 1DVFC 1HOCA 2G60L 4XMLH 1SJXA 2VOTA 3N1PC 1JHKL 4U1MA 4U6HB 4APQD 2BX5A 4TUJA 1JFQL 3VI4F 1UM4H 3DUUB 3HI6H 3O4LD 1NLBH 1I8LA 4JFFB 1V5JA 4HT1L 3UP1A 1RPQA 2E5EA 3RU8L 4DN4H 4UI2A 3HPJB 2J88L 4XMLL 3I9GH 5MEND 1UYWH 1QLFA 3EYOA 4LPWA 2AJUH 4U2YA 4EOWL 4Y2DD 3MJ7B 1UM4L 3HI6L 5E1HB 3BP7A 1NLBL 4BFIB 4Q6IB 4PRIB 2JJSA 3W81A 3TBWB 3AY4A 4FTVB 2E3VA 4NN5C 5E5MB 1FNLA 2I5YH 3FRUA 3PWLA 1KLGB 3TN0D 4PJEF 4KDTC 1CD1A 3RVXC 5INDB 3EDDA 2ICWI 4G5ZL 4DN4L 4Y4FA 1I1AD 1T21A 2OJEA 2D2OA 2ZKHH 4ZFOL 2A83A 4M7ZB 4Y5YC 1UYWL 4U1MB 2AJUL 1AGDA 1AHWC 3ESUF 3B3IB 2IBZX 5E6IA 1DANU 1G6RB 4HG4J 1DBMH 5IBUB 2I5YL 3EJJX 1QLRB 2Q7YA 1I85C 4X9BA 3S37H 3QQ3A 5FAAA 3GSNB 4HGKC 2VISA 2YK1H 1FYHB 3E2HC 2DDQL 4LF3A 4RX4A 1QRND 4JKPL 3V7MA 1Z5LA 1NFIA 4WW2A 2Z8WC 3ZT7A 3M1BA 4DOHE 1BFVH 3QXVA 5DJYA 5EZOH 4NBXB 3S37L 1VADA 1CD1B 4NP4H 2YK1L 4QYOB 3PDDA 2VTFA 1M7DA 4LHUD 3RNKA 3U48A 2OJEB 4P5TC 3R1GH 3VWKA 5DF0A 5BJTA 3TJHC 4EN3B 1IFHH 5C92A 5E6IB 3MJGX 1H8SA 1HHJA 1JV5A 4OLUH 2BRRH 5F89B 3PG2A 3KPSB 3WDJA 5FCSH 3DGCR 1BFVL 5JW4M 1AGFA 3WJJC 5EZOL 2Q7YB 4CAGA 5IVXF 5HTSA 1FFPA 3WKML 1BBDH 3HNVH 3QQ3B 1DDHA 3SDAD 2VISB 2DLGA 4LF3B 4QY8A 4HS6A 4X7TA 5DQ9A 1IFHL 3HB3D 3B6SA 4XNXH 2E7LC 4OLUL 2BRRL 3EYQD 4MB3A 1T1ZA 1NFIB 4WW2B 4AY0A 3VD3A 5D2NC 1NMBH 2CH8A 1IGYA 4XP9H 4QHUB 3P2TA 2EZ0D 3TT1H 3ZKMD 1BBDL 3HNVL 2X4OA 1VADB 3VGGA 2WK2A 1M7DB 3WJLA 3RNKB 1CGWA 5C09E 5GPRA 3V79C 4ORGA 5DRNA 5DD0L 3VWKB 3O6ML 5DFVC 1UWXK 5KSAD 1BM3H 4LCWD 2ICWB 2P5WA 4XNXL 4K7PH 2DBLH 2B2XH 3RL2B 1I3VA 3KPLA 1OAUH 5C0CE 1PY9A 2VKXA 1NMBL 4L4TE 5GSVB 3TT1L 3E3QC 2WIIA 4NQDD 1FFPB 2FBJH 4G7VH 2HTLD 1S78C 3UBXG 5GGRB 4MAYC 4NO3A 4MNGE 3GJEB 1VFAA 4QY8B 3RZCD 3CDGB 2VNCA 4GRWB 4HS6B 4K7PL 5DQ9B 4F9PA 1YY9C 1OHQA 3B6SB 2DBLL 2B2XL 3ZDXE 1OAUL 1T1ZB 3DMMB 4M1DH 1NMCB 2NY0D 3UYRL 1JZ4A 2GIYA 3QUMA 3CUPA 5FM8A 3MRQB 3SE4C 4NZUL 1SM3H 4MD4A 2DQGL 3G04B 2FBJL 1G7PA 2VAJA 3KYKL 4G7VL 3SDCC 4OIIH 2Q3ZA 4JANB 4ORGB 4UILH 5DRNB 4L4VE 2C7UB 4JHAH 4IOIA 1AY1H 3V6OC 1K2DA 3T1FB 2P5WB 2YUXA 3BRGC 5B39G 3OKDB 4M1DL 1U8MB 1XF2A 4C59B 3KPLB 1HSBB 3MRFA 2DD8H 4R4ND 3STBA 4HGWA 1RJLA 3DETC 4X6BA 2BY0A 2CUIA 4ZTOH 4DTGH 4OIIL 4HJJH 1C7SA 5HPOA 4FFWD 5JLZA 1MWAH 2FD6H 4JHAL 1BZ9A 4NO3B 1MPAH 1VFAB 1AY1L 5BRZE 3ELAT 2W92A 1RZKL 4LNVA 1MCWW 3QIWD 3ARBA 1J1PH 2DD8L 4M9OA 1U36A 4WRLA 5GGSA 2Q3AA 3V4PH 2B8OT 2Y9RT 3CUPB 5FYKH 4ZTOL 3MLTA 1G7PB 4HJJL 4M93B 1GAFH 5J89A 4X99B 1MWAL 3HN3A 2FD6L 3FJTA 4BQBA 1MPAL 4KJPD 4IOIB 1RULH 3CZJA 1K2DB 3QCVL 4JPIA 1F3RB 1KELL 4HLZG 1J1PL 1XF2B 1HHGA 3QUYC 4JGMA 2IJ0C 4X6BB 5D71H 4ZQKB 2LTQC 1F6LL 1T7ZA 4JCMA 2Q8AH 5BS0E 1GAFL 1JGDB 3IRZA 2AK4D 5JLZB 5EN2A 2DMBA 2EEAA 5FK9A 2E6JA 3RI5K 3PWNA 1RULL 3IAGC 4BA8A 1UACH 4PUBH 4CJ0A 3C8KB 1S9WA 2QSVA 2F54D 1Y6NR 3DURA 2C1OA 3ARBB 2X9XA 2J5LB 5I0ZA 2Q86A 2WAHA 1Z2KA 5GGSB 2BVOB 3AY4C 4HWEH 4UT6H 1IAMA 3ARGA 1YC7A 5F7LB 4LEXL 5F1KC 3HPLA 1OOAA 2R29H 4Y4FC 2A9MH 3ZYIA 5D1QD 1UACL 3BYYA 1II4E 1M05B 4PUBL 3AAZA 4F37K 1VA9A 4GBXD 3VXRE 2ADGB 3ALWA 2V9TA 1J8KA 2DM4A 5I18H 4HWEL 2I26N 4UT6L 3A0OA 1IEAA 3BKMH 3C5SB 1EJOH 5GS0H 2R29L 5F21B 3LEXA 2FZ3A 5EN2B 5FK9B 9CGTA 4NNXA 3PWNB 4RMRA 4EI6A 3DX7A 4YGVB 2FEDC 1WK0A 5EO1A 5FYJD 5CINL 1S9WB 1VEMA 5TDOB 4BZYA 5MEQA 1ERNA 3BGFC 2Q86B 5I18L 5IBTH 4ALAH 3BKML 1EJOL 1QA9B 3ARGB 5GS0L 3L6FA 5ACLA 1DLFH 3UTSD 2X1OA 3EHBD 4K3JH 2EDQA 5C2BH 4MLIA 3L3HA 3AAZB 3OWEA 3S97C 5MEPA 2R2CA 1IVLA 2YBRA 3IJYB 4KZEH 2NQCA 2Z9TA 4YHOL 2W59A 3ZYJA 5B3JE 3GM0A 3P30H 4AENB 1DLFL 1NGZB 5CEYA 4KMQA 3S3SA 3FFCE 2BOBA 4K3JL 4JFDE 2W91A 5C2BL 1HXMA 3PQYA 2APFA 3QI9A 4HFWA 3SGJC 3K1DA 4DVRH 4NNXB 1LQSR 1OTTC 1WWAX 3DX7B 4J3WA 5FUZL 3P0YH 4KZEL 5F9JB 1P4BH 3BEVB 1P2CA 3DXAE 5JR1H 1IKFL 2OI9C 3JTSB 1CGUA 3L6FB 2AJ3A 4NIKB 2F8OA 4BK4A 2P8LA 1INEH 3DBXB 4DVRL 4ZXBB 1NCUA 5J3HD 2XZCH 3RPKA 3RDTD 1YUHA 4KK8D 3P0YL 1OAYH 5IB4A 2J8OA 5ICZB 2YBRB 1P4BL 2F19H 5F44A 5ESVA 1FAIH 4GG8A 4O00A 3QH3B 5JR1L 3BN3B 4LARH 4FHBD 3IXTA 5CEYB 1JUFA 1INEL 5I66A 5HGAA 1CGXA 1HXMB 4UT9H 2AXGB 2XZCL 3QI9B 4HFWB 2WBKA 4KAQH 4P4KA 3RUGE 5DUPH 3WIIH 2XQYG 3F7YA 1I7UA 1UGNA 1FAIL 3HMXA 1MJ8H 2XY2A 1P2CB 1AI1L 2AK1H 1VENA 2BOCA 3WN5A 3CH1A 5GRXG 4LARL 4PJ7E 3VRLE 2WZPD 4AEFA 1W8NA 1IAIM 2AJ3B 4UT9L 2P8LB 4N8VA 5DUPL 1A6VH 3WIIL 1RUQH 5F8QC 4ELMF 3QFDA 1YUHB 4JG1H 5IB4B 2BDNH 2EYRA 4NSKA 2DTML 3STLA 3VH8G 5ESVB 2AK1L 4JFFE 4MHHG 4V1DD 5AAMA 2X4SB 1P9MA 3B9DA 2HMID 1FSKC 2QQNH 3IXTB 2WQRA 5BVPH 3MRDA 4NRXA 4KPHH 1QKZL 1EA9C 5HGAB 2HRPH 1RUQL 1N6UA 4FRWA 3SO5A 3FQRA 4UUJA 2BDNL 5SWZD 3F7YB 1I7UB 1TVBA 1YECL 2FJFB 2GY7B 2NX5B 4HIIA 4PRIE 3HA0A 4XBGA 3Q3GA 4FTVE 1QO3B 1AGBA 5GSRA 1I1RA 5IJVA 3ULVD 2BVEA 2Z31A 3CH1B 5KS9B 3RVUD 2QQNL 2KPNA 1X6NA 4EUPA 1JGEB 5BV7B 5BVPL 2CRZA 1RZIA 4KPHL 5EBWB 1QSEA 4U1IB 5M94B 3RGVB 1B6DA 2NYYD 2HRPL 1XGYH 3WHE0 3U0WH 3BH9A 4DEPB 4N8VB 3NCMA 1FJ1B 3QFDB 1OP5K 1I8MA 3PXJA 4F57H 2EYRB 4NSKB 1AGEB 4R90H 2HVKA 1NGXB 3IFLL 4PY8J 3W9DA 4KRMB 4WO4A 1OWWA 4LLVA 1RSFA 4ZAKA 1OD9A 4NRXB 4LU5H 3C60D 1XGYL 2JCCB 5C0FB 1JI2A 3AROA 4UDTA 1F4YH 4D0DB 4IEFB 4UUJB 5JPMA 4F57L 1F2XK 4R90L 1TVBB 1NBVH 4HIIB 4KUCF 5CHNA 1B0GB 4XBGB 4ODXA 2FNBA 1MCLA 1MI5D 35C8L 1DLHA 5ID1A 4EUPB 4FZEH 3SDXA 2XN9D 1CICC 1RZIB 4LU5L 5HHVH 1TCRA 1U2HA 2MKWA 3BH9B 1F4YL 2APBA 2DJSA 4PP2A 3VGHA 1LNUA 3TYFB 4F15B 3TIEB 4XX1G 2VQUA 3H0TA 1KCVH 1NBVL 1KJ2H 3KPSE 3JWDH 3TGXA 3MRMA 2EE9A 1P5VA 4NQSA 3V95A 1YQ2A 4LCCB 4WFGE 1ZVHA 4FZEL 4WO4B 4JFYA 1LK2A 4EBQH 5HHVL 3EAKA 3NCCB 5E4EB 1CXEA 1NH6A 2IPKA 4UDTB 5SWQB 2F53A 1FIEA 4J23A 5JPMB 1KCVL 3QDGD 3WLWC 4L1HA 1BLNA 2P49B 3JWDL 2PR4L 3UAJD 4PJHB 2IG2L 3IJHA 4ODXB 2W0LA 5E8NA 3T04D 5ADOH 3QO0A 5ID1B 1A02N 4AH2B 4EBQL 4PREA 2HT2C 3M45A 4WI3A 4JVUA 4XNMA 3VW3H 3SGKA 4PP2B 5EUOF 1JWSA 4NO2A 1UT9A 3LHPH 2W9EH 1CCZA 2DMKA 4TVPD 1NL0H 2IAND 5T1MB 5ADOL 4Q2ZA 1A6TB 1LK2B 4H1LH 2R1WA 3CSYA 1YNLH 4MJ5A 4W6XB 3VW3L 3HAEG 5JDJA 3E6HB 4GRWE 2F53B 3LHPL 3RY5A 2ED8A 2X1WL 5DJAA 4CUCA 1BLNB 3G5VA 1XMWA 1NL0L 3IJHB 3ME0A 3S5LG 5E8NB 2NTSP 2FGZA 5KBNC 2WBJC 5I1KL 5JTWA 2EXWC 3PJSB 4PREB 5D5MA 4S0TD 5DZOA 2D9QB 2GCYA 4XNMB 1EBPA 5DRXA 1J1OL 2P7TA 1F13A 1IC4H 2UUDH 1JWSB 4NO2B 1FGVH 2P5WE 5EBGA 1KPVA 1H3WM 1KLFA 5I8EA 3MUZ1 2FEEI 4K8RD 3IFOA 1A3RH 4HIHB 1PY4A 3BP5A 2R1WB 3KLHC 3CSYB 3G5YA 2VXSL 2FIKA 3F7QA 4Y19B 1IC4L 1MNUH 4Z8FH 3OG6B 2IALA 5HDBE 4U1JA 4P4KC 4Z7UF 4NQCB 3RIFF 5DJAB 4ZPTA 4B0MM 3G5VB 2ORBH 1C5DA 2NNAB 3L3JA 4XAWH 4AT6A 3T2QA 3WN5C 3FTGA 5D5MB 3P9MA 3W5MA 4GRLC 5CCKH 4RGMB 4MJIA 1KXVC 2P7TB 2GKIA 4Z8FL 2HJKA 1TQCC 3T3PF 3IVKA 1KPVB 2X42A 4HKJA 3LD8B 2WP3O 1WZMA 1SYSB 2ORBL 1KACB 4TTDD 3ZO0A 2IH1A 4XAWL 3HG1A 3P40A 5MERA 2FSEA 3MFFA 3VXTB 1P9MC 3GMRA 3MXWH 3QDJB 3D18A 1JTTA 1LE9A 5IJKA 3G5YB 3RHWF 1A1OA 5FO8A 3K8LA 3RTQA 1MRDH 2IALB 4U1JB 2A0LD 3GUTA 5D6CA 1T66D 3T0EA 4PPTA 3WNMA 3RVWC 5E24E 3CVIH 1C5DB 2SEBA 3BZFA 2NY2C 5T1LD 3ZE0F 2Z31C 5C0CD 3FTGB 4DFHA 2AV1B 2ZWLT 1EPFA 3P9MB 3RKDD 4UAOB 3QUXC 1B4RA 4MJIB 4LVHB 3RQ3A 2HH0H 1MRDL 1CN4A 2HJKB 3CFKA 3BVNA 4LOUC 3PWPB 3ARZA 2YD8A 4HKJB 4HPOL 3QUZA 1VGEH 3CVIL 3T1WA 1MJUH 2CK0H 5SX5H 1PQZA 5AD0A 2IH1B 5I75B 3VE0B 4NHCL 3FQUB 5MERB 2FSEB 4OFDA 3MFFB 3S4SA 2MJWA 2OP4H 2ADJA 5D7IB 4UU9A 4CW1A 4ZAKC 1A1OB 3PGFH 1D5BB 5FO8B 2HH0L 4OLYL 1A7PL 1S7RA 4YLQT 4XC1H 3DVFA 4P4RA 3B2UD 4L4VD 3GUTB 4MSWA 5D6CB 4OZIF 5F1IA 4G9DA 1VGEL 2VDRL 3QDMA 2CK0L 5CWSA 2BSSA 4HKBA 2SEBB 1ONQA 3BZFB 1HH9B 5L88L 4YHKL 3EDJA 3M17A 2OP4L 2OL3A 4D9QD 1X5GA 5ALCL 5I74C 4H8WC 2XOTA 1LHZA 3PGFL 4OZ4A 4HH8A 5B8CC 4C4KO 4EKXA 3LKQA 4XC1L 1WBXA 5KVFH 3GO1H 1VKXA 2NY3C 3NIFE 3CFKB 3BVNB 3UPCA 4PJBA 1KCLA 1OGAA 4LSSH 1ZLUH 1QSVA 1HNGA 1S7XA 5BRZD 3OAZK 3WNPA 3FO9A 2JKXA 1GZQB 5FYJH 4G9FB 2P24A 4JGJA 2R69H 2RBLA 5I1JH 3U1SL 4P5KA 2Z35A 1KIQA 4DUXA 4UU9B 2F9BT 5C3LD 1UB5A 2A6DB 2FLBT 4YC2B 3TNMB 4CW1B 1SJHA 3CCHB 5KVFL 5L0QB 3GO1L 3AU1B 1S7RB 3KNBB 1A5FL 1DVFD 1E6OH 3NFPB 3BRDA 3L5WA 4LSSL 4MSWB 1MCIA 5JOFA 5GXBB 5F1IB 1SY6H 4WI5A 5F93C 4KFZC 2EECA 5CWSB 4CVXA 1MELA 2BSSB 4HKBB 1ONQB 1I9RH 5FYJL 1D5IH 2R69L 2XA8H 1WEJH 2OL3B 3UTQA 4LSVH 3FKUS 4HUVA 1DE4B 4X6FB 3MRRB 1FLRH 3LKQB 5I8OH 1NSNH 1WBXB 3WS6C 1E6OL 4PJBB 4QNPE 1A6AB 5EZJB 1GVIA 1SY6L 1OGAB 4HCRL 1S5IH 5C71A 3ARSA 2OXGA 5E8EB 3SGDI 1I9RL 3DROB 3FO9B 1FL3A 3HZKB 1D5IL 2XA8L 1WEJL 2P24B 1IAOA 2QR0A 3K7UA 2FX9H 3OGCB 4LSVL 4P3WA 1OY3B 2FH6A 1UB5B 2NY6C 1FLRL 1AHWB 2GJ6D 1GC1C 4P2QA 3G6JB 1XF4B 1NSNL 1K5NB 1SJHB 1Y6KR 3PL6C 2WP3T 3MRKA 4C56B 5JOFB 2Q20A 1T89A 1NAMH 4XCYA 1MY5A 1G7IA 4HJGB 3REWA 3VXRD 3IDNB 4JE4B 2OTUA 2FH8A 3VCLA 2FX9L 4E9LA 2E9BA 3UTQB 1UVQA 1N2RA 3QYCA 1Q1JL 4JFED 1U8KB 1FYTB 1JPSH 4KRLB 4HUVB 1T83C 2X4TA 4X7CC 5DVKA 3TBYA 3LS5H 1PZ5A 3TV3H 3FQWB 4R7DB 4RFNB 2R4SH 4F80A 2XXMB 1RHHA 1NAML 1MQKH 5E99L 1KB5H 4IMKA 1ZTXH 1D9KC 1L0QA 4LIQE 1XIWD 4HQQH 3WLBB 3T09A 5EOTB 2QR0B 1JPSL 2D0GA 4RBPH 4WFEE 4YFLF 4ODUA 5C0IA 3LS5L 3TV3L 5I30H 3AS3A 3MRKB 4P5TD 4K94C 4NRYB 2R4SL 1OW0A 4XPGH 2NX5E 4DGIH 2CLZB 4H25A 1G9EA 1I7ZA 4HUNB 3EDFA 4LLYA 5KS9E 4HQQL 3REWB 2E7MA 2VDKL 3SY0A 2AEIT 2WWMC 5FOBB 1D3CA 3QIUD 2OTUB 4GOSA 1UVQB 1N2RB 1YY8B 2DM7A 2NY1D 1CDGA 3VXNB 3FFCD 2NPLX 5KTEH 4LFHG 4M43L 4JFDD 1NGPH 1QSZA 1J0KA 1ZA6A 3LIZH 5EU5B 5C0ND 1AR1C 4XPGL 3H9SA 3OXSA 4WU5A 1RHHB 4HUKB 2DKMA 5GS1A 5FXCH 1XCQA 2PW1A 1OP3K 4YX2H 4C4KT 3DXAD 3ULVH 1FN4A 4ZNCD 5CEZH 2JCCE 2DYPD 2GSGB 4G6FB 5F70A 2V9QA 4ODUB 4WTZA 5C0IB 5I1GH 1NFDF 1N26A 4P5MA 5HYSB 5KTEL 5IJKC 5HDQH 3QXDB 1NGPL 1L6XA 3LIZL 5J6GA 3RTQC 3NVQA 1QQDB 4XHQA 2D7MA 4Y16D 3T0EC 4BH8A 4H25B 3NMEA 4U6YA 2DMCA 5D70H 1I7ZB 4LLYB 1K4DA 1G9ML 5B38G 3SY0B 2Y7QA 3ULVL 2AXFA 3KLDA 5EIVA 5CEZL 2VMFA 5CEXA 5I1GL 5K9QI 1YQVH 5HDQL 1MHCB 5GGTA 1CFNA 3BUYA 1A4JB 1ZA6B 5J1TC 2OR8A 3CVHB 3H9SB 1YY9D 1A9BB 3QUZC 3OXSB 4M7LH 5T1KD 1CZ8H 5L8JB 1P84K 4S10A 1JPTH 2PW1B 4GW4B 5LAXB 4MJ2A 1FV1A 3WO4C 1FN4B 3EFFB 1OAXL 1IGML 4P5MB 3WXVH 5A43C 4OI9A 4YHLH 5J6GB 4YHMH 5T3ZE 3HE7A 4PJFB 4M7LL 4ZUSB 4U6YB 2AEPH 2NY4B 1CZ8L 3L3KA 4PJHE 1JPTL 1YN6A 4U05A 4KTEL 3T2PA 2VDML 4J4PD 4JFFD 2Y7QB 4RWHA 4YHIA 4RNRA 1Z9OA 3PIQA 5CEXB 4I77H 3WXVL 1PFCA 4PG9A 1TZHA 3BUYB 1IEBB 2X4NA 1NKRA 2BHZA 3MLWH 4YHML 2AJXH 4JM2C 5TDNA 3S35H 2K7QA 2BCKA 3QIBC 2IAMA 2AEPL 2EO1A 5GZNC 3GJFK 4O5LH 2ERJB 4PRID 1OB1A 1IC7H 2WQ8A 1O7VA 4FTVD 5JO5A 3A6BH 3VWJC 4UTAL 3VFRB 1CQKA 2GAZA 5E6ZA 3R4DA 1WSST 3OAUH 2VAAA 5LWYH 3X11B 1T2QH 1WQVT 2F53E 3MLWL 5KANG 1KSRA 2AJXL 4Y1AB 3BN9C 2FBOJ 3TF7C 4PJEA 3L3KB 4J8RA 4LAJH 1HHKA 1YN6B 1IC7L 1MCCA 3VMOA 5CZKA 2G5BA 1F5WA 4R4FL 1WBZA 3A6BL 4TVPH 1ZLSL 4RNRB 2ICES 1YPZA 3ARRA 5F1OB 3OAUL 2HTKC 3FQNB 3ETBF 3KPPA 5FDYA 5E2UH 3BGMB 2F8XC 3FB7A 1MCSA 4L5FH 3QQ9C 5TDNB 5GGVH 3FRPG 3IB4A 5SX4I 5GGUA 3HR6A 2IAMB 1Z9SA 3PXHA 3T0XA 3EZJB 2ICEB 3NGBB 4KK9C 1OB1B 4U31A 4TVPL 1OT1A 4G8EA 5HI5C 5E2VH 2YPLA 5IQ9A 4LVOC 4Y19E 2GAZB 3U4EA 2VAAB 4XNUL 5E2UL 4Y4FD 1NUGA 1K9TA 4L5FL 4WV1A 1G7MA 4NQCE 5IVOA 4MJ6A 3K1KC 3MV7A 2RCSL 4WEMB 5DYOA 1DBBH 4EN3D 5E6ID 1HHKB 3WFHA 2YMXH 4QWWC 5D5ME 5E2VL 1FZOA 4WFGD 1YPZB 5IMLA 4N1EA 1FCCA 2XTLA 4KI1A 4IMLA 4ZFGL 3BGFB 2QSCL 4MA3A 4AIZA 4WFHE 3V8CA 3NN8B 2E9JA 4A6YH 1U0QA 4RX4D 1DBBL 5IVXA 4FABH 1WFNA 1CL7I 3UTPE 4JPKH 4LSPH 2YMXL 4KGLA 3ULUH 2AI0H 3P3YA 3QDJE 3CFBA 5JIKA 5IEKA 1N5AA 3MSPA 3CD4A 2YPLB 3GKZA 1FO0B 2HFGH 4AL8H 3CLEH 1KIUA 4U6XA 1MRCH 1M6OA 1PG7H 3HHRB 1IILE 1G7MB 4A6YL 4MJ6B 2D0FA 3VWKD 3MV7B 3S7GA 1JPGB 3U7AA 4FABL 5DYOB 1GGCH 1PVHA 4YHYB 4JPKL 4OLXH 3WSQH 4ENED 3I75A 4NPYB 2EDTA 4U0RB 3ULUL 1PX4A 3WFHB 1NPUA 5E9DA 4P3DB 4JB9H 3QQ4A 4X4ME 5IHUH 1GZPB 1FZOB 2I07B 5IMLB 2HFGL 4MJIE 4AL8L 1T80A 5AZEH 3CLEL 3MJ6A 4OI8A 3GSQB 1PG7L 1ZHLB 2H45A 2O5YH 2XQYK 1RIHH 2Q1EA 3BQUA 4AIZB 3PWPE 3QEGH 4PGZA 1YMMA 5TF0A 3WS3A 3VFPB 2IFFH 2WINA 4YDLB 1GGCL 1A6PA 4MDIA 1R5IA 5IVXB 4LRIA 3WSQL 1YEEH 1BREA 4P59H 3EYVA 3MODH 5GS1C 5DVMA 4JB9L 4YBLB 5D7IE 5IEKB 5IHUL 1N5AB 1U8JA 1XR9A 4OQTH 4MQXC 2O5YL 1RIHL 2YN3A 3LRHA 1M6OB 4ZD3H 1OLZA 4MS8C 3ZDXF 3VDCA 1MCRA 4DVBB 4KJWC 2BJMH 4HDIB 3GKWH 5K9OA 2P5WD 4P59L 3MODL 3I75B 5I17B 3PGCA 1ZVSA 4DN3H 4G42A 2VYRE 3B9VA 1TPXB 5E9DB 4OQTL 4Y5XC 4HEME 3BRFA 4WHDA 3W2DH 1FVDB 2OLDA 4DCQA 2FJGB 2VRAA 1OAZH 5AG9A 1QFWH 1MCHA 4ZD3L 3BQUB 2EIBA 5F7EH 4OZHF 4KJQC 3VFWA 2BJML 1FG2A 3GKWL 1R24B 2E8ZA 4H0HB 2ZOLA 1MHHA 1R5IB 3HI1A 5FFLA 3EYVB 4G9FE 5H8DA 4DN3L 2A1WH 3JV0A 1ZKAA 4X7SL 3QEQA 3W2DL 3ARDC 3UBXI 4TRPH 1ZANH 4UMGA 2NZ9D 4CMHC 4GKOA 4P9HC 5D1ZA 4CVWA 1CI5A 1S9VB 3QISA 4OCNC 4FQXC 5F7EL 3P9LA 3FT2A 4MCYB 4Z0BH 3TNNA 3HE7C 2YSSA 1XGTA 2DQJH 1VFBB 4QKXB 3U0TA 1F3DJ 2EDFA 3O4OB 3PGCB 4NKMA 2BNQA 3BXNA 3JUZA 1A7RH 1KF9B 4TRPL 1ZANL 4LGRB 4D3CH 1BVLB 4DCQB 3WE6A 4ZUUA 4LLMA 2XWTA 5C0DA 1ZMYA 4PJBE 3NA9L 2Y07H 2HT3D 1OGAE 4ZS6C 4Z0BL 3VFWB 1FG2B 3RWGA 3IT8D 3ZHDA 2I25N 2FX7H 2DQJL 3HI1B 4U2ZA 4ZUVB 3NFNB 3ARBD 1S7TA 2DWEA 3MOQA 1A7RL 3ARFA 3KWWB 3S37X 4QRSA 3O9WA 2M1KA 1L9MA 2R8SL 4D3CL 3G6JE 1ZWIA 3DRTA 3ZDYE 5IT2L 1E4JA 3IS0X 4FG6C 3GIVA 4OZGF 5D96C 5HHNA 1N7MH 4C56E 1C7TA 2H9GB 1MVFA 3HZVA 2NY7L 3C6LC 3P9LB 3FT2B 3TNNB 1BQSA 2FX7L 5ESAA 4P0DA 4J7RA 4MAUL 7FABH 3U0TB 1SQ2N 3CMGA 4NUJA 2BNQB 3BXNB 1FYTE 5IFJA 1QPXA 1UFUA 3WE6B 1AJ7H 4Q97A 4ZUUB 4LLMB 1A0QH 5C0DB 1Q0XH 5GRUH 3VJ6A 1X4XA 4U1LA 3MBXL 1CIUA 1CICB 2HA1A 3WEXA 1NBZA 1S7TB 2DWEB 5FCUH 2LVEA 3OL2A 5IMKA 5DO2D 4E5XA 1IRAY 4XVJL 3I6GA 3QXTA 3ARGD 3OXRB 1JYWA 1AJ7L 1SBBA 1PAMA 1ZWIB 3IKKA 4P46C 1A0QL 3N06B 4Y4KC 4KI5E 1LEKA 2GTWB 5JIPA 4PLKD 5FKAB 5J8OA 3U79A 4W70A 4WV1C 4X5WA 3HZVB 1SVZA 3B2VH 1CDHA 5ESAB 4B7IA 5FCUL 2NXZB 4KKLD 2ITDB 2O26U 5IFJB 3BT2H 4Y89A 4KMLB 5K9KA 4RCAA 2P45B 1GL4B 5F9OL 4R3SB 3Q5OA 1V3LA 5HHQA 1W2KT 5E00A 4K7PX 3L3DB 4JO1H 5KSVA 3CFEA 5JA8B 1P7QB 4FQ1H 3B2VL 5L2JA 3TH3T 1ORQA 4UZGA 5HYIA 2FYYA 2ED9A 5B3JF 1NBZB 3V52L 4M1CD 4NCC2 2X05A 5IW1A 3C2AH 1NEZA 5J0BA 2BSRA 4BZ2H 3FN9A 3I6GB 2WLYA 4XCFH 3GNMH 4F58H 1IGIH 1LEKB 4Z7QE 3NBNA 4JO1L 1TFHA 2A9NH 3C5ZC 3SKOB 3CDCA 5E2WH 4FQ1L 4X5WB 1CDJA 3MRIB 4DKFH 5DTFB 2HWZH 4ZOCA 4YXKH 4BZ2L 4CVUA 4R2GC 4F58L 2I27N 1IGIL 2YKLL 1TIUA 1UJTA 4POZD 4YHNA 2GITA 2A9NL 5HHQB 3PQYD 1HDMA 3GMMB 3QI9D 4MNQA 5IMOA 4PGDA 3H9SE 2ZUXA 1T3FA 5L2JB 1ORQB 5TH2A 1RV6X 2FYYB 5GZOD 1EO7A 4JJ5A 4D9RE 4DKFL 4LHUG 5DMYA 1NEZB 5EO9A 3R8BB 4WUUA 1UH3A 4I0PC 3X3FH 2QADC 3KLAA 3SOBH 5EOCH 5ITFB 5C0GA 4PJFE 5KW9H 5BMFH 3UTTA 5D1XA 1EVTC 3TBTA 5HJ3A 1K8IB 1FZKA 3FB6B 4Q58C 4PJ7F 3N1QC 5DJXA 3MRGA 4DKAA 1OF2A 4ELMA 1DQJA 4OD2A 4YHNB 2GITB 4UIKH 3SOBL 2CIKA 1ZLWK 2EH7H 4OFVA 4YH6A 4WFED 1HDMB 5EOCL 5FYLE 4H1LG 4MNQB 4MXQD 5IMOB 5KW9L 4PGDB 3UZVB 4I9WD 4TNVF 2R56H 5TH2B 4R7NB 4GRLB 3IRPX 4XH2B 4WHYG 2EDLA 5EO9B 2BRQA 4OV6F 1VPOH 1ZEAH 1A22B 4UIKL 3X12B 2EH7L 3U7YH 4Y1AE 1ADQA 5D1ZC 3KLAB 2CO7B 3BW9B 5DFWH 2XFXA 1DSFH 5IESH 2CKBB 4XZUA 5D1XB 2OTWB 3TBTB 5HJ3B 1FZKB 3U2SA 4BH7A 5DJXB 1R5WA 4GH7B 4M7JH 3MRGB 1OF2B 1ZEAL 3O3UN 2H1PL 4JEGB 2DQIH 5C2UB 4OD2B 4YDIH 4I2XA 3VI4E 2OTPA 2CIKB 1TQBB 3TWCL 1DSFL 5IESL 1BIIA 1EGJA 2DJUA 4H5SA 4MHHI 5DEZA 1TZGH 4UT7L 1G84A 2YD2A 1IC5L 5I9QC 4MQ7A 2BVUA 4M7JL 3GRWA 1M7IB 1NCNA 3ARFC 2XTJB 4TSAH 2BVPA 3O9WC 1AFVL 2DQIL 4X4XA 3NAAL 4TSBL 4YDIL 1QSED 3WL9A 3CH8A 5I1EH 2EIEA 3Q5YA 4LOUD 1QFUH 5I8CA 4XZUB 2DM3A 1IGJB 1TZGL 5M95B 3TO2A 1KTRL 1EUTA 1RQ5A 4BH7B 1BZ7B 2BP3A 3ECBB 4GG6F 4TSAL 1YPZE 3T0BA 3WFZA 5IR1A 2DKUA 4WO4D 1E4WL 3CMOH 4ZAKD 4I2XB 1T20B 2K1MA 4LHUA 3QJFA 1QFUL 1BIIB 1RUML 3AS0A 3DX6A 4YBHA 4I48B 4RMQA 4H5SB 5I73B 1UCTA 3RGHA 5T3ZD 3SKNA 2DTSA 4JFQA 4KK6C 2Z93A 4UNTA 2YPLE 2VITA 3ILQD 3PV6B 2BVPB 3CMOL 4JFHD 3EOBA 3O45A 1U58A 2K3TA 3WL9B 2NY3D 3MV7E 5TQ2H 2DAVA 5AAWA 5GJTH 1MQ8A 4IHOA 3GSXB 1EZVY 4HFUH 1DQMH 3RWCB 3HMWL 4OGAC 3NCYP 2AABL 2FO4A 5EUOA 4XAKE 5FO7A 5IR1B 4J6RH 4LRNH 2EDYA 4LEOA 3RJQB 1W72B 1JNNH 2Z8RA 4XNQA 1MOEA 3BMVA 5CFHA 1KENL 3RY4A 4PRNB 2QEJA 2FGWH 1NFKA 5TQ2L 4N90E 3QJFB 1ORSA 4M3KB 2F53D 4JO2H 5GJTL 5IVXE 1ACZA 3U6RA 4HFUL 5MI0C 1DQML 5TQ0H 3SKNB 4OLEA 4JFQB 3MX0A 3CXHJ 4HH9A 2Z93B 5F1NB 3QO1B 5AZ2H 1UJ3C 4LRNL 6CGTA 3K2UH 1F11A 3OR6A 3LEYH 3EOBB 4GRWF 5TF1L 4NUGH 1S7QB 2FGWL 3QRGH 1DBJH 1UZ6E 3W39A 1VFUA 1RK0A 3WUWB 3ARQA 3TO4A 5TQ0L 1T4KA 1MCOH 2NY6B 1BJ1J 2X1QA 5E9DE 5C0EA 1WJ3A 5AZ2L 3PL6B 3MRBA 2FO4B 4JQVC 4MB5A 5FO7B 3K2UL 4R0LC 3SCMC 4LEOB 2UY7A 1KN2H 4ETYA 3LEYL 4XNQB 4NUGL 2IMNA 2VLJA 2X09A 4OUUB 3QRGL 1DBJL 4Y19D 3X3GH 3BPLB 2ESVA 1ORSB 3C2SA 3IDXL 1V7MH 1TZIA 4M8VA 1TVDA 1KT2A 1WIOA 4XPHH 1R3HA 2OXHA 3E0GA 2VZOA 2EEDA 4EQ2A 1EV2E 4N0YH 2X6MA 3MJ8A 3LKPB 4NN7B 4HH9B 2XZZA 4K3HA 4LLQB 4KKCD 3T4AB 4PB9H 4PBWD 3IDIA 4Z7UA 5JXEA 1JF1B 1KN2L 5EBLA 3OR6B 5HDBF 4GXUM 1FPTH 4DKDC 3TFKC 4LQFH 1DANT 4RISH 5F9AC 1D9KB 3W39B 4NJAH 3UC0H 4UV7H 3TA3C 3KGRA 4XPHL 1SBSH 2XACC 3TO4B 3D69B 4ZO6A 1L6ZA 1T4KB 2KZWA 1MFBH 5C0EB 3AMLA 4XHJC 1HH6A 1F3JA 1U8QA 5E08H 3UTPD 2NMSA 4PB9L 1BFOA 3ORJA 2GK2A 3OJMB 1X6LA 43C9A 3HLAA 1AC6A 2VZVA 1CXKA 4XPBH 1Q9KB 1FPTL 2OQJB 3QUMH 3L5JA 3CSPA 4I3GA 4LQFL 4MWFA 1B0RA 2ESVB 4NJAL 3UC0L 5DQJA 4XXCA 3TVMA 1SBSL 3MLXH 1J0IA 4HAGA 4U49A 1R3HB 1WWWX 4RRPA 3P73A 1Q94A 1VDGA 3QDHA 4JFPA 4LDEB 2Y1VA 1MFBL 2OZ4A 1C12B 5E08L 2F5AH 3MJ8B 1K4CA 2JJTA 2WWMD 4KGJA 5J11B 1E4KC 1LD9B 3TCLA 3JVGA 4Z7UB 4XPBL 5EBLB 4FS0A 4Q0XH 3PHQA 3QUML 1LE5A 3MO1A 2AV7A 1FZMA 4MJID 5DSCA 5GGVY 3MLXL 3FT4A 1AO7B 1UH2A 2ZSVA 3C09C 5IVZA 2BNQE 1U8QB 4RMVA 3HG1D 1BFOB 1S7VA 2BY1A 2WM0A 1QNZH 4KK5D 4Q0XL 5A2JH 43C9B 3HLAB 2ARJB 2GTZB 1H5BB 1Z6JT 2YEZB 1TXKA 5IW6B 1A9EA 4L9LA 4OF3A 1B0RB 1NBYB 3BO8B 1I1AC 3PWJA 5DQJB 3RTQD 1JPFA 4YO0A 4LSDA 1N6VA 2BMKB 4GQ9H 1Q94B 3UYOD 4JFPB 4YK4B 5L9DL 4HUMB 5LGJA 1HQ4A 1XGRA 1KJVA 1WLHA 3UJIH 5B22A 5J56B 3TCLB 4OZIA 2BVTA 2ZG1A 2VLKA 2VXUH 5EPMB 1FZMB 5DSCB 2RFXA 4J3SA 1RY7B 2V5MA 3AREB 1FNFA 1NEUA 2MCG1 3FT4B 4GQ9L 2N1KA 3QUZD 3NIGF 5IVZB 3H7BB 1Q38A 4NQVA 4NZJA 3KPQA 4O58H 3T65A 5L6YH 4G9FD 1CGVA 1S7VB 4EDXA 5FA4B 1YA5A 4HWBA 2V17H 3NIFF 2VXUL 4ZNEE 4DZBA 1WF5A 1A9EB 3LKRA 3JSSA 4KZDH 3UXFA 3F5WA 4YPGA 4YNYA 1JPFB 1MVUA 4YO0B 1DUYB 2EDOA 4X9IA 5D7KD 1BP3B 1T5WB 4XNZC 4W4NA 3U82B 3QDMD 5L6YL 2PO6A 5LGJB 1HQ4B 1XGRB 1KJVB 3LDBB 5F9WB 3BD4A 2V17L 4OZIB 4QTHA 3QIBB 2CLRA 4YFDB 5DJDB 4HLJA 2C3WA 1H3GA 5E2JA 3SDAC 4RMSA 1OGAD 4HV8A 3RWJA 4BM7A 3CFJA 2PNDA 1KPRA 3EOAA 3BPCA 3HB3C 1QLEH 3KPQB 3T65B 1IKNA 2RR3A 1N0XH 3EYQC 5GJSH 5DEFA 1IAKA 4EDXB 2P48B 4YE4H 4G8GA 1CS6A 4QNPF 1E6JH 3OF6A 2GK0B 3NABL 4WHTA 2AJZA 3ZKMC 1LDPL 1UKQA 3PDOA 5LGKA 3OBAA 3GEWB 4CGTA 1FNEA 4YPGB 4YNYB 3BI9X 1MVUB 3LN5A 4JREB 5KSAC 4LCIH 4HWZA 1FZJA 1QLEL 2F74A 1KGCD 2PO6B 1N0XL 3VFUA 5I71B 1JGVL 3OR7A 3IGAB 1JZ7A 3KJ4C 4YE4L 2BNUA 3QNYA 4JFZL 2CLRB 1E6JL 1LGVA 4M03A 1PSKH 3LZFH 4DGYH 5ISZA 3H3PH 5GS2D 1T1YB 4HWUA 2HTLC 3A67H 2DRUA 3GGWA 4K71C 3VFTB 2FHFA 4HV8B 1VSCA 4LCIL 3J7HA 3RWJB 5DD3H 4WCYL 3EOAB 1KB9J 3BPCB 4M4RA 5CGYD 5IG7B 1MH5A 5J6HA 1DN0A 4BJLA 5DEFB 2NY0C 3OKOA 5HI5D 3RZWA 3MLSH 1QEWA 1PSKL 3LZFL 1EHAA 4G8GB 4DGYL 2AJZB 3PDOB 4MNQE 1FL5B 3DX8A 5C0JA 3A67L 3WHE1 4KI5D 1FNEB 1HINL 5KOMC 2AERT 1XR8A 5F97E 5DD3L 1V05A 1FZJB 5ILTH 3LN4A 3GMOA 3VFUB 3OR7B 3L7EA 4X9HA 4R4NC 3FOLB 2BNUB 3MLSL 3QNYB 2H2PD 1QZ1A 1IQWL 3MYJA 4LIQH 1U3HA 1JK8A 2MMXA 5HY9A 4FXGB 2G75B 3NTCL 5E94B 5ISZB 3DTXA 3GMLA 5DC9B 4IRZH 1JWMA 3FT3A 1HQRA 4FFWC 4JPWL 4NQEB 4M6NH 5KS9F 4YHZH 3GGWB 1FL6A 5DRZA 3GJFH 1GGUA 3O3DA 2QTEA 6FABH 2ZUQC 3QZWA 4I18B 5J6HB 2FHBA 3QIWC 3V6BR 3V0AC 4Y4HA 3HMXH 5T33H 3OKOB 4UOJA 1ES0B 1QEWB 3QFJA 4JY6A 2J8UF 3CFDB 3MUHL 2Z91A 4HIJB 4ELKB 4IRZL 3DX8B 5C0JB 2APXA 5E5RB 2K9UA 2CIIB 1D6VH 1F90L 4FXKA 3I6LE 4KJPC 4TUOA 6FABL 2BXZA 3G5ZB 1NFDA 3OJVC 3GMOB 4OUOA 1WUNT 2JCCF 2OYPA 4BELD 2XPGA 2XTJE 3L7EB 3INUH 3MC0A 4XVTH 1CFTA 2D7TH 2EYTA 3X13A 3MYJB 1J88A 2UVEA 1JK8B 3GSUB 3FB5A 5HY9B 3GMQA 3PWUB 3C60A 3DTXB 4CVZA 3VFNA 3FT3B 1HQRB 4FQIH 4MDJA 1DQQA 1A3QA 5CP3A 1D6VL 1S7UA 4S11A 2J6EL 3H9SD 2YPVH 2CJUH 2H2SC 3MBEA 5GRVK 4P49A 3I85A 2KQMA 3QZWB 5L8KB 5JORA 1QVOA 3INUL 3ROOB 1NUFA 4XVTL 2D7TL 2YHGA 3BAEH 4I2XE 3GMNA 3QFJB 4NRZA 2VE6A 1JMZA 4JY6B 1KCSH 2Z91B 4EUPH 1NGYA 2OJZH 1UM6H 4L9LC 5J1AA 3L3IA 1MEXH 1FNHA 4FXKB 5D1QC 3S88H 2YPVL 2CJUL 2NY4D 1GOGA 1I1FA 4CN1A 4GBXC 5I1HH 5E8PA 1U8IB 3ARVA 3OV6A 2Z92A 2XPGB 3SJVA 3FO1A 2EYTB 3X13B 2AEQH 3J8F7 5J13C 1KCSL 4EI5B 4GRMA 2KL6A 2F58H 2OJZL 5I19H 1IT9H 4PJHF 3VFNB 3SE3C 4GW1B 1JZ5A 1MEXL 1DQQB 3U36A 5LG1A 1TVHA 4PRDA 1EHXA 3MBEB 3FFDA 3SGEH 1BQHG 4NKOB 3EO0A 1XGPB 5D72L 5JORB 1QVOB 1CLYH 4NWTH 4QT5B 3DYMA 5FB8A 4NRZB 4OZFA 2VN7A 3O3AA 2F58L 1LO3H 4ZOAA 4NFCA 5I19L 1NGYB 1J12A 3EHBC 4L29A 2VLRA 2V7NA 3L3IB 2PW2A 4Y1AD 3L5IA 4W4OA 4ZFFA 1CLZH 1D5ZA 3HE7D 4N8PA 5FKPA 4JFXB 1U95B 1I1FB 5FGBA 3MZGB 4OCXH 3KYOA 3O8XA 4NDMA 2Z92B 3SJVB 3FO1B 4NWTL 4ZFOB 3QWQB 2ED7A 1BGXH 5IHBA 3ES6A 4ZMAT 5F88A 1LO3L 4MXWL 3K2MC 5FO9A 2PYEB 2JJWA 4CU7A 3ZZ1A 5LKNA 2HVJA 2XXCB 1CLZL 1L9NA 3T77B 1R3IH 3D0VA 2IAMD 4I8DA 4PRDB 4OCXL 1YYLH 2VO5A 3BEWA 3FFDB 3H9HB 4FQLH 4HF5H 4CU6A 1P4LA 1INQB 3EO0B 1DEEA 5D96B 1IKNC 2IBGA 4JDZA 4PS4H 1BGXL 2VDQH 5FB8B 1E0OB 4OZFB 3O3AB 5CJ8A 2QQKH 5I1LB 4FG6D 2VSCA 4L29B 1NJ9A 4YEEA 2VLRB 2V7NB 2PW2B 3N1GC 4KQ3L 3SEPA 1LO4H 4KKBC 1R3IL 5J3HC 4ZFFB 3ZT6A 4HAFA 4RDQG 3RDTC 4FQLL 4HF5L 1S5HB 4R9HA 1YEKH 3KYOB 4NDMB 2O5ZH 2WNGA 5J12B 5LQBH 4PS4L 1X5YA 3VGAC 2VDQL 4OT1H 2LVCA 3MOAL 3RWFB 5KANI 3QCTH 2QQKL 1K6QH 1Z3GL 2R15A 1WZLA 3ULSB 3MGOB 4NO0A 5BVJA 4NFBA 4Z0XA 1LO4L 3EDKA 4A2LA 5IROA 3D0VB 5C6TL 4LSTH 1F58H 1WIUA 4EZMA 3U30C 2UZYB 1YEKL 4HZLA 1P4LB 5F7NC 1DEEB 4LLWA 2O5ZL 3CDYA 5LQBL 1U8HA 1FIGH 4JDZB 3RWIA 2I60H 2Q76B 4OCLC 4OT1L 1S8DA 1E4XH 2NW2B 3QCTL 2A6JB 2YPLD 3PP4L 3QDAA 4KXZH 2ESVE 3PWVA 3UYPA 4HJ0D 1JYNA 1ZGLP 2P5EB 1UXSA 3WFBH 3RI5F 4IRSA 4YDVA 1VFMA 3MV7D 5J4MA 3S36H 4XX1E 4RIRA 3OKEA 4LSTL 1F58L 1Y18B 4JN2A 3MLRH 3O3EA 3P77A 1PYWA 4I5BA 4WU7A 3K0WA 3S96A 4PGEA 4IRJA 1FIGL 2ICWJ 4Z7UE 2I60L 3I02A 3W11D 2X4PB 5TE7H 1E4XL 3GHBH 3CFCH 3NA4A 4XAKD 5CZXC 4OGYH 5EG6C 3BISA 3WFBL 1BQHA 5BVJB 2JB6A 4ONFH 4Z0XB 2EH8H 1O0VA 4EQ3A 2HFFA 3PF2A 3S36L 1AO7E 4N90D 4KU1A 1P53A 5C09A 2C3GA 3E8UH 5E8OA 3MLRL 5FUCE 15C8H 3OB0H 4K94H 2ZCLH 3MCLH 1P7HL 1A6WH 3HFMH 4NN6C 2G2RB 4LLWB 2AKRA 3C5ZB 5TE7L 3U83A 4Y4HC 3CFCL 3WXWL 1KC5L 2AJVH 4OGYL 5CGTA 3RVUC 5H2BA 4L4TA 1ZHNA 4JQXC 4U6VH 3S3PA 1L0YA 2WSKA 2PETA 1UXSB 4ONFL 3GSOA 2EH8L 2NYYC 5JOEA 1WV7T 1YN7A 1H3UA 3MMEA 4IRSB 4YDVB 5EA0L 5F6IB 3RAJH 3E8UL 3JWOC 4U7KA 2Y5TA 3FCTA 4RIRB 3OKEB 1GOHA 5I8KH 1H3XA 3P77B 2ZCLL 4JN2B 4K94L 5D7IF 1A6WL 1PYWB 3HFML 4LPVA 1PD6A 2D0HA 3S96B 2FDBP 2W1NA 4PGEB 1MWAA 4TUKH 4JZNB 3I02B 4ZUWA 5E9DD 3DYOA 1N8ZA 2AJVL 3O11B 4F7TA 3SO3C 4GS7C 4U6VL 1IZJA 3LQZB 1XGQA 3C60C 1BOGA 3BQUD 4HK3J 4NQXB 5HYQA 3F65A 3RAJL 2HFFB 1YMMD 3KJ6L 1KCRH 3FMGH 5I8KL 5E8OB 4NHUA 4X80H 2VQ1A 1T6WA 2AKRB 3UJJH 3DV6B 2GFBA 2V2TA 4OZHA 4Z76B 4PRPB 2DQTH 32C2B 4ZG1A 5TPWH 1RUAH 3S35X 2LE9A 4MXVE 2QADD 4KJYA 4QF1A 2PCPB 3GSOB 1YN7B 1MLCB 4OGZA 4Q9CA 2EE3A 1KCRL 2Y5TB 3FCTB 2UUDK 1ND0B 5T5FH 1AKJB 4X80L 1B9ZA 4Z6AT 1ETZA 4M6AA 1MWAB 4JLRB 2DQTL 3ALPA 4OZIE 1I9JH 2DI8A 4F7TB 1RUAL 1HHHB 1SEQH 3B8SA 3MNWA 1FC1A 4FQ2H 2A6IB 5HYQB 3G5XA 4WEBH 5ABDE 3OX8B 3FOMB 3UTOA 5T5FL 4NHUB 5E7BA 3O6LL 1IMHC 4KRNA 1XH3A 3P4OB 5C70A 2PXYB 3D0LB 3UAJC 2GFBB 1T04A 2V2TB 2LAGB 4GSDL 4OZHB 1I9JL 3QEQD 5EFIA 4EEEA 2YS4A 4D8PA 1WGOA 1SEQL 1C5BH 4BSVA 2OL3H 4X6CF 3QXWA 4FQ2L 4KJYB 4QF1B 1I8KA 1R3JA 5BS0A 4PJ5B 4WEBL 1WWBX 5KVMC 2WUCH 1DFBL 5GGRY 1S9KC 2DKSA 1QD0A 4C55A 1RFDH 3G6JF 4OZGA 3O8XC 2W65A 2BNQD 3ZDYF 5JIIA 4PRHA 1C5BL 4ZO8A 3O6FA 4OBSA 2WLZA 3SBWA 3G5XB 3SQBA 4KDVA 2WUCL 1TTUA 4XBEH 4BFGA 5EUKA 1O5DT 1JF6A 3HC0A 1RFDL 1XH3B 2KBGA 5ACZB 3ARFD 4FQCH 4OLVH 3KLSA 3OHXA 4L1DA 3EO9H 4G8GE 2R2BB 3O9WD 3RHWK 4IJ3B 3BP6A 4HIEB 4D8PB 5F7HA 2IMMA 3OGOE 1XZ0B 1CR9H 3KPRA 1QOKA 2ARWA 1I8KB 1W0VB 5DK2A 3RVVD 4C57C 1U42A 1REIA 3BPNB 1EO8L 4LPCA 5CSZB 5DA0B 1FHGA 1GGIL 4OZGB 2GT9A 2X4QA 4K8RC 4FQCL 2NXZD 2W65B 4OLVL 5SX5K 3EO9L 2W0PA 1NC4A 1PG7X 4LSQL 4PRHB 1CR9L 4NM8H 4L8CB 3Q0HA 5ISZE 1SYVB 4JG0H 4IDJH 3O6FB 5D7SH 3AM8C 4B5EA 4NQEE 1UCBL 4G7YH 2VXQH 4NQUA 3VDAA 2XV6B 3HC0B 2MWCA 4IIQA 4L3AA 1BFTA 5E8DH 2ZUYA 5HHOA 2YWZA 3D1MC 1MREL 4MA1B 1J8HB 4NM8L 1ZE3C 3TYGH 4JG0L 3QEHA 5D7SL 3KPRB 4Z95H 1G0DA 3W0WA 4G7YL 2QJDA 4R8WH 5BZDA 5ICXA 1NCWL 2VXQL 4FFZH 1HILB 1GOFA 2G9HB 3GSRA 3HE6A 5IBUG 5T3XE 2C3VA 3TZVA 1ZLUK 4OGAD 1BZQK 3TCXA 8CGTA 1AXTH 5E8DL 4TTDC 2W9DH 4Z7QF 3EBAA 1NC4B 5GGSY 1KTLA 3TYGL 4Z95L 4R8WL 5CJXA 1IM3A 4RGOL 4FFZL 3HZMA 3QAZC 4PJ9A 4O51A 1T0NB 3PHOA 4RAUA 4ORZC 2A0LC 4J2XA 4YIQB 1Q8MA 1T66C 1AXTL 1T0MA 4PV9B 2V5TA 5LCVH 3GM8A 1HK6A 3G08B 5HHOB 2P8MB 3QFJE 3H9ZA 4OM0L 3X14A 1BX2A 3EYFA 3QEHB 5JOPD 2WBWB 5A16B 3RKDC 4XI5D 1GRWA 3W0WB 3BZDA 3N1FC 2VLME 5BZDB 3F12A 5ICXB 1X7QA 3NOIA 3SCMB 5HI4D 4GKSA 3TZVB 1FC2D 1MCPH 1NDMA 4OM1H 3VXQB 1NANH 2JE8A 1QR4A 1KTLB 3VXUB 1IM9B 4PJFF 2NXYB 1W0WA 4PJ7A 3MNVA 4LHJB 4QCIA 3HZMB 4MNQD 2BVYA 1JN6B 3PHOB 1N64H 4HMCA 4WHCA 3B2UC 1CE6A 1MCJA 5KN5B 1MCPL 4OM1L 4X7DC 5C08B 2NW3A 4K23H 3CNKA 1WCBA 1G7LA 2OSLA 5LBSH 4PJIB 1QHOA 3JV4A 4DK6A 3WYRA 2GHWB 5EO0A 3QWRD 4WUUD 3X14B 2C4XA 2HT4C 3EYFB 1WVZA 5DURB 2JLLA 5IFHH 3B4NA 4H0IA 4JRXA 5JHDB 2CXKA 1N64L 1X7QB 5GGTH 3C5JB 1FP5A 2ZPKH 4U1GC 3UTTD 5D1XD 3GBNH 1TNMA 4GKSB 2R2HA 3SJVE 4K23L 3IDJB 3MJ7A 4MVBC 1EFXA 4BFIA 4Q6IA 5LBSL 4EVNB 1JE6A 4FP8H 2YD9A 4HGMA 3TBWA 1WZKA 4XXDA 4FTVA 5M7QA 1OM3H 1FH5L 4XPAL 2PYEE 3I2CH 1MLBA 1W0WB 4QCIB 3E1F1 5GRJL 5INDA 5IFHL 1MJJA 4ZSOB 4RBPK 3CSBA 4APQB 3P4MA 4HS8L 5GGTL 3QXAA 5IB5A 3BJ91 2ZPKL 3GBNL 3V6FA 2IH3B 3LB6D 5IQ7L 1CE6B 1NCBH 2ZG2A 4XWOD 3I6LD 3B3IA 2NW3B 3G6AA 1CDCA 1G6RA 1WCBB 1G7LB 1I8IA 1P69B 2OSLB 2D7QA 3RA7H 2XTJD 3JV4B 1OM3L 5EO0B 3I2CL 1QLRA 4HSQA 2ZUSA 3C09B 5MENB 2VLRE 3SE8H 3GSNA 4P9HL 1IGFH 4Y2DB 4JRXB 4AM0B 2DQUH 5F7MC 3CSGA 3FHAA 1NCBL 4E0RA 4JFOA 2HG5B 3ZSTA 3TN0B 2R2HB 5F7WC 5BW7A 1EFXB 2FCBA 3C6SA 4NNYA 4XXDB 1EAPB 3U4BH 3BD3A 5DEGB 3VG9C 1URLA 5AG8A 1MLBB 3SE8L 1MJJB 1IGFL 4QYOA 3R8QA 3P4MB 2P42B 4GG6A 3QXAB 5IB5B 3I9GL 1AXSA 3V6FB 2EKSA 5F9DC 1YPZF 1FVCB 4XRCA 4OCRH 2H32A 4EN3A 1TENA 3G6AB 1CDBA 2CKNA 5DFTA 1I8IB 5F89A 3KPSA 3PGDA 1A47A 3U4BL 2YC1A 2EDEA 3BKCH 3H3BC 2P5EE 1KTDA 2XWBB 4KUCD 5MP6H 5HXMA 4HC1A 4GUPB 3TP4A 2ZKHL 2BK8A 4ETQA 1B2WH 4E0RB 1RUPH 4JFOB 5DQDH 4OCRL 4U1NA 2XKNA 4D0CB 3SPVB 4QRPA 3EDEA 3RX5A 5ALBH 1DBML 3C6SB 4KQ4H 1XIWC 4IOFD 4NNYB 3RL1B 4QHUA 3K4ZA 3RVTD 1CK0H 4A2MA 3TBVA 4GG6B 1CU4H 1MUJA 2LU7A 1D6EA 2VR9A 2X40A 1AXSB 3MRJA 1B2WL 1RUPL 2ICCA 2EKSB 5DQDL 3OJDB 4XRCB 1JZ8A 3LV3A 2ICWA 2QQQA 5CJQH 4AG4H 3STZA 2H32B 4IIQC 5J06A 3RL2A 5ALBL 2ZUVA 3PGDB 2YC1B 2X70A 3OQ3B 3EIFA 3QIUC 4PG2A 2H3NB 5GSVA 1JTPA 4NP4L 1CK0L 1KTDB 4JDVB 5EU3A 2F15A 2NY1C 4G8IA 1QYGH 1CU4L 3R1GL 5GGRA 5CBEB 3GJEA 3HE6C 2B20A 1KEMH 4ETQB 2UWEB 3CDGA 5C0NC 4L3CA 4U1NB 5CJQL 2XKNB 4AG4L 2AGJH 3BGAA 3RWHB 3DMMA 1AC0A 4QRPB 2MQCA 2DQEH 1FVEB 2R0WH 1SVCP 1UZ6F 1EERB 3MRQA 5DJ2B 2QL1A 3G04A 5KSAB 5TGBA 3BX7C 4LCWB 4KHTH 1U8LB 4J3XA 2Y06H 5IIEB 1QYGL 4LP4A 2VERN 4JANA 3V5KB 3TBVB 2V7HB 1MUJB 2C7UA 1D6EB 2BSTB 1KEML 4P2OA 3MRJB 3T1FA 3LV3B 3NH7H 4Y16C 3TIDA 2AGJL 4LBEA 3STZB 3OKDA 4PRPE 4I13B 1U8MA 1HSBA 2DQEL 2X7LA 2R0WL 2X70B 4XP9L 3UPRB 1U8OA 4K71B 3RZCB 5C6PB 4OKVA 5HHXH 2Y06L 3EJYC 5IWLA 5EU3B 3VFMB 4G8IB 1HIMH 1CDYA 3T3ME 3VXMA 2C9AA 5HYJA 1KXQE 2QHLA 1BM3L 4I3SH 3TO4D 3NH7L 4L3CB 5DVOA 1XGUA 1TDQA 3CXHK 4M62H 2FB4H 5JA9A 3W5NA 3B9KA 3OG4B 4AIOA 1VEPA 5HHXL 3ZKXC 5TGBB 2VLJD 2PYFB 1HIML 2XZQH 5F3HA 4X99A 2ESVD 4EJ1C 2B5IC 4YPJA 4AMKH 3RFZC 3IXAA 3AB0B 3NPSC 4X9GA 4P2OB 4I3SL 2IBBA 4G6JH 2VZ3A 5EWIH 1A7OH 4LBEB 3TIDB 2Q8BH 4OZHE 5C6WH 1QR1A 5K9JH 5CAYB 4M62L 3VRJB 2ZCHH 2X7LB 1YDPB 4ODHH 1DUZA 5JXED 4J4PC 1U8OB 4ZQKA 1SM3L 1G1CA 1X5KA 4OKVB 4PJ5E 2XZQL 1TCMA 4X5LA 2VC2H 1J0HA 1JGDA 4AMKL 4UILL 3VXMB 3LKNB 5HYJB 2ZSWB 5JQ6H 1KV3A 3ZTJG 5EWIL 4WFFD 1A7OL 3C8KA 1XGUB 2Q8BL 5K9JL 2ZCHL 4MCZA 4ODHL 4GAGH 4Q6IC 2BVOA 3B9KB 3R0NA 4N1CA 4DTGL 3NACH 5F3HB 4NO5B 3B5TA 3FQTA 4B41A 3IXAB 5JQ6L 3TVMD 1Y6MR 1M05A 3RNQA 4BK5A 1CFBA 1KYOJ 1JIBA 5F3BB 1FG9C 1QR1B 2ADGA 1CD0A 4GAGL 4RAHA 5K33A 2A2QT 2DIBA 3V4PL 1DUZB 2AK4B 5IOPB 5FYKL 1I8LC 4RFEB 1I3RA 1CG9A 3C5SA 4KWUA 1NGQH 2DLFH 1L7TH 4YGVA 2DOCA 2H2SD 4OZGE 4WNQA 2DQFA 5TDOA 3L7FB 4MCZB 4M61B 4J1UA 4PRHE 1C16A 2JJSC 2ZG3A 3Q6GH 5A1AA 4QHNA 5D71L 1U2CA 4WI6A 4YDKH 4HCRA 3WIHA 2OMBA 1QA9A 2Q8AL 5DD5H 4PJAB 4XB7A 3IF1A 2Y36H 4GBXB 1NGQL 4HW6A 3FQTB 4P99A 4CMMA 1IQDB 2DLFL 1A21A 5K59E 1L7TL 3RNQB 3MROA 2XRAH 5TDPB 4FFVD 1UWGH 3IJYA 4EN3C 5E6IC 1T6VN 3IDUA 3Q6GL 3ZKQD 1J8HE 4N8VG 4HMDA 4YDKL 1MFEH 3KPRE 3CK0H 1I3RB 1CG9B 2R1YB 1NGZA 2VLKD 4AENA 2Y36L 4WEUD 2XNAB 1I75A 2A9ML 1CF8H 4RQQA 3PV7A 2XRAL 1T2JA 4XC3H 1UWGL 4WNQB 4YDJB 2FRGP 5F9JA 2DQFB 4G43B 4FQQB 3BEVA 3DJ9A 3VXOA 4DFIA 4NC2B 4WW2C 3BKYH 4J1UB 1C16B 1MFEL 2CO6B 3UPAA 2R4RH 4QHNB 4JZJA 3JTSA 3Q6FA 5DGRA 2CUHA 1NAMA 4X83A 4OCSH 3IF1B 3L95A 1TITA 2UYLB 3BPOB 1CF8L 4BSJA 4CJ1A 3DBXA 4CMMB 4ONHA 4ZXBA 1SHMA 4TULH 3VWKC 4EUPG 5I6XB 1KIRB 4XC3L 3MROB 5ICZA 1ZVYA 2PO6D 5HHOE 3QH3A 4ENEC 3IFPA 5HBBA 3BKYL 4OCYH 5IBTL 4ALAL 3GDBA 4OTXH 2BVQB 1BD2A 4PG2C 2FJHA 5E5UB 4OCSL 4PGBA 3W0WE 5HVHB 3OPZH 5HYEA 4PJ8A 2AXGA 2P47B 5A40E 4RQQB 2XWJA 3K46A 3IDYC 1FE8H 4TULL 3DUSA 4PJDF 1BQUA 3IETA 3ZKND 2J1KA 4OCYL 4OQ1A 1OD7A 1RIUH 3VXOB 4OTXL 1G7QB 3VXUE 1TLKA 1EAJA 3P30L 4JZJB 4G8GD 3Q6FB 3RDTB 5C9KA 2GW5A 1NAMB 3OF6D 2F5BH 3OPZL 4U1SA 1AGCB 2DIJA 3L95B 3WJLC 4KKBD 4ONHB 1FE8L 3MRCB 4QHLB 5GRVL 3V6ZA 3PABA 5C08E 3VFSB 5ECJE 2CLVA 4BSWA 3MRNA 3IKCB 4PJIE 1RIUL 3IFPB 5T5NG 4XBPA 2VSDA 2DIAA 4I0CC 2X4SA 1BD2B 2FJHB 1JP5A 4PGBB 3AUVA 3MLYH 4QRQA 5JHDE 5ISZD 1ZSDA 2HN7B 5BOPA 2NR6D 4PJ8B 4KRPD 2ZCKH 2XWJB 1BF2A 3I50H 1N0LA 4Q9RH 3DUSB 4GLRH 1OAYL 3H8NA 4M5YH 2JJUA 3SDDA 2F19L 1OARH 4RA3A 4F9PC 2FJFA 3IETB 2NX5A 1ZOXA 3MA7A 2AXHA 1QO3A 5C0AB 3LKSB 4J3UA 1H3VA 5KS9A 1J18A 4LP5A 1JGEA 4ZSOE 3L1OH 3MLYL 3D25B 4LPUA 5DLMH 4U1IA 2NZ9C 5EBWA 1LEGB 4U1SB 4M93C 3RGVA 1CVRA 2ZCKL 2IC2A 4KAQL 5GRYA 4Q9RL 1A64A 4J12A 4YXLH 3KPMA 4M5YL 3V6ZB 1FJ1A 3PABB 3MGTB 5T3XD 2J8UA 2CLVB 1AGEA 3MRNB 4BSWB 1NGXA 1MJ8L 3QRFM 1NCDH 2VDNH 4XBPB 4HUUA 3QG7H 1AD9A 2VZSA 4PRBA 5CZXD 4Z7OF 4N9OB 5MENE 2CDEA 3L1OL 3N9GH 1U3HD 5SWZB 1BVZA 2VDPH 3WFEH 2N7AA 4NN6B 4QRQB 1S7SA 1XT5A 4JRXE 1ZSDB 2JCCA 4K3DH 5C0FA 4P23A 2A74A 3IAPA 4D0DA 2O5XH 1A6VL 2HT3C 4JG1L 4XNYH 3B5HA 3WCYA 3SDDB 4WWKA 1NCDL 2VDNL 3MA7B 1B0GA 3ARBC 3ZDZE 4Y4HD 2PTTB 4HPYH 3QG7L 2XZAH 3ABZA 3NCYS 1H8OA 3BSZH 3N9GL 3QFJD 5D7JA 4K3DL 3MRLA 1N4XH 1OQXA 1FFRA 2O5XL 1JNJA 3TYFA 1B4JH 1ADQH 1FBIH 3F62A 2LFGA 3KPMB 4OB5H 4XNYL 5F7FA 3TIEA 2IBZY 1RAMA 2J8UB 4PJGA 2D7OA 4FOMA 3LPFA 4HPYL 4C83B 1JYXA 4HUUB 4LCCA 4K9EC 1AD9B 3BSZL 4CL7A 4PRBB 1TTGA 2CDEB 4PJXF 3ZL4H 1S7SB 3QG6A 1PG7W 3U0WL 4P23B 2A74B 1B4JL 1ADQL 5SWQA 2YUWA 1TJHH 4UQ2A 4O02H 4OB5L 4HD9A 2VH5H 1J7VR 1EGJH 2B0SH 2VZUA 4N8CH 3MBED 1JVKA 1IC1A 4HK0A 4WWKB 3KPNA 1L4IA 4OAWB 3WFCH 4PJHA 4ZODA 4JM4H 5HHMD 1GH7A 5DO2C 3V9FA 5IHZB 4U6TA 4CADB 1YJDH 3GRWH 5FOJA 4AH2A 5D7JB 1CLOH 3ZL4L 5IBLD 1QBBA 1A7BA 1U3JA 3ARGC 2GY5A 2EDNA 4ZOEA 4F33A 4GG6E 3MRLB 1OTSD 1TJHL 4PLKC 4O02L 2H8PA 1I7RB 1EGJL 1X5XA 4N8CL 5DJCA 3MLVH 5BQ7B 1W0YT 1WAAF 1DL7H 4PJGB 1QFOA 3WFCL 1MAMH 4M6OH 4JM4L 2BXYA 3SJVD 5T1MA 4KKLC 1A6TA 1CLOL 3DI3B 2XY1A 3NFSH 1GSMA 3QDGB 2PYED 1RHFA 3MQIA 3D85A 3QG6B 3BJLA 5FM5M 1MCQA 2JJVA 2EIDA 1G1YA 1ZT4A 3BD5A 2UWEE 4L8SB 3TPUA 3E6HA 4UQ2B 3VD4A 5C8JA 3MLVL 4RGNB 4MD5A 1I9IH 1KJ2L 1MAML 4HK0B 4JKLA 4QRPE 3KPNB 5EZLA 4NNPH 4M1CC 1J11A 5DZLA 1FCGA 4LCWE 1I1CA 3PJSA 1AXIB 3NFSL 1QPPA 4F33B 4JJHA 4XCNA 2VLRD 1NC2A 4OFIA 2R1XB 4ZXBC 4F8TA 2H8PB 2IANB 2ID5A 1I9IL 5DJCB 3MACH 1A6ZB 4BKLB 3BMWA 3O8XD 4NNPL 1MCNA 4H88H 3CX5K 4HIHA 4KHXH 2DM2A 2VWEC 1IGTB 3T2NH 3UDWA 3D85B 4Y19A 2QQLH 4POZC 3KS0H 1DQLH 1ZT4B 3TPUB 3CFIC 4WHYH 5H94B 3QI9C 3S4SG 2J8HA 2W9EL 4NQCA 5C8JB 4MD5B 1G0XA 3MACL 2E9IA 5GZOC 4Z7VF 5EZLB 4F7PA 2NNAA 3DGGB 4WW1B 4H88L 4KVNH 4KHXL 4LVNB 3ARPA 1OAKH 3T2NL 4F8QA 1YNLL 4M9PA 5CD5D 1QFWI 4XCNB 3R0MA 1XF5B 2IPUG 4EIGB 1BQLH 1NC2B 3F7VA 4X4ZA 4WTWA 3KYNA 1YEJH 5I1AA 1VCAA 5FEBA 4C58B 1SYSA 1IZKA 4UIMA 4HXAH 2W9LA 5SWSA 5EU4A 4A6YB 1F6FB 1C1EH 1OAKL 3QEUA 5DHYA 3VXTA 3QDJA 3PNWA 3VXME 5SV4A 5HYJE 5IEHB 1BQLL 4NO0D 5E7FA 4OQTA 3DI2B 1IE5A 1FGVL 3FQXA 4MXQC 2MPAH 1YEJL 1Y0LB 2UV3A 5C9JB 1C5CH 1ZHKB 3C08H 1JZ2A 4HXAL 1H3PH 4F7PB 1A3RL 1C1EL 1CXIA 1AE6H 1UB6A 2DQDH 5FECB 4UTBH 2DF3A 2AV1A 4HMEA 5BV7C 4X4MA 4XP5H 1MNUL 4G80A 4IRSD 5IMMB 3VRIA 3F7VB 5KSUA 2MPAL 4DEPC 4N5UA 1UEMA 3H9YA 5H37H 3PWPA 4RZCB 3KYNB 1C5CL 3C08L 5I1AB 5IW3A 3WV0A 1K85A 1H3PL 4UIMB 4OD3H 2YD3A 4IRJD 2AK4E 2W0FA 3VE0A 5SWSB 5EU4B 1AE6L 3EYUH 3FQUA 3RIAK 5JDSA 5L8LB 3QEUB 3AFLA 5DHYB 5D7IA 1CBVH 5CCKL 3F8UB 4XP5L 1J1XH 1YNKH 3PNWB 3I6KA 1D5BA 1F4XH 2CMRH 4I0KA 5C09D 3FQXB 5T1LB 4Z7NE 2E7BA 1PW3A 2I9TB 3O41A 3GI9H 1F3DH 1HH9A 2OZ4H 2D4FA 1XEDA 5IB2A 1UB6B 4PJAE 3MXWL 1CBVL 1EUUA 5E2TH 4MNHA 1J1XL 4L4TD 1YNKL 5JNYA 4OF7A 3LRSA 1SJEA 1F4XL 1U8NB 5CJBA 2Q87A 4Y5VB 2CMRL 4G80B 3VRIB 5KSUB 3VMPA 4F15C 1CFQB 2D03H 3MJ9H 3IS1X 1HI6A 2W0FB 3H42H 2OZ4L 1GZQA 1NUNB 4MXVF 5DA4A 1R3KA 4G9FA 4LCCC 5JDSB 5E2TL 4WO4C 5KVGH 5FYJE 4Z7WB 2A6DA 4DAGH 3TNMA 3I6KB 4NFDA 1Q72H 3CCHA 4OD1H 5KZCB 1KEGH 1MIEH 3AU1A 5E4EC 3KNBA 3FO2A 1J05A 3NFPA 4ERSH 2D03L 3MJ9L 2X1PA 4ODWA 5EORH 5IUSA 1JWUA 1MHEA 1MJUL 5HYSG 3O41B 3S98A 3H42L 1MAJA 3L3GA 4P9MH 4X5XA 2YXFA 5IB2B 3KG5A 3NIGE 3UTZA 4ISVA 5KVGL 3ILQC 2HT4D 4MNHB 3REVA 5TFSH 4DW2H 4DAGL 4XTRD 2EE6A 4RFOH 2DLTA 5JNYB 1DE4A 4X6FA 3BUTA 3MRRA 3LRSB 4OD1L 1SJEB 5DWUH 1MIEL 5JPNA 4U1HA 5GS3A 1KEGL 4DKEH 3DIFA 4E41A 1A6AA 5EZJA 5EORL 4M4PA 4X6CA 2EYSB 4KDTA 5E8EA 4MVBD 4CNIB 1HI6B 3DROA 3HZKA 5DHVA 2GUOA 1R3KB 2EICA 1DVFB 3OGCA 5TFSL 4Y5YA 4RFOL 1MHPH 4HWBH 4E42B 1AHWA 3G6JA 1XF4A 5HVGB 1K5NA 4DKEL 3FO2B 1XFPA 3ALXA 1J05B 1E28A 5FV2A 4C56A 4PJCF 4LGPB 4ODWB 4S2SA 4G3YH 1I85A 1GJIA 1JWUB 1MHEB 4WTZG 1D5XB 1K8DA 4UQ3B 2X9WA 3L3GB 4HJGA 3B83A 3GMPB 4X5XB 3IDNA 4JY4B 5IK3A 3UTZB 5I1JL 4ISVB 1MHPL 1U8KA 3REVB 1FYTA 1JTOA 4KROD 5JPNB 3MCKA 4U1HB 5BS0D 3SGKC 3FQWA 3DIFB 4E41B 4NN5B 1PLGH 2EDJA 4R7DA 3VG9B 4DK3A 2HRLA 4G3YL 2R2EB 4X6CB 3SE9H 5F6HI 2GJ6B 1CFVH 3KYMB 1RU9H 1BD2E 5DHVB 2GUOB 3WLBA 4L9DA 3HCVB 1UQSA 1X4YA 5EOTA 1BJMA 4PRHD 5AEAA 4Y5YB 4ONGH 1RZJC 4WI2A 3S36X 2AQ1A 1ZT7B 3GZKA 1EEQA 3O6FD 4IBLT 5I8OL 3EYSH 1AD0A 1E28B 4NRYA 3WJJA 1HWGB 1S5IL 4S2SB 4PTTA 2CLZA 4JFEB 2R9HD 5C0AE 1K8DB 1CFVL 4U3HA 1RU9L 4LAQH 2JB5H 5EU6A 1OT2A 5FOBA 3E2HB 4KKCC 5IK3B 1BMGA 1RZ7H 4ONGL 2R0LH 1YY8A 3LN9A 3ZHLA 3KPRD 3VXNA 4RGMC 3EYSL 3MCKB 4BYHA 1N5YH 2A6KA 5EU5A 3DARA 2IQ9H 4ZO7A 4S1DD 2VUOA 4HKXB 3LD8C 4S1QH 1YNTA 1DEDA 4N1HB 1RMFH 4LAQL 1UQSB 4P5TB 1NC4D 2R0LL 5SWZE 5K9QG 4I4WA 1AQDA 5EOQH 4PFEA 1TJIH 2GSGA 1M71B 5HYSA 3TH4T 3DVIA 1P84J 3QXDA 5DUBB 3ULVE 3MNZB 5C0BA 5CEZE 2YA2A 4LKCA 1AD0B 1QHPA 2IQ9L 3RPIB 1QQDA 4NZTH 4PTTB 2C5DC 1EHNA 1RMFL 1P7KA 5F7DB 1MQKL 1KB5L 1HCFX 4Z18A 5GRZA 4YR6A 1ZTXL 3H6JA 2ZOKA 5T3XH 5EU6B 1Q9LA 5HHOD 1YEDB 4UINH 5DR5H 5TE4H 1DBKH 5EOQL 1TJIL 4W68A 2Y23A 3HR5A 5DD6B 4UAOC 3W0WD 1MHCA 5I30L 4LVHC 4GMTH 5J1SC 1A4JA 4KMTH 3HE6D 4GAJH 1G6VK 2A6KB 5B4MD 5D2NB 2J8UE 2FLRT 2WANA 4NZTL 4DGIL 3CVHA 3BIBX 3DO3A 3TZVD 3EW3B 1A9BA 1YNTB 5IKCB 1NMAH 2DYPB 3CAFA 5T3XL 3SDCA 2BC4B 2IQAA 4GW4A 5LAXA 5I75C 2XICA 4UINL 5DR5L 5TE4L 4KK5C 1DBKL 3QA3A 4GJTB 1ZS8A 5FDWA 4I4WB 1AQDB 2NXYD 3EFFA 4Y16B 1Q0YH 4GMTL 4KMTL 5C0BB 4PJ9D 4GAJL 4LKCB 2IEPA 2XKUA 4PJFA 3JWOH 2FX8H 2OK0H 4ZUSA 4V2BA 1GIGH 1P7KB 1NMAL 5C08D 4YR6B 1N3NB 4PYGA 2ZOKB 1JRHH 1Q9LB 4YX2L 1HZHH 4MAYB 2FECL 4POUB 1VESA 3BWUC 3VFOB 5DMGD 3VGFA 3EJYD 1S9XB 3QUKB 1Q0YL 1ED3A 3HR5B 4LLUA 4M8QB 5DURD 1IEBA 3HTLX 3QT2A 1NKOA 3AMKA 3VXSA 3JWOL 2FX8L 4PJGE 1GIGL 5D70L 1U91A 5GGQH 3ZKXB 4CDHA 3SDCB 1JRHL 2IQAB 4JO3H 3HS0A 1HZHL 2V9RA 1RK1A 3QA3B 1ZS8B 4KV5F 3VFRA 5FDWB 3QDGE 4Q9BA 1RIVH 1YQVL 4F3FB 4YC2C 1CTNA 3X11A 4JHZA 4EOWH 5L0QC 2BNRA 3QUYA 4Y1AA 4RGNE 4Y7MA 4JAMA 3WMSA 5GGQL 5JW3H 2CUMA 2DI7A 3HC4H 2J7LA 2LAAA 3FN3A 1PEZA 3VMNA 1S9YB 4JO3L 1HXYA 4G5ZH 3K74B 1IL1B 4YBQD 3AXLA 1MY7A 1LP9F 1RIVL 2GJJA 3FQNA 1ED3B 4LLUB 4TVPE 1ZT1B 2IANE 3BGMA 4JRXD 4UDUB 4JKMA 4YHLL 2LU4A 4ZTPH 1BHGA 1M7XA 3VXSB 4XP4H 2OR7A 2O93L 5JW3L 3BYTA 1MSPA 5FF6B 3FB8A 1U91B 3HC4L 1KJMA 2PTUA 3HZYB 2ICEA 1OWRM 4J3TA 1EFXD 5TE6H 3HS0B 2YWYA 4FZ8H 1RK1B 4NKIH 1CXLA 2DDQH 1ZGLB 3RX7A 1HOCB 2P46B 4I77L 5FA3A 4U33A 4KTYA 4ZDHA 4HWNA 4YWGH 4OZFH 4JKPH 5KJRH 4TUJB 2BNRB 3QUYB 4ZTPL 3S35L 4XP4L 1QUNA 4JAMB 1V3MA 4O5LL 3RRQA 1TNNA 2LTQB 1F02I 4Y2OA 4HULB 5TE6L 1HXYB 4FZ8L 3AXLB 1EEZA 4NKIL 1HKLH 4YWGL 2P1YA 2GEEA 2J2ZA 1QLFB 3EYOB 4ZYKA 5LWYL 1T2QL 5KJRL 1T0PB 1WWCA 3QSKB 3BP7B 3NN8A 2VXVH 5DMIH 3WDHA 4RFNC 3FRUB 3FB8B 3PWLB 1KJMB 3WKMH 3MXVH 5CGYC 4TNWK 4Y4FB 5CIPA 1T21B 1HKLL 5BZWA 3HUJF 2E7CA 5INCA 4M6MH 4YZFF 2A83B 3ULUE 1FO0A 5FA3B 2EXYD 4ZDHB 1AGDB 4AZ8A 5CKGA 4AK1A 3LQAC 2VXVL 5GGVL 4KI5C 2VLLA 5DMIL 1JPGA 1KOAA 5E95B 1BJ1H 1T89C 3MXVL 4NPYA 1QFWM 3KPSD 3U0PA 1EEZB 3ARTA 3CDFA 4K8RH 4P3DA 4PGCA 3SGJA 5IHLB 4M6ML 1GZPA 3B9AA 2I07A 1BPVA 5DD0H 2H2PC 3O6MH 2C3HA 5I1CH 4BZ1H 4ZYKB 3GSQA 1ZHLA 1F45A 1Z5LB 3M1BB 3VFPA 5DJYB 3MV01 1JNLH 1RJZA 1EEUA 5SWSE 3QBTB 5I2IA 5TJWK 4QRPD 2UY6A 4IMKC 1KCUH 4K8RL 5CIPB 4HG4K 1B3JA 5BZWB 5INCB 5BJTB 5I1CL 4BZ1L 4GT7A 1A8JH 4JQIH 1CT8A 3KS0J 1HHJB 1JV5B 1ZHBA 2DWDA 2VLLB 4DVBA 4HDIA 3UYRH 1AGFB 1JNLL 1OW0C 2YA0A 4NZUH 5DC4B 2DQGH 4LSPL 5F7KC 5I17A 3KYKH 1DDHB 1KCUL 2AI0L 3U0PB 4PGCB 3IDYB 3MV9A 1FVDA 2FJGA 4X7TB 1MRCL 4JQIL 4JHWH 2CQVA 1T03H 5JW4R 1R24A 2OI9B 1IGYB 1RJZB 4OLXL 2X4OB 5I2IB 2YA1A 3DMMD 3BDXA 1V3JA 3T3MF 1C08A 2AXJA 4Z7WE 3ILPA 4H0GA 5EIQA 5AZEL 4WY7H 3VD7A 1RZKH 4JHWL 4NC1E 1S9VA 3PP3H 1LVEA 1CT8B 3QEGL 4LASH 1ZHBB 4QHKI 1T03L 4P2OD 2DWDB 5IM7A 2IFFL 1NUDA 4MCYA 4D9QE 5F71A 5CMAA 5FM5O 1YEEL 2WIIB 2NY4C 1VFBA 4QRTA 2CK2A 2YD7A 3V4VH 3MV9B 2FR4A 5HPMA 4WY7L 5DJ6A 1BVLA 5ID0A 1DQDH 2VZ1A 3QCVH 4LASL 3VXMD 1KELH 4TYUA 5HYJD 2KUTA 3QUMB 3LSOA 4MD4B 4ZUVA 3NFNA 2ERJC 3V4VL 2JIXA 2YXMA 4PBXA 3KWWA 4PLNC 5EIIA 3B9KD 1C08B 3ILPB 1DQDL 1OAZL 5JXAH 1QFWL 1NEZG 2H9GA 3MRFB 4U1KA 5IM7B 3NCFB 4HGWB 1RJLB 1FSKB 1FFOA 5CMAB 4QEGA 4B53A 1X5ZA 3WHXA 4QRTB 2A1WL 4LEXH 4HIXH 1BZ9B 5JW5A 2FR4B 5HPMB 5JXAL 5DJ6B 5ID0B 4JKKA 3GIZH 4RMUA 1DQTA 5D9SA 4CBPA 4E41E 3AGVA 3P11H 4X6CE 3LSOB 1HSAA 2IAMC 2GJ6E 3WO3B 1CICA 1HYRC 3MLTB 3OB0K 2JIXB 3NGBC 4HIXL 2X89D 4NGHH 5EIIB 5CLWA 4OCWH 3UEZA 3P4LA 4JCLA 3OXRA 3GIZL 3MRHA 4JPIB 2BHUA 3LKOA 1OVZA 3WD5H