1ACYH

Crystal structure of the principal neutralizing site of hiv-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
QVKLQESGPAVIKPSQSLSLTCIVSGFSITRTNYCWHWIRQAPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLISVTNEDTAMYYCSRENHMYETYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA 59.1 FAB (LIGHT CHAIN)
publication title Crystal structure of the principal neutralization site of HIV-1.
pubmed rcsb
source organism Mus musculus
molecule tags Complex(antibody/hiv-1 fragment)
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH01
4F7PA 5JMRA 1Q38A 3GGWB 1QFOA 3PG2A 2AXHA 1BPVA 2X4NA 3KPSA 15C8L 3GMLB 5IROA 3T0EE 3EHBD 1D5IL 4N1HB 2YC1B 3W11D 2ESVB 3TH4T 1ZLVK 3RFZC 1I7ZA 1SEQH 3FN0L 5CJXC 1QFWM 1T83A 4BH7A 4QTIH 4ZTPL 3BE1L 5EZOH 3WEXA 1A6PA 2MQCA 3UYOD 3RIAK 4KQ4L 3HFMH 2AXJA 4LPYA 3B2UC 2HFEA 3QP3A 4JGMA 4MNGB 1J1XH 5HGGS 3QDGE 3AXLB 4NRZB 1HXMB 2G5BA 5F3HA 1MHPH 5D6DA 4DTGH 1BFSA 2VQ1A 4LSQL 3RVWC 5L2JB 5H94A 3NVQA 4HFUH 3D0LA 4PR5A 5GGVL 1CXEA 5FHAL 3BKJL 4HGMA 1AD0B 4LLUB 3HMXA 3F5WB 3HRZB 1KG0B 4XNQB 2NY0B 3FO1B 1EX0A 2XTJC 1YN7A 4POUB 4KDTC 1S9YB 5IGXL 1U8HA 4L9LC 3CLFL 2IBZX 3NOIA 1GAFH 1Q72H 4MHHG 2NR6D 1CLZH 4OZ4B 2ZJSH 1D5XB 4P2OD 4OV6F 4QOKB 5KVFH 3UTPD 3GSQA 5D7IA 3EDEA 1CDJA 4P23A 2D7PA 3T0EC 4Y16B 5JIHA 1OVZA 1AP2B 3P11L 1VCAA 1MI5D 5DJ6A 3ZTNL 1FL3A 2VISB 1UCTA 1MWAA 3OKKA 5LAXA 1Z9OA 5FA3A 3WFBH 3GI8H 2AJ3A 2H1PL 2HH0L 3IDJB 3QDME 1A7OH 4LDOB 5F7UA 5HXMA 3E1F1 5K93A 1CFBA 5SWZD 4PRNA 3GHBH 4OGYH 5KVDH 1A9BA 5DA0B 4ZD3L 5B8CB 3KNBB 1U3ZA 4L1HA 1TCRB 4YDVB 1UKQA 3MLTA 5ESQA 4FMFA 1I8IB 2EH7H 1NMCB 3DVGB 4LAJH 5FYKD 5JW3H 3V6ZB 2DLFH 3PWLB 1MFNA 4XCFL 1HI6B 3MOBL 4Y19A 4NQEE 1DBKL 4ODXB 5J6GB 1N6QL 5I8KH 4B7IA 4M02A 2F53A 5GISL 4O2FA 4X4XA 3RWJB 1KJ2B 2V7HA 3QIBC 3MBED 5KJRH 3DXAD 1ZVSB 3TVMD 1WZLA 1RIHL 2F19H 2QHLA 3QHZL 3BRFA 5I74B 2VIRB 5IK3A 3LD8C 5F72S 1KPRA 2EE6A 3DRQB 1IM3B 3EJYC 1YEHL 2J8HA 1A4JA 4KKCD 3DROA 4JY4A 2D0HA 5C07E 4H20L 4KROD 3C6SA 3OJDB 4OZGA 1B0GB 5IVXE 4WV1A 5C0JB 2W60B 3ZL4L 3OF6A 5HDOA 1JGLL 2ZUUA 3F7RA 4KMLB 3SQBA 4AQOA 4ODSL 4PRAA 3MZTA 4JB9L 3QUXD 4NRXA 4Y4FD 4PJCA 3MLVL 1ZXQA 1DBBH 5E9DD 5I1GH 4MJ5B 1IGCL 4ZXBD 3PWNB 5JMOC 1MI5B 3VFVA 5FCSH 5AG8A 1K6QL 3CFDA 3WUZA 3L3HA 5TE4L 5T1KD 1DFBH 4G9DB 5ALBH 4X6CE 4U1GB 3L1OL 2BNRE 4M6OL 3WDIA 2VXQH 2KH2B 6FABL 2UV3A 4DZ8B 1OGTB 1K8DA 3B5GA 1FL6B 3U0WH 4M7LL 2V6HA 3S35H 3SGKA 4NO0D 3TF7C 4ZUUB 4GKNA 2CPCA 2Z91B 3G9VA 1M1SA 3PQYA 2GY5A 3L95A 2ZWLT 3DV4B 4F7CB 3QJFB 4AEFA 1QFPA 3GRWA 1MCKA 2X7LA 1WT5A 2CDEA 3MBEB 1C7SA 5HHVH 3DXAB 1LP9F 5IMKB 1R3IL 1IT9H 4RA0C 4CDHA 2R2BB 2BFVH 4ORZC 2CR3A 4X6EA 4K55A 1GC1L 4S1RL 3CVHH 1ED3A 3STLA 1E4KC 1E28A 4FRWA 4QXGH 1KUMA 3N0PB 3BKML 5GGTH 4PJ7B 3B3IB 5FYJL 1X9QA 4KROB 5DQDH 1YA5A 1ZLWK 4UAOC 3RTQC 3P4NB 4FFYH 4N0UE 1TPXC 4WVRA 4N1EA 5DEZA 4FQQB 4MQXD 3B9EA 1KSRA 1SEQL 1Q9KB 4BZYA 4LVNB 4CVWA 1G9MH 2AXGB 4QTIL 3GIVB 5EZOL 4ORGA 1Q0YL 3LRSA 5TH2B 4OI7A 5CMAA 1HYSD 1LE9B 3P9MB 3CJJA 3IFPB 1UJTA 1HZHH 2WK2A 4DTGL 2Y5EA 3ARDA 1F13A 1KPUB 5T1KB 2QEJA 1BD2A 4MA1B 4HFUL 2A73B 2IPUG 4CMHB 2RB8A 4X7TA 3RVTC 4JN2A 1I85A 4KVCH 3OAZH 4U0QB 5L2KE 4YEEA 2V5YA 3GHEL 1UJ3C 4NO0B 3SQOH 4A6YH 5MEQB 3HS0A 1HINH 3ILPB 4I2XE 2Y06H 3IU3A 4LEXH 1MCWM 1GAFL 1Q72L 3HUJE 1CLZL 2ZJSL 5GGRA 1CD8A 2PW1B 1HILB 5FEBA 3K2MC 5E2UH 2ERJC 5DYOB 5KVFL 5ITBL 1K4CA 2FO1A 2HLFD 3UPRA 1CL7H 1P6AB 2FO4A 3A6OA 2J4WH 3O3AA 3FJTA 1FVEB 3IXAB 3NZHL 1U3HA 4S1DD 1ADQH 2A0LC 3S36X 1T5XB 5ESAA 3WFBL 2N7AA 3CLEH 3GI8L 1NCDH 1ZWIB 4LPTA 4W6WB 5EZJB 4BQ9A 5DXWA 5KSVA 1E4WH 2YOCA 2WP3T 2P44B 4OF8A 3GHBL 4OGYL 4WU5A 4UT6L 1M7IA 1T04A 2OP4H 1F45A 5D7LB 2HTLC 3AM8C 4LSVH 1XF4B 2E7LC 4QHUB 4C56A 4U1JB 3QCTH 3BMVA 3MV01 2A83B 2Y5TA 4L8BB 1GVIA 5JW3L 2DLFL 4LCYA 5DK3A 3V0VA 3EYVA 1NEZA 1NFKA 1JWMB 4MQTB 4XI5C 1J0KA 1ACYH 4I0PD 1QRNE 4MXQD 1U8NB 4GRLD 4OLZH 3OV6A 3OX8A 1ODAA 5KJRL 1MLCB 4KJPD 5DF0A 1MLBA 3QQ4B 4U1HB 3U6RB 4I1NB 3UTZA 2F19L 2V2WA 1KCKA 4IRSA 1QRKA 1QBAA 1UM6H 4G8EB 1ZSDA 2DIAA 3TT3H 1I4FB 1DTUA 5F7WC 5DO2D 1R5WB 1DN0B 1NGZA 3QG7H 4HUUA 5ICXB 2NW2A 3V8CA 5IF0A 5DUBB 4LGRB 4NCC2 3MV8A 1OD9A 1BECA 4Y88A 3IS0X 1S7XA 1JGDA 3TLRA 2MCPH 1NCCH 3C5JB 3DGGA 3MV7A 4FQXC 4EDWH 3MJ9H 4PY8J 5SWSA 5FDYA 4HKJB 2J5LC 5AZ2H 2E9BA 4OLWH 1A7RH 1I1CA 2XQBH 1OF2A 5IM7A 5I1GL 1I8KB 5DHXB 4EI5A 3VXMA 2DYPD 4G6KH 5HI3C 3T4YB 1UZ6E 3A67H 4PGBA 5F1SA 3GJFH 4TSAH 1CFNA 4Y5YB 4M1CC 2XKNB 2GJZB 5ALBL 5F93C 1K85A 1JYVA 1FV1B 5F6HJ 4HUVA 4NNYB 3B9AA 4NN5C 2KQNA 2YD4A 1CICC 1KYOK 2VXQL 4ZFFB 5F3BA 1IILE 5EU5B 5JZ7D 3U0WL 1JNLH 1C1EH 4HQQH 3V6OE 2FR4B 1A02N 1L0XA 4MLIA 4JFYA 5EO1B 3I75A 4I0PB 5EO9A 4NKMA 4GRLB 4EOWH 2R15A 3NTCH 2AABL 1IGTB 4L4VE 1MY5A 4ZOEA 1QO3A 3WJLA 4JFHD 1IT9L 2SEBB 1P53A 4XVTH 4JFPB 4R3SA 1AKJA 4PJFF 5GGSB 3CVHL 3D2UD 1KTDA 4U0RC 3I85A 5IT2H 4QXGL 1TLKA 5GGTL 4R4BB 3C08H 1XZ0B 3AB0C 3DX7A 3TBYB 3EBAA 5C9JB 1HE7A 5DQDL 2YMXH 3F7YA 3CX5J 1RJYA 2BNUA 4LCCB 4O2EB 1HXYA 1ZTXH 5FA4A 1B6DA 3KLHC 1H9VA 3BXNA 3EYOA 2P5WE 5EO0B 4MJ6A 2AV7A 1FPTL 2DD8H 5MENA 4CVXA 2FHCA 4TNVK 3HMXH 2AAVA 4FQLH 3KPPB 2R39A 1G0XA 2R1YA 1Q9WB 1NUFA 5SWQB 2X89D 4HCRL 3MO1A 4RGMC 3V6OC 4DWHA 2PW2B 4TRPH 1FZMB 5J12B 1U8PA 3ARYA 1N6VA 3SGDH 1TQBC 5I1KH 4QTHB 4WI9A 3HI1B 4NT6A 1FLTX 1FO0B 1JPFA 1PZUB 1NCBH 5T5FH 3EYQD 1MWAH 3AFLA 3SQOL 4A6YL 4BZ2H 5EU6D 2Y06L 4LEXL 4JG1H 3V5HA 2J8OA 4WWKD 5E2UL 3ARRA 3Q0HA 5LGKA 3JV6B 3G6JB 4QCIB 1BP3B 3B8SA 4OKVB 4MAYC 1CL7L 3QUZC 4MWFB 2J4WL 5T1LA 3DHJA 4OSUH 1BZ9A 1KCVL 2YBRB 1ADQL 1J0IA 3MXVH 4IOSD 4NFDA 5C3LD 2JLLA 3CLEL 3MA7A 1NCDL 4OCRL 1NANH 5L9DH 2VL4A 3D2UB 1E4WL 1QPPA 2IWGA 4M8QB 5INCB 1FIEA 3P2TA 4H25A 3OG4B 4GUPB 1XF5A 5C09E 3CMGA 5BV7C 4LSVL 2AW2A 5C07A 2JB5H 3QCTL 5AAWA 1PSKH 4HZAA 3RHWF 3AGVA 1TZHB 1I1RA 1H5BC 3B83A 3N1FC 1I1FB 5DHYA 5HY9B 1VESA 3UPAA 1U91A 4LGSB 1CE1H 4JFXA 1R5IB 4WHDA 1XCTB 2FBJL 1JFQH 4J6RL 3T0DA 3PDOB 4NCC1 4RMUA 3BP4A 1NCTA 1LK3H 1YNKH 4JDVA 3O2DH 1KEML 1XIWD 5DJZB 1UM6L 2AI0H 4KXZH 3TT3L 3QG7L 2Y07H 2AJYL 3MJ6A 3LSOA 4QRTB 4XRCA 1CDCA 2ARJA 5JIIA 4U2YA 4EIGB 1A2YB 3RI5F 1NJ9A 2BNRA 4ODWB 2MCPL 1NCCL 2XWJB 4XC1L 1S7UA 1URLA 2R0LH 5EU6B 3O8XC 5AYQA 4FQHB 2HJKA 2LAAA 3MJ9L 4EDWL 5D5MA 3QCVH 2B39A 4OLVH 3K7UA 4MJ4A 1FCCA 3EGSA 4WWKB 4OFYA 5AZ2L 1RK0B 4OLWL 1A7RL 1KEGL 2VOTA 2XQBL 4PGCB 5K9QG 2EIEA 2VLKD 4EN3C 4MA8L 3BGAA 4ELME 2V2XA 3BN9D 2CIKB 4MCZA 5I73C 3A67L 1UVQA 1R5VA 1NDGA 1VGKB 4TSAL 3ZE1E 5IFJB 1S7WA 2CUIA 5HYSA 4FXLA 5H35B 5KSBB 3ARGD 3EKCA 3SEPA 5F7FA 3OPZL 4OZFB 3NCFB 4UT9L 4M3JA 1JNLL 3QPQD 3IXTA 1C1EL 2FECL 2AQ2A 4D8PA 2OTUA 1LNUA 5T3ZL 4LVOB 3R06A 3KPNA 1IQWH 2H26A 3ILQC 4EOWL 1X4ZA 3NTCL 3QWOA 2A6IA 3QIUA 4X6DA 1YZZA 1CT8A 2GAZB 3MREA 5DQ9B 2VZOA 3QDJB 3CFKA 4PTTB 3O0RL 1KN2L 1UWGH 3G5ZB 1XIWB 3FFCA 1L9MA 3NFPA 3FOMA 5IT2L 4C54A 3VE0A 4HZLB 5EZIH 4X7EC 5LCVL 3C08L 1JYWA 5DJYB 4HXBH 5HDBF 4BKLA 2YMXL 2YPKA 3B2VL 5DSCA 3LKNB 5F8RC 4HC1A 5SX5K 5HI5C 4J3OC 4YHMH 2NW3B 4PJDE 4O9HL 4YXKH 4Z76A 4ZS6C 1ZTXL 3TN0C 5JW5A 3VXRB 2HN7B 1FN4B 1OCWH 4NQCA 1BIHA 2DD8L 2CRIA 1CG9A 3HN3A 4P4KC 5DRXB 2BZDA 2FJHA 1JVKA 2F8VA 1G7JB 3HMXL 2VLKB 4KPHH 2PXYB 3PGDA 1NKRA 3CMOL 5T3XD 1E4JA 3GSWA 4JDTH 3UZEA 1RULH 2FL5A 4MHHI 5I1AB 1KJMA 4QOKE 1U8OB 3QNZA 2CUMA 3ARFD 3RY6A 1HQ4B 2YUWA 3L3DB 1KOAA 4P5KB 2C1OA 4PJAF 4TRPL 5KOMC 4UIKH 2ZUSA 3QT2A 3WV0A 1IARB 3FMGH 5J4MA 2WIIA 4PJEF 2FLBT 4XNMB 3TO4D 1TIUA 1DUYA 3ARGB 4BJLA 1CGUA 5KW9H 1T0PB 1UA6L 5SX4I 1NCBL 1OAYH 5T5FL 2ZCKH 1MWAL 3TYGH 4PRBA 4HWBA 4HV8B 3QFJD 4GXVH 2GW5A 3CPLB 5JHDD 4CL7A 1JI2A 4BFGA 4Z77B 2CJUL 2J8UA 2YA2A 4IJ3B 1FVDB 2VTFA 3CUPA 1CICA 4OSUL 1IEBA 4ONHA 1G7QB 4U3XA 3MXVL 4GAJH 5J06A 3EFFB 1F6LL 5J8OA 2VN7A 1TMCB 4HIHA 3E2HB 4POZC 3WS3A 2NY0C 3RGHA 4LGPB 4W6YB 2YD3A 3BDYL 2QQNH 2DKSA 1J1PH 2YPLD 4O5LL 3X14B 4Q6IC 4DAGH 1PSKL 4MJ2A 4PGDA 2JCCA 1C16A 1MNUH 3BP7B 4C83A 1SBBA 3IAPA 5IHUL 1YEKH 1F11A 5FUCE 2OJEB 3DECA 5CBAB 1W0WA 4G9FD 4UOW1 4Y16C 2B4CC 3PIQB 5HSFA 3W9EA 5ISZA 1JFQL 5HHPB 3DX9A 5CEYB 1I8MB 5I0DA 4G6AC 1LK3L 2HFTA 3VCLB 4M93B 1YNKL 5B8CC 2NYYD 3O2DL 3UTPE 2AI0L 3LY6A 2JK5B 4L9DA 4DGYH 1NMCC 3NFSL 3EHBC 1GYAA 1U92B 2Y07L 3C2SA 3W11C 1MI5E 5DDHB 3TO4B 2G60H 2IFGA 3D39B 3QO0B 1ONQA 3HG1D 4ZO6A 5FV1L 5SWZE 1S9KC 1JNNH 4I3SH 1NLBH 2R0LL 3QFJB 5DURD 3QCVL 3RX5A 5JHDB 4OLVL 5I1LA 4HEPG 3O3DA 5FYKE 1ZGLA 4RSVA 2JB6B 4OCNC 3VDCA 3NIDE 4BUGA 1I75A 2VZTA 4L4VA 1FNSL 3BZFB 4JAMA 4G6JH 1BVKB 5F7EH 5KTEL 4NHUA 5FUCC 4PJIF 1DEEA 4GKOA 1EVTC 3DXAE 1JK8A 4HIEA 3GRWL 5C92A 1OAXL 1WIOA 2XQYK 4M8VA 1FCGA 3BWAA 2EYSA 4P2QB 2NR6C 2CIIA 1BIIA 1UXWB 5JXED 4S1QH 4MAYA 1BX2A 1REIA 3TGXA 1UWXH 3PWVA 4OZHF 1MAMH 5DVOA 1F3JB 5I8EA 1QOKA 3O6KH 3JTSB 3AMKA 4WUUE 1DR9A 1EO8H 3JTTB 2UY7A 5E00B 2P5WA 2QL1A 4G8IA 4Z0BH 4KH2A 1U58A 3MRCB 2B8OT 4RDQG 1N5AA 1RZKL 1JI1A 2RCSH 4MJIE 5GHWH 1NEUA 5MP6L 4NQVB 2E5EA 4U1GC 4XX1G 5I1HH 2VABA 3NMEA 1UWGL 1WJ3A 1ERNA 1I7RB 1T0NB 5HPMB 1MREL 5E9DE 1KTLA 2CLVB 4I18B 3W5NA 1H5BA 2X70A 3DTXA 2VDQH 1ZHLA 5F9WB 2JE8A 3WUWA 2FWOA 3HG1B 2X4QB 5ICZA 1G7IA 2VXUH 3ARBB 3QUYD 4RIRB 1KB5A 3CFIC 5EORH 4LQFH 4X8XA 3FT4A 1OW0C 3STZA 4YHML 4LU5H 3SBWC 3MYJB 3SO5A 4NQDD 4XMPH 2HVKA 3V5DB 3BO8B 4YXKL 2WSKA 3G6DL 5E70A 5MEOB 1S9XA 3MBEC 1JHTA 1RZ7H 1S7RA 2AERT 5DURB 1AQKH 4OCMC 1OCWL 5IKCA 2CXKA 2P8LB 5JW4N 1N0LA 4OBSA 5C0AD 2DQIL 1PKQB 1EMTH 3BUTA 2BOCB 1BQUA 4JDTL 1MCCA 3SPVB 3L7FB 4YDJA 3REVB 2KPNA 4MNQA 1IZJA 3RNQB 4KROC 3N85H 3PNWB 1LK2B 3OXSB 4XBPB 4X0KA 3O8XA 2CH8A 3MRMB 2AXFB 3FMGL 1J5OH 5HYEA 1CDBA 4EUPA 3BQUD 1MCEA 3MUHL 2QADD 5HHQA 1OAYL 3MJGX 5C0CB 5IEKA 2ZCKL 2VO5A 3TYGL 4EN3A 4YJZL 1E27A 2Z92B 4HEME 5EUOA 3U4EA 1T1XA 3CX2A 4Y4FC 1W72H 2D9CA 4ZXBC 3S3SA 2MKWA 3BH9A 2XN9A 3P9WB 5CD3A 4RWHA 1LVEA 1CZ8H 2DQJH 4Y8DC 1AH1A 3L3KB 3TYFA 1QQDA 4FFZH 4NC0B 3R1GL 5K59F 2IGFL 3RU8H 1A6AB 4CMHC 3WJJA 1VKXA 1X5HA 3P0VH 3VFNA 3D6GA 1B0RB 4JO4L 4QWWD 4Y0GA 5IG7B 4JFQB 4DUXA 4CVZA 3MNVB 2QQNL 2EDYA 2ID5A 1NCWH 1UM4L 1J1PL 3BW9B 4HJGA 5A16B 4DAGL 3GB7B 1MNUL 2C4XA 4HULB 4NQDB 1D6EA 1Q94A 1UC6A 4JRYD 4JHZA 1WIUA 3U4BH 4HLZH 4L8SA 1XGPA 1B2WH 2AKRB 5HHMB 4D9RE 1PLGH 2GJ6A 1L6ZA 4FQIL 4FXKA 5CILH 5C0AB 2EECA 1YQ2A 4HS6A 4U7MA 5JLZB 3FKUS 2W91A 1DLHA 1DQMH 5KSUB 5GSVB 3CC5B 4R9HA 2AGJH 4JANB 4ELMA 4P57A 4YNYA 4DGYL 5FGSA 2VLLA 5BQ7A 2ZUQB 4G8GD 2JIXA 3PGCA 3BQUB 4MQXC 4HIJA 2G60L 3B9KA 4R26L 4X4YB 1V05A 2QADB 3MRPB 4H5SB 1JJUA 4YHNB 1IC1A 1GIGH 3NFNB 3VXUD 3ZLQC 1NLBL 2BSTB 2VZVA 1NUGA 2HFFB 1M05B 4N0CD 5MHSD 2I5YH 4OF3A 1HYSC 1JWUB 3GMLA 4JPVH 3V6FB 1H3PH 5DC4B 3DARA 2YC1A 3IFOA 3QEGH 2ESVA 2BVEA 4RX4D 1NBYA 2AJXH 3RDTD 4G6JL 5F7EL 1NMAL 4ONFL 2DS4A 1QTYT 1OWWA 3DI2B 5LQBH 4X7SL 4XH2A 4F3FB 1X5KA 3LN4B 1UB6B 4MGXA 4OZGF 3FTGB 2K9UA 2ZUVA 2XA3A 4MNGA 5JOEA 2P24B 4W4OA 2BY1A 1J8KA 1A6UH 1HXMA 2V5SA 3BJLA 4MD0B 4NYLB 2DAVA 2A1WL 1QR1A 4AIZB 4XNYL 1YEGH 4S1QL 4EI6A 5L2JA 3SCMA 1MAML 4JRYB 5IVZB 2HLFC 3O6KL 3VFUA 4PJCF 4TTDD 3K0WA 4N0RA 4X7DC 4NOBA 3LZFH 5E6ID 1EO8L 1FFNA 2EDTA 4O2CB 4LLUA 1VADA 1K8IB 4S1DC 3F5WA 3V4VH 3HRZA 1KG0A 4XNQA 1P4BH 2PTUA 3FO1A 4Y5YC 1HCFX 4HC1H 1S9YA 4MB3A 5GHWL 2RCSL 1FBIH 1IAOA 1DP0A 1TJGH 5I1HL 4F7MB 3CAFA 3CU1A 4GS7B 4HKZB 4KHTL 4CUCA 5D7SH 4WDIB 4Q9QH 2VDQL 1N4XH 2VLMD 5FYJD 5HDLA 4QF1A 4X9BA 1T66D 1AP2A 1JF1A 2VISA 3NIGE 3ZDZE 3AU1B 5DRZB 1QFUH 2CKNA 4I0PC 3QISA 3IDJA 4MXQC 4LU5L 4GRLC 3VXUB 3GBMH 4XMPL 3S36L 3HZVA 3O6FD 1ZLUH 4YK4B 3IRZA 1RZ7L 3T0XA 2XG4A 3BGFB 3SDDB 5BOPA 1RD6A 5GIRA 3KNBA 1WBYA 3FO2A 2RBLA 4MD4B 5GRVK 3WHE1 3WN5B 4YDVA 1WUNT 4OM0H 3MRJB 2P48B 1EMTL 4LCIH 3DVGA 2DF3A 4R0LB 3KPRD 4YEFA 3V6ZA 3PWLA 5DWUH 3ZKMD 2VAAB 2MWCA 3RDTB 5AUMB 5DO2C 3SKOA 1T0MB 2J6EA 1Z5LA 1HI6A 5DUMH 4G43B 5J6GA 3CFEA 3G6JE 1KIQB 1KJ2A 2C9AA 4JFHE 1J5OL 2YUVA 3WFZA 5D1XD 4P46D 4OAWB 5F8QC 2VIRA 5ADOH 5T5NF 1IM3A 3VXQA 4U1IB 1DE4B 1IGIH 3E6HA 3TESA 4OB5L 1Z0NA 1F02I 3K4DA 1W72L 3OJDA 3ARWA 1B0GA 3ABZA 4GW4B 2NLJB 1CZ8L 2DQJL 2W60A 4TNWF 1V3LA 2ATKB 5AAMA 2CLRA 4FFZL 3K74B 3TP4A 3ARED 4WFFD 3HR5A 5E8NB 3BP5A 5D6CA 4QHMB 1ZS8B 4OI9A 2BX5A 3AS1A 5JZ7C 3EYSH 1GGTA 3OGCB 4ZUTA 2E6JA 4MJ5A 4JHAH 2XRAH 4D3CH 3WIFB 1NCWL 4UIMA 1V5JA 2E7BA 4OIIH 2UZIH 3STBA 3MSPA 1OAQL 4G9DA 4P49A 3O6FB 3LAFA 3U4BL 5LXGH 1B2WL 1MVUA 5F7DB 3MV9E 3T3PE 4IMLB 4HXAH 5GZNC 4DZ8A 4IDJH 1FL6A 4GAYB 4NO2A 2FB4H 4DZBB 2BVPB 3KPRB 1DQML 5IBTH 2FD6H 1UADC 3FFDA 3EOAA 1G1CA 5B4MD 2IBGA 2O26U 3DV4A 4PJHB 3QJFA 5K9QI 4EXPX 1HQRA 4XGZA 1LO5A 5IMKA 3NIFF 5D1XB 4P46B 4PRPD 1D9KA 1NUNB 1R24B 4W4NA 5KSBE 2XYCA 2NY4D 4PJ7A 3B3IA 5C08B 4F37K 1A8JH 5MERB 2I5YL 5C0EB 4MCYB 2EYRA 4KUCF 1EFQA 4JPVL 3ZHKA 1CLCA 3VFMB 1H3PL 3G5XB 2VE6A 3P4NA 4H1LB 4X4MA 1ACZA 4FQQA 4KV5F 3HNSH 1E4XI 3FOLB 2IJ0C 2AJXL 4YFDB 3FN9A 4PGJA 1Q9KA 4KK6D 4FN0A 3TCLB 4Y4HA 2AXGA 3HMWH 2MOVA 1OSZB 2EICA 5CUSL 2KDGA 3EYQC 4LMQI 4RAUA 4K9EL 3I6GA 1OM3H 4XXCA 1LE9A 1A6UL 1UB5A 3IFPA 4JRXD 4WI7A 1EBPA 5BV7H 2RQ8A 2GI7A 3CSPA 4N0FA 4PP2A 2WP3O 4PRDB 4WWKC 1YEGL 3KHQA 1CD1B 1KPUA 3QO1A 5T1KA 3ORJA 1J0JA 1ORSB 5DJ8B 2A73A 1MFEH 2Y23A 2R0WL 5ID1B 1FDLH 2EEAA 5EWIH 3WIHA 3IDNB 3LZFL 3V4VL 3JV4A 3NCMA 1DL7L 1P4BL 3UCRA 2EDJA 1KB5H 4NO0A 3TPUB 4HC1L 1EFXD 5MEQA 2N4IA 3QEQB 1LD9B 5SX4H 3ILPA 3IDYB 1CXKA 5EG6C 1FBIL 2QQLH 5J9PB 1TJGL 2DJUA 4LLWB 2E7HA 1HILA 3RWCB 2IADB 5DYOA 2AQ3A 2VLKE 3V5KB 5E5MB 4UDTA 5D7SL 1VFBA 3L3JB 1PZ5B 3IXAA 1X5ZA 4KHXH 2N1KA 2AP2A 4GOSA 3VFSB 1QFUL 1T5XA 4LVOC 4L3CB 4PRPB 1ZWIA 1A7QH 3FO9B 1P7QD 5EZJA 5HGAB 5DD5H 3GBML 1MRDH 1CU4L 2FJFA 3GSOA 7FABH 5TDOA 4TVSa 1KGCD 4KZDL 4U6TA 1QACA 1IAIM 5D7LA 4LOUD 2F54D 4N8PA 1CFQA 3VGGA 1JZ7A 4OM0L 1M7DB 3FN3A 4U1JA 3O41B 2A83A 2VDML 1XIWC 3CSYA 5DWUL 2Z35B 1WLHA 4HWBL 3PDDA 2CRMA 5DUML 1CN4A 2V5MA 4NQSB 3NBNA 4ZFOB 3LHPH 1IL1A 1U8NA 4W81A 3ZSTA 4HJ0D 3CGTA 3H2WA 4YXLH 3S8WA 3RX7A 1MY7A 4ZDHB 3WHXB 3QQ4A 1H0DB 1AGEB 3D18A 4U1HA 3U6RA 1AHWB 2X4OB 3RZWA 4JRXB 5J0BA 1IAIL 5DFWH 5EUKB 1DQJA 3OR6B 2R8SL 5ADOL 4QYOB 4ZQKB 1X4XA 2BHUA 4F33B 1R5WA 3TBSB 5DJ0A 4RISH 1IGIL 2X9XA 4KWUA 5FKAA 5ICXA 5F1KC 1MCRA 4XHQA 3BN9C 3L9RB 2PYED 2OTWB 3DX6A 4Y5XB 1XR8B 4PJEB 1HHHB 5GS3A 5JQHC 1EFXB 3KG5A 2XICA 3DNKA 3LKRA 5E2JA 1P84K 5KSAD 3ARGC 4J4PA 3O2WH 3C60B 4HKJA 4M03A 3EYSL 4NN7B 5FFLA 3OB8A 3W0WB 3LS5H 3QPQC 2X4SB 2XRAL 2ZSVB 4D3CL 2F8OA 3W82A 2Y9RT 4OIIL 1IKNC 2UZIL 2EYTB 4PG2C 4OV5B 1P7QB 4JRWA 4Y5YA 3F6LA 2XKNA 2EKSA 1WTLA 3GJEB 2GJZA 3NAAH 3RWHB 3ZE0E 1LEIB 4FQ2H 3GBNH 4IJ3C 1FV1A 1DQQB 4Y5VB 4D0CA 4ZFFA 3FQNB 3KYNB 3PP4L 1NBZB 4HXAL 5HVHC 5CIPB 1FL5B 4H26A 3SDAD 2FB4L 4L4TB 4QXUH 4GLRI 1PG7W 2ITDB 5JHDE 3E2HC 5BCAA 1IGMH 1U93B 3HE6B 3IVKB 4LARH 1S9VB 1LO2H 2Q86B 5CKGA 4GRLA 5TFSL 3CDGB 5FM5O 4ZFZB 1IGTA 4I8DA 1LE5B 2Z9TA 4RFEB 4C55A 2FRGP 4I77H 2SEBA 3MGTB 3HPLB 3VGBA 1BM3H 4JFPA 3RVXD 4H8WL 3F7VB 2D0FA 5DJXB 2W9LA 2IPTH 3KDMB 3HI5H 1X5GA 4R4BA 3TFKD 4DN4H 2Y72A 2YPLE 1XZ0A 3QHFH 3TBYA 1BQHG 1E6OH 3OKNB 1MIEH 4CVUA 4K7FB 4M93C 1NCAH 3ZHLA 3ARFC 2JTDA 3VWKD 4LCCA 3ZMRA 3HNSL 4G9FE 4O2EA 4XP9H 4TVPD 3ESUF 3TO4C 5KSAB 5EO0A 1ZT1B 5IMLA 3HMWL 4ZS7L 3QZWG 4R4FL 3SO3B 4KZEH 1UENA 1OM3L 1Q9WA 1DN2A 5SWQA 3BRDA 5I9QB 5BV7L 4L8CB 4XB8A 2Z93B 2PW2A 5D5MF 4R97B 3HG1E 1MFEL 5EWIL 4QTHA 5T3ZD 4OCYH 1FO0A 3S4SA 3QUKB 3KPSD 2GKIA 1ZT7A 3SDAB 4XZUB 5IMMA 3O4LB 4U7KA 1KB5L 2B4CH 4FQJH 4XBEH 3U9UA 1YJDL 1KIRB 1JBJA 1PKQE 1RHFA 3RVVD 1LEKA 5I76B 3JV6A 5EIVA 2OS7A 3EYUH 4OZHB 1DQLL 1N8ZB 4QCIA 4LIQE 4Q2ZA 5E2VH 4AM0B 1D5MA 3AAZB 2YBRA 3L5XH 1UACH 4KHXL 3VMOA 3I6KB 3ZZ1A 4P3WA 2NPLX 2LAGB 1A7QL 4Z7VA 3EOTL 5DD5L 1MRDL 4M8QA 1T4KB 4QNPE 5K9KB 1V7ML 3WNNA 1KJ2H 4GUPA 4X6DF 4LAQH 3IJSA 4KMTH 2NYYC 4I48B 2APTA 4GO6B 2M2DA 4I18C 1TZHA 5F9WC 5HY9A 3I50H 1LO0H 2CDGB 2LU7A 2A9NL 2X1QA 4YXLL 1R5IA 4UMGA 1XCTA 1O5DT 3FT2B 4EEEA 4J12A 4DKEH 3M1BB 5B39G 2GTZB 4P23D 4RGND 3CZJA 1MCFA 2OL3A 5DJZA 2ICWB 3EO1B 3OR7A 3QXWA 1DDHA 1VFAB 5I75B 4QRTA 43C9B 1IAKB 3S9DB 3QH3B 1R3LB 2DQUH 2F74B 4IEFB 1A2YA 2M1KA 5LWYH 2X4NB 3KPSB 2XZZA 1YPZA 4ODWA 1OTSD 5D9SA 2XWJA 2OXGA 3G5VA 1BLNB 4HH9B 5EU6A 5I71B 4X9IA 5H2BB 1PAMA 2R29L 3O2WL 5IFAH 2GCYA 4Y19D 1RK0A 3QSKB 3MRQA 4PGCA 2P43B 1FORH 2F53D 3WEXB 3LS5L 5JXEC 2APVA 5FYKH 2CIKA 4OGAD 2HFEB 4NWUL 4Y1AD 4EJ1C 2B0SH 4FQ2L 4ODHH 5H94B 3D0LB 4IIQB 4XXDA 4Y4KA 4I4WA 1A7NL 3MXWH 1BWWA 3T3MF 1I3RB 4LHJB 3HKFA 4J8RB 2WW8A 1WQVT 3OF6D 1IGML 5DRNB 1G9EA 2V17H 1U8HB 4LARL 1EUTA 4P5TD 1D6VH 5D2LB 5FF6B 2Q8AL 4P2CG 5ECJE 2GAZA 3GSQB 3EDDA 5EIIA 5D7IB 5DQ9A 2JCCF 3QDJA 1FAIH 4LRIA 4PTTA 4MDJB 4UU9A 1FVCB 1BM3L 1NL0H 4RGNB 3OG6B 3G5ZA 2DBLH 3OKKB 2ZG1A 2IPTL 4LLVA 4HZLA 4HWEL 4DN4L 1MFDH 4P3DA 3QHFL 1E6OL 4PRNB 5DJYA 1A9BB 1MIEL 3EDKA 3UDWC 3CXHK 4NZTL 1NCAL 2I26N 3LKNA 5JHLH 4JRYE 1MVFA 3MLTB 5ESQB 3ZT6A 2NW3A 4X98B 2X05A 4XP9L 3ARQA 4PB0H 2ZSWA 3VXRA 3BQUC 3AY4C 4F58H 2XNAB 2QADC 1ND0B 4Z7UB 3PQYD 3T2QA 5HVFB 2F53B 2XKUA 3MBXH 2PXYA 3L7EB 5JOPD 1A0QL 5I1AA 4OM1H 5GRJH 5LGJB 4Y1AB 1C5BH 1HQ4A 1TVHB 5DMJB 5L6YH 3L3DA 4G8GE 5DZOA 3PHSA 1SJVA 5B22A 1KYOJ 2HKFH 3QFDB 3CXDH 1X7QA 3P0YH 1MFCH 3DX8A 2ORBH 1A4JB 4OCYL 5HHOA 2OK0L 3FQTB 3VXUE 4JY4B 2W0LA 2VR5A 3UJJL 4MX7B 1HOCB 2B4CL 4WV1B 2HYMA 3BVNB 4XBEL 3BIAX 2H45A 4QWWC 2C5DC 5MHSE 3MLXH 5D96B 1IKNA 3CPLA 4P5TB 3AVEA 2EXWD 1VFUA 1CGWA 4Z77A 4PRAB 1T7WA 3EYUL 5TDNB 5IUSA 2WLZA 2D03H 3VI3F 1FVDA 5E2VL 1UZ8A 1MJ7H 4NRXB 4PJCB 2DBJA 3L5WB 3L5XL 1UACL 1G7QA 1UQSA 3VJ6B 5FYLD 2J6EL 2FX9H 4LCWD 3EFFA 3VFVB 4CDGC 3ARDD 1FQ9C 4M7LT 1KJ2L 2F8XC 3ZDXE 1BD2D 4CMMB 3T1FB 4P3CH 1YECL 4X83A 5F9AC 1N0XH 5I1DB 1J11A 3X14A 4KMTL 5IB2B 4A2MA 3JVGA 1D3CA 3H0TB 1K8DB 3MCG1 2QSVA 3S97C 2OJEA 1QLFB 3KPQB 5CBAA 2P8MB 4GKNB 3KS0H 2D4DA 3T0VA 3I50L 1LO0L 1EHNA 1ZV5A 3PQYB 1X5AA 3PIQA 2BXYA 2W0PA 4EIZC 1CK0H 1J7VR 3UTQB 5CEYA 4DKEL 4CN1A 4YK4C 1MSPA 3BGFC 3KPMB 3VCLA 5JOFB 1JRHI 2CKBB 2CDFA 1NC2D 1XGTA 1U3HD 4N0CC 4U1SB 3WN5C 2JK5A 1F4XH 2VLME 5FYJE 5JR1H 4S0SD 5IJVB 4R0LC 4K3EH 1U92A 4NHCL 1YMHA 3STLB 5DEGA 5DDHA 2JJUA 3TO4A 1E28B 5FCUH 1P7HL 4OFIA 3D39A 4WFED 3RDTC 5EA0H 3C8DA 4GQ9H 2DQUL 4TOYH 3I3EA 4IM8A 5LWYL 4L8DB 4LPVA 2DRUA 3BIKA 1LDPH 3QFJA 4DKFH 4ZTOL 1IQDA 2X4PA 4HUKB 1UM5L 4JQIH 4O4YH 4PV8B 2PTVA 4CU6A 1GH7A 3ZKSD 5IFAL 3IDMB 3KPRE 4M4PA 2BK8A 1FORL 2JB6A 4KMQA 2UUDK 5FYKL 3BZFA 4PJHE 1BVKA 4KUCD 5EUOF 2V9TA 4LCWB 4TTDC 1F2QA 3VXTB 4OUOA 3FB7B 1F4AA 4IRSD 2ZCHL 3ARDB 3K80A 4ODHL 1AJ7L 5KAQG 2BY0A 5HPOA 3BD3A 4P2QA 2D7NA 2AK4E 5EOTB 1J86A 1T2QH 4JN2B 3MV8D 2QKIB 1UXWA 4XVUD 3S5LB 4GXUN 4JGJA 1IM9D 3GMOB 1G7LB 3MV7D 5CJQH 2FEDD 2V17L 3JTSA 3IU3B 1T66C 1QLEH 4YC2B 1D6VL 5SWSD 1A3QA 1NQBA 1TETH 1M71B 2V9RA 4WFFE 2WNGA 3L3OB 3GKWL 3VFRB 3O6FC 2OJZH 2VNCA 3RPIA 4EQ2A 1FAIL 4NQVA 3TNMB 3UPRB 3WSQH 1JTPA 4PJ5D 1NC2B 4EI5D 1I7RA 3VXMD 5HPMA 2DBLL 4LF3A 4FQCH 5DK2A 4I18A 1JV5B 2VUYA 4ZSOE 1E6JL 4FTVA 1F00I 5DS8A 3ZKMC 1A7PH 3O9WD 2X4QA 3HAEB 4WU5B 5JHLL 3ARBA 4RIRA 1EHAA 1YEFH 4AJ0A 4ELMF 3V5DA 3BO8A 2Y5TB 4XMKH 1QD0A 5MEOA 1EEZB 4LCYB 4F58L 3ZE1F 5I8CB 4QY8B 3Q5TA 5D1XC 5ICYB 4P46C 3WIHL 1PKQA 2WUCH 4J2XA 1FO0H 1S9WB 2BOCA 3MBXL 1T22B 4U6VH 3SPVA 4OM1L 3HZYA 3L7FA 5GRJL 4DCQB 1QEWB 3REVA 4LDLB 1C5BL 2EC9U 3RNQA 4RGOL 1LK2A 5DI8B 4IRSB 3OXSA 1AKJD 4XBPA 4RRPA 3MRMA 2AXFA 4DK6A 3ARUA 3CXDL 1ZSDB 4IHOB 3P0YL 2KL6A 4YPGA 5F1IB 1MFCL 3VRLF 3AREC 4PRPE 5SV4A 2NZIA 4PS4H 5C0CA 5F9DC 1MCPH 3MV8B 4P9ML 5I15H 4QLRA 1S7XB 1HKFA 1IM9B 3MLXL 1G0YR 3BX7C 1MHHA 2HT3D 3QULB 2FATH 2F5AH 5HDBE 3VFPA 3FQUB 2QQKH 5IWLC 5MEND 1HHIB 4X6BB 1MJ7L 4JFFA 2M26A 1IFHH 4FQPA 4M7KH 4PJ5B 4EI5B 2FX9L 5CSBA 4HS3B 1B0RA 5FUOH 4WHYH 1CFNB 2IMNA 5IG7A 4JFQA 4P3CL 4EBQH 3MGOB 3O9WB 1ZE3C 4KK9D 3BW9A 3O45A 5B4MC 5A16A 4XPAH 4JZOA 1C12A 3GB7A 1KJVA 2BVOB 2WAHA 4NQDA 3MODH 1CFTB 3MNZB 2VDKH 2WIMA 4NKOB 5C0FA 2R2CA 1VEOA 1WEJH 4PJEE 5C0AA 4JFYB 3I75B 4NKMB 3TJEL 1CK0L 5KANG 3RGVB 3VXSE 5JLZA 3QQ3B 5GJSL 5GSVA 2NY4C 3CC5A 3UDWA 1QO3B 4JANA 3C8KB 4PLKD 1F4XL 5JR1L 4X80L 1AKJB 4YHLH 4L1DA 4S11A 5C0GB 1DEDA 4NC1E 3UZVB 4GQ9L 4X4YA 1CTNA 1KB9K 3MRPA 1B9ZA 4H5SA 4UDUA 5GGUB 2ZG3A 4KQ3L 2BSTA 2IANB 1KGCE 1ITCA 5TGBA 2F54E 3ULSB 4OD1L 5KZCD 5T5NG 4JQIL 5FM4A 1XAUA 4O4YL 1HXYB 4NQXB 1F90H 3C5ZD 1CFVL 5KN5B 2VXSH 3EYOB 3V6FA 2AV7B 1T7VA 3O11A 4OZFH 5FAAA 2C3HA 3V7MA 2OBGA 2Z8RA 3MUZ1 1INEH 2R1YB 3AS0A 3EIFA 1I9IL 3MO1B 1T03L 3LN4A 4Y5XC 1UB6A 4X6FA 1RUQH 3BJ91 3FTGA 1JHKL 4NZUL 1KFAH 4NNPH 1IE5A 4JCLA 3MCLL 2P24A 2DQFB 3BSZL 3I2CH 3U0TB 4MD0A 4NYLA 1T6WA 3BT2H 4AIZA 4OLXL 1T2QL 2H41A 4M61B 4DEPB 3X11A 1ES0A 4P4RB 3DSNA 3N9GH 4JDZA 5A2FA 5IVZA 4XNUH 4MXVF 2WBJA 4NN7C 1AD9B 1DCLA 2PYEE 5CJQL 2CO7B 1QLEL 4O2CA 3U0PB 1K8IA 1DLFH 1TETL 4NC1C 2E7MA 1U9KA 4OFYD 4OJFL 1NMBL 2YN3A 1JPST 2OJZL 4OIAA 4X99B 4Y5VC 3WSQL 1NGWB 2C1PA 4HKZA 5GS0C 2VQTA 5D7JD 4LOUC 4HSQA 5C0IA 1KLGB 4IS6A 1YYML 4FQCL 1PDKA 5FOBA 3MLRL 2V5TA 1Q9LA 4WDIA 2AS5M 2D3VA 1BGXL 5INDB 3H3BC 1XF5B 3AU1A 3Q2CA 4QRUB 3QBTB 5DRZA 1YEFL 4MZ3A 4OGXL 2WLYA 3VD9A 3PHOA 3PJSA 3VXUA 4HJ0C 3NPZB 5HD8D 4XMKL 5I1CH 1W2KT 1EEQA 1NEZG 1M6OA 3SDDA 3GO1H 4JQXC 3HC4H 5KZCB 5GGQH 3LS4H 5F7LB 4MD4A 3C5ZB 2R4RH 1PG7X 3ZDYF 1FO0L 4R0LA 1U91B 4QHKJ 4E41A 3BFOA 3QIUD 2VAAA 4RX4A 4HW6A 5ACZA 4U6VL 3RDTA 1T0MA 2WQ8A 4G43A 1QYGH 1NLDH 3BP4B 1PQZA 1X5FA 4OZHE 4PJ7F 4UT7H 4YIQB 2BOBB 4JG0H 1U3YA 3S34H 1QNZH 4QXWA 3FFCD 4NUGH 3O3UN 3D85A 4ZUSA 5IBLD 3LSOB 1G84A 2ARJB 4PS4L 2HWZL 5KSAC 1UH3A 1MCPL 2FGZA 1B0WA 2OLDA 4PRHB 1C5CH 2PN5A 1NJ9B 5I15L 3L6FB 3H9SE 1DE4A 1HWGB 1OAUH 3GKZA 3SO3C 4RBPH 1P9MC 5CZKA 5TE6H 3QDHA 4EDXA 2FATL 3Q3GB 1QBMH 1OAKH 5I9QC 3LRHA 2F5AL 4NQCD 2ATKA 3EGSB 2QQKL 4TVPE 4WWID 1F4WH 4R97C 1WWWX 3GEWB 4E5XA 2XA8H 5C6PB 1GRWA 1IFHL 3WHE0 4M7KL 1C5DB 5BS0D 4MCZB 4OLUH 1U8MB 5D7JB 4QHMA 1ZS8A 2EC8A 4LBEB 3BKYH 5EU4B 3KPOA 5FUOL 2DIBA 4GBXA 4K3DH 5E08H 4TN9A 2W65B 2RFXA 3SDAC 3VG0L 1S7WB 1U95B 3MOAL 4EBQL 1QSVA 3WIFA 5A1AA 5HYSB 2VJXA 5T3XH 4BYHA 4XPAL 3T04D 3BDXA 4OQTH 2OL3L 3MMEB 4KUZH 3O6FA 2XWBB 3MODL 5T3ZE 2VDKL 5DQJB 1BZQK 4UTBL 4KJYA 5F7DA 3KPSE 5FYKU 1C08A 1WEJL 3MRRB 4IMLA 1RIUL 1SHMA 5I17A 3R06B 3RVXC 1XF3B 4GAYA 4DZBA 2BVPA 1UWEH 2WUBL 3QIUB 4J3XA 3SE4A 4X6DB 3TM6A 3P0GB 3TFKC 1FLRH 2YA1A 4PJHA 3CFKB 5K33A 3GK8L 1J87A 3VWJA 3QXAA 4YHLL 3NFPB 3FOMB 4JKLA 2FH6A 3T0BA 3VE0B 1MCDA 3JZ7A 1MCIA 4PLJD 2XPGB 1A6TB 2Z8WC 2EXYD 5K59E 4BKLB 4PJGA 5DSCB 2BVTA 4NFBA 1R24A 2NMSA 1A3RH 1NSNH 4MA7H 5C08A 4ODUB 2OXHA 4Z76B 5MERA 4WI4A 1F90L 5C0EA 3NACL 5JW5B 4MCYA 1RU9H 2VXSL 4KTDH 5IW3A 3G5XA 5K9JH 4WI3A 4NQCB 4V1DD 4RWYL 2ITCB 4NM8H 1CG9B 4H1LA 5L88L 1GGCL 5ISZD 3QWRA 4FZEH 4XPTH 5I75C 5JW4M 2DDQL 1INEL 2R0KH 2A9MH 3GSWB 1I3GH 5BS0B 2B5IB 1KJMB 3KLAB 3GMMA 1KCLA 1RUKH 4GAGL 1A7BA 3C09B 5D7IE 2C1OB 1KFAL 4NNPL 4KDVA 4WUKH 3RZCA 1MELA 5F6IC 5A2JH 3MRDA 6CGTA 3I2CL 5I71C 3KLHD 3LQAC 3BT2L 4NQTA 5IWLA 3RVVC 1CD1A 1T83C 3N9GL 2XTLA 4XNUL 3WMSA 1ORSA 5DJ8A 5DMIL 1V7NL 1QA9B 3RIFK 2OZ4A 5ID1A 3IDNA 5CGYD 3ZT5A 1KPVA 5M7QA 4M9PA 5DD0H 1CL7I 3UZQA 2HT2D 4M7JH 3TPUA 2J8UB 5D6DC 3QEQA 3NPSC 2DMCA 1OP5H 3T4AB 5J9PA 4Y19E 4QO1A 1CFSB 3ESVF 3ROLA 4LLWA 3RWCA 2F53E 2IADA 3TBTB 1RUPH 5E5MA 3CH1B 3V5KA 5ABDE 3V0WH 3VD4A 2O61B 4GFTB 2Q20A 1PZ5A 3UTSA 4HIHB 4JVPA 3WS3B 2IMMA 2NX5A 3VFSA 4LIQH 4L3CA 4PRPA 2W1NA 2O5YL 3WBDA 4N9GB 1DVFA 5C71A 5I1CL 2JCCB 1C16B 4MAYD 4QRQB 3HC4L 5GGQL 3LS4L 3GSRA 1EEYB 2R4SH 4OZGE 2R4RL 2X1PA 1HHKB 4P23C 1M7DA 4RGNC 2OYPA 3O41A 4V1DB 3P4MB 3MFFB 4U6YA 3SKMB 2Z35A 3LKSA 1JTTA 1QYGL 1NLDL 3QAZB 4UT7L 4JG0L 3S34L 4HLZG 1QNZL 4PJCE 1OTSC 5EC2B 1H0DA 1AGEA 1L7IL 3VD5A 1AHWA 3NGBC 1S5IH 3MRLB 1N3NB 4JRXA 1ONQB 5EUKA 3OR6A 3M8OH 1C5CL 4YWGH 4F33A 5IFHH 2VZSA 3TBSA 3F58H 1MPAL 4KDWA 1GZQB 2W38A 3PP3K 4OGAC 3L9RA 5ESVB 1QBML 1OAKL 4Y5XA 5E2WL 4J3UA 2CMRH 1HHHA 3NCYS 1D5IH 1F3DJ 2DQEH 2XA8L 3WLWD 4PGEA 3PQYE 2OR8A 4XTRC 4LEOA 5BZWA 1WZ1H 4JAMB 4OLUL 3C60A 5J7CC 5C0RH 4MNQD 3BKYL 4OFDA 4K3DL 5E08L 5JOPE 1DEEB 3W0WA 3BE1H 1FFOB 1LO4H 2DLTA 4WV1C 3PWPA 2X4SA 1JK8B 3O8XD 4MMXC 4NDMB 3D5OF 2ZSVA 4PJBB 4JFOA 4CJ0A 5T3XL 5D96C 3BWAB 5CZVL 2EYTA 4P5TC 4OT1L 1T89C 4OV5A 4PUBH 3GJEA 5TPWL 4DN3H 3RWHA 2GSGA 2CIIB 3HA0A 1LEIA 5KVEH 1BIIB 4EN3D 1BX2B 1MCWW 1U8JB 3ETBF 3S6CA 5I8EB 1JNHA 1T21A 3G08A 4OD2A 1ZVHA 5CIPA 4Z5RA 2XN9D 1QFWH 4L4TA 4MZ2A 1UWEL 2Z31D 4LLDA 2ITDA 4Z7VF 1OY3B 4B0MM 2Y1VA 5HYJA 5I8OH 1U93A 3E0GA 1FLRL 1U58B 3HE6A 3OKLB 3IVKA 1FZJB 1N5AB 1S9VA 4AEIH 5I1JH 4XP4L 4APQD 3CDGA 4K23H 5DGRA 1LE5A 5E95B 4RFEA 3EAKA 5FYLE 5HDQH 5IVNA 3BESR 3BEWB 3O3EA 5IB5B 2BDNH 3UBXG 3TBWB 2FWOB 3P11H 3U30B 3F7VA 5DJXA 4Q9BA 1BD2E 2HG5A 1A3RL 1NSNL 3KDMA 2HH0H 3LV3B 4MA7L 3TPKA 1WT5C 2HVKB 3BZEA 3OKNA 1P2CB 4M3KB 4X5WB 4K7FA 2BNQB 1RU9L 4KTDL 1S78D 4BSVB 5IKCB 2GJ6D 5K9JL 2V2TB 3K4AA 3WKNA 1ETZB 4Z7WA 1J12A 1J1OH 3U1SH 1UT9A 1HCVA 2R0KL 2A9ML 1I3GL 3I6LD 5C0BD 1ZT1A 4HMEA 2QSCH 4RCAA 3K8LA 1WFOA 4F9PC 4MNQB 1RUKL 4KGJA 3SGDI 2GT9B 3VFGL 2BVYA 4WUKL 2H2SD 4X0KB 5IMOB 1YPZF 3OB0H 2JIXD 1RZKC 4U1LA 3B9KD 4L8CA 2Z93A 1KELH 1RIHH 2EXWC 3K46A 1NUDA 2GFBA 3PL6D 3QHZH 2H8PA 3KJ4C 4OCLC 5IEKB 1YEEH 4WFEE 2J1KA 4YHIA 3WFEH 2IG2H 5EUOB 1N2RB 1T1XB 3FO0H 1CQKA 1YEHH 4WI2A 3QUKA 1LILA 4C56E 5DD0L 2CSPA 3JSSA 2XN9B 3NIFE 3NH7H 3P77B 4XZUA 3O4LA 1BMGA 2Z31B 1L0QA 4BA8A 2H9GB 3ARDC 4IOIB 2X5PA 1QQDB 3BN3B 1NANI 5D1QA 2P42B 5E1AB 4APQB 1RUPL 1GOHA 5JORB 2BVUA 1RZIA 3CFJA 4U3CA 1N8ZA 2ZUWA 4FXGA 3BPCB 2DLGA 1I85C 4MYWB 4AM0A 1Q0XH 1RJZB 1ZHNB 3AAZA 3VMPA 3HRPA 3R4DA 3I6KA 4LIQL 2X4RB 2NZ9C 1BJ1J 2RR3A 1BVLB 4I3GA 4YC2C 1YEDB 1K6QH 4HJGB 1T4KA 3U4AA 2YWZA 5JIPA 5TE4H 3PGFH 1PKOA 3SCMD 1VEMA 2R4SL 1JNJA 3MV8E 3FZUD 4L8SB 4JZJB 4KI1A 5B3JF 2IQAB 2W9EH 3TWCH 1U3HC 4I48A 3DV6B 3L5JA 3MV7E 4HS6B 4QRPA 1G7PB 2H32A 2VERN 2E6QA 4XCEB 2IPUK 5SWSE 4KXZI 5C0BB 3OJMB 1FNAA 2AJUH 3J7HA 4JREB 2CDGA 4P48A 2UVEA 2BY2A 3CCHB 2VRAA 4YNYB 5D8JH 1JZ4A 5DFTA 3M1BA 2Y4SA 2DI7A 3H3PH 2Q7YB 3VXME 2GTZA 4ODVH 4HIJB 2K1MA 2B1HH 2GK0B 4PJ8D 2AV1A 3M8OL 4WGVB 4YWGL 3EO1A 4DQOH 3PL6B 5F70A 1VB9A 5IFHL 1IAKA 3QH3A 3BKMH 2PYFA 1R3LA 2F74A 5FYJH 1JZ3A 2CMRL 2HRPH 3BPNB 1KXVC 1RZJC 4IOFD 4HAGA 4IRSC 3BYTA 1BLNA 4HH9A 3IFOB 1A3LL 3ZHDA 2DQEL 4QRSA 5H2BA 25C8H 3WL9A 1NBYB 1WZ1L 1D5ZB 1QG3A 5C0RL 4R4ND 1WZKA 3F7QA 5KANI 4XH2B 1LO4L 3KPLB 1JMZA 4XVUC 4AZ8A 1Q0YH 1WGOA 5CCKH 3LN5A 1EERB 5C3TA 2YZ8A 4QXTB 4YX2H 2FEDC 3FCTA 1TZGL 4PUBL 2VLRB 4DN3L 3FB6B 2Y6SD 1QR1B 5KVEL 3TIEB 4EI6B 3SCMB 4NZJA 1RSFA 4IIQA 5ALCH 2EDXA 3VFUB 3KYKL 4EI5C 1XGQB 1QFWL 1EA9C 1S3KH 1FFNB 1I3RA 2DQTH 1VADB 2FIKB 2AEQL 4J8RA 4BUHA 4L4JA 5I8OL 1UFUA 3GHEH 5ERWA 5DRNA 1RFDL 4AEIL 5I1JL 4H0HB 1IAOB 4I3RH 2X09A 3O9WC 5MENE 2NCMA 5D2LA 5FF6A 4K23L 1J8HB 1FJ1B 1G0DA 3UPCA 5ITBH 4H1LH 5HDQL 3WUWG 1I3UA 2BDNL 3GSNB 4IRZH 4MDJA 3UYRH 1FVCA 1RZGB 4QF1B 4KU1A 5FM8A 4PJ8B 4YFEA 3NZHH 4RZCB 1JF1B 3S37H 4TTGA 3RGVC 3VI4E 5D2NB 1RJLA 3HZVB 4DUVA 5A40E 4UT6H 3WJLC 3GMNA 5GIRB 3SKJH 1WBYB 3C9NA 3FO2B 3CDFA 1DBJH 4X98A 4MXWH 1QHOA 1P84J 1J1OL 4NZDA 3U1SL 1GZPB 2YWYA 1IBGH 3HLAB 3SKOB 2XNAA 1DJSA 1Z5LB 3OWEA 1OSPL 2OZ4H 2QSCL 1ND0A 4Z7UA 4FQ1H 2I9TB 3ZE0F 3CFEB 5TJWK 2G75A 3L7EA 5IQ9A 4EUPG 4ETYA 2E8YA 2FSEB 4LSRH 4OFKA 5LGJA 4Y1AA 1RI8A 1TVHA 2EDKA 5EB9A 1KELL 3B5HA 2HT3C 4ZOAA 1D9KD 1YEEL 3OAYK 3QFDA 1J9CT 3WFEL 4D2NA 3VXQB 1MJJA 2XZAH 2IG2L 4KTYA 3FO0L 2QQQA 3E6HB 2A77H 1P5VA 3LN9A 3FQTA 3MTRA 2MKLC 3NH7L 4MX7A 1HOCA 3EDFA 3BIBX 4J3TA 3BVNA 5GRYA 1OLZA 2CLRB 3KGRA 4P5TA 1T89A 3HR5B 4HWNA 4KK9C 4Y4HD 3BP5B 5JPNA 5TDNA 4HWZB 2YD2A 4G6FB 5D6CB 4DEPC 4MSWA 5GGVY 4GG6A 4Y2DA 1Q0XL 4HT1H 3L5WA 5EBWB 4ZUTB 4GJTB 4RMQA 1XGRB 4I0KA 4ZNCD 3VJ6A 5BMFH 3MRHA 4UIMB 5CKAA 4U31A 5KG9B 1EVUA 4JLRB 3PGFL 4MMZC 2RJMA 4CMMA 3T1FA 5JXAH 5I1DA 3VA6A 3VFOA 1MVUB 2W9EL 4PLKC 3C8HA 3BWUC 3TWCL 1MRFH 5IB2A 3FQXB 2E9IA 4K07A 1KC5L 4LQ1A 4UB0H 3X12A 2NTSP 5FDWB 4FABH 2JJWA 3H0TA 5E7FA 3SDXB 5DJ2B 2MTPA 4NO2B 3KPQA 1QLFA 3ZTJH 5D5ME 2P8MA 3D1MC 2ED7A 1U2HA 4Z95H 2AJUL 5ANMB 1WBXB 3FFDB 3EOAB 4JFEB 4WHCA 2J7LA 5D8JL 3UTQA 1I1AD 4N90D 3QWQB 2AABH 4JM2B 2C7UA 3DBXB 3H3PL 1HQRB 4QRRA 4ODVL 4F7EB 1QSZA 1S7SB 2ED8A 3KPMA 4XGZB 5DJAB 1LO5B 1RZ8B 5JOFA 2CKBA 2B1HL 1QVOB 3PE9A 3C5ZC 4U1SA 1H3GA 1WITA 2APBA 5EOQH 4DQOL 3BAEL 1JPGA 1D9KB 1U36A 5IJVA 3QA3B 2EDBA 1BQSA 2YD6A 3H9YA 4KJQD 4F9PA 5A2KH 3P4LA 4L8DA 5D7LD 4HPYL 3SY0A 2HRPL 3MACL 4CNIB 5HTSA 2EYRB 1J0HA 4L3EA 1K3IA 2KZWA 2VE6B 4YDIH 4ZOBA 3P40A 2WWMD 25C8L 1F42A 3QJHB 4PV8A 4AENA 1GCFA 3IDMA 2VSDA 2LTQB 4QNPF 1IC5H 1VSCA 5GS0H 4Y4HB 4X6DE 1N5YL 1FPTH 3OKMA 3OXRB 4I5BB 2DMBA 2VXVH 5CCKL 3QHTC 2E8ZA 4N8VB 4RAUB 3I6GB 4YX2L 2BMKB 4ZO7A 2NY7H 1T7XA 4LCWA 3CSGA 1UB5B 2DI9A 3VXTA 4HCRH 3FFCE 3K4ZA 3FB7A 1JL8A 1K3ZA 4N0FB 4PP2B 4S2SB 2CQVA 4LSSH 4OCSH 3QO1B 2VKXA 3O6LL 3ULVD 3ARTA 4LSPH 1I9JH 4WEMB 5ALCL 2VKWA 4JN1H 4M43H 5EOTA 4JE4B 4XP5H 2QKIA 1S3KL 2DQTL 5D7JC 3JV4B 4PJXA 3S5LA 1BBDH 2FIRT 5EPMB 1WK0A 3GMOA 1G7LA 4U1NB 1TNMA 4XCCH 4JFDD 4I3RL 2ICEB 1MFAH 4NQCE 3RUGB 1LDSA 2X4UB 4J4PD 1M71A 1OTUD 1I1AB 3L3OA 4UDTB 4HBCH 5FK9B 1VFBB 4K2UL 3VFRA 5BS0E 5HD8C 3ULUH 3TNMA 4IRZL 5FGBA 3DUUB 3UYRL 3W2DH 2MMXA 1NC2A 4KRNA 1KCVH 3QB7C 3S37L 3MZGB 2Q76A 5JUEL 4MQSB 1JV5A 2VITA 4OCRH 4DVRL 1AR1D 1CCZA 1YN6A 4NIKB 3T09A 1I9RH 1JPSH 3QIUC 4K9EC 2FJFB 1K5NB 3GSOB 5DZLA 3HAEA 5TDOB 1MJUH 1IEHA 3K2UH 1TDQA 4XPHL 3SKJL 2IAMA 1O0VA 1QSEB 1CFQB 5F7MC 4X9HA 1DBJL 3X17A 3ZYOA 4MXWL 4N5UA 4LNRB 1MQKH 3LEVH 1EEZA 2GK2A 3CSYB 3UTTA 3CDYA 2BRRL 2X1OA 3O4OB 1IBGL 1OT1A 4XAWH 5I8CA 4QY8A 5KS9B 2OZ4L 5IBLC 5ICYA 4FQ1L 2J8UE 4Y89A 1NAKH 1IL1B 1CYGA 2DJ4A 1S9WA 1PG7L 2APXA 1T22A 3IDIA 5BO1H 4WI6A 1QLRB 4FZ8H 2FBJH 4J6RH 4LSRL 4PG9A 3T3ME 3D18B 4DCQA 1QEWA 4C57C 3RWEA 3RJDA 3HE7A 3V95A 1KENH 3ARZA 5DI8A 5ENWA 4DOHB 1DQJB 1KEMH 4XP1H 4WCYL 1HH9B 3QRGH 3UYPA 1MCJA 4IHOA 5F1IA 1DQTA 5CJ5A 2XZAL 4DGIH 1ZHBB 5F9OH 5DJ0B 2AJYH 2A77L 2FX7L 1F58H 4U05A 5FKAB 5I19H 5J11B 3LIZH 43CAB 4DKDC 1K4DB 4KC3B 2JCCE 4AEHL 3AUVA 3DX6B 4OQ1A 3IB4A 3RY6C 4F80A 3ZKNC 3C09C 1IM9A 4XC1H 3D3VB 5TDPB 5EBMA 4JFDB 3QULA 3LKRB 4F8TA 1HIMH 1AGDB 3CFCL 5CLWA 5ISZE 3FQUA 3X13A 1KEGH 1HHIA 4X6BA 4HT1L 5FGCE 5EOCJ 4MA8H 4PJ5A 5I1EH 4UNTA 5BMFL 5I2IB 4WFGE 4TVPH 4HS3A 3LH2H 4ZFOL 4LFHD 2L7JA 1MIML 2EKSB 2HVJB 3QCUH 3ZKXC 3CXHJ 3INUH 3MGOA 4DVBA 5JXAL 1C7TA 3O9WA 4GMTH 3VH8B 2XTJB 1MRFL 4IRJA 4D0CB 4UB0L 4FABL 2BVOA 3OPZH 1LO3H 4OF6A 4H26B 4WFHD 4UT9H 3T0AA 4QEGA 3WO4B 1CFTA 3MNZA 3OQ3B 2P5EA 4NKOA 1YNLL 1FP5A 4Z95L 4Y8AA 3LEXA 2WQRA 2A74A 4PLJC 3RKDD 5T3ZH 2EXYC 2ZUYA 3RGVA 1Y6KR 3VDBA 4U7SA 1QKZL 3GUTB 3QQ3A 4Z18A 3UO1L 3SE3A 1F8TL 3C8KA 1T1YA 2FHBA 1PY9A 3LQAH 5DD6A 5GZND 4YQXL 5EOQL 7CGTA 3O0RH 1KN2H 2DM7A 4Q9CA 4PJBE 3OHXA 5C0GA 2X6MA 2ATPB 5LCVH 1RURL 1NAMB 3VI3E 1JUFB 5GGUA 12E8L 3QAZC 2BSRA 3B2VH 3IJHB 4G7YH 5LJYH 2YEZB 2MPAH 2IANA 4N5EC 4YDIL 1TTGA 3IJYA 5EC1A 1XCQB 3ULSA 4O9HH 3RIAF 1FC1A 4NQXA 4HPOH 5KN5A 1IC5L 4AL8H 4LVHB 5GS0L 5IMLB 3ZDXF 4P99A 2VXVL 4CRPA 5K9OB 2YD9A 2VWEE 3S96B 2CK0H 3CMOH 2NY7L 5IR1A 5CGYC 4TUOA 5T1DH 1AXTL 1KF9B 1ULVA 4ACPA 4LSSL 4OCSL 3DO7A 2HT2C 4R7NB 4LSPL 3VGFA 1I9JL 4M48H 2DQFA 4D94A 2VAJA 1ZA6B 4NNXB 3UBXI 5BRZA 3VA2C 4JN1L 4M43L 3U0TA 3Q6FB 4XP5L 4M61A 1UA6H 4H8WC 4RMVA 3S4SB 4P4RA 1BBDL 5E4EB 3HZMA 1ZT7B 5IMMB 1QBLL 1AD9A 3F6IA 5DUPH 2DLHA 4XCCL 3U9UB 1MFAL 2DQCH 2APWA 2EEDA 1GHFH 3S7GA 3U0PA 2R2HA 2DWDA 4ZNEA 4LP4A 3EYFB 3QNXA 1LEKB 1U8KA 2CJUH 1AE6L 3ULUL 4HBCL 1MAKA 4Q2ZB 4X99A 3W2DL 2RGSA 1NGWA 2Q1EA 4MNQE 1D5MB 2EC9T 4M7ZB 4NQEB 3VDAA 2P45B 1N64H 1KLGA 3P30H 4I9WD 3VFWA 4YR6B 4Z7VB 1A1OB 1MAJA 5FV2A 1I9RL 1JPSL 2Y25A 5INDA 1MJUL 2ARWA 3K2UL 4HDIA 3ECBA 4QRUA 4O58H 3BDYH 4YHYB 5CEZL 2VWEC 4Y4KD 4O5LH 3IJSB 2X41A 1Z6JT 3SGEI 5EUOE 4PJHF 5GRXG 1MQKL 5BVPH 3LEVL 5B38B 2YSSA 5IHUH 3WFCH 4XAWL 2XN9E 4HK0A 3C5ZA 4K3GA 5F9JA 3MROB 4JY5H 4Q58C 5IVXB 2QJDA 1NAKL 3U30C 3W5MA 1RHHA 4PJFA 1I7UB 5ELIA 4TQEH 5BO1L 4PJGF 4FZ8L 1A6VH 1OGAD 1YJDC 2QR0B 1I8LC 3QDJD 4PV9A 1JGUH 1G6VK 4NJ9H 5JQ6L 1OT2A 1KENL 4YIQA 2BOBA 1YY9D 4XP1L 4F9LC 2OL3B 3OR7B 3QRGL 1GOFA 1DDHB 3NFSH 4DGIL 5F9OL 2ZKHH 2FCBA 1F58L 1OQOA 3WLWC 4PY7B 5I19L 4JQVA 35C8L 3LIZL 4PRHA 3D25A 1MRCH 2A6JA 3L6FA 1YPZB 4JPWL 5D9SB 4X6CB 2XFXA 1VGEL 3G5VB 2GJ6E 3VXRD 1HIML 3Q3GA 5DRWA 3MRBB 2EE3A 3ALWA 4WTWA 2GCYB 2DL9A 1CLOH 3MRQB 5DC9B 2R56H 3I6LE 5C0BE 2PXYD 3OKYA 1Y18A 5HJ3A 2VSCA 4M62H 5DVKA 5I1EL 1C5DA 1FNSH 4PRID 5T33H 4RFNB 4TVPL 4HHAB 1U8MA 5D7JA 3LH2L 5FYJU 5KTEH 4LBEA 5CJOH 5EU4A 1TVBA 1INDL 1EH9A 1EGJA 1WV7T 2W65A 1U95A 3QCUL 4KK8D 2Z31C 3INUL 2OR9H 3GRWH 2AVGA 4W6XB 1OAXH 4GMTL 1T1WA 3IFLH 5AZEH 2DWEB 5HHOD 2GSIA 4XXDB 4PBXA 1D5BA 4I4WB 2CKBH 4Y4KB 3VRIB 4APQC 2ZOLB 1LO3L 3WJJC 3MMEA 3SDYH 5IB4B 2XWBA 3S35X 5DQJA 4K71B 9CGTA 4J23A 3LDBB 3FT3A 3MRRA 4YLQT 3VRLE 4GXUM 1XF3A 2ESVE 4NO5B 3WIIL 2FYYB 1OGAB 5EIIB 1EEUA 1RZKH 5MP6H 3LQAL 1CGVA 2C3GA 4UU9B 4L8SC 1S78C 4JFZH 1EAPB 1MREH 4LASL 4MNGE 1FFQA 4LLVB 1UCBH 3TA3D 3JUYA 3UAJD 2XPGA 1A6TA 4NBZB 4P3DB 1TJIH 4G7YL 4JREC 1G9NC 5FYLH 2MPAL 1CE6B 3G6AB 3N50A 4PIRF 4M5ZH 4N8CH 5ETUA 3DI3B 3QPXH 4ODUA 3G6DH 4AYFA 2H2SC 5FKPA 4LHUD 5JTWA 3QEHA 5M95B 4HPOL 2ZSWB 1JPTH 1INQB 4AL8L 1B4RA 3B9KC 1FIGL 2ITCA 1MCQA 2DQIH 2PO6A 3PL6C 5EFIB 3RAJH 2JELH 2CK0L 4GSDL 2X9YA 3REWB 1KJ3H 1I7TB 5BS0A 4PRIB 1RY7B 2QHRH 3KLAA 2ENYA 5T1DL 3EJJX 3NN8B 3BPNC 1WICA 5JA8B 2PTTA 4M48L 2FLRT 4JKPH 4WW2A 4OIBA 1X7QB 1OWRM 3S4SG 3D39D 3LMJH 4UOJA 3DX8B 1L7TL 4FQXB 5HHOB 5HYIA 2I07B 2MSPA 5D2NE 4DK3A 1QA9A 3MUJA 1B3JA 1T7ZA 5DUPL 2J5LB 3RWFA 4BH8B 2DQCL 3GBLA 1GHFL 3DMMA 4GKZB 4XCNB 3HAEH 4P5MB 4W4OC 4B5EA 2G5RA 2W0FB 1MHEB 4U3HA 2H3NA 3K8MA 3T4AA 3R1GH 1UZ8B 3SCMC 2IGFH 1EZVY 1CFSA 3HZKB 1N6UA 1UQSB 1N64L 1QRNB 3FZUC 3TBTA 3P30L 3CH1A 4NN5B 2O61A 3DIFB 1OTTD 2YD1A 3Q6GL 4AK1A 1I1YB 1KB9J 4JO4H 3T8XB 3TA3B 1T20A 4HMCA 4O58L 4UUJB 4P2QD 1UM4H 4K7PY 2EDRA 4N9GA 2OMNA 1RZJH 5BVPL 2F5BH 1MJ8H 4QRQA 3WFCL 3FHAA 1EEYA 4LHUB 4WHYG 1HHKA 2J2ZA 3LCYA 4JY5L 4Z7OE 3CVIL 4PJ8C 3U82B 4V1DA 3P4MA 3KR3L 4FQIH 3MFFA 4BSWB 3SKMA 4TQEL 2V7NB 3FB5A 1A6VL 5F7KC 3CD4A 5F44A 2Q6WB 5EU7E 5D2NC 1WSST 4PJ9B 4MXVE 1JGUL 4NJ9L 5FO7A 3KYOB 1BFVH 2CDFB 1FNLA 5C9KA 1XGTB 2YUZA 2AEPH 5EC2A 5I0ZA 4R2GB 4IOFC 2B1AH 3ULUF 2BHYA 2ZKHL 3N1PC 1YMHB 3MRLA 4FTVD 5DEGB 1N3NA 5DEFB 2YXFA 4Z7WF 4R26H 2AJZB 1AR2A 4QHLA 4WJ5B 4KTEH 3ARBD 1MRCL 4R4NC 5B39A 3TV3H 3BIKB 2WBWB 2ICCA 4NBYB 1GZQA 2IBBA 5ESVA 1IQDB 2JJSC 2X4PB 1YUHB 3SDXE 4NKIH 1AGFA 4Z7QF 1HEZB 1XT5A 1CLOL 2ED9A 5I74C 2Y6SC 5DGQA 2R56L 2DM3A 4N0YL 5SV3A 3PWJB 4M62L 3IDGA 4YE4H 5HI4D 5T33L 4RMWA 2YPVH 1U41A 1NMAH 4ONFH 1CDGA 5CJOL 3LPWA 4X7SH 2KBGA 4MD5A 1KN4H 1FFOA 3TJHC 3ZDYE 1NCNA 2OR9L 4NDMA 4O02H 2VLJA 4PJBA 3IFLL 4DGVH 5AZEL 5CSZB 4OZFG 5GGTA 3MJ8B 4ZOCA 2CKBL 5EU7C 4JO1H 5C0CD 2A1WH 5IV2B 3SDYL 4JPIB 4XNYH 4PJ7E 4RFOL 5I30H 5B3NA 1U8JA 3GM0A 3MUY1 1OP3K 4NN6B 3MLWH 1BEYL 3R0MA 3KVQA 4Z78B 2BC4B 4X4ME 3DUSA 2FBOJ 2GEEA 4P2RA 4K7PX 3OKLA 1FZJA 4JFFD 1FZKA 2P7TB 3RPIB 4U6HB 2UZYB 4G7VL 3GSXB 4JFZL 4KHTH 3P73A 4LF3B 5DK2B 3HHRB 1UCBL 2PETA 4OZIA 2YRPA 3BEWA 3RL2A 5IB5A 4FTVB 1TJIL 5DS8B 3H8NA 2KKQA 3TBWA 1HHGB 1T6VN 4KI5D 2HRLA 1OPGH 5FYLL 3TIDA 4GW1B 4M5ZL 1AQDB 3B6SB 4N8CL 4ZO9A 3LV3A 5CSGA 2DQHL 3QPXL 3S36H 2YZ1A 2AK1H 1I8LA 4N68A 4TNVF 2BERA 5E99L 2GY7B 4A6YA 1P2CA 1DSFH 1UKSA 1JPTL 1V3MA 2BNQA 4X5WA 1HSAA 1G6RB 5HHMD 1CDYA 4BSVA 4F9LA 2V2TA 4MVBC 1D9KC 1ETZA 3RAJL 2JELL 1XGYL 3PV6A 1KJ3L 3RWIB 2QHRL 1SBSL 3KXFA 3HZYB 4N90E 3SJVA 1MHCB 1X6NA 4S1SL 2UZXB 2GT9A 1FYTA 3WNLA 1U8LB 2OI9B 5IMOA 3UJIH 4ZPTB 4JKPL 2EDHA 4YPGB 5EN2B 4K3JH 4GRWF 3LMJL 1BJMA 4FOMA 1A64A 1AC0A 1KIPB 2DKUA 4LPCA 4LVNC 5ITFA 4FP8H 2LTQC 2O5XH 4TYUA 4Y4HC 4NKQB 4AMKH 2EDFA 1N2RA 2Z4QA 5C09B 5D7LE 1RJCA 3AROA 4OB5H 3T77B 4MNHB 3VXOB 1MHHB 4XXCC 2NY5C 3P77A 3JWOC 2Z31A 3G04B 4PJIA 5D93B 2H9GA 4IOIA 4XAKD 3VFPB 1FGNH 1FC2D 1H3UA 4JHBA 4Q9RH 4MA1C 3MLSH 3OMZA 4JFFB 5E1AA 3DRTA 4APQA 1NGPH 4WI5A 4F7TB 5JORA 5I66A 2NQCA 3BPCA 1GOGA 1VFOA 3RWGB 1ZMYA 2E27H 1RJZA 1ZHNA 3LB6C 1A9EB 4BK4A 4AQ1B 1U3JA 1TENA 3IDXL 2X4RA 3SKUD 4LLQA 1BVLA 2VC2H 4GRMA 1YEDA 3O45B 4PREA 4WGWB 5J1AB 4JZOB 1C12B 1II4E 1RZJL 1OAQH 1KJVB 1H8NA 1I1AC 2F5BL 1MJ8L 1VENA 1VPOH 5D2LF 2WBJD 5GRWA 4Q0XH 4JZJA 2IQAA 5C0FB 5L7XH 2E3VA 5D7IF 2PR4H 3DV6A 3MRGB 3J8F7 3IETB 4HK3N 1G7PA 3V9FA 2X10A 3I84A 4GMSL 4XCEA 1WIPA 4YGAB 5GS2D 5C0BA 1WISA 4KJQC 1N7ML 4PY8I 1BFVL 2BXZA 4G6MH 1R0AH 3CCHA 4NO3B 2K3TA 2AEPL 3GJFA 1UEMA 2B1AL 4PTUB 2Q7YA 3BHBA 4CN4A 4WEBH 3O4OC 2WWMC 1PVHA 4CJ1A 5IOPA 2GK0A 3RL1B 2GJJA 4KTEL 3WDJA 5BVJB 4FFVD 3PL6A 4UDUB 4KJWD 3E3QE 5I6XB 5JDSA 4Z7UF 3LKQB 3TV3L 3MUGB 5F6HI 4EKXA 5TGBB 3SDDD 3V4UH 2WM0A 4RMRA 1WCQA 2Y36L 4NKIL 5FO8B 3Q5YA 2GUOB 3O11B 1CGYA 4E41D 3ULVC 3JWDC 4YE4L 5F7HA 3EO9H 2YPVL 1D5ZA 5J11C 1QR4A 3NCCB 4L29B 4TULH 1J0YA 5KVGH 1KN4L 3KPLA 2WWKT 4X6FB 5CUSH 4O02L 3RPKA 4YHOH 1FNEB 3D85D 4K9EH 4QXTA 1NFDB 2OX5A 4HKBA 3FONB 4DGVL 2VLRA 1A1NA 4JO1L 3FB6A 4J4PC 3DVNB 5FGRA 3QI9D 3X11B 3TIEA 1ES0B 1OTUC 1P69B 5C6WH 5I30L 1CD9B 3MNWB 4JDZB 4LNVA 2WBJB 5C7XH 2VYRE 3MLWL 4GG6F 2R0WH 3RP1A 1V3KA 4XWOD 2H2PC 1XGQA 4JM4L 1FFPA 3OJVC 2FIKA 3UTOA 3S88H 1DL7H 4PJDB 1AR1C 4ONGH 1F3RB 4YHPA 5C2BL 3E3QC 2ZOKB 3WXWH 2CO6B 2C1PB 4YBQD 4UQ2B 1J8HA 1WF5A 5C0IB 1FJ1A 4E9LA 5L0QB 4IS6B 5IIEB 3TH2T 4GBXD 4B53A 3HR6A 2C3WA 2BCKA 5FOBB 3P4OA 1Q9LB 5D1ZD 4Q6IB 4I0CC 3WO4C 3GSNA 2LU3A 1RZGA 4PJ8A 4RZCA 2NXYD 1OPGL 1A5FH 3HNTL 5F88B 2CRZA 2V9QA 4AIOA 3O2VL 4KAQH 3PHOB 3PJSB 2RIKA 5D2NA 2EIBA 2AK1L 1CU4H 4OF0A 1M6OB 2I9LB 1DSFL 4KZDH 4PP1D 4R90H 4WFHE 5CHNB 2XKSA 2ENSA 2VDMH 3U48A 2C26A 3VD7A 4E41B 1GZPA 3HLAA 5ACZB 4L5FH 4HWBH 2FJGA 3SGEH 3IFNH 2I9TA 1PQZB 3B8YA 4RRPG 3VWJD 3UJIL 1B4JH 2FSEA 4NC2B 2XXCB 2HT4D 3D85B 4LCCC 4URTB 2JJSA 4KY1L 1SYVA 4K3JL 4ZUSB 5DZNA 3RHWK 4GG8B 4Z7VE 2PCPB 4FP8L 2FNBA 1IAIH 2O5XL 4W70A 4LVHC 2R8SH 4AMKL 2ADJB 3QI9B 2J3SA 1QPXA 5C08D 4CW1A 4HGKC 5J1TC 4EDXB 3N1GC 4F15B 1QP1A 1JZ2A 1FGNL 1MCOH 5J12C 1BJ1H 4Q9RL 1HH6A 3QWRD 3MLSL 5IB1B 4JO2H 4E5XB 5GS1A 3DSFH 5EU3B 1S5HA 3Q48A 1NGPL 1N26A 3JV0A 4WUUD 2M8XA 3G9AB 5JO5A 4ALAH 3FQWB 4HWZA 1Z9MA 4YO0A 4U1MB 3KPOB 3O2DA 4GBXB 4HWUA 5E4EC 2E27L 5D1ZB 4HUXA 2RFXB 3FRUB 3RI5K 5EBWA 4MJID 4PJXF 1WAAA 1XGRA 3IU4L 5FUZH 3RZCD 4LLMB 4P2OB 4JJHA 3WNMA 1WC7B 2NXYB 2VC2L 1JIBA 5DJDA 3RKDC 1CBVH 4XVJH 3RRQA 1TVDA 4WU7B 5KG9A 4JLRA 1VPOL 1MCNA 5EIQA 3BKCL 2EO9A 4Q0XL 2R0ZH 1IGFH 4KJYB 5L7XL 4MB4A 1N59B 2MCG1 3FQXA 1C08B 4M7ZC 1YPZE 2PR4L 5SWZB 3PP4H 5FDWA 4M1DH 5I17B 1ZT4B 2MQ0A 3SDXA 5DJ2A 5EU6E 2R1WB 3VW3H 1SVZA 3QEQD 3NABL 3QNYA 5ANMA 1X5JA 1WBXA 1NH6A 4G6ML 4JFEA 1R0AL 2RHEA 4YHYC 5TFSH 4JM2A 3VWJB 3DBXA 3QXAB 5CZXD 2BSSB 4WEBL 1S7SA 5DJAA 3ROOB 3UTSD 4F7EA 1RZ8A 5E8EB 4I9WE 1QVOA 2NX5D 1L0YA 4H8WH 4NM4L 4PJGB 1JMXA 1WTGT 1JZ5A 4QT5A 3CFBB 3TVMB 1DVFD 1EGJL 3QA3A 3C6LD 2VR9A 2Z8SA 3MRFB 4XMLH 3V4UL 5DTFB 5CEXB 3WD5H 1T3FB 4CNIA 3DVFA 1ZK9A 3QJHA 3EO9L 4B50A 4Z0XA 3MGAA 3MJ7A 4WUUB 5GRVL 3VRJA 4TULL 3BH8A 3OXRA 2UWEA 4NSKA 1RMFH 4XNZB 4ZS7H 4I5BA 3GMMB 5KVGL 3QXDA 1OGAE 4NUJB 3NA4A 5B3JE 1ORQA 1XH3B 3QDJE 4R4FH 4YHOL 4N8VA 4MJIB 2BMKA 3RZCB 1RV6X 1IKFH 1CGSH 3MRDB 3QEUA 2OQJA 3QUXB 3ARPA 3HFML 3MOQA 4Y4FB 5E9DB 2ZNWA 3ARXA 4S2SA 1J1XL 2CR6A 4ZXBB 1CXLA 3GMQA 1MHPL 5C7XL 4Q6YA 3DVIA 4RFNC 1KPVB 3IAGC 3S88L 4MQ7A 5EPMA 2DLEA 3EO0A 4ONGL 2Y7QA 4WO4D 3VXRE 5GSRA 4U1NA 1BFOA 1YJDH 2ICEA 4D9RD 5BJTB 2A6DA 3WXWL 1HSBB 3RUGA 2B7DT 2X4UA 4WTZA 3ROLB 3GSVB 3C60D 4Y4KC 1I1AA 3U7WH 2X2YA 3I3BA 5FK9A 1DQLH 3W0WD 4PRIE 1H15B 5LVEA 3PWPD 3DUUA 3UTSB 4K71C 4KKLC 1MCBA 1MEXH 3LDBC 5IHZB 3FHQA 1P5UA 2NX5B 1A5FL 5E2TH 4J1UB 3A0OA 1QSFA 3O6MH 2HJFB 3EOTH 4KAQL 2E6PA 1BOYA 1DVFB 1V7MH 1WWCA 3C6LB 1K5NA 4ZPVB 5HHOE 3RBGA 1K2DB 4CU7A 1IGYA 3DO3A 4R90L 3GSRB 1A7OL 1QSEA 3L3IA 5GS0D 4EUPH 5J89A 4LRIC 5KVDL 1YY9C 3BGMB 1XEDA 4LNRA 1BAFH 1U42A 4L4TD 4U6YB 5JNYB 2ZUTA 4L5FL 5JPMB 5HYJD 5HVGB 3LKSB 2EH7L 5KS9A 3HE6D 3KPTA 3VXPA 3IFNL 2A9NH 1B4JL 1XR9B 1QLRA 5DVLA 4H88H 2I24N 5I8KL 2GHWB 3RNKB 4E42B 5FECB 2UVFA 4GQPH 3TZVD 2GTWB 1NC4D 1HH9A 1ZHKA 1ZHBA 4U6XA 2PXYC 3OAZK 43CAA 1PFCA 4HUMB 4LHQB 5MI0B 1K4DA 3ALPA 4E0RB 1IMHC 1DUZA 1RUAH 5CJXA 3ULUD 3W81A 1MCOL 3D3VA 4WO4B 4KK8C 5TDPA 4JO2L 4JFDA 3DSFL 4PGEB 1AGDA 2R29H 4LEOB 4NPYB 5BZWB 2Q3AA 4ALAL 3VI4F 1ZLSH 1QUNA 4RAHA 5T3XE 3PWPB 5FUZL 4WW1B 1W8OA 5I2IA 4JFOB 5CEZD 4YUEH 2DB8A 4NWUH 4HUNB 1CBVL 1MUJA 4XVJL 1DBBL 4LVEA 1G9NH 1W0YT 2HVJA 3QXTA 2GSGB 2JJVA 3LKPB 3D39E 2R0ZL 1IGFL 2EDLA 4V2CB 3VH8A 1JNHB 1T21B 1DFBL 3G08B 4KDTA 4OD2B 1U8QB 2DOCA 4L9LA 4M1DL 2DM4A 4PLNC 4Z5RB 1A7NH 3VW3L 3O4LD 3WNKA 3QFJE 4LLDB 3KWWB 2G2RB 1FNGB 3UAJC 3TA3C 5HYJB 4BK5A 5D1QD 3S35L 5L8KB 3BRGC 4CBPA 3T0EA 2PKDA 3GUTA 2Q8AH 2HMID 1CQYA 4MA3B 3JVGC 1SVCP 4AY0A 3E6FB