1ACYH

Crystal structure of the principal neutralizing site of hiv-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
221
structure length
221
Chain Sequence
QVKLQESGPAVIKPSQSLSLTCIVSGFSITRTNYCWHWIRQAPGKGLEWMGRICYEGSIYYSPSIKSRSTISRDTSLNKFFIQLISVTNEDTAMYYCSRENHMYETYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the principal neutralization site of HIV-1.
pubmed rcsb
source organism Mus musculus
molecule tags Complex(antibody/hiv-1 fragment)
molecule keywords IGG1-KAPPA 59.1 FAB (LIGHT CHAIN)
total genus 39
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1994-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1acyH01
4Z5RA 1CXEA 2HAZA 2JB5L 4S1SH 5DHYB 5KZCD 3RDTB 3VGAB 1QFUL 4ODTL 1A14H 5C0NC 2VXTL 2EE9A 5IB5B 1A7NH 1UWEL 5HGDB 4XVJL 4NZJA 3FQRA 4F2MA 4JREC 3OKYA 1JNNH 3TJHD 3ORJA 4HIEB 1PGRB 2ZUYA 3O2WL 3DVNA 3MJ8B 2E7LC 2N56A 4HFUH 2CKBB 4QY8B 3UBXB 2P8LB 1MJ7L 2PXYA 3HLAB 1VKXA 1BFOA 4A6YA 3G9VA 5L0QB 4QOKE 4JM2A 5D5ME 1U3JA 1BJ8A 4YHML 1OPGH 4NIKB 3AS3A 5LQBH 3V5KA 5F7FA 3RWEA 2ITCA 4U6VH 4ZUVA 4YR6B 1ZVSB 1YMHB 3D25A 3EFFB 1QRKA 4P3CL 5FF6B 1OGAD 5ALCH 2VL4A 3UTTD 3MUGB 1ZA6A 5SWSD 3S88L 4OQTH 2EDQA 1EAPB 3DRQB 3EOTL 4GKSA 5CJXC 4YBQD 3VXPB 2GKIA 3QA3B 1I7TB 4XNQB 1QPPA 4JHBA 1L4IA 3CPLA 1ED3A 1NUFA 4E0RB 5C0ND 3CVIH 1WIUA 3RPIB 3IDNB 1YDPB 4HKBA 1X5YA 4UDTB 2OR9H 3RA7H 2VTFA 3NIGE 1QLRB 2X70B 4DN4L 4IJ3C 4OLVL 3MOBH 4K3EH 3PL6D 4OFYA 4OM0L 3O2WH 4TNVK 1E27A 4FQXD 2CO7B 4MX7B 3IFOA 2H2SC 3CVHH 1KELL 3UPAA 3QQ3A 2AGJL 1DVFD 1WK0A 3V5DB 5IMLA 1LO2H 3EO1A 4GXUM 1K8IA 5KVFH 5D1ZB 1FZOA 4F7MA 2FO1A 1M7DB 3PNWA 2V2TB 1MFEL 4J3SA 1EGJH 1OM3H 3INUH 1D5MB 4KJWD 1CK0H 2BNRB 2V2XB 1TCRB 2IJ0C 4LSQL 4XPAH 1RK1B 1JPST 4MJIA 2DS4A 1RHFA 4BM7A 1CDUA 1R5IA 1IC5L 4OFPA 4ZYKA 4HX1B 2JJUA 1YMMD 3U7YL 2ICWA 1T22B 3QULB 1ZHBB 4QOKA 1E6OL 2NXZC 3TYGL 2FBJH 4CU8A 4PG2C 5I1IL 4GKNB 4FP8L 1MI5D 1LO5A 1AXTH 5DFWH 5DRWB 3CDCA 1BQSA 4GQ9H 4K7FB 5IF0A 2FATH 3QUYB 1EFXA 4ONOA 1BQLH 5DURD 4Y4HB 2HN7B 3QZWG 4CN6A 1T1XB 5TJWK 1XGYL 4HW6A 1UJ3B 1NAMB 5JPMA 1INDL 4UQ2A 3TIDA 1F5WA 5DRNB 2Q20A 5FYJU 3ILPA 2EDRA 1MFAH 4DUWA 1BLNA 1CFQA 2I25N 3QDJD 1I1RA 3EIFA 1J0YA 5FUZL 1VPOL 1CVSC 1NL0H 4QXWA 5DJ0A 2BJMH 2RAMA 3IAGC 1S7WA 3KYAA 4XPHH 1IM3B 1T20B 4LSPH 3KPRA 5FFLA 4MAYA 1J1OL 4KI1A 4C56B 1TPXB 1EEZA 1EHAA 1U8HA 4GRWB 4YXHL 3QDJA 5IVXA 4QHNB 3OBAA 3K4DA 1KJVB 2H8PB 3LHPH 4OZFG 3FO0L 1NCCL 3RWDB 3EOAA 4YJZL 3DO7B 2X4QB 3B6SB 5MEPA 3RWCB 4ZSOA 4X8XA 1L6XA 4ZUVB 2ZG1A 1IAOA 2AV1A 4H5SB 4LCCC 4PLJD 3RWEB 5I8CA 4K3JH 3WUWB 3V5KB 1YEKL 1FYTE 5CBAA 3UJJH 2FH6A 2H9GA 5F89A 1NBZA 1LILA 4M6AA 1FH5H 2Z8RA 4ZFFA 4XCYB 1OGAB 1G7IB 3DX7A 3ROOB 1UZ6F 3ZKMC 2XIDA 1FNEB 2AK4A 3MMEB 2B1HL 1XCTB 3IDUA 1TETH 4H1LB 2YUVA 1AI1L 1HHHB 1UB5B 5D7LD 4CW1A 1MCIA 4LPUA 4JEGB 3GSRA 1INQB 3O6FB 3FN3A 5DO2C 1KPVB 4MA8L 2B0SL 4ZFZA 1J8HA 3HHRB 3ULVF 3HE7C 3MA9L 1Q0XH 3SDDB 5D2NB 2XTJD 4F7CB 4PJIF 3BPLC 5JDSA 1QSFE 1PBYA 2DBLH 1WZKA 1ZHKB 1D5ZA 2MPAH 2VZ3A 3FT2B 4NO0A 5EB9A 4JM2F 3HZYB 4I3GA 1J8KA 2I9LB 3QIWA 1U8JA 3G6AB 4LIQH 5EU5A 2V2XA 4MD4A 4JFFD 1MCEA 4WHYG 4AL8L 2HFGH 4O02H 3PL6A 4OFYD 3WO3B 1EVUA 3D69A 1M05A 3FO1A 1HYSD 5F93C 4BKLB 4Z77A 1RVFL 2Y6SD 4LCUB 4N8VA 1PG7L 4ELMB 5JQ6L 2VDPL 1CF8H 2F19L 1ADQL 5IVXB 2DQUH 2G9HB 4UOJA 1BQUA 5CGYD 4P57A 4YFLF 5IMKA 1UZ8B 3TO4B 1HI6B 3G08A 1HSBA 4HF5H 4Y88A 2E7CA 1T21A 3P4MA 4JVWA 5L88H 1IM9D 4G9DA 3QG7H 5HHVL 4HKBB 4MLSA 3SKUD 1YN7B 4GOSA 3J8F7 3SY0A 5CEZE 1FVCB 4L3CA 4LKXA 4XX1E 5E9DB 5GGVY 3L3DB 4XX1G 2OQJA 1QTYT 3WFEH 3L7EA 3O9WB 1DFBH 5DMIH 1UXSA 3QUXD 1PKQE 1G1CA 4P2QA 1YYLH 1LEGB 2C3WA 3P11H 2R2EA 5BVJA 1T2XA 2H41A 3U82B 2QHRL 2BNRE 1GOFA 4KDVA 1E4XH 3GSQA 5DDHA 5DMGD 5D1QD 3MNWA 1CT8B 2XI9A 1G1YA 1HEZA 3C5ZD 1MFBL 3TO2A 1NMAH 1J8HE 5DRWA 5EDXA 1I9JH 1XIWA 4NKMB 1VPOH 4UDUA 1I3GL 4Y19B 3MRKA 4JZJC 3SDCA 5CP7B 4BZ1L 4XGZA 1A9BA 1HDMB 3MODH 3TBWB 1JZ3A 4ZPTA 2VN4A 2QADD 1MY7A 2NXZD 4LCYA 1A6WL 3KVQA 2W60B 5SWZE 1BPVA 2NNAA 4C54A 2QLVB 1FN4A 3D18A 1MLBA 2ED8A 5F1KC 2R29L 4F9LA 1D5MA 3FO2A 5CILL 4ZDHA 4DFIA 2ORBH 4OLWL 4LBEB 1FJ1A 3PE9A 1G7QB 3DROA 3VXRA 2ATPB 2BSTA 25C8L 2AXHA 5HHPA 3U9PH 2ZSVA 2DTSA 4P9HC 5HI4D 3O9WA 4K7PX 5C0GB 1FNGB 3MGOA 3DSFL 3GBML 3S96B 3NACH 3UTSE 5GS0L 1KC5L 3ULUE 4K3DL 5J06A 1QG3A 1NMCB 4XPGH 4KZDH 2DQDL 1Q94B 4G42B 5F96L 3OAUL 4RAUB 1T21B 5ADOL 1RZJC 2BCKA 3KYOA 2R9HD 4J8RA 1Q94A 1JPGA 5GXBB 1UG9A 1KF9B 5GZOC 1TPXC 3SJVE 1R0AH 4PJAA 4ZUWA 3QNZA 2PCPB 4R96A 3GMQB 5TQ0L 3QCUL 5BCAA 1BMGA 3ROLB 3V52H 4MAYC 1JMXA 4Z95L 1MWAL 1WLHA 4YIQA 5JMRA 1MAMH 1MRCL 4JZOB 2HT3D 1R5VA 1BP3B 5K9KB 2AKRA 3LOWA 4WENB 5HYFA 2XA3A 4OM0H 5I18H 2WP3T 4OT1L 1FZKB 5E9DD 1A2YB 5AD0A 4G6FB 3W9DA 1FVEA 1CGXA 4KAQH 5CZVL 3UTSD 1FLTX 4YPGB 3SDCB 3ZKNC 4ZFZB 4UOW0 1DLFL 3MBEC 5F72S 1FG2A 2UUDH 4OZIB 3HZKA 3QEGL 2VLJE 2XKSA 1V7NL 4P2YA 4RIRB 1MIML 1NUGA 4JFDD 3MZTA 3A67H 3QUMA 4KHTH 1V3LA 1NCUA 2Y36H 4N8PA 4OSUH 5JORB 4WUUD 2BNQE 4LLWA 4I5BB 1W0WA 2X09A 2CXKA 1T6VN 4OFDA 5SWZD 5DD3L 1GOHA 4PJ8B 3LKNA 3QUZD 1IGJA 2AK4D 2HFFA 4YAQB 4GW1B 4HKJA 4M5ZH 2H6PB 4OLEA 2BNUA 2QQLL 1CICB 2QADB 5KSBB 4PJXB 2OR7A 2CLVA 4GW4A 3IAPA 1P4IH 4UILH 3EW3B 5T5FL 4MCYA 1M6OA 1AGEB 5DDHB 1S78C 4KJYB 1OAXH 4ZSOB 3ABZA 4IM8A 2CIIA 3O6ML 3SDYH 3CFBA 5BRZE 2V5MA 4XVJH 5JR1H 2NY5C 2XG5A 1BAFL 1OGTB 4RSVA 5JLZA 2MSPA 4DK3A 4PRPA 4LLVB 5E8EA 3QJFA 1FAKT 3ZE2E 4JFZL 2LTQC 2ZOLB 1HZHH 3ZE2F 3KYKL 4JM4L 1ADQA 3PQYE 1P4IL 3CCHA 1NAMH 3OKNA 3CFJA 5D71H 3TV3H 3MNZA 3O3AA 3DXAB 1EX0A 4WI3A 2FZ3B 1VEPA 5AYUL 1GGCH 3GI9H 1X5FA 2DLGA 4HWEL 3RVWD 5E8DL 5B38A 5BXFB 2P7TA 5EZLA 4ZTPL 3VWJD 4CJ0A 2JB6A 5HGHA 3K3QA 1NAMA 5JPMB 5IFHL 1X5KA 1SY6H 5IEHA 1T1XA 2NY2C 3KXFA 5LAXA 1VFAB 4OZ4A 1NGWB 2MNUA 2QL1A 4BA8A 2BNQA 2QR0A 3QHTC 2FJGB 4X6DE 3JSSA 4YHZL 1U8JB 3G6AA 5DZNA 4KDWA 1TJIH 2EKSA 4OLWH 4ZAKD 3IVKB 4NHUA 2GT9B 4TVPD 1WV7T 2R0WL 1AKJB 5E2UH 5FCUH 5J6GA 4XVSH 5HBBA 3BRDA 1QSFD 3CDGA 1KOAA 1KG0B 1Z3GH 3ARFA 4WDIB 4HC1H 2F53E 4ZXBB 2J5LC 2VISA 4U1HA 3D39B 4QXTA 5GGRA 4NNYA 1H3GA 2GAZB 2BNQB 2HVJA 2XQBL 3NIDF 4Z8FH 5K9KA 5CSBA 4B50A 3PNWB 3WV0A 2W9DH 2GHWB 3TIEB 4AM0A 5DURB 5KOVC 2A2QT 2H3NA 2OLDA 3NFNA 1MCPL 3L5JA 3H3KA 4ZO8A 4Y4FC 4XPTH 4MNQD 3MFFB 3EDJA 2W65B 15C8H 2DKSA 4LLDA 2F58H 4PRIE 4KQ3H 5ADOH 2D31B 1HHIA 5GJTH 5CEXA 3ZKSD 4ZOAA 2X89D 3N9GH 5E00A 3OG6B 3AS1A 4U1MA 1T89C 5KTEL 4GG6B 4OCRH 3WS6A 5ACZA 4NNXA 1IL1A 3DGGB 5E99H 1UKQA 2DLHA 4Y2OA 3BE1H 3FQTA 4Q9RL 2G5RA 1DN0B 5DRXA 2FCBA 4PY8I 4RX4A 1UFUA 2OXGA 3D85B 4GW1A 4HKJB 4LNVA 3IDGB 5D70L 4LVOC 3HAEH 3CFEA 4Q9QL 4X6FA 1Z0MA 2GJ6E 2J88L 3GKWL 5IQ7L 5SWSA 3ARPA 5HI5C 1N8ZB 4MDIA 4HHAA 4URTB 4AMKH 1ND0B 4NKOA 4NC2B 4WO4D 3H3PL 5C0AB 3C5ZB 4RIRA 2WM0A 1UXWB 1L7TL 5GSRB 2BMKB 3KPRD 5I8OH 4QRSA 4PJIB 3SOBL 3X13A 1FFRA 3KPSD 4KRNA 4HUUA 3U7WL 3LKNB 3QHFL 4WTWA 5I1CL 1KCKA 5FB8A 1IAII 4MHHI 1S7SA 1YECH 3MLVH 4LKCB 3U30C 5FYJE 1G6RL 3BH9B 2GSGA 2PF6A 4LOUC 1RIVL 4RDQF 4RZCB 5ECJE 5GGQL 4NFDA 2YRZA 4NN6B 1FC2D 1T83A 3GMLB 1NMCC 1CFBA 5T3XH 5DHYA 3LRHA 4X99A 3BUTA 3OJMB 5GGVL 3BP5A 4JFEE 4HIXL 1K4DA 4LDLB 4MJ5B 2PYEB 2WIIA 4KKAC 3TBTB 1QSEE 3CC5B 5JXEC 1NC4D 2AJYL 4N0UB 4GMTL 1F11B 4U31A 1AI1H 5IJKA 4PIRF 1AXSA 2AJVH 3GJFK 1E27B 2F9BT 2YHGA 4ODVH 3AB0C 3O6LL 4QTIH 5DLML 4HJJH 3IDNA 2PNDA 5IVNA 4Y19D 1KIQB 5TH2B 5FO7A 2HJFA 1XR8A 5IB2A 5ID1B 4WY7H 5CWSB 4LAQH 2MHAB 3E8UL 5EU4A 3QJFB 4M7LH 2DLEA 1HSAA 2J7LA 3IFOB 1OARH 1QYGH 35C8L 4HV8A 5J11C 4OM1H 4XCNB 1FE8L 2MOVA 5IJKC 5BZWA 3RBGA 5ADPL 4H1LG 1UB6B 1A6VH 4KC3B 4DAGH 4U6YB 5TQ2H 1CIDA 4U1NA 3VRLF 1YQ2A 5HYQA 2DQDH 5F96H 1NDMB 2V17L 4HIIB 2R9HC 3LDBB 5LGJA 5D5MA 5HYSA 5B3JE 3IDJB 4HFWB 1BGXL 3FFDA 1FO0H 1RHHA 4XBEH 3ZT6A 4WW1B 2BZDA 3BFOA 3H3PH 4KKBD 2HMIC 4X4ZA 2HP4A 3AS0A 4FQ2H 3PWJB 4M6OH 1D5IH 3F7PC 3EYSH 5I71B 4H88L 3B9KC 1JWSA 3SDXE 3BVNA 1XGYH 4ZO6A 2QADC 1BFVH 4P4KD 2VDNL 2JLLA 4XVTL 1CU4L 2VXVH 5C70A 4IRSC 1FH5L 2GY7B 4JFEA 3UP1A 5I30L 4NQCE 1A4JB 4X8JB 1OGAA 4YK4B 5KVMC 4Q9RH 3H2WA 5BQ7B 1BJ1J 2XQYK 1U6AL 1BEYH 4O9HH 2FBJL 3QISA 1URLA 3CMGA 4N90E 1DDHA 1AGCB 4JO1L 4XNUL 3G5VB 3LD8C 1KV3A 5TDNA 2DLIA 3MLZL 3O8XB 2A0LC 5EG6C 1N8ZA 1AP2B 4MDIB 1N0XL 5E94A 12E8L 3DUUB 5T5NG 2DRUA 3LRGA 3CX5K 1CDYA 1NCDL 5IBTL 1ZGLA 4YGVA 4Y4FB 3C8KB 1TLKA 3NN8B 3V5HB 4AY0A 8FABA 2WZPD 4APQA 3QO1B 4PRIB 1JFQL 1R3LB 4DGYL 5JZ7D 3ALPA 3IS1X 4WUKH 2R0LL 3OAYK 5KVDH 4FQHA 3PDDA 2B7DT 3NIFE 4UNVA 2P43B 5D7LB 5T1KD 1BEYL 5EOCL 1ZAGA 3BUYB 4OAWB 4P4KB 5L2JA 4N0FA 4CVXA 3MREB 4CADA 4Y1AE 1MPAL 1NEUA 3VDCA 2LVEA 3ZMRA 1TVBB 4MQ7B 2CDGB 1RZGB 4RGOL 1JWUB 1F6FB 5C0FA 5F7WC 3VFVB 2C1OB 1DQDH 4Y4HA 3GZKA 1MCBA 3BKJH 1HHKA 1SJHA 2FLBT 3L3HA 2EIDA 2UWEF 4AYFA 4P5TA 5D1XC 5D2LA 3L5WA 1S9WB 3R4DA 1CE1H 2J8HA 3IJHA 4ZNEE 4NDMA 3NCFB 1BGXH 1VA9A 4FFYH 4TULL 5MENA 4P5MA 4ZXBA 4QNPF 4OGXH 2L7JA 3GSOB 1JGVL 4WEUD 4K3GA 5FGBA 2DQHL 1M7XA 3TA3C 3U2SA 2DN7A 5F7DB 1UYWH 4GS7C 3GI9L 4MS8C 3IVKA 3S7GA 1EGJL 2O5XH 1OM3L 3LV3B 1QYGL 1MAKA 2DI8A 3MA9H 2H45A 4JKPH 3AFLA 4E5XB 1TTUA 1G9EA 1H5BA 3TF7C 2YK1L 2VDML 4HHAB 3CFJB 5C92A 2VC2H 4KGJA 4R4NC 4ZQKB 3OMZA 4MA1C 3F12B 1LP9E 1FORL 1WBYA 2P5WA 1BWWA 2ILLA 4DCQA 3HE6D 2EYTA 5HHQA 4H8WC 2CLRA 3AXLA 3WKNA 4R2GB 1S7UA 2OL3A 3F7YA 2X9XA 3G04A 5JOPE 3L9RB 3BUYA 4OAWA 1IFHH 4NPYA 4DGIH 1EEQA 5J3HD 2Y1VA 3C60B 4U1MB 2Y06H 2E6PA 1XF1A 2B4CL 3DXAD 3OKEA 4GRLA 5K59F 1CG9A 2NX5D 5ITFA 5CD5D 2PW2A 1D9KC 2IGFH 4HS8L 3SPVA 3VJ6B 5CSGA 1UVQA 1CG9B 1HNFA 4U2YA 3KPSB 1WZMA 2KL6A 1WITA 4G6KL 2A83A 3WIFB 5HDQL 4XPTL 2HT3C 5J56B 5ILTH 5DK0A 5TFSL 4ZFOL 4XZUB 1MQ8A 4GRLC 5KSBA 2LU4A 1MFDH 4M6ML 4WTZG 2D7OA 5DXWA 5DJ2B 3RX5A 4M61A 4OZFH 1VACA 1WT5A 1U91B 3MRLA 1WBYB 2P5WB 3RIAF 5F7DA 4M1CD 5HSFA 3PIQB 4RFNC 4L9LC 2BSSB 4X6EA 5AD0B 3RAJL 1R5IB 5CSZA 3B9KB 1RUAL 1U93A 1FFNB 5D9SA 3VXME 4XC1L 5AEAA 4PJCB 4U1JB 3I84A 2JE8A 2VZOA 4OD1H 4OQTA 3K0WA 4AK1A 5HYSG 1ORQA 4YHPA 3RY4A 4DQOL 5FGCE 1MI5B 5CLTA 2NZIA 5GRWA 1XF2B 5ESQB 4LHQB 5I1IH 3HC4L 1BWMA 4OFIA 2YS4A 4XNYH 1P53A 2E6QA 1RJLB 5CKAA 5HJ3A 3BSZH 4JFOA 1G0XA 2BFVL 2OJZH 5E1HB 4WHCA 5CCKH 1GZQA 1YPZB 3C6SB 4NM8H 4D9RE 4ZTPH 3ARBC 3JV5A 5DJAB 4NSKB 1J5OL 3FN0L 2J6EH 3HS0B 1M7DA 1GGBH 1NMBL 4I48A 3HG1B 1CVRA 4Y5VC 1UKSA 4LPWA 1MRDH 4M4PA 4QXGL 1RUAH 4LDEB 2R29H 1JTOA 4XMLH 1TVHA 2OXHA 1I1YA 4P5KA 4ZDHB 2HYMA 3C08H 4P5TC 5D1XA 4NC0B 3RWGA 1MRFH 2Y72A 3SJVB 5ANMA 1I8MA 3PUCA 4LLYA 5J6HA 4H8WH 4NHCH 1KJMB 2X40A 3FB6A 8CGTA 1INEL 2CLZB 4GW4B 3H42H 1G7PB 3GIVA 4A6YL 4GKZA 4HWBH 1K5NB 4L8CB 4DVRL 2QBWA 4Y19E 2HJKA 2Y5TA 4JFXA 3MJGX 5JQHC 3BESR 3P30H 3MJ8A 5FYKH 4WEMB 3ZKND 3CUPA 1JGUH 1Q9OB 5EU6D 2FEDD 3IFNL 1FQ9C 3NZ8A 4OZHF 1ETZA 2ESVD 3R06B 4MAUH 2IAND 4MHHG 1MH5B 2AJXL 3DVIA 4J4PC 5GRJH 5TE4L 3LD8B 5HYJA 4K71B 4M7KL 5C6TL 3E2HB 2Z8VC 4I0PB 1FIGL 2Q7YB 1OPGL 4ONGL 4I0PA 1DBMH 3KHQA 1F4WH 5CAYB 3TV3L 3DV4B 3GMRB 5E2VL 2IBBA 3RX8A 1YYMH 4ZMAT 5SWQA 5IG7A 2EH7L 1MCWM 5JO5A 3MLPA 3ARDA 2A38A 3KYKH 2L7UA 3RI5F 3GNMH 1ETZB 3PJSA 4BQ6A 5F7KC 3SJVA 1YN6B 3WJJC 4MNGA 3HZVA 4XCNA 4L3AA 2CIKA 1BQHG 3OXSB 1QR4A 2H1PL 2R1WB 1HWHB 5IROA 5T5FH 4IJ3B 4WU5B 4JKMA 3LH2L 4PRBA 5BS0E 1LO3L 3KS0H 1HNGA 5GJSL 3LIZL 1UYWL 5ESAA 3WUWG 2FL5B 3ARBD 3C8DA 3BGMA 3ARDC 3QUXC 4M5YH 1I75A 3STLB 2ARJB 2FL5A 3V7MA 4EZMA 1U8IA 2CDFA 4PJHF 1C5BL 2IPUG 5DJ6B 1W0VB 1WIPA 1PD6A 2G9HA 3ES6A 5F6HJ 5JHLL 2EC8A 1B2WH 5I73C 1MHPH 4X6CB 5T3ZH 1KB5H 4OCSL 2C3GA 5CWSA 3IDMA 1P6FA 1IEAA 5ESQA 4Q9CA 5CD5C 1Q1JH 4PJEB 1MIMH 1CE1L 1P6AB 4WFFE 4ELMF 1D6VL 2HKHH 1ERNA 1OSPH 4MLIA 5DQDH 4JR9H 2BY2A 3DGCR 4HD9A 3G5VA 5HYJE 1AHWA 4P23C 4N9GA 3LKSA 3X14B 1RZKC 3RUGB 4MD0B 3QRFM 2Q87A 3DV4A 3GMRA 4JM2B 2GT9A 2HKFL 1IC1A 4UNTA 5KANG 1OLZA 1OW0C 3MLSL 4LMQI 2F54D 1KCUL 4OQ1A 1L7IH 2MWCA 3G9AB 3TN0A 3DVNB 3I75B 1MWAH 2CD0A 1JFQH 2APBA 1P5VA 4XP5L 5DEFA 1T4KB 1M7IA 3VMNA 4OCWH 43CAB 4BZYA 4OCXL 4UT7H 4QCIA 2D0FA 5I9QB 1Q72L 1LQSR 2QKIB 2RGSA 2VIRB 1CFNA 3PQYA 4Y5VA 1A3QA 4RCAA 4C83B 3L1OH 3GSNH 4PJGB 3OTTA 5E6IB 3E6HB 1GH7A 3MRDB 3FFDB 3GSXA 2YA1A 3RHWF 4X4XB 1KC5H 1R24B 2F74A 3QNYB 3GBMH 4LAJH 5CJBA 3U7AA 5IB4A 5CEZL 4XWGL 2IQAB 2ATKA 1Q9WB 4OCNC 3UTSB 4Y8DC 5TE7H 5I1JH 1T3FB 3E3QC 4JKLA 4NC1C 2XRAL 4V1DE 3RHWK 1HKLH 3BP7B 1X5XA 3EFDL 2EEDA 1OTTD 4Z7NF 1JZ7A 4WO4C 2EDKA 4RQQA 5GS3A 5INDB 1T1ZA 3RPKA 4HF5L 3LN9A 4GRLB 4P46A 3D85A 5I1JL 1QO3A 3KLHC 3LB6C 1GC1H 1E0OB 5ID1A 1QSEA 4JLRB 3PL6C 4KTEL 4ZUSB 3Q5TA 1MQKL 4Y1AD 3V9FA 4XBPA 4E5XA 1XF4A 1IKFL 2WK2A 5EOQH 4F15B 2V9RA 4U1HB 1DUZA 4B41A 1T22A 2X5PA 2H32B 2SEBA 2ZZUT 5HHXH 3TFKC 3O2VL 1VADB 1Y0LA 3F12A 5J13B 5MERB 4ODWB 3QO0B 4XCFH 4AIOA 5D93C 5DC4B 1YUHA 4GXVH 4QRUB 5IVZB 2GSIA 4MJIB 3VCLA 4LNRA 4X99B 1M7IB 1T7YA 1N64L 2OS7A 1QFPA 4P59H 5JIHA 3SKJL 3V4UL 3P0YH 1S5HB 1DSFH 5FUOH 4BUGA 1V7ML 1WQVT 4QXUL 2X4NA 2APWA 4IOSD 3QXAA 3MRBB 2NLJB 4IRZL 1O7VA 5IFJB 3BYYA 4POUB 4PB0L 4D9LL 5IB1A 4F9PC 3GJFH 1X4XA 4QRPA 3F5WB 5EOTB 3ULUL 3WO4C 3JUYA 3QG6B 2D7MA 2PYEE 1RSFA 32C2A 1DANU 4GMTH 2A6DA 1PAMA 5EA0L 4NUJA 3GMPA 1OP3K 4OZFB 5C0JB 4YDKL 1LP9F 2E8YA 5EH1A 4E9LA 3D3VB 2YPKB 1J18A 2BHZA 3F62A 3VG0H 3GBNL 1HE7A 4P5TB 3KXFB 2IAMD 5FCSH 1FP5A 1D7FA 3SE8L 3OKOB 2YPLE 3EOTH 4FXKA 4P46B 1X5LA 1HXYB 1NPUA 2BDNL 1HILA 2H32A 2SEBB 5DUBA 1Z5LA 3KYMB 2KDGA 5SWSE 4PP2B 5AYQA 2GUOA 1OGAE 1IMHC 5KW9L 1S7TA 1QBLL 4TUJB 3O9WC 3G5YA 1W72H 2Z31D 4YXHH 2WUCH 3P9LB 1DQLH 3MBXL 5D6CA 1A1NB 1NGQH 4NRXB 4FQXB 3T4YB 1FSKC 4HWBL 2JCCF 4JCMA 1RZKH 1PX4A 2JTDA 3S96A 4NBXB 4WGVB 1H15A 5E4EB 5F6IC 5JNYA 4MJ2A 4XNZC 3LRSB 2GJ6B 5FDWB 3GSUB 3WS6C 4PJEE 3QNXA 2BC4A 3OXSA 4G7VL 3HRZB 3ZL4H 3S35H 1ZGLB 1DCLA 1C08B 3S8WA 4UBDC 1WJ3A 2IH1B 2ZWLT 5IQ7H 2HN7A 1DLHB 5EIQA 3C09B 3VRJB 3DX8B 5H37H 2VLLA 1MCLA 1GGUA 2DQFB 5T1KB 3I6KB 4PG2A 2RR3A 4WNQB 4P48A 3UPRA 3H9SB 2JCCB 4NN5B 4H26A 4J4PD 4X5XA 3LS4H 3WFZA 2HFEB 4BFIA 4WJ5A 4LK4A 4NM8L 4K07A 5EC1A 4GS7B 2XXCB 1OAQL 1MUJA 5C0BB 2A9MH 4ZODA 4JKWA 1AKJA 5E8PB 4PRAB 4P99A 3FO0H 2GCYB 4PB9H 1ZHNB 5C3TA 4F3FB 1OB1B 3D39D 1LD9A 1NJ9A 1IC5H 3KPMB 1CIUA 3ARUA 4FRWA 5DGRA 1I3VA 3GJEA 5IV2B 4P3DA 4FMKA 3DO3A 2YPLA 4QGYA 3RNKB 5IB3A 4GH7B 2W9DL 3QIBC 3HMXL 1ZLVK 4GRWE 1P2CB 2AAVA 1A7PL 4FHBD 3TVMA 1HCFX 1AGBB 1T0MA 2YZ8A 4P9ML 4LSRH 4MDJB 4EXPX 1Y6NR 5CINL 5F9JA 5D96B 2Z35B 2YRPA 2VOTA 1NDMA 2YPVH 1ZLSH 4YHOL 4UB0H 4KUCD 1U8KA 4G9DB 5J9PB 1OP3H 6CGTA 3WHE1 2GK0A 4CL7A 2BSRA 4XWOC 5IESH 3CZFB 1HXMA 4J3VA 1QNZH 4GBXB 4K3EL 4OD3H 1JNLL 4LSRL 3S3JA 3UC0H 1VHPA 4FQQB 4IRJC 1ZSDA 1NAKL 3AM8A 3CPLB 2MQCA 2GJ6D 4X7SH 5IW1A 2WANA 2FYYA 2ADGA 3KS0J 3L3JA 2UZIH 4DTGH 1BD2A 3IXAA 2XZAL 3U1SH 4NJAH 1XGQB 4WHTA 5EZOH 4PJCE 4PGJA 5J1TC 1OB1A 2XTLA 2OMNA 2ZCHH 2VLJB 4HMCA 1GPOL 4PGEB 3O6KL 3C2AH 1A0QH 2JF1A 2WBJC 3D2UA 4PJCF 2HFEA 2IC2A 2VLRD 3HNTH 2NY5H 2DWEB 4PTTB 3KR3H 1JNHA 1RZIA 4MYWB 4X7DC 3BWAB 3S36L 1INQA 1U92A 1XH3A 4TQEL 1S7QA 4JJ5B 4P2RD 5ESVA 4EBQH 3QXVA 3ZTJH 4NQDD 5B3NA 4PJ9D 1WBZA 1A9EA 3WIHA 3C6LD 1S7SB 3CUPB 3O6MH 5CZXD 3SDYL 3TC9A 3JWDL 5T1LD 3O0RH 1EJOH 5MHSE 4M6MH 3M17B 5HTSA 4ODXA 4DN4H 5I1AA 1IBGL 5MHSD 1WT5C 5DJ2A 3GSUA 3O3UN 1ONQB 4LVHC 5T33H 5I0DA 3SO3C 2XN9D 2NY5L 2NY6C 3DXAE 5C6TH 4U1NB 2QQLH 3TYFB 5B8CC 3KNBB 5KOMC 2PTUA 1CLZH 3Q0HA 4ZUUB 3G5YB 2EC9U 4S1RH 1MWAB 4WRLA 5EWIL 5BVJB 5I16A 5ISZD 2EXYC 1K2DA 1N59B 4KHTL 2VWEC 1CLZL 1KLFA 1KJ3H 3QWOA 3R0NA 5FA3B 3RZCA 5JNYB 5BJTB 2D9QB 5IB2B 5FO7B 1I3RB 4DVBB 1MOEA 4PJAB 4ZUWB 1AY1H 5KJRL 3GSNB 5F7LB 1DEEA 1I9IH 4Y1AB 5IJVB 2AI0L 5DVOA 5I74C 4R3SB 4RFNB 4JGMA 5LWYH 3QUYC 3WJLA 3CDGB 4WHYH 1MRFL 2B2XL 4XMPH 4MMZC 1A7NL 1UWEH 1P7KA 4UTBH 3JXAA 2X42A 4MDJA 2NLJA 5HHMD 4WU5A 1HWGB 2APVA 3ARYA 2P8MA 1R3IH 1IQDB 2JB5H 4K7FA 1OSZB 2F8XC 4PJEF 1BM3L 3VFPB 1YEFH 3WKMH 5BV7C 5BRZD 1XGTA 2P1YA 4LVNB 1FFNA 2P5WE 3CSYB 4V2CB 4HWBA 3C5SB 3LQMA 1RPQA 1XCTA 3FB8B 4GRWF 2BERA 4AIXA 5IB1B 4RBPK 5IW6B 2X4PB 3GSOA 4NJAL 3L7FA 3OKKB 1GGIL 2R2BB 4U1IB 4HKZA 4Q58C 4OI7A 1FO0B 3T0ED 4OF0A 2UY6A 3NA9H 3TO2B 3LCYA 1TVDA 1F3DJ 3MLYH 5EBMA 3V6OA 2J12B 3VRJA 2ORBL 3O45A 1PSKH 1PDKA 4YLQT 4M02A 5CZXC 3V4VL 1T0NA 4YHIB 4BQ8A 4WI6A 2NW3B 5F7NC 1B6DA 1DVFB 5IESL 2AEIT 4WTXA 4G6JL 5KVGL 1QRNB 4OUUB 3U9UA 4BQCA 1DUZB 4IMKC 1GIGH 1D5IL 4L5FL 1EZVX 1A6WH 3BQUC 1GZPA 4GG8A 2AJSH 5CBAB 1SQ2N 3BH8A 4U0RB 3QDME 2EIZB 1IAIH 4H0IA 3IDYB 1UWGH 3BZDA 3VFNB 1KTDA 1MCDA 1QOKA 1MFBH 4QHNA 5E56A 3C60D 3CXDL 3K2UH 4YDLC 3VWKD 2DQIH 4JPWL 12E8H 2VIRA 1E6JL 1JGLH 4LP5A 3K80A 3VXMA 1KB9J 3VXOB 2LVCA 5CHNA 1XZ0A 2D3VA 4YR6A 1AGEA 2B4CH 2YD6A 3A0OA 4D3CH 1DFBL 3PXJA 1AGDB 2OP4L 1OTSC 3VI4F 3U4EA 3FN9A 1FIEA 5JIKA 1DQJB 5J8OA 2IALB 4R0LC 1JF6A 4OZFA 4DGIL 5C0JA 1J05A 3A6BH 1WEJL 3VXNB 5ALBL 3ILPB 4Q74A 3MV01 2CMRL 3UBXA 4L1DA 1JWMB 3LZFL 3F58H 1DBKH 2G2RA 3UTTE 5D2NE 2F15A 4PPTA 1I7RA 1YEGH 1YNKL 3D9AL 1NC2D 3C2SA 3MRJB 5JQ6H 2AJYH 4KTYA 1WZ1L 3ZL4L 2XY1A 1QHPA 1BOGA 4G7VH 4HXAL 4Z7NE 1BIIA 1U3HC 3RVTC 3GHBH 4L9LA 4PGBA 1V7MH 4F33B 4NYLA 4G3YH 4PD4K 1XF5A 3MRIA 2GITB 5HI5D 2W9EL 3V4UH 1F8TH 4OV5B 3QQ4B 5HVHC 1DQLL 3T2PA 3PP4L 3X14A 5I15H 1A6VL 3AVEA 5DMKB 3QUXB 5H94A 4NO5A 3EBAA 2DBLL 4XNMB 3CXHK 3VXSE 3TZVB 4DGVH 1Y18B 4CU7A 3DI3B 2BHUA 2EDTA 2PN5A 1OT1A 3VFPA 2ZUWA 5CS7A 3RY6A 2O5YH 3CU7A 4CVZB 4LCIH 5C2BH 2Z31C 4I4WB 5JMOC 4OTXH 4J3XA 1F3DH 3HG1A 5IMMB 1DQDL 1R5WB 1V5JA 5JIIA 3V79C 4PRNA 4YHLL 5FEBA 3PV7A 2R8SH 2Y25A 4KV5E 1QLRA 2APXA 4P9HH 1RZ8B 1MPAH 4NQEA 1T5XB 5DJ0B 4PB0H 1J0JA 3MJ7A 5JO5B 3UJJL 1BFSA 3QNYA 5TE7L 1KLGA 3G6JF 5I2IA 1IEBA 1CICA 1O5DT 4DN3L 1XF3B 1XR9B 2NTFA 5DYOA 1VFOA 3T2NH 2VLRB 3TH2T 1U3HA 1P2CA 2X44D 4JFHE 2MTPA 4V1DD 3LAFA 5ICYA 2EDYA 1T1WA 2NY3B 1JGLL 4LCWA 2VSDA 5DUPH 2APFA 1JGUL 1OAKL 3D18B 1ZV5A 1YEDA 2D0GA 4LP4A 1TZHA 3KYNA 1JUFA 1YEDB 5CSZB 5E6IC 3ZKXC 3I75A 5HHOB 4UV4L 5FYKU 5GGSA 3U0WL 2V5TA 1I1AA 3BPNC 2Q86B 1BFOB 4OI8A 4X5WB 3RI5K 1INEH 1UWGL 1XFPA 5IR1B 2P4AB 4Y16A 2QEJA 3O4LB 4ZTOL 1G7PA 3WO4B 5J11B 1KJ2H 3QIUA 3I3EA 2ZJSL 3DLQR 4TVSa 2OJEB 3SDAA 3PGDA 2XZQH 1DLHA 4NBZB 4XXDA 4BK4A 4JAMB 1JYNA 1OL0A 1BFVL 1W8NA 2AV7A 4KKNA 3PABB 4LHUA 1BQLL 3WLWD 2GIYA 3SQOH 4L4JA 4ZFGH 4EUPG 5KG9B 3QEHB 1FLRL 3V0VB 1IC4H 1PSKL 4N8VB 1CBVL 5FO8B 1KPUA 2DLTA 2A74A 3W0WA 3HNVL 4PRID 4HULB 5AG8A 1FNSL 2R4RH 1AGFA 1AIFB 3DURA 5FHBL 4MNQE 1SY6L 3FT4B 2IPTL 5JUEL 2XG4A 2P46B 1JRHI 2FB4H 1SM3L 1C1EL 4HAGA 2XN9E 4PJAF 3WD5L 5EO1A 2NY6D 4KQ3L 4YE4H 1KFAL 4HK3J 5D1XB 4AEIH 2CLRB 3AXLB 1OQXA 4WEBH 4LL9A 4PJ7A 5I1EH 4OCXH 4UT7L 2VQUA 2XTJC 4CBPA 4O2CA 4YHKL 5C07E 4YHIA 4FQHB 4FXKB 5D71L 1MJ8H 1T89A 2Q3AA 1YEFL 3WKML 1G7LA 3VXPA 4FA8A 3Q5OA 2P45B 1TITA 4JM4H 4U2ZA 1FYHB 4YGVB 3MV9B 1MNUH 1IC7L 4BSVA 5BS0D 3FO9B 2GK0B 1BAFH 4Z0BH 1SVCP 1E28A 3CIQA 3N85L 4KQ4H 1E4WH 4HUWA 1EEYA 3WS3B 1DZBA 2A9NH 4QO1A 1DJSA 3O4LA 3B43A 5GGUB 2D7PA 2AI0H 3DX7B 2OZ4A 2FIRT 2YBRB 5F6HI 3IETB 4EUPA 1AFVH 1BQHB 3NPZB 3GO1H 3H9SA 4HIXH 1DBML 2XFXA 4NDMB 3GMLA 3NAAH 3P4OB 5J12B 4L4VE 4BH7A 3QFJA 4KROD 5F44A 5GS2D 3NCMA 2HLAA 1B2WL 5HDBE 3S88H 1FVDB 2EZ0D 2NR6D 1N4XL 2IH1A 3BN3B 4UINL 4L3ED 4U0RC 4P3CH 3JTTA 4XP9L 3Q5YA 2XACC 5AYUH 4NQCA 2WINB 1YEJL 2VLKD 3E3QE 4NC1E 4R7NA 5HVWA 2M26A 1YMME 4L8CA 2X4SB 3MRRB 2ERJB 2CLZA 1ZKAA 2AP2A 4KAQL 1I85A 4U6HB 4QRQB 4YWGL 5MEOA 1TJGH 2H1PH 3RJQB 5H8DA 4Y7MA 4LASH 3MQIA 1N3NB 3IKCA 5D72H 3C9NA 2ZCLH 2X4OA 4O2FB 5E8EB 5C07A 3DOSA 4MVBC 3FB7B 1YNTB 3W81A 1A1OB 1EXUB 2C3HA 3C08L 3AY4A 5C0CB 4Q9QH 2VDMH 1TNMA 3PG2A 1FL6B 3SHSA 3H6JA 1MAML 1F4YL 4QXGH 2JK5B 3O8XA 5HGBA 3KDMA 3HPJB 4QRQA 3T0BA 2D7NA 3DGGA 5IGXL 4F7TB 4YHKH 3QRGL 1KNOA 4M5ZL 1D6EA 5LXGH 1FGVH 4LPCA 4FQJL 5EPMB 4Q6IB 1PZUB 1GGBL 4HKZB 4U1IA 3OPZL 4JVUA 4PFEA 5KSAB 4OZHB 5GRJL 4XP9H 5DQJA 1SEQH 2AJXH 4OF7A 2JELH 4O58L 5CIPB 3G5ZA 3ECBB 1PQZA 1QVOB 2UYLB 4F7CA 3ISWA 1Z9LA 2BOCA 2XZCL 5FHBH 1UM4L 3U1SL 3QIWC 3RWFA 4L4VA 4R26H 1SJEB 5GGTL 5B8CA 2V2TA 5CJOH 3BMWA 25C8H 3ARTA 5D1QC 1NANH 4LNRB 2C9AA 1CQKA 2ZOKA 5KSUB 4MQTB 1P7HL 3GRWH 4FQLL 3VFVA 5JW3H 4JANB 2ZJSH 4PGEA 3PP3H 5FYLL 4TYUA 3ILQC 1G7IA 3ROOA 4I1NB 1MNUL 2B1AL 4PJDB 2ZG2A 4C59B 2J1KA 4OF3A 1MIEH 4FQLH 3Q3GA 1LE5A 1EERB 1JHKL 2HTLD 3MGAA 2EYSA 1OAUH 3WUWA 3WFCL 3VRIA 2P8MB 4Y5XA 4H20L 4PJEA 4U7MA 4K9EH 3WBDA 4QHUB 2ITDA 5C09B 2CGRL 4U3XA 2JJTC 4X6FB 5GISL 1C12B 1T2JA 1BFTA 1A1OA 2HLFD 2XZCH 3DARA 2GYSA 5ITBL 3PF2A 2OJZL 4KXZI 1YEEL 3OKMA 2PYFB 1N6VA 5GRYA 1VEMA 1IT9H 2EE2A 5E8DH 4UI2A 1IGYA 1F00I 4JLRA 4LRIA 4M9PA 4ZS6D 4H25B 4WFGE 2ZPKH 4PJBB 5I74B 1MHHA 3WXVH 3C6LC 5E8NA 3LPFA 4LLVA 1N59A 3EYQC 4PRHD 3CFIC 3QUMH 4DKDC 2IEPA 3AS2A 1SBBA 4I0PC 1I1CA 4D0BB 2NMSA 1HH6A 4G9FD 4LLAA 2CRYA 2V5SA 2X1OA 3VXUB 4N0RA 1S7QB 5F3BA 5LJYH 1R24A 1FO0L 4XBEL 1J9CT 3EJJX 2X1PA 4YWGH 1AQKL 4LSUH 1PKQB 1DBAL 2WWMD 1KTKE 4JFPB 4E42B 4YPGA 2OSLB 5TFSH 4YAQA 1K3IA 4KK6C 2WLYA 4POZD 2O5XL 3Q2CA 3JTTB 5EIVA 4RWYL 2OK0H 1MH5A 4K2UH 4JRWA 4I3SL 2H32H 5D7SH 1I7ZB 3ULUF 5EU7E 5FM4A 2J8UE 2ZUQC 1CFSA 5JORA 3QXUA 4KWUA 2YA2A 1FZMB 4NUGH 1C08A 2CUMA 2W9EH 4FQIL 1BHGA 3UZVB 4FFYL 1RZIB 4ZAKC 2VZUA 4RRPA 1CLYL 4G6FD 5HHMB 1UXSB 5IBUB 5EU4B 1BD2E 5T1DH 2YWZA 1XF3A 1XR9A 2NTFB 3F6IA 1KLGB 1FAIH 1NANI 3HC3L 4Q2ZA 4IIQB 3WSQH 3DWTA 5ISZE 5K9QG 3BQUB 4ONHB 2BCKB 4J8RB 3OHXA 3QXTA 4Z0BL 4QXUH 5GRZA 4LCCA 1ZTXH 1ZHLB 1BX2A 5GRVL 1P4BH 4KVNH 1CZ8L 4JN2B 2VC2L 3UROR 1EVTC 4HBCL 1FG9C 5T3XL 1OD9A 5FUCC 4O2CB 1NLBH 4CMHB 5KVDL 1ZK9A 4GXVL 4XCFL 2VDKL 5IV2A 2HVJB 1P7QD 3CVHA 1N2RB 3O11A 3MLWL 4HLZG 3CXDH 3K2UL 1EIBA 2LAGB 4Q6IC 4WEBL 2KKQA 3ARQA 1OAYH 2OJEA 4U3CA 1I9EA 1U8KB 1TZIB 5HJ3B 3W11C 4UIKH 3UTTB 2MCG1 5JUEH 1WCQA 1MCWW 1UWXH 1YEHL 5EOQL 2GW5A 3WUZA 5IEKB 4YO0B 4TSAL 3BP5B 1F45A 3L3KA 1JTTA 1NCWH 2AJSL 3HE7A 3CSBA 1IZKA 2BY1A 1UZ6E 2P8LA 3QEHA 4EVNB 2XWJA 2YEZB 3RL1A 4YHNA 3VDAA 5JIPA 4BSJA 5I30H 3UYOD 4IRSD 4CW1B 3BVNB 1DVFC 1FYTD 3VGBA 2BXZA 1HKLL 5IKCB 1MUJB 3VXSB 5D7JB 4TN9A 2WWMC 1N7MH 2HJKB 2Y5TB 3QB7C 4ETQB 3G6JA 3SGJA 5JW4N 3EYSL 2JJTA 4PJIA 3MRKB 1RHHB 4XBGA 4JDZA 1SYVA 1N26A 2NY0B 3FONA 1K4CB 1VGEL 5F71A 1IEBB 1G6VK 4YFDB 1EBPA 3VXUA 2WBJD 1IAOB 4IDLA 4JQVC 1K3ZA 4UIKL 2FHBA 2X4QA 3B6SA 4PJ5D 4DGYH 4YDLB 3IF1B 2PYFA 3UJTL 3HAEB 4LCWB 1KIRA 4G8GB 3S5LA 4HK3N 3RGVD 1TVHB 3QDJE 4KJWC 3LQAH 4O2FA 4OCWL 5KSAC 5F1NB 4AG4L 4M7LL 1H15B 1ZSDB 5B4MD 3EZJB 2BP3A 5H35A 1NCTA 2HH0L 3RWJB 1IL1B 4PJHA 4DWHA 1P4BL 1KENH 4PREB 4B7IA 4Y2DA 5KVGH 3ARVA 1TZGH 1U8OB 3QFDB 4RAUA 1A8JH 5E6IA 2DKMA 3TBSA 3W2DH 4XAKD 1HK6A 4NZUL 4JFOB 2HFFB 4XI5C 3PDOA 3CMOL 2X9WA 4ZUTB 4CDHA 1V8HA 5C09A 1LO4H 3SGDI 4LLQA 4O51B 2L4OA 2DIJA 5B39B 5EIIB 3MRBA 4KMLB 4M6OL 4C58B 4XPFL 5J0BA 5DF0A 1H5BB 5IB3B 3O3DB 5GGVH 4NZDA 3PV6A 4NSKA 4LCIL 4NNYB 4JZNB 3PP3K 1JCKA 4GKNA 1MLBB 4PY8J 5F7UA 4Q6YA 5A2FA 1NGYA 3UDWC 1WFUA 1IGTA 4WU7A 4LIQL 4O58H 3VXSD 3PIQA 5JW4R 1X3DA 4HUUB 4PJGE 4TNVF 2ZUVA 4I3SH 3O81A 3SDDA 1XT5A 3CSYA 5I1CH 2GTZB 2AERT 5KSUA 4ZPVA 5CIPH 5KSVB 2R56H 3ZE0E 4MA8H 3UJIL 3LKQA 3LH2H 4F15C 1AQKH 4LSUL 2VDRH 4H5SA 4WY7L 4FQCH 4O2EA 5HGBB 2UZXB 2YRLA 1YUHB 4K7PL 4LCWD 3JV4B 3CLEH 1JHLL 4WFEE 3B5GA 1CGSH 1EEZB 2UVEA 4ENED 2AJVL 3STLA 1GAFH 4FOMA 4NKDB 5EFIA 1YYML 4XBPB 5FGSA 4WWKA 3HR6A 1D5BB 4MXQC 2CJUL 1YEKH 2R2HB 5BJTA 4YEEA 4NQSA 4AH2B 2FEEI 1QO3B 4FTVD 5GIRA 1S8DB 3T65B 5FO9A 1LEKA 1EHLH 1I8KA 4Z7VE 4RBPH 3T0EC 8FABB 4LEXL 4OCMC 1YEIH 3BPLB 3OXRB 3C9NB 2ZNWA 5C0CE 3P30L 5ITBH 2XYCA 2DQIL 5C0BD 1JF5A 2Y36L 3DRTB 4JDVA 1J1PH 4NN5C 4M3JA 4JO4L 5LCVH 3QUZB 3DV6B 1UWXK 3TPKA 4NPYB 3I6LE 1ZOXA 4HSQA 5I8OL 2ED9A 2JJSA 3GSVB 1GZPB 1I1FB 5JHDB 4ALAH 4ZNCD 1QBBA 4LU5H 3P73B 1HIMH 1WWAX 4FQ1H 4PJGA 2CH8A 4NKMA 2VUYA 1MIEL 1F90H 1T03H 4NO3A 5HHOA 3VXSA 4YHOH 2IBZY 3GKWH 3RL2B 3CFCH 4ACPA 3QXAB 1EDQA 2VKXA 3JV6A 2F5AL 3EGSB 2F53D 1RJCA 3QUMB 4TUKL 3KR3L 3MV9A 3S36X 3GMMA 1C16B 4YHZH 4OZ4B 1JNHB 3UBXI 4GQ9L 4M1DL 5DK2A 2RIKA 2R2BA 4IRJA 4U1KB 2MFNA 1T66D 1UJTA 3NVQA 2EECA 2C1OA 4LARH 1NEZB 3F8UB 4ZUTA 3ECBA 3WHE0 4ELKB 5KTEH 1NLDL 3MV7B 4MX7A 1UT9A 4OLYL 5CCKL 5DJYA 3OGCA 3WFHB 5AAWA 1HH9B 1A3RH 2X7LB 2G60L 5D1ZD 3HFMH 3O3EA 3GMOA 4X6CF 4ORZC 3D0LA 4ONFL 4Q2ZB 4JFQB 1RD6A 3ARGB 3MRPA 2VL5A 1DTUA 1U41A 3JWOL 4Y4KC 3RWCA 4PRBB 1FPTL 3LKRA 1JNLH 4ZFGL 3PDGA 4PGCA 4Z7WA 2CDGA 3D69B 3LB6D 3VWKA 1UACL 2XNAB 4PJ7B 4PS4L 3ZSTA 3L95A 1OGTA 5JLZB 3S37X 4X0KA 3BYTA 5CBEA 3N1PC 5K33A 4WW2A 1ZA3B 1MLCA 1B0WA 4U1GC 4AT6A 1JN6B 4QTHA 4NM4H 1Z2KA 4MD5B 1AXSB 2OZ4H 4LASL 3OSKA 3IJSA 1UCTA 2F8OA 4M93B 2FX7H 3L3IA 2AEQH 5ERWB 3S3PA 3HMXH 1MCHA 2APTA 1S3KH 4MJ5A 5DD6B 3DHJA 3E6HA 2R0ZL 4ZOEA 4EN3D 5ENWA 5MI0C 1QFHA 5KG9A 3JWDC 3KJ6L 2DM2A 5AZ2H 4RAVB 4M48H 1JF1B 5DUPL 3MRQB 2DOCA 3D0VA 5B22A 3STBA 5L8JB 2NY3D 1CFVL 2WIMA 4L4TE 1EHLL 2NY6B 3RL1B 2OMBA 5ICYB 1P1ZA 5JXAL 1IJ9A 4PBVC 4D0DA 3MXWH 2CRMA 1DBJL 5ETUA 4PUBL 1XIWB 5LGJB 2XOTA 2CUHA 5C1MB 4S2SB 1QSZA 4P49A 3X11A 4LFHG 1UB6A 1CDHA 3DO7A 1CGSL 2VDPH 5BO1H 3GM8A 1JRHL 3UDWA 1TQCB 1WTLA 1ZLUK 2FJFA 1L9NA 2RCSL 2X4TB 5J3HC 3G6DL 5CJ8A 5DSCA 1BREA 2FYYB 4Z7WE 4ODTH 1MCCA 4IEFB 4JRYD 4GBXD 4M7LT 3LKRB 3QEQD 4RMQA 4KDTC 1A7QH 1G7JA 2Y9RT 2VLRE 1UH3A 2E3VA 4QF1B 2Q8AL 2UWEE 2EDDA 4GG6A 2ARJA 1A6UH 1ZT7A 4LEOA 3ZE1F 5C0CD 5E00B 4JQIH 1DUYB 1F3JB 4KK9D 4AEIL 4MA7H 3O4LE 5I9QC 1Z9MA 3LKPB 2YC1B 2E5EA 4Y4KD 4YDIL 4E41B 2Z35A 2B0SH 3LN5B 4K3DH 3NIGF 3BEVB 1H8OA 3NAAL 3RKPA 2GITA 3VFRA 3WL9B 3DYPA 1XGPA 2X10A 5A16A 4GKSB 2YPLB 5EBWA 1WC7B 3NIFF 3D3VA 4BSWA 3NOIA 3BKJL 3QAZC 5A43C 1YNKH 4PJCA 5F9OH 1F4HA 3PWVB 1HHGA 1QNZL 4XNMA 3HZYA 1WWWX 5CILH 4X5LA 4LIQE 2VE6B 4OGYL 1A6AB 2LV4A 1ZE3C 4QYOA 2PKDA 2W9LA 4NNPL 2FDBP 5I66B 4JJHA 2VDLL 5JOFA 4CN1A 1II4E 5HPMA 5D6DA 4Z7UB 1CDCA 1B0GA 2Q86A 4AZ8A 2P47B 1XGTB 3CZJA 1A7PH 4P3DB 2Z93B 4JGUA 4MA3B 1FNLA 2FWOB 3V52L 3BZFB 3EYVB 3BH9A 3GGWA 3V6ZA 4OBSA 4QRRE 2HTLC 3ZE1E 2BOCB 2BVQA 1V05A 4MJIE 3VXQA 4MQ7A 3WXWH 4YHYB 4JO3H 4ODHL 4JFXB 3DI2B 5ENWB 4XPBH 1IKFH 2VABA 5EN2B 3TBSB 2RFXB 5FA4A 1YYLL 1WUNT 3CH8A 2KZ1B 4ODSH 3L7EB 3X12B 4KK8C 2HLFC 3I6KA 4H25A 1AD9B 4MMXC 4PYGA 5BV7B 2BNRD 4TSBL 4HIHB 3CSPA 1AQDB 3NBNA 3GB7A 1IE5A 1NCAH 4NQDB 3BW9A 2VLMD 2VQ1A 2NXYB 4Z78A 5EO9B 5FA3A 3RZCB 4YC2B 1J0ZA 1SEBB 2YD2A 1QRNA 4O4YH 3VJ6A 1KSRA 4XAKE 1Z5LB 1JK8A 5FOJA 3BX7C 5IT2H 4C56A 1NFKA 4XWGH 1JYWA 2P8PB 5DFVC 4N68A 1IM3A 1T20A 3FO1B 1M05B 1AR1D 1QR1A 5C9JA 1DQMH 3QYCA 2DD8H 3T4YA 4PLNC 4MA3A 2EYRA 4PLOB 4P2OC 3EOBA 3TYGH 5E24E 1K4CA 4OIAA 2QQNL 3SQBA 4UV4H 2V17H 2VAAB 4XP4H 3RQ3A 2ZUSA 4OJFL 4HK0A 5HI3D 5I66A 3N1FC 2OTPA 4JPIB 3MNVA 5E1AA 5BS0B 1BOYA 4JCLA 5ADPH 3SKNB 1FFOB 4XP5H 3ZKQD 4C55A 5FYLD 3QUYA 2M8XA 2VDKH 3QEQB 3OX8B 4HWNA 3V0AC 5DEFB 4KI5C 4QRRB 5L2KD 5E70A 4I77H 4HDIA 1ZWIB 4QRRA 1QLEH 3D39A 5FM5O 3RWFB 3FFCE 1DQQB 3DJ9A 3TZVC 3ZO0A 4EUPB 3O4OC 5D1ZA 1SJVA 3L7FB 3MRJA 3OF6A 1UEMA 2B2XH 4XMPL 3CFKB 3H7BB 3KAAA 5D7JC 3RUGA 4E41A 3D9AH 3MTRA 3HI5H 4J3OC 1QQDA 1DL7L 4N8CH 4OF8A 1OF2A 3MV7D 2EH7H 4GBXC 4XCYA 2Z92B 5D8JL 1CD0A 2IALA 5I76A 1XF4B 4N5EC 3F7VB 3SDXB 1WC7A 1FNAA 2IMMA 1RVFH 3RTQD 3O8XD 4OCSH 4XHJD 1GSMA 4YIQB 5F9WB 4I77L 1G9NC 4LHUD 1K8IB 3CCHB 5MEPB 1CGWA 1LDPL 1N64H 3EOAB 1X6LA 2R1YA 5CMAA 2HJFB 3A6OA 1TVBA 3HA0A 1R3LA 2FX8H 4X4YB 4PBXA 5JZ7C 4WI9A 2DM3A 4Y4FA 1J12A 5ELIA 1X7QB 3ESUF 1Z0NA 3RVWC 4NQVA 1WFOA 2X70A 2FO4B 5FF6A 4ZS7L 1XMWA 4NQXB 3VFMA 4YHMH 4K8RH 5B39G 1S3KL 3CJJA 4HKXB 3QUYD 2NY3C 3MGOB 1WBXA 3QJHA 3W39A 5F7HA 3M07A 2O26U 1I7UA 3AAZA 4NHCL 1L7TH 4HGWB 4MWFA 3U9UB 3ULVH 2I24N 5EZJA 3HE6B 5DHVH 1P1ZB 3IU4L 3PWLA 1FJ1B 1PYWA 5JW4M 1IGJB 1DE4A 2DWDB 2J8UA 3VXUD 5A3ID 4N5ED 2I60L 5D70H 3R0MA 4V1DB 1T3FA 4TSCL 3VE0A 5TDNB 3OR7B 1EV2E 1L6ZA 4TUOB 4XP1L 3A6BL 4JVPA 5KAQF 3HNTL 4MXVF 3RDTA 1NCAL 3ELAT 3FN0H 4W68A 1Z9SA 4A6YB 1MCFA 4PTTA 4H0GA 4DKAA 2OTUB 1CD8A 4ERSL 1JPSL 2QSQA 1QA9B 3HI6H 4EDWL 2G60H 2NW2A 5E99L 4RWHA 4KI5E 4HIIA 1ZLUH 2BFVH 5IMOA 3GSNL 1E6OH 2DICA 1TZIA 5I19H 1UKTA 1JUFB 3N9GL 3HC4H 3ZZ1A 5TPWH 3QEUB 4WW2B 1MCPH 5L2KB 3HE7D 2MKLC 5BVPH 3UXFA 2UZIL 4X0KB 3HC0A 4I18A 3FKUS 1YJDL 1BJ1H 7CGTA 1UA6H 1LGVA 5HGAA 1G7LB 4LSSH 2VAJA 5E03A 4PY7B 4O5LH 1CTOA 1IAIL 4YBLC 4UT6H 2W07A 4UU9B 1JWUA 3L3IB 4LPYA 2Z4QB 4YNYA 3L5XL 3W9DB 3THMH 3REWA 5JXEA 5C7XH 5IWLA 5C3LD 1KELH 4I13B 1RU9L 5DS8B 5I71C 4UB0L 1UM6H 1HH9A 1F6AA 2X7LA 3KPOA 4DKEH 2NXYC 3F7QA 5ESAB 1PJ9A 4OLVH 4MXWL 2I9TB 1WAAA 4P9MH 5M95B 5IMMA 1AGFB 4MXVE 2FATL 2YMXL 1G84A 4WI2A 2V9QA 2QTEA 4HPYH 1UH4A 3DUSB 2C26A 4V2BA 4WV1C 5GQBA 4NN7C 1KIQA 3MLXH 4U7KA 5TH2A 3VFTA 5D2LE 4NYLB 5C0EB 2BVUA 5TPWL 4LCCB 3TA3A 3S5LB 1A6ZB 2CK0L 2V7NB 1RFDH 5BOPA 3W9EA 1JZ4A 4JHWH 4Z7UE 4NQEE 2K7QA 3O8XC 3B5TA 1JPFA 3BDBA 1D5ZB 2JIXD 3FT2A 2G2RB 3TNNB 1FNFA 2I5YL 3CFDB 5B4MC 4Z7OF 4UOW1 4IS6B 2Z91A 5GJSH 2A6IB 5F9JB 3BRGC 5FYLE 1QFWH 4BFIB 3Q48A 3ARWA 1JPTH 4FQJH 2QV2A 1MEXH 1OP9A 2LQRA 4NKIH 4ZOBA 5JW5B 1HZHL 4LBEA 2IFFL 1P5UA 3NPSC 1ZT1A 4K55A 4KU1A 1I85C 4WVRA 1R3JA 1RZFH 4LGPB 1S5IH 3NZ8B 1IGFL 4NWUH 3DRTA 1Q9OA 4JDVB 3HNSH 1JF1A 4HXBL 5E8OB 3VXMB 3RP1A 5D72L 1JWMA 2XWJB 1EH9A 3RIFF 2VXTH 1KLUA 3NCEB 2IFFH 2E9JA 1RIHH 4HGWA 1A1MB 4XCCH 5JHDA 3QDMD 3RIFK 5A2KH 2RQ8A 5T3ZD 3T8XB 4M7KH 2FBOJ 5E0QA 2VLJA 4MNHB 3P9LA 1EO7A 3SKMA 1CFVH 3P4NB 2OYPA 3T04D 3RWGB 2VLKB 3S3SA 1JGEB 2R39A 3MV9E 1MJUH 2R69H 1LEGA 5EU6E 5ALCL 1RFDL 2Y06L 3HG1D 4JFYA 5KN5A 3DTXA 1RK0A 3O2DA 4JG1L 5GIRB 2R1YB 4XVUC 1WF5A 3GBNH 5EO9A 2CO6B 4NQSB 3VRLE 4NCDA 2H3NB 3NFNB 5E2TL 4DTGL 3OF6D 4KK5C 4Y5XB 2WNGA 4AM0B 1NBVL 4NBYB 3FL7A 4KMTL 2Q6WB 4DFHA 3SY0B 4FFZL 1J10A 1H3VA 5HY9B 3UAJC 1XAUA 2H2SD 5KSBE 3CZFA 4N8CL 2BSRB 4OT1H 2V7HB 5BV7H 3S97C 5DJYB 3QDAA 1UZ8A 3EHBD 1RUPH 5IW6A 3R8QA 3MRHB 5BRZA 4HJ0C 1RJZB 3FRPA 4JRYB 3TNMA 2BVQB 2HH0H 3NCBB 1UACH 1QLEL 3K1KC 3GDBA 3H7LA 3BIAX 4PRDB 3KG5A 5F1IB 3S36H 2VDQL 4M1CC 5IF0B 4LF3A 2RJMA 3JWOH 3O6FA 3VXRE 2FEDC 5CGMA 1JPTL 1RZJH 4U1JA 2NY1B 2J6EL 2XQYG 3KPMA 3JV6B 4F9PA 1C5DA 1CE6B 4XMKH 2W0PA 1MHCB 1NCDH 1KG0A 1EO8H 3H3BC 4F9LC 5LGHH 1ZHKA 3MMEA 3PWUA 4OLYH 3H7BA 3U0TA 1AHWB 3ZDZF 4XNUH 1N6QH 1D9KB 4WU7B 4P3WA 4H26B 3PWPD 2CK0H 5L0QC 4XPGL 5BXFA 4KZDL 4QRSB 2NY0D 1RIUH 3LS4L 5T1MA 1I1FA 1KPRA 2LE9A 1D9KD 4K94H 3UYRH 3SDCC 3TA3B 4OZGA 1EBAA 4HPYL 3BMVA 4X9HA 3ARED 4KMQA 4YDVB 3BRFA 3RU8H 2IBGA 3VE0B 5HD8C 5IT2L 2VXVL 5EU6A 3EO1B 4LLQB 4O51A 5T3XE 3LEXA 4Y16C 3RWDA 4WFHE 1QKZL 1J88A 4ELME 5C0CA 3GMNA 1HN1A 4M1GH 3LQZA 1I1AC 4ISVA 4GFTB 2BC4B 1GOGA 2XKNA 1KIRB 3V6FB 2BOBB 2YD3A 2JCCE 5D4QA 1X4YA 1G7HB 2H9GB 5F89B 4Y4HC 2A6JA 3HE6C 3L5XH 5SWZB 1KNOB 4D94A 1YDPA 3VFNA 5CINH 1RY7B 3RWHB 4PV8A 4IOIA 1SHMA 4N1CA 2F74B 5EFIB 1FL6A 4LVEA 1NGQL 3U36B 4XNQA 2FECL 2GFBA 2EDJA 4G9FB 4JE4B 1UCBH 2VZ1A 1MJJB 2PTTB 1X5ZA 2Y7QA 5HPOA 3EO0A 1T6WA 2AQ1A 4G7YL 1G9ML 3GK8L 1U3YA 4KI5F 4LEXH 5GRUL 3CFBB 1CLOH 4JFFB 1FVDA 4LLWB 3PGDB 1OAQH 3P11L 1S7WB 3ARRA 1KCUH 5DTFA 3T8XA 5IMOB 4CRPA 2YPKA 1HHJA 1KEMH 4IOFD 3QPXL 3IFLL 3MRNB 1SYVB 3NCYP 1J0KA 2BNUB 3QXDA 5T3XD 1D9KA 1KIUA 1TMCB 4OV6F 4Y5VB 5DVNA 3AGVA 3PWUB 2ICES 1LO0H 3LKOA 1KB9K 2QQQA 4XB8A 3PWPA 5E6ZA 4LGSB 3T1FA 5IHZA 1U9KA 3WHXA 4H88H 3ULUH 3GSQB 3H9ZA 5DEGA 2VN7A 2ZOKB 1ROWA 3MV8A 5F88A 5DA4A 3C5JA 1G0DA 2HVKB 4HDIB 2EXWD 4FQCL 4GUPB 4KV5F 4XC3H 4CKVX 1FG2B 5LVEA 4PJXF 3AY4C 3MCKB 1A47A 1FL5B 1RZKL 2YBRA 5CJ5A 4ZD3H 1O0VA 3B9VA 4IS6A 2DBJA 4JRYA 3RTQC 3BIKA 4ZS7H 5E1AB 2WUCL 3VWJB 5BS0A 1BX2B 1YN7A 4HK0B 2E9IA 3HRPA 1X4ZA 3FQUB 1JVKA 2DQTL 3RRQA 2E7LA 2O93L 3KYOB 1OVZA 3NCCB 4G5ZH 3EO9H 4Q6IA 5DS8A 3DBXA 2YUZA 1LK2B 4Z18A 3DVGB 3HMWL 1ACYL 3IFPA 3SE8H 1K6QL 2FR4B 3B9KD 5DEZA 5I1LB 4OZIF 3G6DH 3WN5B 1KPUB 3QWOB 4PJ9B 2D4FA 2JIXA 3KXFE 1SEBA 4RGOH 2B1HH 4CU6A 4GAJL 1CTNA 2QSTA 4APQC 4TTDC 5A40E 2V5RA 4MXWH 3ZYJA 3EFDH 1Q9LA 1ES0A 1WFNA 2DM4A 1OF2B 4YFLI 2BRQA 3QIBB 2CMRH 3QDMB 4X6BA 1RU9H 2C4FU 1DBJH 5I1GH 1UEYA 3AM8C 2VLJD 1HYRC 5E7BA 3EAKA 4C4KT 2F53A 4Y5YC 2PXYB 4KUZH 2P44B 5F6IB 2EDEA 3ZYZA 5F3BB 3FT3B 2YXFA 2KPNA 1YC8A 3MV8E 1T66C 2WBKA 1YJDH 4G7YH 1A9EB 4JPKL 5LBSH 2EDNA 2CK2A 1R3JB 4JJ5A 5ESVB 3WYRA 1T4KA 3ARDB 4MCZA 3O6FC 4NT6B 1J1OH 4BQBA 4EVNA 4DVRH 4I9WE 2VKWA 3MRMB 4OLUL 4D8PA 1QPXA 4LSVH 3HE7B 2VAAA 3VXNA 2YUXA 4X6CE 1J05B 4Z8FL 2VLRA 3TJEL 4KTEH 4ZXBC 5FUZH 3D2UB 4JFEB 5ERWA 4G8EB 1Z3GL 3ZT5A 4NQCD 2C4XA 1Q0YH 4FTVE 3MNWB 1GIGL 4L5FH 4NNPH 1P9MC 4V1DA 3B9EA 5C0AE 3MFGB 5IB5A 5JW3L 1QFWI 1RUKL 3RKDC 5IQ9B 1A6ZA 4BSWB 4DEPB 3FAWA 5C9KA 3QDJB 4P5TD 2J6EA 3IDXL 4Z5RB 3TH3T 2GJ6A 4LCUA 1AXTL 1G0YR 4OCYL 4MQSB 4WFED 4R4FL 4E41E 5C0AD 2J2ZA 5EBGA 4JY4A 2OM5A 1X6NA 4FP8H 1ZHLA 3N06B 1BBDL 4N9OB 2EYSB 1B0RA 3SDAC 5T3ZL 3NABL 1WICA 2A6JB 2OR8A 3O6FD 3KPOB 1X7QA 2PYED 5CBEB 4M8VA 2Z92A 5KSAD 2RFXA 1OCWL 5CEXB 5GS0C 4M5YL 3STZA 2D4DA 3NH7L 3T77B 1KCRH 4OF6A 1IKNC 1C12A 2H2PD 3UAJD 4HGKC 3QQNA 3INUL 1UJ3A 4JPKH 5LBSL 5FKAA 1XGUB 2BVPA 2QSVA 3TVMD 1RZJL 5FO8A 3MJ9H 1IRAY 1CS6A 4X83A 4IRJB 4U1KA 3FTGB 1L7IL 4CVUA 4XVUD 1NFDA 3LSOB 3VXRB 3VH8A 4KKLC 4U05A 2LAAA 4HQQL 3CFCL 4G8FA 4QWWD 3OX8A 3FQXB 4XXDB 1YPZA 4WI8A 5DEGB 4RA3A 2GCYA 4JKKA 2W91A 1JGDB 1KTRL 3DX9B 2FHFA 1RUPL 3MRGA 5L8KB 2X1QA 4PV9A 1F4XH 1VERA 4XGZB 3MO1A 3RUGF 4JR9L 3MCKA 3RTQA 3OB0K 3U30B 3W0WD 4P5MB 4FTVA 1CDJA 3I2CH 3QXWA 4RZCA 3GJFA 1BIIB 1TTFA 5C0AA 4G6KH 5F7YC 4YX2L 3RVUC 3D6GA 5CEZD 1KB5A 4U7SA 5E5MB 1YEIL 5GGQH 5GHWL 5IVZA 2IGFL 2FHCA 4HS8H 5FYJD 3VMOA 3FOMB 4KFZC 2VDOH 2AK4B 3TM6A 4C56E 3FCTA 5DQ9A 2ICCA 3EDKA 4K2UL 2LFGA 3RNQB 3P3YA 3G6JE 4WV1A 3QXDB 1RV6X 5L6YH 4XXCA 5IBLC 3U36A 3GBLA 4CVXB 1EUTA 2AJZA 4JQXC 1H5BC 5E5RB 4AH2A 4X7EC 2AABH 4ODUA 2E8ZA 3VGGA 4PJHB 5JW4Q 1KIPB 1RURH 3VXUE 1KBGL 1CDIA 2AV1B 1RIHL 4HFUL 4PJGF 1G7JB 1T83C 4NQEB 4KK8D 2E9BA 3L9RA 4JFFE 1G7HA 2DI7A 4M43H 4NQVB 3S5LG 1JHLH 1EXUA 1EAPA 5GS2H 1IC7H 4UQ2B 3TIDB 1OAXL 1DANT 1MWAA 2WBJA 3QUML 1FFPB 2HTKC 3NA4A 5GRVK 2NW3A 3PHQA 4RNRA 2DQGH 1TXKA 2W0KA 2VL5B 4MCYB 5HVFB 2DYPA 1T7ZA 5F1SA 2ZPKL 4Q97A 3T2OA 4ONGH 3X12A 1KPRB 3TA3D 3FQNB 5D7IF 3I02A 4P4RA 4JDZB 4OZIE 2H6PA 3LV3A 4IHOA 5FA4B 3LN4A 1A0QL 5TF0A 4PRHA 1KFAH 2KZWA 1A3RL 4ODXB 2W1NA 4Z0XB 4P46C 1FRGH 4WW2C 2FX9L 3GK8H 5GS0H 3GIZH 4ZQKA 5FV2A 4R7DA 5GISH 1NGYB 3WEXB 4RFOH 3DSFH 4UUJB 5GGTA 2BNRA 4ORGB 4G6ML 3AROA 3VWJC 2F5BH 3WNLA 5KBNC 2G5BA 5EC2A 5TDPB 1BOGB 2R23B 2Q7NA 4Z7UA 2EKJA 2BRRH 4TUKH 4HFWA 4EI6B 3B9KA 2BX5A 3ARBA 1XGUA 2ICWB 4PJBE 4QOKB 4H1LA 4IMLB 4GXUN 3MLRL 1VFUA 1PQZB 1RJZA 1W0VA 3ES6B 2ARJQ 3RAJH 4MD5A 5C2UB 5E2UL 1DUYA 1F3JA 4WI7A 3VMPA 3MREA 2FLRT 2R0WH 5EOCH 4M62H 1S9XB 5FGCB 4G8FB 1MRCH 2VO5A 4PREA 4K23L 3L3GA 2FZ3A 3BJLA 1XEDA 4L29A 5TDOA 4Y1AA 3S37H 2PO6B 4X9GA 1GHFL 2OBGA 2R4SL 3SGJC 1NMAL 1A21A 5EIIA 4HWUA 4OD2B 2MHAA 3SBWC 5F1NA 3X3FH 4R26L 3TPUA 1L0XA 1AR1C 3QSKB 3V7AG 4ONFH 3S4SB 3AMLA 1IQWH 4M6NH 3Q1SH 3K2MC 3WIIH 3H9HA 4MA1B 4RRPG 5D7IE 1LK3H 4ZSOE 1VCAA 5SV3A 4C56D 4ZNEA 4NCC1 2JELL 2R2HA 5E94B 1FYTA 4TNWK 4NGHH 5D7JD 1N5YH 3OKDB 3BP4A 5IG7B 2CJUH 5SWQB 2J8UF 1CLCA 4GAGL 3P9MA 4M1DH 1N5AB 3T0VA 3F7YB 3QT2A 5GZOD 2WLZA 4KVCL 3RFZC 4OD1L 5GS1A 4JFYB 2A6KA 4Z6AT 5IBLD 1OQOA 4XC1H 2QKIA 2IANE 5DGQA 1IILE 1ZVYA 1XCQB 5DC0A 2I60H 1ADQH 4PP1C 1FORH 1GCFA 4KZEL 3KLAA 1ZT4A 4O2EB 2W60A 3KNBA 4EIZC 3MODL 4BH7B 2DJSA 4R6UA 4AIZB 1DBBH 4LU5L 3BZEB 3VFGH 4ALAL 3PWJA 1KBGH 4A2LA 4HEPG 2H26B 2XA8L 3IB4A 3MC0A 4O02L 3R8BB 4WW1A 1ORSB 4FFZH 1UM5H 5I75C 4KDTA 4WNQA 4AEEA 4DGVL 2AXGB 3GI8H 5EUKA 3MXWL 2JJSC 2UZYB 1I4FA 3C5SA 4J1UB 4OIIH 3T4AA 1FE8H 1S9KC 4Z7VF 5KW9H 1CFTB 4OLXL 4R9HA 4F7EA 3CSGA 1Q0XL 2BNQD 3U0PA 1MJUL 2R69L 1VSCA 4I0CC 2HMID 3HUJF 3CFEB 3SE4C 4B5EA 3KPNB 3MLUL 3EDDA 4JFDE 1EZVY 3WL9A 4DZ8B 1C7TA 4S1DD 1U3HB 3QEGH 4E41D 4NZRL 3NCJH 2R0ZH 1P7KB 4UMGA 3BEWA 3TNNA 3GM0A 3NFPA 1AO7D 4JFQA 4GKOA 3OR6B 3HB3C 5T3ZE 5I8EB 2XT1B 3L6FB 5FOBB 5E9DE 3B8YA 1H8NA 1Y18A 5CGTA 3HI5L 3VD7A 1S7TB 1ZMYA 4S1QH 4HUXB 3SCMC 1U8NB 3VFUB 5I8KL 3QAZB 2W65A 1LP9B 3B3IB 3DMMD 3CC5A 1FNGA 1FBIL 1KN2L 4K3JL 4QHUA 3WN5A 3TVMB 1S9YA 5JOEA 4JKPL 1AR2A 4AG4H 1D5XA 1CN4A 3HS0A 1C16A 2WV3A 5TQ0H 4TTGA 2CKBH 3NZHH 4RAHA 1S9XA 3VA2C 4R2GD 1X5HA 1CFSB 3DMMA 1GRWA 3PHOA 1QQDB 3MRFA 3MV8D 4IOFC 1NSNL 2IPTH 3P0GB 1AE6H 4RGMB 2QQNH 1NL0L 2X05A 1MHCA 1ORSA 1HINL 3FMGL 4MB3A 4O9HL 3UPRB 1ITCA 3J7HA 4QY8A 4YHYC 1AO7A 4HS6A 3PV6B 1DP0A 1N7ML 1FZMA 2ESVA 5FKPB 1CT8A 3K8LA 4KROB 2ZKHH 4KJPC 1GGTA 1KXTB 1I7RB 5EZIL 4YUEL 1A7RL 2UVFA 4CGTA 2XKUA 5DJ8A 4L4TA 3FRUA 2NX5E 1NUNB 2XTJB 4L8SA 4OZGF 5HGHB 3JV0A 4YDJB 4AJ0A 1TZGL 1EPFA 2D03L 2P7TB 5B21A 4X9IA 3F7RA 4JFPA 1S9VB 1F90L 2DQJH 3RZCC 3KPLB 2GJZA 2PTVA 5CEZH 3P40A 5A2JH 5AZEL 4XZUA 4YH6A 3V0WH 4FABH 5HYQB 3VFWB 3U4AA 5CLWA 1YEEH 4GO6B 5ACZB 2DYPD 1XZ0B 3LQAL 1BZQK 5T1LB 5KANI 2GQHA 4JO4H 4P2RA 5LCVL 1JNJA 5BVPL 1T7VA 2EYTB 3NZHL 2E9WA 2DF3A 2X4OB 3KPQA 5HHME 3S4SA 3N1MC 3SE3A 2Y23A 4OKDA 1N5AA 4F7PA 2DM7A 3QJHB 1NLBL 3CX2A 1T80A 2VQTA 1OTTC 3D0LB 4HC1A 1HKFA 2GAZA 3MRRA 4NQTA 3DIFA 3UMTA 5FYLH 5K9JH 3GMPB 4L4VD 3B2VH 3FQUA 1D3CA 2GUOB 2RB8A 5DD5L 4NKQB 1QBMH 1H9VA 1AC0A 5D7JA 3LDBC 3FOMA 1X5JA 1J87A 5IHUL 5D2NA 2DQUL 4CVWA 4EI6A 2X2YA 4JN1H 2DLFL 5L8LB 3T0DA 3X3GH 2X4NB 4OZGE 3VGAC 1D6VH 2HKHL 4XAWL 1I8IB 4PP1D 5AWNH 3Q3GB 1LE5B 4F57H 4MD4B 2AS5M 4JO2L 1RUMH 4RGNC 5HPMB 1PG7X 1KUMA 3BDXA 4KY1L 5FHAH 5C0FB 4R4BA 4KUCF 3RVUD 1JZ5A 3CLFL 3P0VL 4Q0XL 4XPAL 1JGDA 2ZG3A 3N1QC 5C07D 2XTJE 3PP4H 5I15L 4TRPH 3O3BA 1CE6A 1DQQA 5SX4I 4UV7H 3TZVD 2VUOA 1YNLL 3C5ZA 4FXGA 1NGWA 3RWJA 1OSZA 1LDPH 2X1WL 1AGDA 1J1XL 2AGJH 2GSIB 1T1YA 2J4WH 1JNNL 3VI3F 1MCOH 4HJJL 4DEPC 1TFHA 1F2QA 2DLFH 3GMQA 3O6LH 1YEGL 1CR9L 1S7XA 2I9TA 4QRPE 1ZEAH 2FECI 3U4BH 2KQNA 4EDXB 4BUHA 3IRPX 3BGMB 4Z78B 5JA9A 4G42A 1H0DA 3BO8A 3FQWB 3UTQA 5D1QB 5I1HH 4IBLT 3FQWA 4P4KC 1I3RA 1FIGH 4GG8B 3PHSA 2VH5H 2CDEA 4D2NA 1J86A 3FB7A 1G7QA 2K3TA 3DROB 1NCCH 3LVEA 4X80L 5F3HA 4XTRD 4FFVC 3BP7A 3IU3B 3MUHL 3WIIL 4J23A 2B4CC 1MREL 3U7WH 3JVGA 5BZDA 2CGRH 4Y16D 1JWSB 3VFWA 1KXQE 1F58H 1AFVL 4GAYB 5JW5A 1FO0A 1GHFH 1LO5B 3GSXB 1B0GB 2AEQL 3VD4A 4PJ5B 5EN2A 2DD8L 1IGMH 2CKNA 2X6MA 3TCXA 3FHAA 4L8SB 1YJDC 5GGRY 3ETBF 3HCVB 3GSWA 3D0VB 2I26N 4ZXBD 2VYRE 1QFUH 3MACH 3QDGB 3P4OA 5CP3H 2BRRL 3HI1A 5D7KD 4NJ9H 2W92A 4EEEA 1CYGA 1SJEA 3D39E 3VFRB 4N0YL 4RFEB 2E6JA 5C0RL 1BVKB 1VESA 3TBYB 1MHHB 5GGTH 4QRTB 2RBLA 5L9DH 3UCRA 1C7SA 2Q8BL 1HINH 3P9MB 1V3MA 1MVUA 4DW2H 2VLME 5TGBA 2CQVA 3FJTA 4CNIB 2OL3H 5FGRA 3MYJA 5IFHH 4IRSA 3ZSSA 2X4UA 4YQXH 3NFSL 4NFBA 4PG9A 2YOCA 4N0FB 4ODHH 2X4UB 15C8L 5FOBA 3WXWL 3IAQA 5E5UB 3OPZH 4F37K 1PEWA 4LARL 3OZ9L 1BD2B 1CK0L 2Q6WA 4POYA 4K9EL 4R97B 4QRTA 1R3IL 3S37L 4QRRD 2ZSVB 2AJUH 4APQD 2FR4A 3GKZA 4MJ4A 5HXMA 1DQTA 3DRQA 3T77A 3MACL 2XZQL 1MFNA 2HJLB 2WMPA 4MAYD 3CVHL 1MHEB 3E0GA 3BXNA 3TZVA 1KYOK 2ZCLL 3RGVA 4S1QL 4Z9KB 2WWKO 1T03L 4FQPA 3T4AB 3Q6FB 2V2WB 3RPIA 3RA7L 5C0BA 3NPSB 2Z4QA 4YNYB 4G8IA 4WO4A 3WFDH 2HWZH 3VGDA 2PYEA 3LEYL 4FQXC 5ETUB 3CVIL 5BOZG 3KLHD 4JRXB 5CJOL 3BKMH 1AC6A 3G6JB 1U3HD 3H9SE 3RVTD 5E2TH 3Q6GH 5E4EC 3VD5A 3VW3H 4L9LB 3ZDXE 1UM4H 1NH6A 2K9UA 2OTWB 3EGSA 3RDTD 4OQTL 3I3BA 4LQ1A 3T1FB 4HUVB 5FYKD 1ZGLP 1N0LA 3KPTA 1XH3B 2AK1L 1OT2A 3MNVB 4FG6C 4X98B 3X13B 3P73A 3GI8L 1QLFA 4UDUB 5D2NC 2QQKH 3RVVD 1FV1B 5GS0D 3MCLH 3QG7L 5HHVH 3BKML 1NAML 4ESKA 2XA8H 1JPFB 1JTPA 3VXMD 2G75B 2LTQB 3KDMB 4U33A 2O5ZH 3BPOB 4G80A 1MLCB 3N85H 4AT6B 5BZWB 5IK3B 3FT3A 4QEGA 1U58A 2CRZA 2DQEL 4O00A 5DUBB 5FUOL 4EN3C 2EDBA 1S8DA 1F2XK 1EHNA 3OJDB 2CDEB 4S1SL 3QCVL 4PJBA 5DJZB 4OD2A 5I1LA 3SN6N 4I4WA 2FIKB 1YNLH 1PW3A 1CD1A 2FGWH 4PJFB 4Z7UF 5IVXF 3HZMB 2QQKL 5I0ZA 4FQXA 4WWKB 5I1KH 2D9CA 5D96C 4GAGH 3O2VH 3JTSB 3P4MB 1CFQB 4F80A 2KUTA 2EDHA 32C2B 2AEWA 4KY1H 5FHAL 4DKFL 1DN2A 4L4TD 3D2UD 3KXFD 3QCTL 4F57L 4CAGA 3MLXL 4BKLA 4Z77B 3GHBL 2R4RL 9CGTA 1J8HB 4LRIC 2AXFA 3MRIB 1BF8A 2R23A 5L9DL 3NTCL 1S5HA 2ED7A 5C0RH 5I1DA 3F7VA 3SDXA 1CBVH 3IDIB 5KSVA 3SDDC 1JYXA 1BBJA 2GSGB 2A9NL 3HPLB 1KCSH 1FFOA 1U8MA 1IM9B 4MJ6A 5CUSL 5ALBH 4HJGA 1VADA 1Y0LB 3E1F1 3NGBB 3RVXD 3E2HC 4R4BB 3LMJH 5EZLB 1KENL 4I3RH 4Y5XC 4ZFFB 3FQXA 4NWTH 3F6LA 1PKQA 4OBRA 3FQNA 3K74B 5FM5M 2Y5EA 2W59A 1YZZA 5EBWB 4AEHL 2W0LA 3M8OH 2R0LH 1BIHA 1ZT4B 1HHHA 1SJXA 4G6MH 1MCQA 4JPWH 5IVXE 5IIEB 1UVQB 3LKPA 3UJTH 4LMQE 3OB8A 3WD5H 5E8NB 5DFTA 1A4KB 1BZ9B 1S7RA 1I8LC 2FB4L 2VITB 4IHOB 1PLGH 2F54B 1AXIB 3V0WL 1CD9B 1QRND 1NGXA 2EYRB 1A3LH 4M7JL 2ZP0T 3T2NL 3MLTB 3B2UD 3IGAB 3QUZA 5F8RC 1UC6A 1MCSA 2JK5A 4N0YH 1FYTB 3DNKA 4PRHE 5ICZA 5IGXH 4J6RH 4GRLD 3BN9D 5DD1H 3BKCH 5HHNA 2F5AH 2X4TA 4MZ2A 3V4VH 1OOAA 4LSTL 4JFDA 5C86A 4QHLA 4DCQB 3B4NA 4GAJH 5FYJH 5FO9B 2C3XA 5DQDL 3S35L 4WUUE 4MAYB 4NZTL 3LPWA 1WISA 4GMSL 3UTSA 4PLKD 4X7FC 2WQRA 4KK6D 2GY5A 1AQDA 5DJXA 5K93A 3BAEL 1TJGL 3HZKB 4NQDE 1NKOA 3I50H 3HMWH 4Y16B 1F6LL 1RURL 4Y8AA 3MRDA 5JHDD 2HFGL 4OB5L 3BPCB 5HHQB 5DT1L 5D5MF 4KRMB 5E7FA 5TF1L 4X4ME 3QR2A 4MCZB 3MRFB 4WCYH 1OAKH 5CZKA 5DR5L 3MBEB 4OM1L 2R2CA 1XF5B 1N4XH 4UINH 1ZWIA 3MOQA 4QHKI 1I8IA 2Z31A