1XGRB

Structure for antibody hyhel-63 y33i mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
b'AVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDIWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB02
1I7ZB 3X11B 1QFPA 3MODH 3QEQE 4RISH 4J1UA 4MNGE 4M8QA 5CSBA 2ZUVA 4Y5VC 4M6OL 2Q20A 3T65A 2W60A 1S8DA 2HRPL 2IMNA 3QDJA 3TNNA 1BP3B 3B8SA 4KKBD 1T1YA 2MOVA 2R2BB 3O9WD 3EFDL 1ZEAL 3GSWA 5IMMA 1JGDB 3UP1A 2DQDH 5FHAL 4PUBL 5GS2H 1MCQA 5CP3H 3SKJL 5BVPL 1CS6A 1TXKA 3BD4A 3MV9B 3VWJC 3RVXC 4KK9C 4HT1L 1I9JL 2Q1EA 4OIIH 3L3DB 4LOUC 2GITA 4D9RD 1KCVH 5FKAB 4M1CD 2DRUA 4JJ5B 4P9HC 5F7NC 3T2OA 1NDGA 5IROC 4TPRH 5D8JH 3PWPE 5EC2A 1IFHL 1NC2D 1CCZA 3QJFA 2P5EA 1JPGB 1IT9H 2VZ3A 1JNLH 2WBJC 4NKOA 4YBQC 4LQFH 5J9PB 1UM6H 3EYQC 4P5TA 4PY8I 4ZS6D 5I75C 2IQAA 4JR9H 2DLEA 5JW4R 2QSCL 3FTGA 5D2LF 5TH2A 5BRZB 2X42A 5GJSH 3MRBA 3S88L 1FL5A 4XCNA 1CFQA 1MQ8A 2VC2H 1UWEH 5D9SA 5KSBA 2DKMA 1UYWL 4LSUL 3D18B 4JFDA 2FX8H 4O9HH 3SGKC 3ARZA 4PJBB 1Y0LB 5C0IB 4YR6B 2YWYA 2A77L 5KVEH 1U8PB 3QEQD 5DZOA 3TO4B 1L7TL 4N0UB 1NMCB 2CMRH 2APTA 2EYTA 3ARYA 4P9HL 4XHJD 2I9LA 3W2DH 1MAML 2CIKA 3BPNB 1NCDH 3WFDL 3MFFA 5E1AA 2KZ1B 4JO3L 4ZQKB 2QSQA 1A6UL 2DM4A 5B4MD 5C9KA 2DTSA 2I07B 3STLB 1TVBB 4OLUL 2LU3A 4HKXA 4Q9RH 1S9YA 2EH7H 4BZ1L 2X4PA 1I1CA 2DQTL 4AMKL 1LWRA 1AIFB 3SE3C 3ZKSD 4R2GD 1BFTA 5DJDA 1NJ9B 1MQKL 2BNQE 4M03A 5GIRA 1QRNA 3WJJA 2Z31B 2BY0A 2R9HC 1MJUL 3PWPD 3GMLA 3RAJL 1ZHBA 1YA5A 4P4KB 3DGGA 2CRZA 3HI1B 4C56B 2MKWA 2AK4E 2H32H 2J8OA 4P2OC 3SDAA 4OGYL 1K8DB 4AEEA 4KUCD 5HHMB 4J1UB 4JN2A 4M8QB 4M93C 5IHBA 4I48A 3S34L 4QHKI 2OS7A 3T65B 2W60B 5HGHA 2G75A 1S8DB 1IKNA 3QDJB 4KJQC 5F7YC 1QRKA 3ELAT 4UT6L 3TNNB 4RFOH 2Y1VA 1MCNA 1T1YB 4WUUE 4ZUWA 1O7VA 5IMMB 1IAMA 1PKQB 1EHLL 5DHVH 2Q87A 1DBAL 4KQ4L 4X7TA 3PIQA 4ZNEE 3FCTA 4LK4A 2GITB 5FO7A 1B88A 2VH5H 3K81A 4NNYA 1NDGB 5E8PA 3GK8H 3TP4A 5TDPA 5EC2B 3BFOA 3QJFB 4JQIL 2P5EB 1DL7H 1KEMH 3RNQA 4LCCB 4NKOB 5JO5A 3QR2A 5FAAA 4P5TB 3QQ3A 2IQAB 4LPUA 4KJPC 2BOCA 3MREB 2WUCH 1F4AA 1MUJA 4KDWA 4YZFF 3FO9A 3W82A 3BUTA 1TJGL 2GK2A 2DN7A 5TH2B 1QVOA 3MRBB 4U6TA 5EUOA 3HTLX 4HXBH 4XCNB 3VWKA 1S78C 2DQIL 5GRYA 2BNQD 4ETQA 1J1XH 4MXQD 2NR6C 5D9SB 1S7RA 1MRFL 5DD3L 3V0WL 5KSBB 4XAWH 2FBJH 2CK2A 3GI9H 3HUJF 3JVGC 1UG9A 3W0WA 4JFDB 2AK4D 1FFOA 1JNJA 5FDWA 2HMIC 4GMTL 1ZMYA 1RMFL 1YPZF 4PJCE 4O4YH 3U9UA 3QDGA 2EYTB 3I3EA 4ZO8A 4JKPL 5EOCJ 2I9LB 1U8HA 2B7DT 4NYLA 2X9YA 2CIKB 3RU8H 5E1AB 4BQCA 5DQDH 1I8MA 2J4WH 3S36H 4WUUD 4DEPB 4Z6AT 1H3TA 4L8CA 3C6LA 4HKXB 5D1XA 2VDNH 1S9YB 3LMJH 1CDGA 2X4PB 3UROR 5HDQH 1AGDB 2CKBA 1K2DA 3H3PL 3NCYP 5DJDB 4JO4L 4PLKC 1LE5B 3UZVB 3AU1A 5GIRB 1QRNB 3MQIA 3GMLB 1ZHBB 2JJWA 4RMTA 3DGGB 3SDAB 1PG7W 2DQEL 3V0VA 4JO2H 4GG6A 4OLWL 4DN4H 3HI5L 4I48B 4TUKH 3KLDA 4MWFB 2R29H 4N8CL 5HGHB 2G75B 3UPRA 4JY5L 4ZO7A 2FDBP 2XPGB 1IC4L 3QFDA 2VN4A 4ZUWB 2AJXL 5IMLA 1NBZA 4M3JA 2GYSA 1CVRA 5T1KA 3VG9B 3WIIH 1I8IA 4XP9H 3CVHL 4X7TB 3PIQB 3FCTB 3RDTA 4GFTB 1A6VL 5A2LH 4X7SH 4JPWL 3BKCL 5FO7B 3T0EE 1J8KA 4RNRA 4NNYB 5TDPB 2OR8A 5TE7H 1GGIL 4HJGA 3BRDA 1UZ6F 3RNQB 4MHHG 2NZ9D 2CO7B 1PSKL 4NO3A 3OKEA 3PP3K 4PJ7A 4LDOB 3QQ3B 1F4WL 2RB8A 5E0QA 3BO8A 3EYFA 1BREA 1IC1A 1G0YR 5EZIL 5DJ0A 3FO9B 1HK6A 1U2HA 2NXZC 1AI1L 3MLZL 4JJHA 1QVOB 4HWBA 1NCWL 5CEYB 1OAXL 5EUOB 3VWKB 1NGYA 4MAYC 5K9KA 5HGBA 4N0CD 1VFBA 3N1GC 4ETQB 4ZUUA 1S7RB 5HDBE 3NCFB 1MY7A 2RIKA 5D1ZA 1FFOB 5C0RL 5FDWB 4Y5XC 1PKOA 4WI3A 3WSQL 5C71A 4NCC1 5F1OB 3QDGB 1YEGH 1Q94B 5BXFA 4UIMA 4K3JH 1U8HB 1UACH 4NYLB 1UVQA 1MRDL 4X6CE 5GXBB 5FGCE 1Q9WA 1I8MB 1ZT4A 4WFHE 4ZSOE 4V1DB 5BV7H 1FZKA 1OARL 3AS2A 4L8CB 5F7EH 5D1XB 3MJ9L 2IQ9H 3PGFH 3G5XA 1UB5A 5GS1A 4W81A 4YFLI 1UKTA 4YUEH 2PO6A 2DM2A 2NXYB 2CKBB 1NAMA 4IJ3C 4Y4KC 5FK9B 4OCYH 1JNNL 3BDXA 1KB9J 4KHXH 1FG9C 1SBBA 3AU1B 2Y5TB 3T0ED 4Z7WA 3S5LG 1KB5A 1CF8L 1N8ZA 4S11A 3SO3B 2EE2A 3K4AA 1RZ8A 4KPHL 1VEPA 3E8UL 3V0VB 5EA0L 1VFAA 2QQQA 4Z18A 1RV6X 3JWNC 1HH9A 2M2DA 2BP3A 4GG6B 3TCLA 2G60L 1CICC 1E4KC 6CGTA 5DZNA 3CLEH 3PP3H 2Y5EA 4EBQH 1IE5A 3UPRB 1MHCA 1BBDH 2PTTA 3RBSA 3C8KA 3P30L 3QFDB 5DO2C 5IMLB 1NBZB 3JV0A 4POYA 2ZCHH 3K8LA 1I8IB 3BKMH 2PTVA 5C6WH 5ENWA 4I18A 1KJ3H 1FE8L 1EPFA 3TA3B 2EDRA 1A1OA 1QBLL 4PB0L 4OCSL 3VXOA 5JA8B 1G6VK 3HC0A 5DF0A 5C08A 3UJJL 1A3QA 4RNRB 5JHDE 1PG7H 5IEKA 2XG5A 5GGQH 4P3WA 4TSCH 2X40A 3CXHJ 1CLOH 2E3VA 3IAPA 3EO1B 4HJGB 2ID5A 4Y4FC 2X1WL 1YQ2A 4WFHD 3GJFA 3O11A 4HFWA 3OKEB 5GS0D 1CFTB 2YA2A 3BO8B 3EYFB 4LSRH 1GVIA 1WFUA 2V5SA 4MNHA 5A43C 1A02N 2A2QT 5BW7A 1DANU 1NGYB 2PXYD 5K9KB 5HGBB 4Q9QL 1VFBB 4LCUA 2XFXA 3O3EA 1D3CA 5DGRA 4MNQA 2DJ4A 2GTZA 4S0SD 3WS3A 5D1ZB 2RJMA 5LGHL 3O8XA 4HC1L 4XWOC 3WFEH 1DEDA 2ZNWA 2X89A 3WMSA 1CK0H 1NCCL 2BSTA 5BXFB 4UIMB 4OF8A 1XGQA 3MRNA 1C16A 4JVPA 3QCTL 3MCKB 1Q9WB 1ZT4B 1ZA6A 1FZKB 4YDIL 2CRIA 5HI5C 2BSSA 1EZVX 3N1MC 5HHXL 5IBLC 3G5XB 1UB5B 4NZUH 5GS1B 3LQAH 5ADOL 2PO6B 1QKZL 3NFPA 1NAMB 2UY7A 1H0DA 1MLBA 1D6VL 2EEDA 2KZWA 5E99H 4OFVA 4Z7WB 5JHDD 1J0IA 1KB5B 2ZG2A 5TQ2L 1KN2H 5D2LE 1K6QH 1N8ZB 1OP5H 1M71B 3VRIA 3OV6A 1HXMA 1RZ8B 3E3QC 4X4XA 3G5YA 4WGWB 1VFAB 4M43H 1E27A 3CX5J 3LEYH 2X2YA 1A4JA 5JMOC 3TCLB 1DQMH 1NKOA 4M1GH 5E5MA 1ZS8A 2BJMH 3C8HA 4WW2F 5D7JC 5GS0H 2EKSB 1MHCB 1KLUA 2PTTB 1NKRA 3C8KB 5T3XL 1U8LB 5HDOA 4FXKA 2WW8A 4JFPA 4U6VL 3FFDA 2XN9E 5D72H 1T5WB 5ENWB 3RIAF 4HKBA 4I18B 1Z9SA 1L9MA 1QOKA 1TZGL 4N1HB 2QADB 3B83A 1A1OB 5K9QG 3VXOB 3SO5A 1AGBA 5C08B 2ITCA 5IEKB 1FL6A 1NAKH 1OT1A 1A7QH 3K1DA 1I85C 3P73A 4YDJA 1FZMA 3GJFB 3O11B 4HFWB 1KOAA 1AXIB 1I7RA 5KVDL 4EJ1C 4MNHB 1X6LA 1DDHA 5DVOA 3SDXB 3WE6A 2UWEF 1WWAX 2F5BH 3EO0A 3KPRA 4X4ME 4ZFOA 3WXVH 2EZ0C 2HJLA 2XFXB 3O3EB 3FO2A 5F3BA 1NL0H 4MNQB 4ODVL 2R8SH 4PRAB 4PJ9A 1YEDA 4EOWH 3WS3B 3O8XB 2C5DC 4U3HA 5FUZH 1EEYA 3BMWA 3Q5YA 4GW4A 1OAQH 4OM0L 3SE4A 1UEYA 3MOAH 5D71L 3G6DL 1BGXL 2P47B 4QRSB 4DZ8B 2MCG1 2BSTB 4ELMA 2JJTC 4U1GB 1C16B 4M62L 4TTDD 1S7VB 3C9NA 5J12B 2AGJL 4I1NB 4GW1B 1FN4A 1ZA6B 2XZAH 1MAJA 5F9DC 5BZWA 4PGEA 4XB8A 1S3KH 2E7CA 2BNRA 5E1HB 2BSSB 1KCUH 1FFNA 4YE4H 4OCRL 5L2JB 1UT9A 5D1QA 3NFPB 3V4VL 1H0DB 1PZ5A 1JZ5A 2DQUL 1ULVA 4YK4C 4KRPD 3MRRA 3U48A 3RWJB 4HS6A 2FECI 4R8WL 4XZUA 3HE7A 4YZFE 4OTXH 1BLNA 4UT9H 3VRIB 1HXMB 3HG1E 2ERJB 4FTVA 4X4XB 1QA9A 4HPYH 3RVTC 3V5KA 3G5YB 1EFXA 4P2QA 3AGVA 2J3SA 5J3HD 3HUJE 4GMSL 4HIEA 1SYVA 1A4JB 2ESVA 5E5MB 3AB0B 1TTFA 1F8TL 5E8DL 1KCSH 1KLUB 1YPZE 3MA7A 1UKQA 1JL8A 4FXKB 3WDJA 4H8WH 4JFPB 4DKDC 4WHDA 4XPTL 3FFDB 4HAGA 4EZMA 3P0YH 1UJ3A 4HKBB 4X83A 2YMXL 1CXIA 1JGUH 5IHLB 5F9WC 4MMXC 3N1PC 3EFFA 4NJ9H 3O2WL 4POZD 1AGBB 4PJ8A 1RFDL 2JB5L 4D9LH 1PX4A 2IMMA 4I77L 5B38G 1A6ZA 1FL6B 5F6HJ 4IDJL 3WKMH 4U1JA 5DR5L 4FZEL 6FABL 4CVWA 3P73B 4YDJB 3GKWL 1XR9A 1FZMB 2ADFL 4MD4A 2JJUA 4K23L 1I7RB 1RIHL 4RAUA 4HPOH 3CFDB 2FWOA 3RTQD 1DDHB 3T77A 3FOLA 4OBRA 4Z95H 3WE6B 3KPRB 3EO0B 4ZFOB 1JHLL 5I6XB 2HJLB 1HKLH 1MCSA 3FN9A 4F15C 3HNTL 3MLUH 4PJ9B 1YEDB 3V6OC 1UADC 3HG1D 3VXMB 3JTTA 1X5IA 4HXAL 3UXFA 1UJTA 1Y6KR 4GW4B 1JHKL 2Q8AL 4LHUD 3BAEH 2YS4A 4L29A 4P0DA 4ELMB 4RDQG 3ARWA 1A3RH 2Y9RT 3C9NB 5EZOL 3ARPA 3MXVH 1OW0A 2AV1A 1FN4B 2OTWB 5BZWB 3L5WA 5DD5L 3T04D 4OFPA 1KIRA 5ITFA 2BNRB 5I30L 4DFIA 5C86A 1ZOXA 1FFNB 5TE4H 3HE6C 5AYQA 3ALPA 1PZ5B 1S9KC 1QSFE 3DVGA 3MRRB 5FA4A 1HEZB 4HS6B 4RMWA 4XZUB 3HE7B 1X4XA 4OZHA 1A7RL 4S1SH 1BLNB 4G6AC 2P5WE 1AP2A 2DYPD 4RGOL 4NT6A 3RVUD 3HRZA 4FTVB 2V5RA 1QA9B 3FQWA 3V5KB 1EFXB 4P2QB 2J5LB 3D25A 5L0QB 1BF8A 1PFCA 3BN9C 5GISH 1B3JA 2VZTA 4HIEB 3DSNA 1SYVB 5I1EH 2ESVB 1X5JA 4OD1H 5C3LD 1YYMH 4CVZB 4PGCB 5KS9A 1HINL 3LPGA 4JZJC 4FQXC 2DLFL 5C0AE 1OSZA 3UPCA 4LGPB 3EZ8A 3QEQA 4OCWH 3BT2L 4XBEH 2W07A 4M7ZB 4K94H 3ZT5A 2BXZA 3QB7C 1TJHL 3ZKMD 1FGVH 1RPQA 1UJ3B 1WBXA 4FFVC 2D7NA 2ORBH 3EFFB 3BVNB 4LPCA 3QNXB 5JDSA 4B53A 4PJ8B 4JLRB 3MLXL 5DUPH 1CLZL 3GMPA 3MCG1 1NGPH 1PBYA 2W9DH 1A6ZB 3QH3A 5GGTH 3PGCA 4U1JB 5KVMC 1GH7A 4DJMA 3QCVH 1DJSA 5IJVA 3QQNA 1XR9B 4OCXH 1G9EA 1CFVH 2HTKD 2AEQL 4MD4B 4R9HA 3KVQA 4YBHA 2RCSH 3SDCC 1H3UA 1JTPA 2JJVA 3VFOA 5I16A 3UYRL 4RAUB 4LRNL 4XMPH 4WY7H 4KZDL 2NY1B 3DBXA 3T77B 1TZHA 1YMME 2NY5H 4FQCH 3S35H 2HT2D 2O61A 1RZGB 2XICA 3CSYB 4OIAA 1IM3A 1QSFD 1YY8A 3D3VE 4P48A 4JHZA 3UO1H 4GRMA 3EJZD 5CP7A 4M5YH 3MGAA 1UC6A 2P5WD 5DMGC 1VFOA 4LHUG 2AI0L 3JTTB 1MCPL 1UA6H 3WUZA 1FVEA 1II4E 5JTWA 4PRNA 1LNUA 4TSAH 5HGAA 4L29B 1SVCP 4M8VA 4AEIL 1PEWA 4YHKL 3O6FB 4GKSA 1BOGA 4XPBH 1NDMA 2AV1B 4CDGC 5F9OL 2WV3A 1U3HD 2NY3D 3RKDD 3SKOA 1KIRB 5ITFB 4M02A 5F1NA 1F4XL 1JNHB 4GS7B 1QYGL 3BE1H 1F4HA 3DVNA 4HGWA 3LZFH 3C6LC 3DVGB 5FA4B 4HEPG 3KWWA 1JK8A 2FX9H 3PXHA 5D93C 4OZHB 1AP2B 2H2PC 4NT6B 5CZVL 4MQXD 3P0VL 3D25B 4NQUA 4PRPE 2J6EH 1ZHNA 3MJGX 4WO4A 5E03A 4L8DA 1D9KC 1OAUL 5ELIA 4NM4L 1EH9A 2VL5A 5DT1H 4QNPF 5KS9B 7CGTA 1R0AH 1YMMD 2HFGH 4AEHH 1PY4A 2AK4A 2ZZUT 1OSZB 2Q7YB 1NFIA 3BI9X 2D0GA 4HLZH 1MIEH 3D3VD 2ZG3A 3QEQB 3P4NA 1JPSH 1DBJH 3WKNA 2DKSA 3O45A 4PGJA 4PGDB 3MCLL 4NKIH 3LKNA 1RU9H 1J87A 2E7MA 3WS6A 1WBXB 5D6DA 5E2VH 1JHTA 5B22A 1HYSC 5TDNA 4WUUA 1UH2A 4HKJA 4OT1H 1CGTA 3X17A 4X6EB 3GMPB 4HAFA 3VGDA 5T5NF 4DN3H 1H8NA 5HYJE 3PGCB 2CQVA 3CK0H 2OX5A 4UBDD 1FBIL 1JTOA 1RVFL 3RDTC 5IJVB 3NA9H 4ZNEA 2DDQL 1JPST 4HLZG 4RIRB 3RUGF 4LBEA 3RGVD 1AGCB 3NCJH 3F65A 3ULUC 1FH5H 2IALB 3G5VA 3IFNH 4YHPA 3TBWA 3VFOB 5I16B 4WTWA 1CR9L 4NWUL 2XY2A 1FQ9C 3TJHD 4CMHB 1RUQH 1EXUA 2FO4A 3DBXB 4JHWH 3T3PF 2O61B 1YY8B 3T2QA 5I17A 2M8XA 4GRMB 1A9EA 3CXDL 5D6CA 4R90L 2EEAA 5F3HA 1MFCL 1C7TA 4CN6A 4YDLB 5FHBH 1L7IH 1UKSA 1FVEB 2MHAB 4PRPD 1T6WA 2DWDA 1A14H 4PRNB 5LXGH 2O5YH 2DMCA 1LNUB 1UCTA 4B0MM 5HGAB 2H8PA 4GKSB 4N5ED 5IWLA 3MLRL 5L8KB 3D48R 1I3RB 2M1KA 1BOGB 3U2SA 3BPCA 2A0LC 3O2DH 3ROLB 1NDMB 1R24A 4PJCA 4Q2ZA 3SKOB 3ULUL 3IRPX 5F1NB 1UXWA 3D9AH 1PW3A 4OF7A 1NMAH 4OCMC 1JZ2A 5SWZE 2PW2B 3DVNB 4HGWB 3IFPA 4M9PA 4XAKE 4A2MA 5DS8A 3H9ZA 3KWWB 4JFEE 1YNTB 1JK8B 3DETC 1A47A 4N68A 4JKLA 1F97A 1WWWX 2LQRA 1ADQH 2FEEI 5HYJD 2DQGL 1DANT 3GZKA 3VE0A 4PB9L 2VXQH 1IBGH 3QHZL 4QTIL 4R6UA 1A1MA 4M7KH 1A7PH 2ADJA 4FQQA 3R8BB 4WO4B 1ZHNB 4L8DB 2DOCA 3SN6N 2D7TH 2VL5B 4KK5D 1SHMA 3FL7A 4N8VA 1NPUA 2P48B 5CILL 2NY0D 3S7GA 1W72A 2AK4B 2HRLA 1U92A 1NFIB 2D03L 4UDTA 2Q8BL 4X7CC 3P4NB 3GSQB 3NTCH 2NY7H 1VGEL 2HG5A 1KJMA 3LKNB 4UB0H 5AZEL 2ZUUA 3Q1SH 4CU6A 1FSKB 4LGRB 1M7DA 4P9ML 5TDNB 4WUUB 3VXSE 4HKJB 2O5ZH 4GXVL 3TIDA 3RIAK 4QXGH 1KELH 5SX5K 3PQYA 5F7FA 4HS8L 5F1IA 5F7WC 3SDDD 1JUFB 4LBEB 4P2RE 3SBWA 1QHPA 3WIHL 4ERSH 3G5VB 3T0EA 2QHLA 3MRDA 4KROC 5DA4A 4PJXA 1EXUB 4H1LB 3IDYB 3L5JA 3K8KA 5F6IB 4FQ1L 2IEPA 1Z2KA 4JFED 1MWAH 1MCDA 1B9ZA 5I17B 1MFBH 4TRPH 1A9EB 1FAKT 5I15H 4WI5A 4YXLL 5E08L 5D6CB 3UJTL 2YN3A 3TBSA 5F3HB 1GGYA 3O4LE 1RULL 1RK1A 4J12A 3GRWH 1YNKL 2DWDB 3FHQA 1IGJB 4NC2B 3VXNB 4EDXA 2H8PB 3M8OH 3TNMA 1PYWA 4I0PC 2GJ6E 3U2SB 3BPCB 2XWJB 1CXKA 4O58L 1ZGLA 4AL8L 4MJIE 1R24B 2XV6B 4NQDE 4PJCB 5FFLA 4Q2ZB 4U1GC 1EJOL 3SE9L 2E27L 4HWUA 5K9QI 1PQZA 3DO3A 1A7BA 1UXWB 2APXA 2ZUQB 4X6CA 3H8NA 3NBNA 3IFPB 3FONA 1FCGA 2QHRH 3A67H 5J89A 5T33H 3SKNB 2EDBA 4ZD3H 4YO0A 5LGKA 1FVCA 4LSTL 1VPOL 2AJVL 5DRXA 3E2HB 2FHBA 5I73B 1IVLA 3KYAA 1A1MB 4HUWA 2PXYA 4P2RD 2ADJB 4FQQB 3QNYA 4PRBA 4RMUA 3GMNA 1GZPA 3L3KB 5SX5H 4MAUL 3OAZK 4KKAC 5HI3D 4WTXA 3IDGA 3MRGA 4AQOA 2DD8L 4LSSL 5SWSE 1CE1L 4N8VB 5JORA 2XKNB 1BFSA 1W72B 4NC1E 2BHZA 2VDPH 5EC1A 4X98A 1CDHA 4E41A 4TOYL 3AB0C 3RP1A 2HG5B 2OP4H 1OHQA 3R8QA 2XA8H 3FRPA 3O4LD 3FRUA 1JGLL 2VDRL 5FGSA 1GGBL 4IRZH 3U79A 4JG0L 1M7DB 3LEVH 3ARED 1BJ1J 3TIDB 2VN7A 2F54E 3V95A 4GXUM 5ACMA 5TE6H 3UAJC 3PQYB 4DK6A 3I6KA 5F1IB 4XCFL 2GJ6D 1INEH 3KR3L 1GHFL 4OB5H 5IV2A 4MJID 4NQDD 3PWNA 3RVVC 1WIUA 4F9PA 3T0EB 3MRDB 4LVOC 4QOKE 3IKKA 4PJXB 1RUPH 2F53E 5I8KL 5C92A 4LHJB 4ZFGL 1FLRH 2DLIA 2QR0A 1KENH 5GPRA 4F33A 1OCWH 2YPVL 3ARXA 1H8SA 4J6RL 3AROA 3BP6A 3KNBA 5J6GA 4JO1H 1T03H 4G6JH 4G6MH 1ETZA 4GG8A 3MXWH 4JM2D 2C3HA 4RGMB 4PGBA 1RK1B 1N3NB 4RGNC 1F3JA 5I1GH 1FHGA 1XCQA 1ZVHA 4XVSL 2W59A 2HT4C 1JMZA 2R4SL 5CJQL 3UTOA 5GHWL 5SWSD 1T0PB 3TNMB 1YEJL 1PYWB 2A1WL 3K46A 1A6PA 4TVPL 1KBGL 1YN6A 3OAZH 3PV7A 4DVRH 1YEEL 4NC0B 4LLUA 4NN7B 1ZGLB 3PWJA 4ODTH 3TZVD 1V7NH 1CVSC 3W9DA 1PQZB 3QUZD 4AG4H 3GJEA 2WINA 4X6CB 3RZCC 4N5UA 3FONB 4JPIA 3VW3L 3DIFA 1HN1A 1R6VA 5DFVC 5BMFL 2F54D 4YO0B 2LTQC 1FVCB 1OQOA 5D1QC 2GY7B 4JGMA 5E4EC 4J8RA 2ADIA 4EN3D 3QXVA 2HTLC 3IRZA 4HUWB 1R3KA 4IRJD 2PXYB 5FOJA 3QNYB 4PRBB 1YNLL 3GMNB 1GZPB 4KK8C 2EDDA 2WIMA 3DXAE 4X5WA 4Y16B 1I1AC 1DN0A 1SJXA 3IDGB 3MRGB 4QOKD 1UXSA 4QRTA 5JORB 2F53D 2XZZA 5D2LA 1VERA 1F4YL 2RQ8A 5EC1B 3WNKA 4P3CH 3TH4T 2NTFA 1R3JA 4NN5B 1WZKA 5IESL 2A74A 2YK1L 5EB9A 1LO2L 2ZKHH 4RAVA 4E41B 1F11A 4DOHB 5IQ7L 1EIBA 4PG2A 1IC7L 3FRUB 3QO0A 2BY2A 1N2RA 3VRJA 1TJIL 5C07E 2B1HL 4X6DA 5FGBC 4MZ3A 2QQLH 4QCIB 4X7DC 8CGTA 1ZGLP 3KPQA 3NH7H 4G9FE 3MODL 1DUZA 1AR1D 4RISL 3JWOL 3GSOA 1LVEA 3AC0A 2AABL 4IBLT 3I6KB 4MX7A 1QG3A 3T0DA 4PJ8C 1BVZA 1X4ZA 5IV2B 3PWNB 3UTSE 2X4OA 4DQOL 4MDJA 2FECL 3QPQD 5MERA 2QR0B 4F33B 4Y4HC 3QZWG 1HSBA 2A6DA 5J6GB 2N4IA 4QNPE 4X7FC 1ACYH 1ETZB 2D0FA 2NY1C 1J8HE 5TFSH 1KCVL 1I3VA 4GG8B 4LGSB 1MHEA 1L6XA 4PGBB 4OZIB 3QBTB 4TPRL 4R3SA 5D8JL 3GB7A 2Y6SC 5FF6A 2EDOA 4F7PA 1QLRA 3HPJA 2ICWI 1IT9L 1SBSH 1JNLL 3DXAD 5FYLH 2ZSWA 4J3TA 4LQFL 1UM6L 5E6ID 5DJ2B 3C09C 4KK9D 4JR9L 3BDYH 4KKBC 1YN6B 3KPSE 5INDA 3O9WC 4LOUD 3WNMA 4LLUB 3T1FB 3ARFC 1WFTA 3PWJB 4ZUTA 5GJSL 4JHAH 3RWGA 1EX0A 2GJJA 4HIXH 1KB9K 4IRSA 3W9DB 2VC2L 1J18A 1UWEL 4M6OH 1WF5A 3GJEB 3JBG7 5J57B 1QHOA 2DI9A 3EYQD 4JPIB 3DIFB 4M1CC 2P45B 2HRPH 5C07D 2FX8L 5F88A 4CRPA 2HKFL 4GS7C 4G9FD 5KVEL 4FA8A 4J8RB 1S7XA 1QUNA 2ADIB 3T3PE 2CMRL 3DRTA 5I1HL 1R3KB 1GL4B 4C4KO 3W2DL 5I1KH 1NEUA 5IOPA 4HT1H 1CLCA 3OKMA 3TN0C 3UTSD 3R0NA 4X5WB 1DN0B 3MRJA 4HMDA 5HPOA 4QRTB 3OKKA 3C6SA 3QUMH 4X6FB 5D2LB 3BD5A 1V05A 1IFHH 5E9DA 4Q9RL 1PY9A 2EH7L 1BZ7A 2NTFB 1R3JB 2A74B 4RRPA 4RAVB 1F11B 3B3IA 4LHUA 5CWSA 5KVFH 4G7YH 3W39A 4NRXA 4PV8A 1J8HD 1CYGA 2VDOH 4H1LG 4MDIA 5ICYA 3QO0B 4F37F 1NCNA 3QUXB 1N2RB 1YPZA 3CXHK 2NY6B 1NQBA 3QP3A 4X6DB 4PJFF 4XHJC 4N0YH 2WZPD 3LIZL 3KPQB 1TNNA 5I8OH 1DUZB 1QFWH 1OWWA 4LSUH 4MX7B 2EYSA 3TPUA 1MPAH 3HC3H 4ZYKA 3NGBC 4KRPB 3U9PH 2Y07L 2X4OB 3WYRA 2VLKB 4MDJB 3FMGH 4RFOL 3BEVA 4BA8A 1RZIA 3EDEA 4W6WB 5MERB 3QQ9C 4J3XA 1LDPH 4R2GC 2DBLH 2DTMH 5J13B 3KXFD 4A6YA 4RX4A 1HSBB 1A6UH 2OL3H 4G80A 2BNUA 3LN5A 3MFGB 1PX3A 4P99A 2VH5L 1WWBX 3EJYC 3GK8L 4R3SB 1XFPA 3A6BH 4AMKH 4POUB 1QLRB 3HPJB 1DL7L 2XG4A 1KEML 2ZSWB 4H25A 4NPYA 2WWKO 4ZTOL 1I8KA 5INDB 4MLSA 4WVRA 1M7XA 3TVMC 4ZUTB 3E6HA 4HXBL 5HDLA 2OLDA 4IRSB 2J6EA 4CAGA 3ULSA 1RY7B 3SKUD 1M05B 1NBYA 3S34H 4XAWL 2FBJL 3ARBD 3GI9L 3SHSA 4F7EA 2GSGA 5F88B 1LEIA 4KJPD 4YC2B 3F7VA 1S7XB 1K5NA 3CX5K 3TFKD 4YXKH 3ALXA 8FABA 1JYXA 4OV6F 3MRPA 4U1HB 4LLWA 1QSFA 5IOPB 3RU8L 2NR6D 3OKMB 1NCTA 5FM5O 5DQDL 3FQNB 4TUOA 4LDEB 3S36L 3HNVH 3OKKB 3C6SB 2P5WA 1JMXA 1INQA 1J05A 3IXAA 5CJ8A 2HMID 2VDNL 5E9DB 2HVJA 4G6FB 3LMJL 1BZ7B 1A0QH 5HDQL 3B3IB 5CWSB 4F7CA 2GUOA 4Q9CA 1G0XA 3QJHA 4XP4H 2DLTA 4NRXB 4PV8B 3F7RA 4MDIB 2YD2A 4APQC 5ICYB 4M5ZH 1AXSA 1YPZB 4O51A 4Y8DC 3DTXA 1EA9C 1HI6A 1P53A 1U3HA 4JO2L 2APVA 1CDJA 3OKNA 5T5NG 5K9OA 2EYSB 3TPUB 1NLBH 4DN4L 4ZYKB 4TUKL 2FD6H 2R29L 4JN1H 2ENYA 3BWAA 1RZIB 1JYVA 2X4TA 2QQNH 5EU6A 4OKDA 4GXUN 4JRWA 2A9MH 2H45A 4KMTH 3WIIL 4GBXD 4A6YB 4XP9L 1XGYH 4NM8H 5C0GA 5CLWA 4G80B 1SY6A 4XRCA 3LN5B 1MAKA 4X7SL 4L4VE 4D0BB 3VXQA 4DFHA 4JQXA 3LQMA 2CK0H 1SQ2N 4XPGH 4LLQA 5DUBB 5TE7L 3CU7A 1G6RL 3D3VA 1FO0A 1N6VA 5BV7C 7FABH 1BAFH 4H25B 3T3MF 5DDHA 2VWEE 4LQ1A 1KACB 5FIEA 3RY5A 4UNTA 5A2FA 3KHQA 1KJ2A 1N59A 3QA3A 4WI7A 5CGMA 4XVJH 1BEYH 3C5SB 1N6UA 5IK3A 3ULSB 3MBEB 3HI5H 1LK2A 3LN9A 3REVA 3AM8C 3RGVA 4NZJA 2GSGB 3MRMA 4KMLB 1LEKA 1LEIB 4JG1H 5IBUB 2QEJA 2X41A 4JFXA 2ZP0T 3FB6A 2OTUA 3F7VB 1OTUC 1K5NB 1LILA 2NZ9C 1AY1H 4K71C 8FABB 4BELD 1AC0A 4PV9A 3PDDA 4URTB 2ATPA 4LVEA 3MRPB 4R97B 5EBLA 1QSFB 3S3SA 3WFHA 1FV1A 1WV7T 1A6VH 4TUOB 3O6LH 3BKCH 4NNXA 5BV7L 2P5WB 1J05B 1INQB 5IB3B 5F7EL 5IGXH 2IQ9L 2DIJA 2HVJB 1TENA 3PGFL 2IBZX 4P3DA 1FYTE 4J7RA 4YUEL 3O4OC 4AIXA 4F7CB 2GUOB 3IS0X 4KHXL 2IAMD 1A3LH 2PNDA 3A6OA 3M17A 1AXSB 4OAWA 4O51B 3DTXB 3RIFF 1HI6B 3C5ZD 1U3HB 3WHE1 4CU7A 5DYOA 3OKNB 4XNZC 3ILQD 4W4NA 5K9OB 1X5GA 3JTSB 2X1QA 4OZFG 3CLEL 5C0EB 3FT3B 4EBQL 4XI5C 25C8H 1BBDL 3LEXA 3BWAB 1H3PH 3GRWA 4V2CB 4XVTH 5T5FH 3VD5A 5HYJA 2IJ0C 1TQBC 2X4TB 5FCUH 5EU6B 5CJ5A 2ZCHL 4KKCD 4NQCE 1DP0A 3SBWC 3BKML 2EDKA 5F89A 1WLHA 3ZT6A 3H9HA 5C0GB 5DMYA 4CVUA 5A2KH 5L9DH 2F15A 3HMWH 3VXQB 1ZLWK 5T3XE 3FN0L 1SJHA 1PG7L 2I9TA 5ERWA 4LLQB 5GGQL 5DO2D 4TSCL 5GGUB 2W92A 2RBLA 4NKQB 5B39G 3D3VB 1FO0B 2HA1A 3U30C 3KLHD 5F8RC 5ILTH 4WW2A 2FGWH 3QIBA 1CI5A 5IW6A 1CTOA 4LSRL 3ZL4H 1G7PB 3MNZA 2ED8A 3LQAC 1P7QD 1KJ2B 1Z9MA 1N59B 2AJZA 1G9MH 1FYTD 3P2TA 3QA3B 4KVNH 4OI9A 4JQVC 1KT2A 2IADA 4IIQA 3OXRA 5IK3B 2ED9A 3TESA 2WQ8A 4M6NH 3PDOA 2G60H 4Y4FD 1H8OA 5KZCB 1LK2B 3REVB 4QHMA 3SDDA 3MGOA 3RGVB 3GI8L 3BOVA 3MRMB 3H3KA 3WFEL 1YJDH 3BGMA 3FB6B 2OTUB 4KTEL 5F71A 4GKNA 1DCLA 1P84K 1VCAA 4RMSA 4QHLA 5GS0C 1QD0A 2ATPB 4NIKB 1ERNA 1A21A 1FV1B 2W9LA 1E6OL 4JFEA 3WFHB 5KW9H 4OCSH 4I4WA 1C1EL 2A73A 1V3LA 2BSRA 1S9WA 1F58L 2DB8A 4M61B 4XWOD 4NUJA 5MP6L 2UWEA 4JFFE 1W8NA 1MHHA 1RUKH 4XBGB 4NZUL 2F58H 4P3DB 3LQAL 4HIHA 3ARDA 1OVZA 3NZHH 3LAFA 4DAGH 1CDIA 3QWOA 5E99L 1NH6A 5T3XD 2VABA 4M4PA 5J1SC 1J0HA 3D2UD 2WUBL 4NN5C 5L2KD 1KN2L 3M17B 4NKDA 1K6QL 4FN0A 4OD2A 1ZLWH 4PS4H 2AEIT 5GRJH 1T2JA 4YEFA 2QV2A 2OM5A 4M43L 1RJYA 4KKLC 5DYOB 4YFLF 3LEYL 2IANA 5GSVA 1DQML 4LRIA 4M1GL 1GRWA 3V8OA 5D7IF 1X9QA 4JCMA 4Z5RA 4PJHF 3LEXB 1JWSA 4FNLH 1FP5A 3OQ3B 5HYJB 1GOHA 2AKRA 3B6SA 3HC4H 4Z0XA 3U46A 3SCMD 1YC7A 3AAZA 2BFVH 3LQZB 3DX6B 5D72L 4P2RA 3DGCR 5DRNA 3H9HB 3ZKXC 3AS3A 3VXRE 4ZODA 1MF2L 5DA0B 3BIAX 5D7JD 5BS0E 4LLDB 2I9TB 2NY0B 5ERWB 1NAKL 3LDBC 3RY6C 1A7QL 5ADOH 4JY6A 3VH8A 3BZFA 3V7AE 4Z7UF 1AD9A 4NHCH 4WW2B 3DI2B 3QIBB 3MRIA 4MVBD 3ARQA 1RZKL 3O4LA 3PP4H 1CGVA 4JRYE 5IW6B 5AZ2H 5ID0A 4JFFD 3MNZB 4JDTL 3CSPA 4NO0D 4EXKA 2NMSA 2DWEA 1U8IB 2AJZB 4PJFE 3AREA 3VGAB 3KPNA 1G7HA 1KT2B 2IADB 1BZ9A 1WFNA 2DKUA 4IIQB 3OXRB 2F5BL 4ZUSB 3BGFC 1FNAA 3WXVL 5IFJA 2R0KL 2R1XA 4YHMH 2FEDD 3PDOB 4W6YB 1IL1A 1NL0L 4QHMB 3SDDB 2R8SL 3MGOB 2HWZL 4EOWL 4IOFC 4EDWH 3HPLA 4JREB 5KSAC 1CTNA 2D7QA 5FUZL 2CUMA 3BGMB 3EOBA 1OAQL 4GKNB 3MOAL 1OAYL 1TVDA 3OB0K 4U6VH 3S96A 4MD5B 1C5CH 1QPXA 4QHLB 2FIKA 4X0KA 4LSVL 1TZGH 3FQXA 3MV01 3VDCA 4I4WB 2YD1A 5EZJB 4H8WC 2XZAL 2A73B 1S9WB 5IT2H 1S3KL 4NUJB 2UWEB 2N56A 1KCUL 1MHHB 1D5IL 2VOTA 4LLYA 3I50L 4DKEH 4HIHB 2VLRE 3ARDB 2F8XC 1ZTXL 3QWOB 5SWSA 4Y8AA 3RPKA 5BS0D 5CINH 2VABB 1IGIH 4OTXL 1RK0A 5D7KE 5IKCA 5JIHA 4NKDB 4UT9L 3DSFL 2MQCA 4OD2B 4EI5D 2Y25A 4WHTA 4I0KA 4KDVA 4PG2C 4HPYL 4TTDC 2UV3A 1RJYB 5KG9A 4KZEL 2VITA 4F37K 5I0DA 4JRYD 2IANB 5GSVB 2RGSA 3P4OA 4Z5RB 1KCSL 5GQBA 1YQVH 15C8H 1UM5H 3V6OE 1GGCH 2AKRB 3B6SB 2EE3A 3QI9D 4H8WL 4Z0XB 1UGNA 3U46B 3VI3E 1EUTA 3AAZB 3RVTD 5CFHA 2IH3B 4IRJA 1HXYA 4P2RB 5DRNB 5H37H 1JGUL 4QRQA 4L1HA 1EV2E 4X7EC 5D5MF 5HPMA 2YXMA 1WUNT 2A38A 4QOKA 3AXLB 2PTUA 1I9EA 2F53A 2OR7A 5J13C 2EDWA 4XTRC 4D9LL 4MCYA 4FQLH 3WKML 3V4VH 3VH8B 4KFZC 3BZFB 5EDXA 5HYFA 3IKCA 4GAYA 2Z91A 4HH8A 2PKDA 3MRIB 1T83C 1WCBA 3O4LB 5ID0B 3BH8A 4HPOL 3IXTA 5H37G 2DWEB 4BFIA 5F7HA 2G2RB 2VLRD 4Z95L 1G7HB 5GGSA 5A16A 4PBXA 5EOTA 4GMSH 2IGFH 5IFJB 1HKLL 2R1XB 1VKXA 4POZC 1IL1B 5D7KD 3DMMC 2VKWA 4W70A 3HPLB 4GKZA 4JGJA 4M6MH 5IVXE 4HLJA 3SY0A 3QDAA 3EOBB 1N64H 1LO0L 3BAEL 4XPTH 3LH2H 3B5TA 5B3NA 1F2QA 1X4YA 5MI0C 2FIKB 2YMXH 4X0KB 1QSEB 3IU3A 3FQXB 3O2WH 4Y5VA 1IJ9A 3MXVL 3RTQC 4K94C 4NN6B 2A9NL 1BJMA 4RFEA 3BPLC 1HHIA 4I77H 1QFWI 2WK2A 4LLYB 2HFFA 4PRHE 5TE4L 3CDYA 4LEOA 5EBGA 3UBXA 2ADFH 3T3ME 3L9RA 2R69H 3WNPA 4HX1A 4QRPE 5SWSB 2F74A 5E6IA 4LLVA 3VWJA 1RK0B 4S1SL 5IKCB 1QZ1A 4OV5A 1W0WA 4WHTB 4AM0A 3RWIA 3PG2A 1CQKA 3KPLA 5IROA 4W4OA 4NOFA 1CN4A 5KG9B 2VITB 2OL3A 4U1KB 3IDXH 3P4OB 1EGJH 2NY5C 1KUMA 1R3LB 2FJHA 5C07A 3KYNB 4ODUB 4G6AD 5I2IA 1JHKH 2NNAB 3GO1L 4OCWL 4XBEL 3TYGH 4K94L 2LE9A 3Q5OA 1PGRB 3WXWH 4IRJB 1HXYB 1Q1JH 4KUZL 3TPKA 2EDTA 3RJQB 4QRQB 3UTSA 2ORBL 4FQJH 4P57A 3MV7E 5HPMB 4QOKB 4Y1AE 4B50A 1BVKA 5DUPL 3SGKA 5C0ND 1A64A 4MCYB 2W9DL 5GGTL 3I85A 4MJ5A 3ZDXF 3QCVL 4DW2H 4PLNC 1U0QA 1XAUA 4OCXL 1CFVL 3IKCB 5IVZA 5MENE 4GAYB 2Z91B 1NANH 2RCSL 1D5XA 1KNOA 4HUUA 4WY7L 4MZ2A 3GUTA 4BFIB 4PRHD 4FQCL 2NY5L 4S2SA 2PR4H 3S35L 3ZTNH 3VFSA 3ZKMC 5GGSB 4L5FH 5EOTB 3S37X 4QRPD 1VGKA 3UO1L 1UH3A 4GKOA 4BFBD 3BKJH 3SE3A 4PJIF 3EDDA 1HOCA 3PUCA 4NWTH 3SDCD 4GKZB 1UA6L 4N0FB 3SY0B 2YUXA 2FB4H 1CD1A 5F70A 4S1RH 1ZT7A 4TSAL 1TJHH 3RUGA 2HTKC 3LKSA 3MMEA 3KXFA 1MCOH 5DRWA 3IU3B 4U7MA 1OP3K 4Y5VB 3LSOA 1E0OB 4XPBL 3IGAA 4HSQA 4RFEB 3L3JA 1HHIB 2DQCL 3S6CA 3Q6FA 5I9QC 3BE1L 2HFFB 3EJZC 4Y0GA 3IETA 3UBXB 1OWRM 2F8OA 3LZFL 3MV7D 4HX1B 4Y1AD 2F74B 4LPWA 2FX9L 4LLVB 3VWJB 2F19H 3S4SA 3ZDZF 3HAEH 3IVKA 5A40E 4OV5B 1KTLA 3L6FB 5IUSA 5JLZA 2GT9A 3KPLB 1CIUA 1N5YL 4ZAKC 3GMOB 4X6BB 2WBJB 1GOGA 5DT1L 1O7SA 3RIFK 1U3HC 2NY3C 2FJHB 4M7LT 5JXED 1R0AL 2AI0H 2HFGL 4AEHL 1X5FA 5I75B 3GSNB 5I2IB 5J1AA 4I5BA 1JPSL 1DBJL 1N7MH 2Y4SA 2HN7A 3HAEG 4NZRH 4AEIH 2BVYA 4ZO6A 5IHZB 1RHFA 1RU9L 5CHNA 2VZUA 1VFUA 2J2ZA 1D9KD 3HI6L 3UTSB 1NGQH 4P57B 5F9OH 3PWLA 1BVKB 2H41A 2WQRA 2Z8SA 4DN3L 3OBAA 2FCBA 3QYCA 3CK0L 1U58A 4MJ5B 3RBGA 2AXHA 4KJWC 5ALCH 3NA9L 1KG0A 5IVZB 1FH5L 4YGAB 1AE6H 1KNOB 4HUUB 1DN2A 3B2UD 5CZVH 2P46B 1RUQL 4FP8H 3GUTB 1ZVSA 4S2SB 4JHWL 5HYSA 3VFSB 3CVHA 5IW1B 3NCMA 5GJTH 1GIGL 4UI2A 2PYFA 5LKNA 4NM4H 2OZ4H 1P4LA 5D7IE 1HOCB 4N9GA 1I9RH 3U36A 2CDFA 2HYMA 5FHBL 2GFBA 1RZ7H 2BVEA 4FFYH 1A14L 1CD1B 5LXGL 3QEHB 2O5YL 1ZT7B 2RFXA 1CD9B 3D1MC 3RGVC 3LKSB 3MMEB 3G6AA 3RUGB 3KXFB 4GBXA 4WHCA 4ODWA 2JF1A 4M93B 3TJHC 3KGRA 3LSOB 3O2DL 5HGGS 4BK5A 4QHUA 4O02L 4GRWF 5C09E 2N1KA 5C0JA 3Q6FB 3D9AL 1NMAL 1QFWM 3BIBX 4OQTH 3IETB 1U6AH 4CGTA 5JOPE 5EFIB 1OGAA 1CR9H 3EGSA 2P1YA 3S4SB 1ADQL 3IVKB 2NYYC 4XBPA 5H94B 4B7LA 2A83A 4TNVF 2OJZH 1IBGL 1KTLB 2VXQL 5IJKA 5JLZB 2GT9B 3QCUH 5ACZA 5IMOB 3F62A 4GAJH 2XYCA 2D7TL 4KI1A 1XH3A 5J6HA 2YBRA 3NAAH 2IBZY 3U83A 1XZ0A 5GZOD 5J1AB 5CJOH 4I5BB 5CSZA 2HN7B 4PTTB 4LCIH 4EUPA 3HLAA 4LSPL 3NTCL 2NY7L 4UB0L 5CHNB 4TUJA 3Q1SL 1MFAL 4JAMA 3T0WA 4XNXL 3KPOB 3PWLB 4WHYH 4XXDB 1JN6A 2MPAL 4P2YA 5DJAA 1Z6JT 2CRYA 4XNQA 4LCYA 1KCLA 5JQHC 2WMPA 3FKUS 4QXGL 3WHXA 5K93A 1WAAF 1KELL 3D6GA 5GZNC 5JDJA 3CCHA 1KG0B 1BQUA 3WD5L 4P23D 4ERSL 2IAMA 4ACPA 5HVFB 5C09D 3GBMH 5F6HI 2D7MA 1SM3H 4PJEA 4NGHH 1M1SA 2WIIA 1ZVSB 4ZS7H 5HYSB 4G8GE 3CVHB 4GH7B 4WV1C 5JOPD 4E9LA 4U2ZA 4WHYG 1MWAL 2PYFB 3FOMA 4ZXBD 1MFBL 5I15L 5KSVA 1ACZA 1B90A 1P4LB 4OLVH 4RMRA 5CILH 5K9JH 4N9GB 4DKFH 3U36B 1TIUA 2CDFB 2MMXA 2R56H 1JIBA 4GOSA 3HZVA 4KROD 1S7QA 3B9VA 2ATKB 3SE8H 3FB8A 5DGQA 3GHEH 3MTRA 4RQQA 5F9JA 2RFXB 2Y36H 3G6AB 3M8OL 2D31B 4GBXB 4ODWB 4KTYA 3CFKA 5EORL 4XNUL 4P9MH 4JHBA 1DLHB 1F42A 3NACH 4QHUB 4G8EB 4YXHH 4FFWC 1GC1H 3VFMB 4HS8H 3REWA 4K2UH 1F5WA 2BY3A 1TETH 2HLAB 2QHRL 1U91A 4TVPE 4HC1A 2R1WA 1RJZA 4X99A 4I0PD 1OGAB 3A67L 3EGSB 5T33L 1MFDH 1HILA 1OSPH 4ZD3L 3H0TB 4XBPB 1E6JH 2A83B 2NX5E 4L3EA 3U0TA 4FQ1H 3WJLC 3IF1B 4Q97A 5ACZB 4K3EL 1CLYH 3FJTA 3PGDB 3SQBA 2AJSL 1JYWA 4Y4FA 3VFRA 1F02I 1RULH 4ZUVA 4LARH 1XH3B 1AH1A 5J6HB 2YBRB 3CAFA 1ZLVK 3HN3A 4MB4A 3V6ZA 1XZ0B 1YNKH 2R23A 4X9BA 5CSZB 2NXZB 1WC7A 4EUPB 1OTSC 1CDUA 2OP4L 4Z9KB 5DRZA 4DCQA 5HHOE 2XA8L 4TUJB 1KEGH 1DBKL 4UAOB 5ESVA 4IRZL 4ZOBA 5DJXA 4JAMB 1S9VA 1KXVC 3LEVL 1WISA 3SE9H 5JPMA 1JN6B 5DJAB 4WWKD 2H26B 1QBMH 4XNQB 2DBJA 2OJEA 4LCYB 1LE9A 3WHXB 1XGUA 2YC1A 4U0RB 5TE6L 4I2XA 4EI6A 5HI3C 1W0YT 1INEL 3CCHB 4HWNA 1BF2A 3QSKB 4LP5A 5C70A 2VE6A 4OB5L 4XCEA 3AMKA 1E28B 3MZGB 3KPPB 4R4BA 3HFMH 3VFTA 2AJVH 5L2KA 1RUPL 4PJEB 1FLRL 1Z3GL 1REIA 1KENL 3MUHL 1TTGA 4K7PY 1OCWL 4JFZH 3B8YA 2V17L 4TVPD 3N85L 2JJSC 3FOMB 4JO1L 5T1DH 4G6JL 4G6ML 4IJ3B 3AREC 5IB4A 4Y4KB 3OR7A 4PLJD 2W0FA 3MXWL 2FJFA 4ZDHB 2NX5D 4HF5H 3T0VA 5I1GL 3U0PA 5F96H 5A3ID 1JV5A 3HZVB 4U7KA 1S7QB 5C6PB 3H42H 4OLZH 4D8PA 5GGRY 2HT3D 2ZCKL 3FB8B 3OAYH 2Q6WA 4B41A 1CGYA 1FZOA 4RQQB 5F9JB 3C08H 3KDMA 3W9EB 4N1CA 4JCLA 3CFKB 3NFNA 1UCBH 5EBWA 4FOMA 3B9KC 2DM7A 2XRAH 3UC0L 5FEBA 5D96C 4DVRL 5JW4M 5E2TL 1CICB 3J7HA 5D7JA 4RGND 4ODTL 2YA1A 3ZDXE 5FOBA 3REWB 5HHOD 1L0QA 3O2VH 1X5ZA 3TO2A 2E5EA 4AG4L 3QXDA 2VDKH 5DQ9A 3QPXH 4MQSB 1U91B 1UWXK 1JI1A 4JM2C 3P0GB 1RJZB 4X99B 2A6JB 1TLKA 1HILB 4G42A 5C1MB 4LDLB 4AH2A 3TYFA 5C2BH 1ZE3C 3BQUD 4NO0A 3ILPA 3QIWD 4L3EB 3U0TB 3O3DA 1RIUL 2IC2A 4NC1C 2B0SH 4S1DC 5L6YH 1EHAA 4PJIE 5AD0B 4K8RL 1FAIH 3Q2CA 3HZYA 2XZCH 4Y4FB 3VFRB 2J8UE 4PTUA 1P4BH 5I19H 5DFVD 3TZVC 3GGWA 5DK3A 4UQ2A 1CGSL 3V6ZB 3QUZC 2EO1A 4H0IA 4P3CL 3I9GL 1IARB 4WEMB 2ZKHL 2HTLD 5GS3A 1WC7B 3WLWD 1S5HA 2X4RA 3RWCA 4L4TD 4DCQB 5DRZB 4KK8D 5ESVB 1NEZG 5DJXB 1S9VB 3CPLA 4EN3C 3UTTE 5IF0A 2CJUH 4PYGA 5JPMB 2QQLL 5GRXG 1XCTA 2OJEB 3KHOA 3NH7L 1XGUB 2YC1B 4I2XB 3EYSH 1L9NA 1YECL 3VJ6A 1HWGB 2MNUA 2VE6B 2JJTA 3NPZB 4LEXH 4R4BB 3ZDZE 5BMFH 4PR5B 1BQSA 3ROOB 4BZ2H 3VFTB 5L2KB 4JVUA 3T4YA 2BHYA 3ZTJH 2HFEA 3HA0A 4L4JA 2P8PA 1ACYL 3O6KH 2H3NA 5IB4B 5TFSL 1IKFH 1MI5A 1UWXH 3OR7B 4P49A 2W0FB 4PREA 4GRLD 4HDIA 3U0PB 3UTZA 1JV5B 1XGTB 1ZA3A 5IESH 3QXWA 4J4PD 4YQXH 3B9EA 2Q6WB 1CXHA 1SBSL 5FYLL 2X4QA 3QI9A 2Z35A 1I8LC 4E42A 3LKQA 4C57C 3KDMB 3NFNB 4JKMA 3BDYL 3ZTJG 3HZKA 4IM8A 5D7JB 4JHAL 4ZOCA 3BP4A 1SMOA 1U8MA 5E4IA 2Y6SD 3JWOH 4HIXL 4K7PH 2AABH 2X1PA 3TO2B 1NCBH 3QXDB 5DQ9B 2FGZA 4YHYC 1EGJA 3VI4F 2EICA 4DQOH 3UTTD 2EDEA 3ZKND 4G42B 3EDFA 3V6BR 5ISZE 4AH2B 3TYFB 3D0LA 1IGMH 3IS1X 4NO0B 3ARFD 3GM0A 3ILPB 4W68A 3DX9A 1T2QH 2XKSA 1FFPA 2GI7A 2XI9A 5E6IC 3SGJC 5I1KL 5LVEA 4PFEA 3TT3L 4WFEE 4KXZH 5DMKA 2X4SA 3DUSA 3HZYB 4YAQA 3HB3D 3QUML 1ZHLA 1TPXB 4PTUB 1IAIH 2PCPA 3GGWB 4W4OC 4LPYA 4MSWA 3U4EA 3QEGL 4NSKA 5DEFA 3OX8A 4NQEB 5KVFL 2FH8A 4G7YL 2FRGP 4XPAH 2X4RB 3RWCB 1K3IA 2VDOL 1NANI 2BMKA 1ITCA 1AJ7H 4JDVA 2VNCA 3QIUD 4OM1L 4TSBH 5ANME 5KANG 3TN0D 3V4PL 3CPLB 3EYOA 3LY6A 3DJ9A 3Q5TA 4GRWE 3IDJA 5IF0B 3V6OA 1F3RB 3P4LA 4ISVA 5KAQF 2M26A 4N0YL 1XCTB 5I8OL 1QFWL 3CVIH 2FHFA 1QO3A 1MPAL 3HC3L 4X9GA 4XMLH 5E5RB 3GDBA 3U9PL 2HKFH 1KYOJ 2HLFC 1Q9KA 3FMGL 3H9YA 3B5HA 4LSQH 3S3JA 4OFKA 4RDQF 4XHQA 5I1HH 1LDPL 3VFWA 1GGUA 2DBLL 2DTML 3T4YB 2HFEB 4WEUD 2ZOLA 4HH9A 3HE6A 2OL3L 3KPTA 2P8PB 4HJJL 1I1FA 5ISZD 2H3NB 2C3WA 4ZG1A 1LO4H 1MI5B 4YK4B 4ONGH 4PREB 2PYEE 4JEGB 1U8KA 3BN3B 4HDIB 4YHIA 5I74C 2C1PA 3A6BL 4X5XA 3QQ9D 1C08A 4WFED 1B2WH 1TTUA 2X4QB 2Z35B 1PEZA 3NN8A 4E42B 3LKQB 4NKMA 4NJAH 4FQHA 3RX5A 2CLZA 4JPVH 3B4NA 5DVNA 3HZKB 3P3YA 4P5KA 5DD1H 3LIZH 4EQ3A 3EJYD 4JZJA 4FQXA 1N0XH 1WAAE 1U8MB 1GOFA 1BWWA 1CFSA 5ICXA 4FFZH 4R7NA 2L7UA 1T6VN 2Y07H 1RAMA 1ZWIA 4I9WE 3P4MA 4YH6A 2ILLA 5F9WB 3GSWB 2XQYK 2R15A 3D0LB 3TVMD 4J3UA 1BMGA 3DX9B 1CZ8L 2PF6A 4YXKL 1FFPB 4L9LC 5IEHA 5DZLA 5B21A 1DVFD 5DMKB 4U31A 4H88H 2X4SB 3DUSB 4YPJA 1JF6A 3BDBA 3C60D 4TNVK 3HNVL 4YAQB 1D5MA 5FXCH 1ZHLB 2QKIA 4L8BA 2PCPB 3L5IA 3SDCA 4MSWB 3U4EB 1A0QL 4NSKB 2ICES 5DEFB 3OX8B 1BPVA 4YHNA 3ARBC 3C2AH 1KFAH 4ZTOH 2EC9U 1WIPA 4XP4L 3T08A 2P42B 2BMKB 1U3YA 2PYED 4JDVB 3OF6D 1E4XH 3P40A 2X7LA 2NW3A 1U8OA 5CGYC 4M5ZL 4F15B 5JW4Q 3FTGB 4GLRH 3IDJB 5JIKA 1FL5B 3TFKC 3ZSSA 3U7YH 1OD7A 1ZXQA 1CFQB 4MA7L 1KTDA 3BZDA 4ISVB 2DMKA 3I75A 4NNPL 4UILH 4QF1A 4TVSa 3FO0H 1U8JA 1V3JA 1QO3B 1W0VA 5DJCA 4FQPA 1D7FA 1NLBL 5DSCA 4GQ9H 2ZWLT 2FD6L 1NSNH 3MV7A 4N90E 4JN1L 2XKUA 4APQD 2EIEA 5CAYB 1CWVA 1WZ1H 5BRZE 2NY4D 1IGFH 3MV8E 2QQNL 3UDWC 3VFWB 4Q7DA 4CN1A 3HZMA 2A9ML 4KMTL 1BD2E 1XGYL 3MFFB 1ITBB 1T0NA 2ZOLB 5HI4C 1EVUA 4HH9B 3GMRA 4I9WD 4NM8L 3HE6B 1I1FB 3CFEA 4PJBE 2F9BT 1JRHH 1CXFA 4PY7A 5BO1H 1U8KB 2CK0L 5D4QA 4GRWH 5JXEA 4YHIB 3W11D 4ODSL 4XPGL 2YUZA 4N0UE 3TM6A 2C1PB 4X5XB 2MQ3A 3HNSH 1C08B 4J2XA 7FABL 1BAFL 3NN8B 4NKMB 1JCKA 1YDPA 4FQHB 1P6FA 4WIQA 1WVZA 2CLZB 1D9KA 2OTPA 3H7BA 4Z76A 2VQ1A 1UENA 1FNFA 1S5IH 1ZV5A 4P5KB 4XVJL 3FQUA 1BEYL 4OGZA 4GBXC 1P7KA 4FQXB 4JZJB 4ODXA 2X4UA 2HP4A 1CFSB 3WNNA 4JN2B 5ICXB 1TMCB 2XY1A 5CIPH 3WUWA 4R7NB 2XQYG 2CR6A 3F6IA 5K33A 1ZWIB 1PJ9A 5JW4N 1BQHG 1LEGA 3KYKH 4JG1L 4XPHH 4C56E 4HBCH 1UWGH 4JKKA 4PJGA 3WN5A 3SDXF 5L7XH 3MJ7A 1AY1L 4MS8C 2WSKA 5HYEA 5IEHB 2VZVA 4HZAA 4MJ2A 1Q0YH 1T22A 1T4KA 3OJVC 4HWEL 4N90D 1GJIA 3O6LL 5TDOA 5BRZD 3LPWA 3QDJE 5IJKC 4OD3H 1D5MB 2QKIB 3MV8D 1YYLH 1RUAH 2JCCA 5E8PB 3SDCB 5IGXL 5I1JH 1BD2D 1G6RH 1N0LA 1PKQE 3S37H 1OTUD 4S1QH 3VFGH 1D6EA 5JO5B 3Q0HA 2YN5A 4LNRA 4HZLA 2VLJE 1OP9A 4O5LH 3LVEA 2BOCB 1A3LL 2NW3B 2X7LB 1MUJB 1U8OB 2DQHH 1CIDA 3F12A 1B4RA 1RSFA 2EKJA 1KTDB 1KLGA 3I75B 3IDMA 4K7FA 4QF1B 4UAOC 1U8JB 1BFVL 2JELH 3V4UL 5DJCB 1W0VB 4AIZA 1M7IA 1G9MC 5DSCB 4MXVF 3W0WB 4I3RH 1EMTL 2CH8A 1B0WA 25C8L 2WWMD 3SGEH 3Q48A 4U0RC 3U9UB 1H3PL 4XVTL 5T5FL 4U33A 3N50A 5FCUL 3RVWC 1MCJA 5HJ3A 4BQ8A 3HZMB 2LVEA 1U2CA 4OBSA 2IAMC 2Z31D 3CSBA 3IU4H 5L8JB 3LD8C 4S10A 3GMRB 1YJDC 5LQBL 2FATH 1G9NH 4C56D 5L9DL 3CFEB 3UMTA 1MIMH 3T2NH 3HMWL 3C6LB 1OOAA 4XI5D 3STBA 3C5ZC 3K2MC 1WBZA 5D93B 4CVXA 4H0GA 4NCDA 1JPFA 2BDNH 2VWEC 2BY1A 2YPLA 3ILQC 1YEIH 2QSTA 1K2DB 2G5RA 5AWNH 1DFBH 5IFHH 5ILTL 1YDPB 2FGWL 3WIHA 3QDJD 5D7IA 4PJHA 1D9KB 2OMBA 3MACH 5D7LA 3ZL4L 3LKPA 3BZEA 3H7BB 4Z76B 2VQ1B 1QLFA 1G9ML 4FG6C 4KVNL 3QO1A 4KKCC 3Q3GA 3FQUB 2JLLA 1P7KB 4ODXB 2X4UB 1I1RA 2VLJD 2VERN 4M6NL 1RHHA 3UEZA 1A9BA 3PABA 3WUWB 1PVHA 3T8XA 3F58L 1HCVA 4P23A 4U6YA 2VJXA 1LEGB 4WTZA 5C09A 1YJDL 3HMXH 2Y72A 1LQSR 5DJYA 2APWA 4PJGB 3WN5B 3K2UH 5T1KB 5BOPA 5E56A 3KLHC 2EDXA 4Z7UA 5CZXD 4X80L 1OY3B 2O93L 1AO7A 1T22B 1T4KB 5KW9L 5B8CC 3HCVA 1OP5K 3RDTB 4ZXBA 3ESUF 5TDOB 5DEGA 1BWMA 5JIPA 1WEJL 1OPGH 2KPNA 3FN0H 3BUYA 2X70A 2JCCB 5JXAH 1A6TA 2IG2H 1RUKL 4OCNC 2F58L 3RJDA 4YNYA 5IMKA 2ZOKA 1D6EB 4NO3B 2W38A 3NZHL 4PJ7B 1MHPH 2OYPA 4DAGL 4PLOB 4LNRB 4AQ1B 4PG9A 1A1NA 1UB6A 4QGTA 4DUXA 5DJ0B 1J12A 4JFHE 3F12B 1BECA 3KJ4C 3BISA 4PS4L 3LOWA 4S0TD 5GRJL 1KLGB 3IDMB 5JHLH 5CBEA 4K7FB 4ZUUB 2FO1A 5K59F 2CSPA 5SV4A 3VI4E 1WTGT 1P5VA 3GI8H 1T1XA 4UTAH 4I0PA 1WTLA 4Y7MA 4KTEH 2C3VA 4FNLL 5EUOE 1WCQA 4ORZC 4IOSD 4JZOA 3HC4L 2FYYA 5DVLA 5HJ3B 1I1YA 2BFVL 2UY6A 1UVQB 1W8OA 4KKLD 1MEXH 1E6OH 2UZYB 2FJGA 2H2SD 4AJ0A 4ZPVA 1C1EH 2BVOA 4PJ5A 5DD6A 1F58H 5MP6H 3VGEA 1J5OH 3VXTA 1WBZB 4CVXB 4YEEA 2E9WA 3QDGE 1JPFB 2YPLB 1X5KA 3V5DA 1OGTA 2VXTH 3BIKA 3DYOA 3U6RA 4ZPTA 2FSEA 4NHCL 5C0CE 3QAZC 5D7IB 1SYSA 4PJHB 2V2XA 4V1DE 3PP4L 2WUBH 1CGWA 5AZ2L 5D7LB 4C4KT 1CD0A 3LKPB 3RKPA 1MCCA 4IMLA 3BZEB 4WU7A 3EIFA 1QLFB 2W91A 3QO1B 3SCMC 3Q3GB 4WWKA 4FABH 1NBVL 4WNQA 1HZHH 1HH9B 1FCCA 4YHML 1RHHB 1A9BB 1Q0XH 3PABB 5D5MA 4OKVA 5DI8A 4JFHD 5DWUL 2YD3A 1H3VA 2NTSP 4K07A 5GRVL 4EDWL 5C8JA 4U6YB 1EO7A 5DJYB 5I18H 1J11A 1Z5LA 4XP5H 1PZUB 3L3IA 1C5CL 2ZUWA 4Z7UB 4C83A 4MVBC 4GG6E 1AO7B 3GIZH 1MF2H 4PPTA 3CFCH 3HCVB 4ZXBB 3HC0B 4PYHA 5DEGB 3EYVA 4MB3A 4IOFD 5KSAD 3BUYB 5IT2L 2X70B 4ORGA 4DKAA 1BZQK 3AY4C 3H7LA 1A6TB 4KROB 5DMIH 3E0GA 4ZFZA 3W81A 4YNYB 4DKEL 2FEDC 5EWIH 2ZOKB 3MOQA 3VRLE 5IMKB 1TPXC 4PG9B 4GAGL 1RZKH 2V7HA 1A1NB 1U8QA 1UB6B 5CINL 5H2BA 1IGIL 4JDTH 3EDKA 3QDGD 3M45A 2EXYD 1U42A 4LCWA 3SQOL 3TIEA 3OGCA 1H5BC 2CLRA 4QWWC 4WJ5A 5CBEB 4LCUB 3WO3B 5C0CD 2R0KH 3R0MA 2FX7H 5HHOA 4U3XA 4V1DD 3DX7A 2GTZB 2HWZH 1UEMA 3IFLH 3CLFH 4I0PB 1YQVL 2WWKT 3U0WH 15C8L 4G5ZH 1O5DT 1OAYH 2C3VB 1UM5L 2NXYD 3BQUA 1GGCL 4KQ3L 3QIWA 2Z93A 4JZOB 2FYYB 2YR3A 5EPMA 1XGQB 2XXCB 3MRNB 4LSVH 4L9DA 5JR1H 5EO1A 3WFCH 1VDGA 3WO4C 2FJGB 4ZPVB 3RZCA 4EI5C 5FECA 2BVOB 5KS9F 4PJ5B 5DD6B 3N0PB 3E6FA 2X05A 2PW1A 5HHVH 3VXTB 1D5IH 2XN9D 2YOCA 2IH1A 4FQLL 4QRUA 1E4WH 3I50H 1QEWA 3QNZA 1A7OH 5H35A 1UQSA 1OGTB 5DURB 1MLBB 3R1GH 3BIKB 2YD5A 2G9HA 1ZTXH 3VGHA 3U6RB 4ZPTB 2FSEB 3O81A 4L4TA 1CL7H 1A5FH 1SYSB 2V2XB 4MGXA 1I1AA 4P46C 3DSFH 4BSWA 4Z7NF 2VXSH 4IMLB 4MA1C 2EIZA 4WU7B 3F7PC 1K4CA 3QI9C 4XTRD 4MJ4A 5CP3A 3CNKA 4WWKB 2VDLL 3ARRA 3TA3D 4KZEH 1E27B 4WNQB 1UZ8A 2IGFL 2VXUH 4KXZI 2CLVA 3JUZA 5DI8B 5D5MB 4OKVB 2GCYA 1ZS8B 4Z7WE 1P6AB 1O0VA 4OZ4A 1CXEA 1IAII 2AVGA 4P59H 5C8JB 4KGJA 4M6ML 1OTTD 1LP9F 4MA3A 5CEZL 5IIEA 3C87A 5EZLA 1N64L 1Z5LB 3EDJA 1H15A 1Z0MA 3L3IB 5FGBA 4BSVA 1IZKA 3LH2L 5DLMH 4C83B 1KPUA 4HK0A 2AQ1A 3DMMD 3EYVB 5JW5A 2ITCB 2A6KA 2BVQA 4ALAH 4ORGB 5F7DA 1OAZH 4LVOB 5AAMA 1V7MH 2V2WA 2CKBH 2CKNA 4PJIA 1H3XA 2R69L 3BH9A 3LHPH 4LPXA 4Y4HA 2V7HB 1U8QB 5H2BB 3GEWB 5C08E 3GM8A 4UIKH 2F5AH 4LCWB 3TIEB 4JM2F 2CLRB 4RGNB 4BUGA 4WJ5B 1KCRH 3MRFA 5E2UL 2VUOA 4RMVA 5KAQG 3FO2B 5F3BB 5HHOB 1EAJA 3IDXL 4XNYL 1EGJL 1G84A 2OMNA 2Z8WC 1B6UA 1B0RA 3UTTA 1EEYB 3SDXE 3VDBA 1XF2A 3O9WA 2PO6D 5IM7A 3BQUB 1LO0H 3ARFA 2Q86A 4Q6IC 4Y19E 2Z93B 3TYGL 5EPMB 3WXWL 1Q1JL 2RR3A 3GSUA 5EO1B 1DTUA 4MNQE 4MA8H 3RZCB 4U1MA 4QXUH 2MFNA 4FQJL 5T1LD 2A9NH 2H32A 5FECB 4PGEB 1S7WA 3E6FB 2PW1B 2IH1B 1JGVL 1NC2A 2LTQB 1XGRA 4U3CA 4HG4J 1QEWB 5D1QB 5EU3A 3QNZB 5E4EB 5H35B 2EC9T 5E7BA 3BX7C 1X44A 4DW2L 2G9HB 3H6JA 2AW2A 2BVTA 5HGDA 3TJEL 4L4TB 3GBNH 3SPVA 1QLEH 3TN0A 5F7MC 1I1AB 4BSWB 5HHPA 4AEFA 4BQBA 3INUH 3PNWA 2EIZB 4H20H 1HNFA 2PR4L 5DHVA 3ZTNL 1A4KA 2YKLH 5J11C 4L5FL 3GMMA 3QFJE 2QADD 1DUYA 1UZ8B 2C4XA 3MC0A 4MXVE 3BKJL 2J8HA 2GCYB 1Q8MA 3ALWA 5C08D 1LDSA 3FAWA 4NWTL 1T1ZA 4OZ4B 1VACA 5DC0A 5C0NC 4QT5A 1P5UA 3MA7B 4QO1A 4MA3B 3MRCA 5E6ZA 2OXGA 3GO1H 2OI9C 1JWMA 4MNGA 5AUMA 2FB4L 5IIEB 4M1DH 4S1RL 5EZLB 1JZ7A 1H15B 4PBVC 4KUZH 3B9AA 3ORJA 1WICA 1KPUB 1MCOL 1E4XI 4HK0B 1MOEA 2YSSA 4FQIH 5ISZA 4GLRI 1DBBH 5JW5B 1AFVL 2PUQT 1A6WH 2A6KB 2MCPH 2BVQB 4Y19D 5F7DB 1FNEA 3EO9H 2V2WB 1NAMH 4R4NC 2Z9TA 4PJIB 3KLSA 1MH5A 3OJ2C 4M7LL 2V9RA 5DK2A 4PJAF 4Y4HB 1E4JA 3MZTA 2F19L 4Z7QF 4BJLA 1FIGH 2X89D 4YFDB 3SJVE 2FWOB 3PWPA 4TYUA 2KQNA 3FOLB 1MFEH 4R0LC 5CJXC 3FAXA 4YX2H 3MRFB 1FJ1A 4HKZA 2P24A 4MCZA 2HVKA 4G6KL 3ZHLA 1T7XA 3BHBA 4JE4B 3IJSA 1JRHI 1B0RB 3UTTB 3C09B 5E8NA 3O9WB 5IM7B 3QFJD 3TVMA 3ARFB 1N7ML 2YRZA 3FQRA 3TCXA 4NDMA 4NZRL 3RL1A 4ZAKD 1FFQA 3GSUB 4JFOA 3MRHA 5C0AD 3D69A 2JIXD 1NGQL 4U1MB 1IQWH 2H32B 3C60A 2L0DA 3QRFM 3L5WB 3VXME 5DVMA 5I66A 3OMZA 1C7SA 3QG7H 2DQCH 3VXUE 5C3TA 2R0LH 1NC2B 1XGRB 1JZ6A 5EU3B 4NOBA 3GJFH 5ALCL 3LB6D 2OK0H 32C2A 5HGDB 5JXEC 4MHHI 1AE6L 4M4RA 2PYEA 4R4FH 3TN0B 3OF6A 2MWCA 1J9CT 5DXWA 5HHPB 4Z7VF 4FQ2H 3PNWB 4FP8L 1ROWA 4F80A 3HRZB 4AY0A 1AQDA 5DHVB 3FQWB 1MSPA 1A4KB 1N5YH 5GJTL 2VSCA 3GMMB 5K59E 2BNQA 1DUYB 4F2MA 3RX8A 4KJWD 2EDLA 2FL5A 3SJVD 2OZ4L 3NMEA 1OD9A 2E6QA 2VAAA 1I9RL 2BC4A 4APQA 2JB6A 1CDYA 1RZ7L 3MRCB 1G6RA 1WAAA 4FFYL 4FTVE 1JWMB 4MNGB 5AUMB 3WLBA 4P2QE 3MLTA 2EEBA 4Z78A 3CJJA 2XTLA 3HI6H 2ESVE 4KK6C 2YSSB 1MJ8H 3B2UC 3WN5C 5CD5C 2JE8A 5ISZB 2EDJA 5CJBA 5JDSB 4E0RA 3BW9A 3NGBB 5GRUH 2W1NA 4CNIA 3QH3B 3FFCE 4GUPA 4B7IA 2VYRE 3LPFA 4OQTL 4KU1A 1MH5B 2DLHA 4R2GB 1IMHC 2MSPA 1U6AL 1CGXA 5DK2B 3D87B 4UV7H 3VXMD 2DAVA 3SGEI 3T0BA 4KMQA 2IPTH 1NLDH 3PWPB 3VXUD 2C3XA 1TZHB 2OJZL 3NVQA 3S5LA 3IYLW 1IM3B 4XCCH 3EOTH 2EYRA 3QCUL 1GIGH 1FJ1B 4HKZB 2P24B 3CSGA 4GAJL 3L1OL 4MCZB 3MLSL 3L3DA 5CP7B 3MUZ1 3U4BL 3RL2A 3BHBB 5IVOA 4OGAD 2VSDA 3IJSB 4YDKH 4JJ5A 4Z77A 4LAQH 5F72S 4GRWB 3NFSH 4Y2DC 1YEFH 4P4RA 1FNSH 5E8NB 3NAAL 3BPOC 2NYYD 2EDNA 5CJOL 5BCAA 5A2IH 3TVMB 4UMGA 3FQRB 4LCIL 4NDMB 1FORH 4JKWA 4KI5F 1KV3A 3HE7D 3RL1B 2JK5A 2X9WA 3MRHB 3D69B 3C60B 4FTVD 4O02H 3AM8A 2UUDK 3MV8A 4C58B 4P2QD 4XP6H 1HYRC 2C9AA 1BD2A 2N7BA 2AXFA 2ESVD 4M6AA 2BVUA 32C2B 1Y0LA 1GC1C 3FFCD 5KTEH 4U1LA 3GBML 1U8PA 1WWCA 5GZOC 1SM3L 4G43A 4NGHL 1CGUA 4ZS7L 2NPLX 4K3DL 1WK0A 2C4FU 2AS5M 5GZND 2BNQB 3AUVA 4UUJA 4F2MB 2E9BA 2NLJA 2FL5B 2I07A 4OLVL 2VRAA 3RWDA 1CXLA 5CEXA 5D2NC 5K9JL 1MVFA 4HUNB 3SEPA 4LIQE 4DKFL 1R5WA 1ZLSL 3GHBH 2BC4B 2WAHA 2R56L 4APQB 2JB6B 3ARGC 2AXJA 1JWUA 1KGCE 3H3BC 3SE8L 1AIFA 3O45B 3GHEL 3BJ91 4LSPH 4WEBH 3HR6A 1NJ9A 4XMKH 4IDLA 3MLTB 1G7LA 1BHGA 4P23C 4Z78B 2Y36L 3MSPA 4L3CA 2Z31A 1MFAH 2L7JA 2P8MA 5DFWH 5KS9E 2J1KA 4UT7H 5D7SH 1JHTB 1N4XH 4XNXH 3UX9B 3AS0A 3MROA 4E0RB 3BW9B 4HGKC 4P5MA 3ULVL 2MPAH 2LU4A 3NACL 4CNIB 4OZIF 4YXHL 1G7IA 3AFLA 4GUPB 5A1AA 1GC1L 4XXCC 3B2VL 4K2UL 4ZXBC 3MA9H 3WD5H 5EU4A 1TETL 5C6TH 4DK3A 1T66D 4YHPB 3TBWB 3JWDL 4RA0C 3EJJX 4Z7NE 1MFDL 1OSPL 1E6JL 4YIQA 2FO4B 1PKQA 5SWZD 4BKLA 3S5LB 2UUDH 4EIGB 1LO3H 3O6FD 4OZGF 4FFWD 4XAKD 5DEZA 2EYRB 5T3ZL 1T2XA 3I3DA 1MVUA 1CLYL 2QJDA 2VLJA 1KYOK 5LAXA 3RL2B 5BV7B 3L3HA 3VD7A 4LU5H 3O3UN 4LARL 4Z77B 1LP9E 2GHWB 1IQDA 1YEKH 4P4RB 3CFIC 4LNVA 1VHPA 5IQ9A 5I1CH 2EDYA 2R2EA 1JZ3A 2ZUYA 4LCCA 1P9MC 1YUHA 3MLWH 5J06A 4JDZA 5EU7E 4JQVA 5SV3A 4EIZC 2P7TA 5F1SA 2NY2D 4JZNA 5EORH 1RQ5A 2JK5B 4XNUH 1MLCA 1KEGL 3MREA 4J23A 4KDTC 3JXAA 5IB1A 1EEQA 1KGCD 4U05A 1BX2A 3MV8B 4JFQA 1N26A 1U95A 1QBML 3OGOE 1BD2B 1SEQH 2AXFB 5IBTH 4BH7A 4NQSA 4U6XA 1OTSD 3RWHA 4K71B 4Z8FH 4ZSOA 5DS8B 2EH8L 3VXSD 1EEUA 1P4IH 4U1LB 3OJMB 3VE0B 3HFML 4GQPH 4G43B 5MEPA 4X6DF 1X5AA 1DLFH 1A2YA 4K3EH 4JFZL 4XX1E 4UUJB 3QXTA 5L88H 1R3HA 2AJSH 4XVUD 4M9OA 2J7LA 2NLJB 3OKDA 5T1DL 3O4OB 3RWDB 5CEXB 1EZVY 1BQLH 1R5WB 4HF5L 4WWKC 1U92B 3GSNL 5F96L 1JWUB 4UDTB 3H42L 2Z8RA 2ZSVA 4OLZL 3QDHA 1AGDA 2X1XR 5DC9B 4RSVA 2X09A 4R96A 2RHEA 1G7LB 1KJMB 3C08L 1LE5A 4ONFH 4DGIL 4L3CB 1DBKH 1BM3L 2NCMA 2VXVH 2P8MB 3UYOD 1UCBL 4NBYB 1FVDA 4XNZB 1H3WM 4YHOH 2XRAL 1N5AA 3MROB 4P5MB 4B5EA 1G7IB 1MCHA 5FYLE 4K8RD 4WI4A 3O2VL 1TQBB 4PRIE 1MRCH 2J88L 2VDKL 5FA3A 3QPXL 5EU4B 4ESKA 1QR1A 1BIHA 3GNMH 5IW3A 3N1FC 4YBLC 4PLJC 4MWFA 3S8WA 3BRFA 1AQKL 2FH6A 3VMNA 2UZIH 5JHDA 2XPGA 3B9KD 4LIQH 5A3IC 5C2BL 4YIQB 1Z3GH 2HT3C 2R0ZH 4UV4H 3NIFE 4BKLB 5EO9A 3ZYIA 1X5XA 2HJKA 2QLVB 2V17H 2IF7A 3N85H 3CDGA 3RY6A 3ZYJA 1MVUB 2BRRH 2B0SL 2VLJB 2YRLA 5L6YL 4Q58C 5LAXB 1FAIL 3TBSB 2XZCL 3L3HB 3U30B 5E2WH 3NCYS 1P4BL 5I19L 1NMBH 1IQDB 1NC4D 4OQ1A 1VFMA 2E9IA 1NCAH 2DI8A 2ZCKH 4KRLB 5IQ9B 2R2EB 4Q0XH 4HGMA 3MOBL 1FZJA 1NFDF 1YUHB 5ICZA 4JDZB 5CMAA 4EDXB 1JZ4A 4HK3J 2P7TB 4JZNB 1CL7I 4RAHA 3M1BA 3X14A 1MLCB 4S1DD 3UC0H 4RWHA 5E2TH 5IB1B 2LFGA 1DR9A 3BQUC 3QIWC 3K4ZA 4RWYL 3ZDYE 3DV6A 1BX2B 5CEYA 1IC5H 2CJUL 5KSAA 4JFQB 1U95B 4ZOEA 1CFBA 1IEHA 4WO4D 2K9UA 1KPVA 5FO9A 1MJ7H 3EYSL 3L5HA 4NQSB 1EEZA 5FGCB 2ZUSA 1HNGA 4U6XB 3RWHB 4PJAE 3WV0A 5B38A 4ZSOB 3KS0J 3M07A 4Z7QE 4LEXL 4OF0A 3JWOC 4BZ2L 1Z0NA 1QQDA 5DRXB 5FYLD 1OLLA 4Q74A 5MEPB 1Q94A 3WLWC 4PRID 3EOYG 1RIUH 4XCYA 1A2YB 4CL7A 5C0CA 1R3HB 5J1TC 4K8RH 3RA7H 3OKDB 4V1DA 3O6KL 2BOBA 1IKFL 1C12A 2XTJC 1CGSH 4X98B 3I9GH 2ZSVB 4YQXL 5FK9A 4R96B 3MLYH 4D2NA 1FC2D 2Y5TA 3CGTA 3IJHA 5C9JA 1FVDB 3O3BA 1N5AB 5E5UB 1XF5A 4DGYL 4K9EH 4ETYA 4JFYA 2XN9A 4K7PL 1DBMH 4J3VA 1YECH 4BSJA 1NCBL 4GSDH 5FA3B 2IPUK 4X4YA 1QR1B 3WDIA 5CS7A 4GRLC 2Y06H 5JHDB 4Z7VE 2AV7A 3ZKXB 3D39E 3RWEA 3QDME 1A7NH 4J4PC 1T3FA 3VFPA 1IGML 2KUTA 1T2QL 5EO9B 3UZQA 2HJKB 3PQYE 4NFDA 3CDGB 3BP6B 2ZNXA 3KNBB 3LDBB 3MUGA 3TA3A 5EO0A 4WI6A 1TCMA 3MBXH 2BERA 4I3GA 4XX1G 1HE7A 1EO8H 1IAIL 1F3JB 1U41A 1T83A 4PJXE 1XCQB 4CUCA 3GSXA 1GPOH 3CFJA 1SEBA 3QISA 1I9IH 3EO1A 4X4MA 2GAZA 4NO5A 3S3PA 4D94A 1WT5A 2ICWA 1FZJB 5ICZB 1KF9B 2BK8A 5CMAB 1VEMA 2HKHH 4XPAL 4LKCA 4OFYD 4BZYA 5HVHC 4X9HA 1CFTA 3JV5A 3BGFB 1U8NA 3M1BB 3HKFA 2OCFD 4PP1D 1AJ7L 5DJ6A 4TSBL 3X14B 3ZKNC 4RA3A 2V5TA 2IPKA 2O5XH 3DMMA 3DOSA 3DV6B 5KSAB 2XA3A 4D3CL 4P2CG 1KPVB 5FO9B 1OQXA 1QNZH 3CVIL 2WINB 1EEZB 1YZZA 3QXUA 5B38B 5ACLA 5LWYH 1HQ4A 3HB3C 4XMLL 2APFA 1HDMA 3HRPA 3NABH 3OL2A 2YXFA 2GIYA 4LSQL 5I76A 3RTQA 1QQDB 4H1LH 5ID1A 5LGJA 2CO6B 5HTSA 3MNVA 4XCYB 2DMBA 3T09A 3TT3H 3QIUC 5F7KC 3MCKA 5C0CB 1LGVA 2B1AH 2KDGA 2E7HA 3D39D 1UXSB 3QDMD 2BOBB 1LO4L 1C12B 4ONGL 1TITA 3HG1A 4K3GA 2HLFD 2YD6A 2YZ8A 5GGTA 4LVNC 1DEEA 1LK3H 3PQYD 2P44B 3QEGH 3HUJA 1FYHB 3TWCH 1B2WL 4KI5E 4NJAL 4HWZA 4R26H 4OM1H 3V4PH 3BRGC 4KRMB 2GW5A 3IJHB 1J0JA 5C9JB 4JPVL 3VRJB 3O3BB 1M71A 1XF5B 4G7VH 5T1LA 1V3MA 3F8UB 4JRXE 4OIBA 5DD1L 2IPUG 1N0XL 3KAAA 4JFYB 4RCAA 4BFEA 4E41E 3GSOB 2XN9B 1VSCA 2MTPA 1KIPA 1GCFA 2LVCA 3DUUA 4DOHE 4FFZL 3ECBA 3KPSD 4X4YB 2C7UA 3ARTA 2EKSA 1ZK9A 2GK0A 2AV7B 3DECA 1U8LA 3G9VA 3RWEB 3L7FA 3VFPB 1T3FB 1TCRA 1IRAY 2DYPA 2FHCA 5ECJE 4K3HA 3QUYC 3BKYH 1T5WA 1FNGA 1HIMH 4RFNC 3MUGB 2A6DB 4ZO9A 5EO0B 4HJJH 1FGNH 2K7PA 1QR4A 4H88L 4JB9H 3V7MA 1MHEB 2NQCA 5FM5M 2KQMA 5AEAA 1W72H 3GSXB 3GB7B 5FF6B 3CFJB 1SEBB 4F7PB 2GAZB 4NO5B 4BH7B 4KWUA 2ICWB 2HH0H 3C2AL 1KFAL 4JM4H 4F3FA 2Q3AA 1AHWC 4LKCB 1KN4H 1U8NB 1OM3H 5DJ6B 1X6NA <