1XGRB

Structure for antibody hyhel-63 y33i mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
AVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDIWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB02
4BFIA 1ZWIA 3HR5B 3CSBA 3HRZA 3SDXB 3VFMA 2JKXA 3SCMA 3SE8L 2VYRE 5DA0B 3BEWA 3BKYH 2Z35B 4FFWC 3QUXD 4P2QE 3U82B 5EU4A 2VIRA 5HHMB 3QQ4B 4HUXA 5J8OA 3TT3L 1NH6A 2HH0H 3EDJA 2IAMD 4MHHG 4X6CF 1MFBH 4LCUA 3VXOB 3GFUA 4NQEB 2NY1B 1R0AH 3RTQC 4GBXA 1R24B 1QLRA 2XNAB 5E94A 5ISZA 5IIEB 2VXUH 3FONA 4EUPB 4PLKC 4MSWB 2ICCA 2P24B 4BH7A 3L3HA 3MYJB 4FZ8H 3VXSB 1FCGA 1RUKL 4LQFH 5DJXB 4ZFZA 4X8XA 2EH7L 5ENWB 3P9LA 4IRSA 4FFWD 4G7YL 3WFCL 4YDLB 3DYPA 4JRWA 2PUQT 4MQXD 4P2RE 2ILLA 1PD6A 4G42B 5IBUG 3NABL 3T4YB 5C7XH 4XBPA 2NY4B 1S3KL 3O45B 4U33A 2WK2A 4F7PB 1E0OB 1AGBB 3NVQA 3RTQD 3AROA 5IMOB 2W9EH 1U8PA 2DQIL 2QR0A 4YGVA 4RQQA 4Z0XB 3SKNA 1R3IL 3MNVB 3O6MH 3R06B 1OTUC 3LN9A 5M94B 2HJKA 3FQTA 4RMQA 2HFFA 4P46B 3WHXB 5FO9B 4HS3A 2HT3D 5DXWA 5C9JA 5E2TL 4UU9B 1BJ1H 3CLFH 3CSYB 1AC0A 2ZPKH 4U49A 2WIIA 4G80A 1LO3L 3ULUH 2F5BL 1M05B 4TRPL 1QR1A 3OAZK 4WU7B 2Y07L 1AQKL 5GS2H 2V2XB 1A6PA 4BK5A 3I84A 1I1AC 3O9WA 4ZXBA 4S1DC 3O2WH 2LAGB 5DVKA 4JAMA 3KWWB 2BSTB 3VXRA 4LSUL 1IRAY 1OTUD 3C2AH 1J1OH 4MCYB 2K3TA 1FJ1A 1V3MA 3LHPH 1BWMA 3LSOB 2D0GA 1FV1B 4EDWH 2YD7A 3EJZC 3LQZB 4BKLB 4B7LA 3W5NA 5D8JH 2EDLA 4MXVE 3BMWA 3FO2B 1WV7T 4TNWF 1QLEH 3ARFC 1OGAD 1HEZA 4NZJA 4U0RC 5KANG 4JRYE 4PJIB 4B53A 4U4BA 2VDPH 1NFDA 4AZ8A 5IGXH 3DWTA 3N06B 4MMXC 3ZT5A 4EDXA 3ESUF 4FTVB 1RIVH 2GW5A 4ZOEA 1W0VA 2XRAH 4U31A 5KAQG 3FB6A 5IFJB 1RFDL 4KRMB 3VGAB 3GO1L 1YC7A 4MA3B 3OG6B 3ARBD 2C3XA 5MI0B 2X44D 4KK5D 1KIRB 4YE4H 3B9KB 1FG2A 3KYNA 3FO9A 3P77A 5AYUH 4NQSA 1F2QA 1F6LL 1RHFA 3ARGB 4PJ7E 5GGQH 3RL1A 1YEDA 1CTOA 5E1AA 3QH3A 4XPTH 3RGVB 1UG9A 4HKZA 4JG0H 4M7JL 3TBYA 1U6AL 3TBTA 4AJ0A 5D7LE 1OTSC 5J56B 4U7SA 4NKOA 2CJUL 3LCYA 3IFOB 4J6RL 2OR7A 1P4IL 1RI8A 1XZ0A 2VDLL 5DLMH 1Z9OA 1A4KA 2IPUK 4OD2B 3SDCA 2X9WA 4G8EA 2CIIA 5C71A 1KFAL 5E99H 1MI5E 5DC0A 1MLCA 5LAXA 2UWEF 2F9BT 3MRHA 1WC7B 4MJ4A 1A7NL 2UZYB 5FGSA 4ETQA 3KXFD 4ZFOB 3QPQD 4M7ZC 3X17A 3K74B 4DQOH 5IF0A 4P2YA 3QA3B 2OLDA 5IMLA 1HH9A 3MROB 4R7NB 4LU5H 5DD1H 2H1PL 4PJDE 2E7CA 3RDTA 1JPSH 1XGRB 3VH8A 2NNAB 3F58H 1WBZB 4IMKA 2NX5D 5T3ZE 3QRGL 1P1ZB 1RJYB 2O5XL 2DMKA 1SEQL 5BO1H 2AJSH 3HZMA 3B6SA 3UTSE 3PABA 2QKIB 5KSUB 1TJGL 2KZ1B 4X4ME 4LLVA 4X5XA 1Z0NA 2APXA 3S35H 4M1GL 2GJ6B 4NZUH 5EU5A 5FOBB 3WS3A 3EJYD 4PV9A 1TIUA 1IQDB 3SKJL 1J8KA 4QXTA 2HN7A 4QRQA 3ZE0E 1B0RA 4M6OH 3H42H 4NM8L 1SVZA 1BVLB 1A22B 2WLZA 2A38A 4N8VB 1N5AA 1WWCA 2F54A 2FB4H 4LMQE 5I0ZA 5AG9A 3V5KA 5DD0H 5J6HB 3RRQA 3RVTC 5CMAB 1FAIL 2VDNH 3HC3H 3KYMB 5I2IA 1U93B 4GKNA 3VFGH 3QNZB 1T5WB 5CEYA 4V1DA 4OI7A 1ADQH 1YNTB 2AJYH 5F7KC 1FL6A 3B2UC 1A6UL 4HUUA 5HHOE 1INEH 5B3NA 5IB3B 3MBXH 5LJYH 1W72B 3MV9B 3TWCH 2DLIA 1OGTA 4MNHA 2Q87A 3HLAB 4M43L 2FDBP 4FQCL 5AAWA 5DMGC 1KELL 4WTZG 2Q76A 3PWNB 3FQWA 4EXKA 5LBSL 3CDGA 1MFAH 5FF6B 3GSUA 4X8JA 1A6WH 3MJ8A 4I2XB 2YBRA 5F8RC 1RK1A 5GS0C 4UINL 3MRQB 2HLFC 3BUTA 3MRGB 1YZZA 3MXVH 5DFVD 3O3BA 3ILPB 4G6FB 3KPSB 3CXDL 1I7TB 1D6VH 4WENB 3ZT7A 3DLQR 1IZJA 4RFOL 2OSLA 3MFFA 5DMGD 2D7TL 4LHUB 3U7YH 3JUZA 3NTCH 3ARUA 4X5LA 1AI1L 1QACA 4HIIB 4ZQKA 3L7EB 1I4FB 3LEYL 5A2FA 3I6LE 4PB0L 5GS0D 4F3FA 2PXYC 4LF3A 1CLYH 4AEIH 4R8WH 1RZJL 2HLFD 1DDHB 5CUSH 5K9OB 2MHAA 3IGAA 1AGDB 3TC9A 1BMGA 1T03H 1QFHA 2Z8WC 4XPAL 2VITA 2AERT 4XCYA 1YN6B 5JA8B 1QEWB 2EXWC 1GYAA 2NYYD 5I75C 2R1YA 3AMLA 2NY6C 3MRBB 5TE4L 1CDBA 1BZ9B 4I3RH 4WV1A 1CBVH 3TPUB 3P4LA 5IEKA 4HMCA 3DECA 1AO7D 4NHUA 2E8YA 4TULH 3UPRA 5T1DH 4HD9A 2M2DA 4KU1A 3MACH 1EEQA 3QUML 1A7OH 2R4RL 2JIXA 5EBMA 2AJ3B 1M7IA 3N1FC 3SQOH 1E6OH 3PXJA 4P2OC 3E6HA 1CQYA 4HJ0C 4UV7H 4L3AA 4NKMA 4G8FB 2IANB 1VGKA 1CICC 3O4LE 4KHXL 3WN5A 3BKML 1DCLA 3DXAE 3A6CH 4RAHA 3ZE2E 43C9B 5JHDB 2BNUA 5DRZB 3N85L 1J0IA 1QA9B 5TF0A 3L3OA 1KTDB 2AXJA 2PYFB 4P59L 5KVDH 1CCZA 1GC1H 2Y06L 3WYRA 4TNWK 3ZLQC 3SGEH 3BAEL 1T7WA 3NA9H 4X4YA 2AJUH 4GAYA 3JTTB 1S9KC 3NIGF 1KLUB 4IRJC 3QUMA 1BOGA 3RWEB 4HJ0D 3KYOB 4OQTA 3O41A 4PLNC 2BNRD 4H0GA 3ARBA 4NQVA 1KCUH 1U8OB 1U8QA 3QG7H 5IHUH 1FZJB 4U6HB 2NY3C 4TVSa 3GGWB 3WLWD 3U2SA 1TNNA 5JO5A 1J1XH 4Q0XL 4NUGL 5DJ6A 3HZVB 1MJUH 3MLUH 3BIKA 1VENA 5HGAA 3X14B 1UB6B 3EOTL 4WU5A 3H3BC 1F4YH 3GMLB 1N6QH 2X4NA 4MGXA 1NKRA 2GAZB 4L9DA 3MJ7B 4F2MB 4JRXB 2KPNA 2YD9A 4QKXB 3W82A 2WM0A 2VMFA 1EGJH 4DTGH 2OZ4H 2G9HB 1DBAL 4I0KA 3B5GA 3SQBA 4JPVL 4BUGA 3X3FL 3CVIL 5E1HB 4JPKH 2L0DA 4XP9L 1GGCL 1BEYH 3RUGB 4JGMA 3TBVB 2QTEA 5KTEL 2EDDA 3FHAA 4NPYA 5EUKB 4Z7NE 3UJIL 3DUSA 1KNOA 2IJ0C 3R0MA 4YZFE 4WEMB 1CFBA 3I6KB 4WJ5B 1HKFA 2G75B 3KXFA 4CJ0A 4K9EH 1X5GA 2K9UA 4H26B 1C5DB 2BVTA 4OAWB 2ED8A 2OMBA 4LVHC 5GZND 4WWKC 3SO3B 5FA4B 4ODTL 3C2SA 3PHOB 4L8CA 3GSXA 2CDGB 5I1DB 2NX5A 4MYWB 1WAAA 3QQNA 4U1JA 1LO5B 5DEGB 4I48A 2O5YL 4LSPH 4NO2A 4WW2A 4QHMA 5JDSA 4Z77A 3OXSB 5J1TC 4JM2A 1YY8B 4XP4H 1CLOH 3QEUA 5KSBF 2CO7B 3PWVA 3V0AC 3DO3A 5CJXC 4BFBD 1FN4B 1CL7H 4APQC 4EI6B 2CXKA 2X4OB 3IDYC 5AZEL 3Q2CA 1CZ8L 5GGSA 1EDQA 2DRUA 4AL8H 4UB0H 4WWKD 1J8HD 1U36A 3UJTL 4LLDA 2DDQL 3EYOA 2A77L 3BEWB 1MY5A 3H7BB 4Q9CA 4X9GA 3DGCR 3MLZH 4H0HB 5EU4B 5HHME 4N0UB 4K3EL 5C6TL 2VIRB 3V6OE 4HUXB 2R2HB 1T2QH 5TE6H 2UZIL 1BIHA 1DQTA 4D0DB 4LCUB 2EDKA 4NQEE 1A1MA 1QYGH 4C83B 3MRDB 1U8IA 4MLIA 1KEMH 1TITA 1WVZA 3G5YA 4GBXB 1AGFA 2QHRL 3IT8D 1QLRB 4OFDA 5TDOB 1KJMB 5E94B 1CVSC 4O58H 2FGWH 4X6DB 5F7LB 5KW9H 2C4FT 2X1OA 4OF8A 1QFPA 4NRXA 1CXIA 4BH7B 4PB9H 3L3HB 5SX5K 1EXUA 5HYQB 5J11B 4KDVA 3BH9B 4UQ2A 4ZFZB 1YMMD 2AXFA 4IRSB 5ELIA 1VEOA 1OPGL 3LRHA 4K7PL 2OXGA 2FR4A 3U0TA 4YFDB 5C9KA 2IFGA 2W0LA 4PJHB 1NDMA 4XBPB 5DI8A 1KLGA 3LD8B 2FEEI 1I9IL 1R3HB 5GRUH 4LIQE 1LO0L 4JDVA 3F8UB 5F44A 5CKGA 2DI8A 4X7EC 3TVMC 1CGUA 2FZ3A 3L3JA 1U8PB 5D96B 4NQCB 5HI4C 3OSKA 2HFTA 4YC2B 4XC3H 2XFXB 4N5UA 5CEZD 5T3XE 5DHVH 2HFFB 1OAZL 1NAKL 2NXZB 3MYZA 4UDTA 4HS3B 1IAIL 1LMKA 4ZS7L 3BQUC 4I3GA 1P7HL 2XZAL 1I9RL 4G80B 2J1KA 5LGHH 3RNQA 1UH2A 2MTPA 2OP4L 4JN1L 4DWHA 3TNNA 1OLZA 1NC4D 4HXBL 1Q38A 4N90E 1JIBA 4J3UA 3QUYC 4OT1H 4Z8FL 2DN7A 4UMGA 5DJ2B 1Y0LA 5F1NB 4I13B 4KQ3L 2R0ZH 5HI4D 2D9QB 2H26B 1QZ1A 2LV4A 5IR1A 3VXRB 4X0KB 1JRHH 4TSAL 1MRCH 1QKZL 2BOBB 4JHAL 1XCQA 1BX2A 3TH4T 1AO7A 4YO0A 3BQUD 3K0WA 5ESVA 5CP7B 4QWWC 3QHZL 3BP4A 4PJIE 5D6DA 4XNXL 3HAEH 3ZDYE 3G6JA 5K9JL 1E4XL 3LKRA 2A9ML 5EO0B 1NFDB 4JJ5B 3N50A 4Z7VB 5CD5C 1BQSA 4RFEA 4M5YH 1I1FB 4U1MB 1NLBH 1JWUA 1W0VB 2DQUH 4LKCA 4KKBC 4AG4L 5HVFB 4FZEH 4KPHH 1KYOK 4KI5D 5GGVY 3UPAA 4MNQB 5E2WH 1NEZA 4LCCC 5MEOA 1OP3K 3V6ZB 4OGYL 5B8CA 2VDML 1MIML 1BVKA 2WV3A 4JY4B 4N5ED 2V17H 4Y5YB 1FG2B 3KYNB 3RY6A 4P5TC 2XPGA 2BX5A 4OD1L 2Y5TA 4P9ML 3IDUA 3U7WL 3RL1B 2EEAA 4JB9L 1LK2A 5IQ9A 5E1AB 3NCJL 5FAAA 5JW3L 3QI9B 1HKLL 4OCMC 1A5FL 3DX9A 4HKZB 5DMYA 3RVVD 1EH9A 2BNRA 35C8L 1BQHA 3UTOA 2D03H 4HKBB 3RY5A 4MB3A 4WFGD 5DQ9B 4MD0B 3MUGA 4P3DA 3ULUC 2XG4A 3RBSA 5DJDB 2AK1H 3B5TA 4K94L 3VXPA 3VCLA 3OKOB 3OF6D 2QSTA 1HXYA 2HG5A 2A74A 1XGQA 3DVFA 2BOCA 4I8DA 4DGYL 5LAXB 3OR7A 5C0CA 1NGZA 2ZCHL 1F90L 5IF0B 2R8SH 4WHYH 1UZ6E 4KGLA 1WJ3A 1HH9B 2W92A 4K2UH 1WFTA 4WY7H 2HLAA 3T08A 3NPSB 4PJFF 2FECI 1PKQA 3IKKA 1DP0A 4Y4HC 4YH6A 1XEDA 2BCKB 5D7KE 4JKPL 5GRJL 4OFYD 4R97B 3ULUD 1EPFA 3O6FB 4GG6B 4LBEA 25C8L 2GUOA 5EPMA 1AFVH 1CGWA 1XF1A 4L3CA 3VXUB 3MCG1 1NSNL 2YUXA 3U4AA 2A6IB 5GS2D 3EBAA 1ZHBB 5EU6D 1NEZG 3B9EA 3DI2B 1GJIA 4O02H 1N4XL 3B8SA 2HFEB 4QRQB 3THMH 3AY4A 3MLSL 3L5HA 1OY3B 1IZKA 3UTPE 5DJYB 5CZVL 5CS7A 2I5YL 3OTTA 3TBWB 2FL5B 1FQ9C 4NN5B 1X5YA 3MPCA 1S9WB 1N5AB 2VJXA 5F93C 2F54B 2A6JA 5IFAH 1TVBA 2AV7B 1G6RL 4PP2B 5EUOF 1WZKA 5IHBA 4HC1L 5I8EA 1Q9OA 5I2IB 2EC9U 4WI6A 1RZ8B 2OR8A 3BWAA 2GK0B 5CEYB 5FUZH 1FVCA 2DYPD 4WGVB 4N9OB 3ULSB 3VA6A 1IGCH 4D0BA 4Y0GA 3KAAA 2OJZL 3MV9E 1X5LA 5E8PA 1J8HA 4JGJA 3T3PE 3GMPB 3PDOA 2YUWA 2ATPA 5DJAA 3O3EA 4H1LH 4Z9KB 3QUXB 5HJ3A 3HE6C 5BVJB 2Q76B 2ZOLA 4GW5A 3FQWB 2IAMB 1C8PA 3CDGB 1CGSH 1A6TA 3GSUB 4N9GA 1KACB 3CNKA 4I2XE 1LEGA 1F42A 3OWEA 4M4RA 5KS9A 3QEQD 4LSSH 2H32A 3DHJA 3VDBA 4DN3H 4HWEL 3NPZB 3OJDA 4PJCF 3KPSE 1HZHH 5EA0H 1CGYA 2CH8A 1Q9WB 4XCFL 4U1GC 1G6RA 1N59B 2DKUA 1JFQL 5LWYH 3CH8A 4HC1A 1YMMA 2QEJA 2IFFL 1QNZH 4QXUH 3MJ9L 1BHGA 5F7UA 2OSLB 3FMGL 3HE6D 4OFKA 1MFEH 2D7MA 4PJXB 4EKXA 3QWQB 3HUJA 3GHEL 5E70A 4XMLL 4RMTA 3RTQB 4LF3B 1E28B 3JZ7A 3ILQC 1RZGA 4YFLF 4ZUVB 1IQWH 3W81A 1JGLH 2ZG3A 3HKFA 3HNSH 4U1NB 5GRWA 4QCIA 3WFBL 4HPYL 9CGTA 5HI3C 4W4OC 1NCWL 3MR9A 4ACPA 1HQRA 1ZHLA 2DQFA 5GGUA 2UVEA 2FH6A 4B50A 1ZSDB 1VKXB 1GRWA 1WBXA 2R1YB 4JANA 3CSPA 1VFBB 4YPJA 3PWJA 1SJHA 4HULB 1QOKA 4WV1B 2FX8L 4NQUA 1MCJA 5JLZA 2BY3A 4RFNC 1HINL 2J5LC 1KTRL 4RGOH 4NHUB 3UPRB 3SDYH 2VQ1A 2Q86A 1UFUA 3K8LA 4X6BB 3BKYL 3MJ9A 4TOYH 3DROA 1M7IB 3FRUA 4AENA 1WIOA 2M8XA 1YNKL 4OZFG 3GSRB 1MFBL 1ZGLP 4Y4FD 1P7KA 4OGAC 1I7RA 1R0AL 3SGDI 3NN8A 3S4SG 1G7QA 2IANE 32C2A 4NKMB 2YWYA 3U4EA 1C12A 1VGKB 1OGAB 4FZ8L 4AEHH 4NIKB 1UWXH 4LQFL 1FZMB 3BP6A 1KJVA 2AP2A 2WNGA 4J1UA 5EORL 1FNFA 3S5LA 1JGDA 1I1AB 4ODHH 3L3OB 2V7NA 5BV7C 4LHUG 4EI5A 1RJZA 5JIHA 1RMFH 4NQXB 5C7XL 3FQXB 2YRPA 5E9DD 1HHHA 2V2TB 5FKPB 5GZOD 3S88H 3PNWA 4L4TD 1L0QA 3QUMB 1BOGB 4RAVA 2W9EL 2OK0H 3BHBB 3DMMC 5KN5A 3O11B 1U8KB 3O41B 3CX2A 4MXVF 1A1NA 4J23A 3K4ZA 4KKLC 3ARBB 3RWCB 4NQVB 3O6ML 1U8QB 3D3VA 4U0RB 4NT6B 5MEND 2EXYD 5BZWB 2HFGH 5FO8A 4MZ2A 3GZKA 4X4XB 4HGMA 3GHBH 5JO5B 5I15H 2Z31D 5T5NF 1RHHA 3SKOA 2ZPKL 3MLRH 4PS4H 3KLHD 5DJZA 5HGAB 5FV1L 4NN7B 2XACC 1K3ZA 1DUZA 4JRXE 4GT7A 5CGYD 4HWZB 4M7LL 3FO0H 4MMZC 3FFDA 3O2WL 1G7PB 3C6LC 2K7PA 1R3KB 3LQAC 4UQ3B 1X5JA 5FYJU 1S78C 4O2FA 2WWKO 3GSOB 4KKLD 1IAMA 2RB8A 1RZKC 2DQHH 2AGJH 1J1OL 3C2AL 4ZAKC 1HXMB 3P30H 3LHPL 2WP3T 4EDWL 1A0QH 1ZV5A 1FIGH 3X12A 3MRMA 1IMHC 4PY8J 1KNOB 2P48B 2MQCA 5D8JL 1D6EB 1QVOB 3KXFB 1QLEL 4Y8AA 3L9RA 4PJ7F 2OR9H 4N68A 4DFIA 4JZOB 1EZVX 4H8WH 5TE7H 1BM3H 4XVSH 2VDPL 1QBMH 3NFPB 5IGXL 4UIKH 3D87B 3HNVH 4L8CB 3GSXB 2NX5B 4MB4A 1RIVL 4HS8L 3RWFA 4QHMB 4ZAKD 2GY7B 2GTWB 4NKQB 4C57C 3OJMB 1DVFC 2LFGA 2P5ED 1IM3A 5J13C 4J3SA 4MB5A 3KPOA 3P4OA 3UP1A 1U8JB 3H8NA 4MD5B 4M7ZB 1ZK9A 4XVJH 5DD6B 2BVOA 3MLXH 5GRVK 4YE4L 4LLDB 3EYOB 2YD6A 3MRCA 1MOEA 4HAFA 4PJDF 1CYGA 2ICWA 2OX5A 3EGSA 5AYUL 5CWSB 5TDNA 3VWJD 1HHJB 5GGQL 1OQXA 3V5HB 4U3HA 5E00A 2OTUA 3D0LA 1HWHB 3DSFH 1B6UA 4JG0L 4X9BA 1FDLH 2XTJC 3BWUC 1U8IB 3TF7C 1AGFB 5ISZE 4DJMA 1JZ3A 2UY6A 1ZT1B 4QRUB 5I0DA 2VLLA 4ZNCD 5DLML 4V2CB 5IB5B 3U0WL 3QPXH 2VUYA 4NRXB 4OCRH 3UJJH 1EXUB 3JWOH 5E4EC 1K6QL 4KWUA 3UZQA 1C5BH 2XXMB 5C08D 4BZ2H 2AXFB 3IU3B 5E99L 4Z78B 4KUCF 3VFWA 1UCTA 3E2HC 1VERA 5JHLH 2YD5A 4DQOL 3M17A 3U0TB 1T0MB 2FR4B 4PJHE 2Y6SC 1F4XH 3QEQA 5DI8B 1FLRH 4LU5L 4ZFGH 5DD1L 1JPSL 1JYXA 1I1YA 3BGFC 3F58L 5CJBA 4NQCE 2FZ3B 5C0AA 4LLYA 3LPGA 1I8MA 4YHPB 5IV2A 4XNYL 3O2VH 2X4UA 3VG0H 1A2YA 3S35L 5IP4A 3BZ4B 4HWBH 4ONHB 4ZOAA 3EJJX 43CAA 1CT8A 2H8PA 3D18B 1EHLH 2Y6SD 4EBQH 4M6OL 3H42L 4MA7H 5F3HA 1NCDL 3FHQA 4F7CB 3KLAB 1PY4A 1NCBH 3CH1A 3TNNB 1T66D 4ONGL 1ED3A 5DEFB 3QRFM 1VADB 2FB4L 1Y0LB 5AYQA 3R1GL 5DD0L 4NC2B 3VXRE 1ZT4A 3UCRA 2R2CA 5C2UB 5F1KC 3HC3L 5ETUB 1PVHA 3JV5A 3VFGL 2UVFA 4OLZH 4YXLH 3QFDA 1ADQL 5C0GA 4LNRA 2IBZY 1XCQB 2JJTC 4M61A 1RZFH 3MV8D 1BX2B 1INEL 1AO7B 1EHAA 4YO0B 3KLDA 3MBXL 2DMCA 1CXFA 1UH3A 3S96B 3TWCL 5ESVB 4NRYA 1CGXA 5C07D 5BVPL 3MRNA 1MCOH 1RURH 4M1CC 5CFHA 2VZOA 1S7RA 1KCSH 1NFDE 5L8LB 4Z7VE 3RWHA 1VA9A 1MFAL 3IDGA 3E0GA 4JO1H 4ZS6C 1UM5H 4LEXH 4Y4FA 1A6WL 4AIOA 2BHYA 5I75B 4LKCB 3P11H 4OB5H 1T20B 4DZ8A 2C1PA 4JFOA 3QXAB 3QYCA 1RQ5A 4XXCC 4X99B 3P9WB 3MXVL 5I8CA 4KUZH 4JCMA 1DZBA 5MEOB 1ZGLA 1KT2B 1FZOA 4HUNB 4U1HA 4JFXA 1BJ8A 3FN9A 4M1CD 4P3WA 5E6IC 4MS8C 5BRZD 1BVKB 2GK2A 3ZDZE 4Y4KC 1ADQA 4L3EA 3NTCL 3GKZA 1A02N 4OLEA 5I9QC 2XPGB 2Y5TB 5E9DA 2NY0C 5FYJL 3ZHDA 1LK2B 4QOKA 1CLYL 4JZJA 2XZQH 1TQCC 1S7SA 4AEIL 4R8WL 3DX9B 4HG4K 5CUSL 4S1QH 3SGJC 1AXSB 1T03L 2BNRB 1BQHB 1G7IA 3C5JA 2CMRH 3UPCA 1OAUH 1ZLUK 4UI2A 3DX6A 2EO9A 4P3DB 4G7VH 3T65A 3ZE2F 5C09A 1F6FB 5D71H 1TPXC 4MS8D 3OG4B 5E6ID 3VXPB 3VCLB 1N5YL 4I3RL 5KSAD 1CBVL 1HXYB 2Z31A 3NCMA 2HG5B 4DKEH 1NDGA 1XGQB 3J8F7 5C70A 1XIWC 5F21B 5TQ2H 3OR7B 3GM8A 4TULL 5EZJA 2NY0D 3AAZA 5T1DL 2E7MA 3MACL 3KPQB 2J8UA 1TQBB 3FQUB 3ZSSA 1A7OL 2B8OT 1A64A 1OAQH 3SQOL 4QTIH 4J8RA 4OLYH 1W2KT 1E6OL 4QRSA 1PKQB 1S7TA 2XN9B 3MZGB 2X09A 1NMCC 1ZANH 4GG6E 4MJ2A 4WI8A 3RBGA 3VXUE 3EFFA 1H15B 1LNUA 4L3CB 5A2KH 5HYSA 1OWWA 3O8XA 3TA3A 1FZKA 3CAFA 5FB8B 5CBEA 3ULVE 1B0GA 3CUPA 1XIWD 1VPOH 3V7AE 5E7BA 3A6CL 1CXHA 4HKJB 5ALBH 2V5TA 5LVEA 3UTTA 3LEXA 2VAAA 1FVEA 1GC1L 1ZVHA 4OFVA 4I18A 1WGOA 1SBBA 2VL4A 2F54E 1T1XB 3NA9L 1XH3B 3LKNB 1BFSA 2AJUL 2A6JB 1T04A 3MA7A 4AM0A 1EEUA 1X4XA 1XAUA 2CIKA 1R3JA 1CK0H 1XR9A 4R4FH 5I8EB 4Z7NF 4WIQA 4X6CB 4GS7B 2HVJA 3BWAB 4YZFF 2BY0A 5L9DH 1KCUL 4QYOA 3N1QC 5DRWA 3KPRA 5MEPA 5IHUL 3OX8B 3K80A 5JORB 5E8PB 4WWKB 1J8HB 2Z0BA 4M8QB 5DJAB 1WUNT 3O3EB 2JJSC 1J1XL 3MNWA 3VWJA 2W1NA 4XNUH 1MJUL 3K4AA 3MLUL 4WI9A 5FHAH 2ZOLB 4GW5B 1CDHA 2KUTA 4QTHB 4YNYA 2AEIT 3UX9B 1F4YL 3C8DA 1A6TB 4RMWA 5JXAH 1MRDH 3IJYA 5KS9B 4MJ6A 2H32B 4C55A 5HPOA 4S0TD 4G6AC 1EGJL 4DTGL 2OZ4L 2H9GB 1S7QA 4QNPE 1NJ9A 3QDGA 3ZE1F 4JFYA 1N6VA 4JPKL 5HGBA 1J86A 1BEYL 4CNIB 2Q3ZA 2D4FA 2CK2A 4NBXB 2HTKC 1YMMB 4PIRF 5E2JA 1JL8A 4E9LA 1QFWM 5IROC 1AD0B 4PJXE 1DQJA 4K9EL 4HEPG 4ZFFA 1KXQE 1Q94A 1H3GA 4Z7QE 1UWXK 4X5WA 4E41A 1XGTA 1CU4H 1N8ZA 1RZGB 3HMXH 4G6AD 4LSPL 4BZYA 5C8JA 3BZDA 4KK8D 3L6FB 5GQBA 4R3SA 3CVHH 4XP4L 1CLOL 4FXKA 1U42A 2DQFB 3K2MC 1F6AB 2HTKD 5D1XD 3PUCA 1WBXB 2P8PA 2PNDA 5C1MB 1B6DA 1DLHB 1KENH 3PWJB 4FQXC 5JPMB 1MCPH 4PD4J 3NH7H 1EGJA 5CSZB 2OZ4A 2FBOJ 1FFOA 2WUBH 1EA9C 2BC4A 5JQ6H 2W0FB 3VGBA 4AL8L 2VQ1B 1NC4B 2Q86B 4F80A 5CBAA 3JV4B 2X42A 1I3GH 5D70H 5DJ0A 3O3AA 3ARYA 5CJOL 5HY9B 1T2QL 4UNUA 1G0YR 5TE6L 4AENB 2AJZA 1FNGA 1QYGL 2Z92A 1P7KB 2FJHA 1I7RB 1KEML 3NN8B 4FQXD 4QHNA 5INCB 3MV8A 3BQUB 32C2B 4O58L 4CMMA 2FGWL 3V2AR 4EZMA 2E8ZA 5KW9L 4ISVB 1OGAE 3WJLA 4PB9L 3BP6B 1Z2KA 3PWLA 4J1UB 1L9MA 4KVNL 2BERA 3QUYB 3W11D 4GXUM 1U3HC 3TM6A 1IARB 4NKIH 2VKWA 5B38A 1PFCA 2F8OA 1V7MH 1CFSA 4WWID 4L8DB 2DLHA 4P5MA 4FRWA 5ICZA 2AQ3A 1A9BA 1HHHB 5GRUL 3GJFH 2VR5A 1GOFA 1JTOA 3MLYH 4ODUA 4IS6A 3MC0A 4M4PA 1INDH 1A1NB 2L7UA 1C5CL 4NFDA 4XC3L 3IDNA 5DC4B 5BRZA 4C56D 2XIDA 3G08A 3P0YH 4PJIF 2YEZB 5MERA 1A6AA 1F3JB 3ZDYF 1U3HD 3UROR 3B9VA 5F6IC 3RGHA 2FHBA 4D0CA 5LGHL 1MFCH 4XX1G 2ADGA 2UWEB 4DW2H 4N0CC 5ID0A 2LU4A 2X4RA 4LCCB 3FFDB 2XV6B 2F53D 2R0ZL 2WINA 4KMLB 5DUMH 2RFXB 3EO9H 4O2FB 1A7RH 4KGJA 4D9QD 1JRHL 3PF2A 1JVKA 1ACYH 5KSAA 1Z3GH 3JWDH 1MRCL 3LKPA 5BXFB 5CKAA 4DUXA 5GJSL 3TLRA 1X5KA 3MGTB 3MRMB 4HX1A 2FEDC 2RCSL 1QHOA 3KXFE 3AREC 5IJKC 3L9RB 5F9WC 4DGIH 5DHVA 4PGBA 1QSFA 2VTFA 1QQDB 1WZ1H 4PJGA 4D8PA 4U6YB 2NX5E 1WAAE 4JDZB 4DCQA 5B38G 3D85D 1YNLL 1NBZB 1JNHB 2IPKA 4XB7A 1KCVH 5A2LH 4FZEL 3QZWG 4KPHL 3LRGA 2FX9H 3WLBA 2JELH 1KTKE 5K93A 5EU6B 1IM3B 2IQAA 2MFNA 3P4OB 2RJMA 3ARED 3DO7A 1VFAB 4XXDA 2APWA 3WCYA 3F12B 3VFVB 5J3HD 4YHKH 5TDPA 1B4RA 3QIUD 1UZ6F 4S1RH 3U1SL 3GIVA 3MRCB 4RISH 3EGSB 2ENSA 5H37G 5TDNB 3BPNB 1T21A 2BDNH 2HJFB 3MMEA 4POUB 3FB7B 5E00B 1WZLA 3D0LB 2R23B 3IVKA 3V0VA 4DFHA 1CDYA 2B7DT 2E9IA 1PKOA 3FOMA 4K23H 5DJCA 4BZ1H 2DYPB 2H3NB 2D03L 4YIQA 1ZLSH 3WO4C 5FK9A 2V9QA 4Z7OE 1XR8A 2VLLB 1CFVL 1YECH 2D7PA 2AK1L 3VDCA 4WTWA 3WMSA 1LO4H 2RR3A 1T1YB 1P5UA 5E6YA 1V05A 2D7QA 5AEAA 1MH5A 5CGTA 4HIJA 2FJFB 3VFWB 1EBAA 1UT9A 2D4DA 3MXWL 5TF1L 1TVDA 1CDIA 3CLEL 1G9EA 3SY0B 3V6FA 1JGEA 1HNFA 3DETC 4O2EA 2X7LB 3QEQB 4NN6C 4K2UL 4WY7L 1HK6A 3W2DL 1I1YB 3AU1A 4M9PA 3MRPB 1C16A 4NQDA 1U58A 3BD4A 5JXED 4M6ML 3L3KA 5AWNL 4OIBA 1NCNA 2DI9A 1AFVL 5IV2B 1I8MB 4F33B 2UYLA 4NP4H 4Q7DA 2X4UB 1TETL 4H8WC 3HE6B 2WWMC 2DQCH 4JFZH 2P5WA 3DURB 5CSBA 3KDMA 3B9DA 1GSMA 4O02L 3WJJA 1TDQA 4XMPH 4OKVA 3VXQB 5FCSH 3PDDA 3DETD 3THML 1YJDH 3T0EA 3M1BB 5FGCB 4LAJH 2NR6C 4G6KH 1JZ2A 3CH1B 3RWIA 1X5ZA 1OAXH 1HH6B 2XWTA 3I6LD 3AXLA 5IFAL 4Y19D 1XGPA 4KKCD 2ZUXA 4IMLA 2KDGA 2ZJSH 4RBPH 5D1XA 5JOFB 3CK0H 4F7EA 1IGTB 2WWMD 3QXDB 2X70B 2NW2B 3QFDB 1OD9A 1R5VB 1O0VA 1UCBH 4E0RB 3TO4D 3IF1A 3QEGH 5I1LA 1AO7E 1IGCL 4OM1H 3OKLA 3QUZC 4EIZC 4PG2A 4Z7UF 2EDTA 2DM7A 2ZKHH 4X9HA 3ZMRA 2NR6D 1N3NB 4ZO9A 1QSED 2PO6C 1WIUA 5KVEH 4MZ3A 3RWHB 2VR9A 3GNMH 3IDGB 5IJVA 1CGSL 1CD0A 5DD3H 1OT2A 4Y4FB 5I17A 5BW7C 4FQIH 4QXGH 3KJ4C 4O4YH 4LSSL 4DZ8B 1JI2A 4JKMA 3VA2C 1MCWM 4JFOB 4JM4L 3S34H 4R6UA 4DN3L 4XP5H 4OSUL 1P4LA 3CFDA 4DN4H 1XF2A 3V79C 5EA0L 2G60H 3KNBA 5F7MC 1L4IA 4G8GD 3MUHL 4U1HB 4JFXB 4DUVA 1B90A 1QNZL 4QHKJ 4QXUL 2PO6D 3VXMD 1FNLA 2QQNH 2X2YA 5DD5H 5IHZA 5DSCB 2ED7A 1QPXA 2QQLH 5E9DB 1JV5A 2D31A 3IFPA 1JPGB 1AGCA 4L4TB 4H1LA 4JZJB 5DRXA 1IFHL 1S7SB 3RA7L 1QFOA 3LKOB 1JGLL 1HSAA 2BNRE 1XCTA 3QCTH 3HNSL 3BZFB 1TFHA 1IAIM 3C5JB 3PV6B 4H5SB 1BGXH 5CD3A 2P7TA 3HZYA 5MENB 4K3JH 1K85A 2B2XH 5F7DA 3T65B 2J3SA 5EOCJ 4KXZH 4ALAL 4YFLI 2AEWA 2WAHA 4G6JL 2Z31B 5BV7B 5CZXC 2FWOB 3R0NA 1K4CA 2GQHA 3CMOH 1NANH 1WZMA 4RGOL 3SE8H 5EZJB 3VGHA 5HD8C 4ORGB 5DJ8A 2DD8H 3K46A 4GKSA 4TOYL 1F3RB 1OQOA 4TUJA 1I8IA 5I71C 2F53A 2X89A 4Y5VC 5FM5M 4J8RB 1FPTL 1PKQE 1F58L 4RAUA 4NNXA 5JNYB 1S7TB 3DRQB 2PW1A 3VMPA 5FECB 2IALB 2HVKA 4PJAF 1RUAL 2Y1VA 3FB8B 3WS6C 3EFFB 4MXWH 4R4BB 4JFHD 5IEHA 1MCCA 1JPFA 3KVQA 1B0GB 3RWGA 2FIKA 4PRHD 3ESVF 3CUPB 3FKUS 1DBJH 2IPUG 5HD8D 5DGQA 4UT9H 1A4JB 1I8LA 1D9KD 4YGAB 4CDHA 5EIIB 3U83A 4ODHL 2VAAB 3D85A 1FVEB 1MEXH 2E9BA 4I18B 1RMFL 2F19H 5DK2A 4ONFH 3OGCA 5D7JC 4ZAKB 5AD0A 1AP2B 4FG6D 2LVEA 3EYUL 4OLVL 1T04B 2EYTA 1LDSA 2PKDA 4OZIA 2W0KA 1FNSH 2CIKB 3H9SD 1XR9B 2XXCB 2P5EB 4H1LG 4K07A 5F6HI 5GS1A 1ROWA 2YPKA 2OK0L 4GRWH 2HT4C 3P0VH 5C3TA 3V6OC 3BRFA 2HVJB 3LMJH 2CLRB 4XI5C 5FGBC 4QYOB 5D1QA 5MEPB 1J8HE 4DK6A 3QIUA 2HFGL 4PRDA 3GSVB 3GHBL 2V7HB 1F4AA 3MNWB 1LO3H 3TO2B 4AIZB 3VWJB 1LGVA 3MLRL 4LPCA 4PS4L 2C7UA 4W6XB 5HBBA 2GTZB 4PREB 4YNYB 2Y07H 5E8EA 5D7JD 5D2NA 5HDLA 4YDLC 1PYWB 1WISA 1DVFB 5KS9E 1E4KA 5J13B 3FO0L 1AXTH 2UV3A 3RY4A 4EVNB 3PP3H 1DQQA 3ALPA 3C60A 5F9AC 5JIIA 4LSUH 1UACL 1IAKB 2NY4C 3R8BB 3W9EA 4H0IA 4GRLA 2FX7H 5IUSA 1T89A 5KSVA 2Z4QA 1X3DA 1YMME 5K9QI 1LEIB 4WUKH 1A0QL 5C08B 2IGFH 5IWLC 1MVUA 4GMTH 1RZ7L 4HGWB 3BX7C 3ABZA 1K8DA 1NC2D 2HMID 4JKKA 2XTLA 1UXSA 2PCPB 4BSVA 2AK4A 3DV6B 3QWRA 1DQJB 5L0QB 4GFTB 1LEKA 1DE4A 2OR9L 4WHCA 4ZFFB 1Q94B 4CMHC 5TE7L 4K7PX 3W0WA 5DK3A 1BM3L 4XVSL 1QBML 3HNVL 4X5WB 3B5HA 1XGTB 2OQJB 1N8ZB 2CRYA 3P0GB 2VKXA 2EDEA 3GSWA 3NGBC 3P73A 5C8JB 5JXEA 1G9NH 4CVWA 2R2BA 1RSFA 4YQXH 1RFDH 1J0JA 1P53A 2Q7NA 3HNTH 5CEZE 2BXYA 3D25A 4XVUC 3CDYA 5E4EB 4GUPA 4FXKB 4E5XA 5C0EB 1HI6B 3PDGA 3DYOA 2IQ9H 5E8OB 3E2HB 1FFOB 3U36A 1QTYT 4XVJL 1DQDL 2BC4B 1PSKL 5T3XD 1ULVA 4KKAC 3MLXL 2YWZA 1MVFA 1GOHA 1CE6A 3QQ3B 2QQQA 3MOAH 3V6BR 4HXAH 4J4PC 2GCYB 4JHWH 5T3ZH 4PJ9D 4Z7WA 4Y2DD 1LVEA 2FLBT 4M7JH 5JUEH 1IGYA 3DSFL 1FNGB 2OL3L 3PIQA 3MLTA 2FJHB 4I3SL 4ENEC 3TO4A 3MRFB 1P4IH 4QHNB 1DEEA 3LQMA 3MV8B 2NPLX 3IXAA 2VLJD 1DN0A 3HB3C 4KKAD 5ACZA 3QPXL 1RUMH 4OCRL 4YFEA 1Q1JL 3JWOL 5C07B 1KFAH 3VGAC 1QSEA 3PWLB 3WFHA 4BZ2L 4HUMB 5J9PA 3E6FB 1GGTA 3FOLB 5D2LB 5JHLL 1CFSB 3C09C 4M8VA 1QFWH 1F4XL 3B9KC 1FLRL 4ZUSB 4KI5E 1L6XA 1A9BB 3PGCB 4ENED 4LARH 4XPBH 5IKCA 2VN4A 4J3XA 4IS6B 3LRSA 4G5ZL 2NZ9D 3O4OB 3HB3D 4LMQI 4Y16C 3D3VE 5GSRA 3O2VL 4URTB 3G5ZA 1LD9B 3IDNB 2LAAA 3AUVA 3VG0L 2OL3A 3FZUC 5BRZB 2WBJC 2X6MA 4RWYL 3VXMA 4AT6A 5ESAA 3ARZA 5SX4I 1HHKB 4HWBL 1H8SA 5I8KH 3C87A 4GRMA 1NFDF 1NAMH 4OF6A 4B41A 4TQEH 4D0CB 3DOSA 1J87A 2CRZA 4HFWA 4EBQL 3DTXA 5IK3A 1WCBA 1L7TH 4JO4L 3CJJA 1NCBL 1WBYA 4K7FB 2A0LD 5ID0B 2YK1H 2X4RB 4LHJB 4WFGE 4PG9B 3DVNA 4KY1H 1FAIH 5L8JB 5F88B 5HYIA 4TUOB 1AY1L 3QT2A 4WUUD 4OLXH 5E6IB 1KN2H 3FZUD 1BLNB 2BVPB 2WBJD 5JIKA 1RD6A 5KSAB 4OLZL 3LKPB 4YXLL 2B1HH 3ZDZF 3DNKA 3V8CA 5I9QB 5FYKD 1EMTL 2NY0B 4J3VA 4I9WD 5F89B 1KELH 4R2GC 1MCOL 1RURL 1TQCB 1J7VR 5EULV 4PGBB 3SJVD 2KKQA 5LBSH 1DUYA 4HWBA 4FA8A 4E42A 4PJGB 5HXMA 1YEFH 4JO1L 4LEXL 3ULUE 4YR6B 4JFFB 2NY5H 4MLSA 1RK0A 3P11L 4QHKI 1TPXB 2IH3A 3LY6A 4OB5L 4J3OC 1JI1A 4OZ4A 2ARWA 5EU6E 4KUZL 2YPVH 4PRHA 5EUOB 1XIWB 3LS4H 1U8MB 2CPCA 5EOCH 4LAQH 3UBXA 3X3GH 4V2BA 3DO7B 3C8HA 4XXDB 2ITDB 3LKSB 1G7MA 4R2GD 1IL1A 1D9KA 5K9KA 4YXHH 3RWJA 4DEPB 1BOYA 3GIVB 4O5LH 5EDXA 3KG5A 4L9LA 4PB0H 2QV2A 3VFUB 5IG7A 3MRLA 4NO5A 2V5SA 2XZQL 3H9SA 5GIRA 3HAEB 3OAYK 2DQDH 1MHCA 3NMEA 3PHSA 1MRFH 4XPAH 5C0BB 4S1QL 2CRIA 3FOMB 3F7YA 4UIMB 4O9HH 1MJJA 1IGJA 2CMRL 4NZRH 4Y1AD 3D2UD 4G7VL 5D71L 4KDTA 1JF5A 3SOBH 1BD2A 3AM8A 1K2DB 5DO2C 2BJMH 3NZ8A 3BO8A 4OZGA 5TQ2L 1DFBH 4HIJB 3G5XA 4ODXB 1AGEA 4WVRA 3RIAF 4R96B 5BS0D 5ERWB 3QEQE 1JMXA 2FO4B 2EIZB 3DV4A 4HUVA 1OAQL 2AXGA 1MWAB 4QTIL 3REWB 3MCKA 4OLYL 5GHWL 4CBPA 2OXHA 2ADJB 2FRGP 2GSIB 3NACH 1FYTD 2UYLB 2NW3B 4ZPVA 4ZTPH 1NC2A 3VXTB 1BFVH 5DO2D 4JFED 3KDMB 5J6GA 1VPOL 2H41A 2XI9A 3TPKA 1ORSA 3QIWC 2XKNA 5ALBL 3VXNB 3IDMB 5FGCE 4NZTH 1CFQB 1C7SA 1WLHA 2NCMA 1RVFH 1NBVH 5IW6A 5KBNC 4QNPF 3QCUH 3GUTB 1XGPB 4ZYKA 5H35B 1FL5A 1JF1B 3GMRB 5KG9B 5D1XB 1ZVSA 4R4FL 1CK0L 5EIVA 4MXQC 2DBJA 5TQ0H 1ND0A 3BYTA 3GSNH 1OP5H 1YY9C 1OTTC 3QDJD 5I1LB 5L9DL 2ZUYA 4PJXF 5FUCE 3QIWD 3MRIA 1IEAA 4NUGH 4Z7QF 4PGJA 4PJ9A 2L7JA 3GMNB 4UUJA 1RIHH 1UJ3A 4XNUL 3PWUA 5FHAL 4Y2DA 4I5BA 5E5MA 1KIPB 2R1WA 1SYSA 3SKUD 3QUKA 5ESQA 1LQSR 2YUZA 5JXAL 4MXQD 1MRDL 3SDDD 5IESH 4FQXB 3AGVA 1UA6H 4LDOB 4PGEB 3ZYZA 3PE9A 4JQIH 1OTTD 4OV5A 5C0DA 5L2KD 3CFDB 2OJEA 2FJGA 3STZB 4IOIA 1T7VA 4FQQA 2O5ZH 5JW5A 1RAMA 2C9AA 1H3WM 3GDBA 3MV11 2MKWA 5B39A 3FO1A 4M7LT 1VB9A 3EOYG 1U2CA 4L8BB 1SEBA 4TN9A 1G9MC 3EYVA 2FLRT 5E9DE 5A1AA 2R0KH 1OF2A 2FO1A 4PTTB 4NM4H 4L4TE 5A16A 2I26N 1KJ2H 3C5SA 4LSRH 5C0NC 4UAOB 4XRCB 5DYOA 1HSAB 4GXUN 1GGUA 4U3CA 5JA9A 1JE6A 5I1HH 3B3IB 4RGND 3CVHL 4ZPTB 3TN0D 5L6YH 1AC6A 5MENE 1CR9H 4C56B 1G7JA 1FFRA 3HZYB 4OTXH 5CD3B 5ICXA 5DVOA 4PV8A 2XA8H 3FT4B 5F7DB 5IVXA 4QT5A 1U3HB 1MCPL 4KHTH 1XF4A 2WQ8A 1LK3H 2EC9T 1L0YA 2Q20A 2X9XA 2WUBL 5JQ6L 1T0PB 5AUMB 1ZGLM 1D5ZA 1SJEA 4GSDH 4O2CA 2EKSB 1ETZA 3CFCH 5DJ8B 1JTTA 5ECJE 5C0ND 4K3EH 4TUJB 5J1AA 2FATH 5D70L 4RAUB 5JPNB 4WUUA 4KZDH 5KZCD 3WSQH 2NMSA 3TGXA 2EIDA 2Z9TA 4NKDA 1HSBA 5DZOA 4QXWA 1S7XA 5F6IB 5IEHB 4JCLA 4LCWA 3KS0J 4B0MM 1JPFB 4M93C 3RWGB 1AD9A 1CI5A 3CVHA 2FD6H 3B43A 3ZKNC 1E4JA 2YXMA 1IAOB 3FFCA 4JFDD 3WUWA 1KPVA 1I7UA 1EAJA 5I73C 1OPGH 1ZLWH 1Y6NR 1S7WA 4NKIL 4LRNL 5T1LD 1V7ML 1FNEA 1KPUA 3D85B 2Q3AA 4MQ7A 3T2PA 1UM6H 2BK8A 5DK2B 3SCMC 1H0DA 3O3DA 5AD0B 4NJAH 5BZDA 5DDHA 1R5IB 2O93L 5F1IB 2EYTB 4OZIB 3BUYB 3MLYL 1QO3A 4NO3A 4WO4A 3LEVH 5FKAB 4XB8A 3CXHJ 3AREB 3VRJA 1INDL 4LCYB 1OAZH 1NAKH 5F9WB 3ZKND 5EC1B 3QIUB 4DK3A 4GBXC 4LGSB 3H9ZA 4PRDB 1JPST 1CE1H 4BELD 3CU7A 3QJFA 1I9RH 2YOCA 3RL2A 1WAAF 3OKYA 1J0YA 2DLEA 2UUDH 4XPFH 4WW2F 3UTQA 3SCMD 4HXBH 4OM0L 1MFCL 3RZCA 1UM4H 4IRSC 1YN7A 5TGBA 4DW2L 3IXTA 2XZCH 4MNGA 2EDWA 1NFKA 3BGMA 4WDIA 1DQQB 5E4IA 5IT2H 2W38A 5DUML 2FYYA 1A7RL 2Z8VC 3MREA 3WXVH 4XNQB 3VFTA 1ACYL 2MMXA 1Z3GL 3JWDL 3GJFA 1UKSA 5C08E 5JOPD 5ISZD 4P4KD 1K8DB 5DK0A 2E27H 3SDAA 1KLFA 1WIPA 5DEZA 1I8KB 1UXSB 2K1MA 3HI1B 1K5NA 3V5DA 5BJTA 2PTVA 4HK0A 4XP6H 1DE4B 4DGIL 2NXZC 4JY6B 1FFNB 1ZEAH 2ENYA 4NO0A 2I27N 3L5IA 3WUWG 4E41E 5IB4B 3H0TB 2CD0A 4WHTA 3WO4B 2JF1A 4QHUA 3P73B 3U7AA 5IOPA 3G04A 3RIAK 2R2BB 4OCLC 5HHXL 1KCVL 4Z7OF 1FYTA 1BQUA 2JB5H 5EU3A 1ZA6B 3O9WC 4GUPB 4ZXBC 2FX9L 4E5XB 5IM7A 3L7FA 2JELL 4JFEA 3FT3A 1A6ZA 3PQYD 3MA9H 1C1EH 2VDMH 5F71A 1H3UA 3M07A 1RZIA 3NFNA 2R2EB 4ZG1A 3OHXA 2DICA 4NSKA 3VD7A 1RY7B 4HIXH 5D1ZA 1CE6B 3ZDXF 4S1RL 4MX7B 3DBXA 4JREC 1S7VA 4RISL 3U7WH 4Z7WB 2KQNA 5FGRA 3CX5K 4Y19B 3OKEB 5HVHB 2BDNL 2YRZA 4PRNB 1IGYB 3HMWH 3P3YA 4ZXBD 4Z5RA 3PIQB 1JCKA 3MLTB 4K23L 3F7VA 4BZ1L 3TO4B 3MV8E 4W6WB 5DUBA 1ZLSL 2WP3O 1XT5A 1DEEB 1AQDA 3IXAB 4KC3B 3QIWA 1S8DA 4WGWB 2BVEA 1RUPH 5C07E 5ACZB 4W68A 5FIEA 3QDMA 4W4NA 1ORQB 1LO4L 1QSEB 4FFVC 4RNRB 5ANMA 5CHNA 3P4MA 3D48R 3BH8B 2VC2H 4LQ1A 5LGJB 1RU9H 2DI7A 5D2LE 3VFPA 2EDYA 4NOFA 5FEBA 5LGKA 4ZD3H 4Q6YA 3SDDA 5SWZD 3T1FA 2PTUA 3RZWA 3Q5OA 3GBNH 4KK6C 2DOCA 2VISA 1FL3B 1WTLA 2ZCLH 3T0VA 5L2KA 1W72H 3EO0B 4POZC 2YN5A 4R0LA 4G8GB 2AW2A 4QRRA 5BRZE 3O2DH 4FFVD 2PO6B 4Q6IA 1LWRA 2DQCL 4JFZL 3VXMB 1WFNA 2X4SB 5ESAB 1AJ7H 4YEEA 3JVGA 4OZFH 3G6JF 4Y5XA 4QY8A 2I60H 3KPTA 3RWDB 3CPLA 4XMPL 2HWZL 2PTTA 4LNVA 1AH1A 4O00A 4U7MA 4IOFC 4HFWB 3SDCC 1YJDL 5KVFH 5IK3B 1MHPH 4G6KL 3DX8A 1WBYB 2Z93A 2J2ZA 1T0NB 4WW1B 1D5XB 4HIHA 4POZD 4JKWA 3TN0A 2DL9A 5H2BA 2Q7YB 2ZJSL 2EE2A 4PJFA 5C0IB 1NGWA 1P9MA 3NPSC 4HQQH 1S9VB 3RDTC 4LGRB 2P8MB 4GG8A 2F58L 2ZG2A 3E8UL 4R90H 4IMKC 4X98A 1ZS8A 3QEGL 2E7LA 3TH2T 1KEGH 4OM1L 5IB1A 1EV2E 4IIQA 4ZTOH 3SDCD 1EO8H 1J10A 2ITCB 2APFA 1PG7X 2XQYK 3QO1B 5KVEL 4PJGE 3TBSB 1DUYB 4E42B 3GNML 1QLFA 3ARPA 5DD3L 5LCVL 1JBJA 3I75B 2Q8BH 1RK0B 4O4YL 3RDTD 2IH3B 4I0PA 5D6CB 4OZ4B 3S34L 3BEVA 4S2SA 4DN4L 1AHWA 4PRHB 4UZGA 3ROLA 2G60L 2IFFH 2MPAH 3UBXB 4JFDA 4UBDD 4N1EA 1IL1B 1D9KB 2CLZB 5K9KB 5I71B 3RWJB 1Q8MA 5TFSH 3U9PL 4EQ3A 4Y5VB 2ESVD 1OARH 2QQNL 5DD5L 2EDOA 1S7UA 4L9LB 4CN4A 4QO1A 5IG7B 4PJ8A 4GW4A 5H94B 1GL4B 2XOTA 1TTGA 3HC4H 3MRLB 4XC1L 3H9SB 5GIRB 1YMHA 4NBYB 4XNMA 5ITBH 4G43A 1CF8H 3QCTL 4K3HA 4PLJD 1NCWH 5FOJA 3JWNC 2BSRB 3HZKA 3QSKB 1FC2D 4X80L 1IGJB 1BGXL 4K3JL 1JTPA 2B2XL 4PBVC 1QBLH 3IDJA 3KS0H 4V1DD 4P5KA 5JIPA 4U1SA 3PHQB 2N1KA 1I1CA 4NRZA 1WSST 3GEWB 4P48A 2E9JA 4YAQB 5FHBH 3NZ8B 3CMOL 3BO8B 4YDVA 1DLFH 4JQXA 4KI1A 3QWOA 2IC2A 5D7JB 3G5XB 4U2YA 3U4BL 3BP7A 1IKFH 3EZJB 2DD8L 3ORJA 3BE1H 5EO9A 4MQXC 4P2QA 1X5XA 1T80A 1F8TH 2XG5A 5E5UB 1EVTC 4HUVB 1YNKH 3BN3B 1PDKA 4R7DA 2NTFA 5FUOH 2HRLA 2PF6A 2F15A 4P23A 3MTRA 1VACB 5ITFA 4LFHD 2APVA 2R0WH 1WTGT 3FRPA 2EYRA 5IHLB 5DWUH 1WQVT 3V52H 4P4KA 1X7QB 4MXWL 3RKDD 1NC2B 2VR4A 3QQ9C 3QXWA 5CJQH 5BMFH 4U6VH 2GHWB 5F7FA 1DBJL 4IEFB 1P84J 5EORH 5L88H 5JQHC 3T0DA 1T22A 3CZFB 3GIZH 5CP3H 2B39A 3BDYH 4UT9L 2XKNB 2HT3C 5DVLA 3REVA 3VWKD 4WV1C 1T1ZB 1YYMH 2H2SD 3NOIA 5KS9F 3HC0A 2EZ0D 3C9NA 1MEXL 3PL6D 5DGRA 1GGIH 3QJHA 5DHYA 3EKCA 4FXGB 4CL7A 2F19L 2G2RA 4PRBA 4DKAA 4ONFL 3OB0H 1MQKH 1FFQA 4MHHI 2O61B 3H9YA 1FNSL 3BXNB 2A83A 3PQYA 1MSPA 4PJEA 3D6GA 3WEXA 1ND0B 3QQ9D 3P0VL 5C0JA 3EZ8A 3UYOD 3LMJL 2EDJA 1NFIA 4JO3H 4XMKH 3BT2H 3L3DA 5SWSD 2IADB 2QADD 3FL7A 5ICYB 4CMHB 3HUJF 4KVCH 3MRIB 1RZJC 3NGBB 1YUHA 3IB4A 3S3JA 1CXLA 3PWUB 3WN5C 4Y2DB 4TTGA 2V2WB 2IBBA 4AEEA 2R1WB 2VWEE 1A7QH 1SYSB 5HYEA 4M7LH 2HP4A 2JIXD 3QUKB 4YDIH 5ESQB 3WIFB 4NNPL 2CUHA 3PWPD 3PGFH 1AXTL 1DBBL 3ALXA 3EYQD 1G7LB 4J3WA 4I1NB 2VLJB 4OV5B 5HGHA 2FX7L 3D69A 2OJEB 1HHGA 3Q48A 3SPVB 1NBYB 4UTAL 4M6AA 1DQMH 5I16B 4WUKL 2IGFL 2W65B 3FRPG 5JW5B 3WE6A 4GMTL 3LS5H 1H3XA 4WEBH 5B39B 3GMQB 1BZ7A 3FO1B 2I07B 5I1AA 5TH2A 3HPJB 3ARBC 5F3BB 3EO1A 1L6ZA 2VOTA 4KK5C 4TPRH 1FVDB 5SWZA 3UZVB 3EYVB 1I7ZA 1I85A 3MUY1 1DANU 5DMIH 4M6NH 3JV0A 2C3VA 3C5SB 3CCHA 2E9WA 4HS8H 1IKNC 2ATKB 4K8RH 1G9NL 3OKMA 1CFNA 4ZUTA 4YQXL 2CR3A 4NN7C 4JQVA 3HNTL 1S5IH 4C56E 4CADA 3QB7C 4OF0A 2HJLA 4PV8B 5IVXB 1V3LA 4QT5B 4JG1H 3IDIB 2IQ9L 3C09B 2D9CA 4GLRI 4XP1L 1HYSD 1IC1A 3UZEA 1IC4H 1X5FA 3MOAL 4HXAL 3W9DB 4KI5F 4JHWL 5T3ZL 2F53E 1E6JH 3QPQC 4OUUB 3HG1D 1UH4A 2V9TA 5FDWB 3MUZ1 3MGOA 4JZNA 4Y16B 4RGMC 5JUEL 4D9QE 1ZHNA 4WUUB 3GI8H 1TVHA 2WBJB 4NKDB 1OSZB 1H8NA 4TYUA 2I9TB 2CR6A 2MCPH 2ZUSA 5DC9B 5I66B 3KPMB 4UDUB 4WW2C 1JPTH 1A3QA 3U0WH 4XPGL 1H5BA 5AAMA 1XF3A 4JM2C 1K6QH 4WTZA 1RUML 3CVHB 4F9PA 4NYLA 4F9LA 3MODL 1UADC 4HBCH 3SJVB 3EJYC 3MBED 3NZHH 1I7UB 3O6KH 4LLUA 3BYYA 5CIPH 3SE4A 1A7BA 1IVLA 4P2CG 1KPUB 1MCDA 2P45B 1QFWL 3G9VA 1A1OB 3PJSB 1B0WA 5BZDB 1CFTB 4OZIE 3WNLA 5T5NG 4LP5A 4LARL 4XPBL 5F7EH 4U6TA 5ID1B 4A2LA 2G5BB 4NO3B 3PP4H 2FIRT 4XNYH 2VABB 5EZLB 4JM2D 2EICA 3VRJB 5K9QG 3VFSB 1JWSA 3GMOB 4R2GB 4NDMB 2ESVA 5I8KL 3NBNA 1NAML 4MQSB 1WWWX 1KTLA 2PETA 3QJFB 2GFBB 4TQEL 1NCDH 1YDPB 3MLVL 4UOJA 3ULUF 2B4CH 3C5ZA 3UTQB 3ZKMC 1UKQA 4ONGH 1L7TL 5D2NE 1Z6JT 4OCYH 3T2NH 4LDEB 5TGBB 2X41A 4EOWH 3JTSA 4CN1A 3RNKB 2YK1L 3R1GH 15C8H 1CS6A 4KY1L 3CDCA 4IHOB 4EN3A 4Y1AB 2DKMA 3D2UB 1T4KA 1FP5A 4OLXL 1KN2L 3VFTB 4NC1C 3UDWA 3GJFB 2B1HL 3OXRB 4M48H 5DFVC 1JYNA 2W60A 3UC0H 3RPIA 2AXHA 3I50H 1CWVA 2AK4E 5BVPH 1K5NB 5BS0B 3ZKMD 3V5DB 5DRNB 3EOAA 3STLA 3T04D 2R56L 4YEFA 4HHAA 4A6YH 4KJQD 4ESKA 3T4AA 4X7SH 1LO2H 4NQTA 4FOMA 1MJ8L 1NAMA 4WHTB 1YEFL 3BESR 3VU2A 4ZNEE 4YBHA 3G04B 2NY5L 1FYTB 4CVZA 5GGSY 4K55A 1M71A 2YSSA 2GT9B 2CKBH 3L7FB 4JFEB 3NIDF 3FT3B 4MQTB 3WNKA 1A6ZB 2BVUA 2YPVL 3LS4L 1I1RA 2YD2A 5EOCL 1RJLA 4LAQL 2NYYC 1S5HB 3X3GL 2N7BA 2KL6A 1RZIB 3VWKA 5J12C 3BISA 4DKFH 4NSKB 4GXVH 4YXHL 1B4JL 1NGYA 2ZOKA 1LE5B 3PL6A 4O5LL 2AV1A 5C0RH 4XGZB 2XWBB 3DBXB 4Z7UB 4Z7WE 1S7VB 5FYJH 3CFKB 4Y19E 4G9DB 2CXGA 2CDFA 1YYLH 5D6DC 4CW1A 2N4IA 4P57B 4AY0A 4XH2A 3U0PA 3GJEA 1QPPA 2DQDL 3IAPA 3RP1A 1MRFL 3ULVH 1EFQA 1BFOA 2HKHH 1HOCB 3F7VB 4Q2ZA 4O9HL 3QDJB 1UQSA 4PBWD 5SWSA 4FXLA 4NZRL 4ODSH 3QIWB 1U91A 1N5YH 1I3VA 3MNZB 5IQ7H 3SOBL 1QSEE 1YEHH 4YDJB 1G0XA 1JWMB 4YHIA 1PG7H 2BJML 3IU4H 5CHNB 1Q9KA 1QHPA 3NCYP 1DFBL 5B8CC 4ZUUA 4D9LH 3VFPB 1F97A 3Q6FA 1T3FA 2R4SL 4P9HH 1KB5H 4HH8A 4XCNA 4RA0C 3PWPA 3SDDB 5L7XL 2P1YA 1PG7W 3RY6C 2VISB 3G5VB 2OTPA 5J0BA 3VRLE 3CMGA 4G8GE 3AS0A 3NACL 2KZWA 4ZUWB 1WT5A 4R0LB 4YHNB 1OB1B 3VGGA 2ED9A 1IM9A 2X4QA 4ZTPL 4JEGB 1BFVL 3VXME 1YQVH 1N7MH 5FCUL 3O4LA 4U1LA 3DXAA 3UEZA 3VFOB 5ADOH 3HS0A 3WLWC 5F9JA 1WEJH 4Q58C 1S9YB 1HWGB 2GJZA 4K7PY 4L1DA 1ZLVK 4MWFA 1EERB 3EOBA 4NZTL 4PGDA 5F9DC 3VGFA 3DX8B 1RVFL 1NBVL 2DL2A 2J8OA 2Z93B 3OKNB 4MJ5A 4PYHA 5IVNA 1MCLA 3QCUL 3TN0B 1TQBC 1XGUA 5H2BB 2DTMH 1A9EA 4YHMH 5TQ0L 1HNGA 3GSNL 3LN5A 4GG8B 3BKJH 4LK4A 4LLMB 3C8KA 1F2XK 3ZHKA 4PJAB 5HGGS 5FV2A 4PR5A 3F7PC 5EN2A 4IIQB 3RVXC 1RV6X 5HSFA 1IKNA 1W0WA 1RIHL 4CVXB 3T77B 1F11A 3HG1A 5C0CD 5C6WH 1CXEA 2Y5EA 1PZ5A 4AH2A 4OJFH 3KPLA 5J06A 5GZNC 2ZNXA 3OJ2C 2EE9A 4LKXA 3AY4C 4K94C 4JR9H 4NHCH 5IESL 4JFHE 4ODVH 1TCRA 1UA6L 4HH9A 2RHEA 4JQIL 4NWTH 3U46A 1QP1A 4HKXB 3BEVB 3WNNA 3DX7A 4PRHE 1DJSA 4YBLC 1CD1B 1SHMA 4N0FA 1N26A 4G8IB 3EDKA 1J9CT 4C58B 1LDPH 3RVXD 4JFDB 2O5ZL 3MBEA 1HIMH 3CFBA 3A67H 4GS7C 1SMOA 3TIDB 1JUFA 2J8UF 5IBUB 3GSNA 4MCZB 2DJSA 5T1LB 1M6OB 4J12A 4FMFA 3IDXH 5I1KH 1EFXD 3HTLX 2PW2B 1CVRA 5E8NA 2R0KL 1IEBA 3ZYIA 4RDQF 4JFQA 4NM4L 4GW4B 5EBWA 3IJSA 1KJ2L 4KTEL 4F7TB 3H9SE 5I18L 4LSRL 4XBEH 2CDEA 5CILH 4PTUA 5I1HL 4M93B 2X4PA 1BAFL 3FT2B 2JB6B 1BJMA 5L6YL 1CR9L 4FQ2H 4HK3J 4U3XA 4OTXL 2YS4A 2XA8L 4P4RA 3IDJB 3FQNA 1R3LA 3ZE1E 5I73B 5D5MA 1P7QA 4P5KB 4KHTL 1NUDA 1OAYH 1S9XB 3N1PC 4NRZB 4BFIB 1ZWIB 1LK3L 3QIBD 3SDXA 4OZGE 3HRZB 2CK0H 2BRQA 3VFMB 4YDVB 2X5PA 5F97E 3SCMB 3TT1H 1WF5A 1KUMA 2Z35A 4GSDL 4HV8A 2DM3A 3CFCL 3LN4A 4LASH 5EO9B 1DBMH 3QQ4A 3KHOA 3CC5A 2FATL 5CJOH 3VMOA 1DQLH 4R7DB 3NCBB 5D7SH 4TNVF 3EYSH 2AJXH 4NQEA 4KZDL 5ITFB 3WSQL 1U8HA 1CIUA 5E2UH 1F4HA 2XNAA 1KJ2A 2EYRB 5ISZB 5H37H 4P4KB 3FONB 4MSWA 2P24A 5I30L 2V9RA 3MYJA 3VXSA 2YKLH 5DJXA 5ENWA 3TJEH 2FD6L 4PPTA 4KDWA 4KVNH 3P9LB 1F02I 5T1MA 1T22B 1L7IL 2X05A 3REVB 2A1WH 4G42A 1V3JA 2QL1A 1QFUH 4U6XA 3T4YA 4YJZL 4WFHD 3U9UA 3O45A 1UM6L 3QJHB 5DHYB 4QHLA 1I3UA 4L29A 3WDHA 5GPRA 4NJAL 5IMOA 3WFEH 4GMSH 3V9FA 3PQYB 2QR0B 3AS1A 4Z0XA 4YGVB 4RQQB 5DT1L 2P44B 3VD4A 3SKNB 3LEVL 3R06A 5C0JB 1C5CH 5KJRH 5SV4A 4NFBA 2E7HA 2HJKB 3FQTB 4P46A 1EIBA 3WHXA 1SY6H 5FO9A 1IC5L 1J1PH 2WUCL 4Z0BH 5C9JB 3CSYA 1CE1L 2WIIB 4LRIA 1M05A 4XPFL 2HRPH 2NLJA 1QR1B 1OCWL 1UM4L 1QG3A 3B9AA 3O9WB 4ZXBB 1X5HA 2XZCL 5FYLH 3KWWA 2ZZUT 4JAMB 4EI5C 4NC0B 2YD4A 2VLJE 5IT2L 3AB0C 5F7WC 3VI3E 2VL5A 1FJ1B 3LSOA 1A8JH 1HHGB 3LQZA 4KI5C 3WXVL 4BKLA 1H9VA 5GJSH 4IRZH 4YX2H 2SEBA 1FYHB 2RCSH 3DHMA 4JREB 4EUPG 4M62H 4GRWB 2E27L 1BZ7B 5I1AB 1HEZB 3V4UH 4PJIA 4KKNA 4XP6L 4KTDH 5SWZB 4N5EC 1KN4H 4Y2OA 1ZEAL 4FTVA 3LH2L 4EDXB 2ARJA 1YNLH 4EI5D 2DF3A 4NFCA 4CVUA 5C6PB 5IFJA 4ZUTB 3FB6B 2X1XR 3RVVC 2JB5L 3L95A 4CADB 3EFDL 4OCSH 4KQ4H 4XHQA 1FSKB 1AR1D 5IVXE 2ZSWA 3MA9L 1MY7A 3OAZH 1C1EL 3D3VD 5D2LF 4KK9C 1FGNH 1B88A 3U1SH 5GXBB 1O7SA 2NQCA 4HIXL 3SGKA 3FO9B 3P77B 4HS6A 4NQSB 3ARGA 4GO6B 1J18A 1YEDB 2V6HA 4M9OA 1JNNH 3QH3B 3RGVA 3BD3A 3MGOB 1HE7A 4JZNB 4WUUE 3TBYB 1ZHNB 3HMWL 4XAKD 2QQKH 3TBTB 1IC7L 4R4ND 4NKOB 5I1IL 4F57H 5FYKE 1XZ0B 1TCMA 1CFVH 1A4KB 5GS0H 4I9WE 1CD9B 4OD2A 4ORZC 1XF3B 3V0WH 4KK9D 1UWGH 3SDCB 1RUPL 3BDXA 3L5WA 4G8EB 4NYLB 2CIIB 3SJVE 1YEJH 1MLCB 5F9OH 3MRHB 3MXWH 3GRWH 2VC2L 5TF1H 4ETQB 1YEGL 4OFPA 1RU9L 3CLEH 3QA3A 3MROA 5IMLB 4R7NA 5E24E 4HT1H 4OD3H 4ZD3L 5FM5O 1Y6KR 5D93B 1FGVH 3RDTB 1XGRA 2YMXH 3W2DH 3MZTA 3GBNL 1WBZA 3VH8B 5GGRA 1P1ZA 2ZCLL 3GI9H 1IGIH 4M6MH 3BPNC 2J8HA 1W72L 3HZMB 5AWNH 3B6SB 2QKIA 3PABB 4LLVB 1TETH 4X5XB 1ZAGA 2ZUWA 3QHFH 2GJ6A 3O2DL 5FOBA 4YHZH 5EU5B 3UXFA 3WS3B 4WCYL 1AJ7L 2DTSA 2ESVB 4PV9B 1IQDA 3QEHA 4PJGF 1EFXA 2I60L 4QXTB 2HN7B 4ELKA 4OQ1A 1B0RB 4MA1B 3CZJA 2KH2B 1FG9C 5KVFL 3EDDA 1MHPL 4ERSH 2D0FA 1JMZA 2RBLA 4MAYD 3AC0A 3V5KB 1IAII 4N0YH 1DL7H 4PJBA 4Y1AE 3ZSTA 3KYMA 3QR2A 4GKNB 1N64H 4FQHA 4V1DB 4HQQL 2X1PA 3OQ3B 1FL6B 3MOQA 4R90L 3QIBA 4HUUB 1KEGL 1W72A 3MV9A 3HFMH 1EAPA 5DMKA 3MJ6A 4K8RD 4HCRH 3HLAA 2YHGA 1OGTB 4MNHB 5BS0E 4ZTOL 5LQBH 1EO8L 2DJ4A 3STLB 3PWNA 3O2DA 4HHAB 1CIDA 1O5DT 4OZFA 4UOW0 2BXZA 3BFOA 3RVUC 1OW0A 1KV3A 4X8JB 3MJ8B 4I2XA 4NNYA 4PYGA 3S4SA 2YBRB 1RK1B 2Q8BL 1X4YA 1FYTE 5EZIH 4OLWL 3MRQA 4RMRA 3SHSA 4JM4H 3MRGA 4CVZB 4LOUC 4OSUH 4JFEE 1BF8A 2IPTH 1BF2A 3O3BB 3H3PL 3KPSA 5ABDE 1PZUB 1E4XI 1I7TA 5C0AD 3ELAT 4TNVK 4NJ9H 3LIZH 4WFED 2MPAL 3MFFB 3VWKB 4LHUA 1B2WL 2HKFH 1KOAA 1NGYB 2GIYA 3BPOB 5TFSL 4S10A 3PL6B 4HIIA 3RVUD 4Z7UE 3L7EA 1I4FA 4ZQKB 1OARL 5FUCC 3SE3A 4F3FB 4KZEH 3HC4L 4BYHA 1IFHH 3RA7H 4CW1B 4XH2B 5K9OA 2WMPA 4LOUD 2MHAB 1AGDA 1WFOA 3IGAB 2LTQC 5ITBL 4WEUD 4N8VG 1CF8L 2VITB 3QDJE 2R9HC 4XCYB 4Y4FC 1QEWA 1UQSB 5SWSB 2QADB 2M26A 1X5AA 4I4WA 1BZ9A 4ALAH 1U91B 1QBLL 3TPUA 3K3QA 3B2VH 4G6JH 3MRJA 1CG9A 5IEKB 5ANME 3SGDH 4KMTH 4YHIB 5FHBL 1DLFL 1IKFL 4Q9QH 3Q6FB 3BE1L 5L8KB 2JIXB 2AJ3A 3FB5A 5EBMB 2Y4SA 4XCNB 3PWPB 1F8TL 1FPTH 5DHXB 2XZZA 1F58H 5F7YC 1JK8A 2Y25A 5L2KE 5FUOL 2R9HD 1TZGH 2X10A 5HI5D 3VD5A 3PG2A 3AS2A 5A2JH 5GZOC 1RUAH 4CN6A 3E6HB 2R0WL 4JZJC 5CLTA 4L8SA 5DWUL 3V52L 1ZTXH 2IANA 4YXKH 2EKJA 3WN5B 4M7KH 5CJQL 5BMFL 4U6VL 4F15B 1TMCB 43C9A 5JHDA 5C2BH 2WSKA 5L88L 2EXYC 2BNUB 3GIZL 5DRZA 3BDYL 1ONQA 1KTDA 2IH1A 3MQIA 2PYFA 5DUPH 1KYOJ 1YYML 2Z31C 4L3ED 1MAKA 4MWFB 2QSVA 3EOBB 3KLHC 1D5BA 4PGDB 3HI5H 1OP9A 1GGIL 1DR9A 1JGUH 3BW9A 4X4YB 4RGNE 3EYUH 4OLVH 4GAYB 1MQKL 1KLUA 1UYWL 4QOKD 3RWEA 4JO2L 2EDRA 5CGYC 1XGUB 3KYOA 2ERJC 4U0QB 1Q72H 1U8OA 3K8KA 4PJAE 3C8KB 4Z76A 4U6HA 3VI4E 4JO3L 4XMKL 3GGWA 3BT2L 4IJ3C 3S37X 2E7BA 4PR5B 5C09D 3U2SB 2XQBH 5EN2B 3UTZA 4KVCL 3H3KA 3O8XC 3TA3C 5DJ6B 2FHCA 4UNTA 4UT7H 1W0WB 3BIKB 3X14A 1RULH 3HG1B 3GMLA 4WU5B 1PZ5B 1OVZA 5CEZH 3KPLB 2X4NB 1MCQA 2GAZA 2W9DH 1A7QL 5CP3A 4F2MA 1MUJA 4Z6AT 2AEQH 2MJWA 4YDIL 3PGFL 1UACH 3ZO0A 1A3LH 4I18C 5GGVH 4HH9B 4X83A 3TJHC 1VCAA 3U46B 4EXPX 3ME0A 3RUGA 2P4AB 5FYJD 5EUKA 4NPYB 5JW4R 4JFDE 1DQML 1RZ7H 1H3VA 3BRGC 1ES0A 3DUSB 2H6PA 1PEWA 3O8XD 3TA3D 4WJ5A 2G75A 3LS5L 4WEBL 1JUFB 4I77H 4S0SD 4H26A 1C5DA 2CRMA 3LVEA 4FN0A 3L5XH 1MCEA 4RGMB 4TPRL 1J05A 1BFTA 3NCYS 2B0SH 5E8NB 2CDGA 5DMIL 1NLDH 4M6NL 5DEGA 1LO5A 5EBWB 3UTTD 4U1JB 4JPWH 4I48B 3VWJC 4NCDA 4NO2B 2MOVA 4WW2B 3TJHD 3SBWA 4AMKH 5JDSB 3RIFK 3RHWF 4Z77B 4K8RL 1YY8A 4JM2B 4JGUA 3QEUB 3TYGH 3PWVB 2YPLD 1S5IL 2YUVA 3ECBA 2LQRA 1FN4A 4OGXL 3NCCB 4EI6A 2X4OA 5F96L 1GC1C 1R3LB 5D5MB 4JG1L 3TZVD 3IKCA 5GGSB 2YZ8A 1DQDH 1PSKH 3KPRD 4D9RD 3BIBX 1TLKA 2VXSH 3TESA 4KTYA 1TJHH 3UYRH 1QBAA 1QRND 3H7BA 1IC4L 4HV8B 1LP9A 2CSPA 2NXYD 3LN4B 2J6EH 4N0UA 3LV3A 4OZIF 4MAYA 5A40E 1E6JL 2R2HA 3CC5B 2DIAA 5L0QC 4D0DA 3DVIA 2OL3H 1A1MB 4C83A 3MRDA 3GI8L 1PAMA 4I3SH 1U8HB 5JOPE 3G5YB 5TDOA 1KJMA 1KJ2B 1FAKT 2MCPL 2C3GA 4X7TA 4FQPA 4TSBH 3HE7D 3NA4A 3QDGD 4X6DA 3BSZH 1JPTL 3UO1H 3F6LA 3WBDA 5HYQA 1Q1JH 3BH9A 4GAGH 4HDIA 4WI5A 4QRTA 4UQ2B 3WD5L 2UY7A 5T1MB 4PY7A 4HBCL 3OV6A 3NZHL 3O6KL 4GAFB 5I8OH 3JXAA 4U6XB 1PW3A 2Z91A 4PJHA 4BJLA 3U9UB 3ZZ1A 1NDMB 1KLGB 4GW1A 3ZT6A 1R3HA 4QHLB 4L29B 1T66C 4JDVB 4E41D 3PQYE 4NGHH 4PJEE 3L3JB 4G5ZH 5F7EL 3BKCH 4NQCA 4PLKD 5IW1A 3BPLB 4W81A 4K9EC 3PP4L 3ETBF 2XFXA 4M3JA 4G3YH 4G6MH 4RWYH 4GAJH 2AEPH 4UDTB 1X5IA 1P4BH 1D5IH 1M7XA 1SYVA 3WJLC 1HYRC 3RNQB 4JO4H 5F1SA 1T7YA 2NLJB 2B4CL 2YA1A 2VN7A 4LGPB 4OCYL 5DJ2A 3T2NL 2F5AL 1KBGH 1G7HA 5F1NA 5CIPA 4EOWL 5SX5H 3DUHA 7CGTA 2H26A 3MSPA 15C8L 5IR1B 1AY1H 3ARTA 4X0KA 5J12B 2ZP0T 1GXEA 2VL5B 3GB7A 4JDTL 1VSCA 2BOBA 2W91A 4MAUH 4IDLA 2SEBB 4M48L 1GOGA 1EMTH 1SM3H 4PRPD 4GRWE 4DZBA 4YHLH 5A2IH 3O4OC 3UC0L 5CP7A 4Z7WF 3I50L 2NTSP 2VSCA 4HIEA 4FHBD 3BP4B 4OI9A 2JE8A 2Y7QA 4YPGA 4CRPA 1MQ8A 5SWZE 4ELMA 3B8YA 3G6JB 3J7HA 1I1AD 5EO0A 3LKRB 4JJ5A 4A6YL 4Z7VA 1FORH 4S1DD 4X7SL 1LO2L 4RFEB 4LLWA 1I1FA 4U1MA 2ARJB 3QXUA 1JWUB 1VGEH 2YD1A 3SE9H 2ICWI 5BOPA 2BRRH 1BBJA 3EJZD 4MNQA 4C4KT 3L95B 1NEZB 5HYJD 3O0RH 2CKBL 1MELA 3V6ZA 2ZSWB 5MHSD 8FABA 3ARFD 5B8CB 5E0QA 3HRPA 1JGVL 1YEKL 5CINL 4HZLA 5KSAC 3IAGC 2DBLH 4JY4A 4DKFL 4GXVL 4Y5YA 4ZO6A 12E8H 3A6OA 2HA1A 3K7UA 4HS6B 1OSPH 5C0RL 3X13A 3FCTA 1W0YT 2KQMA 2R1XA 1EBPA 5IQ9B 5LXGH 2JJWA 1YYLL 2FSEA 3QI9A 2BVQA 4JY5H 3VRLF 1ZVYA 4A6YA 3WNPA 1F45A 4JKLA 5DR5H 2PN5A 2VZ1A 3ULVL 4HKBA 2HKHL 3QBTB 5DQ9A 4MD0A 3MUGB 5DZNA 1T6VN 5DJDA 4ODSL 3QULA 3OKOA 1BREA 2VZTA 1WCQA 5IQ7L 3L5WB 2A74B 3FJTA 2BOCB 1YEHL 2CKBA 1PG7L 5C0CB 1NGZB 1X44A 3IU4L 3MRKA 3P4NA 2DQJH 4KJYA 1EX0A 4D9LL 3L3GA 5CEXA 4P9HL 4DEPC 1OP3H 1KB5L 1QSFD 2HLAB 1OTSD 4CDGC 5GHWH 2M1KA 4HJJL 5GGRB 2BCKA 4X9IA 4GG6A 3O6FA 2AABH 4ODBD 4RRPA 4HLJA 4LBEB 4OF7A 2GUOB 5EPMB 3VXUA 4J7RA 3WFZA 3OKKA 2A6IA 1ZHBA 3S97C 3QG6A 2ESVE 1YQVL 1N7ML 5FYLD 4DVBA 5ADPH 1BECA 3HCVA 3FTGA 3QEHB 3MFGB 2HFEA 1EFXB 2MWCA 2V5RA 5ADOL 4AYFA 5IBTH 4ELKB 5EBLA 3TP4A 5DJYA 1WEJL 3TBWA 2FL5A 4DAGH 3IYLW 3RX5A 2EDFA 1S9WA 3I85A 4Z18A 1FNHA 4YBLB 3S36X 1TVBB 2AV7A 4PP2A 2YPLA 5E2VH 4PJBB 3NIFE 1Q9OB 1RZ8A 2DTML 1KB5A 4V1DE 1R6VA 2GK0A 2WBWB 2BMKA 5GSVA 4YHML 4FQHB 1T83A 3ULSA 4EIGB 1FVCB 3TZVA 3BKJL 3RHWK 4D0BB 3QIBB 5I76A 2JCCA 1EAPB 3GMPA 5DMKB 3PDOB 3F5WA 1QRNA 2ATPB 1ZMYA 4RMVA 3QUXA 1JHKL 5HJ3B 4XZUA 5BVJA 3MLPA 2E3VA 3MJGX 2IAMA 4OZFB 3WJJC 4OJFL 4N9GB 3RVTD 1LEGB 4NNYB 3S4SB 5D7IA 3T0EC 4JR9L 1GGBH 4NHCL 5E8DH 5BV7H 3HE7A 4ODVL 5E5RB 2XWJA 3B2UD 3OJDB 4KK8C 1T5XA 3VH8G 4NWTL 4NQDD 1Q9WA 1GGYA 4LSTH 1N59A 1MFNA 1G6RB 5J57B 4RRPG 4OZGF 5D1XC 1LDPL 3D39D 4XT1C 1HIML 3A67L 2P5WD 3HI6H 4QF1A 4PJXA 2ZSVA 1KGCD 1LILA 1UVQA 4KRPC 3V7AG 3IDXL 3HUJB 5I1KL 4LPYA 2YR3A 3UAJC 4PG2C 3RTQA 3T0ED 1E28A 2DQTL 4ZUVA 2VH5H 4FQLH 3K81A 3E1F1 3NAAH 5CSGA 4LSVH 4XBEL 4U1NA 5CILL 1T2JA 4QCIB 5FA3A 1P6FA 3MR9B 1Q9LA 2I25N 3INUH 1HQRB 1ZHLB 2VWEC 5GGUB 5SWSE 1ZSDA 2XT1B 1VKXA 4FQ2L 1VFBA 5F70A 4JANB 4I4WB 5HDBE 4OIIH 3S37H 1SJHB 4LSDA 3A6BH 3LQAH 3OB8A 5E56A 5JLZB 5IMMA 5CLWA 3MRJB 2MQ0A 5GS3A 2R69L 1CG9B 1OLLA 1OAYL 4KRPD 2AVGA 1RZKH 1V3KA 5HHQA 2CK0L 3VG9C 3UAJD 2Q8AH 4M1DH 4X6BA 2PXYD 3TT1L 1UB5A 3W11C 4XBGA 4LASL 3NCEB 3DROB 3PWPE 3FB5B 4OQTL 1DBML 3FRUB 1DQLL 1JK8B 3GSRA 3O3UN 5D7SL 3EYSL 2AJXL 5K59F 2EXWD 2NY6D 4LFHG 5E2UL 1G7QB 4UAOC 4L8SB 3LAFA 4PRPA 1RUQL 2FEEL 2QJDA 4DOHB 3U4EB 1C12B 5EOQH 3IS0X 1I9EA 1OGAA 2OI9C 2YKLL 5HVWA 1FZMA 1KXTB 3TJEL 1KJVB 1I1AA 3CU1A 3S5LB 1JGDB 4WI3A 5DVMA 4N8CH 4LRNH 1ONQB 2IH1B 4FFYH 1J12A 2A1WL 3D9AH 2V7NB 4EI5B 1HILA 1QFUL 1RJZB 4NQXA 1D5BB 3AB0B 3FQXA 3QZWA 4HWNA 3ZYOA 3BW9B 3HPLA 4P2OD 5FKPA 2V2TA 2IBGA 2YXFA 3VI3F 3PNWB 2VERN 3BHBA 4RAVB 3WFEL 2G5RA 4GMSL 3S3SA 5HYJA 2BNQD 3O11A 1A21A 4HZAA 5KN5B 1U8KA 1PX4A 3ARFA 1CICD 2GY5A 3RWCA 5KJRL 3BI9X 3D3VB 4Z76B 4NT6A 5F7HA 3SGEI 5BZWA 4R26H 2VQUA 3ROOA 1SY6L 1HDMA 1Y18A 4X4XA 5FO8B 1J1PL 4Z0BL 3KPNA 3UTZB 5F6HJ 3Q3GA 4AQ1B 4HG4J 1RHHB 3SKOB 3QO0A 5F7NC 5DJZB 5CJ8A 3HG1E 1F00I 5DFTA 2DQEH 2VXTH 4OM0H 1YC8A 3OPZH 5D9SA 2HRPL 1NCAH 4IRJD 2FH8A 3NFSH 1DUZB 2VQTA 4HWZA 1I8LC 1MUJB 1MJ7H 5EB9A 1G7PA 1U3ZA 5FYLL 1EO7A 4AK1A 1R3KA 4UQ3A 1K4DA 1DEDA 2X89D 1JHTA 2A9NH 5IVXF 3GSOA 2XN9D 2FHFA 3E3QE 3T2QA 1MF2H 2NY3D 1HXMA 4FABH 1E27A 4RMSA 1QRKA 3DUUA 2D7OA 4ZOBA 3X12B 4IRZL 4YX2L 1K3IA 5GS1C 1ES0B 3KJ6H 2H6PB 4YHOH 1D6EA 2HTLC 3MUJA