1XGRB

Structure for antibody hyhel-63 y33i mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
AVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDIWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords antibody kappa light chain
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrB02
1JGLL 4KI5F 3MCLL 4IIQA 3N06B 4NO5B 4M43L 3S37H 2ZJSH 3KS0H 3MNVA 3RY4A 4IOSD 2I60L 3O4OC 2KZ1B 2CUHA 2ID5A 2XKUA 1LO5B 5FAAA 5FUZH 1DEEA 1Z9LA 4JFDD 4LHUB 5IQ9A 4MJ6B 4U3HA 5GHWH 4JN2A 3I85A 3VXUE 1BAFL 3D69A 1JF5A 2NW3B 1U41A 5HDBF 3GMNB 4B7LA 4I5BB 3UTPE 2B8OT 1RVFH 2ESVB 5ECJE 4N5ED 1IFHL 4U33A 2BY0A 4HUWB 3U0TB 3ARDD 1HQ4B 1IAOA 4GUPB 1I3RA 3C5ZC 4P4KD 2JJSA 3I6GA 4WHYG 3GSOB 2OZ4L 3WFDL 5I1DA 1RK0A 2K1MA 4CADB 4G42B 4P4KB 5EBMB 2WWKT 3SDAC 4NNPL 2UUDK 3OF6D 4GLRH 2FATL 1XMWA 4UDUB 3A6BH 3ARGB 5A16A 1FVCB 1MRDH 4OFKA 5HYFA 1FC2D 1UEMA 3QDGA 2JB5L 5JHLL 1GYAA 1YC7A 4QOKE 3QIWD 3GSNA 2AXHA 3REWB 1X5JA 4H1LH 4DVBB 3UTSA 4P3WA 4K9EL 2R56L 5CINL 4JG0H 4KVCL 3QEQB 1TZGL 3MLSL 1WV7T 2QSQA 4DZBB 4X5WB 5E6IC 3IGAB 1SJHB 3WFEL 4O58H 3VXMD 5MENA 5J6GA 4AG4L 2B7DT 3QEQD 4HIEB 1K6QL 4Q9QH 1LO0H 2BC4A 1TITA 5D5MA 4NKOA 5E08H 3DSFL 3B2VL 5DD0L 4GRLB 4XVUC 1BZ7A 4DOHE 5T1LD 3IJSA 4PRIE 4L9LB 4LHQB 3QFDA 1FRGL 2VMFA 1YEGH 1P2CB 1W0WB 3VDCA 3GMOA 3B9KA 5JXEC 4MSWB 3UZVB 4JE4B 5F3BA 4F3FB 1S7WB 4ODXB 2A38A 1C5CL 3FT2A 2VAJA 2P5WB 5BRZD 2ZCHL 3DTXB 4N1EA 5CKGA 1LE5B 3NA4A 3TBYA 4CJ0A 3BEWA 1P6AB 1U8NA 1DN0B 4M5YH 4HCRH 2WV3A 3MRHA 4NNPH 4I3RH 5DQJA 2YA1A 4J6RL 4YFDB 3QXAA 4K2UL 4B50A 3DO3A 4O2FA 2HWZL 1YNLL 5D1ZA 5GJTL 4KK9D 2A6JB 1LP9A 2A9NL 4QGYA 3ZE1F 4CUCA 1D6VL 1JRHI 4PRAA 4M93C 1WK0A 4KXZH 4HS8L 4CN1A 5AYUH 4QTIH 5CEZL 2BDNH 5CS7A 2DJUA 4UV7H 2CO7B 2HFGL 5H94A 4U49A 3KXFD 3PWVA 1KULA 1N0LA 2W92A 5IR1A 1E4JA 3KXFB 4LSRL 3FCTB 4BH7A 2Q86A 3IJHB 5EU6B 2AEPL 5LBSH 4EI5A 5DJ0A 4LVHB 2OMNA 5EUOB 4Z7NF 3TP4A 3VD7A 2HT3C 4OT1H 2C9AA 4GW1B 3OTTA 1N2RB 2RJMA 3WUWB 1KELH 3O4LD 1U8JA 1IC4L 4JRYA 2BMKA 1NCAL 3DROA 1NCDH 2WUCH 4W68A 1A7QH 3ZDZE 4CU7A 1KTRL 1I1AD 3V6OC 3SDDD 3SJVE 3U4BL 1NGQH 1PG7L 3IXTA 1UQSB 3T65A 1FBIH 5BZDA 1EAJA 1FL3B 5GISH 3UP1A 4P23D 1MFEL 4P23C 4M7JH 2VQUA 1M7XA 4H0GA 5BMFL 1NGZB 1WSST 1DBAH 3O45B 4CAGA 1YDPA 5T3XL 5A43C 2VXSL 4JFZH 3VXME 4Z7UF 4L8SC 3H6JA 1BFVH 1L0QA 5IEKA 4JZOB 3CDGA 2FBOJ 5T1KA 4Y1AD 2AV1B 1CCZA 2EEDA 5GGQL 4X99A 5DI8A 1T1ZB 3DNKA 4POZC 1X9QA 1F3RB 4AQ1B 2B4CC 2YK1H 3Q6FB 4XGZA 4ONFH 2N7AA 4OFYD 1DANU 2DS4A 1T3FA 2AEPH 2EDBA 2VZ3A 1ZKAA 3SQBA 2UWEF 4Y2OA 3W39B 1CDUA 3T0AA 4H26A 3ZDXE 3VFVB 3K74B 1AGCB 2NZ9C 5IJKA 3L3KA 3I2CL 4Y2DC 1DQJB 1M7IB 1BGXL 3JWOH 3AGVA 2JB6A 2PXYB 1FFRA 1KLUB 1NCAH 5E1AB 5KG9A 5CBAB 1GGTA 1D5ZA 4LCWA 4HULB 1VACA 5C8JB 4NN7B 4NQXA 5LXGH 5C0BB 1T2JA 5DURB 3GRWL 3AVEA 1KN4H 3PQYE 4PY7A 5B21A 1IZKA 2Q8AL 2ATKA 1QFHA 5GISL 4HH9B 3T1FA 4XBPA 3LRSB 1NCBH 4YFEA 5FYLE 1F8TL 3Q0HA 3KPNA 2Q7NA 3SKOB 2JELH 1WZMA 3LEXB 3UTZB 2UY7A 4J3OC 1LK2B 2WQ8A 3MNVB 1GOFA 4NO2A 1FG9C 1FZOB 2QSTA 3ELAT 5EA0L 4QXGH 3UXFA 1VB9A 4NUJB 3NOIA 3VFSA 1TQBB 3V0WL 2IH1A 3EYVA 3GB7A 2D31A 3C5JB 4RGOH 2FGWH 5K33A 3HR5A 4JPKL 2YK1L 5J13B 2XQBH 1T7XA 3MUZ1 1ITCA 3GMNA 1E6OH 1TQCB 3HCVB 2ESVA 4LDLB 3VFUA 4MQXC 2A77L 5I9QB 4GXUN 1D6EA 4NC0B 1TJHH 2EH8L 2V2WA 1A3LH 3SDYL 1PAMA 2NXZB 3AU1B 5MEQB 2HT4C 5FYJD 1RK0B 4NKDA 1S7VB 4UTAL 4G42A 4P4KA 5F9DC 5JTWA 5CBEA 3GBNH 3BJLA 4OIAA 4WO4C 1QRND 3B6SB 1KCVH 3RIAK 3TBSA 2J5LB 3SQOH 2XQYK 1RQ5A 3DJ9A 5HGAA 3RWDB 1QRNB 3WHE1 5DZOA 4WTXA 2YHGA 3RWGB 3QDGB 4GKNA 5IHLB 5H37G 3RWJB 5JUEH 4MA8H 4FZEL 1X7QA 2WANA 4NRZB 5KVEL 2EXWC 3OX8B 1UM4L 3PWUA 1B4RA 1PFCA 3GMMA 2A73A 3S36L 1RZFH 3TESA 1G7JA 4QF1B 3WO3B 4EIZC 2HVJA 2QR0B 3LB6C 4IIQB 5MENB 2DLFH 4GQ9H 2XICA 4NKOB 3V0WH 2SEBA 4HAGA 3PV7A 1QSFD 4YO0B 2XZAH 4L1DA 1VFBB 1HZHL 4L9LA 2COQA 5T1LA 3BP7B 5IQ9B 1X5ZA 4LRIA 4OIIH 3ILQC 3S7GA 2XZQH 5I1JH 4PGBB 3S5LA 2NW3A 3PXHA 5IBTH 2R1XA 4JR9H 4LSVL 3D6GA 1HXMB 3UYOD 3MCLH 3I6GB 3GJFB 1V5JA 3F7VA 3GBNL 4M43H 3FRUB 2IAMC 2D7QA 2P48B 3CD4A 1XZ0A 5ENWA 2ED9A 1I8LC 1C7SA 3BGMB 4G8IB 3CVIL 1A22B 3GMLB 1FFNB 1K8DB 4GRWE 1OAKH 5ESQB 1R0AL 3DMMA 4YXHL 3KPSE 2H32A 2YN5A 3JV0A 1FVCA 3MCG1 1S9XA 3PDOA 4LAQH 4ZUSB 5CGTA 3BZFB 5JDSB 2AEWA 2DB8A 4M61A 3D85A 1I8LA 3UEZA 4YDKL 3KXFA 3MPCA 1UWGH 1TVDA 3CSYA 4OD3H 4FMFA 1L4IA 4DGVH 1JWUA 4P59H 1OGAE 1Z6JT 2BC4B 1NJ9B 4FFZL 2ARJQ 3G5ZB 4LAJH 1EXUA 3Q3GB 4DWHA 4OQTL 4FA8A 3KPOA 4ODHH 2BP3A 5IROC 3MC0A 5DD3H 1X5FA 3OZ9L 3PP3K 2L7JA 1CYGA 4R3SB 1BX2B 1N5AB 3PQYA 4HLZG 4X4YB 2FSEB 4WEBL 5I1IH 3KDMB 2DI8A 1J8HE 4QY8B 3KR3H 4JG0L 3MRKA 4GAYA 4ONGL 5DJ8A 1U3JA 3K80A 4WTZA 3RL2A 5BZDB 1TJGL 3CNKA 1IBGL 4U1SB 5D4QA 1U92A 3M8OH 3OB0K 3ARBC 4HSQA 2MCPH 3H3BC 3BUYA 4M93B 4HZAA 3H2WA 4YPGB 5FCSH 4EDWL 2JLLA 4LCIH 3MRFB 3QCUH 2G75A 1LO4L 3BE1L 4GS7B 1SMAA 2AJZB 1IL1B 3IS0X 3P4MA 4XWGL 3DUSB 2AV1A 2RHEA 1SBBA 3S3JA 3GI9H 5DI8B 4I77H 5EWIH 4YXLH 3WIIH 3WIFB 2D7OA 3EZJB 3QDAA 2GHWB 2UZIH 1OW0A 4RA0C 2W1NA 3D87B 4JFYA 4R2GC 4F7CB 1DBMH 2FHCA 3EDEA 3PWVB 2EXWD 3HNVL 4EXKA 3FB7A 2GFBA 4LEOB 3BKYL 1AQKH 1FYHB 3R06A 2Y25A 4LNRB 4TVSa 5EULV 1UXWB 5JHLH 3LS4L 3UZQA 1U2HA 1A5FL 4Y16B 4M6AA 3RWHA 3D3VB 4LF3A 4UBDC 3K4ZA 4RFNB 2YKLL 2PXYA 3MLYH 3FZUC 1BQSA 1KLUA 3ZMRA 4O4YH 1KIRA 1X3DA 1BFSA 3U7YH 3MLSH 1V7MH 3U30B 3RX8A 2EDOA 5C8JA 3H9YA 3DROB 3B2UC 2HVKA 4PBVC 4YUEL 1OTSD 1P69B 3DRQA 4L3EE 5AZ2L 5C0AA 3ZDXF 5DQDL 4JDVB 4M4RA 2DF3A 1IBGH 3V6ZA 1LDPH 3LRSA 3UC0L 3S9DB 4J4PC 4X7TB 2CH8A 1QFWL 3O6ML 4QWWD 1IKFH 2XA8L 2X4TA 1GZPB 4LASL 4PJXB 1FZOA 4R26L 5T1MB 4OZ4A 3W2DL 2RR3A 3LH2L 1FE8L 3OV6A 5D7SL 4JZOA 5CIPA 4V2BA 1KJ2A 1TETL 3ARYA 2E9WA 1UWXH 4NSKB 2YMXL 3Q6FA 4XGZB 5D7IE 3NFSL 1BOGA 1AR2A 3QUYB 5DUML 1LK3L 3NA9H 1GOGA 1P4BH 4E41B 5L88L 2OL3B 4AJ0A 3S34H 4LGSB 1HXYB 4NKDB 4LLWB 3CFDA 4PD4J 3UO1L 3IDUA 3SGJC 4Z7WF 3V4UH 4PJ9A 4W4OC 4ZNEE 3TPUB 1OQXA 4P46B 1KTLB 5C0CD 2APVA 4JFHD 2HMID 1S5IL 3ALPA 5HGAB 3SO5A 2WWMC 1JYVA 5DO2D 5HBBA 2F54D 2OYPA 4Y0GA 4AIZB 3HI5L 3BDYH 5F72S 1YMMA 3GJEA 3UTTD 3VXOB 3OKMB 4LSTH 5DJDB 5E1HB 3VCLA 2HFFB 2A73B 1WEJL 3UX9B 1N8ZA 3HG1E 5KVGH 3MBXH 2OBGA 4PP2A 2HVJB 15C8L 4HFWB 4XNQB 4YHZH 4PJGB 2GSGA 3FQXB 3S96B 3UTZA 5DFVD 3SBWA 3OJMB 4NKMA 3IU4L 3QEGH 4QHLB 3IDYB 3QIBA 1VGKA 4OCSL 1RURL 3FN0H 3OXSB 2OZ4A 3CU1A 1HSAB 2IH1B 3EDFA 1A6WL 1HQRA 4OGZA 4YO0A 2YXMA 3GRWH 4K3DH 4BZ1H 2CKNA 4LVNC 1MQ8A 1QSFA 4DN4H 4NZTH 3HR5B 1J86A 2BY1A 1JYNA 5IT2L 2O61B 4HF5L 1DE4A 2R1XB 3CGTA 5GS2H 4QNPF 3R1GH 2J8UE 2X1PA 3WNPA 3F6IA 2W9EH 3TZVD 1CL7L 3RZCA 4GMSL 3U2SB 4RFEB 3QNZA 5MEQA 3DV4B 4QXGL 4X8JB 1EO8H 3QDME 1G7IB 4KJPD 2P8MA 3BGMA 4G8IA 1DL7H 4IDJL 1GGCH 1TVBA 1IQWH 1B2WH 2H8PA 4XC1H 4ZS6C 2L7UA 3GM0A 3BP6B 3FT4A 1FO0L 2XY1A 3HTLX 4M8QA 1AXTH 2A9ML 2C4XA 3DMMD 1S9XB 2EIBA 1VEOA 1JZ4A 1H9VA 1HHHA 1T1XB 5HHOB 3MRGA 3OX8A 3TH3T 2B4CL 5F9WB 1KXVC 1BF2A 1VHPA 2HJKA 3BN9D 4KQ4L 4AQOA 1FGNL 2IFFH 2YBRA 4QO1A 5FYKU 3GUTA 4X6BB 1R3JB 1FO0A 1U91A 4PJCB 1A7BA 1EXUB 2PYFA 2HYMA 3X3GH 3KPOB 1B6UA 5F93C 5DO2C 4LCCA 2J12B 4XAKD 1ODAA 3BP7A 3MLUL 5I1CL 2DLIA 5KVEH 5C0CE 4LL9A 4LKXA 4YR6B 1T22A 4MXVF 4HFUH 5E8DL 3QNYB 2LVCA 1U8PB 3MRKB 4GAYB 5DJ8B 1CQKA 3JWNC 5DK3A 3N9GL 2F53D 1BHGA 5HHME 4LLUA 1MJJB 1N0XH 1OARH 1QLFB 1K5NB 3P40A 3JWOC 5TJWK 1DL7L 4IDJH 1KTKE 1QUNA 1CFVH 2X4QB 3RY5A 1YEJL 5C08A 3D39A 5LG1A 2VZ1A 5JW4N 3GMLA 1FFNA 1K8DA 4U1JB 5I9QC 5GRXG 4HXAH 4WEUD 5KSAC 3LZFH 5AWNL 4MJIA 1JTOA 4UTAH 1LWRA 4TQEL 4XNZC 3ETBF 4PJGF 1N6QH 5ITBH 4YHKH 5EZLB 2BJMH 3CSGA 2CJUH 4Y5XB 3HE7C 5L7XL 3FB7B 1CBVL 3DETD 2FCBA 1MAML 1RPQA 3BKCL 4OCRL 2OK0L 35C8H 4OD1L 1JZ8A 2DL9A 2FNBA 1T7WA 4XX1G 1CXKA 4XH2A 4CMMB 1NH6A 3G5ZA 4JN1H 3RU8L 3SDCB 3DWTA 3FQNA 3T3PF 1X5LA 1IFHH 5FOBB 2IBBA 3RTQB 2BFVH 3O2VL 2VN4A 3SDAD 4P5TA 1BX2A 1NKOA 4X7FC 1M6OA 1MHHA 4NHCL 1KFAH 4NN7C 1OW0C 4KHXH 3QXUA 3GK8H 4QY8A 2K3TA 2QKIB 4HWEH 3QI9A 3RGVD 5EZOH 3WYRA 4RFNC 3V6ZB 3PG2A 1G9ML 2ESVE 3SBWC 3BDBA 5E2VH 1HZHH 4U1SA 2D7TL 4U1MA 3JTTA 1U92B 3PWNB 4OIIL 5IFJA 4X6EA 4BFIA 4KRPB 1OT2A 1WFTA 5IBTL 3O3UN 4G8GE 3MOQA 4PJXA 5T1MA 5JOFA 5F8QC 2G75B 4LK4A 3LOWA 4M1CD 3WL9A 4F58L 3HR6A 5BS0A 1L6ZA 5EUKB 1P7KB 3NIDE 3QEUA 3HE6C 3EYQC 4MCYA 4D0BB 2HTLD 1QPXA 1U9KA 1IGCH 4KKBD 4NQCA 4NSKA 3K46A 5BZWB 4JFYB 5LWYH 1MAMH 5IVOA 1UKSA 1K3IA 1MRCH 4JRXD 3SGJA 4RMWA 2AKRB 3DSNA 4LEOA 1OWWA 4DKEL 3R06B 4LNRA 3TNMA 2FL5A 5GGTH 1L7TL 1HXYA 1OAQH 3P0YH 4UT7L 1R3KB 5ADOL 4U1HA 3DXAB 4LF3B 3BT2L 1INQB 1KT2B 4LCWE 2Y36H 4UTBL 4HIXL 2FGZA 2P45B 3WJJA 1MCPL 5KSBB 3OQ3B 4XXCA 2H3NA 3DIFB 2V17H 1Q94B 1EBPA 4JQXC 4LSSL 2XY2A 4K94L 4I0PD 3JV4B 3NFPB 2Z31A 3ULUL 4EN3C 5C0AB 1BVKB 4N0UE 4PRHD 5J1AB 2B1HL 4K7PY 3AREB 5IV2A 4NQEE 3HG1D 3WBDA 5I15L 4X7TA 5EO0B 3OG6B 3MRNA 5H2BA 4Z7VE 1YNTA 2P24B 5H35A 1UYWL 3UTTE 1ORSB 3NIFF 5CEXA 4PJIA 5SWZD 4KJYA 1MCCA 1A8JH 5CZVL 4LLMB 1H8OA 1KACB 4XNXL 4AEHH 4G3YL 2YA2A 3PP3H 1AHWB 5CIPB 3M8OL 3TGXA 4HKZB 4X98A 1MF2L 3TO4D 2EYTB 3CLFH 3LQAH 3QFJA 4LRNH 1CGTA 1X5XA 3LKPA 3BH8B 2J6EL 3BP4B 1N26A 3MRBB 3O6MH 5GS1B 4XT1C 1IKFL 1WLHA 2YZ8A 4L8DB 3DV4A 4X8JA 3W2DH 2NXYB 2OZ4H 3P30L 3G5YB 5F1OB 1RIHH 1TVBB 4OGAC 2H1PL 5B38B 4P46A 1TTUA 3DHJA 1INEH 3RVTD 1FORH 2NYYC 3BGAA 4CNIB 1YECH 2ZNXA 3V4PL 1J0IA 4M8QB 1YMMD 1XIWB 4QOKD 4KWUA 3GO1L 3K1DA 4AIZA 1HHIA 3OSKA 3ILPB 1YMMB 4LMQE 4TPRH 1LK3H 1T04B 4LHUG 4ZO9A 3TCLB 3VXOA 3VGAB 2WP3T 3VCLB 3ARQA 4YXKH 4PJ7B 4M9PA 4H0HB 2ICES 3JWDH 1I9JH 2Z91B 4JRYD 5C0ND 4PJGA 1HINL 3FQXA 3S96A 4LSQL 3X17A 1A6PA 5SX5H 1XH3A 2VLKB 4C56A 4AEHL 1IAIM 1M7DB 5TQ0L 1LDPL 4LCCB 1DLFH 5I17B 2YEZA 2NY3B 4NC2B 5KSBE 4ODVL 2IANE 1KBGH 4IS6A 4U6TA 3L6FA 1IGYB 4RWYH 4OCXH 1U8PA 3RZWA 4R26H 1Z0NA 2I07B 2IALA 1IT9H 5B3NA 4OZIE 2GCYB 1OF2A 2HT4D 4RFEA 2OR9H 1XGYL 1CD1A 1IGJB 5CIPH 1F4AA 5DFVC 4JG1H 4PJCF 1PG7W 3MRDA 4HJ0D 4PYHA 5EZIH 5BVJA 2Q8AH 4FFWD 5AUMB 3D39B 2Z8WC 5E8NB 1R3HB 3UYRL 3FT4B 1PYWB 5EOQL 1HIML 4JFFD 4B41A 1F8TH 1FLRL 2F19L 1RZKH 2JCCF 2VERN 1G0DA 2FH6A 1YNKL 3TBTB 4LCYA 2IQAA 2PYEE 3CIQA 4MJIB 1XIWC 3UO1H 5EC2A 4YEFA 1E28B 1ITBB 2K7QA 1ZLSL 1T1XA 5HHOA 4GKZB 4OTXL 3IDJB 3ZE2E 4Y4FC 4UV7L 5A2IH 1B6DA 1R3LB 4G80B 2H6PA 3MV7D 1QSEA 4XRCA 3GUTB 3QO1B 2Q8BL 1FO0B 1U91B 2DKSA 2FZ3A 4ZXBC 2X9WA 4NRXA 3FMGH 1BBJB 1HE7A 3BDYL 1BVLB 1RHHB 2BK8A 2L0DA 2R9HC 2YD4A 4XPBH 4NT6B 3RTQA 3U6RA 2FO1A 1RZGA 1XF3A 5F6HI 4HJJL 4RWYL 1UH2A 1YA5A 4JO2L 3EGSB 1LMKA 1EBAA 1T22B 1EHLL 4BUHA 1EAPA 2A1WL 4LPTA 2NNAA 4RGNC 4NGHH 4LHJB 1U95B 5K59E 3UCRA 4KY1L 1TXKA 1AY1H 1MJJA 2VDOH 4P2OD 5DJZB 1NMBL 2YPKA 5DSCA 4IRZH 4JFDB 4LHUD 1JF1B 1YEKL 4V1DA 2IBZY 5TDNA 5L2JA 5KS9B 3B9EA 4Y16C 2CRIA 3E8UL 5EOQH 3CDFA 4DFIA 3SE3C 2ESVD 4ZOEA 1AE6L 4S1DC 1BPVA 4V2CB 4KC3B 2XNAA 3OKNA 5SWSA 4JFZL 3HLAA 1ZA6B 4D0BA 3KPSB 5DTFA 1MPAH 3CLEH 1IKNC 4NQCB 5DEGB 1SQ2N 3L3GB 3NPZB 1NMCB 4Y5XA 1WCQA 3QH3A 3VI4F 5T3ZD 3DGGB 3TNMB 1K4DB 2FL5B 1DTUA 1S5HA 3TBWA 4ZNEA 3L9RB 4X0KA 1EHXA 1YYLL 2NR6D 3DRTA 2IMNA 2P5ED 4M62H 1D7FA 3VGFA 2FX8L 3FQNB 5FOBA 4HBCL 5KSUA 5KSBA 4U7KA 5J0BA 5FDYA 1F6AB 3TT1H 2DDQL 5CGYC 2HRLA 3VWKB 2DQHH 4HLJA 1MREH 3ZSSA 4PRHE 1KB5A 3LV3B 4J3UA 2VDOL 3ME0A 4Z78A 4M4PA 1LO2H 2WM0A 5L2KE 4CVUA 5DWUH 3OWEA 3QDJE 3JTTB 1RZ8B 3Q1SH 4HEPG 4TUKH 5I8CA 4YDLC 1ORSA 5CCKH 1SVCP 5SWZE 3BRGC 1F42A 3H9SD 5J06A 3FTGB 4N9GB 2DQFB 2P5WD 3WL9B 4M3JA 3MOBL 4JPWH 4XP1L 3OR6B 1MFBH 5D7LD 4OD3L 2CIIB 2V2TB 1TNMA 4ERSL 1PSKH 5C0BE 3GHEL 1Q0YH 1H3PL 1TCRA 3PWPB 4O02L 3RP1A 3W5MA 2VZUA 2BRRH 4P2RD 4DEPB 3EO0A 4HXAL 1EUTA 1AGBB 4XNMA 3LZFL 1NFDA 4ZXBA 2WIIB 3V52L 3DI3B 1TJHL 5BV7H 4G6AC 2C3GA 3KYMA 3DXAA 4K3EH 3S4SA 1FJ1B 5LCVH 2J88L 43CAA 3QG7L 3PABB 2A6DB 1U8IA 3CCHB 2DQJL 4MZ2A 3TT1L 3KLAA 2JK5B 4H25A 1R5WB 1FN4A 1XR8B 5GSVA 1Q94A 2OK0H 1XGQB 1XIWA 1I1RA 1G7HB 2GJ6D 1CGUA 5I19H 2Z31B 3TLRA 5EC1B 1ZEAH 4HUXB 2YUXA 2ADFH 4Y7MA 1M05B 4XNYH 2ERJB 4PJ7A 1U8QB 2NY5C 5CCKL 4XB8A 4CKVX 1UM4H 1PLGL 3BWUC 5IF0B 1EEQA 4KVNL 5DQ9A 3KVQA 3EFDL 5H35B 3I02B 1U58A 2IAMA 4PJIB 5FHBL 5EUOE 5KJRH 5I6XB 3WN5A 4C56B 1I1AB 2ADJA 4OFIA 3QIWC 3MLWH 2DQUH 2NXZC 5I17A 2GTWA 1WJ3A 2AEIT 2D7TH 4NNYB 1JFQH 3T2NL 4X98B 4U1KB 4XI5C 1A14H 1JZ6A 1YEEH 3T0XA 4Y4FA 4K71B 4OM1L 5E6YA 1A1OA 3BH8A 1PKQA 2CKBB 2IALB 1URLA 2GCYA 4ZOCA 3QPXL 1CDJA 2PO6A 2BOBB 2WWMD 2EDXA 3H0TA 4L8DA 2CRZA 3BMVA 4GRWH 1EEZA 1MEXL 5C2BH 1BJMA 3MRDB 3IT8D 3C6LC 3FL7A 1G9NH 5AUMA 1UFUA 1T1YA 1T7ZA 4JHWL 4JO1H 1F00I 3P0VL 5DRXA 4M6OL 5HJ3B 3H9SE 4TSCL 4TNVF 5I8KH 1T21A 3EJYD 3UTSD 4YXHH 4LCYB 2IQAB 3QIUC 1UM6L 3IXAB 2P5WE 5EC2B 5I8EA 1S9VA 1N7ML 3ILPA 3MLZL 1UZ6E 4XP6L 3ZKQD 1NDGB 1KG0A 5HGBA 2R1YA 4F57L 3BIBX 2DQCL 3QXDB 4G80A 4FQXD 3OPZH 1X5GA 5C0FA 3PHOA 4LSPL 4ONHA 3K4DA 1XH3B 3BKJL 1FVEA 1BVLA 1T66C 4ODSL 3EOYG 5K9QG 3SE9L 4NT6A 3ULVC 2A0LD 4WIQA 1RIVH 3PL6D 2EDFA 1P4BL 2R4SL 1IC7L 2VWEC 5EB9A 1U93A 4C83A 2OL3H 4OM1H 3L6FB 1A6TA 4P3CL 2VN7A 2VXVH 3FO2A 2OP4L 4HWUA 4D3CL 4LVNB 3J7HA 3LPWA 1BD2A 2NNAB 43C9B 3VH8A 4ZTPH 3R4DA 1KTDA 5KZCD 1MEXH 2DI9A 1OF2B 1K6QH 4FQIL 1CD1B 4Y4KA 3IKKA 3C5ZB 2R0LL 3ZKXB 1G9NL 5DDHA 1FGVH 3L7EB 5JW4M 4V1DB 2V9TA 5D1ZD 3DX7B 5E8NA 2LVEA 3GM8A 1MCEA 4X5XA 4N90E 4A2LA 2XNAB 2I5YL 5I76B 5D71L 4GRWB 3KAAA 4PY8J 1MFCH 3CFJA 3EO9L 3D18B 5DTFB 3O3AA 3QAZB 5DUPH 2ATPB 1KCSL 4WW2A 2R15A 5DD6A 5EOTB 1YQVH 1UWEH 1YEIH 3X14A 3BH9B 5DRWA 5E70A 4X0KB 3FFDB 4LMQI 4JZNA 3K8LA 3OKLA 5IW1A 2ZPKL 1D9KD 4R9HA 5GJTH 1HIMH 4ODWA 1B0WA 1SJEA 1DFBH 3R1GL 3RWIA 4NZJA 1AO7A 3F5WB 2AXFB 1IVLA 1XF3B 5EPMA 3D5OF 2O26U 5C9KA 2EDNA 1MCFA 5F7NC 5SX4H 1HINH 5FB8B 4PREB 3HN3A 2ZG2A 4OJFH 4OF5A 2EDKA 3LV3A 1NLBH 1FFQA 4YUEH 3NTCL 4XZUA 4PRBB 5JQ6H 4HKBA 4WFFE 2YPKB 4AL8L 1MNUL 1BECA 4L3ED 4ZPVB 2NY1B 4HWZB 3W82A 2NY4D 4KI5D 4OT1L 3C8KB 3IJYB 5DZLA 4N9GA 3QDGE 2N7BA 3QDJD 2OQJA 2NTSP 1WIUA 3DVGB 5SWSB 4HC1H 2R8SL 4KJWD 2CDFB 3HLAB 5FGRA 2CIIA 2V2TA 5ESVB 5HHQA 3BPNB 4NGHL 4JZJC 3FQTB 5J11C 1JK8B 1KCSH 3L3GA 4PV9A 2VE6B 4HIIA 1GHFL 1F3DJ 1P5VA 3EO0B 3TYFA 1A0QL 5K9QI 1T83C 3T3PE 1HWHB 5T3XH 1R5VB 3S5LG 4NBXB 3QUZD 4YEEA 4MVBD 4Y89A 4ISVA 5KVFH 3QZWG 3EUUA 1U8IB 4UNTA 3TFKD 1HKLH 1XF5B 4I3GA 4R0LC 4I0PA 3X11A 4OLYL 1S7UB 1FN4B 1XR8A 4M1CC 4H88H 1ZLWK 2AJ3A 3JBG7 4UQ3A 1KB5B 5IB4B 1SEQL 4MXWH 4R4FH 5GGTA 4XMLL 3DX9A 4AL8H 1U8QA 1OAUH 2IPUK 4HKXB 1E4XI 4FQ1L 4FNLL 3H7LA 3QEQE 2EH8H 1WIOA 3NZHH 1Q9LA 5FKPA 3WN5B 4QXTB 3MJ9H 2ADJB 3KPRD 3LKSA 3DLQR 3WCYA 4XB7A 4Z7OF 3BPLC 2PTUA 3MV9B 1OB1A 1CD0A 1GGYA 3VWJC 3E6HB 1KN4L 3KPRB 5E5UB 5IOPA 3IDMB 4RGMB 4QRRE 2CPCA 4K3DL 4BZ1L 1A64A 2A0LC 2J4WL 3U0WL 5I2IA 3QUYD 2EZ0C 4JY5L 4JRWA 1T66D 4HEME 4P0DA 4JN1L 3RU8H 1RZ7L 1D5MA 4O51A 1AXSA 2CKBA 3MMEB 4L5FH 5L0QB 3HB3C 1NBZB 4D8PB 4D9RD 5C1MB 4UB0H 5EOCJ 3UTQB 3R8QA 1RJZB 1TTFA 2CLVA 5D1XD 1ZMYA 2ICCA 2UY6A 3DECA 4R7NB 4Z7UE 1I9IH 4FABL 3IRPX 3PABA 2F74A 3INUL 2DQGH 5EORL 1DBBL 4H25B 3HC4L 1DQQB 1FDLH 1RZIA 3E6FA 5D93B 5HHOE 1MY7A 1AC6A 3IXAA 1T6WA 4R4FL 1A7RL 1NGXA 3AROA 4MJ4A 3ZE0E 3MRQB 4ACPA 4ONOA 1U3HA 3C08L 3Q6GH 5I1JL 1IQDA 5MP6L 1RUKL 3JTSB 2FR4B 4KMTL 3NCCB 4G7VH 5C6TH 3EDJA 5E0QA 3RNQA 3SDXB 2OR8A 4AY0A 3TVMB 1B0GB 2IAMB 4QGTA 1IGCL 1EUUA 4QRQB 3VU2A 4LSDA 1C16A 3C9NA 4WW2F 3VXTA 1SJVA 2UWEB 5D8JH 4BZ2H 3K0WA 4JZJA 2GTWB 2DYPA 2J4WH 4Y4FD 4I4WA 1OGTA 3H9ZA 5C09D 1A6TB 1RVFL 5ADOH 2Y07H 4R90L 1AR1D 1CE6B 2PR4L 4KRNA 4PRIA 1MCPH 2PO6B 1JIBA 4XPHH 3CMOH 4OLUL 4CRPA 3LMJL 4GO6B 4LSSH 4ORZC 5DDHB 2V7HB 3JV5A 4GW4A 5FGCB 3MTRA 4HJ0C 2UVEA 4XMPL 4ZO8A 1J0HA 4R0LA 1D5XB 1UEYA 1OQOA 3E3QC 5CUSL 5CWSA 1J8HD 4O2CB 5M94B 1G1YA 1MLBA 2BNRD 5DD5H 1TZIB 4WU5B 1CR9H 2OJEA 3IU3A 4S10A 1XCTB 2JJTC 5BV7B 3PNWA 5F8RC 1K2DA 1NDGA 2J88H 3VI4E 4TQEH 4TVPL 1WVZA 4O58L 4YNYB 2FX7L 1AKJD 4YHKL 3DBXB 4JVPA 3THML 2CLZA 1CLOL 5EOTA 5KSAB 4MX7B 3FQWA 1JYWA 4GAJH 4ZAKD 3SO3B 5SV4A 3VXPB 1OAKL 5FXCH 4JO1L 4PJAB 1J1PL 4HS6B 1FVEB 2FD6H 4IOIA 3TNNB 1YPZA 4RAVA 5FOJA 3RWIB 4WENB 3ZTNL 1FV1A 2KQMA 1AO7B 3TYGH 4EDWH 5EPMB 3I3EA 3P9MB 4FQLL 4MD4A 5EU4A 3TV3H 3ULUD 1U93B 2Y06H 3DGCR 1DVFC 2RCSL 5ESAB 5I16A 3W0WD 1FFOA 1FAIL 4XWGH 5EZJB 1BVZA 2J2ZA 5HDBE 4FG6C 1A4JA 4HCRL 3ROOB 4JKLA 2YD1A 4Z95H 4KK8D 3VGGA 4WWKA 6CGTA 3ARSA 1JFQL 3PF2A 4MVBC 4RMTA 1GC1L 3GIVB 2J1KA 5ADPL 2AV7B 4JDTL 4X5XB 1EZVY 1NGYB 1EERB 5CJQL 1ZT1B 4PY8I 2H32H 4UU9A 5C2BL 4IRSD 3O0RL 3FQTA 1WZ1L 3P2TA 4XP5L 3KJ4C 1BZQK 2VE6A 5FA4B 2FIKA 4IRSB 4JFXA 2ATPA 2VLJA 3UPCA 5I1AB 4XBEH 4TVPE 2NY2C 5JO5B 2C4FU 2O5XL 2P5EA 2R2HA 3BIKB 3IFOA 1ONQA 4MDIB 5KN5B 5GHWL 1J5OH 1YYML 1WQVT 5DEFA 5JOPE 4KDWA 1BREA 1D3CA 1VCAA 1OWRM 4MAYC 1IC1A 3I75A 4FQLH 1I3GL 3RWEA 2ZP0T 3GI9L 1MFCL 3EO9H 5D70H 5IFAH 1BFOB 3QULB 5DVNA 1H3XA 7CGTA 1RIUL 1IEHA 4U1NA 4PREA 5IUSA 1MAKA 1FBIL 1A6AA 5IQ7H 3QUXC 3O6LH 1EEYB 1JMXA 3DV6B 2FDBP 2E6JA 4KRPC 3WNOA 1HKFA 3ARFD 1DBJL 4ZODA 3GJFH 1GPOL 4GAFB 4NQSA 4X4ME 3VXNA 1J18A 1OTUC 5FKPB 4YZFF 5F71A 3KPRE 1GRWA 1OCWL 5IB5A 4BKLB 2NY0C 3FO9B 1OB1B 4RMVA 1S9WA 2NCMA 2OQJB 5JW4R 5DRZA 4ZSOE 4YAQA 5EBLA 5DR5L 2JF1A 5HHQB 1EHAA 2EXYD 5E8EB 3FZUD 3QIWA 3BWAA 3HE6A 25C8L 1MHCA 1ZVSB 1T0MB 1WBXA 4C55A 4D8PA 2ERJC 3EKCA 2JJVA 3D2UD 4RNRB 1ZLUK 2DD8L 1I85A 3UTQA 4BM7A 3F7YA 1ZS8B 4D9LH 1UXSA 1A3RL 3BZDA 2FRGP 3T3ME 4OZHB 5BVPH 4X4MA 2ZUQC 4R97C 1IAMA 5E94B 3RAJH 2OXGA 1RZIB 2EEBA 2C3VA 3MV7A 1J0YA 4HGWB 5ACLA 4OKVA 4LPCA 2AJXL 5D6DA 2YWYA 3ARED 1M71B 4AT6A 4BK5A 2O5YH 4UQ3B 1QNZH 1U3HB 3SJVD 3NA9L 5IB4A 5C0RH 3GSQB 3JTSA 3QDMD 2FR4A 3G9VA 2UVFA 4Q9RL 1QBLL 5EUOF 5HYSB 1CIUA 4ZPTA 2Y1VA 4J3VA 4LLDB 4DTGH 1BBDH 4TSAH 3VXUA 4OIBA 5J12B 3UROR 3SCMB 4M48L 2W9LA 1CFQA 2UWEA 3UMTA 2DQTL 4F15C 4MB3A 5IHUH 2OLDA 5TH2A 1T0PB 4FTVE 1T1WA 3IDMA 1SYVB 2DM3A 3HI5H 5A40E 4L4TB 1YN7B 2A77H 1IAIH 4KRPD 25C8H 3ET9F 2LV4A 3O8XC 3ZYIA 3OKOA 3H7BA 1FPTH 4HCRA 4GSDL 4P2QD 3QQ3A 2W9DL 4WHYH 1IT9L 1KELL 4OLEA 3SDXF 3MLRL 3PV6A 3UZEA 4N68A 3TZVA 2E8YA 5F7EH 3FN0L 3WLBB 3NN8B 5HI4C 1JPTL 1RJZA 2LAGB 1H5BA 4L8BA 4JG1L 4IRSC 3RDTD 4HXBL 4D0CA 3EO1B 2G60L 1JNHA 4WDIB 4MDJB 1IC5H 3I6KA 4N8VA 2LAAA 3BYTA 1BM3L 2E27H 4HF5H 1QKZL 3UYRH 4B0MM 1S3KH 3LKNB 3X3FH 1VERA 5F7DA 4MJ5A 4DGIH 4FQXA 2R0ZH 2VXSH 4HK3J 5HY9A 2ZUVA 3QBTB 3DBXA 3RPIA 1A1NA 5D7IA 3UTPD 1EK3A 4MX7A 1VKXB 3CXHJ 4J3SA 4NNXA 2ICEB 8FABB 5HYIA 2APWA 3VMNA 3LPFA 1WAAF 1C16B 3UJTL 5KVMC 1YPZB 1CFVL 1LO3L 1FV1B 1O0VA 4E0RB 4WTWA 4GW5A 1I4FB 2JCCB 2FIRT 4JFED 2C7UA 1J1XL 5B39B 1CZ8H 3EJZD 1BD2D 3PGCA 2ITDA 2WAHA 3EYSL 4XCYB 4RQQB 1UH3A 3O8XB 1J1OL 4WI4A 3DVNB 1T2QL 5FECB 2R29H 3D25B 4EZMA 3T0EA 1FSKB 2F5BH 1EHLH 4CGTA 4HH8A 4XC3H 1GIGH 1E4WH 4H1LB 4XTRC 5ITBL 4HHAA 2LTQB 1IILE 5E00A 3CVIH 3MNWB 5I1KH 1DSFL 2WBJD 5B8CB 4QRPA 2AK4A 2BNQE 1JTPA 4KJPC 5D8JL 3HNTH 1HYSD 1G9NC 4OZIB 4EN3D 3IDYC 4YFLI 3MOAL 1I1AC 4O2CA 2CXKA 4XAWL 2MNUA 3NZ8B 3QA3A 3ORJA 3O2VH 4UU9B 2X40A 5TFSH 3VXRB 4PBWD 1PKOA 1BQHA 3QQ9C 4XPHL 1EJOL 4Y5VC 4ZDHA 1MI5A 1Z9SA 1ZWIA 3QPQC 1JZ2A 5MEOB 2VLJB 5I1AA 3HI6H 4NPYB 2IANA 5GZND 4NP4H 3HAEG 1IEBA 1A21A 1U3HC 2WZPD 4AM0B 2XKNB 1JGDA 5DVLA 4P57B 5JLZB 3X13A 1DUZB 2VITB 1UT9A 3RUGF 3KPPA 4U05A 3U83A 5ESAA 3BPOC 4JKKA 4Z7WA 2DBLL 5FYJU 2VR5A 1WFOA 5ISZD 2D0GA 1T89C 1I1FB 3HMWH 4L4TE 1CDGA 2BHYA 4PGDA 5D2NA 4L8SA 2I60H 5ISZB 4HS3A 2ZUTA 1RU9H 3O2WH 5FUZL 2FHBA 3HZMA 1J1PH 1MRCL 1HHGA 1IGFH 3K8KA 4OBRA 5CSGA 4HMEA 3VFPA 3TYGL 2JJUA 4YQXH 4BKLA 1QFUH 4J8RA 3CVHL 4LVOC 1I8IB 1NGYA 4S1SL 3T2QA 1FG2A 3RKDC 1B0RB 1CTOA 1ZT4B 3KHQA 4NDMA 2F5AH 3HFML 3O2DL 5ICZB 1WFUA 2Q6WA 5ILTH 5MEPA 4OBSA 1BZ9A 5A1AA 3WV0A 5FA4A 5CJ5A 3DUUB 3Q5YA 5ID1A 1PSKL 4RX4A 3OKYA 4Y5XC 3ARGD 4O02H 4Q0XL 4QRRA 1HSBA 4Q97A 5TDPA 3W5NA 1ORQB 4RNRA 3U30C 2Q87A 3MODL 4OGYH 1A1MB 2OP4H 4KZDL 1FFPB 1EEUA 3MRLA 5L8JB 1ZS8A 1W2KT 3O2DA 1XT5A 1AQDA 4HG4J 3I75B 1XGTB 3L5XL 4K3EL 1Q9KB 4WI5A 4UILL 5CZVH 1MSPA 3QULA 4K07A 4OKVB 5LGJA 1LO0L 1JPFB 3F12B 4F9PC 2H2PC 4M1GL 3GSQA 2XA3A 4CDGC 1L7TH 4F33A 1SBSL 3PWPE 3FOMB 5F7UA 3OKDB 2WBJC 3C60B 5HYJE 3BZEB 2HKFL 4NQSB 4JQIH 1YMHA 5FO9B 1IAKB 3FQRB 4W6XB 2BVYA 4Y19D 1MUJB 2NY6C 4J1UA 3TO4A 2IEPA 2NX5E 3RTQC 3OAYH 4FFVD 4NYLB 3V5DA 1UWEL 3BO8A 4Y4HB 5IVNA 3MV8E 3RRQA 5C3LD 1WAAA 2B1HH 3T2NH 2IBGA 4P9ML 5L8LB 3HE6B 3H7BB 4NQCE 4OCYH 1NKRA 3WFZA 2QQKH 1T0MA 1WBXB 2BVUA 4JJ5B 6FABH 1NFIB 3LN4B 4K9EH 5CINH 4JDZB 2XXCB 4PJBA 3ZE2F 1FNFA 4S1RH 3MRPA 1OCWH 1HCVA 2HG5A 5E95B 2R0KH 1ETZB 2APBA 5T33L 4IHOB 2BDNL 1LEIB 3KJ4B 1UXSB 2X44D 1KUMA 4FQPA 2Z31C 2AJUL 2APFA 2BSSB 3EBAA 2O5XH 4P46D 5C0CB 1EGJH 5IVZA 1G7LB 3LKNA 1JHKH 4XPTL 2EC9T 2KPNA 2CRMA 3A0OA 2IGFH 1UM6H 2FBJH 3QCUL 2EIEA 1KIPA 4L3CA 4N0UB 1BIIB 1S9YB 4MCZA 1HH9B 3QEGL 5JQHC 4ZPTB 4DZ8A 3BZ4A 2DQCH 1JGUL 4U0RB 3HUJA 3CK0H 1CLYL 4TN9A 4PRDB 1KCRL 1KCKA 3VFRA 2X9YA 3BKJH 2ARJB 2NY7H 4PLKC 3NVQA 3HAEA 4GOSA 4I3SL 4JN2B 4YDLB 1YN7A 1P4LA 4DUVA 4OCYL 1D9KC 4JM4L 4P4RB 4S2SA 2YC1B 5SX5K 5FECA 3D25A 3T0EB 1TTGA 2WLZA 3ARPA 1U8MB 1HQ4A 3L5WB 4MLSA 3GSOA 5I1DB 3MFFB 2V9RA 2J8OA 4PJFA 4DUWA 4MMZC 2VB5A 1ZA3B 2ZKHL 2F15A 1J0JA 3CZFA 2AK4B 2J3SA 3FRPA 4GT7A 4MDJA 4L8CA 2PETA 1P9MC 1AGEA 3QRGH 3NZ8A 2XTJE 4RSVA 5A3IC 5HYJA 1AHWC 4NQED 2KH2B 4EXPX 4XVJL 4HJJH 2DIJA 4BSWA 4QCIA 4LLQB 4FQXB 5FDWA 1FHGA 2OR9L 3HRZA 2KUTA 2OSLB 2GUOA 5C0EA 2PXYD 5K93A 1ZWIB 5C0IA 5MEOA 3QEQA 3OKEA 2ZUQB 4R97B 3MACL 3EYUL 4DZBA 3D9AH 2BCKA 4PJ7E 1L6XA 3F8UB 8FABA 1IARB 4H5SB 4M7JL 1NEZB 3PL6B 4FQQA 2ZUYA 1QNZL 2YMXH 5HI4D 5D7JC 2NY7L 1VFAB 1OP9A 3MLPA 5CLTA 3NGBB 3RBSA 4XCCH 2C7UB 2Y5TB 2OXHA 4UV4H 3PGCB 3E3QE 4HZLB 4LCUB 1QOKA 1YJDH 4U6VL 4RQQA 4WI9A 5JZ7D 4ZNCD 4F3FA 5GGSA 3TJEL 4D94A 4LP5A 3N1GC 4JQVC 4HS3B 3DTXA 1LE5A 3PHQA 5DFTA 4QRPD 5ICXB 3GMQA 5FGBC 4GLRI 5E00B 2PO6C 5D9SA 3MNWA 1KEGL 3M1BB 3BPCB 3HC0B 3WKNA 3X12A 5FA3B 1CN4A 3I6LE 3QIUD 2VLLA 1RUKH 4JRYE 1OPGL 4OD2A 2XQYG 5C0DB 3N1FC 3FO1A 3MRMA 1N6QL 4MQXD 2CDGA 5DHYB 2R0WH 3IAPA 2Q6WB 2ARWA 1JGVL 1H15B 3GEWB 5IFHL 1F45A 5J6HB 2IAND 3ALXA 3SQOL 3U82B 1H0DB 4OI9A 2A83A 5LGKA 4EI6A 3HMXL 3MLXH 4YHOL 4G6KL 1HSBB 4AEIH 3K3QA 5TDPB 4PRPB 1BLNB 1XGRA 5DVKA 5EU6A 1FFPA 2DICA 4MA8L 4AM0A 2JELL 1I9RH 1VEPA 2ICWB 2XT1B 4OI7A 1LP9E 3GJFK 2BHZA 4GW1A 1CIDA 3WUWA 2VITA 4KAQH 4APQB 2BXZA 2BMKB 3T4AA 1W8NA 1WZKA 5HYEA 1AO7E 5AD0A 2FGWL 5LQBL 3RL1A 1PVHA 1F4XL 5E2TL 3MLVL 1LDSA 4TRPH 4PGDB 5ALBH 4CVWA 2FEDD 3MYZA 4KH2A 4F33B 4RGNB 5CUSH 4JM2A 5IWLA 3TN0C 1FCCA 1BEYL 3O81A 4X7DC 5DT1L 1YEFH 5CEYA 3V4VL 2ZSWA 5C0JA 5C09A 1A3LL 2P8PA 3O4OB 1NGZA 1J1OH 4JLRB 5FO9A 5T1DH 3V52H 3FQRA 4PUBH 4JGMA 2ZJSL 3DXAE 1F11A 1BQUA 1JRHH 2D2OA 4KXZI 4PP1D 1FG2B 1A7OH 4NDMB 1CT8B 5T1KB 3BO8B 4Y4HA 2WBKA 4FFYL 3BYYA 5D5ME 5TE7H 5FGSA 1G1CA 1I7TB 2EKSB 3FB8A 4YBLC 1NL0L 3X3GL 2P4AB 4G6KH 2VH5L 3VXQA 4QLRA 1SM3L 1C1EH 2HT2C 4EIGB 2E9JA 3P0YL 3VRJA 1U8OA 4ZAKC 3CVHB 1P84J 4H8WL 1A1MA 2Y4SA 4LNVA 1MCLA 2VDPH 1J12A 4UB0L 5HYSG 3D0LB 3ARBB 3FB6A 1O7SA 5FHBH 2JB6B 3WS6C 3MUHL 4DUXA 1HEZB 5CD3A 1YN6B 4JFFE 5CBAA 2FEEL 1F90L 3I3BA 5KOVC 4LLYB 3GSRB 4HIHB 4HAFA 3KJ6L 5EG6C 5LGJB 3IRZA 1WITA 1C5BH 4MWFA 3S36X 1FYTA 5IIEA 4XBPB 2R4RH 3MUGA 5E5MB 3FOMA 2BVPA 2VJXA 1BIIA 4LSVH 3QWOA 3OKDA 4MAUL 3BZEA 3C60A 4OF3A 5IMOA 5C86A 2X2YA 1J10A 5EBGA 2XWBB 4M7LH 3W0WA 3EOAA 4G3YH 2QQNL 1UA6H 4NUJA 3WXVL 3NACH 2D7PA 1SHMA 4IBLT 2D31B 2X4SB 2Q20A 3VGEA 3V5DB 3KYAA 4OCWH 1Q72L 3NCEB 1P4LB 2NY6D 3VFTA 4KROB 5F9JA 3VWKC 4X6FA 5GSRA 4EQ2A 4X9FA 2D0HA 4PJAF 1TIUA 2E7HA 3WFHB 3HPLA 3GIZL 3CX5J 4JJ5A 3CVHH 2VDQL 4ZS7L 4UAOC 3VXSE 1NFIA 4M7KL 2W0KA 5SWSD 3RVWD 3WSQH 4Q7DA 3MRPB 3AS3A 1S7VA 1RIUH 4GXVH 1MIMH 5CBEB 3RFZC 3MLTA 3PP4L 5IQ7L 4YHPA 1G7QB 4I3RL 5I74B 1QP1A 1X5YA 4LSPH 4U6HA 1PZ5B 5E8OA 5J7CC 1MCBA 1FZMB 2D9CA 3FFCB 2YS4A 3RWDA 4K2UH 1JPGB 2WW8A 3TA3D 5HYJB 4XCNB 2UUDH 3MROA 4Y16D 1HHKA 2M1KA 4PJHB 4QTHA 3TA3B 4C59B 5IB1A 3JUZA 2ZOKB 4WCYL 3ZL4H 4JHAH 3JWDL 1XGPA 3KYOA 5C0EB 4D3CH 3U48A 4PJGE 3NCYP 1G7JB 3OKEB 4QF1A 4NCC2 1HH9A 1N4XL 4N0CC 2EDDA 4DK6A 2IBZX 4H1LG 5I75C 1JF6A 2SEBB 3P0VH 2F9BT 4WNQB 3SKMB 3PWLA 3TO2A 3PGFH 3B8YA 3UC0H 2YZ1A 4XP4L 3MV9E 3KHOA 3ZSTA 2DMKA 4X5LA 2DBJA 3LS5H 3IFNH 2Q1EA 4CN4A 3QG6B 4PGBA 3S5LB 1MAJA 3TV3L 1WF5A 4LASH 4XPGL 5GGSB 3VWJD 2XZCL 4Y4KD 4G6JH 1ND0B 5CILL 4Z0BH 3WIIL 3A6CH 4HIJA 1U8MA 4QT5A 4YXLL 3U4BH 1JGUH 5I71C 5LGHH 3OJDB 1FE8H 3VWJB 3BUTA 1EX0A 2I24N 1KCRH 5D9SB 4R2GB 3RHWF 3WS6A 5E2UH 1ZA3A 3QJHA 5ENWB 4MXQC 4P99A 3HC0A 3V8OA 2I25N 3X12B 4JM2F 2LU4A 3H9HB 3T0WA 4N1HB 1MJUH 1MFAH 4L8CB 1JV5B 4HWBH 2H32B 1UJTA 4JDTH 1AGEB 4A6YA 3RZCC 3UBXA 3GSNH 2VLRA 2BNRE 1ZAGA 2C26A 3ARDC 5C0DA 3FO1B 1O7VA 4TTGA 3GBML 3PDOB 2IC2A 4ZUSA 3IF1B 4CW1A 5I73B 4ETQA 4GXUM 4EOWL 1JJUA 4MJID 5ACZA 4WFEE 5DMIL 1N4XH 3U7WL 2E5EA 2OTUB 1MCHA 3ABZA 3NGBC 3NTCH 3OBAA 5SX4I 5HPMA 4PRPA 3HAEH 3L3IA 1BLNA 2B5IB 4JY6B 4MMXC 3T4YB 3LQZA 4LRNL 2X7LA 2XXMB 1QFWH 4H5SA 3U9UB 4PR5B 5D1QA 1MCWM 4Y1AE 4FFWC 5C08E 4PRHA 1YYMH 4F8QA 2CO6B 3V6BR 4CDHA 5T5NF 5DJ6B 3TCXA 5KVDH 3C87A 3JWOL 1N5AA 4APQA 4HUUB 4HZLA 1R5IB 2P5EE 1CLYH 1U8LA 3A6CL 1OAXL 5T3XE 1HK6A 2DAVA 3D0VB 1ZSDA 3JV6A 3OR7A 1ZLWH 1KGCE 4FHBD 4N0FB 3RL2B 1L0XA 4JM2B 4I9WE 3UJIL 3PHQB 1RFDL 3GMQB 4DN4L 2XACC 2JIXA 3BGFB 4J6RH 1NCBL 4DKFL 1KB5L 5C09B 2H45A 2Z35A 1MFAL 3BUYB 3BKML 4P2OB 3KNBA 4L4VB 2ZUWA 3V79C 2VLLB 1TMCB 2A9NH 3L3HB 2PXYC 4Q9CA 5TPWL 1QBAA 4U2ZA 2X4PB 5CJ8A 3B9AA 5I1GH 2YD7A 1IM3A 4XMKL 2CDEA 3TT3L 5BS0D 4ENEC 3WIFA 2X1WL 4U1IA 3ESVF 4X7CC 5DLMH 5IW3A 1TPXB 2AI0H 4KV5F 5C9JA 1NBVL 2IF7A 3IFLL 4XC1L 3UJTH 5J6HA 1H0DA 3QYCA 1QBBA 4I18A 2VDNL 4OM0L 1UXWA 1XGRB 4XVJH 4LSUL 5BCAA 3SDYH 4K3GA 4BH8B 3Q2CA 5TGBA 3QUZC 3O4LB 4HC1L 4F7EA 5TQ2H 1KIRB 1KCVL 1UB6A 4LQFL 2IFFL 3O9WC 5HVHC 1OAXH 3L3DA 1NUFA 2HFEA 2HLAB 1NGQL 5FFLA 4NCC1 4ZAKB 1YY8A 3DRQB 1OVZA 1FNEA 2VAAA 5D72H 1CXEA 3ZYZA 2X4UB 3K4AA 3OB0H 4MWFB 4J7RA 5IIEB 1B88A 3I3DA 2YUVA 4XAWH 4DCQB 1I7ZA 3P77B 4LARH 5CEYB 5JR1L 2R1WA 2FJGB 4DQOL 1B90A 1CGXA 4DW2H 3TF7C 3DYMA 2XWBA 3W0WB 4BQBA 2W0FA 2YN3A 3G04A 4QXUL 4RGNE 4IDLA 4TSAL 1F11B 2Z93A 3MUJA 4ZUVB 3MA9L 5INDA 5I1GL 3VRIB 1KJVB 4JPIA 5ICYB 2Y7QB 2E7LA 4YJZL 1J05B 4HDIB 3GHEH 4PJFE 5GJSH 1E4XH 4Z7WE 2WBJA 4HPOL 4HUKB 3MGOB 3BOVA 5F9JB 1V3MA 1OAUL 3PL6C 4MNHB 2HN7B 1Z2KA 1F3JA 2C1OA 4FQ1H 1OSZB 3PWJA 1QZ1A 2E7MA 5E6ID 4E41A 3VRJB 5LAXB 2Q3AA 4YGAB 1A9EB 3FRPG 4JO2H 1T6VN 4D0DA 3CFDB 1ZHKB 4X6DA 3MLTB 3FB5B 2X10A 3D0LA 3MJ7B 2X1OA 3ARBA 5I1LA 2CJUL 3T77B 4X6CE 1HEZA 4MD5A 5CD3B 2IADA 1ULVA 5I19L 4LBEB 2Q7YB 4MB5A 4GRLC 1NMBH 5SV3A 1ZEAL 4NHUA 4XCNA 3SDAB 4P48A 2CK0H 3MGTA 1DBKL 2EDRA 4G8EA 4XPFL 4P49A 1AE6H 4NO0A 2HFFA 3KYOB 3P4OA 3RTQD 4R90H 4MA7H 2AK4E 3N85L 4HFWA 1JZ3A 3VH8G 4J3XA 4NKMB 1LEGA 2W0PA 4OLWH 3EOAB 5GRUL 2VC2L 1H3UA 1VGKB 4Z7VF 2YRPA 4WNQA 3SKMA 3TO2B 1AP2A 3QEHA 3W81A 3OXSA 4URTB 2EICA 1A14L 3ARFB 1FIGL 3EFFB 2EC8A 5DT1H 1KENH 1JPST 5HHPA 1DQLH 1CZ8L 3QUKB 3LKQA 1EO7A 1KPUB 4RIRB 3VFGH 1CR9L 2NXZD 5JPNB 1X44A 1UG9A 1WISA 5GS0D 5CEZE 1IAOB 4F7TB 1I3RB 3VW3L 3B43A 1A7OL 3SKUD 4HV8B 2EXYC 3HI1B 4YHML 2VRAA 4JQXA 3QJHB 3CH1A 3K2UL 1CLOH 2P8MB 5F7HA 5IVXA 5E4IA 5E8OB 3SY0A 5EIVA 3JVGC 4QHNA 5FCUL 3DI2B 3CJJA 3RI5F 3UBXB 2YPLD 2YOCA 1CK0L 2Y07L 5BJTA 1JGEA 3DURB 3NBNA 3SKNB 1HHKB 3GIZH 4QKXB 4NZDA 3SGEH 3UTSB 2ZOKA 3FT3A 5ITFB 5JHDA 5BOPA 5FEBA 4EEEA 2UZIL 1N64L 1MWAH 4JANB 4OLWL 5GRUH 4PJHF 1SJHA 4I13B 4S1QH 2DKUA 2CR3A 4JY6A 3T4YA 2HAZA 5J6GB 1T4KA 4HIEA 3CDYA 1J0ZA 5KOMC 4GG6F 5DMYA 4KGLA 1Q0YL 1H3PH 4GRLA 1MCRA 3DX6A 5I15H 1IM9A 3SE8L 2LTQC 1S7TA 4MAUH 5EU6E 3RVWC 3NPSC 4L4JA 4U1GB 3QNXA 3B9KB 4LKXB 4ZTPL 1B3JA 1QA9A 4FTVA 4OB5H 1S7WA 2NYYD 3WHXA 3O9WD 5LCVL 2QQNH 4NC1E 1ZSDB 3JV6B 1CU4H 5ERWB 4K8RH 4WWKD 3HMWL 2DQJH 5C71A 1QYGL 3BEWB 3OJDA 1DN0A 3MGAA 2FD6L 4L4TD 4BSVB 4JGJA 2X4QA 2BY2A 4P2OA 5A2FA 5FYLH 4L4VA 2E7LC 4RAHA 3KLHC 1FYTE 3QHFH 4V1DD 2Y06L 1EFQA 5D71H 5GGRA 4KDVA 4DKAA 5EO9A 4NQDB 5D1ZB 4AK1A 2A6JA 4PJDF 4FQ2L 2X4PA 3RX7A 5DGRA 4HUVA 3LH2H 5ALCH 5JXAL 4NQDD 4GMTH 4G8GD 5HHXL 1MIML 2QADB 3K1KC 1VADB 3LAFA 2GJ6A 4ODBD 4ETQB 3IAQA 4HK0A 1A7NH 4S1QL 1MH5A 2A2QT 4FFVC 3VFOA 2H2SD 2OTUA 4Y8DC 1MRDL 1QSFE 2DQEL 1BJ1J 1WCBB 5CMAB 5HI5D 3LQZB 5DRNA 3IJHA 3BEVB 1MJUL 4F37K 1AIFB 4POUB 1FAKT 3U9UA 5DJ0B 1YNLH 5D1QB 4TSBL 5IG7A 4K7PX 1VDGA 1TPXC 2ZWLT 2VLKD 2V5MA 3SO3C 3V4UL 2AQ1A 1UB6B 1H5BC 3WNLA 3KR3L 4X80H 1S5IH 4LEXH 3FONA 3NFNB 4PJEE 2XV6B 1F4HA 4XVSH 3QIBD 3IXTB 2M2DA 2X4UA 5HVWA 4TTDC 1DCLA 1KSRA 1DLFL 1RV6X 5IK3B 4DFHA 5DJYA 5JXEA 3REVA 4LCIL 4WO4D 5DD1L 5JW5A 1G6RL 2Z35B 5AG8A 2VLMD 3TIEB 4YHLH 5IW6A 3G04B 5JOFB 1WZLA 2FX9L 5HGGS 1AR1C 4BA8A 3O6FD 4OZIF 4EKXA 5GS3A 1ZV5A 1P7QA 1XGYH 2DLEA 1G0XA 4JFFB 3U9PH 2B2XH 3RY6A 2WBJB 3QQNA 3U4AA 4M6NL 2FWOA 4ZG1A 1Z3GL 3EYOA 5J4MA 3P11L 1RUAH 1JHTA 4NBZB 4IOFD 2AKRA 1T3FB 1IC7H 5LAXA 5D2NC 3W11C 5GXBB 5HVHB 4D0DB 2HRPH 3IDIA 3VDBA 2W59A 1X4XA 2JTDA 4OZGA 4EOWH 1DQJA 5J12C 4LSQH 2H9GA 1HCFX 4ZYKB 1ZGLP 3ZT7A 4K94C 4Y4KC 4OAWB 3DIFA 1J9CT 3HUJE 3MSPA 4N5UA 3V6OA 2AJUH 3KPTA 4ZAKA 2NLJA 3B5GA 4J3WA 1CFNA 1DLHA 1A7PL 5D7LE 5J1AA 5KS9F 3QUXB 1FZJB 3QO0B 3FJTA 3P4OB 3AREA 1WC7B 3WO4B 1TNNA 1CICC 1ADQH 3NZHL 4MD0A 1HOCB 1CWVA 1CXHA 1FPTL 1I7ZB 1G9EA 1IAII 4HJGB 1FLTX 2XTLA 3LKRB 2FJGA 4K8RD 4NBYB 4GH7B 3DO7A 3QEHB 1DEDA 4ZUVA 3EYVB 5L0QC 3RQ3A 1KJVA 2DLHA 4NFCA 3QPQD 1T20B 4JFQA 4FP8L 2Y7QA 1EIBA 1V3KA 4TNVK 4NKQB 1FIEA 5C0GA 4CVXB 5KBNC 3QUKA 3LKQB 1QKZH 3PXJA 4RIRA 4WFHE 4HK3N 5JPNA 5MI0B 3ESUF 1YPZE 1F3JB 2C1OB 3QJFA 4JFPA 1OTSC 4Q6IC 3UDWA 4DQOH 2EDQA 1W0VB 1GGUA 3HZKB 2DI7A 3CH1B 5C0NC 4R96B 1F4XH 3FB5A 5E2TH 2APTA 3TBSB 5I1LB 2QEJA 3MREA 4KKAC 1HHJB 1YEJH 3FMGL 4ELME 5FYJE 4CNIA 4NN5C 3V5KA 2W91A 1E6OL 5BJTB 1JGEB 3DURA 4AYFA 2H2SC 3SDAA 5B4MD 5MP6H 3PQYD 3MRIA 3A67H 4HUNB 1X7QB 1XAUA 4G8EB 2D03H 4HX1B 1V7NL 3SDDB 1HYRC 3MBED 1CE1H 4NUGL 1ES0A 4JPVH 4FFYH 1T4KB 4FS0A 1OTUD 1LEGB 1GZQA 4AMKL 3GRWA 2B1AH 3TFKC 4YX2H 3DX6B 4MHHI 3EOTH 5DVMA 1I8MB 1VFBA 1F2QA 2RQ8A 3KPMA 1SY6H 1OLLA 3KXFE 5ELIA 3OGOE 4G43A 1I1YA 2XWTA 4UDTA 2DIAA 2X4NB 32C2A 3RVXC 5D7LB 4AZ8A 4FTVB 3WHXB 1CL7H 4OV6F 5EA0H 3V5HA 5DHXB 4FN0A 4DAGH 5ERWA 3AM8C 1MPAL 1QRKA 1HKLL 4F7TA 2Z8SA 3B9DA 3SKJH 4JPWL 4P2RB 5L6YH 1EGJA 1C08A 2YSSB 5HGHA 4MA1C 1LO3H 3MJ6A 5IVXB 5ESQA 3SY0B 3DMMB 4Z0XB 4NM8H 4UIKH 1AI1L 4G9FD 1JMZA 4YGVB 1T2QH 3TBTA 5HHOD 5I18H 3I6LD 4EI5C 4OLXH 1VADA 1D5BB 1X6LA 3GHBH 5C0BD 5JDSA 5HXMA 2DBLH 1OP3K 2YWZA 2OR7A 2DQHL 1VFOA 3IAGC 3PUCA 4M61B 1PX3A 5M95B 1R3LA 4Z7VB 1AJ7L 4MNGA 3NCMA 4FZ8H 1JZ5A 2DOCA 3HNTL 3QO1A 5FGBA 3U36B 1JWUB 3AXLB 1NJ9A 2IG2L 4HT1L 3Q3GA 3LVEA 1ZHBB 1RZ7H 1X6NA 1RHHA 1PG7X 4XNYL 1RZGB 5EIIB 2DWDB 2YPVH 1ADQA 5IKCB 4XX1E 1S7TB 4U1LB 4X4YA 1NUDA 5DJXA 1AO7D 1Y0LA 2DLFL 3KDMA 2E6QA 4PRPE 3WD5L 5DMGC 1EAPB 3VE0B 4NOFA 4KDTA 5EO1A 2XPGB 3MLVH 1NANH 1GC1C 2DQGL 5J56B 5IK3A 3KPLA 2AGJH 4JFDA 3I50L 3AY4A 3VJ6A 1IGTA 1DDHA 1YC8A 5TDNB 5KS9A 2YD5A 5L2JB 5SWQA 4I0KA 3TIEA 5IW6B 4Z7QF 1ZHLB 4NRYA 5BV7L 4WW2C 5GGRB 4NQDA 4X4ZA 5I1IL 3EW3B 4LGRB 2AXGB 1IL1A 3JSSA 3LEVH 3ISWA 3P4MB 4Z7OE 1ZA6A 4XNXH 4G8FB 4NKIL 2CD0A 4EUPB 4UIMB 2VR4A 3NAAH 4NZRH 4K8RL 2XWJA 4WEMB 1A47A 3JWDC 5DEGA 1CBVH 1SEBB 1MF2H 4PPTA 4HK0B 3NCJH 4G7YL 1Q1JL 3JXAA 4WY7H 5IMMB 2YUWA 4M6OH 2HJFA 4OD1H 3DGGA 4PJBF 2CXGA 4PJ5A 1SY6A 1S5HB 3TBWB 4F80A 4L9DA 5IESL 4RX4D 5EU7E 3IDIB 4OZGB 2MTPA 4LAQL 2X89A 1MCNA 1N7MH 3TPKA 4NQVA 4F57H 2AAVA 3C6LA 4ZOBA 3ULVD 1UB5A 2ZCHH 4ZYKA 5KSUB 1BMGA 4ZFZA 5D7JA 1JNLL 1RIHL 1IGML 5MHSE 1U8HB 2BHUA 5HHNB 4OLUH 3R0MA 1QSZA 5IEHB 2HVKB 2EH7H 5F1NA 3PIQA 4U2YA 5I1EL 3K7UA 4JDVA 1CFNB 4OLZL 4GG6E 4EVNA 4PJ5E 2MKWA 4X83A 4AIXA 3LRGA 4Q2ZB 2PW1A 5DD5L 1RHFA 4YXKL 2QQKL 2Q76B 4KKLC 2XRAH 3H42L 2EO1A 4M02A 3LIZL 4UAOB 4GRMB 3MLYL 4EBQL 5GGRY 1P7QD 1CU4L 3LD8C 3MFGB 4WI6A 4GBXB 1P7QB 4FQIH 1KC5L 5TQ0H 4Y19A 4OQTA 3GDBA 5C0GB 4MNQA 4KDTC 1JYXA 4PGJA 1CGSL 1CVRA 3IDNB 3CSBA 5I8KL 4JRXB 2IFGA 2Z9TA 2AABL 4KRMB 1BAFH 3QIUB 3QHFL 3QUYA 4AENB 1JHTB 5HHMD 5FYKD 4YIQB 2UV3A 4UT7H 2VLRD 4TVPD 1E27A 1U8KB 4KFZC 1NFDB 4ZXBB 2RCSH 3IFPB 3HZKA 2RB8A 3ARBD 1RZJH 5HHMB 5D1XC 5LJYH 1QSED 4R96A 3VXMA 3MZTA 4PJ7F 1FJ1A 1A6UH 1DBML 1JUFA 4LGPB 2H9GB 1HHJA 4U6YA 2JK5A 5FO7B 3ZKMD 2GYSA 3V5KB 1R5WA 5F88B 4TYUA 5GSVB 1OSPL 1XGQA 1YQVL 4CMHC 3HE7D 4FG6D 4OLZH 4LIQH 4Z76A 1QVOB 1AGFA 4Y5VA 3OKMA 5DJDA 1S7RB 5J11B 4NO3B 3S34L 1FVDA 2QSCH 5BQ7B 4MD0B 3WDHA 1NDMB 2R56H 5BRZA 4RMQA 3RKPA 4APQD 4XNQA 4QYOA 4HJGA 4LU5L 3LKRA 2GSGB 3BSZL 2RIKA 3SE4A 4QHLA 1ERNA 1I1AA 2BXYA 1MVUB 2NY1D 4M1DH 3C8HA 3O6KL 1UCBL 2MFNA 1CGSH 2VIRB 4KROD 1NCWL 3S37X 3AM8A 4LSUH 1J5OL 2J6EH 32C2B 5HVGB 2EIDA 2KKQA 3ES6B 2NY2B 1A1OB 1PKQB 4LDEB 2YD9A 1MIEH 4MQSB 4UINH 3U2SA 3CK0L 5DUPL 5TF0A 5D7SH 3JUYA 1ZANL 2VQ1B 2ZCLL 3MV8B 5HDQH 2YSSA 5HD8D 5HGHB 1PEZA 1RUPH 4ZO7A 3O4LE 5FKAB 1IC5L 5FYKH 3PJSB 4F9LC 5JOEA 4Y5YC 5JW4Q 2AP2A 1CICA 5HYJD 5JIPA 4Z0XA 4LIQL 3GI8L 4R6UA 1QTYT 2GSIB 3BDXA 4N8CL 5ID0A 2KQNA 3TBVA 1IZJA 5F7LB 5FM5M 3QUZB 1II4E 3J8F7 3CFEA 4NQEA 1NC2D 2BNQB 1VSCA 2VDRH 3MRGB 4CBPA 4HX1A 4HS8H 3HKFA 5GIRB 1DQDH 1JN6A 2GKIA 1NLBL 2XN9D 4Z7VA 4MNGB 1JI2A 4JPKH 4WI3A 5J8OA 4RAUA 3O6KH 1GZQB 1R24A 4GKSA 2F8XC 1I8KB 2NY1C 5EIIA 2DWDA 4RDQF 2YD2A 1T89A 7FABL 4WUUD 4OCXL 1NUGA 2APXA 3TZVC 15C8H 4G43B 2HH0H 3S88H 2ZCKL 4UDTB 4APQC 2X4NA 4YR6A 2MPAL 3H3PH 1KN2L 4M7ZC 2KZWA 4UINL 3VE0A 1BD2B 2VLJE 43C9A 1CGYA 2UWEE 1LEKB 4JB9H 5KTEH 2LABA 3GSWA 2KBGA 4OV5B 4PG2A 3C5ZA 1K5NA 4OFYA 3ZYJA 3O11A 1C08B 2Y6SC 4U4BA 3VJ6B 3L7EA 2R39A 4NC1C 2DJ4A 5SWQB 2VDLL 3SGDI 4NRYB 2CLRA 2OM5A 1G84A 1JHLL 5TDOB 4G6MH 4G8GA 3ECBA 2NW2A 1MCWW 4G8FA 4UIMA 3AS0A 1EJOH 1MFBL 2VC2H 4MQTB 1UWXK 4PJXE 1S7SA 3V7MA 1HI6B 2P1YA 5LQBH 3CX5K 2ORBL 5J57B 4XWOD 4WW2B 5DK2B 5EIQA 1QBMH 3SDCC 3X14B 5E03A 4ZQKA 3BH9A 2OMBA 3U36A 3AXLA 5IWLC 1KEMH 4XH2B 3EYFB 4J12A 1FH5H 3SDCA 4JR9L 3QWQB 3BAEH 4NO0D 1A9BA 2X89D 4HKJB 4KQ4H 2ENSA 5D7JB 4G7VL 3KG5A 3BFOA 1UKTA 3BD4A 1QACA 3BD3A 4IOFC 4P5TB 5EU7C 5IKCA 3MLRH 2A1WH 1OP5H 5DJXB 1Y0LB 3QI9C 3RBGA 4FQCL 4W4OA 1Q9OB 2QV2A 2VOTA 5I75B 2QKIA 3GMRB 3V0AC 5CJOL 4EVNB 5IBLD 1MQKL 3QHZH 1R0AH 4I9WD 3S35L 1IGFL 3WXWL 1LHZA 2PW1B 4NQTA 4HT1H 4ZFOB 5IFJB 2FB4H 5I1HH 1BJ8A 3O6FA 1IGTB 4LVOB 4YDVB 3CFBA 3C8KA 3IJYA 4YK4B 2PYED 4R7DA 2F54E 3E2HB 4GBXA 1CLCA 1N0XL 5BS0B 4IM8A 4TTDD 5HSFA 3MA9H 4HWBA 5ESVA 4EUPA 4F7MB 4MJ2A 4JRXA 3DOSA 2XQBL 4OQTH 5GJSL 4PV9B 5BZWA 4E42A 1CD8A 1BEYH 3IS1X 4KJWC 1RZJC 3RWCA 4N0YH 4JAMB 5EN2A 2EIZB 4UQ2B 2BZDA 4PJ5B 2BNRB 3GZKA 4AEEA 4KZDH 5IB2B 3FHAA 3WJLA 1R5VA 1A02N 5C70A 2JE8A 1XR9A 3WMSA 1ZGLA 4NQVB 4KKNA 4ONGH 4F58H 4MAYD 4XBGB 3S37L 4ZFZB 4U6YB 3X11B 4OF6A 3VMPA 4MAYB 4FQCH 4CVZA 4U6XA 5IHZB 3JV4A 3RVTC 2IG2H 4UOW1 3ULVH 2VUYA 1T03H 5SWSE 4UZGA 2IWGA 4L1HA 2C5DC 5F7MC 3WNNA 3WXWH 2Z8VC 4NO3A 1A6ZB 4X4XA 1W72L 3ZTNH 2FB4L 5A3ID 5BQ7A 3UBXG 1TFHA 5DJAB 1FYTD 2Q76A 2F53B 2WINA 4V1DE 2Y36L 4UTBH 1YNTB 1KFAL 4M7KH 2HJLA 4DVRL 3TEUA 4QXTA 12E8L 1NCTA 3LKSB 5FHAH 3C60D 3GMPA 4WW1B 3UTSE 4PGEA 1DP0A 5EZOL 2FECI 3VXRE 3MV9A 3HA0A 4OGAD 3T0DA 1WT5A 3MRJB 1AHWA 2VIRA 2ZOLA 4Q6YA 4Y19B 3TIDA 2AGJL 5IHBA 3W9DB 4P9MH 4WWKC 4MNQB 2XZAL 3M17B 1A5FH 1NPUA 2VLKE 1FIGH 5H8DA 2PTVA 3GSUB 3V6OE 4KK9C 5CGMA 1D5MB 4O51B 1AXSB 4L4VD 3BP4A 2YKLH 3P4LA 3FN9A 3QIUA 4OUOA 4JJHA 5F9OH 2OTWA 4AENA 4YIQA 2Y23A 4XVTL 1NBZA 3LSOA 4TUJB 3LCYA 3NIDF 4KVCH 3MV8A 3NAAL 2F8VA 2VZTA 2KDGA 5FV2A 1QSEE 5D96B 4GRWF 2CLVB 1S7XB 4XVSL 1CXIA 5J9PA 5T3ZH 5LWYL 1Y18A 1JUFB 1Q1JH 4WY7L 4AH2A 3DSFH 2F74B 5CP3A 4PJIF 5F88A 1DQQA 3PGFL 5CLWA 2D9QB 4C57C 3TBVB 3E6FB 3WEXA 1RJLB 4IRJC 5DEZA 3L5HA 4HUMB 1AGFB 2KL6A 1T04A 2FECL 1S7RA 4NO5A 3B8SA 1MRFL 2WIMA 3GBLA 3G6DL 3WHE0 3IDGB 5TE4L 3RGVB 2XN9E 1YMME 4GXVL 3T8XB 4YBHA 5CILH 4Z0BL 2Z91A 1ZOXA 2BERA 4QYOB 1N64H 2P46B 3ARUA 2NY5H 5T5FL 1DEEB 4F7PA 3A6BL 2HLFD 4MJ6A 5L9DH 4GKSB 5F1IB 2YRZA 5AYQA 1OSPH 1TVHB 3U0PB 1S78D 4GJTB 2JB5H 2DYPB 4PJ8C 5L88H 4HUWA 3U0TA 4IS6B 1FL6A 2CIKA 4GUPA 5GS0C 2RFXA 3H42H 1PD6A 3MBEC 3QPXH 3SN6N 3GBMH 5CHNB 1LEKA 4PRIB 2A6KA 2XG5A 3ARZA 2HFGH 4NFBA 4QHMA 3BN3B 4UDUA 4OZFA 1ZK9A 4NWTH 1QYGH 3T0VA 2NR6C 1AH1A 4XXDB 4LIQE 1MNUH 3IYLW 4IJ3C 2VUOA 5CFHA 3PJSA 2IPKA 3QRGL 1R3HA 5DHVH 3HUJF 3IFNL 3L1OL 1PYWA 3MBXL 3ZHLA 3CXHK 4UMGA 2DD8H 4QHUB 5TF1H 3JVGA 3FFCE 3GSVA 1XCTA 4JQIL 3S35X 2VL5A 2HFTA 5TE4H 2H26A 3P3YA 4NQEB 2WUCL 4BFGA 5D5MB 4DN3L 5GIRA 5L8KB 1FNGB 1QFPA 5GGVY 4RFOH 4Z7UA 3QXTA 4YWGH 3K8MA 4NZTL 4XRCB 5DMGD 2W38A 1QLEL 5KSAA 4L4VE 3FQWB 1A2YB 2FZ3B 4NRXB 3OAUL 3QFDB 4PYGA 1P4IH 1KB5H 2R2CA 1R24B 4KTDH 4IOIB 2GJZB 2MWCA 4QRSB 3SJVB 3TNNA 4MSWA 5F3BB 1T80A 4UV4L 5JW3L 1JPSL 2E6PA 4ELMB 2ZSVA 4Q9RH 2VXVL 3C2AH 5EU5B 1P5UA 5CEZH 3EHBD 3EGSA 5TPWH 2IJ0C 3ZE1E 1BBDL 3HB3D 5DF0A 3UJJL 2NTFA 3RA7L 5EZJA 1RUMH 4OLVH 1A4JB 3ROOA 4H88L 4NWTL 1FO0H 2VZOA 1FGVL 4BQ9A 3N1QC 4N9OB 3RJDA 4K7PH 1JF1A 3MXWL 1LP9B 4XPTH 3GIVA 3CFBB 4RGMC 4AIOA 4DGYH 3U1SL 5ETUA 1EVUA 5E9DE 1F5WA 2DRUA 4G8GB 5H94B 2BSTA 3OKNB 1W72B 5DA0B 4DN3H 3BQUC 5EZIL 3VGAC 4QOKB 4AMKH 2G5RA 2QQLL 2JJWA 5KTEL 4RRPA 1MFEH 4NCDA 4EI5B 1FLRH 1SY6L 1BM3H 2E27L 1DBAL 5D1QC 1YY9C 2R2HB 3BIKA 3BKMH 3VD5A 1ONQB 4MDIA 5KN5A 4I3SH 2WK2A 5HYQA 3WO4C 4XNUL 2IQ9L 3IDXL 1DFBL 5DEFB 4QHKJ 3DRTB 3O3EA 4HFUL 4LARL 5JORA 1HH6A 2VDRL 1IGIL 2GK0A 2HKHL 3R0NA 4ZFOL 3RJQB 5HI3C 3T65B 4MAYA 1BFOA 1H3GA 2GITA 3RA7H 2BVOB 3SE4C 3VWKA 2WUBL 2E3VA 5E6ZA 1Q9OA 3BMWA 4IMKC 3DHMA 4G5ZH 4J23A 4C54A 2GIYA 1MCKA 2AS5M 4X4XB 3S3PA 1YJDC 3ILQD 1OGAA 1Y6NR 3BQUD 5H37H 3MXWH 5F9AC 3QT2A 3BW9B 1ZVHA 3E0GA 1RZ8A 2V9QA 1OTTD 3GSXA 5I8CB 1FH5L 5HDOA 5K9JH 2HH0L 5IEKB 2ZCKH 3S88L 1ZT7A 1IKNA 3O6FB 3SGKC 2HJLB 3BGFC 3HPJA 2EYRA 1A4KB 4OLXL 3QDJB 4F9PA 1RULH 5F7YC 4LLAA 4YHZL 5IB5B 2BVQA 4PGEB 3AB0C 4LQFH 4WW1A 4OZHF 3RWFA 4R7DB 4ZS6D 2P42B 3UBXI 4LPUA 1F13A 1LQSR 2PF6A 4X6CF 3OR6A 3CX2A 3TIDB 4IRZL 4E9LA 3D9AL 4ELKA 1MHPH 3M17A 3P73B 3EOBB 5CJOH 4GG6B 4F7MA 4PJCE 3GSUA 5E8EA 1MCOL 3F7PC 3VXRD 1KPVB 2QBWA 3VFVA 1GVIA 5FIEA 1AGCA 2AK1L 3RWCB 1TJIH 5JR1H 4DGIL 4XHJC 1AGBA 4XNMB 5GRVL 1B4JL 2QSVA 3NCBB 4TUJA 5F3HA 5IB2A 5C7XH 5AZEL 4RBPH 2VISB 1QQDB 43CAB 2A6DA 2QHRH 3LY6A 4PY7B 2ATKB 1KJ2H 5DK0B 5I8OL 2EE3A 2C3VB 4U6XB 5IHZA 1RJLA 2BSED 1WAAE 4PB9H 3KPNB 1KENL 3SKOA 4HUXA 3O3DA 5D1QD 3LEXA 5AEAA 1H8NA 3U4EB 3B3IB 3IDGA 5D2LE 3N1PC 4M6ML 5I66B 3T8XA 3P9WB 5DA4A 2B4CH 3VFSB 1V7NH 2PTTA 5DJAA 3SHSA 5DQ9B 1OAYH 3VW3H 3I02A 3C5JA 2VXUL 1CE1L 4NUGH 2LFGA 5IFHH 1ACYH 2HTKC 4GAJL 4W81A 5F1IA 1NFDF 3QHZL 2HMIC 1TVHA 3U0PA 2DKMA 4NNYA 4EUPG 3Q1SL 4U1KA 1VGEH 3W9DA 3CFCL 2V2WB 2J8UF 3BT2H 3ARDB 1RZFL 4CU8A 5CJBA 4KTEH 3OKOB 1CTNA 2OTWB 5E8DH 3VG9C 2W60B 3B6SA 2BOBA 3QUMB 3H0TB 3LSOB 3F62A 3PP4H 2EDHA 3WLBA 3NN8A 3IETA 4Y2DD 4XXDA 3KYKL 3RWGA 1S7XA 1L7IH 3VG0L 1KJ2L 3GKZA 2IPKB 3EO1A 3NMEA 4KUZH 3RWJA 4FFZH 4AH2B 1CXFA 2VXQH 4N0YL 4PJDA 2I9TB 1G9MC 3DVIA 4IRJA 4QHUA 3ZDYF 3FFCD 2GJ6E 3GSVB 1IEAA 2R2EA 4JY4A 1JWMB 5I8EB 3S6CA 1S9VB 2QR0A 4EBQH 4KMTH 4P3DA 3QG7H 4PUBL 1WZ1H 4PJBE 3QI9D 3RGVA 3RPIB 5GS0L 1Z9OA 2R2BB 1OAZH 1EDQA 4NNXB 4NM4H 1A2YA 2ICEA 4ONHB 5GS1C 4BK4A 4NWUL 4F7PB 5T1LB 3ULVL 5FCUH 5EU3A 5DFWH 1T5WA 4BSJA 1QR4A 1YUHA 4ELMA 3SOBL 2JCCA 1J8KA 4A6YL 1A3QA 5B39A 4FTVD 5GGVL 1HXMA 1FL6B 2CIKB 4PGCB 2RFXB 3G6AA 3GJFA 3F7VB 3FO2B 1IM9D 4ZUTB 3FRUA 2NTFB 2CK2A 5HVFB 1DVFA 3T09A 4XPAL 5ILTL 1KPRB 3GK8L 2A6KB 1KTDB 3PWPD 1P1ZB 4QHMB 1CLZH 4Y4KB 4OZFB 3BHBA 3IKCA 5K9KA 4Y4HD 5J89A 1Q0XL 1DBJH 3DPBA 1I9EA 3D2UA 2G5BA 2VXQL 3ARRA 1AFVH 2VNCA 2BOCB 5E4EB 3B5TA 4OZIA 1KCLA 4PJ8D 3BZFA 4Y5YB 4TSBH 1LGVA 5FUOH 5F89B 3VFWB 1JGLH 3ARFC 5E2WL 2VQTA 3LN5B 4UILH 5JMOC 4D9QE 3O3AB 1BQHB 2VL5B 4PV8A 1XCQB 4HD9A 4OFDA 4P5KA 5DR5H 3WNMA 2H26B 2XTJB 3ULUE 4JHWH 5KSAD 1CFSB 2R0LH 1MI5B 1YEHL 1UCBH 3OKKA 4XCEB 5DD6B 1MLCA 2RGSA 4NWUH 1P7HL 1EGJL 4X9IA 5FYLL 5DRWB 4R3SA 2MJWA 3PQYB 3OKLB 5IW1B 2VXTH 4WHDA 2FSEA 3BE1H 1V05A 2RBLA 3AS2A 2GJZA 4QRSA 3SJVA 3SOBH 1JGDB 1IC4H 1KJ3H 5JLZA 1K8IB 4O9HH 4YHLL 1F97A 4X8XA 4MS8C 4GMTL 5HHXH 4WHCA 3WFDH 1ZTXH 1ZANH 5FB8A 3HRPA 2NY5L 5T5FH 4UOW0 5FYKL 4GKOA 4YZFE 1RZKC 3QFJD 1JCKA 4K94H 4L8SB 3RUGB 1DUYB 2ZNWA 5JXED 2DQEH 1KYOJ 5DMJB 3MRFA 4HKBB 2ZPKH 1MWAB 6FABL 1AFVL 4JM2D 2PYEA 2ZZUT 2AJZA 5JDJA 4ZUWB 4HWZA 1A4KA 2CMRL 1X5HA 3QDJA 2X5PA 1BQHG 3TWCL 2OTPA 5JW3H 3ZO0A 2BVQB 4X9HA 3NCYS 1V7ML 5KSBF 5ETUB 2IMMA 2BSTB 1DQML 4F7CA 2DN7A 4XP5H 2GFBB 2FEDC 4ELKB 5CSZA 3ARXA 4P5MB 3CH8A 5E08L 1VESA 1IE5A 1BZ9B 1YEHH 3MV11 5DD0H 1H3WM 4Y16A 3RWHB 3D3VA 2A6IB 4QRRB 4UT6L 2YPLA 3LB6D 5F3HB 3MNZB 1WEJH 2ED7A 5TF1L 3O3EB 4XPGH 3KYNB 4ISVB