5CGYC

Fab fragment of chikungunya virus neutralizing human monoclonal antibody 4j21
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
222
Chain Sequence
QVQLVQSGSELKKPGASVKVSCKASGYSFTSYSINWVRQAPGQGPEWMGWIDTNTGNPTYAQDFAGRFVFSLDTSVTTAYLQISSLKAGDTAVYYCATYYVDLWGSYRQDYYGMDVWGHGTLVTVSSASTKGPSVFPLAPGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy Chain of Fab
publication title Cryo-EM structures elucidate neutralizing mechanisms of anti-chikungunya human monoclonal antibodies with therapeutic activity.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 222
sequence length 228
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgyC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5cgyC01
4JFQB 4NYLB 5JDSB 4JKPH 3UTZB 3MRCA 3NAAL 1NBZA 1P1ZA 5HD8C 1EEYB 3VXOA 1BIIB 2YPLD 3D18B 3STBA 2Q7YB 3DIFA 3ARDB 1S3KH 4NZDA 5EIIA 2DLEA 2ZNWA 3H3BC 2DTMH 1XF3A 4QHMA 5DUPH 5IV2B 1L0QA 2G5BB 3CZFB 3DX6B 4N0CC 5KVGH 3HE7C 3IFPA 1F11A 1JZ6A 5I0ZA 3V6OA 5CBAB 3OAZH 1G9MH 3N9GL 4NBYB 5TPWH 2VZSA 3ZE0E 4Z77B 4GKSA 5E8NB 2YD5A 2VQUA 3CFCL 2VN4A 1N3NB 1ORQB 1RUML 5F1OB 5K93A 4P5TA 1ODAA 4OI9A 4QHNB 4O4YL 1CFSB 4AMKH 2GUOA 4ONGL 1NCUA 2O5YL 5IW6A 2ATPA 2VMFA 3GM0A 1YEHL 3GKWH 3VI4F 1QSFD 2VLME 4ZNEA 2AK4E 4MHHG 2C3WA 2FH6A 1IQDB 3ULVL 2EXWD 4NQDB 5DMIL 2PNDA 3VFNA 2E7HA 5E56A 3NCJH 1IRAY 4H26B 1WWAX 1MUJB 1LEGB 4DCQB 1U3HA 5DGQA 3MV7E 1HXMA 4LOUC 2DQDL 1BQSA 1AQKL 3TJHD 4IRZH 4OZHF 1X5AA 2LVCA 3QDJE 1RUPH 1RY7B 5K59E 3FMGL 3UXFA 4XVUC 4CDHA 3O2WL 3UO1L 5E70A 5SWQA 3T2NH 3QUMB 1KBGH 2G75B 2WINB 2QSCH 1UM5L 2NPLX 2QKIB 1DBKH 2J6EH 2OSLB 3QBTB 3ESVF 4MQSB 4KPHH 3RY4A 5I6XC 5EU3B 3GMLB 3C5ZD 3BUYB 4LSSH 4KHTH 4ZUUB 1ZANH 2Y5EA 3CPLB 1A6ZB 3GSXB 1DBJH 3RWGA 1UYWL 1JYVA 4WV1C 1GJIA 3OHXA 1YQVH 4U1SA 2W91A 4NKDA 4OQTH 1N6QH 1MFAH 4FQPA 3BPNB 3KJ6L 3OR7A 3S7GA 1KTDB 4P23C 5E5MB 2JCCE 3WN5C 3L1OL 1N4XL 3P30H 5I1CL 1SBBA 1SJEB 3N1QC 4XNMB 2CDEA 1IAOA 3T0EB 4Z76B 5DMKB 3JV4B 5EN2A 4ODHL 4N90D 1W72L 4MX7A 1KPUA 2NY4D 4AQ1B 2ICWA 2I07B 5K9JL 5IHZB 4EXKA 3VFOB 5C0IA 4WI8A 1KENH 4NWTL 5C71A 3ARBB 4Z7VE 5CSBA 3LKSA 1I8LA 2UWEB 1YY8A 3PHQB 4J3WA 1WAAE 1KN2H 2VKXA 2HKHH 3FO9B 5IM7A 4KMTL 3WLBA 1NLDL 1BAFH 3R1GL 3QJHA 2C5DC 5E2TL 3FAWA 3BPCA 4R0LC 1X5HA 3U4AA 3BD3A 2P8MA 2A1WH 3RZWA 2AV1B 4WU5B 4AEFA 1MQKH 1EX0A 1N7ML 4WFED 3W82A 2ORBL 1OAUH 1X7QA 1LO2H 1MCCA 5LGHH 1YEJL 2FSEB 4XCNB 1QA9A 5A3IC 3MQIA 4TNWF 5L9DL 5CZVH 3GSNA 5FA4B 1KLUA 4PRHE 2AJYH 3V0WH 5DFVD 1MHHA 3C08H 4FTVD 1ACYH 4NQXA 3IDGB 5CCKL 2M2DA 1FFNB 2V2TA 1KN4H 3LOWA 2FWOA 2J4WH 4P46C 3TWCH 5BO1L 4XCFL 4YDLB 2C1PA 4LBEB 3HI6L 1QSFE 1X4ZA 4ENEC 3GBNL 4HEPG 3ULUC 4Y4HA 4ONHB 1XCQB 1A14H 3ZTJH 3UJIH 1BZ7B 4CW1A 5BV7L 1JWSA 5J6HA 5MEPA 4R8WH 3QXVA 3OB0K 4YBLB 3NPSC 4JG0H 2AEIT 4QRRE 1CGWA 2A6KA 1QFWH 3C60C 1W0WA 1F90H 1A7OH 5HHXH 1KOAA 3B4NA 3QQNA 3QXAB 1LO4H 1NBYB 2BDNH 3HC0B 1YN7A 5JO5A 4KKLC 4DVBB 2J8HA 3F7PC 1QOKA 3E3QE 4NUGL 1T2QL 2I24N 2FHFA 1XZ0B 4IRSD 3RDTA 4M61B 1B0RA 5GJTH 1AIFB 3EOTL 2WIIB 2VZ3A 5MI0C 2EYSA 1AD0B 4G7YL 2R0WH 3MNWB 3QDGE 3UX9B 2VDML 2FX9H 4TUOB 2Y6SD 3PDOA 4MNHA 1BOGB 3DGGB 2NY7L 1FBIL 5I75B 1CFTA 3T4YA 2AXJA 3LHPH 5GZOC 1C1EH 1M7IA 3W5NA 3C2AH 3V95A 4HJ0D 4ODSH 3ZE2F 5DEFA 4IBLT 1I1AB 3RDTD 4MQXC 3HNSH 1X9QA 1RURL 4NSKB 4D9RD 2FO1A 1FH5H 4RFOL 5FA3A 5ISZB 1G7JA 3QEGH 3DHJA 1EXUA 3OKMA 3VRLF 1DLFL 1OTUD 3HB3C 4IOIA 4Y4KB 3G08B 2FHCA 4NJ9L 3TA3C 4IMLB 5HYSB 2IPUG 2A74A 2AJUH 4Q0XL 1CGYA 2ZUQB 5DC0A 3D39E 4U1IA 1S7QA 1I7RA 2VDLH 3O4LD 1DQDL 4B0MM 4O58H 4L9LB 2JIXB 4BSVA 5EFIA 3SO5A 4BQ6A 2ZKHH 1J1OH 2ICES 3TYGH 1LEIB 2Z92A 3SE9L 3BIAX 5HY9B 3MCLH 1AE6L 4EEEA 4NHUA 1E4WH 1P9MA 1UWXK 1PQZA 4O2FA 3SY0B 3LEXA 2FL5A 4HKJA 3HA0A 1QRKA 4FXGB 4QWWD 2YRLA 1OAZH 3NFNA 4XT1C 5JMRA 1F2QA 3C5SA 4G7VL 1F02I 4I0KA 3TT3L 4ORGA 5GISH 1WZ1L 2PYEB 4N0UA 4PJ5E 3Q3GA 1MNUL 3ZDZE 5DQ9A 2A83A 2VKWA 2DD8H 3VCLB 5EWIL 3DVIA 1G7LB 1VEOA 1MCSA 2DJUA 3SBWA 3IYLW 3SDXA 3FRUA 2NY3D 5A16A 2DS4A 4PJDA 1MCLA 2JLLA 3GZKA 1K6QH 5FCUL 1BQHB 5GGVL 4FA8A 5T5NF 5DJXA 4LAQL 4WUUE 5TDPA 3I6LD 2ED8A 2OP4H 3ULUF 2CKBB 4PGBB 2NXZC 3QIBC 5IKCA 3MGOB 1QLEH 4Y2OA 1QBLL 2EE3A 5F88A 3HE6A 3UTTD 4XMPL 4YX2L 5D7IA 1N5AB 5F6IC 3ILPA 3X14A 1A6AA 1DN2A 4ODTL 2VB5A 2EC8A 3VFGH 3AMKA 5EU6D 3CSYB 4DW2L 3U30B 2E9JA 3W39A 3O6FA 4WGWB 2HT4C 3B3IB 5FHAL 4C56B 5KSUA 3O6LH 4C4KT 3I50H 4JB9L 1RHHB 1R3LB 4BA8A 1NUFA 1UJ3B 5HDBE 3QIWB 4ZO8A 4BK5A 4EOWL 3Q5OA 1Z0NA 3O2VH 4MAYC 3CH8A 1QYGH 2FGWL 2VOTA 4JQIH 1VENA 3QQ3A 5F3HB 3RIAF 5CEYA 1YMME 1JHLH 2W65B 1QFOA 4D94A 4NHCL 1MCJA 3T0WA 2X4OB 1WITA 1ZEAL 1T20B 3IF1A 3WHE0 1Z9MA 1FNGA 1NCBL 5T3ZD 1F45A 6FABL 1PEWA 2PW2B 4Y5YA 4X6DA 4B5EA 2DQUH 4P57B 4KXZI 2F58H 4POZD 4HXBL 2YMXH 4PJ9A 4WWKD 1FZKB 3TO2B 3TBTA 2LU7A 3ZDYE 3W9EB 5SWSE 4NQCD 5D7JC 2W60B 2VDNL 3LZFL 4JPWL 2FEDC 1INQB 2VC2H 3IETB 5EUOE 3FL7A 3AS0A 3C09B 4OLVL 4TN9A 3JTTA 3NH7H 4U1GC 3EJZD 1T1WA 5HHMB 1FIEA 5IQ9B 1BD2B 3ROOA 4Q9RH 1ZGLM 4CJ1A 5IHUH 1MLBA 1DANT 4TRPH 3N0PB 3MBED 4NCC2 1FVDB 4O9HH 3TO4A 4JJ5A 4D8PA 3KPOA 1OGAE 1XF2A 3WHE1 1U8LA 3MJ8B 4S1SL 4HPYL 1XGRB 5EC1A 5CGYC 1NFDA 1IC5L 1KTLA 1AO7A 3H0TA 2EZ0C 3X3FL 2EEBA 2H26A 4R2GB 5KS9E 2BNRE 5DJ8B 3ZYJA 3NA9H 2Z93A 2ADGA 3JWOC 1RZ7L 5CIPB 3VMOA 1A22B 3OKOB 1T6WA 1I9RH 3RNQA 1ZLSH 5MEND 3KPRA 2HJLB 2X40A 3EHBD 4JO1L 1CXKA 4FS0A 4GO6B 5FYLH 4XB8A 3KR3H 4EJ1C 5I18H 5CP7A 3LQZA 1R6VA 4LHUA 4M5YH 4GKNB 4G8IA 2XN9A 1KT2B 5GGTH 1AO7D 4PJFA 5KOVC 2K7QA 1OT2A 4U4BA 2BSRA 4G9FB 4JM4L 4B53A 4RDQF 4WWID 4HUXA 3S96B 2NY6D 4X7EC 4WTZA 2CIKB 1HWGB 1KNOB 4HBQA 3NZ8A 1OAXL 1KXVC 3EYVA 1TQBC 1KLGB 2Y25A 3HC3L 4P4RB 5D1ZC 5IEKB 3QZWA 1F6FB 1YDPA 3P4NA 2VDKL 3RKDD 4G8GB 1S7VA 4EI6A 5C0GB 3DMMC 4WV1B 3REWB 4UQ2B 2FX8L 3BRGC 4UB0H 3KPRD 3N1MC 1FV1A 4JPIA 1P7KA 3BP6A 1FG2A 4QRTB 1CE1L 2FB4H 2HT3C 4B41A 3C6SB 4DOHE 3SGEI 1ZMYA 1MCOH 4P2OA 3FB6B 4URTB 4X7CC 4UQ3B 4LDOB 1MPAL 3BEVB 2XN9D 3VXUE 1BFOB 1KB9K 4G80B 3D6GA 2D4DA 1UEYA 4P5MB 3T0AA 3OAYK 4QGYA 1ZSDB 2JK5B 2VXQL 5D93C 2ZJSH 2XXMB 3VW3H 4ZQKA 5C0AE 1MIEL 2A6IB 1A5FL 4XC3H 4I3SL 1L9MA 2GI7A 5JNYB 2X89A 5KVFL 4XNYH 4PRPD 1WBZB 2R29L 4JRWA 1U8QA 3ZLQC 4M7JL 4F9PC 4WW2C 1Z9LA 5KW9H 4QTHB 5HI4D 1JPSH 4EN3C 2QHRL 1VACB 3MJ9L 4K3JL 5TH2B 4P2OD 4X6CA 4HF5L 1S9XA 4LGRB 2ZUTA 3IDXL 4OF7A 5EBWA 4CUCA 1DANU 4NQCE 1S78C 4XP4L 2IPKA 5K9OB 3MLXH 5CUSH 1UM6H 2FZ3B 4YIQA 1WEJL 4OIIL 4UIMA 2E6PA 3NAAH 3O11A 3ARFC 4JFDB 1G6VK 4FN0A 4I2XB 1E6OL 3FJTA 4WNQA 5T1LD 3SDYL 4OD2B 4U6YA 1QSEB 2CQVA 4JLRB 1U93A 5EG6C 3AU1A 3SGKC 5IK3A 4HC1L 5ACZA 5A2FA 2EEDA 5I1EL 5FOJA 1R5WA 1AP2B 4KJYB 5F96H 2VDRL 1E4JA 2GEEA 5DC4B 3N9GH 4YDVB 5DT1L 4P46B 4FHBD 2RFXA 1E27A 3AREA 4LCWB 3FB8B 5H37G 1G9MC 4QGTA 3QUZD 4Y5XB 3CFCH 3D69A 1K4CA 4BH8A 2GIYA 5DZNA 1MHEA 1RUMH 2P5WA 3OXRB 5HHPA 3BI9X 1H3UA 4O4YH 3EW3B 4HEME 2YZ1A 4EUPA 3BZFA 2A6JB 4ONGH 1U8NA 1J0JA 3L3JB 2O5YH 2CRZA 1R3HB 2GTWB 5F71A 1INEL 1YEHH 5KSBE 4WJ5B 4MNQB 4R7DB 4KTDH 3V6OC 4OFYA 2HWZL 1G84A 2BVOA 5DMIH 3ARED 4NQEA 4CVWA 1M71B 4NN7C 4F57L 4YPGA 4QRSB 4EUPH 4P5TC 4YHPA 1MRDL 4RMVA 4DAGL 3FT4B 3U48A 1JTTA 4JFHE 2P5WD 1J86A 4PTUA 5FO8B 5HYJE 2VN7A 3BPLB 3QULB 3BYTA 2JJTC 3SJVB 4MXQC 3NOIA 3P0VL 1QEWA 1YPZE 4N0YL 5F9JA 3OSKA 4C4KO 2XPGA 1F2XK 3C9NA 1JNLL 4PRIA 4YHIA 2PXYB 3W81A 1UJTA 3BSZL 1QKZL 2RQ8A 3VD9A 1C8PA 3DVGB 4Z7WB 3O2WH 3UO1H 3L9RA 1JGLH 5ESQB 4F7CA 3QDMA 4LU5L 1HQRB 1UQSA 1EUUA 5IR1B 1UM5H 3CZJA 3GB7A 1U3HC 4HIIA 4HV8B 2VLJB 5IWLC 3BIKA 4NO2A 3VD5A 2HA1A 1WBYB 5KAQF 4OGXL 4LSUL 4TUJB 4OZIE 1Q94B 4R90H 2AJSL 4PJEF 3TCXA 2KZ1B 3HS0B 5JHDD 3KJ6H 4PRID 3P4MA 4PRPE 4WIQA 1KB9J 4X6BA 3VWKA 4F37K 2BNQD 3CSGA 3L1OH 5ITFA 1N4XH 3U0TB 5I1CH 2NY1D 3G9VA 5IT2L 2AJXL 1YECL 3JBG7 4X6FB 3W2DH 3QDMD 4L8BA 1AXSA 4PJXB 1EO8L 1MLCB 3MNZB 4ZXBD 5JW4M 1W72H 4WW2F 3WNNA 2BSSB 4HK3N 4KFZC 3LKOB 3FTGA 5INDA 5K9JH 4D9LL 5CZXD 4ZFZB 2EE6A 1F97A 4NWTH 1ZHKA 4X4ZA 4YO0B 3NIGE 4BJLA 5F70A 5E1HB 1S7RB 4PJIE 4RQQA 1VFAB 2UZYB 3VWKD 5BRZB 5CEXB 1I7ZB 1RAMA 3FOLA 1L6XA 3IXTB 3KPNB 2PTTA 4RWYL 1NLDH 3I02A 3R1GH 3WEXA 1P84K 3VDBA 4OFVA 5D2NE 5E2TH 1KG0B 1G9NC 5F8RC 1FYTB 1SJHA 1GL4B 4IOFC 1KGCD 1HHGA 2V9RA 3HAEG 1NGYA 4K7FB 4PRDB 3BPOC 5F3BB 1N7MH 3BGMA 2GFBA 4NIKB 4LF3A 2ORBH 4NN5C 5JDJA 5C09A 1B6UA 3MV8B 1G6RA 1YEJH 1YEIL 4LLDA 5IESL 2HFGH 3I2CL 5L9DH 4TVPD 1QP1A 1JCKA 3CJJA 1WWCA 1J5OL 4M9PA 1WJ3A 2IMNA 3JV5A 1XF4A 4ODUB 4WFGD 4CN1A 5KSVB 1HXYA 1F3DJ 3OB8A 5GS0D 1CR9L 4GSDL 3HKFA 4NNXB 5CCKH 4K55A 2X4PA 2W1NA 3LRSB 1JF6A 3O3EA 1T22A 4LCYA 1I3RA 2FJGA 3N06B 5AWNL 1Z2KA 1A9BA 3GMQA 3HI6H 4HUNB 3SKMA 5IMMB 1IAIM 3GBNH 1K8IB 1DUYB 3DECA 4QXTA 1ETZA 3I6GB 5C09D 2R2CA 5CJ5A 4PPTA 4GH7B 4HIEB 4JM2A 2IANE 5TGBB 3RVVC 4JAMB 1HEZA 3BWAB 4P2RB 5BV7H 4U1NA 3JV6B 5EH1A 4R4BB 2DDQH 3MO1B 5EZJB 4AK1A 1JK8A 1Z9OA 4Q9QL 1WZLA 1X5GA 2VAAA 2DLHA 3KPSE 5HJ3B 1CFQB 3P9MB 4X99A 1H9VA 3MRQA 3K8MA 2BY0A 3B9VA 3IJSB 4XH2A 2I26N 5DJ6A 3VRIA 1U8PB 4Y4HC 2QSVA 4PJ8C 3MGTB 1MI5D 1HH9B 4IM8A 4X7DC 1GGCH 2C3XA 3L5JA 4NUGH 4PG9A 3UTSA 1ZE3C 3QRGL 1YA5A 3IAQA 3UPRB 3VXRD 1NUGA 5C08B 5BS0E 1IM9B 4JM2D 2Z31C 3RWJB 3EOTH 1L0XA 4CADA 1B0GB 2X4UA 4EI5A 5EOCJ 5A2JH 4WCYL 3GNML 4G7YH 3TM6A 2IALB 4Z5RA 3DX8A 5C6WH 2VDMH 3DX7A 2W0FA 1K4DA 4JHAH 5JHLH 1MCEA 1U95A 1S5HA 5DJDA 2NY7H 4HGMA 1FBIH 4ZUVB 3RVUC 3HPLA 2V5YA 3VGGA 5CD5C 2R1XA 1I7UB 5J6GA 5DSCA 5IMMA 1NC4B 2CMRL 5JHDE 5E03A 4WHDA 2HH0L 2IPTL 4HJ0C 2BXZA 1KEGL 4U1GB 4I5BA 2YBRB 3CFEB 5IVXB 1HHHA 4NRXB 3UTSD 1T3FA 3MV7A 5FYJE 2ZUXA 4XB7A 1RURH 2A9ML 3U1SL 1ZHLA 1QQDB 2FHBA 4EI5D 4ZFOA 1DLFH 1OTTC 5IB4B 1A4JA 4NM8L 1FSKB 4PJCE 1MF2H 4NJ9H 4KU1A 1WC7B 3BZ4A 3CVIL 4NZTL 4XVJH 4OZFG 2Y1VA 3TZVC 3MGAA 4LRIA 2G2RB 1C5DB 1U2CA 2FEEI 1B88A 4JFED 1UB6B 1QR1B 1DQDH 3WS6A 1DBAL 4JREB 4N5UA 5KSAC 3KYOB 5ESAB 3D85A 5LXGL 3RUGA 2ID5A 3VI3F 4HUUB 2VUOA 3FONA 5CHNA 5CJQL 3OKKA 4MA8L 3SE9H 1AE6H 5LGJB 1KGCE 3BGAA 2Q20A 4J3UA 4G9DB 4MA3B 2Q86A 3W9DA 1CTOA 2JCCA 5EUKA 5C0ND 1P84J 2ZSWB 2CDFA 4QWWC 4MJ5A 4GXVL 3ILQD 5J13B 1GZPB 2BOCB 1BQUA 4HFWA 4QHKI 4HWBA 4KHXL 3LS5H 1EHLL 2HKFL 4TSAL 3TT3H 2APBA 4YE4H 3D85D 1WZ1H 1MNUH 3MRFA 1JWMB 2DWEB 5B39A 3WXVL 5C07E 4H25A 4M4RA 3KWWA 3DYPA 5T3XD 2DL9A 4OT1L 5EO1B 3VFMA 1JRHL 2XQYK 2FR4B 1TCRA 4Z7VA 2NY3C 5EZIL 3LRHA 3QIUA 4QNPE 2NW2B 1RJYA 3H7BA 1U8IB 3SGDI 3K3QA 3QHFL 3DMMB 1TENA 4YNYB 4WO4D 5GGVH 1V7NL 3FQTB 5H94B 3PQYE 2OTUA 4LAQH 3RWCA 1KCRL 3CVHL 2Y72A 2FEEL 5JXEC 2BNUA 4X0KA 1QBLH 3FAXA 4XAKD 1S9YB 4XMPH 4YX2H 4GMSL 1EJOL 2CLRA 3BXNB 5BVPH 1Z6JT 4ODTH 4GXUM 2OQJB 4MLIA 2NY0D 4F7TA 3JWNC 4I18A 4M6NL 3SBWC 3U79A 4FFWC 2VZUA 5DQJA 1VGKA 4Y7MA 4PJ7A 2F74A 4DW2H 2NTFA 2OR9L 4LP5A 5DRXB 5FHAH 2MHAA 2C3HA 3QIUD 5HHQB 4PRHA 5EULV 4HS3A 4JB9H 5F1SA 5D96B 4XXDB 4EN3B 1RJZB 1EHNA 1TMCB 3CFJA 3F7QA 4UBDC 4EOWH 1O7SA 2DMKA 1A4KB 2YR3A 3HE6C 4KKAD 5DDHB 5FKPB 2WV3A 3VJ6B 2FGWH 3UAJC 1AGDB 3A0OA 4BFGA 3OB0H 1VEPA 1QLRA 4NHCH 1IMHC 2ICEA 1ZEAH 3O6FC 3UZEA 7CGTA 3CMOL 4KVCL 1HSAA 1A7NL 2NCMA 1U8JA 1NCBH 2X4SA 3MRBB 3CLEL 6FABH 3TNNA 1KCSH 4R7NB 2MCPL 4GT7A 2YPLB 2EKJA 4HXBH 3WNKA 1WV7T 1M4KA 3BEWB 12E8L 2XOTA 1UZ6E 1XR9A 2WBWB 2F53E 1OQXA 2OJEA 4JPWH 2IG2H 3SOBL 4HZAA 1MAJA 3QNYA 3VGEA 4YHYB 4OLVH 3BHBB 2EIZA 1FFOA 2P7TB 2EH8L 5F7LB 2YPVL 3TYFB 5H37H 4JGUA 3QUXA 1NBZB 1P1ZB 1OLZA 1OP5K 3SHSA 4PJ9C 1YEGL 3VXOB 2WM0A 3I75A 5DJAA 1KJ2L 3RU8H 4JKKA 4RMSA 3P4OB 1F13A 5EIIB 2YWZA 5DUML 5GSVA 5T1DL 1QSFB 1V3LA 1TPXC 4S1SH 4HPYH 2Y07L 4GLRI 1F11B 1I1RA 1IC5H 2OBGA 1KTKE 4YXKL 3P11L 4GKSB 1OCWL 2EKSB 4QCIA 3EYOA 3X3FH 1VKXA 3QUXD 4LLVA 1G7PB 3S88L 3TFKD 4KXZH 1F3JB 4NKIL 5CJOH 1RZ7H 4X8JA 1A3LL 5IVZA 3CSBA 3TO4C 2GUOB 4MD0A 1MFNA 1QPXA 5IW6B 1LHZA 3V5HA 1KIRA 4HWUA 5F7YC 2Q8AL 3WFCL 3O2DA 2K9UA 4WRLA 2HRPL 5E8OB 5FYJL 2QBWA 3IGAB 5CWSB 3WYRA 5IJVA 2FO4A 3PP3H 3WKNA 1KXTB 1S7TA 1CG9A 3OXSB 3EZJB 5GS2H 1HN1A 4Z6AT 2GJZA 3AXLA 3C5ZB 3HC4L 1SVCP 3H9HB 1OAXH 4JFZL 4XI5C 1HHIA 1TIUA 3HC3H 1IFHL 3FOMA 2D0GA 2P24B 3TC9A 2FX8H 3VGBA 4U3HA 4HDIB 5C0CA 1WT5C 1CE1H 3WS3A 5T33L 2YXFA 1Q9KA 2OMBA 4JDVB 5EOQL 3FFDA 1MPAH 1UH4A 4AZ8A 3WFEL 4PJDF 1NCWL 1LO5A 4YH6A 3T8XB 4ELKA 2VXQH 4UV7L 4QKXB 4XRCA 4NNPL 2NY4B 1G7MA 1MIEH 1YY9C 2DI7A 2JTDA 3O0RL 3SCMA 4LNRB 4I3SH 3HI5L 3RWGB 4X5WB 5ALBL 3TVMA 5KVFH 2CLVA 2R29H 3D39B 4KC3B 4U1SB 2VISB 2ERJB 4NKDB 5HI4C 5GS1B 5D7IF 5J1SC 2VH5L 3LMJL 3OR7B 4WUUA 4PBWD 4GW1B 5C0CD 3B2UC 1IKNC 3MJ9H 4K3JH 4DGYL 3KDMB 3PJSB 1JPGA 5GS0L 1W0VB 2CDEB 3HZMA 2VRAA 3FO0H 5EO9A 2Q3ZA 3ARYA 3VFUB 3CDGB 4XCEA 2BSTB 3REVA 2I5YL 3D48R 4BSWA 4A6YL 3QUKA 3ME0A 4AIZA 5GGUA 4KZDH 4XP4H 4HCRL 1ZA3A 1LE9A 1QFWM 2BSED 3CUPB 5IBTL 4JRXE 1RUQH 1T7WA 3BPOB 1WEJH 4OIIH 4PUBL 1U36A 3LKSB 4DN4L 1E6OH 4RISL 1NFIA 5IF0B 3RBGA 5C3TA 1EPFA 3SGEH 2D7QA 5CJ8A 4FQIL 4OLZL 3WLBB 4MAUH 4FTVB 2JELL 4WFHD 4OM1L 4X6DF 3DO7A 3BPCB 4MCZA 2P8MB 2VDRH 2IGFH 4JZNB 1I7TA 5DT1H 1Q0XL 5C70A 5DJYA 3LN5A 3GK8L 2X1PA 2GK0A 1NCDL 3IDJA 5ICZB 2Z35A 3HAEB 1TJIL 2UYLA 4PBXA 1QA9B 2EDNA 4C58B 4ZYKB 1K8DB 3IAPA 3EYFA 5SWSA 2HRLA 4OGAD 1KLUB 5BW7A 3PNWA 4PJAE 1BEYH 5LGKA 4J3XA 3LEYL 5EUOA 4W68A 4WEBL 2F8XC 4NQXB 1QG3A 3G6AA 4Z7OF 3SE8L 3CNKA 1X5FA 2HWZH 1XF5A 4M7LT 2C1PB 1LNUA 1Q9LA 4HKZA 4ORZC 4HQQH 1AD9B 4F57H 2B2XL 3AM8A 4ZOCA 2HJFA 3HI1A 1MRDH 4IRSB 4DAGH 3QEQE 3HNVH 2HFEB 4CW1B 4L4VE 1NFDF 3OQ3B 5BMFL 5J6HB 3HR6A 3IVKB 2M26A 3P0VH 2W9DH 4N0YH 4S0TD 1OGAA 4RGND 5C0JB 1HKFA 4KK8D 1ZAGA 2A6KB 5GRWA 2HAZA 4ZPVA 1JNLH 1FL6A 4EVNA 4FG6C 3BSZH 3JVGA 1QKZH 5DD5L 3DYOA 3FB7A 4KRMB 4S1RL 5E7BA 4LU5H 1TZGH 1BWWA 1N6UA 1U91B 4XX1G 3D25A 4L3CA 1YNTA 5KS9A 2BNRA 3PUCA 3NCFB 1VGEL 4XGZA 2ESVA 3RDTB 1C5BL 1FVCA 5E6IA 1T5XA 1D9KB 1QNZL 3SE4A 4OGXH 4LSUH 4PJFF 3QFJD 2XNAA 4CNIB 5IMOA 3PDOB 5DTFA 3UPAA 4Z0BL 3P40A 1U92B 4GG6E 2OI9C 4L5FH 1CFTB 3T4YB 5BOZG 4X4YA 5IT2H 1F4XL 1JTOA 2AJXH 1YECH 5HPMB 1GXEA 3ARWA 3O4LB 4OZFH 4MJ6A 4PB0L 1EO8H 2WUCL 3DVNB 4QXUL 4KKNA 4HFUL 1A1NB 1R0AL 5E2VH 3M07A 3F8UB 5DEFB 3BT2L 2ESVD 2NY2D 1G7IB 4UOJA 3HUJA 1EXUB 1DFBL 2E7LA 1P4BH 4APQD 3KPQA 1D5ZB 2Q87A 1CXFA 4LQ1A 3VWKC 1R3JB 2A74B 3OAYH 4XZUA 4F58L 4U3CA 2XKUA 5DMJB 3LPGA 1QD0A 4PGDA 1BVLA 1QRNA 4U1IB 4H1LA 4MS8C 2V7NA 1I7RB 4RWYH 1HK6A 5DR5H 3T65A 5E8PB 4Q97A 1E28A 5LG1A 4OZFB 4OLUL 1MHPL 1HWHB 3LKNB 5EFIB 3V2AR 3QP3A 3BW9A 1IEBA 4NM4L 3G5YA 1SJXA 2Q6WB 3E6FB 4JHZA 4X6CF 4LCCB 4P5KA 5SV3A 4WFHE 4NKOA 3GGWA 2MKWA 1J05B 3NCYS 1KSRA 1E6JH 3QO1A 4H5SB 3VFTA 1TJGL 2O5ZL 3JWDL 1IEAB 4NHUB 1BREA 1YEIH 4PGCB 3I2CH 4H1LH 2NY3B 5D1QA 2A2QT 1J5OH 4ZS6C 3V0VA 2FL5B 2BRQA 1D5MB 1QRND 4KI1A 1XGQA 1NGWA 2OX5A 2ADFL 1CR9H 4GSDH 5FUCC 1H3WM 4ORGB 3UTTB 3VU2A 4N0UB 3Q3GB 5AWNH 1ITBB 2A83B 5F7FA 3S5LG 2IBBA 4CRPA 4JDTH 3BKCL 4NJAL 4U7MA 4TPRL 2V5SA 5ICYA 4M93B 3GHEH 5EU6B 4D0CA 4DK3A 1DQQA 3EDDA 3SDXB 5IG7A 2PTUA 3FFCE 3FRUB 1IILE 4GUPB 3PWJB 5AZEL 5TDPB 4M1GH 4OIAA 4Q9QH 3MYJA 1IC7L 2P8LA 3JSSA 4J4PD 3T3ME 5IKCB 1UFUA 4JZOA 2L7UA 3N1PC 2FYYA 2AS5M 5FO7A 2BVPB 3WL9B 1MEXL 1K85A 2ZUUA 3ILPB 4RIRA 3X14B 5EZLA 5FF6A 3MRDB 3Q6GH 2R2EA 2E7BA 1Z3GL 3VXME 1WTGT 4OI7A 1RK0B 2A73A 4Y1AE 3QRGH 5EU7E 4U33A 2FIRT 1LO3L 4O51B 3ZKXB 1A21A 3ZYOA 1F4AA 3CXHJ 5I0DA 3TN0A 1PKQB 1YUHA 4WCYH 3V4VH 2VDOL 1IAKA 2X4TA 3GNMH 4V1DD 4WWKB 1NCAH 5GGSY 1G0XA 1QVOB 2NX5A 5I73B 5KSBA 4NQCB 4HGKC 2GYSA 3RVXC 3GSQB 4ZTPL 1FNLA 2EC9T 3LQMA 2B5IC 5L0QB 2CMRH 1CD1A 2HH0H 1V3JA 2IPTH 5CEYB 3W0WA 1KEGH 4MJID 3EDEA 4OBSA 2VIRA 1LP9A 5EOCH 3IF1B 1A7PL 5HYJA 1FNGB 2PTVA 32C2B 4U6HA 2A9MH 2HJKA 4Z7UB 3SE3A 3U1SH 4DUVA 2VERN 3NFPA 4Y5YB 4P3WA 3MRLA 5T1KA 3HZYA 4NM8H 1UA6L 3MBEB 4ODWA 3ARQA 2NX5D 2NTSP 5IEHB 1GC1L 3E0GA 2H32B 3DTXA 3CVIH 4NZTH 4AY0A 4JJHA 3QJFB 3VXTB 4TOYL 2YD9A 3FQNA 2IQ9H 4PRAB 1T1WB 3W0WD 3MA9L 1GAFL 4MNGE 3DLQR 4WHTA 1DBAH 5EC2A 2D7MA 3AVEA 3O6MH 5LXGH 1MCDA 1CL7I 4JG1L 4JY4A 3ALXA 3L95A 5CJQH 3ROOB 5I1LA 3RWHA 1CICA 2XZCH 4QHLA 1JGEA 3RZCD 4KRPC 4RGMC 1UB5B 1A7QL 4BM7A 1CLZL 3T3PF 4ZUSA 5C0NC 5MENB 4KROD 1R5IB 3PV6A 2W0LA 4JJ5B 4WY7L 5FGBA 1KB5L 3MX0A 5I15L 3MUGA 1NANI 2DI8A 1HKLH 4LRIC 3GMMB 1FZMA 2J2ZA 4GXVH 4MLSA 5H2BA 3PWPA 4M8VA 2R4SL 1NFDB 1Y6NR 5IUSA 2HKFH 5L6YL 1KTLB 4TSAH 1AO7B 1BFSA 2PO6A 3H0TB 4UT7L 1MOEA 2NY6B 3CCHB 3WXVH 4ONFL 1YPZB 3GMRA 4MCYA 3VXSA 2H9GB 2Z93B 4JPKL 4X8XA 3RPKA 1FGNL 1BP3B 1U8MB 5ESVA 5ILTL 1CN4A 5EZIH 1FO0L 3KPRB 3D3VA 3QHFH 2ZOKA 4S11A 1IGJA 5GGRB 5LCVL 2Y36L 4J3OC 4AJ0A 1KCRH 3WKML 3CVHH 2P5ED 3DO3A 4PLJD 4E5XB 4J3VA 3HMWL 1YZZA 5CP7B 2IFFL 1U58A 3DRQA 5F7WC 2XN9B 3H9SE 4PJFB 4NQVA 4NKMB 4FP8L 4RAUA 2BSRB 4OZIB 2LTQB 3WFDH 3KLDA 4GMSH 3B43A 2G60L 3IXAA 5E00A 3VXSD 2HVJA 2JE8A 5A1AA 3KS0H 4Y19D 4Y89A 3QZWB 2IQAB 1YDPB 2N4IA 4PRPB 3STLA 3RX7A 2GSIA 1CXEA 3QIUC 1CFNB 1S7VB 3BAEH 3UMTA 2OR9H 1VESA 3LKQB 2EDXA 5I19L 3I6KA 3MRIB 1XAUA 5EBGA 4RA0C 4I48B 3RY5A 3D3VD 1FV1B 4KDTA 4JPIB 4L1HA 1P7KB 4CN4A 3BP6B 5DVKA 3MOQA 4P2OB 5FM8A 1UXSA 3CVHB 3DURB 4UT6H 3P77A 4HJGA 1A9EB 4OM0L 4PJBB 2E3VA 3PABA 5DJZB 4M62L 5FKAA 1TXKA 3T77A 1YEDA 3BX7C 4KKBD 2ADJB 4I18C 3MLTA 3U6RB 2WWMC 5AYUL 2P45B 3WUZA 5C2BH 1AJ7L 2HTKD 2ZG3A 3CFBB 2EIDA 1OF2A 3ZO0A 3ROLB 4D0BB 4KVCH 1A7NH 2EDLA 3GBML 4M1DL 3CLEH 3ZE0F 2KUTA 5E8DL 3SGDH 4R97B 1Q8MA 5T1LB 2MCPH 5IJKC 2ZOLB 4F7EB 4OZ4A 4XP1L 12E8H 5A2IH 4X6CB 3FQXB 4XPTL 1S9XB 4ZOAA 5CJBA 2ZZUT 3SOBH 5EBWB 1CLCA 3KPPA 1SEBA 4ZAKD 1DE4B 1WWWX 2XZAL 1OL0A 2IPKB 2I60L 2J3SA 2EH8H 2YPVH 3QUZB 3RWIB 4GAGL 3UP1A 1I1CA 4DKFL 4OV5A 3AB0B 3T4AB 2VABB 4M00A 4O2EA 4Z7QF 3F12A 1ONQB 1YEGH 4GRLD 1ZXQA 5E5UB 4R96A 3MFGB 4MMXC 2CUMA 3AU1B 4LVNC 2YD3A 4K23L 2DQCL 5FGRA 2Y07H 3E3QC 2P46B 3FQRA 5HGGS 4PJHA 2AERT 1E0OB 2RFXB 3P11H 3AREB 3AAZA 4Y2DA 1OCWH 4FQ2L 3QUXC 3O3AA 1VFUA 5GRYA 3S88H 1WUNT 4B7LA 1MHEB 3QWQB 2P5WB 5TQ0H 5HHPB 4NKIH 1ZKAA 2D7OA 4XNQA 4JN1L 3GJFB 3QNXA 2RGSA 4X7TB 1A3LH 1NBVL 3BZFB 4YBQC 4ZNCD 3W5MA 3CU1A 2XICA 5DI8A 3RUGF 1I1FA 3WO3B 2ZNXA 1KJ2B 4MD5B 2VTFA 2Q8AH 4ETYA 3MXWH 3WFCH 1JPTL 3SKUD 5F89A 1B4JL 2X44D 3MUY1 5FYJH 2C4FT 3L3GA 5I74B 3KPTA 2BVOB 2WBJA 4NQDE 3V7AE 4PGEA 2JCCF 3EFFA 4Y2DD 5DO2D 2R9HD 3FZUD 2V7HA 1AGBA 4JY6A 4YHPB 3HC4H 2YD8A 4LEXH 1T66C 1R3IL 2WNGA 3MZGB 4LGSB 3QCUH 4PTUB 2Z9TA 1IFHH 4U7KA 5FO9A 1J11A 4HAGA 5E9DD 1LD9A 1QEWB 1I8KA 5JHDB 2XPGB 2YZ8A 5C8JA 2AV7A 3ALPA 4CVXA 1U8HA 2BNQB 5T33H 4Y16B 2FNBA 5I1DB 2NY1B 4L29A 2I9TA 3L9RB 2OI9B 4GLRH 4Z7VF 4GBXD 4J12A 3QDMB 3WFEH 3WIHA 4OAWA 2Q76A 3IDYC 4P49A 4ZXBB 3ULSB 1IC4L 4HIIB 4E42A 4XNUL 3BIKB 2EYTA 4NNPH 3GJEA 4JFPB 5JQ6L 1SBSH 5ALBH 3LDBC 2JJVA 4HBCL 3U4EA 3GEWB 4DKAA 4F33A 2EDBA 3WUWA 1ZA6B 2VH5H 4Y88A 3LMJH 2VR9A 3MYZA 5EBLB 3P4MB 4X6BB 4G8EB 3VWKB 5ITFB 3TP4A 1E4XL 3QEUB 5GS0H 4PJ7F 1HHJB 3EDJA 3IU3B 3T0EE 3BGFC 4L8BB 3MODL 2D31A 2IADB 1A3QA 2IMMA 5I9QC 1CWVA 2I5YH 2DQTH 2VL5A 4A6YH 5DJ2A 4GW5A 8FABB 3GIVB 3SCMC 1ADQL 1EZVX 1R5VA 4HCRH 4K94C 1I1YA 1LEKA 5INDB 1TITA 3TVMC 1CLOL 4WI5A 1BBDL 1CFBA 1KF9B 5IBTH 3R06A 3IDMB 5IFJA 1ZHKB 3GSWA 4G5ZL 3SEPA 3EO1B 4DN4H 2UWEE 4HJJL 1YYLH 2JJWA 4U6TA 1QO3A 3MLZL 5F21B 3MSPA 5DEZA 4NDMA 4WFFE 2VWEE 4NQTA 2PTTB 4FQIH 4OLZH 1CT8A 2JELH 3WEXB 4TSBL 2ZCLL 4WHYG 3TIDA 4IIQA 4Z7NE 5I16A 2E9IA 4HX1B 4NRZB 1A1OA 1Q0XH 2L7JA 3GK8H 3BGMB 3MLVL 4W4NA 1RZFL 3X3GL 2CLZB 1NCDH 4ZFFB 4M7LL 1CDGA 5D1XC 4LVEA 5IIEA 1MCPL 1TJIH 1KCLA 5B8CB 3BKYL 2C4FU 3GRWA 3OJDB 5DWUL 2J88H 2F53A 4LRNL 4Q74A 2D2OA 2Q7NA 3QHZL 5JW5A 3LEYH 4WEBH 1EFXA 5IMLA 2X4PB 3SE8H 3EYUL 3I3BA 5CMAB 5IB2B 3KYMA 1K3IA 4J1UA 5I71C 1OP5H 1I3RB 3FN0L 2FJGB 5F7DB 2DICA 3VXPB 5I8KL 3GMQB 1C7TA 1MI5B 1X6LA 4PP2B 1TQCB 4X5XB 2B2XH 2APFA 3OR6A 4FQQA 4QXTB 4M4PA 3H2WA 3IFOA 3VXRB 1NAML 4IHOA 2FBOJ 4X6EB 2OK0L 4JM2B 2X42A 3E8UL 4ZTOL 5BW7C 4RGNC 2Z8RA 4KK8C 2DJSA 2WQRA 2X5PA 1JK8B 2DM3A 4BSJA 4Z0XB 1JN6B 4P2QA 4L4TD 4X99B 5DD3H 5DD5H 3I3DA 3MRQB 1T7VA 2CDGA 2HLAA 4YK4C 4S1RH 5DJ0A 4CVZB 4GMTL 3AM8C 3MRGA 2HLFC 4U1KB 1D5IL 2CD0A 4KMQA 1IL1A 4PG9B 1KEML 1VGEH 3QO0B 3SO3B 3UTSB 4LSRL 5FB8A 4YHKH 3MREA 1C5BH 1IC1A 1MRCL 3KYNB 1ZT7A 1RJLA 1QNZH 4CADB 5TE6L 5L2JA 2H2PD 2X4UB 4EI5B 4WTWA 5EB9A 4Z5RB 4KZEL 3DX7B 3OL2A 5F1NA 4Z0BH 4DUWA 1K4DB 4Z95L 5E4EC 5IMKA 1UWEL 4P2QD 1TTUA 4OLYL 5DJDB 3ECBA 2IBZY 2OZ4L 1FORL 3HPLB 5J6GB 2R1XB 2FJHB 4K7PY 5GGSA 1JPST 3WIFB 3X13A 5DSCB 3G5XB 4JFEB 4PB0H 4NN6B 5HHOD 1VADA 2WUCH 3D2UA 4QXUH 1FFPB 4YFDB 1RVFH 4HFUH 1R0AH 1EEQA 2NY2C 5ICXB 3BYYA 1PG7L 1HHHB 2D4FA 2FCBA 3BT2H 4MSWA 4U2ZA 5E6IC 1NMCC 3IDUA 4FMKA 5HD8D 4QF1A 1G1CA 4WI6A 2J8UB 5IB5B 1UG9A 1DFBH 3HHRB 2XZZA 3FN3A 1A4JB 1CE6B 2JKXA 4K71B 2VL4A 4U1MA 4RGMB 5D2LA 2E6JA 4F58H 1FE8L 1U8KA 3QB7C 4NO0A 3BZ4B 3HE7D 4JFOA 2VJXA 1H8OA 3EJJX 2X9XA 5DVMA 4ELMA 1LDPL 3D2UD 5GIRA 4QYOA 3MR9A 3SDCA 4AM0B 5C0EB 1JZ8A 1I9EA 2VZTA 1MHPH 4OLUH 4RFNC 3D85B 3V6FB 3VXQB 3DUSA 3RUGB 4NM4H 4KQ3L 5EOTA 5F72S 5I1AB 1MWAB 1NLBL 2P4AB 4JFXB 1AKJA 1AY1L 4UILH 1B4RA 1FRGL 2O5XH 3ZDXF 5C1MB 3WO4B 3KYKL 5FGSA 2O5ZH 3QQ4A 2J8OA 3JWDH 3X12A 2Y7QA 4OLEA 2ED9A 5E95B 4RRPA 3QUML 3W9DB 3G04B 2WP3T 4UU9A 4AH2A 4YZFE 4NO0D 5JOPD 4WO4B 2CDFB 5ALCL 1JHTB 3EOAB 3GKZA 4Y4FA 1RZKC 2EEAA 4HFWB 1DTUA 4UDUB 3S35L 3ARVA 5IB1B 4HS8H 1M7DA 2IH1A 5EZOL 1RIVL 2RR3A 3K80A 1T1XA 1AXTH 4O2CA 3OGOE 2AEPH 3TH4T 4LOUD 1AKJD 4JRXA 3BKCH 2NY0B 3M8OL 3VFMB 1I3UA 4TPRH 5CEZE 1J8HA 3EO0B 3PG2A 3B83A 3PWLA 5D1QC 4XVUD 4GQ9L 1RJYB 4HIJA 3KPMB 3E1F1 5AZEH 1A6WL 4Y4FD 3TJEL 1JGDB 1IGTB 1IC7H 5I66A 1T21B 5JTWA 2PR4L 4PY7B 2BNUB 3IKCA 1F4WL 2X4RB 4C83A 4C55A 3ZDYF 2ZSVB 4NZRL 1EK3A 5FGCB 2X05A 4W6XB 1EGJL 2CLRB 5H35A 3W11D 3PP4L 5BVJA 1Z3GH 4CBPA 4F7TB 5EUOF 4I18B 4FQHA 1QFUL 5DQJB 1J8HD 3QAZC 4JKMA 1LO3H 1K9TA 3BVNB 4PJ7B 5B38A 2NTFB 1S7WA 5CSZA 1SM3L 1T1ZB 3RP1A 4KTEL 4C56E 3DSFL 5JA9A 1INDH 2VDOH 1L0YA 5A40E 4HS3B 4PJAA 5CKGA 3B2VL 4GAFB 2AI0L 4L3ED 4JANA 2Q8BL 4ZTPH 3HR5B 5KBNC 4XBGA 2NLJA 5HVWA 3OTTA 4BUGA 2Q1EA 3BRDA 3JXAA 1QLRB 2DQGL 2X7LB 3L5XL 3QEQA 4YEEA 4ZFGL 5FEBA 2ICEB 4ZO9A 3LD8C 2R0LH 4L4VA 3K2MC 4XPFL 3TN0C 3MRHA 4PJGB 3GI8H 4WEUD 2X4SB 1DLHB 3TNNB 3K2UL 1NJ9A 4YGVA 3MMEB 1UA6H 5KS9F 4S1QL 4Q58C 3TPKA 4ZSOA 3ZYZA 3WDHA 1GC1H 3PGCB 5AAWA 3WLWC 4D0DA 1H0DB 3DNKA 5LAXA 5C7XL 5K9QI 4CMMA 3QNYB 4OSUH 4D9QE 4R3SB 5I17A 1JMZA 1FFOB 1BZ9A 1PG7W 1KB5A 2CUHA 2DMBA 1DZBA 1GAFH 3MA9H 5HHME 5TFSL 4C59B 5L88H 4OTXL 1CD0A 1HHKA 1P69B 3B9AA 4MDJA 3SE3C 4FFVC 1BD2E 4JG1H 4CMHB 1U8OA 4XP9H 4MD4A 5EU4A 4RCAA 4LVOC 1NSNL 3ARTA 3PWVB 4D3CL 3A6BL 5I76B 4FQCL 4WDIA 3HZKB 4KWUA 3V7AG 3C60A 4YJZL 1A7QH 4KDWA 3RKPA 5DJAB 4HUWA 1CLZH 1FC2D 4GG6A 3CD4A 5C0RL 2APXA 1YJDL 1KB5H 1T0NA 2N1KA 2ILLA 1IKFL 5CBEA 1NCCL 5HYQB 3SDAA 4W81A 2IEPA 5C92A 3L5IA 5D72L 4ENED 2R4SH 1SYVB 5DHVH 3ULUD 4UT7H 3EYOB 5T1MB 5HVHB 1VKXB 1CICC 1JNHA 4K9EL 3E6HB 4POUB 1SVZA 4ONFH 3QEHA 3LQAL 4Y8AA 5TF0A 1WZKA 4JPKH 2LFGA 1OHQA 3NGBC 4X8JB 4Z78A 2NW3A 1KPVB 1BLNB 4XNZB 5ILTH 3C60D 3GHBL 2HTLC 1MRFH 5FGBC 1FO0H 3OAUL 1T0MB 3HLAA 1KIRB 5E8EA 1AGEA 4JRYD 2VE6A 3ET9F 4PLJC 5LCVH 5J0BA 2Y36H 3SDDA 3GMNA 3WKMH 2BERA 3GDBA 4KKLD 3KLAA 3M45A 3HMWH 2PO6C 2FO4B 2IFFH 4LDEB 4YDKL 4HLZH 1MJ7H 4N0FA 2FJFB 4FP8H 2IAMA 4MGXA 4G9FE 1LMKA 1CL7H 1K5NB 4UAOC 3CFIC 2P1YA 2GTZA 3AXLB 1M6OB 5LQBH 1PG7X 1S7UA 1F6AA 4QY8A 1SQ2N 3U83A 1TDQA 1GOGA 2EDDA 3HRZA 3AMLA 4MA7L 1T03H 1NEZA 4G8GE 1G1YA 4XAWL 1H5BB 2DLTA 4XVTH 2AJZA 1FGVL 4OIBA 4KK6C 5FYKE 4F9LA 5JLZA 2MTPA 1DR9A 5C0CB 1NANH 1BJ1H 5GZOD 4Z18A 5AD0A 4XP6L 2WW8A 1Q9KB 4M6ML 3FFDB 2BP3A 2XTJC 4XPHL 4FQJL 4OM0H 2KQNA 3BGFB 1FJ1A 1LO5B 4M62H 4ELKB 2AQ1A 4XRCB 4IJ3B 1XR8A 3WHXA 1YYML 2HTKC 5AYUH 4DZBA 2VXTL 3VFRB 1Y0LA 3I9GH 4U1JA 3FFCA 1SMOA 2CLVB 3CDYA 3TA3D 4HZLA 1YQ2A 2D7PA 3GBMH 4KDTC 5KANG 4M1DH 5E8DH 4UINL 4EXPX 2GJ6A 1WCQA 5IB3A 5FK9A 4FQLL 3O3BB 4CKVX 4XP1H 3D0LB 4RGOL 4XPTH 2QL1A 1FVEB 1M1SA 2KDGA 1L4IA 4JFYB 2BVYA 3MBXL 3BIBX 2DF3A 5CEZL 1QFPA 1YEEL 4LSPL 1XGUB 3S35X 4BSWB 4M8QA 3QUKB 3B9KA 4WHYH 4Y5VC 4AIZB 3BZEA 2FIKA 2XZAH 3MOAH 1ZA3B 2I60H 3ARGA 5KSBF 4Y1AA 1XGPA 4MMZC 3B6SB 4WI3A 43C9A 4GAGH 1KC5H 1Q0YL 3OKLB 4DKFH 4KK5C 3RJQB 5DRWA 4JFDE 1W8OA 2GJ6D 4I2XE 4OZGA 3TT1L 2WP3O 1QSEE 4G6MH 1ED3A 3JUYA 3DX9B 1OSZA 4KI5E 2B8OT 5KVDL 1CDYA 2OJZL 5D7KE 3DO7B 5JR1L 2DQCH 3MRJB 2SEBA 5HGBB 4K3EL 3B9KD 3HTLX 4MCZB 4F37F 1RZ8A 2H1PL 4L9DA 2ZCHL 3CFKB 4LCWE 4TULL 5DJYB 4FQ2H 2EDFA 4YQXL 3HMXA 2N7BA 4L8SA 4KV5E 1KTRL 2Z8SA 1JV5A 1NBVH 2XWJA 3X17A 3EYFB 1A64A 2NXZD 4KH2A 3QIBD 3TV3L 1QACA 5MERA 1I9IL 1JWUB 5DUBB 2NNAB 5L2KD 4ODVL 3T04D 1MELA 2EE9A 1B4JH 3L7EA 5DYOB 5KOMC 5C6TL 5KN5B 1XF5B 4PYGA 3MROA 4MNGA 4Y2DC 1JNJA 1Q9LB 4HKZB 3OPZL 3FZUC 1X6NA 3UBXA 1EUTA 3KPLB 3G5ZA 2HT4D 5JXAL 2AEQL 3V4PL 2NY5L 4NQUA 1R3IH 3MLUL 2H3NB 3V7MA 1UVQB 4KKCD 3VGAC 3E2HC 4HHAB 1GGTA 2R0KL 3SJVE 3Q48A 3QFJB 4MAYD 3VFSA 2QQNL 3ZMRA 2D9CA 5K9QG 1EIBA 2DTSA 4ZPVB 4EVNB 4OGYL 1FNEA 5C0DA 4HS6B 4Z7WE 2WBJC 4PJIF 4P4KA 2AEWA 3ULVE 2HN7B 4LARL 3QH3A 1J0KA 1NGXB 4FABL 2F54D 2ESVB 2NY2B 2VLJE 3LS4L 4FZ8L 4XNUH 1BVKB 5JQ6H 4TUKH 5HDQL 2VR5A 3MV9A 4NP4L 2WWKT 3UTOA 3OJ2C 2XZQH 3ARSA 4HBCH 1KELL 2X9WA 4APQB 1WFTA 1ADQA 4ZO6A 1UZ8B 5D7JD 2OR7A 2FEDD 1IQWL 4YLQT 3SQBA 1S9WA 5F1IA 3WJJA 5DK2A 5SWZD 1WQVT 2DI9A 4X4YB 4B7IA 4P4KD 3MODH 4PJXE 1FZOA 1J9CT 1A1MB 1ADQH 5FXCH 4PY8J 2YK1L 5EO0A 1BBDH 3HUJB 3MV9D 1MJUL 3V5KA 1ZT1A 3KPQB 3GI9L 4JFFD 3VD7A 4PLKC 2I27N 4G5ZH 4HJJH 3NCMA 5ADPH 4F15C 5BRZE 4PGDB 1BVLB 1QRNB 2WUBL 3F7YA 3V8OA 1T1YA 1SYSB 2EZ0D 3T65B 2EH7L 5GGQH 1B2WL 4UV4H 2F15A 4TSBH 2ZCLH 3MRKA 4HKXB 5ID1A 3KHQA 4R26L 5I8OL 1FYTE 1IEBB 3G5YB 5D1ZA 1JZ5A 3FT3A 1JJUA 4ISVA 5FYKL 2VLKA 3O41A 2CO7B 1IGMH 1PFCA 3MLVH 1RZFH 3X3GH 1ZHBB 2YRPA 4GOSA 3T2QA 4M7LH 3VFTB 3MV8E 4NPYB 1MCPH 1DL7L 3BKYH 3ISWA 3BISA 3SPVA 3TBYA 4OCWL 5DWUH 4N5EC 5LJYH 3O4OC 4NC0B 3MC0A 4X9GA 1JZ4A 4LRNH 3F7VA 3ESUF 3H8NA 3QHZH 1XGQB 2BOBA 1N64L 2YD4A 1NGWB 4PJEA 1IJ9A 2IPUK 4IIQC 4GS7C 1JZ2A 3WNOA 3BP5B 1HOCB 2ATKA 3FN0H 1YNLL 2IBGA 5D1ZD 4G42A 3SKOB 2DKMA 5I8KH 1ZTXL 4EIGB 1JPFB 2ITCA 2CGRL 3NA4A 4NYLA 3UTZA 4AENB 4GAJL 4D0CB 3H42H 5DGRA 1NAMH 5IG7B 3RBSA 2OK0H 3D18A 3FHAA 2Q7YA 2HT3D 4P2RE 4NFCA 3NZHL 2BVUA 3E8UH 1PZ5B 4ZTOH 5FOBB 4V1DB 1PYWB 4LSTH 4X4XA 3MYJB 3WXWL 2P8LB 4ETQA 4LPXA 1B3JA 1DSFL 5GHWL 2VLRD 1AI1H 1DBBL 1VFBB 5CBAA 2IH3B 4JE4B 4YWGL 3VE0B 4P9ML 4W6YB 4Z77A 4LFHD 2J5LC 5C0BD 2R2EB 4MJIB 3U7AA 1D5IH 1N3NA 3GIZL 1KEMH 3P9LB 4LSRH 1MRCH 4QHNA 4V2BA 4P3DB 5C08E 4MZ2A 1CFSA 5TE6H 2EIEA 1NAMB 1YUHB 4BFIA 2X4TB 5D7LD 3RFZC 3S4SG 4KZEH 4LLWB 4QRPA 4JDZA 1V5JA 2NX5B 4Z95H 1UWEH 2A77L 5ID0B 4W70A 3C87A 4OLYH 2OZ4H 1IQDA 1X3DA 4NQDA 2CJUL 2IJ0C 3ULUL 1CD1B 2GAZB 3W0WB 4YAQB 4UUJB 1EAPB 1CIDA 4RSVA 4H26A 5JZ7D 1BVZA 1MUJA 1WBXB 1LEGA 5IVXE 1PG7H 3ARFD 2X4NB 1LP9B 4NNYA 1RUAL 2YEZB 4MXVF 5HGAA 2HJKB 5TF1L 1YEFL 3EOBB 1DDHB 1FNAA 3RZCB 3HZYB 5D70L 3MXVL 1QSVA 2L0DA 5AEAA 3KNBA 1CD8A 4ODWB 4QRPD 1OVZA 4Z9KB 1CIUA 3PGDB 4KROB 3QR2A 1T80A 1FE8H 2B4CC 2DM2A 1KUMA 4FQXA 4JFFE 3WFZA 5I1JL 3QUMA 4BQCA 1KJVB 2WINA 3MNVA 1LDPH 2QKIA 3PV7A 5F7MC 4RWHA 4WHTB 5EU3A 1GHFL 4KQ3H 4JY4B 4LMQE 3CPLA 1A6ZA 3GSXA 2JJTA 2W9LA 3RPIB 2OXGA 1FRGH 2ITDA 3KYKH 5HVFB 5DMGC 4M1CC 3VWJA 5E5MA 3QUMH 1XGTA 3VGFA 4HMEA 3CLFL 1J1PH 3QSKB 5ALCH 4XNMA 4FQXD 5KG9B 1FZMB 5DMKA 3JV4A 2P5EB 5H2BB 4ZG1A 1ZLVK 3SDCC 4ODXA 3L5WA 3UDWA 3S35H 5TDNB 4P5TD 5IWLA 5EZOH 5FUOL 2J6EA 1RIVH 4BQ8A 3AS2A 5DEGA 5IHZA 3VFOA 4QOKA 3GMRB 4MXQD 4AEHL 1F8TL 4Y19B 3UTQA 3RNKA 1F3RB 3ARBA 4K3HA 1EGJA 2UWEA 1A0QH 1CK0L 1F58L 1GPOL 3LB6C 4OQTA 3PHQA 3VWJD 4GQ9H 3T2OA 3D3VB 1BFVL 4Y4FC 1P4IL 3FO9A 5JIIA 1IGJB 2L4OA 2CH8A 1A2YA 1SY6L 1A6WH 3TJEH 3C8KB 4E0RA 5SV4A 3TBVB 3MRRB 4LVHB 2PR4H 1U3HD 1BX2A 1F4WH 3OKNB 3C6LA 1DQML 4OKVB 3DV4B 4NZRH 1UZ6F 2AV1A 1C16B 3T2PA 4NFDA 1G7HA 3W11C 4ACPA 1EGJH 3P9WB 4QOKD 5E00B 3PP4H 4FXLA 2G9HA 1TVBB 1J10A 3P0YL 1HCVA 2HYMA 1I8IB 1QFUH 3STLB 4XCNA 2WWKO 2GSIB 4WHCA 1JNNL 1S7SB 2DKUA 5GRVL 3GUTA 1HE7A 5FA4A 1SM3H 1P4LB 4KTEH 5CAYB 5DJCA 3DSFH 1VDGA 4G6JL 4KAQL 2B1AL 3A67L 3UJJL 2AI0H 2AXFB 1RQ5A 5DRZA 1UXSB 1S9VB 3P77B 4XCYB 2Q8BH 3QYCA 1U6AH 3C6LD 1NH6A 5FKAB 4ZAKB 3FRPA 3UC0L 5F9DC 3O9WA 3T77B 2R4RL 3FCTB 2D03L 3IT8D 3MACL 2MSPA 1GCFA 4ONHA 2DQGH 1XCQA 1Z9SA 4ZFGH 1WIOA 5A2KH 1BZ7A 4XPFH 2WSKA 2I25N 5GJSL 3HPJB 4IS6A 3K2UH 3L5HA 2UY7A 3L3DA 4HWZB 3KLHD 2YPLE 3O8XC 4GRLB 4S1QH 5T5NG 4F80A 1LDSA 1ZVSB 3BDYL 1NGZA 4F2MA 5C7XH 4IOFD 3QXAA 2ADIA 1NBYA 2X1XR 3KPPB 3FN9A 2AQ3A 2VAJA 3LY6A 3M17B 3O9WD 4DVBA 3VD4A 1L6ZA 4OTXH 4U1LB 1XZ0A 3L3IB 3O81A 1CBVH 3WFHA 3KXFA 1AIFA 4DGIL 1J0YA 1EO5A 2WIIA 4KRLB 4O5LL 3QXDA 4OB5L 1NSNH 2HVKA 4D3CH 1AD0A 3A6BH 1H8SA 2WMPA 5C9JB 4TUOA 5I30L 5E7FA 1BOGA 5F97E 5F9AC 3QCVL 5HI5D 1CQKA 1YJDH 3L3KA 1MCFA 1F00I 3BH9B 1JMXA 1IKFH 1J87A 1OGTB 1NCCH 4BH7A 5CGMA 1EEZA 4LMQI 5D72H 5ADOH 4PJ8A 2ZPKL 3V6OE 4PJHB 4QRUB 2V6HA 4HXAL 1JVKA 2MWCA 2OL3B 3AAZB 4Y2DB 5D2LF 5GSRB 2M1KA 1GIGH 1I3VA 4L8CA 4NSKA 2Z31A 3KXFD 4N8VG 3RVVD 5ISZA 1FCCA 4ELMF 5MEQB 2OTWA 1JBJA 4Y4KA 4TTGA 3QNXB 1LK2B 5D6CB 1OAYH 3VGAB 1IAIL 5E9DB 3GHBH 1H3GA 5HYSA 1MHCB 3OAUH 4M3JA 1O5DT 3SDAC 5FDYA 2VITA 4ZNEE 2EYRB 3GFUA 5F89B 4Y4HD 4PJ8D 2EDHA 4GBXB 4FXKB 4L9LA 4YDKH 5FIEA 1EJ6A 4XMKH 3EFFB 5CD3A 4FQ1L 1IEHA 1IZKA 1AGBB 2Z31D 4ALAL 2W0KA 4JY6B 4HULB 1JIBA 1MVUB 4Q6IB 1LEIA 2DL2A 2BY2A 5HY9A 2YPKB 2Z4QB 4JZJA 4MA7H 4JO2L 5FO9B 3HG1A 4MQ7A 4XAWH 1LD9B 4FMFA 1FGVH 3SY0A 1PAMA 3RVUD 3SDDC 3TZVA 5CD5D 2AV7B 1U8HB 3IJHA 1VHPA 4MVBC 1RZJL 4XP6H 4M6MH 1PJ9A 3U7WL 5KSAA 2AAVA 2IAMC 4XPHH 2PYEA 4OAWB 1J0HA 5DVLA 2Q76B 1VERA 1TLKA 3F6IA 4HUVB 3JWOL 4N90E 3TESA 4E42B 3VCLA 2XG5A 1YYMH 3GJEB 5E2WL 3FT2B 1OTTD 3PHOB 3V5DB 5I1KL 4I9WD 3GMPA 4PG2A 3BQUB 3G6JA 4MA1B 5IP4A 4F33B 4F9LC 3HG1D 3WUWB 3DPBA 4PB9H 1BQHA 4UINH 4JPVL 3TZVD 3X11B 1V7ML 2CKBA 4RGOH 2YKLL 4IRJC 3BO8B 3MGOA 1WWBX 3K1KC 5KSAD 4HUMB 3MBXH 5CEZH 1YEEH 2VLLA 1SHMA 3K4AA 4LSPH 3PP3K 4PJAF 3H9ZA 2QR0B 1SEQL 1I1YB 4RDQG 5GXBB 1ZHNA 3TCLB 5JW4R 3TPUA 4WFEE 2DMCA 3CSYA 3GO1L 1II4E 2DQIL 3B3IA 1Q0YH 3OJMB 4XCCL 3GSWB 5BZDB 2CKBH 2HFFA 1RHHA 1R3LA 3TT1H 1UJ3A 3PDDA 3S9DB 3QIWA 5JXEA 3BN9D 3EJYC 1PDKA 4OZHB 1AHWA 3T0BA 5AUMB 3U0WL 4FTVE 4QT5A 4E41A 3PXHA 3B9KC 5ANMA 5F3HA 3TIDB 5JR1H 5I16B 2JB6A 4K3EH 3ARGC 4KRNA 2W65A 3DUUA 5D8JL 5EU7C 2H1PH 2ZCHH 2X4OA 1PVHA 1PLGH 1T20A 4RNRB 4QHUB 2RJMA 1N59B 3IRZA 2NZ9D 4YQXH 2PW2A 5IIEB 3NVQA 4DVRH 1GH7A 3FQWB 2LU4A 3ZT5A 3W9EA 5BXFA 5JXED 2BHZA 4PV9B 1INQA 5JW5B 5F7EH 1I9IH 4L4TB 4E41D 4LPUA 1CZ8L 5J1AA 4ODVH 4RMRA 2OLDA 1UACL 3UBXG 4J1UB 5C6TH 3HFML 1LO0H 4G43B 4RMWA 3F58H 3DJ9A 4FFWD 3OPZH 4GG6F 5K9KB 2B0SL 3EO9L 5IQ9A 2QADC 2MQ3A 1BD2A 4N0RA 1UKTA 2DN7A 5JXAH 4KKCC 4N9GB 2AEQH 2COQA 3FO2B 2NY5H 3V4PH 5BJTB 4ZODA 4L8SC 1H3XA 1IAMA 2R0KH 1FVDA 1S3KL 4UBDD 3HE6D 1HSBB 1ZV5A 2FLBT 1HI6B 1L7IH 2QQNH 3VRJA 3BMWA 5DUPL 5HVGB 2XTLA 4K8RH 4P2QB 4OGYH 3UAJD 1A6VL 5INCA 1XGRA 4A2MA 2PCPB 3BDBA 1N0LA 2XIDA 5DJ0B 5HHOB 2C1OA 2FATL 3O6FD 3MRGB 4LARH 3VA2C 2DQFA 5DJ8A 1IL1B 4FABH 3LS4H 5FV2A 5FB8B 1ZLUH 1ZT7B 4LPCA 5HDQH 1CS6A 1X4XA 4D9RE 3OKOA 5B3JE 1UENA 1JYXA 5SX5K 3S34H 5FM4A 4YXLL 4XBEL 5FECA 2HJLA 3ZYIA 1OWRM 2IFGA 5IMKB 2C3VB 3P73B 3S4SB 3HE7B 3ECBB 2W0PA 4PP1C 4P4KC 4GKNA 3WIIL 5E99L 5GGSB 2Y06L 1BZQK 3O4LE 3HCVA 2XA8L 1IE5A 5CIPH 3WBDA 1CDIA 4PLOB 1KNOA 3VH8G 5HSFA 4PJ9D 4MXWL 4P4RA 2YK1H 1D5XB 4Q2ZB 5GGVY 4CGTA 4YFLF 1DEEB 1MJUH 1P7QA 3TBWA 4IRZL 4DWHA 3REWA 3GI9H 5DRNA 5MEOA 3WJJC 4QRTA 5D2LB 4HH8A 4NO0B 4JFOB 4UQ3A 2WUBH 2IF7A 4HH9B 3EGSB 5IHLB 2ICWI 2UY6A 2EH7H 1B2WH 1DBKL 1EMTL 4P5MA 5GGTA 5GIRB 1ZSDA 2JK5A 4MWFB 2YD6A 3MR9B 2QSTA 1VPOL 4KPHL 4QYOB 1HINL 4R26H 5EIQA 1LILA 2DWDA 3BJLA 5EOTB 4DFIA 5FYKH 3LVEA 5JNYA 1IZJA 1AKJB 3TO4D 1FNHA 2B39A 1P7QD 1ZVYA 5KAQG 1MFAL 3QQ4B 1NPUA 3X12B 2Y7QB 4QTHA 1DL7H 1WT5A 1TVHA 2XQBH 3MRNB 4AH2B 1VACA 5TH2A 1RZGA 3ELAT 1D5BA 5M7QA 5FYLD 1CCZA 3I6LE 4Y4FB 1XH3B 2YD1A 1N64H 1QPPA 1ZGLB 5F7UA 1KIQB 1M7DB 4LFHG 5I6XB 2IH1B 4WUKL 4OZGF 1Q38A 2P8PB 5K9OA 3UTTE 5EPMB 4N0UE 1YNLH 3LH2L 4XI5D 1HILA 1PY9A 3S97C 5FM5M 1ZTXH 1BGXL 2FZ3A 1GZQA 4LHJB 3ARUA 4H8WH 1C08A 3TIEA 4XPAL 4JFDA 4GAJH 4LHQB 5EU6E 4GKZA 1OOAA 3PWLB 4P23B 4RMQA 3SDXE 2AJ3A 5IVNA 5DA0B 3O3UN 4OD2A 3WN5B 1IKNA 1QSEA 4PJDE 4HK3J 3NZHH 4LHUD 5MHSD 4HIJB 3FO1B 2HKHL 2AKRA 1Q72L 3U2SB 2GY7B 1K2DA 3WXWH 3GMOB 1G9NL 4ZDHB 4ZPTA 1IM3B 1DSFH 4L3EB 1DBBH 3WE6B 1RI8A 2EDEA 1M05B 2FX7L 4JVUA 1MH5A 1YY9D 4U0RC 4YWGH 4P9MH 1X4YA 3OKDB 3FB8A 4RFEA 2LAGB 2R15A 4AEEA 4GRWF 3QCTL 1D3CA 2ZUSA 1MAML 1LO2L 2V9TA 5FHBL 3GIZH 3EBAA 1EHAA 3IDIA 5B38B 3B2UD 5T3ZE 3ARDC 3RGHA 3N85H 1PKQE 3BOVA 3G6DL 4H20H 5JOFA 4LNVA 2GTWA 5J89A 2GSGB 1ACYL 5D5MA 3QWRA 4QXGL 1UKQA 4MNQA 4MJ2A 1N5YL 4R7DA 2A77H 4ZS7H 4JANB 4OCNC 4R0LB 3TWCL 4JGMA 2CJUH 1FAKT 2X89D 4XBGB 2O93L 1KACB 2NLJB 5JZ7C 1M71A 2WBKA 3GSNL 3SN6N 4OFIA 4QRSA 1JUFB 5DZOA 5JIPA 1RUAH 3VFPB 3C8DA 4Z7UE 3QULA 5TF1H 2R23B 1YEFH 3SJVA 4JG0L 1UXWB 4YGVB 4YR6B 3DXAA 5D70H 4GKOA 3V6ZA 4ZSOB 4DTGL 4HT1L 5HHXL 3DVGA 4ZOEA 5LAXB 5ESQA 5I1JH 3AC0A 3MJ6A 2UZIL 5HHNB 1HQRA 5D71L 3IRPX 3UTPD 5I17B 5IR1A 1NDMA 1HHKB 3FQUB 1GHFH 1BF2A 1U8OB 4M3KB 4RZCB 1WBYA 2D9QB 3D5OF 4MD4B 4F7MB 1URLA 3ALWA 2H6PB 4TUJA 3NPSB 2OR8A 2Y5TB 2X1OA 4Z7OE 5D9SB 1Q94A 2H8PB 2OM5A 3DXAD 3C60B 3HS0A 3MFFB 1KJMA 3PWUB 5MENE 3ULVH 3ZKSD 4FQXC 2P43B 1T0NB 3CLFH 1DQLL 4ESKA 4JRYB 3V79C 2C9AA 5FYJU 4BKLA 4LGPB 2OMNA 4PJXA 3R4DA 3PHSA 1NFDE 3MNZA 3NACL 1AO7E 2ARJB 2XWBA 2BSSA 5FUOH 1T7XA 4GQPH 2DQDH 1AQKH 5MI0B 4X98A 3QDHA 3U0PA 4ZFZA 1G7QA 4AEHH 1MCIA 4Z78B 4N8VB 2VQTA 3RWDA 3S37L 2APTA 3FMGH 3VWJC 1S7RA 2DM4A 1F58H 1GPOH 4OFYD 4FG6D 2VQ1A 3HLAB 1S8DB 5BRZA 5CEXA 3KPRE 3T0EC 4KTYA 1AGEB 1P4IH 1WZMA 4BFEA 3UPCA 3IXTA 3KPNA 4NQED 1SY6H 2FDBP 2VDLL 3OGCB 3K7UA 3UDWC 4OI8A 4O58L 4TVSa 2XN9E 5F93C 3U9PL 4N0FB 4PJFE 2CKNA 1W72A 3NABL 2EO9A 1UYWH 1KCKA 2LAAA 2R1WB 3CC5B 4K7FA 4PRDA 5F3BA 1S7UB 1F6AB 5JPMB 3QPQC 1BM3L 2N7AA 3P0YH 3ARBC 2MQCA 3L3OA 3MV8A 2NR6C 3TA3B 1JNNH 5L8KB 2DM7A 2VWEC 1ND0A 3ZKMC 4ODUA 1OAZL 4G6JH 4NC1E 4ODHH 4KAQH 3A67H 3UJJH 5K33A 4NNXA 3C6LC 2VSDA 3F5WA 5GISL 5IW1A 4PJBE 1DVFA 2CO6B 3UC0H 1JF1B 1B9ZA 4EBQL 3WHXB 3MACH 1K8IA 4XWOC 1DUYA 1A6TA 3KAAA 4DZBB 4DKEL 1Y0LB 4U1JB 2CPCA 3C2SA 1IGFL 4HIEA 1ZGLP 5TGBA 5HPOA 4JAMA 4P2RA 5GJSH 2YN3A 4KMTH 3JV6A 3KLHC 3MO1A 2GJ6B 2VZVA 4H0GA 5IB3B 4P99A 1P7HL 4MS8D 4M6AA 5HJ3A 2KKQA 1PZUB 3P9MA 4JHBA 4X6CE 3BDYH 3A6CL 1KCVL 4L8DB 5EBMB 2KH2B 1DVFD 3O9WC 3IJSA 3BZEB 2X4QB 3MGTA 2BY3A 4UDTA 4XPBL 1IM9A 2YC1A 1BHGA 4DGIH 3RWJA 3QXUA 4O5LH 1X5IA 4M9OA 3UEZA 4OB5H 4ZS6D 2DQHL 4UI2A 4OCLC 2IALA 4OZGB 3BE1L 5HI5C 2EDRA 5TDOA 2NXZB 3QCVH 3QIBB 1ED3B 4NUJB 2P44B 5BO1H 1T2JA 4PRNB 4DJMA 4XCFH 4ZUVA 4QRQB 5L2KB 5F6IB 1KJ3L 2GT9A 2SEBB 3TBSA 1N0XL 2ZPKH 1IGYA 5T3ZL 2YBRA 3CFEA 4J7RA 3MRMB 4N1HB 5J9PA 3OKEA 4XBPB 1KIPB 2P5WE 4PD4K 5IB4A 2YMXL 3DHMA 2X9YA 1JV5B 1IAIH 2DQJL 4LQFL 4I4WB 2I9LB 5I75C 4MAYB 3STZB 1NDGB 1D7FA 1R3KA 1WC7A 4GRWB 3LKRB 5MERB 4JQXA 4XVSL 2G2RA 2R2HA 3NCYP 4PIRF 4LLAA 1UB6A 2C7UB 3L7EB 5ERWB 3Q6FB 1T2QH 3OZ9L 1PD6A 3MROB 4BZ2L 1I1AC 5ESAA 3JTSB 3UBXB 4O02L 4PREB 3HZVA 4NQEE 4FQ1H 1LQSR 3G5ZB 3O45B 2FBJL 4ALAH 4LLUB 2F54B 3M1BB 2QEJA 3N50A 1QBAA 4Y4KC 2AK4A 5EIVA 4JO2H 4PS4L 1ZLVH 4G9DA 3BJ91 1A47A 5D7JB 3GJFK 3WJLA 1J0ZA 3RVXD 1FHGA 1JZ3A 2ZSWA 2GITA 4PRBA 4UOW0 2WK2A 4ZUWB 4PRIE 3QPXL 2WLZA 1OB1A 1FNEB 2BNQE 5SWZB 3LV3B 1GZPA 3QG7L 1RZJH 4L9LC 4XXCC 4JQVA 2LQRA 4F7PA 2UWEF 5DURD 3QDME 4P4KB 5C0FA 4RFOH 3C5JB 5DHXB 3UYPA 1JWMA 2HP4A 3JWOH 3RIFK 1JRHI 3NA9L 3QDJA 4XX1E 4NO3B 2BVQA 1D6EB 4JZJC 2OS7A 4QO1A 2FR4A 2VLMD 1AGFB 1TFHA 1A6UL 4Z7NF 4Q0XH 2AK4D 1ES0B 1A8JH 1EVUA 1UKSA 2VZ1A 3P3YA 4JFFB 2NW2A 1U8IA 2PETA 1PKOA 4YNYA 5H94A 5FDWA 1JE6A 4JPVH 5FYLL 2Y4SA 1S9WB 2DLGA 5F1IB 5DK2B 1V7MH 5CJXC 2VXUL 4M5YL 1Q9WA 2YKLH 3MV7D 1J88A 35C8L 1S9YA 3MLWL 4U1HB 3HRPA 4UOW1 2OQJA 3QDJD 3RX8A 1SEQH 4PG2C 1QLFA 4MJ4A 4BFBD 1XCTB 4KRPD 4LLQB 1EEUA 3VH8B 3V5KB 1PX4A 3GO1H 5DRXA 4R9HA 2DQIH 3DBXB 4XCCH 3S37X 3B8YA 4TVPE 3BN9C 4G7VH 2YA0A 4GRMB 4XXDA 1RJZA 1MCOL 4FNLL 1A4KA 4LPWA 5DDHA 4WFGE 2PUQT 3Q1SL 3U0WH 1YC8A 3AY4A 3VJ6A 4RAVA 5EWIH 5FUCE 2OCFD 5D8JH 1TQBB 5D1ZB 4ISVB 3MLRL 4HPOL 3KS0J 4L1DA 3ARRA 1RIUL 3U30C 3RX5A 4XNYL 1WAAA 2NZ9C 2UZXB 5FCUH 4D2NA 3MRBA 5C09E 4WU7A 4R7NA 4OFKA 2YPLA 3SPVB 1UJ3C 2AW2A 3QIWC 3TBYB 2F8VA 1AHWC 2BMKB 2XRAL 1JL8A 3F7VB 4QHKJ 1HDMB 2BHYA 4PJEB 1XIWA 5D93B 2VLRB 1BBJB 1UACH 3LKPB 3BHBA 3HFMH 4KVNL 5CUSL 3R8QA 1C12B 2D7NA 4MDIB 4NOFA 1AGCB 2P7TA 5C0BB 2B0SH 3EO9H 3D1MC 1MI5E 3OV6A 4PD4J 1U0QA 1T04B 1NMBL 4WW2B 2APVA 3BH8B 4P2CG 3ZSSA 3VXRE 1B0WA 3BP7B 5IJKA 4LDLB 1LE5B 4GJTB 2NY5C 2XYCA 1MFBL 2NQCA 5D7LB 2W38A 3P4OA 5E2UL 2HMIC 1DUZB 4X4XB 4OUUB 1QSFA 2EXYC 4KJQC 5DHYB 4ETQB 3O3DB 3C09C 3RI5K 3I84A 1XIWD 1A6VH 3ZSTA 4K07A 4K8RC 5F96L 2WWMD 5AAMA 5JQHC 2EKSA 2FATH 2NZIA 4J3SA 1I8MA 2Z91A 2NMSA 4QRRA 4PRHD 1HZHL 1G7PA 3ARFB 3UTSE 1F3JA 1HQ4B 5GGRY 3FHQA 3PIQA 4RMTA 4HMCA 4LLMA 3D9AL 3QFDB 2E6QA 2VDNH 3LZFH 4XP5L 4BFIB 3P0GB 3CH1A 4XBEH 1RJCA 4YXLH 4QRPB 4JDZB 3T08A 5IFHL 3SKJL 3ZKNC 5E8OA 4KTDL 3PGFL 2PF6A 3IGAA 5CWSA 2D3VA 3WIIH 4DEPC 5E99H 2Y06H 4JFEE 4R2GC 3INUL 3OXSA 5IW3A 4YZFF 4Z7QE 2XA8H 3MRCB 2YA1A 3QDGA 4QRRD 5HI3D 3C5ZA 2JB5L 4LIQE 1WVZA 3H9HA 4NNYB 3DIFB 4MXWH 5KTEL 4HGWA 5HGAB 2VNCA 2MFNA 2J8UE 2P24A 2ARWA 3WFBL 5B22A 1XF3B 4QHMB 4AL8L 3KNBB 4HDIA 3IFPB 1T4KA 3BD4A 4FQXB 1JGLL 3G6JF 1D6VL 4JDVA 1LVEA 4PBVC 3MNVB 1WICA 4NN7B 4RA3A 1EMTH 2R69L 3T8XA 4P5TB 1VPOH 1HINH 3QDGD 3RUGE 5EU5A 3RL2A 4LNRA 4L3AA 3NCEB 4X5WA 4XHQA 4YBQD 2ATPB 5T3XE 2ITDB 3D39A 1DBML 4OJFL 3QXWA 2VISA 4JO1H 4LHUG 2P42B 4R90L 5GS1A 3AS3A 4GW1A 3VWJB 1XGTB 1NGQL 3THML 4WTZG 3VFNB 3KDMA 3PJSA 4JGJA 1W0VA 5DVOA 2CK2A 3U7YL 3W2DL 1NQBA 3VFWA 4JM4H 4JKWA 3VFUA 3CDGA 3QZWG 2BSTA 2XXCB 4ODXB 3L5WB 3B5HA 1U3HB 4WUKH 5GS2D 4XAKE 1HXMB 1T66D 3LH2H 2BK8A 2VDKH 3BESR 1X5KA 5DEGB 3ZHDA 2R0ZL 4PV8A 2BJML 4QOKB 1BGXH 3CUPA 1CDJA 5J11C 3D39D 4XPAH 3RNKB 3UTQB 2FECI 4H8WC 5IF0A 5E94A 3VD3A 5SWQB 1NGPL 3EYSL 4I13B 4PJ5A 2R1YA 2LE9A 1Q72H 3MJ9A 1A2YB 1BF8A 1W8NA 4E0RB 4FTVA 4OKDA 3MLSL 1G9NH 1TCMA 1BX2B 1A5FH 3C6LB 2XT1B 2FX7H 3S8WA 4G3YL 4JZNA 5FGCE 1G7HB 3OHXB 2K1MA 3MLYL 4M7JH 4TVPL 1KCUL 3QCTH 4NWUL 2G9HB 1MAMH 4PR5A 5FHBH 5ICZA 3HAEA 2DAVA 2QHRH 2HFGL 4PJ7E 3GUTB 4HF5H 1IAOB 4NRYA 4ZYKA 1K8DA 5IROA 3G6DH 5F9OL 3CIQA 25C8L 5DJCB 3IDXH 4KI5C 4PGZA 4PJ5D 2R56L 5EN2B 4YHLL 5BQ7A 1ORSA 5HGHA 1WIUA 2FLRT 4MX7B 4QXGH 5DRZB 1N5YH 1KPUB 2V9QA 2ICWB 4HC1A 3SCMD 1KLFA 5FM5O 5C0IB 3TVMD 3HAEH 1HH6A 1G6RL 3O9WB 4Y5XC 3FKUS 1AD9A 1R24A 3GSNH 4NN5B 4I0PA 5D1XA 1YY8B 4IRSA 3SDYH 4WUUD 2FECL 2K3TA 2HFEA 4PJGE 5IM7B 3IVKA 2DDQL 4IS6B 3TH3T 4CU6A 3MUHL 3QJHB 2NYYC 3L3DB 5C0JA 4HC1H 4ZUTA 3NPZB 1YMMA 5I1EH 5BOPA 4DTGH 4HT1H 1RD6A 1NGZB 4F2MB 2ADIB 1MJ8L 3RRQA 4U31A 4J8RA 2UZIH 2Q3AA 1JGVL 3KLSA 5D71H 1U91A 1X7QB 4EUPG 1O7VA 5SX5H 1GGCL 4I0PD 5D1XD 3CX2A 4Y0GA 3GSNB 3WFHB 3BPLC 3KXFB 3S3PA 2H2SC 5B4MC 1D9KA 3QXDB 4J2XA 1MHHB 2HVKB 1INEH 2F5BL 2GHWB 4CNIA 5I1IL 2PYFA 2PXYC 1KYOK 1U92A 2MPAL 2V2TB 1YMMD 4JHAL 5JHLL 2FWOB 1UWGL 3L3KB 1DQLH 5JA8B 4BH7B 4AYFA 5HPMA 3ULVC 1EEZB 3O4LA 4Y4HB 3DVNA 4PJ8B 1A1NA 3NACH 2RHEA 1G7IA 3NMEA 1JWSB 5MEPB 4L8CB 4YGAB 1QHPA 2Z31B 4E9LA 1Q1JL 3G9AB 5SWSD 1D9KD 3EFDL 5DD1L 5IGXL 1P6AB 2OTWB 1D5ZA 1W0WB 3S37H 1TETL 3V6BR 1MF2L 2AXGA 3QRFM 1R3JA 5T5FL 1Z5LA 4W4OA 4XVJL 1YN7B 2VITB 3BKML 3BUTA 5JO5B 4LIQL 5FFLA 2CK0L 5E8PA 1WFUA 2HLFD 4OZFA 2BZDA 2AVGA 1B0RB 3T1FA 3LKNA 5BZWA 4ZFOL 3U9PH 5CD3B 5CILL 5DFTA 2Q6WA 3E6FA 3NABH 2EYSB 4LCCA 3ETBF 2G5RA 1TTFA 3UYRL 4PFEA 4XTRC 4QXWA 2ED7A 1OGAD 1VA9A 1BM3H 1J05A 2AJSH 4MNHB 4H5SA 1EH9A 1ERNA 2A0LD 4JZJB 4AEIL 1IEAA 4PGCA 3HG1B 4MQ7B 4OCSL 4U6XA 3CXDL 2CRIA 3TZVB 1N2RA 5C0CE 1D5MA 1M7IB 5DFWH 1MCRA 3IJHB 2X70A 2BNRD 3VXNA 4WEMB 4TQEL 1CGXA 3LS5L 1WK0A 1MWAL 2E5EA 2HFTA 3GSOA 4M5ZL 5KSAB 5T3XL 3QQ9C 4YE4L 3UTTA 3F62A 5E6ID 4D9LH 5FA3B 1G7JB 5GZND 1OD7A 3OKMB 3B9EA 2XA3A 2EDOA 3RVTC 1CU4L 3NIDF 4IOIB 4EBQH 4KI5F 1T89A 4DKEH 5EU6A 3DROA 3GMPB 3G6JB 1IGFH 1MY7A 4GUPA 3RHWK 3PWJA 1MIML 3DUHA 4HWBL 1S7QB 3VXUA 4KJPC 4NT6A 4FOMA 3DETC 4JN2A 1DQJA 5C0AA 1J12A 4BSVB 1WFOA 4DZ8A 3A6CH 1DVFC 1GSMA 1KCVH 3ZDXE 4KV5F 1AR1C 4LLYA 3WNLA 4DN3L 2BVPA 3WL9A 3D0VA 4U2YA 2HG5A 2VLLB 4MQTB 2Z92B 2O61A 5BVPL 3MRDA 4OQ1A 4PYHA 4XNXL 1PEZA 2UUDH 5D5MF 1ZHNB 5IESH 1RK0A 1XFPA 3TPUB 1PQZB 1NKRA 4O51A 4XPBH 4O2FB 5F8QC 3LEXB 3NIFF 4HKJB 3RVWC 1PKQA 1BECA 4RBPH 2DQHH 4KGLA 3VXUD 2HFFB 3NFNB 4WWKA 2XKNA 3C5SB 3BE1H 4UTBL 1QVOA 3RAJL 4NQCA 5C0AD 3R0MA 1AHWB 4NGHL 3GSQA 5DQ9B 2J7LA 1MVFA 4OCYL 4QT5B 4E41B 5C9KA 1U3YA 5ANMB 1KJ3H 1MREL 2JB6B 3DUUB 1N0XH 2YUZA 4WGVB 5T3ZH 3OBAA 4PTTA 5A16B 4PJDB 4XWGL 2X6MA 4Z7WF 5D1QD 5L7XL 32C2A 1OTSD 4Z7UA 1Q9OA 5DJXB 5BV7C 1KYOJ 1KCSL 5I8CA 1A7RL 3ULVF 3IS1X 3MBEA 5M94B 5JMOC 4KUCF 2DQJH 4LQFH 5BXFB 5F88B 5IEHA 3HE6B 4RGNE 2H32A 2IG2L 5D7IB 1A6AB 2ITCB 3QJFA 3VXTA 4ZMAT 4XVSH 5J1AB 1HNGA 5EA0L