4K23L

Structure of anti-upar fab atn-658
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-uPAR antibody, heavy chain
publication title Identification of a New Epitope in uPAR as a Target for the Cancer Therapeutic Monoclonal Antibody ATN-658, a Structural Homolog of the uPAR Binding Integrin CD11b ( alpha M)
pubmed doi rcsb
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2013-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k23L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4k23L01
1IM9A 1XT5A 3P4NA 2EEAA 5F3BA 1ETZA 3DNKA 4WI5A 4YDIH 4MMZC 1KIRB 3HNSH 5JHDA 1VENA 4BFBD 4D8PB 4JQIH 2C1PB 2JELL 3ZE0E 2PW2B 4K9EL 1DL7H 1INDL 3O41A 1I8LA 1YEKL 1OTTD 3JXAA 5DRNA 3C5SA 4I48B 3LKPA 1A7RL 3V8CA 4PP1D 3RUGA 4ZTOH 3DUHA 3WS6C 1CL7H 2JCCB 4JY4A 3UZVB 4GG6E 4J1UB 4Y1AE 1AO7E 5DRXB 1FZJA 2J8UE 1HQRB 1MVFA 1PYWA 1KPRB 1CTNA 5E5MA 5DMKB 1BEYH 4OIAA 4XBPA 5I1EL 1AGEB 3OG4B 2IAND 4ZAKC 3HNTL 3VFMB 2VLKE 2OZ4H 5E1HB 1NMAL 3FCTB 1I4FB 1QR4A 2H3NA 2YBRB 5DFVD 1ODAA 5D7LB 3ARDC 3IGAA 5IK3B 1CGWA 9CGTA 5TGBB 3INUL 3UJTL 3GHBL 2AEIT 3MBEC 5T33H 1JIBA 5JHDE 1JTPA 1NSNL 4TULL 2V2WA 3AB0B 5CIPB 4GRMB 1JHKL 2A77H 2PNDA 4G8GB 4LEXH 2BSRB 1R5IA 1JWSA 1QHOA 1EJOH 4QRTB 5I19H 4N68A 4U4BA 4CJ1A 3BKYH 5EO1A 1F3DH 4APQD 3GFUA 2X42A 4TVPH 1U0QA 1MRCH 3RUGE 4AH2A 4H0HB 3U7WH 5K9QI 1TXKA 2YOCA 4UQ3B 3VFNA 1T1XA 4O02L 5KW9L 3FO1B 1UH4A 4J3SA 5HHMB 2BNRD 5JO5A 4HK3J 1CQKA 4RGMB 4ZO8A 1SYVA 2K1MA 4MJ2A 3MRIA 4KQ4H 5L88L 5E99L 1E6OL 4Y4KA 1WITA 3I6GA 4QCIB 2EXWD 1NBZB 2C1PA 3MRQB 1VERA 1WZLA 1IC1A 2OL3H 5FOBB 2FEDC 1YA5A 1UYWH 4YGAB 5DD3L 5JUEL 2DD8L 5JR1H 4R0LC 1G6RH 2OQJB 2W65A 2Y5EA 3A6BH 1JBJA 3PXHA 3CX5J 4XC3L 3LV3B 1RUQL 5DMIL 3DX7B 1FNLA 1X5FA 4JFZH 4DKFL 2CUMA 2JCCA 3ZHDA 3OTTA 4NHCL 2CDFA 2Q7NA 1HQRA 1PLGH 3HZYB 3NVQA 1KPRA 4G3YL 1AGEA 4XPFH 5DD6B 3GJEA 5TF0A 2HKHL 2EECA 4WJ5A 2HJFA 3VFMA 2J4WL 1DBBL 4X6EA 3FCTA 1I4FA 2CSPA 3BKML 1FO0B 1LO4H 3I6LE 4L4VA 1Q72L 4HX1A 1BBDL 4PLJC 5EWIL 1UM4L 4BQ8A 5IK3A 4Z7NF 3RL1B 2OJZL 3LCYA 4HPYH 3OKKB 4NO3A 3U4BL 3RDTC 1HXMA 4OLYH 5CIPA 4GRMA 4ZNCD 4Y4FB 1PAMA 3BQUD 1YZZA 3JTSB 3QDMD 4G8GA 3HI1B 5DVMA 4QRTA 1EVTC 3CFDB 4F58H 1WUNT 4FQLH 2CLRA 1TZGH 4NKIL 4KK8D 3RNKB 1S7RB 3T0EB 3B9KC 1HYSD 2JCCE 1EEYB 2ATPB 3ULVL 2ZUQC 3SO3B 4N0RA 5SWZD 2G9HB 3SE3C 4M9OA 3PDDA 4IMKA 4XNQB 2YPKB 4S2SB 5IG7B 4XPAH 4WUUB 1XGTA 4I0PC 3UDWA 4L4VE 5HYJA 1BIHA 1S9VB 5FYKU 3GB7A 2YEZB 4MCYA 1AY1L 2YKLH 5KN5B 2NMSA 3K1KC 4HAGA 3JWDL 5FOBA 5JXAL 1R0AH 4YHML 4RRPA 4HBCL 4G6MH 3JTTB 4G8GE 2C26A 3V4PH 1X3DA 2EYSA 4PJGB 3QG7L 3QQ9C 1H3PH 2QHLA 2VLRD 5ID0A 3LV3A 4IRSC 4MB4A 2WV3A 4LLVB 4ZPTB 1MHEB 4ZAKB 3X3FH 5I8KL 3HZYA 4LNRB 2XFXB 1UGNA 4QRRB 3MRNA 4X8JB 4P2CG 1QSED 1AIFA 4NQCD 1AI1H 5HHME 3HC4L 1SY6A 4F7MB 3RKDD 1QYGL 1WIUA 3EZJB 2D31B 3O2DL 3ARDB 4NO2A 4H5SB 5DEGB 1H8OA 4S11A 5DQJB 2GSIB 3GSVB 5HYJE 1ZT1B 3C5ZC 3M17B 2ZNWA 4D9LH 3BH8B 3KYMA 3ILQD 4YHLH 4K23L 3MV8B 4WUKL 5AZ2L 4G9FD 4Y4FA 2W60A 2JIXD 1WZMA 3JTSA 4Y19D 3VXUD 4FQIL 1N8ZB 4R97C 4FQ1H 3V6BR 2A38A 1R3HB 2VQTA 2AP2A 1D9KD 4P2QA 1X4XA 1U42A 2F53A 1ZT4B 3OAYK 1KIQA 4ZD3L 1UM5H 2DOCA 3NFNA 4OQ1A 4TOYH 1CLYH 2VZVA 2ATPA 4G43B 4F2MA 5L8KB 2LFGA 3U1SL 2FL5B 2G9HA 3C2SA 3RNQB 1BZ9B 4ZS7H 1L7TH 5JOPD 2YPKA 5IG7A 5DRWB 4TNWF 5AEAA 1LNUB 5E5RB 1K8IA 2CLVA 1S9VA 3P77B 2MKWA 3IKKA 5D70H 2R8SL 1X5ZA 2KH2B 4K3DH 3FQNA 4IOFD 4CMMA 4R0LB 1HNGA 5DT1L 2DQGL 5T1KD 2QLVB 4BH7B 3JTTA 2EKJA 4YK4C 1C5CH 5FYJE 2F74B 4PJGA 4NQXB 4KTEH 3WS6A 5I15H 1OTTC 4ISVB 5TE7H 2ZCHH 4P2QE 4PP1C 2CKNA 3F7YB 2BNUB 3ZTNL 2FO1A 2F53E 3LIZL 2EYRB 2V6HA 1MHEA 4ZAKA 4DN4H 5CEXB 2DI9A 1B3JA 4ZQKB 5DHVH 3TCLA 4PJEF 4X8JA 2D7QA 1TMCB 3EOAA 4MAUH 1SEQL 4UT7H 4PGCB 5L2KB 3WJLA 4JFQB 5DJYA 3TM6A 4OZHF 4L1DA 4BUHA 2I5YL 1QSZA 2IH1A 3ARDA 1X5IA 4H5SA 5F88A 1ED3B 3MBEA 3O8XA 4PS4H 5DQJA 1QVOB 4NZJA 4Z7OF 5SX4H 3RDTB 1ZT1A 4GMTL 3M17A 4ZFOL 3BH8A 1IGYB 3GSRB 2AABH 5AG8A 2H2PD 2NW3B 3U0WH 4QXTA 1ZLVK 2Y07H 2MOVA 3ARBD 5HTSA 3RHWF 2XWJB 3TO4A 4PJGE 1REIA 2GSGB 3B9KB 4XNYL 1YY9D 3RVWD 1MHCB 4HC1H 4APQC 2IQAB 2NY0D 2GQHA 1UT9A 1CZ8L 3D87B 3HE6A 2ZUQB 4WGVB 1WV7T 4S1QL 2EC8A 3MACH 4G43A 5EUOA 1KCUH 2XTLA 1M71B 3T3MF 2FL5A 1AE6H 5D96C 3ZTJG 3MOQA 1QFWM 3MLUL 1BZ9A 3O4LB 1VSCA 4I0PB 5C07D 5IR1B 3UTPD 4OLEA 1LNUA 1J12A 3GMOA 1T20B 2I9LA 3P77A 2BVTA 2AW2A 3C5JB 4JG1L 4FABH 4Z77A 5A2IH 1JPTL 1HHIB 3S97C 4JR9L 4HCRL 3B6SB 3WKNA 2EXWC 5DQ9A 1RZJL 2Z93B 2EDQA 1SM3L 4H1LH 1YY8A 4IRSB 5DMYA 4NQXA 4U1SB 3K1DA 3UZQA 4AEFA 2XA8H 3CPLA 4WIQA 4HH8A 4ISVA 3GO1L 1A6AB 4Z78A 2XG4A 3F7YA 4NBXB 3V5HB 3SE4C 1HINH 3P4MB 4ZQKA 1WISA 2W0LA 2AEWA 15C8H 4HWBA 2G2RB 4PGCA 1IAIL 2BCKB 5DD0L 3LQZB 3DVIA 2DIAA 2LQRA 3ARZA 4QYOB 3MQIA 3C5ZB 2XV6B 5CP7A 1T0MB 1CGSL 3HC0B 8FABB 3G9VA 4Z5RA 3U82B 5EOTA 4EBQL 3GSRA 4WVRA 3BZDA 3FT3B 1MFEH 4Y88A 4PGEB 4ODUA 4R97B 4JPIA 2NW3A 1Q0YH 4IOSD 1DVFD 3P30H 4R4ND 3HAEG 5C0IB 1YQ2A 2XWJA 3BQUC 3Q0HA 4XPTL 2FZ3B 4V1DD 4OM1L 3GK8H 1ZVSA 3L3DB 3RX5A 4K8RH 1HILB 2DBJA 1J0JA 4OM0H 2GJZA 4MD5B 4ORGB 4U1MA 4OD1H 4ZFZA 4OCYH 4XTRD 1EX0A 1QRNB 1TVBB 4KK8C 3MRGA 3MLZH 5AYQA 4XCYB 3QIBD 1HYSC 5DFWH 3U2SA 4ESKA 4LIQH 2Y6SD 5CINH 1AD0A 3O4LA 4MNQD 4YDIL 4I0PA 4KMLB 1XGRB 4JQIL 2PR4H 4P3DA 5E4EC 2F8OA 4YHYB 1NCBH 4LKCB 3VD4A 5MP6H 3ALWA 4G7YL 2LE9A 1QLFA 4NO5B 1DL7L 3C5JA 3H3PL 4K94C 4WDIB 2VQ1B 1FJ1B 3RWIB 1HHIA 1U58B 4LARH 4XP5H 2VJXA 4YK4B 2I07B 3B6SA 4JDTH 5C6TH 5JQHC 1CL7L 1U8KB 1SYSA 1MCOH 3O6KH 3FB7B 2Q6WA 2I9TA 1W8NA 4U1SA 4F57H 1IEHA 5EORL 4J12A 3FMGL 1A6AA 2BHUA 3C60A 2ZG2A 1YDPB 3KAAA 4HDIA 4IMLB 2IANB 4FMKA 4AT6A 4M8VA 4EN3D 4HGKC 1OWRM 2G2RA 3HAEB 3O4LE 2DLGA 3BXNB 3SY0B 5C86A 3CH8A 4WFGD 4QYOA 3BPNC 2KUTA 3PWLA 1CK0H 1LO2L 4ZXBD 3RKDC 3HN3A 2H32A 4DWHA 4LEXL 1DQJA 1EJOL 1YMHB 2IGFH 2LAGB 3ZZ1A 3QO0B 4J4PD 5I75C 3BKYL 3LQMA 4JY6A 1OAYH 4PJEB 4YO0B 1LQSR 2X4PB 2VUYA 1CDCA 4TVPL 1MRCL 4LLDA 3HI5H 2A74B 1ZA3B 1JTOA 3U7WL 3IF1A 4OZHB 4BFEA 5C0IA 4ETQA 5FHAL 4APQB 2ZP0T 2YR3A 5E24E 1MAMH 1HZHH 3NABH 1NC2A 1KTLB 1U8QB 1NH6A 5F71A 4Z8FH 5FF6B 3QNXB 1EUTA 5D96B 1QRNA 2EYTB 4XCYA 4FXGA 1KEMH 1KLGA 4MD4A 4ZUTA 2X10A 4KQ4L 4G8FB 4BH8A 2BNRB 1KB5L 5ISZD 1DBJH 3UTTD 5B38G 4LKCA 4HLJA 2OL3L 3D69A 3JV0A 4PREA 2BFVH 3GMMB 5JR1L 3R0NA 5EUKA 3A6BL 1CCZA 3ZLQC 2VQ1A 1FH5H 4XCFH 2I07A 3MRDA 3QEHB 3RWDB 2HKFH 4IOFC 4JFZL 2E6PA 3FB7A 2G75A 1PLGL 1EA9C 2VDPH 1IAOA 1HHGB 3N06B 3DGGA 2GAZB 1IQDA 5FIEA 2FDBP 4QRUA 1OSZB 5ITFB 1GGTA 1NGZB 3EFDH 2X4UB 2OP4H 2NXZD 2APXA 1QRNE 4KKCD 1G1YA 1R24B 3CFJA 1LO4L 3QXAB 2BJMH 1H8SA 4MXWH 5A16A 5EOQH 1RZIA 3FB6A 1G1CA 3CXHK 4ELMB 3WS3A 2BY3A 4HPYL 1FYHB 3Q6FB 4X9HA 4U1KA 3SY0A 2E7HA 2XQBH 1AD9A 4OLYL 4X83A 1I9RL 2HN7B 3H7LA 5IKCB 2A0LD 2VXSH 1L0YA 1W72B 3K4ZA 3QO0A 4A6YB 2DJ4A 3NFPB 4F58L 3GBML 3RP1A 5IMLA 1MCKA 4YO0A 4Z9KB 2VWEC 2X4PA 1TZGL 4TNVK 1FFPB 3BQUB 1EGJH 3QDMB 5IVOA 2ARWA 2VB5A 4ZUWA 4AK1A 2RGSA 4JHZA 4APQA 2E27L 3ARBC 3WN5A 2Z35A 5B38B 4OZ4A 1KTLA 1U8QA 3GIZH 3MREA 1TTFA 5DF0A 1HSAB 4FMFA 4XCEB 1XGYL 2FWOA 1YY9C 5FF6A 1QD0A 3RVWC 5L8JB 3LS5L 2EYTA 1CE6A 2NY0C 4M5YH 2ED9A 2VDRL 4HH9A 1QUNA 4FQJL 4LVHC 4X7TA 1JNJA 5SWZB 4RAVB 4AL8H 5E4EB 4DGYL 4G8FA 4WFFE 3GUTB 2JJWA 3IVKA 2YKLL 5GJTL 4D0BB 1AXIB 1MF2H 1JCKA 1TLKA 3ORJA 4G6ML 1YNKH 3T1WA 2R2HB 2B20A 4GAYB 1XGPB 4P3CH 1H3PL 1MUJB 1SJXA 2YUZA 1RURL 3HZKB 1U3YA 4HUUB 2F8VA 1IKNC 1LILA 3GKZA 4JJ5B 3TF7C 2GW5A 1YMMA 5BXFB 4OZHE 4I0CC 2EH7L 1ZVYA 2VLRB 4KH2A 3PJSB 3BESR 2ZCLH 3OJDB 4D9QD 3BW9B 1CFNB 1BLNA 5ITFA 2O5YH 3G5YB 1Y0LB 1AC0A 1KJMB 1YUHB 2A1WH 1CG9A 1MI5D 1H5BC 3MRBB 2KDGA 4JZNB 5TDOA 1DQQB 1QSEB 4NQCB 1E4XI 3LKNA 4W6XB 4U1LB 4ELMA 3BPNB 5IGXH 4D9LL 4U1HA 4FHBD 1JI1A 3GM8A 4PJAA 5T3XL 2ZSVB 3ZKMD 2EE3A 3G5XA 4XXCC 5I75B 4NT6B 2HN7A 3OXRA 5IKCA 4MNHA 5D7KD 3MRPB 4HS6B 1HIML 3GMLB 2FLBT 1XF5A 5I8CB 2PW1B 3NFPA 3B9VA 5IMMB 2O5ZH 5E8DH 3T3ME 3ZYJA 3SGKC 3BP5B 3FONB 4G9FB 4RCAA 2JIXB 1FFPA 3BQUA 3B3IA 2B1HL 4Y19B 3QXVA 3O3UN 3VXUB 1J8HA 2B1AH 1YMME 2VDOH 3O11B 4TOYL 1CLYL 4N8CH 1DVFC 4R4NC 1F8TL 4KQ3H 2LV4A 3OHXB 1D9KB 5J9PB 4ODTH 3SDYH 4ODVH 3JWOC 4NBZB 5DWUH 4AYFA 3NIDF 3O81A 2K7PA 3CVHL 3SKJH 4DZBA 1L7TL 2BOCA 4JN2B 5DJXB 2VKWA 1N4XH 5SWZA 4JAMA 3WBDA 3QIBC 3EGSB 3LHPH 3QIUD 4JANB 1RJYA 3T0BA 4ELME 3L5HA 4K3DL 4LGPB 1UQSB 3BPLC 3DPBA 4PJAE 5ESAB 4NQUA 5DHXB 4OZGF 2A83B 3OKNB 4RFEB 2R2HA 2NY5C 3N1QC 4GAYA 4LPTA 3AM8C 3PG2A 4MQTB 1QSFD 4MAYD 3WFDH 2YXFA 4E42B 4I3RL 2FX7H 5GRUH 5I15L 1X9QA 4GKNA 5CP3H 5EU3B 5T1KB 5TE7L 2ZCHL 4OD3H 4XZUA 4NC1C 2VUOA 4ZYKA 5BXFA 5L9DH 4J3VA 3TVMA 4DN4L 1UKTA 3CAFA 1SJHB 2WLYA 3AU1B 1FZOA 3PJSA 3PGFH 4MAUL 4RX4D 1D5BA 1CFNA 1NLDH 3U4EB 3G5YA 5F89B 4O51B 1W0WB 1Y0LA 2Q1EA 1YUHA 4NCC2 4PLOB 3EAKA 2QR0B 2W07A 1DQQA 4PS4L 5SWZE 1X7QB 3UJJH 5HYSG 2OTWB 3QUKA 1DTUA 2AXGB 3IT8D 5GGSY 4U1LA 2Q86B 4XP9L 1DQTA 4EN3C 2D4FA 1RZFL 1UXSB 2ZSVA 5FYLH 5JTWA 1DBMH 3SKUD 2IJ0C 3U0WL 4KI5E 2Y07L 3LKRB 4XBGB 5I8CA 1ZTXH 4ZXBC 1RIHH 1AFVH 4N9GB 3ULVD 2PW1A 5DSCB 5IMMA 4J4PC 3BP5A 1QEWA 1MCJA 4HC1L 1A3LL 1KTKE 3ARBB 3VXUA 2ADJA 3T2QA 3O11A 4WW2F 3MACL 1KCUL 4J3TA 3QWOB 5DTFB 3ROLA 2NY0B 4UQ2B 5I8EA 5EC1B 5FM5O 4LVHB 1JNLL 2MJWA 4JN2A 4GJTB 3QXWA 1NC4D 4IIQC 3K81A 3S98A 2XNAB 2CXKA 3GI8H 2A73B 2WBJA 5TDNB 4NQCE 4GXVH 2UVFA 4FABL 5DS8B 1FFOA 1MLBA 1LO3H 5C07B 5JW4M 4WW2C 5ESAA 1ES0A 4Y8AA 2E5EA 3U7AA 4BJLA 1S3KH 4WEMB 5EU5B 1OLLA 3Q1SH 4WWKD 1CFTB 5C09D 3OR7B 5C08A 2Q7YB 4AIXA 4LEOB 1N0XH 32C2A 4E42A 2C1OB 1V8HA 2Y4SA 4NQVA 4PJFA 3VXRA 1EMTH 5HYSB 4Y19E 3VXUE 1G7LA 5CD3A 2IH3B 5D6CB 3QNYA 4YZFF 3OWEA 3JUZA 5IJKC 4Y8DC 3ALXA 1UB5A 2FSEA 3BEWB 5LBSH 1H5BB 4H0GA 2GK0A 1W0WA 2VN4A 1LK2B 4GKOA 3NN8A 2QR0A 3IFOA 3Q5TA 2NXZC 1EDQA 4KKCC 4POYA 4QKXB 5HJ3A 2Q86A 4LP4A 2XPGB 1UXSA 3TV3H 1RIVL 2CXGA 5LCVH 3P30L 4OF0A 4JQXC 1BJ1H 4N9GA 2J2ZA 5F8RC 5C08E 1B88A 2A0LC 2XXMB 3FN0H 3V4VL 3QUMA 1P7QD 4K8RL 3MXWH 1DVFB 4PJFE 4OD1L 3ARBA 4OCYL 3VXRE 2X41A 3MLZL 4V1DB 5E8OB 1GZQA 3WDIA 1GZPB 4LIQL 1YEHL 5DTFA 3MRKA 1UWXH 3WIHH 4UQ2A 1JUFA 4NUJB 1FNAA 4WRLA 2MQ0A 2PR4L 1P7HL 3QIBB 4F9PC 1NCBL 4LCWD 2VL5A 4OSUL 4OF8A 5MP6L 4YXKH 1HOCB 3NBNA 2XNAA 1BX2B 2FX9H 3BPLB 2A73A 2B4CL 3OKMA 3QDJA 5TDNA 4MNQB 3N50A 2CQVA 3QUXD 1K4CB 5INCB 3W11C 2WMPA 4LARL 4UTAL 2ED7A 1HDMB 1EO5A 2MCPH 5C6TL 1SMAA 3JVGA 2C4FT 5EU5A 2R4RH 3G6DH 3ME0A 4LU5H 2I60H 3O6KL 3VXPA 1MFCH 3OR7A 4KPHH 2Q7YA 4BSJA 3H8NA 4F57L 5IBTH 2W9DL 5D1QD 2C1OA 1MRFH 5C0GB 3VFSA 4JM4H 2FIKB 2OJEB 3C2AL 3Q3GB 2A6IA 3SDXB 4GRWE 2FH8A 1SBSH 1N0LA 1FL5A 5HI3D 4WTZG 1WC7B 3NIFE 4OZGB 3SCMA 5IVNA 1D6EA 1EK3A 2ZPKH 3ARSA 3FOMB 3OKEB 4NWTH 3HPLA 1H5BA 1LK2A 4LOUD 1LO0L 4I3GA 5KSBA 1TCRA 2IPKA 5GHWH 3RX8A 4EN3B 3UBXG 3QDJE 4XXCA 3ESUF 1OAYL 3MCKB 3O9WD 5B3JE 1U8JB 3LN9A 3SJVA 3L1OH 2J1KA 5A2LH 1X4YA 4ZXBB 3C08H 5J6GB 1X44A 3HI5L 2DDQH 2O5XH 1E4JA 3SGKA 2Y25A 5CSGA 3GSOB 3RGVD 1TETH 1MAML 1HZHL 3NABL 1BJ1J 3TH2T 2D03H 3S3PA 1BM3L 2FGZA 3LN5B 2QKIA 1P2CA 3X12B 3MMEB 1HKLH 3L3HB 3OF6D 2O93L 3OQ3B 4I9WD 4Z8FL 1J0ZA 1DEEA 5F3HB 1RULH 1ZLWK 4GT7A 4NFDA 3TN0A 4R96B 4QHKI 4YE4H 3WE6A 1KJVA 1JWUB 2Z91A 2BVQA 4IIQB 3VXQB 1G9NC 1DBJL 4RMQA 3VRIB 1SJVA 5H94A 2FJHB 2F5AH 3HB3D 5KSBE 1EHNA 5GRZA 1JF6A 4X4YA 1WSST 1NBVH 4WW2B 2QSQA 4KV5F 4MNQA 5ISZB 1AR1C 3NCJL 1MOEA 2IWGA 1KCVH 1U8HB 5I1LA 3UTTB 1NEZG 3QIUC 4XCFL 2FO4B 3SJVE 3MV9A 3C8KA 3OR6A 4NIKB 2HKFL 3RJDA 1AQKL 2R2CA 4JPVL 2QHRH 1CFSB 1HXYB 1PZ5B 3QT2A 5ICXA 3NIGE 4N1CA 5E00A 1BECA 5C0GA 1F6FB 1P6FA 5IHBA 4MAYC 3Q3GA 3DROB 3SDXA 2PKDA 5M95B 2XIDA 2NY6D 3UBXB 1WEJH 4JFFD 2R0WH 2OP4L 5C9JB 1FE8H 4QRPD 1A4KA 3WDJA 5C71A 4MXWL 2BJML 1YQVH 3H2WA 3ZKXC 2DQHH 1CD1B 3IXAA 2XQBL 2NXZB 3ULVF 4W4NA 4WI7A 4EUPH 1RJZB 4LSVH 1DN0B 4POUB 1O0VA 1EHLH 2VXSL 1E28B 3TZVD 4WU5B 4MNQE 3K7UA 1R5WB 1U8JA 4M7KH 1VFBA 4X9GA 2OSLB 3MV9E 1EGJL 3NIDE 2CLZA 4GKZA 1I7UA 1FQ9C 3SDAA 5F93C 1WTGT 4FQHA 2E9WA 1EEZB 3T4AB 5IFHH 5I1CH 3GSOA 1YNTB 2OR9H 4OT1H 1RJCA 1WGOA 3MUZ1 5ID1A 3GIZL 1JGDB 3RY6C 3ULVC 5DZLA 2CKBA 4MJIA 4V2BA 1RFDH 4X6CB 3SDXE 3GSQB 4M5YL 4UUJA 4U3HA 1NEZB 3RIFK 1JWUA 4AL8L 4L29A 5KANG 5F97E 1I7ZB 3VXQA 3EW3B 1MF2L 5KVEH 4NSKB 4PUBH 3MV7A 3VRIA 1MCCA 1JGEB 4L8CA 3OXSA 2LU3A 2X4RB 4LLQB 5ERWA 1YNKL 1TJHL 4NM8H 4PY7A 4AENA 1ZSDB 5ANMB 5ISZA 4P3CL 2DM7A 5F1OB 2XKNB 1Q9KA 3BVNA 4UIKH 1U8IA 3MUGA 2NW2B 4WFGE 1JRHH 2FJFA 4YGVA 4QWWD 1CDJA 3FJTA 5I74C 4XP6H 3IRPX 3D25A 2HWZH 4PRHD 4G7VH 4NO0D 1CFSA 4IHOA 3GJFA 3X3GH 2ZUYA 3BPOC 2PYEA 1MCSA 3QNZA 4WWKC 1N64H 4GRLD 3ARQA 2ZCLL 5CEZH 4I1NB 2BOBA 3DROA 1FC2D 5ICZA 1WFUA 1WIOA 2AI0L 4MJIE 1N6VA 2O5YL 3UBXA 1ADQL 4HKJA 5GGVY 3K2UH 4LGSB 5IJKA 2IG2H 4XVTH 5F96L 3LEXB 1A0QH 4XH2A 1UG9A 3NCYS 1Z0NA 3SGDH 1EJ6A 5IGXL 2BRRH 4KHTL 2ICWB 2AJZA 4OTXH 5FO7A 3MV7E 3NCEB 4PB9H 1CI5A 1MI5B 5BCAA 3VA2C 2BVYA 3UYOD 2CO7B 1DN0A 5FKAB 2F9BT 4WU7A 5ISZE 5T3ZD 3MO1A 1R5WA 4NYLA 1NL0H 1D5XA 5E8DL 1E6JH 4IM8A 1JZ7A 2B1AL 4WI8A 2ZUTA 4N8CL 4PYHA 5JIPA 1YNTA 3BGFC 5DURD 5FKPB 1Q38A 1QR1A 2PYEE 2ZUSA 1FBIH 1JGDA 4ODTL 5DDHA 4RNRB 1JP5A 5DWUL 1YEIL 3HRZB 3CFBB 4X6CA 1AGFB 5E6YA 2OX5A 2SEBB 4CUCA 1N4XL 1QPPA 1M1SA 3TBSA 4XWGH 2R0KH 1PX4A 4RGOH 1I8IB 2DQEL 4F9PA 4GMSH 1I7ZA 4WTXA 5CGTA 4OV5B 4FQ2H 1S7VB 3BYYA 1UKSA 3DBXB 4DEPC 5GGVH 2RIKA 3E3QE 4LLQA 2X4RA 1KFAH 1QFUL 1MY5A 1XF1A 2OTUA 5KOMC 1ZSDA 3QIUB 5ANMA 1KEGL 2XKNA 3WFDL 3VMNA 1NGXB 5D2LB 5GRUL 5HI4D 2NTFB 3T77A 2PXYA 3U9UA 3QUXC 5CWSB 2AXFB 5A2KH 3KNBB 1VFAB 1GAFH 2I24N 5IVZB 5L9DL 4OFVA 4ZOBA 1QSFB 4MAYB 4U1NA 1UJ3C 1BZQK 5K9OB 2APWA 1GOHA 4KZEH 1IAMA 3PGFL 5CLTA 1U92B 3LN4A 1AKJA 5D1QC 1NLDL 1QFOA 4X6CE 5AZEH 5DJCA 4M1GH 5DI8B 1QO3B 4NQSA 5TF1L 3ZKXB 4Y16D 1A1NA 1QBLH 5HI3C 3LEXA 3AUVA 4C83B 3UJJL 4NZRH 3OGCB 3FTGB 4OZIA 4ALAL 2ICWA 1GC1H 1RAMA 4J8RA 4EI5D 3KJ6H 1DBML 2X1WL 1YN6A 3BKJL 5KG9B 4LOUC 1TTGA 3I50H 2R56L 4N0YH 1ZTXL 1RUML 1RIHL 5ANME 1AFVL 3SQOL 3ZYZA 3VXTB 4BM7A 3RA7H 2YK1H 3O9WC 5EZJB 1NQBA 1Z9SA 2E7LA 5CHNA 1F6LL 5I71C 35C8L 3WCYA 3U9PH 4OLUH 4KK6D 5IW6B 1A5FH 4F7CB 3DIFB 2R2BA 4KKBD 3RGVC 2FBJL 1CIUA 1XEDA 3FHAA 1AGFA 1ONQB 3V5KB 3T0AA 3MRLB 1FVEB 3RQ3A 4Y5VB 4RBPH 1QFWH 3GI8L 3FQUA 4ELKB 4GXVL 4QGTA 1LO3L 4HSQA 4OZIE 2F15A 4PRAA 1NC4B 3CFIC 3KPTA 4KDTC 3ARXA 1S9WA 5IB2A 2BSSB 1EHAA 2R1XA 3W5NA 1S3KL 1KV3A 2VITA 4MQXD 3OGOE 3HB3C 3DVGB 3Q1SL 1RZJC 1W0YT 1FGNL 3LKQB 4QOKA 1EO7A 5D2LA 4CNIA 2NTFA 5I74B 1YEFH 1U3HA 3DRTA 1A9BB 4JEGB 4UNVA 1WAAF 1K4DB 1EMTL 5D7KE 3BPOB 4WWKB 5C09B 4JO2L 1QSFA 1HSBB 4NOFA 3CFKA 2D4DA 1Y18B 5GRWA 4JKLA 3QDGD 3HE7C 1BGXL 4GG8B 5DC9B 4D9RE 1CGUA 5T3XD 5DI8A 1QO3A 3OPZH 2NY6C 1WK0A 1N3NA 4OGXH 3GKWL 3MX0A 4C83A 1QA9B 1D3CA 4RX4A 1H8NA 2CIKA 5FUCC 4HT1L 5FUOH 3FTGA 2NPLX 1PKQB 1SEBA 3BRFA 4GAFB 3Q5OA 2NQCA 4J6RL 3I2CH 5ADOH 5LCVL 3OBAA 5IW1A 4DGVH 5IB1A 3PGDB 3QFJD 3CZFB 5I76B 3SO5A 2H26B 2V2XA 3PP4H 4JQVC 1QLRB 3G6AB 5D2LE 4PJ7F 2YHGA 4NC0B 3TZVC 1TQBC 4X5WB 4BFIA 1IRAY 2XG5A 2AXHA 3MR9B 3MXWL 1NANI 3MRJA 4AY0A 43C9B 3BGFB 3I3BA 5BZDB 1WQVT 5EU7C 5JXEA 3WUWG 3LB6D 2VAAB 1YC7A 1QSFE 3S9DB 3SGJC 1FZKA 5IW6A 1P7QB 4F7CA 3ZHKA 4FQXC 4ZDHB 4TYUA 3WIHL 5BV7L 3MNVB 3DX6B 4JN1H 4MHHI 4EZMA 1ZANH 2BY0A 2IMNA 4X7SH 1GGCH 1FVEA 3DV4B 1CE1L 1QPXA 4YXKL 5BVJB 4DEPB 4ELKA 4WY7H 2EO1A 1NC4A 4LCWB 2BSSA 4PLKD 3EFFB 3TBWA 3S37L 3G6DL 2I60L 4X99A 2FIRT 1R3KB 4HIEA 1MFCL 4KPHL 4XCCH 3QUXB 4JKWA 4MJ5A 5IBTL 4NZDA 1EAPA 3OB0H 4PFEA 3PHQA 3WFEH 4JM4L 4Q9QH 2C3GA 1A9BA 5FYKD 1NCWH 3QI9D 1UJ3B 1SBSL 4P5KB 5INDA 3KPOA 4ZSOB 4QWWC 3MLRH 1HSBA 43CAB 3ULVE 3P0GB 5D1QB 5IT2H 4KKLD 2N7BA 3LH2L 2ZPKL 1MHHB 2D7TH 2IALA 5T5FL 1ZAGA 4XP4H 3FOLB 4GG8A 1WJ3A 4NWTL 1RK0A 3SBWA 4U7SA 3P73B 4GRLC 3K0WA 1IGTA 4DQOH 3I3DA 2ADGB 5GHWL 3FQWA 2NY1D 4IJ3C 1KIUA 2X05A 5H37H 1JZ5A 3L5WA 1NFKA 3CK0H 4KAQH 3MYJA 1PKQA 1FDLH 4NZTH 3WUWB 1MFNA 1N59B 3FQTB 3L1OL 5F7LB 4MA1C 2DDQL 4HF5L 2HP4A 1K6QL 1IAKB 2O5XL 3CZFA 3THMH 4BSWB 3QIWA 4YR6A 1D5IL 3O9WB 1QLRA 1TETL 5IROC 5D7JA 3WYRA 4FG6D 1TJIH 3B8YA 4MYWB 5L2JB 2WUBH 1T89C 4X5WA 5GISH 2WWKO 4TTDD 1T7XA 4C58B 5I71B 3MR9A 1HKLL 5IW3A 1U41A 4M4PA 2ITCB 1JYVA 3HUJF 3RVUD 1Z5LB 1RULL 4GXUM 3MLTB 2APTA 5IV2A 3RGVB 1F00I 2Z8RA 1F13A 4J3OC 1NPUA 3MNVA 4HKBB 5D9SA 2AQ3A 3HZVB 3V7MA 1HK6A 4A2MA 1ZHLB 5IB5A 4O2CB 5LVEA 1N26A 3FO2B 3D0VA 2F8XC 1KGCD 1NBVL 1A7BA 2C3VB 4KKNA 1HH6A 2XN9D 5F7DA 1KCVL 1B0GB 1PKQE 1KF9B 1KCRH 1Q9OB 4LCWA 1G7IB 5DA0B 1BD2D 5DVLA 3QULB 2F5BH 3BEVA 3H9SD 4H8WC 1DP0A 1JGVH 4XX1E 3RGHA 4GBXD 4JZJC 2CRMA 3P0VH 1GSMA 1GH7A 3KPQA 2EDYA 1PQZA 4MZ2A 3VJ6A 2EDJA 1JGLL 3GI9H 4DCQB 5HI4C 1IQWH 1KCSH 1WEJL 2C5DC 2R0WL 1FE8L 4MDJB 3ES6B 1T7VA 5BRZD 5CLWA 3QRGL 1M05A 3UTZB 43CAA 4LPVA 5D1QA 1G0DA 3ELAT 3CSGA 4PJXA 1MHHA 3FOLA 1JK8B 4QRQB 2NY6B 4JFFB 4QRPB 2X7LB 3F6IA 2VR9A 5JHLH 2WUCL 4XNZC 1EHLL 4Y16C 2Y7QA 2H9GA 3AXLA 3DXAD 4RFNC 4EIGB 4ZFOA 2N1KA 3WUWA 4M7KL 1P7KA 2X4TA 5C0FB 5F7NC 4LCWE 3L3KA 4P48A 4K8RD 5DD5H 3RBGA 3ZMRA 2A6DB 5JA9A 1I1YB 3BRDA 2XWBB 1MHPH 3MJ9A 4EI5C 4BQ6A 1IAKA 3TZVB 1TQBB 1I7TA 5IFHL 1N2RB 3X14B 5I1CL 4HUKB 5I9QC 2OR9L 3NFSL 3WIFB 3GMQA 1ZEAL 1ZGLB 4HS8L 3CH1B 5KVFH 1G6VK 5D1ZD 2ITCA 1Z5LA 5IHZA 3MLTA 4FQXB 4XGZB 5GGRY 3DJ9A 2L4OA 2RFXB 4HIIB 3MXVH 2HRPH 2MFNA 1KG0A 1B4JL 4PJXE 1T04A 1BAFH 5IHUL 3JV4B 4HKBA 3HZVA 3U6RB 2V7HB 4U6YA 4OKVB 4PJ7B 5KVEL 3KLAB 4D94A 4KKBC 1ZHLA 1OGTB 5DJDA 2VIRB 5IIEB 4NM8L 5CZXD 1OM3H 4KY1H 4KDTA 2C3VA 2H8PB 4RMTA 5TDPB 1B0GA 3L9RA 1OW0C 4UIKL 4HCRA 4RAHA 4E5XA 1MCPH 5C6PB 1G7IA 1JRHL 4CVZB 4OAWA 2ID5A 2HAZA 4XP6L 2HJKB 2HWZL 1IVLA 4BQCA 4G7VL 3UJIH 4WI3A 1B9ZA 1EZVX 2FATH 3G04B 4MQXC 3D0LB 3VXMA 5EBWA 1AP2B 1KXQE 1N64L 1LE5A 5CEZL 4DCQA 3WJJC 3G5ZB 4PRHB 4YX2H 4GH7B 4NO0B 3HE7A 3J8F7 3K2UL 3UTZA 1J11A 2IG2L 3NA4A 4XVTL 1UA6H 1ZHBB 4GRLB 1KIPB 1JK8A 5D5MF 3ZL4H 2YRLA 2BRRL 3MNZB 4I9WE 3W39A 4G80B 4P5TA 5LGJA 2CUIA 4OTXL 4OLZH 4QRPA 4IJ3B 4PB9L 4BYHA 1XR9B 3KLHD 2BY2A 2ARJQ 1J8KA 1N7MH 3MTRA 1G0YR 4BK4A 1IEAB 4FQQA 2VLMD 1QNZH 4MA1B 3KPPA 3OKOB 1A7NH 1G7HA 5FGSA 5I2IB 1E6JL 1KULA 1RZ8B 3R4DA 1KB9K 5DLMH 3WHE0 2A6DA 1I1YA 5E0QA 4JQVA 1NLBL 4FFZH 1IKFH 2E9IA 3R0MA 4NQEA 5IP4A 3DI3B 1N2RA 1B6DA 4IS6A 4OIIH 3VXME 1ZGLA 3BZFB 1FCCA 3WL9B 2ZWLT 3I3EA 1GJIA 4R7DA 4Y5YA 5HHXH 2AS5M 4JFDA 3DX9B 3QISA 4QXUL 4MNGB 4FQXA 4XGZA 5D7SL 1DUYB 1OB1A 5DURB 2RFXA 4XWGL 2R0KL 3H7BB 5DFTA 2H45A 1A1OB 3LB6C 1GL4B 4RGOL 1IJ9A 1KB5B 1PFCA 3JV4A 4AM0B 4GMSL 4JO3L 4PJCB 3U6RA 3FRPA 5GGVL 4QRPE 4P46A 5FO8A 5EC2A 3IDXL 1OGTA 1KFAL 2DTMH 1I1CA 3EYUH 2VIRA 4WFHD 5IIEA 2WBWB 1WAAE 5FUCE 4BZ2H 1J88A 4WENB 4K3EH 4Q58C 1DUZB 1C12A 4X9BA 4OV6F 3IDMB 2H8PA 4JFED 3T0XA 3UTSD 1MRDL 4JZJB 5MEOB 1XGQB 4LLMB 1CXIA 1GAFL 3GHEH 4M93C 4PLKC 1OOAA 4R4FH 4NQEE 3TNNB 4KVCH 1SVZA 3OX8B 2DBLH 1A14L 4FA8A 1AP2A 4WI4A 4KZEL 1KENH 5EU7E 3ZDYE 2X1OA 4CVWA 5C92A 2C3WA 4LCCC 2OZ4A 2ESVD 1G7QB 2YSSA 3QI9C 4JFDE 5KS9F 2VQUA 5IQ7L 2R4SL 3H42H 4NZRL 4ZUSA 3NZ8A 3KS0H 1S7SA 4KKLC 5JW4R 3G08B 3KPSD 1GC1L 2GY7B 4XNZB 2GT9B 2XQYG 4Y16B 2HMID 4RFNB 3STLA 5C0DB 3O6FD 1MCHA 1PG7H 3PQYD 4N0YL 1IEAA 4IBLT 1BZ7B 2IADB 2NY1C 3VGGA 4OFDA 5C0CA 3CVIH 2HJLB 4JKMA 1S7QB 4EI5B 1MNUH 5I9QB 1RUPH 2M26A 3MOBH 5HYQA 2V2TB 4RISH 4LPUA 4I2XB 5A40E 5JZ7D 5HDOA 1T1ZA 5DJ6B 3U9PL 4OLUL 4KU1A 3VI4F 5JPMA 1BOGA 2BDNL 1A5FL 3WL9A 3VFWB 4TSBH 4FG6C 3EOBA 1U3JA 4PJ8A 3IETA 2VOTA 4TTDC 2R2EB 2VZSA 3MGAA 1DUYA 3B5TA 1NAKH 3RVUC 2D0HA 1E4XL 2WAHA 1A1OA 4Z7UA 1I9JH 2PO6D 3QHZL 2ATKA 5TJWK 4PJCA 5AG9A 4NKDA 1KJ2H 3K8LA 2UWEF 4KXZI 4UOW1 3LSOB 2OL3A 3ECBA 4HEME 4JDVB 1DANT 5IB4A 3D85A 3IDMA 3F7VB 5C0CE 2GK2A 3U30C 1FL3B 3FB8A 5MEOA 4TVPE 4RAUB 1XGUA 1NDMB 5GIRB 4GO6B 2GEEA 1JPSH 5I1DA 1GRWA 4GBXC 4E0RB 3P3YA 2V5YA 3CDCA 1WFOA 4DK6A 3I02B 4F7EB 4JZOA 2UUDH 1G7QA 4OZFG 1RU9L 5B22A 3SDDA 1UXWA 2EKSA 1BQSA 4YEFA 1RZ7H 4GXUN 5CBEB 3V6ZB 3H0TB 4W70A 4OLVH 3QDGB 4RA0C 3UMTA 5FUOL 4EIZC 4PJCE 3KS0J 5EZOH 4Y1AD 2GT9A 3JV6B 5DZOA 2DQCL 4W6WB 5C0DA 2Q8AH 4DGVL 3QFDB 3QAZC 1JPFA 1FAIH 4UIMB 4YPGA 1A64A 3PP4L 5JW3H 1UC6A 2AV1B 5J0BA 2HJLA 4GKSB 4EI5A 3FRUB 4XC1H 5E2WH 3O3AA 4WHYG 1H3VA 1NKRA 2XZQH 3BAEH 3QFJB 2X4QB 4K8RC 3BE1H 2YWZA 4X5XB 3LRSA 3SDCA 3TNMA 1I3GH 1E4KA 2DAVA 4CVXB 5DJ6A 3V6OC 4TNVF 4Y2DA 3V0WL 3CSBA 3VFTB 7FABH 4OFPA 1OTSD 4UDUB 3CVHB 3VFWA 5F9JA 2BY1A 3QO1B 1ZANL 2R2EA 1I8KB 3TPUA 2P46B 5D1ZC 3BD5A 4PGDB 5KSUA 1FNGA 4XB8A 2EIEA 4WY7L 5K59E 2F19L 2P7TB 5FGRA 2B4CC 4NNXB 2J88H 5I1AA 4I13B 1NGPH 3LSOA 5HGBA 4MZ3A 1CQYA 3OKYA 1IC4L 3F65A 4XCCL 3T0WA 1FN4B 4WW1A 1MCIA 1RVFH 4OZFB 3WFEL 2VKXA 4Q9QL 4M93B 5DK2A 3QHFH 1NCWL 4RAUA 1EO8H 1F4YL 5JDSB 3PHOA 3DO7B 4WNQB 5GIRA 3S35H 4PRNB 3MLRL 5TE4L 1RD6A 5IT2L 3V0VB 4KUZH 3HNVH 4LCCB 3TBVA 2D7TL 4XP4L 5CMAB 3ARWA 5EU4A 1HN1A 1JN6B 3QI9B 5EG6C 3HMWH 2CO6B 1F4AA 2ITDB 4XNUH 5GS0L 1R3JB 3WNNA 2P8PB 2FX8L 5DVOA 5CKAA 4XMLH 4TUKH 4YUEL 2PTTB 2Q3AA 3CK0L 4KAQL 1FGVH 3QRFM 1FDLL 5FCSH 3DUUA 1SY6H 4G9DA 2JJUA 1E27A 2NY1B 4OI7A 3QFDA 4RWHA 4TUOB 1FO0H 2JKXA 3O3DB 4JHBA 3WNOA 3THML 5KS9B 3KLHC 1A1MB 2DIJA 2YZ1A 3BIKB 4NBYB 1HWGB 4YHIB 1TJIL 2WUBL 3FRUA 4KRMB 5GISL 3I6LD 4PJIF 3CJJA 1FVDB 1OP3H 2OI9C 1EFXD 3BX7C 4MA3A 4JDZA 3W9EB 3DARA 4Y4KD 5FYJH 3U36B 1HHHB 3EYVB 4K55A 4FQCL 2X09A 4DKDC 2NY4D 3FL7A 4M7LT 3VFTA 4PPTA 2G60L 2RR3A 4JM2F 2PF6A 4P57B 3NPSC 3ZHLA 1I8KA 3KPMA 1CYGA 4F3FA 1WZ1H 1NGWA 2DQJH 3KYAA 5DJZA 3QDGE 2A6JB 3WO4C 3FQRB 4HUMB 2M1KA 3HPJB 1K9TA 2DN7A 2FHFA 1KCRL 1UEYA 5T3XE 1I3RB 2F5BL 2ICCA 2EDNA 5MEPB 1JGVL 2VISA 3U30B 2P8MB 2J6EH 3P0VL 3WLBA 1DE4A 3BZEB 2XN9B 4M6MH 4HWZA 3HHRB 4HUWA 1S9YA 5GPRA 1BD2B 3GI9L 3H9SB 4L4VD 1KCSL 2UWEB 4B7LA 4GBXB 5J3HD 3JSSA 4WNQA 4FTVA 1O7SA 1EBAA 1YYMH 1IFHL 3F5WB 2XRAH 1MCDA 5GQBA 1J1PH 2PUQT 1S7UA 3BGMB 4OBSA 4Z7QE 1JN6A 4YXHH 3IJHB 5J8OA 5C2BL 3WEXB 5BRZB 1GGYA 2XY2A 1JNNH 2YMXL 1KPVB 5JHLL 4L8SA 1OARL 3S4SA 3DHJA 2PTTA 3ESVF 3MLXH 4FNLL 2B39A 2ZUVA 1Q1JH 2DMKA 3T0VA 5HGGS 5DD5L 2E8ZA 5GRVK 2HMIC 1MHPL 3P0YH 4TUOA 3DXAB 5D7IF 3O6FC 4GAJH 3BIKA 4YHIA 4HC1A 1ORSB 2ORBL 5F1NB 1BFTA 1VA9A 4LLYB 1FVDA 3GJFK 4NNPH 4X4XB 4FQPA 5HYJD 3AAZB 2QQKL 4QRSB 3ULUL 3OAZH 4ZUUB 5ESVB 4YHNB 3MXVL 4KRPD 1BBJA 4HIHB 1JPGB 4X80H 1G7PB 4ONOA 5JZ7C 2GCYA 4L3EA 5D1ZB 4HMCA 5HPOA 4Q0XH 5TE6H 3RU8L 4QNPF 1NCUA 2JJTC 3MRRB 1OM3L 2VE6B 3EHBD 4KY1L 2LVEA 4NDMB 2W91A 5DEZA 3FQRA 2BVPB 1NCCH 2V17H 2PO6C 3PUCA 4CN4A 3DX8A 1MCPL 1HQ4B 1TVHA 5F7WC 1Z3GH 5SX5K 1F2QA 3ZE0F 4H1LA 3UJIL 3UTQB 2FATL 5IHLB 4R8WH 2WSKA 1FFRA 4LKXB 5T1MB 3E8UL 1XZ0A 3H9HA 1U8OA 1KPUB 2GI7A 3DUSB 4YX2L 4KUCD 1HH9A 4GG6F 3O3BB 1UA6L 5I1JH 4EXPX 4U6HA 5GS1A 2J8UF 5A3ID 2DWEA 1F90H 3DWTA 4MD0B 3ZL4L 1LDSA 3IXTB 3IJHA 3TYFA 3ZDZF 2FD6H 5BRZA 3B4NA 1NGYB 3QEUA 1KPVA 1F58H 3T65B 4F37K 4N8VA 1EERB 4P2QD 1QNZL 1MREH 2F53D 2CGRH 1A7NL 4Y5XC 1J0IA 1H3TA 1MJ8H 3RWJB 5DLML 3PWJB 5HY9A 4FFZL 1KGCE 3QUML 3SN6N 3ALPA 2FH6A 2P42B 1SVCP 2XN9E 4FRWA 3X17A 2OI9B 2OMBA 1BD2E 4YXLH 1MH5A 2ZOKA 4X4XA 2VABB 3V6OA 3AAZA 3RUGF 5EZIL 1BQLL 3OSKA 3BIBX 2Y5TA 4YHNA 4IDJL 4WV1B 3NPSB 4HIHA 1XF4B 1JPGA 1G7PA 1A7OH 4ONGL 4RA3A 1U8LB 4S1RL 2E7BA 1OTSC 2P47B 5J1AA 3D39A 5SX4I 1R3IH 3U0TB 4Y0GA 5BRZE 4PJIB 3EYUL 2N7AA 3WO4B 3PWPA 3MRFB 4BZ2L 4K3EL 2QSCH 5F21B 5GGTH 2BC4A 4UV7H 4AIZB 4PIRF 4KTYA 3EYFB 4PG9B 4CN1A 1A9EA 2DIBA 5FOJA 5BOPA 5E95B 1H9VA 4LHJB 5E8EB 4K2UH 1RHHB 2DF3A 4KDWA 4R4FL 3DXAE 3BJLA 4JFEB 5F8QC 2DBLL 4K7FA 3UTSB 1KENL 4JHWL 1OAZL 2EEBA 3MBED 1KPUA 3O8XD 2VNCA 1S7TA 1I7RB 2AKRA 3V6OE 1F4XH 3Q48A 1KC5H 4AEIH 1HEZB 1ZHKA 3MCLH 3LDBC 4LLWA 5K9QG 4LIQE 1CLZH 1VADB 5DRZB 3IXTA 2ESVB 3CGTA 2VERN 1ITCA 4OF5A 3B5HA 2QSTA 2DRUA 4LCYB 3T09A 2HVJB 3TO4D 1WICA 1MFAH 2OCFD 4U1IA 3TBYB 3BSZH 4NRYB 4X6FB 5B4MD 5L7XL 3PWPE 1PG7L 5HHVH 3W0WA 4JE4B 3KPSB 4OD2B 3CVIL 3HE6D 5GGQH 1QQDB 3RWJA 3KPNB 1MNUL 3RPKA 5IVXB 5F70A 3O6FB 1SJEB 5E03A 3PQYB 4WWID 3MOBL 4PP2B 3MLYL 1I8MA 5EN2A 5DGRA 3TH4T 1ND0A 3DMMA 4B50A 4FXLA 3RKPA 4TSBL 3DURB 4QO1A 3VE0A 4QT5A 5E94B 5AAWA 4S0TD 1LEKB 3SE9H 2JCCF 1NAKL 2OLDA 1AGDB 3RVTD 3AFLA 4NRXB 1XF4A 4Y4KC 3TFKD 1I9JL 1UZ8A 3MGOB 2NY4C 4IOIB 4UB0L 3HZMA 4XXDB 5CGYD 3ZE2E 3MRHB 5I66B 5DYOA 3E6HA 3VU2A 5KBNC 4MS8D 2PO6B 1NKOA 1HI6A 4Z7VA 1L0XA 3TC9A 3W0WE 1TJGH 2ZOLB 3EYFA 2Z4QB 4JLRB 1RHHA 5IEKB 3CMGA 3IDIA 1LK3H 4LGRB 4QHUB 4JFEA 1JPSL 3U0PB 1JNHB 4QHLA 2X89D 3QQ4B 3B2UD 3T8XB 5EO0B 1WWAX 3K4DA 3BISA 1URLA 5FA3A 4KRLB 1H3WM 5ITBL 5J3HC 4HHAB 4OLVL 4TSCH 5F7HA 3GRWH 4RQQB 1A22B 4NP4L 3BWAB 2A9ML 4POZD 5EZOL 3N1FC 3MRCB 5L8LB 2E6QA 1LWRA 1P5VA 3TJEH 5FXCH 5JPNB 3PXJA 2Q8AL 4X6FA 4HEPG 3ARGA 2VL4A 2Z8SA 4Z7VE 1XH3B 1BOYA 4TSAH 4GG6B 5EZLB 5JW3L 4Y1AB 5JOEA 2J8UB 5E9DA 2R1YB 1QQDA 3HAEH 5E2WL 5IVXA 1EGJA 3O6FA 1SJEA 3BAEL 4IRZH 4X4ZA 3PF2A 3AREA 3IAPA 3PQYA 4FOMA 1WT5A 4PP2A 3BE1L 3LMJL 2PYFA 1I3GL 1XR8B 4I0PD 4JFEE 4QGYA 3P4NB 7FABL 1GOGA 4IMKC 4PYGA 1ETZB 3DURA 3L7FB 1GHFH 3NGBC 5E94A 2NR6D 3WXWH 3P9LA 5JMRA 5BV7C 4JCLA 5IFJA 5FECB 1G7MB 2OS7A 3TWCH 2VDKH 4KRPC 4IOIA 4XXDA 1GIGH 5DRNB 1NBYA 3LEYH 2J88L 1WBXB 2HVKA 4KC3B 2GFBA 5GRVL 3RIFF 1U93A 3RWFA 4DVRH 3VGAC 2PO6A 3CU7A 5C0RL 3KVQA 4X9IA 2EE9A 4PTTA 2NZ9D 4H20H 1ZV5A 4JY4B 2XZAH 3EHBC 3C6SA 3KPSE 3C60D 4OF6A 4KUCF 5ESQA 5HDQL 4UV4H 4WFED 3QHFL 5E5MB 5IVXE 1EO8L 4JHAH 5IEKA 1RJLA 4XP1H 3PQYE 1U95B 5FO9A 3S35L 1UZ6E 2V5SA 4KJYB 3HNVL 3P11H 4CN6A 4HLZG 4Q9BA 3IFPA 2H3NB 5GRYA 5EO0A 3HMWL 3S37X 4LSPH 4XNUL 2D9QB 3IGAB 5BJTB 3HS0A 1T7WA 3IAQA 4HHAA 1Q0XH 4XMLL 5KANI 2D3VA 2D7PA 1MJUH 5A3IC 1R5IB 1JWSB 4DUXA 1I1FA 5EO1B 1IAIM 3WSQH 4NWUH 4Y5XA 1NC2D 4NNYB 2VH5L 1FO0L 1CDHA 4AH2B 1XH3A 4LRIA 1ACZA 3PV6A 1UADC 1CGXA 2R29H 2R1YA 5HHQA 2P5WD 1LP9B 4P9HH 1T1XB 3WFHB 4OQTH 4MQSB 5JO5B 4G6AD 1W72H 1CD9B 4PJGF 4A6YH 5BW7A 4RMSA 3E0GA 1SYVB 3MJGX 1M6OB 1D6VH 3L7FA 2VXTL 4OCRH 2E3VA 3MRIB 4N8PA 1EFXB 1ZGLM 4Y4KB 5SWSD 3ARFA 3I6GB 2X6MA 1JZ3A 5FECA 1G7MA 1WZ1L 3FO0H 2NY4B 1C1EL 2JF1A 2XACC 4HUVB 2E8YA 4ODWA 3HC3L 1K8DA 4RFOH 2W65B 1WBXA 2WK2A 4X98A 4ZTPH 1DBKH 1II4E 3DYMA 3D6GA 3QQNA 2J6EL 5FGBA 5CP3A 3R8QA 2CDFB 3BKCL 3BN3B 5J4MA 1YEJL 3GJEB 4RRPG 5GRJH 3ZDZE 4WFFD 3NZHH 1U95A 3GSXA 4WJ5B 3UC0H 2EEDA 2HJFB 1YYML 3QCTH 4KJYA 2XRAL 3MA9H 4ZOCA 4X6EB 1B0RA 3D18A 2AJXH 4DUWA 4OUUA 3WJLC 4L4VB 4HX1B 4U0QB 4G8EA 4YXHL 2ZUXA 4OUOA 4R2GD 1JNNL 1PX3A 5BJTA 4NO3B 3O8XC 4M03A 2H1PL 2FJGA 3RVVD 1HXMB 4GW5A 4U2ZA 1NFIB 2EE6A 5IMOB 5EUOF 3MLXL 1OSPL 5KVDH 1Q1JL 5JOFA 3H9ZA 1DLFH 1FNHA 3MZTA 3PE9A 1I85C 2VZOA 1MLCA 2CLRB 4NNYA 4OCWH 3TO4C 4KWUA 5CAYB 3FHQA 2VDNL 4RMRA 4GAJL 4JB9H 5B4MC 5FB8A 4CAGA 4Y89A 1LP9A 2R39A 3B9EA 4C59B 5MEQA 3BDXA 3HE6C 5D8JH 2ARJA 4NNPL 5M7QA 3WFHA 5I17B 3ILPA 1TIUA 4Z7WA 3IFNL 1KLUB 2XZCL 5ETUA 2B8OT 3NGBB 2YA0A 4X80L 1XGTB 1T83A 4M5ZH 5BV7B 3B8SA 1M6OA 1NAMH 1RIUL 5HYJB 2PTUA 1XMWA 4Q9RH 1EFXA 3GB7B 1U91B 1BWWA 1UWGH 4H26A 4MCYB 1GXEA 2DM2A 4KRPB 5KOVC 3WXVH 3HFML 3PHSA 2Y06H 2CR6A 2DB8A 3RVTC 4HUVA 1F6AB 1OAUH 4NHUA 3TFKC 2V17L 1YMMD 5AUMA 5DZNA 1DQDH 2CJUH 2EYSB 3VGAB 5I30H 2Q8BH 5FYLE 1T0PB 3HRPA 4R90L 4RSVA 3C8HA 4NRZB 3CSPA 5CGYC 5I18H 3BZ4A 5GGSA 5ID0B 1P69B 3LKSA 3VG0H 3MCG1 1YEEH 5GZOD 3VW3H 4MS8C 4R8WL 2HT2D 2PTVA 2BRQA 1LP9E 3MRNB 4MXVE 1F5WA 5GS0D 1AIFB 5DO2D 3EBAA 2J8HA 3S36X 5I1JL 1KB9J 3KYNB 4CVUA 5F7YC 1MCFA 4NO2B 2FHBA 2YD6A 3WHXA 1F3RB 2FD6L 5HGDA 5C3LD 2AJUH 3B2UC 4R9HA 3VFGH 1I75A 1X5YA 5IBUG 1F58L 3KYMB 5FDYA 2VZUA 1LE9A 1P4IL 1NFIA 3GSNH 3N85L 2W60B 5IMOA 1MREL 2YPLA 3V4UH 1J8HD 3H3KA 1NEUA 1JE6A 2OR8A 4POZC 3CX5K 1F3DJ 2HT3D 4PRPD 4TQEH 3WFCL 1ACYH 4P2QB 2F53B 2LAAA 1KIQB 1KYOJ 3NFNB 4F2MB 4KJQD 4YXLL 2DKMA 5IM7B 1S8DB 4OCLC 4QXWA 5I17A 4NUGL 1JHLL 1PJ9A 3S8WA 1G9MH 2GUOA 1KLUA 3IU3A 2VDLH 5F7MC 3MBXL 3WIHA 1A7OL 4K3GA 3BHBB 5A2FA 1T5XB 5J6HA 1K8IB 4KI5D 2CLVB 3MUHL 1U91A 1R3IL 1ITBB 3G5VB 5TFSH 3FQNB 2NR6C 4CMMB 3IU4L 4HUXA 3MLSH 3IS0X 1X5LA 2QSCL 3QXUA 5HGHB 2DQUH 2VC2L 1P4LB 4CU6A 1F6AA 3TVMD 2YPLE 4QY8B 4KTDH 1BQHG 4G6FD 4NRZA 4K2UL 3KHOA 5LWYH 4ZUVB 4HS3A 3NMEA 1G9EA 3Q5YA 1LEGA 1RZKC 4HWEH 3CMOH 1WVZA 4KJPD 5IBUB 3K4AA 1A6WH 5BMFH 2NZ9C 4ODXA 4GSDH 2YN5A 3L3GB 3L3OB 3TCLB 4AEHH 3C60C 3EOAB 1EUUA 5DJYB 3MCLL 3KYNA 3HA0A 2B5IC 1QG3A 2IH1B 5F88B 3RFZC 3PP3H 1OY3B 3I9GL 3OKLB 3MBEB 3O8XB 3KXFA 5FHBH 5HHOA 2D7MA 1FORH 2APFA 2DM4A 2B7DT 4LSRL 4Y2OA 4MJ4A 2VDML 4KFZC 1MFAL 1HKFA 4YNYA 2R1WA 4QXTB 5T1LA 5GGQL 1MIML 3TO4B 3L5XH 3UAJD 5HXMA 1NJ9A 4G6KH 3VXOA 3ULUD 2ERJC 4UILH 2JE8A 1CDIA 1XIWD 3HE6B 5ICYA 1BFVH 2RAMA 1FG9C 3V9FA 3D9AL 5EUOB 2NY2D 3MA7A 5D72H 5IM7A 5TQ0L 1S8DA 2WBJD 3DTXA 3AS3A 5EO9A 3F12A 1BQHB 3VRLE 3QCUH 2WANA 4G6AC 3BHBA 1T5XA 3GMOB 5HHOE 2I9LB 3KXFE 4P2OA 3MFFB 5C08D 3DVNA 1CDUA 4Z77B 3G5VA 3JWOH 5HGHA 5DQ9B 4HFWA 1P4LA 3JZ7A 1C5DA 3VXRD 5J06A 1TJGL 2DMCA 3FQXB 1YY8B 4QY8A 4TPRH 2MCG1 4LSUH 5J57B 3CPLB 1G0XA 2MQCA 5IOPA 4ZUVA 3RTQD 3K8MA 3IDNA 2HYMA 4YLQT 4Z78B 1MCEA 5HHPA 5LAXA 4MSWA 3GM0A 2FR4A 3L3GA 1OD9A 3L3OA 5B39A 4LPXA 4UU9B 5DJAA 4HG4J 4LCIH 3K74B 2O26U 5I0DA 3CFCH 4Q2ZB 3WFBH 4LHUD 2DICA 5MENA 4TSCL 3CDFA 3TIDA 3GRWL 3BWUC 4K7PX 4CGTA 3OKLA 5CP7B 3I84A 4MJ6B 4PJ5D 4ZPVB 3WO3B 5A2JH 4Z0BH 4Z5RB 3KYKL 5EOTB 4HK3N 3TJEL 4ENED 4Z95H 2DQDH 5DJ8A 4EUPA 4Q9CA 1N6QH 2Y36H 4R2GC 2MKLC 2RCSH 4P4RA 2E9JA 4ODUB 5CSBA 4RWYL 4JPIB 4TSAL 4BZ1H 4EDXA 3RVVC 1I85A 1WF5A 2HLAA 3MJ9L 4M3KB 1GPOH 1UWEH 1AGCA 1A02N 1MQ8A 1VKXA 5GGUA 3GMRA 1ZWIA 2V7NA 1ZVSB 1ZVHA 2JB6A 3QWRA 5GS2D 1YPZB 3TYGH 2GJZB 4U1MB 3WN5C 4LVEA 4ZFZB 1MWAH 2CD0A 2ICEA 3MRGB 5DK0A 1A6VL 3J7HA 3U2SB 5ALCL 4ZFGH 1GHFL 3S34L 3VXNB 2MPAL 3WXWL 2XQYK 3QDJD 1AD0B 1MQKH 4BSVA 4YWGH 4P3DB 3TWCL 1BQHA 1S7WB 2VDKL 1HWHB 5GSVA 1CDGA 1QLFB 3NAAL 1GIGL 3MFFA 5ACMA 1CXEA 1TZHB 3LEYL 2AEQH 4ONHB 4DVRL 3ISWA 5JW5A 3AGVA 3DYOA 4G5ZL 4H20L 2XZAL 1SYSB 5BVPH 3D1MC 3FQXA 2Q6WB 2I9TB 1P4BH 4ELMF 4X6DB 1N5YH 3SCMD 4OI8A 4PJAF 4D0DA 4XP1L 4JFPA 5CFHA 3WDHA 4W81A 5HPMA 1RMFH 1IC5L 5FK9A 3C60B 3P11L 1IT9H 1UACH 1X6NA 4N0UA 5GZOC 5B8CA 1EXUB 4HDIB 5EUOE 4AT6B 4LSPL 2HT2C 4UU9A 5E1AA 5C2UB 1J05B 2HTKD 2B5IB 2F58L 3VD5A 4Q2ZA 2X89A 5GS0C 5DO2C 1Q0XL 3FB5A 3SJVD 4PJBA 3C6LA 1MJUL 3PWLB 1U8MA 1J0KA 1XCQA 2H32B 4M7JL 3QEQA 4YDKH 4EJ1C 1DQJB 4MJ6A 4ZPVA 3GNMH 4E9LA 4L9LC 5D4QA 5ALBL 3VMPA 4JY6B 4NWUL 3QWQB 3WD5L 1RUKL 1RSFA 2CUHA 4LLDB 5HYFA 4D3CH 3IF1B 3PDOB 3RWHA 2R29L 3ZDXF 4ETQB 1GYAA 3O0RL 4P9HL 3TN0D 3TT1H 2ERJB 2AK4A 2WIMA 1NC2B 2EH8L 4LAQH 5DEFA 1YPZA 4LSQH 4OQTL 1F4WH 4MB3A 5F9OH 4KI5F 1KELH 2HT3C 4HKZA 5DJ2B 5LG1A 1W72L 2P5WB 1K5NA 5CEZE 4N0UE 4FXGB 1KLGB 4MD4B 2HRLA 1JWMA 1WCBA 1D6VL 4LQ1A 4OCRL 4ZUTB 3VXNA 3ULSB 4KJQC 4BH8B 2QV2A 3HNSL 1IGFH 2R0ZH 3KLSA 2FRGP 1S7WA 3D69B 3MV9D 4PJBE 4PREB 1TITA 4HIXH 3QEQE 5EUKB 5SWSB 2AGJH 1TZHA 3IRZA 1R5VB 4KI5C 5CJXC 3O6MH 4ONHA 2JJSA 4ZOEA 4ZTPL 1DBKL 3MRDB 4ZTOL 4HV8B 5GRXG 4TUJA 2RB8A 2YPVH 3CX2A 4HULB 2G75B 4X6DA 5GS3A 5LKNA 1BEYL 2X5PA 3TVMC 3CC5A 3VCLA 2AK4E 1IAOB 5GRJL 2J5LC 3DGGB 1IQDB 3NZHL 1MY7A 3UC0L 4QRUB 1YPZE 3QCTL 3SE8H 1S78D 1YEKH 4Q97A 2P44B 3MA9L 2OZ4L 3B43A 1KN2H 4J3XA 2AJXL 3CFJB 2IBZY 1EXUA 3EOTH 4KJPC 5A16B 1QSVA 5IB3B 1RZIB 3W2DH 1J05A 3FB6B 3WS3B 4MQ7B 4R7NA 4PGJA 5T33L 3VXSD 3O3EA 4U1KB 1AD9B 2HH0H 5EFIA 3V7AE 1BP3B 2A77L 4GW1B 3HNTH 4P5MB 4UNTA 5C9KA 5I19L 3SDAD 1LEIA 4R2GB 1DLFL 2BNQD 3M1BA 3QG6A 5DMGD 1HCVA 2DL9A 5IMLB 2HFEA 5ECJE 4LPYA 4MGXA 4UBDD 1XAUA 1JRHI 1BIIB 4KDVA 4MJID 4L3CB 4OF3A 4JB9L 3PDOA 4ZUWB 1NSNH 4TULH 4X6DE 5D8JL 3BO8B 3WN5B 2Z35B 4OZ4B 1JHKH 2HT4D 3MREB 3UAJC 4WO4D 3VGFA 2FWOB 5DJ2A 3ULUC 3MV7D 1CE6B 2P5WA 3GBLA 1XIWC 4WFEE 4M5ZL 4HH9B 4X7TB 2V9TA 1JJUA 1NAML 1INQB 4F15C 4S0SD 1IGIH 1XCTA 2NY2C 3ULSA 1UWGL 5LXGH 3IVKB 3WFZA 1CFQB 4PJFF 3SGDI 4M6AA 2BHZA 1G84A 2WBJC 1IGJB 1Q9WA 25C8H 3WXVL 1GCFA 2Y06L 1UYWL 5KW9H 1OAUL 1G6RL 1DQDL 1MCWW 2CJUL 5SWSA 5I30L 2Q8BL 5EDXA 1R5VA 4FXKA 5I18L 2PYED 2UYLA 4XBEH 4HV8A 1G9NH 4HWNA 5AWNH 1YMMB 5E99H 5BZWA 5L88H 3QR2A 3RBSA 3FZUC 5JQ6H 3EJJX 4XPFL 5FM4A 5FGCB 4PRDA 2NCMA 5DD3H 5JUEH 3N1PC 1BLNB 2DD8H 3RTQC 2YD4A 2XWTB 5EOCH 4TTGA 2P5WE 1CG9B 3UPAA 1OHQA 3MOAH 3L3JA 5DVNA 5TDOB 3MUY1 3H9YA 4M1DH 5IB3A 3VFGL 3LKNB 4DGIH 4DKFH 2ZZUT 4GRWF 4MQ7A 4U1HB 2C7UB 2CRIA 4PJAB 4ZFFA 2BX5A 1OQXA 4L9LB 3GSNL 3NIFF 3PABB 3G5XB 2AERT 5LQBH 1W2KT 4PR5A 5KVMC 3OXRB 4I4WA 4MNHB 4IRJC 1DQMH 2HKHH 4GW1A 4P5MA 1XF5B 2BXZA 2J4WH 2KZ1B 5SWSE 3WLWD 1DBBH 4FQLL 3CNKA 4TQEL 4ENEC 5CZKA 4JY5H 4Y4HD 4YBQD 1BIIA 3B3IB 4L3CA 1OGAD 1J8HB 2OJZH 5FA4A 5B3JF 1JVKA 5E2UH 3BO8A 1ZOXA 2ICWJ 3KG5A 4PRPB 2CIIB 4H88H 4DZBB 3GSUA 2BOCB 1G9ML 2MMXA 4XPAL 5JIIA 2K3TA 3GMNB 2XOTA 4JAMB 1INQA 3VFRA 2Y1VA 4PJDA 1F45A 1HCFX 3W11D 5I1GH 1QACA 2CDEA 1QBAA 1RJYB 1CFQA 4I77H 4M61A 1DLHA 1QZ1A 3H6JA 1IGJA 2PXYD 4O00A 3ULVH 5A43C 2DQUL 1R0AL 1CVRA 2LTQC 3V4PL 1GGIH 4KTDL 1X5KA 3JVGC 4QTIH 3KPLB 1L0QA 1CXHA 3AVEA 4GKNB 1UFUA 4YFLF 5KSBF 2VZTA 4RIRA 1AKJD 4UDTA 4XZUB 3SKMA 4ZYKB 2ZNXA 4W4OA 3TVMB 1AY1H 2WLZA 3IFLH 5C0BD 3CMOL 5BMFL 3LPGA 2J5LB 4G6FB 3SPVB 3X3FL 2NY7H 4GSDL 3CLFH 2QSVA 1T1WA 4AEHL 3DLQR 1HNFA 1FZOB 3AS1A 4PJHA 5JXAH 1D5BB 1C8PA 5C0ND 3SCMC 1AI1L 3WUZA 4XAKD 2XWTA 1J0YA 4Z0XA 5EOCJ 3B9DA 1MCNA 2VLJD 3NIGF 3DGCR 4LSDA 3UX9B 1RY7B 4WCYH 5FHBL 1FORL 3QUKB 4PJDE 1QFWI 4FP8H 3NACH 4G42A 4JRXD 5DA4A 2C7UA 4YHLL 1FP5A 4U6VH 2HTKC 4L9LA 3PABA 3CUPA 4K3HA 4PV9A 3UPRB 1RI8A 3REWA 5E4IA 1T0NA 3MROA 3HC4H 3L5XL 4FQ1L 1QKZH 1ZK9A 1QYGH 3Q2CA 2EDLA 3O2DH 4QTHA 1QEWB 2O61B 1ZLSH 2IPUK 5E7BA 2UY7A 4D9RD 5HHNB 1UM5L 2ADJB 3QZWA 1BFVL 4LHUG 1CVSC 2J12B 3ROOA 5D72L 1PG7X 4PRPA 3TN0C 4M4RA 2CIIA 5FGCE 3ROLB 1XIWB 4PJHE 4ZS7L 3ZE1E 5I8EB 3DI2B 1Y6KR 4M62H 3HG1A 3RRQA 4P4KC 2GTWB 4F15B 1YYLH 5HBBA 4EVNA 3GMNA 2NY2B 3E2HC 2X4OA 1AR1D 1N5AA 1MAJA 3EYOA 2WBJB 4DFHA 1YJDH 5D70L 4ODBD 4MWFA 2CDGB 3SDXF 1FFOB 1MLBB 4JFOA 4QOKD 3G6JA 3QQ3A 1JYXA 4NKOB 1U3HD 3JWOL 5KZCD 5LGHH 1ES0B 3U1SH 4CADA 2IEPA 3N9GH 5CJXA 1MCWM 1A3QA 1C5CL 3LKOB 5C08B 1IZJA 4TPRL 1BF8A 4KTEL 32C2B 3GEWB 1OT1A 3KPLA 4JFHE 1FNEA 4QHMA 2YD8A 4NQVB 4PJFB 3PV7A 3VXRB 1F3JA 4YIQB 5C8JB 1G7LB 2V9QA 1J8HE 1DBAH 4ZO7A 3QNYB 3AS2A 3SPVA 5CD3B 3RTQB 2AK1H 4LCIL 3PWUA 4PRPE 5C0JB 3V8OA 4UT7L 3CFCL 1UB5B 2FSEB 1WFTA 2GK0B 3VGDA 3HG1E 4L5FH 3NN8B 4NQTA 1S78C 3IFOB 3GDBA 1XF3B 3PGCA 4F7PB 3OJVC 5DC0A 4AIOA 4F8TA 3ZDXE 4Z0BL 5HJ3B 4UI2A 5E2TH 4LHUB 1N6QL 3VFPB 1ZS8B 1O7VA 5SV3A 2AABL 2RCSL 3S3JA 4BZ1L 3UPRA 4PJ5B 2YRPA 3SGEI 1A6TA 3S5LA 3VH8B 1Y6MR 5JXED 1D7FA 2Y23A 4UOW0 3SDAC 4FZ8H 2I5YH 4Z18A 2O61A 4FFVD 3QUMB 4C54A 5DMGC 4GRWB 3TYGL 2JB5H 4S1DD 5HHNA 2P4AB 3EKCA 3OZ9H 4UBDC 4MCZA 1MWAL 2XYCA 4GMTH 1OP9A 5T1DH 3K3QA 1NCTA 1GZQB 3NCCB 1AE6L 4N1HB 1FNFA 3REVA 3MRKB 1XIWA 1JUFB 4N90E 2HT4C 2AQ1A 4YWGL 4QLRA 2GTWA 4WO4C 1BWMA 3FFDA 5F9DC 2VL5B 4XNYH 4OGYH 3RWGA 2WW8A 3OKMB 3QDJB 4HUNB 4P49A 1CZ8H 2CDGA 3PL6A 4Z76A 2AEQL 2FB4H 4NKOA 4P23A 2LTQB 4UINH 5I0ZA 5AD0A 3KR3H 3LZFH 4DUVA 1A4JB 2QQNH 3QJHA 2BHYA 3MLUH 3VXPB 5BVPL 3LKOA 4BZYA 1P4BL 4XB7A 2XA8L 1N5YL 4KI1A 3VFSB 2A6IB 1TVDA 2F54D 2X4SA 4NM4H 1RMFL 1NFDB 1FL5B 4YIQA 4JG1H 2B0SH 2YD2A 5C8JA 5J13C 4C56A 1UACL 1HINL 2FECI 3SCMB 3QDAA 5F44A 4YAQA 1D6EB 3RTQA 4U3XA 2BSTB 5C0JA 2DLEA 3ULUE 1ZMYA 15C8L 3HPLB 1SM3H 4M3JA 1PZUB 1KOAA 5KSBB 2COQA 1TCRB 1XF3A 2IPKB 4JFYB 4F7PA 2WIIA 4JRYA 5ENWA 3E3QC 4N0CD 5GGRA 3GBNH 3LD8C 3QIWD 5D2NA 4C4KT 4X6CF 4LHUA 4X0KB 3VFPA 4IRJA 1ZS8A 5D7JD 3SJVB 1MFEL 5IWLA 4AQ1B 3RX7A 4LLUA 1Q0YL 2WWMD 4D3CL 2YUWA 3QEGH 4PJ5A 3V5DA 5IF0B 3VH8A 1L7IH 3TT1L 5DD0H 4F37F 2GIYA 3SOBH 3GK8L 2QKIB 1JZ2A 1P2CB 5E70A 3WLWC 5E7FA 1KTDA 4LSQL 4NJAH 4JREC 5EU6A 4OM0L 1DEEB 4JKPH 3CFEA 4YDVA 4NQDA 4Y4HC 3TN0B 4QHNB 4YBQC 4EBQH 4JVPA 1T2JA 4C56E 3IDJA 3WE6B 2WQ8A 4ORZC 5FDWB 1KJVB 3ARRA 1LDPH 2Z91B 5FM5M 2BVQB 3I6KA 3BP7A 5CINL 5LJYH 5CSZB 1IGFL 3E2HB 1IEBB 2VLLA 5H94B 5JORA 1NDGB 4X4YB 1CGVA 3IYLW 1Q94A 3EJYD 2AGJL 5DUBA 1CD8A 2VLKA 4K9EC 4X5LA 4YC2C 5D2NE 2C4FU 5I1LB 4XP5L 1DCLA 3DETD 1MPAH 1SMOA 4JDTL 3MV9B 3C8KB 3OR6B 4O2EA 5D1XD 1A4JA 3BDBA 2PXYC 2YPVL 3AMLA 4PJ5E 1MCOL 1CXFA 5ICXB 4OZIF 1JMXA 5E00B 1C16A 1ZA6B 2BVEA 4L1HA 4G7YH 3RI5K 1DSFH 5EU6E 3SE8L 1NFDA 1T5WA 4BUGA 3H3PH 4NQDE 1A4KB 3QUYD 1KN2L 3EOTL 3UZEA 1S9XA 4U6XB 3VD3A 2W0KA 4L8DA 5H35B 2BSTA 3W2DL 1BPVA 4UMGA 2VAJA 3BPCA 3IXAB 2A2QT 2HH0L 5C0NC 3L6FB 5EORH 3FMGH 1CK0L 4JFYA 1DJSA 2IGFL 2BMKB 3VXSB 5HD8D 3QH3A 1T3FA 1R3LA 4X0KA 1KSRA 1VFBB 4C55A 5E08H 3A67H 3VGEA 2CLZB 3U83A 1AGBA 1I7UB 4GKZB 3SDAB 5IF0A 4E41B 4FQHB 2AV7A 3P9MB 2BNQB 1N6UA 3KPRD 2VYRE 2VZ3A 3T2NH 2E7LC 5ID1B 3EDFA 1LO2H 1PKOA 2CKBB 4MJIB 4LNVA 1NFDE 4PG2A 4QHNA 4UUJB 1KEML 5D2LF 5FDWA 2L0DA 2CK2A 4P4KA 4Q74A 5TPWH 4L29B 1IGIL 4WO4B 5LXGL 5CSZA 1FSKC 1LGVA 3MV7B 1IEBA 4JPKH 25C8L 1JZ6A 5FHAH 4QXGH 5T3ZH 4L8CB 3WV0A 3OXSB 4O4YH 3UYRH 2ADIB 1NDGA 2BFVL 1KJ2A 5ERWB 2MHAB 4M8QB 4PY7B 4AENB 2UZXB 1D5ZA 1M7DA 1Q9KB 3BVNB 1GGBH 1NCDH 1U8IB 3MUGB 3VXMD 1FH5L 4XBEL 2MQ3A 2FJFB 1QFPA 4YGVB 1G9NL 4NKMB 5F72S 3PIQB 1U3HC 5AWNL 2GITB 3D25B 1KB5H 1KIRA 3HE7D 4IHOB 3GJFB 4D8PA 5H8DA 5CJQH 5JQ6L 2VDPL 2QJDA 2PYEB 3QNZB 1ZA6A 2PW2A 5J13B 1MCBA 2BOBB 5ICZB 3EFDL 4P5TD 5EOCL 4KJWD 4HKJB 4I48A 2IBGA 4H8WH 3MOAL 5HYEA 4XH2B 4U6XA 3OAYH 4M1DL 5H35A 5EOQL 4DGIL 4J1UA 1UWXK 2AJZB 5DRXA 3GZKA 5FO7B 4TN9A 4LDLB 5F9AC 5HSFA 5DMKA 2AJSH 3L6FA 1ZGLP 5LQBL 5E2VH 3LD8B 5HDBE 1DQML 1EHXA 4DW2H 4NQED 2BMKA 4WU7B 3VXSA 3MO1B 1EZVY 4MHHG 4NYLB 1D5XB 5CZVH 1J5OH 2YBRA 4JY5L 3VFVB 4I3SH 5D7LA 2K7QA 1C5BH 1QP1A 5TGBA 4E41A 3P9MA 4JFDD 2BNQA 4JREB 4FQXD 3ZSSA 5E2UL 1QR1B 3WKMH 5JXEC 1T22B 5DDHB 1I9RH 4Y4HB 4H88L 1U9KA 1OGAB 2BSRA 4CW1B 1KXTB 3G9AB 4FFVC 3T2OA 4S1DC 3GBMH 4P46D 1AXTH 4PD4K 4W6YB 3PDGA 4J2XA 3TBSB 5JMOC 2DI8A 1BHGA 3RJQB 5FV1L 1IBGH 1KN4H 2AJYH 5I1GL 4WO4A 3LPWA 4I77L 1TDQA 2NX5D 5E8PB 4UQ3A 2E27H 1UKQA 2ADIA 3FO1A 2MHAA 2OTUB 2X9WA 4M8QA 4YC2B 3JWDC 1GGIL 1XGYH 2C4XA 1CT8B 1T7ZA 1MCLA 3VXSE 3LS5H 4QTIL 1RK1B 3T77B 2PXYB 1BJMA 3M45A 2VDRH 3U9UB 4FQJH 4NKMA 3PIQA 4DGYH 1H3GA 2GITA 3IFLL 5D7LE 5GJTH 4E41E 4QCIA 2NY7L 4U1NB 2BNQE 3CLFL 1NBZA 4HW6A 3WHE1 2EDKA 3MRQA 3O4OC 1ZLVH 3LN4B 1AKJB 1F4HA 2KZWA 4LMQE 2OQJA 5C0BB 5DJCB 3UO1H 4NQSB 5DR5H 2A1WL 3SBWC 4GLRH 1RURH 4LLAA 1A1NB 4WCYL 2H2SD 3DX7A 4FP8L 1FRGH 3NACL 4OZIB 5C0CD 4DZ8B 2R0LH 4J8RB 4U6VL 5HVGB 2VLJB 2EH7H 4TVPD 1YN6B 1VACB 5DD6A 2VXUH 2J8OA 4JRXB 5HGAB 1QKZL 4M00A 4N0CC 2A6KB 3GMPB 2O5ZL 3N1MC 1FO0A 5JW4N 4P59H 1ZLSL 3QIWC 1BFSA 3L3IB 3VFVA 1CGTA 5D7JC 4PJ8D 2VDOL 5CHNB 3RL1A 3OKKA 2WWMC 4ODSH 1INEH 1JGUH 2DQTH 4KQ3L 5T3XH 3W5MA 2VSCA 3CSYB 1T22A 3SDYL 4ODVL 4Y4HA 2R2BB 4M62L 1OGAA 3HI1A 1HIMH 5D6DC 3SKJL 4UOJA 4CW1A 3PWVB 3CFDA 1YYLL 4XHQA 4YEEA 2BZDA 3NPZB 1FSKB 4YFEA 4MDIB 3FQUB 3RNKA 1S7RA 1YJDL 3T0EA 2B1HH 3BH9B 3LHPL 1U2CA 2ED8A 3D85D 4LF3B 1EEYA 4DKEH 4PRAB 5E8PA 1S9WB 1KBGH 2EIZB 1F8TH 5IB2B 1V3LA 5LGHL 2R1XB 2UVEA 3N9GL 2VITB 4PJXF 2YD5A 3CVHH 4ONFH 1CT8A 12E8H 4QOKB 1AR2A 4XNQA 2FX7L 4CNIB 1GOFA 4S2SA 1RK1A 4KMQA 3DRTB 1U3HB 3EJYC 5KZCB 4WUUA 2J6EA 4OD3L 3DETC 4YHYC 2YEZA 5D1XC 3SDDD 1DBAL 1A6ZB 5KN5A 3CFKB 4LMQI 2AK1L 3UEZA 2D2OA 1OGAE 5C0BA 4L5FL 4I3RH 4MX7B 4OZFH 3BN9D 1N3NB 1KLFA 4UTBH 1VESA 2N56A 1CFVH 3QUYC 4L9DA 5HVFB 4OB5H 1IILE 2CIKB 4LLVA 4HFUH 3T0EE 4ZPTA 5E2TL 4DZ8A 1QHPA 1SEBB 3U7YH 1MSPA 3RZWA 4LNRA 5FYLL 2VLJA 2XFXA 5FFLA 4QRRA 1RPQA 5KVGH 3QDHA 1VACA 5IW1B 5FYKH 5IB1B 2WINB 3SHSA 4JRXA 2V2XB 5HGAA 4F7MA 3SDCD 3GMPA 2A6KA 1TNNA 4FZ8L 4KHXH 2D31A 4LASH 1ZLUK 4Y2DD 5DEGA 4BFIB 4WUUE 5HD8C 3L3IA 5J12C 2GYSA 2JB5L 2GSIA 3MRJB 3GSVA 3RZCD 4WHYH 5T1DL 3MPCA 3OZ9L 5DFVC 4K07A 1C08B 3VGHA 4XP9H 1RZFH 3BMWA 3MV8A 1FZKB 4XX1G 3CSYA 1VHPA 2XXCB 4HK0B 3PWVA 1N8ZA 3BRGC 5C0BE 5SWQB 4B0MM 3D2UD 1R3HA 6CGTA 4OGYL 3QPQD 4MDIA 3BH9A 1A3LH 1ZT4A 2Z0BA 1OF2B 4WI2A 4LF3A 3A6CH 4XAKE 1T7YA 2FB4L 4UINL 3SQBA 1V7MH 2EIZA 5E6ID 3KR3L 2VLJE 3LZFL 4QRRE 3MRMB 3TBWB 2A9NH 2QQNL 3RNQA 3MJ8B 4X99B 3NCYP 4HIEB 1JNLH 1N0XL 1FV1B 2M2DA 4MJ5B 4JRXE 1EAPB 3PHQB 5I1KH 1EH9A 5DRWA 3P9WB 5DQDH 3ZKND 4TRPH 4NM4L 5INDB 1VPOH 2BERA 3KPOB 2B0SL 2P24B 1DDHB 4BK5A 3O4OB 3O2VH 1A6ZA 4KK5D 4R0LA 1FIGH 1KT2B 2IALB 2W92A 3MV8E 5F1KC 4U7MA 1RK0B 2F54B 4BH7A 1WBYB 5LBSL 2F74A 4ZOAA 3F62A 2PCPB 1IGTB 4MX7A 4P5TC 4KJWC 4W68A 3FQWB 3IAGC 3LQAH 3L5WB 1Q9LB 2C3HA 3ZDYF 2IPTH 3GBNL 2WP3T 2BNUA 3MYJB 3NH7H 1Q8MA 4MA8H 5HI5D 2EYRA 5CEXA 3TV3L 1DQLH 4YH6A 5BQ7B 3QEGL 2WINA 1OVZA 5L2KA 1L7IL 3QIWB 4JFQA 4YR6B 4UAOC 5DHYB 4QOKE 3B2VH 5D7JB 3SOBL 4P9HC 3FN0L 4NJAL 1ED3A 1QVOA 4JKPL 3RDTA 3HMXH 2JJVA 3W81A 1IGYA 1C08A 5IV2B 2QTEA 3OG6B 5ELIA 4Y5YC 1RIVH 5DGQA 1LDPL 3BGAA 3RWEB 1WZKA 5D9SB 2V5RA 4HK0A 4N9OB 3O6LH 2HFFB 5DUMH 5SWQA 1MFBH 5IB5B 4CU8A 2GSGA 3B9KA 1AHWC 4DKAA 4OJFH 2WP3O 3V4VH 2CMRH 3D0VB 5E8NB 1MHCA 2FX9L 2XY1A 4P46C 2IQAA 1CD0A 3AMKA 1HH6B 1OF2A 5F7DB 2VDQH 5CS7A 3SE3A 1MPAL 4JJHA 2QL1A 2OBGA 1M71A 3BEVB 5GGTA 2MCPL 3SGEH