1NICA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA02
4HHGA 5LDUA 2VW7A 2BW4A 1AZRA 3AG4B 2IDTA 3PAUA 1ZIBA 2YAPA 1GW0A 3ABGA 1PLAA 5D4JA 3FQYA 2OV0A 4A2HA 4DP5X 2QPDB 4UANA 2MTAA 4F2FA 3EF4A 1NPJA 6PCYA 2I85A 2IDQA 2CAKA 3ASNB 3OMNB 3S3CB 2FT7A 1MG3C 5I6PA 1SFHA 2BWIA 3ZX1A 7PAZA 4FAAB 3T6VA 5I6LA 1IKOP 3WKQA 3NYKA 2I7SA 3U25A 2LLNA 3NSYA 4G71B 1JOIA 4UAHA 4L0PB 1JZHA 3T9WA 3D12B 2DYRB 4HZ1A 1MZYA 2VN3A 3WKPA 2X88A 1N70A 4X4KA 1V10A 2CUAA 5E9NA 1AZBA 2AFNA 2GSMB 3FPXA 5I28A 2VW4A 1R1CA 1AANA 3AW5A 3RYMA 1MDAA 1JZFA 2YAQA 4M4RB 4GXFA 3NJHA 2EINB 1BQKA 2FWLB 3DKHA 2HZHA 1BAWA 2WO2B 1CYXA 3EH5B 5I6MA 2H3XC 3NJNA 2HRGA 2CALA 7PCYA 1AG0A 2YAMA 3OQRA 1ZIAA 1PNCA 4YL4A 2UXTA 3CDZA 4A2GA 3CVDA 2XX1A 3UAEA 2IWEA 3SBQA 4E9VA 2UX7A 3WG7B 4AKOA 1J5CA 2AVFA 2YXWA 3T71A 4YSPA 2BW5A 1JVLA 3X1NA 2R7EA 2VM3A 1AS6A 3AG2B 1MG2C 2Y1AA 4BDVA 4YSRA 4YSTA 2GB2A 2GIMA 3G5WA 1GS7A 3QJVB 1URIA 1PZBA 1ASPA 1PAZA 3UADA 3X1FA 4BDVB 3DIVA 2ZONA 3NJIA 1BQ5A 3NP4A 3ABMB 4GP4B 3UACA 2BZCA 4P5RA 1IBYA 1NIEA 3QPKA 2N0MA 1QNIA 4DP1X 2ZXWB 3ERXA 1IC0A 1PNDA 2GBAA 1V54B 1AAJA 1A4BA 1AG6A 1JERA 3FU9A 1BXAA 4E9QA 2XLLA 2Y69B 4YSQA 1WAEA 1NWOA 5I6NA 2PPFA 5I5JA 3H4HA 2BP0A 4A67A 3ABLB 1CURA 5F7AA 4AKQA 4YSUA 4K9JA 4KO6A 1AQ8A 4BWTA 2J5WA 1WA0X 3OD3A 2IDFA 1RZPA 1OOWA 4PCYA 2XXFA 3ZBMA 1PZAA 4G7RB 1JXFA 1DZ0A 5TK2A 1PZCA 2EIJB 3PXLA 1AACA 1HFUA 2B08A 5AKRA 2IH8A 1JXDA 3OM3B 1J9TA 1PF3A 1KBVA 4DP8X 2PCYA 1GY2A 2FQEA 2JFCA 2XV0A 1SJMA 3MX0B 3UGEA 3T6XA 9PCYA 2BO0A 4GY4A 3EHBB 2EILB 1KYAA 2YAHA 5B1AB 3T6WA 2HX9A 2J57A 1RZQA 2RACA 1T5KA 5FC9A 2NRDA 4AKPA 5AFAA 1E30A 4KOBA 3V9EA 3WNJA 1HAUA 1E5ZA 1NTDA 4W9ZA 1PY0A 2IDSA 1NZRA 4HALA 2VM4A 4Q89A 1SHXA 3NJMA 4DP0X 1KCWA 2TSAA 1ADWA 3CVBA 5B3SB 2DWSA 1CUOA 5I6KA 3CDZB 3L45A 4DP2X 1SDDA 2W8CA 1AIZA 2DY2A 3IEAA 1SHWA 4ENZA 4A66A 5I26A 2FTAA 3QJRB 3JTBA 1OCCB 2YQBA 2YARA 3PAZA 1WA2X 3S3DB 4E9YA 3X2QB 4JKNA 1XMEB 3HEIB 4BWUA 5B1JC 4E9WA 3NJGA 1UATA 5B7FA 3QJTB 2ZOOA 2IWFA 1GS8A 5PCYA 2WSDA 5I5MA 1XB3A 1M9WA 5TK4A 3TU6A 3NJLA 3V9CA 4GYBA 2H47C 2AZAA 1GS6X 2GI0A 5ANHA 1QHQA 4YSEA 1OF0A 2XXGA 4KOCA 5IY5B 2E86A 4DP7X 2UXFA 1AZCA 3S8GB 1RCYA 1AR1B 2XV2A 1DYZA 1AS7A 1J5DA 2HRHA 1W8EA 3BVDB 1OE2A 1PMYA 1ASOA 1JXGA 2TSBA 1E5YA 4AZUA 2QDVA 2CCWA 2FT6A 4TXVB 3NP3A 1L9OA 2PP8A 1HAWA 1KDIA 3GDCA 1OCZB 5D4IA 3UABA 1TU2A 1SDDB 3PPSA 2QT6A 1CC3A 3EH3B 2FQDA 3ABKB 2FT8A 4KO5A 1XB6A 1TKWA 4P5SA 4G7SB 3NJFA 3KW7A 3FT0A 5B1BB 2PPDA 1AS8A 3X1BA 1NINA 4YVNA 2JKWA 3OMAB 3GYRA 1TEFA 1A65A 4E9XA 1L9RA 2Q5BA 3TASA 1ILSA 1I53A 2FQGA 3WI9A 1KV7A 2HX7A 4QLWA 4A68A 5A7EA 3AZUA 3FSAA 1ASQA 4UF7C 1BEXA 3FQ1A 2PPCA 4DPBX 1SNRA 2HXAA 2R7EB 1ETJA 4W1TA 4YSOA 4NB7A 1KGYE 1JZIA 2BP0B 1KDJA 2EIKB 2AANA 1ZV2A 1GYCA 2VMJA 4PAZA 2I7OA 1L9PA 3SQRA 5I5IA 2P80D 1A4AA 4A2DA 4E9RA 3NJKA 4G7QB 1ZPUA 2X87A 4N8UA 1E65A 2VSMB 3IBOA 3CZUB 2YAEA 3NSFA 1TEGA 2W88A 1W6WA 3GXUB 2DV6A 1NIAA 2JXMA 3OMIB 4Q8BA 3TA4D 4EF3A 3H4FA 1JZJA 4HIPA 4AX3A 3PLYA 4BXVA 3SBPA 3CG8A 3NJJA 1L9QA 3QJSB 4KO7A 3TBBA 4BK5C 4YSDA 2BHFA 1ILUA 2MRYA 2DWTA 2VW6A 1N68A 5B7MA 1SF5A 1L9TA 5PAZA 1AZUA 6PAZA 4HHWA 1L9SA 2HLEB 3QQXA 4QKTA 1IBZA 2OCCB 2YAOA 1F56A 2XWZA 4DP9X 1NPNA 1BYOA 2IDUA 4BWWA 1QLEB 2PP7A 8PAZA 4A2FA 3PAVA 1A3ZA 1OV8A 1YLBB 3X1GA 2XVBA 2YAFA 1ET5A 1ID2A 3C75A 1BXVA 3N55A 3PCYA 4KNSA 1NDTA 2YXVA 2XX0A 4DPAX 1BQRA 2XYBA 4N4YB 4E9SA 1EHKB 4F2EA 4ZK8A 5D4HA 2UX6A 2PCFA 4HCFA 1FA4A 1ET8A 4KNUA 4KNTA 2PLTA 2IH9A 2PPAA 2OJ1A 3FPYA 2QDWA 5AZUA 1AOZA 1ET7A 3T6ZA 1NWPA 3QJQB 1EZLA 2AZUA 3ZDWA 4HCGA 1OCOB 5B7EA 1KCBA 1WA1X 1JZEA 3TBCA 2P80A 1BYPA 2IAAC 2HX8A 1V55B 4WKXA 2GC7C 4F7KA 2BP8B 4CSPA 5B1KA 1JVOA 3IE9A 1PCSA 1J9QA 4DPCX 4FA7B 1JZGA 1PLBA 3EH4B 1M56B 2XU9A 1AZNA 3DTUB 4AI7A 3FYIB 4YSAA 2FJSA 3QJUB 4HCIA 1GR7A 1BXUA 1ZDSA 4RH4A 3KW8A 2BZ7A 1OCRB 4GP5B 4YSCA 2CJ3A 1SF3A 1NIBA 1FFTB 1VLXA 4G72B 3N2JA 1MZZA 3AG3B 4MFHA 2PP9A 2FQFA 3FSVA 4YVUA 1OE3A 2A3TA 1NIFA 2UXGA 1ZDQA 5I6OA 4E9TA 4NAJA 3FSWA 4JHUA 4JHVA 1GY1A 3WNIA 4NERA 5EHFA 1A4CA 1NIDA 1FWXA 2DYSB 2J56A 2WO3B 3FYEB 2GC4C 2VSKB 3S3BB 3WIAA 1B3IA 1WS7A 1CYWA 2ZWNA 1OE1A 5B1JA 4DP4X 3CVCA 3FU8A 4GP8B 1WS8A 4A2EA 4M3HA 1RKRA 2Q9OA 2B3IA 3UAAA 1J9SA 1XB8A 2CBPA 1X9RA 2EIMB 4WTQA 4BXSV 3NSDA 3AY2A 1PLCA 3SBRA 3S8FB 3AG1B 1X9UA 3JT2A 2BP8A 3BQVA 4HAKA 3MBWB 2IWKA 4KO9A 4DP6X 3H56A 1KBWA 1A8ZA 1J9RA 2BWDA 3IN0A 3FS9A 2FNWA 3FU7B 1W6LA 1E67A 4CSZA 2H5UA 3X1EA 1IUZA 1SFDA 4G70B 1NICA 3IN2A 2XUWA 2QPEB 4YSSA 3FU7A 2UXVA 3FQ2A 2XV3A 1M57B 2GHZA 1GSKA 3NSCA 3ZIYA 3HB3B 3ASOB 5F7BA 3NT0A 3FSZA 2PPEA 2J55A
chains in the Genus database with same CATH superfamily
3ML9A 1FGNH 1U8CA 1AZRA 1WQVT 4JLRB 3K5RA 3AG4B 3Q44A 3ZYOA 4DOHB 2DQJH 1QMUA 4WSJA 1FVDA 1GW0A 3BLPX 3ABGA 2DF3A 4I1PA 5GRUH 5IJVA 3EDKA 4NBXB 3QUMA 4NKOB 5FGBA 5KVDE 1CT8B 1HKLL 3ABZA 4MQTB 1OM3L 2IDQA 3BO8B 4RRPM 4R7NA 5FYLD 1ORQA 3HPLA 2OX5A 3BW9A 3QNZB 5I6PA 2WBJC 4L4TE 3T6VA 3ECWA 3WE6B 1YYCA 5INCA 3B2XA 2YSSB 1IGJB 1THCA 5C1MB 4U1SA 5D7SL 4CC1A 4G71B 3NSYA 2R83A 1TQWA 4JPIB 4R8WH 1JZHA 4PJXF 4LGRB 5L8JB 1TSHA 5A7BA 1R3IL 2Z65C 2C7UB 4F9LC 3ARBC 2FB4L 2FJHA 1M7XA 4UQ2B 5J12B 4U1LB 1KBBA 5D7JA 1A1OA 4UIKL 1DFBH 1AANA 2VIRB 3FO1A 3T3ME 2GEEA 2DLTA 3GTVA 2DQIL 1MELA 3D25B 4MD0A 1NEPA 4L37B 1I7RB 4TUKL 1G9NH 4A6YL 1UXWB 2DQGL 3OLDA 1WV7T 2VB5A 4TUOA 3TH2T 4KQ0A 2UXTA 5L0QC 4JN2B 1CL7H 1BVLB 2XX1A 3SKUD 1S8DB 5BJTA 3B2UD 2HTLC 5SWQB 3D7PA 4ABQA 2PABA 3OKOB 4HCRL 3LH8A 3MJGX 4AKOA 4NN5B 5E1AA 3B7YA 1FO0H 4B9ZA 1HQ4A 1A02N 4XMPL 5H2BB 3WL9A 4AEFA 2CO6B 4HBCL 4F7PA 3NRFA 1F42A 1TTCA 3WTXA 3STZA 3G6AB 5HI3D 5J6HB 3P0VL 1V7MH 2CR3A 5HYJE 1PZBA 5E2VL 3ZHKA 4N2CA 1DEEB 4MA1B 3BRDA 4HXAL 4WNQB 2FX9H 1QFUL 3QAQA 1EO7A 1KJ2B 4Q9QH 3HG5A 4JMXA 2ZOTA 3MQIA 3QPKA 3VYNA 1CICA 2N0MA 5DJ0B 3PUCA 1ZTMA 1SDAB 5FEBA 2EE0A 3UZQA 4EI5B 3E8UL 3R06A 4RFOH 1MQ8A 4YPJA 5GJTH 1LEKA 4AY0A 1F3JA 1JK8B 1PJ9A 4ZTEA 1JHTA 5KN5B 2OXGA 1BZ9A 5HDBB 3ABLB 1O7DE 4LARL 1KTBA 1RU9L 1MFAH 3A6BH 1ZLVH 5KSVB 4YHNB 2X1QA 2BSSB 3KPSB 2I9TB 3GMQA 1BVLA 1SQ2N 4GO6B 4M1CD 2J5WA 3BQUB 2P45B 2AEQH 2D7MA 5EU3B 5B22A 1RJYA 4JQIA 3N40P 4AIEA 2J6EA 4MZ2A 4J2QA 4OVVA 5IESL 4DZ8A 2DZEA 2VUYA 5L4FA 1TJHH 3GPEA 3JVFC 5C0JA 4CILA 1OGSA 2PO6B 2E7DA 5B38G 1MJUL 4OGYH 2G9HB 1ZHKB 4JRLA 3KJ6H 1T0NB 5HYJA 2ITDA 1RZ8B 3CU7A 2BVYA 4HEME 3FQNB 2L7UA 2R0ZL 2YLKA 1J48A 2AXWA 1USZA 3DK2A 1LM8V 2XWCA 3B8YA 3EYFB 1YSOA 5A2IH 2J44A 3N9GL 3NCFB 2XQYK 4HC1A 2BO0A 4WK4B 4R8WL 3ULUL 1IAIM 5KG9B 1A3RH 4ZXBD 1EJFA 2HX9A 3KE0A 5CLZA 1XF4A 1G7PB 1SLXA 2J4WL 1IBDA 2EUXA 1IKNC 4JO4H 3TXAA 5HYSG 2CM5A 2P5WE 4M7KL 3OV6A 3WY2A 1HVXA 1NTDA 2VXVL 4ELMB 1O5DT 1TQVA 4PJ5E 5TPWH 3FL7A 3QH3B 5AWNH 1G7MB 2VITB 5HD8D 1JPEA 3V4PA 3WNLA 3HTLX 4AWJC 1H3PH 2IH1B 3H55A 3L2MA 4K94H 4C47A 4ANXA 3ZDXB 2DWSA 3F8UB 5INDA 2Y07H 3PU7A 1D5ZA 5C6TL 2GEQA 1J8HD 4IGBC 4XPTH 5K69A 5C0RH 1H5BC 3UTTA 4HJJH 1KWKA 3ARZA 4PJHB 1YY8A 3KJ4B 5CGMA 2Z35B 2D7OA 5EH1A 4YX2L 1MFEH 3S35X 2YWYA 1KB5L 3GO1L 1BFVH 3HEIB 2Z4QA 3FT2B 4EPSA 3WEBA 5B7FA 5DMKB 2GSIA 3AFLA 5KYYA 3L5WA 3QBTB 4KVNH 4J3OF 4JO5A 3OKMA 1DJHA 2XNAB 1Q90A 5F0LB 3KBPA 3BRFA 2C1OA 2ZUVA 1XB3A 3VWJA 3EBIA 5I15L 1I9IL 3BWUC 5LO7A 4HXBL 2AZAA 1AI1L 2ADIB 5ANHA 1QHQA 2IVFC 4ODXA 5AVRB 4JKPL 4L4TA 1N59A 2AABL 2WQVA 3VFWA 4A7VA 3BRGC 4FTVD 5ICZA 1A25A 2CK2A 5TDNB 2EDQA 4EN2A 1L5GB 5IFJA 1HNYA 1THAA 1TQCB 4UYQA 2Y5EA 3ZHNA 4A55A 1G94A 3D2UB 3QORB 2HT4C 2X4TA 1DLFL 1OGTB 1HAWA 4S1SL 1C5DA 4ZDHB 4WEBH 1KDIA 3ZZLA 1T2QH 4FXGB 1SN5A 4ZMXA 5JW3H 3ZVVA 5LXVA 2JKIS 3GI9H 4GMTL 4PTUA 1GYUA 4PWHA 1CS6A 1JHTB 2XPZA 2NY0B 1F3JB 5KN5A 2JH2A 3FOLB 4GKSB 4JFQA 3WEXB 4M9OA 4HPYL 2G2PA 3GB7A 4DN3H 4F8QA 4RCAA 1RZ7H 3D48R 1CFNB 2Y7SA 1GL4B 2CBTA 5B1BB 1I3RB 5DVNA 2YUWA 5EEZA 3FCTA 5FUOH 3UGUA 3UJIH 3ILQD 1C8PA 3ZRCC 2FEEI 1E4WL 1ADQH 2WY3B 2X2JA 4NCC2 2XN2A 1G9MC 1B0RB 3UTSB 4UV4H 2WZ0A 4KKBD 3RA7L 1TENA 1A7QL 4PG9B 4F57L 1YN7B 2BVPA 3DSNA 3ZQXA 5MEPB 3LNGA 5KZCD 1ICTA 1JFQL 2XIBA 3DMMD 3GI8H 1ZS8B 3QUZA 2VDRH 3MR9B 5I1DB 1DTUA 1IGFH 4PSRA 1AQKH 1KTDB 2AANA 4XPGL 1V7NH 4N5ED 3IF1A 4AL8H 2GIXA 2GT9B 3L7FA 2P80D 4MJHA 4S2SA 1I1RA 1K5NB 3CDFA 2XY2A 4X9GA 2VDLB 3SCMB 1URZA 2EYTB 2JLLA 3A4FA 1J8HE 2C9SA 3PDGA 4LESA 4Z95L 5LXGL 5CCGE 3QISA 3K6FA 3IBOA 3NIFE 5H35A 3SE8L 2VL4A 4PRID 1TEGA 3TH4T 3VXTA 3IMVA 3B9AA 4LHUA 1LE9B 2FX7H 4AL8C 1I7RA 1DVFC 1P84J 4HS8L 3EH2A 2P24B 1RL1A 4EKXA 3T8VA 5GISH 3VSVA 1DQML 5CD5D 1YPZB 2XPGA 2GAZA 2CR6A 3SBPA 3BI9X 3NJJA 1L9QA 2W0FA 3HNVL 5T1LB 3UFIA 1OP5K 2KL6A 3MA7A 1ZLWH 3I9PA 2OMWB 3CE1A 2DWTA 4FNTA 4JFXA 4PP1C 3UMTA 1A0QL 5D7JB 3S8WA 1SF5A 1KTLB 5JOFB 3QQNA 3C5SB 3MUGA 4ZPVB 1HHHA 4OCSH 4XTRD 3UCRA 1IBZA 2H45A 2YAOA 3P3YA 1F56A 4I0CC 5FLVA 1KB5B 4FMKA 1I1AD 1BFVL 4WCYL 1LHZA 2NSMA 3PAVA 1NMCC 4EMZA 5GJSL 4RGNC 3ZHFA 2VC2L 1N5YH 4JHBA 5K59E 1FFQA 4E41E 5A2JH 5KS9E 1YO4A 5KVGE 1IIKA 2X3AA 3SDCD 5I75B 2XYBA 1B0WA 2J73A 2V8MA 1BGXL 2AI0L 4U33A 2R4SH 2O93L 3QUMB 4LOVA 4N26A 4X8GA 5AYUH 5AKVA 4ZFZB 4AEIL 3MROB 1QRKA 3D87B 4GAYB 2XSKA 2O5NA 3U7YL 3OHMB 2WKGA 2XTLA 1BVZA 2F9BT 3MV8E 3KYOB 1UZ6F 1UZ6E 2GTQA 3G5ZB 3L4VA 5MP6L 1TCRA 4NNYA 2WIIB 4I77H 4P8QA 1CVSC 1HU8A 2X0UA 3WXVL 3ECVA 4PVNA 4CSPA 4XVUD 2WSPA 4XVSH 5EO9A 5CP3H 4FTVE 5CCKH 1TLKA 1PCSA 4RFOL 4YPGA 1JZGA 4M6OH 1UD8A 1MPAL 4YSAA 4OM1H 4YHZL 4JFOA 4YR6A 3RZCD 3LS5L 4PCTA 4WO4D 1A5FL 1U91B 4G9FA 4B60A 4W9LC 4YNYB 5D2LB 2P5WB 4B97A 2AK4B 3BJ91 1H19A 1RULH 3TYFA 1N5AB 5IVZA 3T4AA 1D5IL 4FC3E 3N2JA 5E1IA 3UBXI 3VWJD 3L5JA 4X7SL 3TFKD 4NRZA 4MJ4A 4ICXA 3I02A 4Y2OA 1I1AC 2QADB 4G83A 2F7RA 5JW4M 4GUOA 2XG4A 3RVXC 5F88B 1XAUA 4MXVE 2KS0A 3K5SA 3LB6D 3VFGL 3ULUF 5I0DA 2JELL 3HE7B 3HUJE 4UIMA 3K71A 1HH9B 2H3NA 4BCZA 4ZFFB 5FO9B 3BGAA 4QRUA 2AITA 4NFCA 2NOYA 5JOFA 5L4IA 3U30C 4PGZA 2C5DC 1N3NB 2AP2A 3BUBA 4PGDB 4WU7B 4YHKL 4GQ9L 4W4NA 2RAMA 2GAZB 4DW2L 1H5BB 1L7TL 4NAQA 3BPLB 4FCHA 4KK9D 1KV3A 4P04A 4ZO8A 5JHDE 4N0FA 5KWYC 3N41B 1DBMH 4NQCA 3AY2A 1XR9A 4GXUM 1KTKE 4TQHA 4KNQA 1IMHC 1S3KH 5E6YA 4N0YH 5DJDA 1A21A 4OTXH 4HK0B 2X4SB 2BP3A 1L6ZA 1Q0YL 1JUFA 3MJ9H 4XVUC 5IGXH 2WPGA 1AKJB 1N7ML 5ESAA 2C9VA 2DYPA 4MSWB 3ARBB 4N25A 1ZKAA 4M56A 3QULB 5IHUH 5HGHA 1UT1A 5IVXA 2VR7A 5DEFA 4TNEA 1DBKL 2BOCB 2K9FB 2CWRA 1LK2B 3FSZA 1YEGL 4J27A 1GZHA 1HL5A 4X7CC 2UWEA 4YC2C 5SWSB 1KCRH 3D2UD 3TA3A 4RLDA 4I0PB 4I2XE 4XE5B 1BWWA 1GOFA 4X50A 3V0JA 4PJDF 2VDNH 4FQ1L 3VFMB 2JI1A 2O5YL 1RH8A 5IBUB 2WUCL 1K8DB 2KDYA 1ID5I 1MVYA 1OM3H 3ZU8A 3CFCL 2MTAA 4U1GC 3GK8L 3QIWA 4F8LA 3ASNB 3QDJA 3S3CB 1U8LB 4OV6F 5ITFA 2HH0H 1X6LA 4JL2A 3U46A 1S5IL 2X4QB 3EJCA 1OGAA 3LDBC 3F62A 3CZNA 1XXFC 3SDXE 3ZL4H 4IMKA 4MAUL 4APXB 3WYRA 1QSFD 2QV4A 3C08L 5ID1B 4EE2A 3ZQ9A 3VWKC 2AS5M 3ULUE 4AT6A 2XZAL 1CPUA 4UDUB 5F9DC 3UH8A 1MW2A 2X88A 4NWTL 4GFTB 4PJBA 1LTXA 5CD5C 3TYFB 4M61A 1M42A 1HJCA 1UEYA 5CXPA 4A7UA 4I48B 1PD1A 1BF5A 4HUUB 3MBEA 3AXHA 3EGXA 3NIFB 2PYFA 4MZIA 1LDPL 2YC1A 3TO4D 4ATTA 1JZFA 5KJ4A 3SDDB 5GGVY 2QHRH 4LE8A 3REWA 4CRPA 5IT2H 3Q05A 1IO4C 2WP3T 4HS3A 1B9KA 1NCJA 1Z1WA 3HCVA 4UV7L 4ZQKA 5ADOL 3CZFB 4B5EA 3WBDA 5I74B 5J1TC 3NH7H 4HFWA 4NQQA 1HI6B 2R2CA 1Y7VA 3FTGB 2WBJB 4QNPF 3G5ZA 3RKDC 4MNQA 4NQSA 1AKPA 4XO9A 1F4XL 5FYJL 3O3BA 2JKXA 4L3EB 1DJYA 2C3VB 2IWEA 1CO1A 4OF0A 1WZ1H 2NUPA 1ZCRA 4GAYA 3QP3A 3GBEA 5CGYC 2OBGA 4CJ1A 2IADB 1QPPA 3FUHA 4HZAA 4W4OA 1AS6A 1CLOH 3SYQA 5EZIH 1VACA 3QXUA 4W93A 1P1VA 4X7EC 4D7PA 2E27L 2CE6A 2MEJB 5T5FH 1YEDA 3V9FA 4ES9A 2F54B 4FHJA 4AZ8B 2NX5D 5GS2D 2EC9U 4YJZL 2XWBB 1PAZA 4TL5A 3UADA 4OZIA 4WUKL 2CRMA 1DVFA 5FGRA 1XCXA 3DYMA 3GSNA 4TSBH 3IGLA 1BQ5A 4O58L 1PX3A 1KB3A 4YGVA 1TYEB 3DJSA 3QDHA 4GRMB 3LKOB 3DX7B 5T1LD 3O6FA 3I3BA 4AENB 2CK0L 4ADJA 1QUNB 2O61B 1MFDH 2CRYA 3R8BB 4GW4A 5SX5H 4QRFA 2EH8H 1J7VR 3ZKMC 2K9UA 4BFGA 2PPFA 1E43A 3MGOA 2JKRM 4WUUB 1V05A 3D0VA 1MWAB 3MCYA 4UDTB 3KG5A 4ZNEA 4ZX3A 1YEJL 4K94C 4I2XA 1RZGB 2X0VA 3I9AA 1WA0X 1IKNA 4A2LA 1QQDB 2X6MA 5JIKA 2IDFA 4D7BA 5CJOL 1N10A 3BVVA 4PD4J 4F15B 2YEQA 3GUFA 2QQKL 3CHOA 2YMXL 2JJUA 3ZBMA 3TWYA 1NL0L 2HG5B 5DD0L 3MJ8B 2G3NA 3DMMB 4YO0A 2NXYD 4WGWB 3GKWH 4PJXB 2Z31A 4NRXA 4OI7A 4WNSA 1U3HA 1WPCA 4TLSA 1JYVA 3HBQA 4ZAKC 4LQ1A 1HTYA 1UQSA 1KBVA 1RD6A 2KZKA 5FKPA 2OZ4H 5D1XC 2OI9B 3AC0A 2DTSA 3FHEA 3UZQB 4B53A 2WO4A 2YQ2A 3WNMA 2G5RA 1RZFH 4H8HA 2AJSH 2SEBA 2K8MA 3ARGA 2YAHA 3ECBA 5GS2H 3F7PC 4X6DE 2JQAA 2Z92B 2V37A 1AZVA 2H32B 1FZOB 3C5ZB 3L3OB 4JFDA 4KOBA 4QXTA 2B16A 4ADIA 1XH0A 1HAUA 1RJCA 1T22B 4M62L 1YQVH 4XBEH 1PY0A 2AV7B 2JE8A 3PYCA 4HJJL 4XVJL 4E42A 3BP4B 2D0GA 1LEIA 3MRBA 3TJEL 3COOA 5JHDB 2XRAH 4WEMB 3GB7B 3TA3D 4EOWH 2F53D 3D9AH 4G8GD 3VE0A 1YC7A 1TDQA 1G7JA 4QRSB 1E5AA 3QORD 2HMID 3NMEA 4M29A 2OULB 5CCHE 2CHNA 4APQD 5AD0A 2Q86A 5I17B 3UO8B 4R7XA 5T1JA 3OPZH 3IMRA 4R84A 4EQ2A 3BCFA 4K71C 3LRHA 4G3YL 5DRXB 5I26A 4Z3IA 5FB8B 1GOGA 3DMMA 3HG0A 3BYTA 4AQEA 2F19L 3V52L 4QO1A 3BWAB 1UZ8B 5CP3A 4E9WA 1GPOL 2XA8H 3N3EA 1IGIH 2WBWB 1U4FA 4UM9A 5E6SB 2X3CA 2CH8A 4HFUL 1G7IA 3T3MF 3DX6A 1MHHA 1YEHL 3KWWB 3VFWB 2DIJA 3HG1A 3D25A 3IE4A 2GI0A 3DC0A 3FRUB 4XX1E 5DGRA 4B5ZA 3GSNH 4F58L 1RQ5A 5IY5B 1MJJB 2UXFA 4PWIA 4PWKA 1BCIA 3DTXA 5BZWB 2C1OB 3TVMB 2GQHA 4JJOA 3WXWL 3C6LA 4K3EH 4JRYA 1T83C 2OR8A 3US1A 3F58H 5FGCB 1CFSA 2N56A 2XFXA 4JFDE 3HZMB 4NM4L 1QRNA 4M8RA 1QX1A 1F45A 2AMGA 3W11C 3NP3A 5IBLC 4MMZA 1Q9WB 3QIUA 1H3PL 5EEUA 5EZOH 1Q0XL 4X7TB 3DX0A 1JRHL 4GXVL 4HGWA 4LKCA 4XOCA 1S9VB 5T1DL 4N20A 3NABH 2ZP8A 2ZX6A 3FTWA 2XDHA 5CZXD 1JGUH 3ABKB 1HH6B 3MLRH 5C0AA 2HVKB 3B56A 2WZAA 3NG5A 3BW9B 3QNZA 4PWFA 2ATPA 3NGBB 2HP4A 5I8EB 4D0CA 3JWOC 5KBDA 2FEJA 4DVRH 5HD8C 2NQCA 4ZS7H 1G0XA 1AHWB 3MRLB 1KGWA 3BP7B 3RUGF 4BSWB 2VLKD 2VUOA 2YQ3A 3WUWA 4X6DF 1F1GA 3B9KB 4R5TA 3QXAB 3MRFA 2CDGB 1AVAA 5DK3A 3BGMB 4PBXA 4PJ6A 5CIPA 2BP0B 2QQKH 4G6KL 1A9BB 3UJTH 5I18L 4KKAC 3IJHA 5C09B 4RWYH 5AYTA 4D8OA 5HHQA 3V5KA 5L7XH 1AO7A 1UXSB 1P84K 1NM4A 3N50A 3O6FC 2J5LC 3HE6A 1BFSA 4MYPA 4TULH 2NYYD 1MAKA 2W38A 4OD3H 5MI0C 3PHAA 3VFRA 2BJML 1HXYA 1SN0A 3QDGE 4Z8FH 1CXEA 4J8RA 2R8SH 1NAKL 1JV2B 2YS4A 1HSBA 2WNXA 3PHSA 4BXVA 3CG8A 1VGKA 2A77L 3VTAA 2V17L 4E41B 2G2NA 3HPJA 2MOGA 4HWUA 4QI3A 3FBQA 4EZLA 1IBBA 2B5IC 5C0CD 2LLGA 1XSKA 4YFLI 4XHQA 1UB6B 3R0NA 5IZ7A 4UYPA 2NNFA 4G80B 3QWRD 5GSRB 4GBXD 3S48A 3CN4A 5D70L 1AY1H 3WEMA 1I3VA 4EUPH 1W16A 3D0AA 2FJFA 3AWGA 4ZTOH 1FZOA 1KELH 3L3OA 4QXTB 1MRFH 4YXLL 3O3EB 1QLFB 3WU1A 3H9SB 4GT7A 2YAFA 3C75A 4K8RL 3RTQB 3N55A 4JO3H 3AJ7A 5HGAB 4OCYH 4I0PA 1W9XA 3IU4L 1WZ1L 1QFWI 1C12B 1QOKA 1VEMA 3G6DH 3MNZA 4F92B 1PX8A 3T5WA 4AGMA 3O3BB 4JHZA 3QG6B 1M05A 4XNYH 5H2BA 1DSFL 5IB5B 3R4RA 3PP3H 4JRYE 5I1IL 2XQYG 4JR9L 1NC2B 3QZLA 4RAVB 3K2UL 2BNQB 3H3KA 1ZY9A 3TN0B 1VADA 4AJ0A 3SEPA 1DBBH 4O2FA 2Q7AA 4M3KB 1NWPA 2NY5H 5ISZB 3D9AL 5G4OA 2E7BA 4LCWB 3DXAD 5I0VA 2FLMA 2KI6A 3MV7A 1R17A 4TNVK 3GRBA 4QXUL 2FB4H 3TZVD 4YE4H 4FA7B 1R3IH 4Z7NE 2NXYB 2BIPA 1PLBA 2QFRA 4BGDA 4QXGH 4D9RE 3MTRA 2FJSA 1K4DB 2BNRD 1OPGH 4HCIA 3HZKA 4JG1L 2GJ6E 3ZL4L 2CLVB 4YSCA 1U8KB 1D7CA 4GW4B 2H4EA 4ZX5A 2FX8H 4JFVA 2ZG1A 3B7TA 5MEOB 1Y07A 3CPLB 3NCYS 4HEPA 1KY6A 1KZQA 3RWJA 1F11A 2A6KA 2ALWA 3S9DB 3QUXD 3U79A 1A64A 1NGZA 2UXGA 1U8OA 3LRLA 4LVNC 4U1SB 3WS6C 5GS1B 4PRDB 5DRNB 2XKSA 4I9WE 1RSFA 4XN1A 4PJAB 4GAFB 3ZK0A 1SEQL 2K4AA 4KDTA 4DAGL 1PW3A 3NBNA 3PNWB 1DFXA 3LSOA 3V5HA 3UG3A 3II1A 5C7XH 1F97A 4MMZC 4BYHA 3BXNA 4Y0GA 4P2QB 3EGSB 1YEGH 4X8JA 4FQIL 5BRQA 1BD2A 3KLKA 3Q0HA 4Z78B 4QJ5B 1DHKA 2ROXA 4QHUB 5EOQL 5IVXB 4NO5A 1LP9F 3CVIH 2DM4A 1RUQL 4HXAH 2WBJA 3ARED 3NZSA 1I8UA 4HP5A 2W07B 3IT8D 1QTYT 1UG9A 1FH5L 3DX3A 3FS9A 4HPHA 1GXEA 4OF7A 4KMTL 2PKDA 2B5IB 4U3CA 1OD9A 4HBCH 1SFDA 1H8OA 2I32A 5L2KA 3BVTA 3E7JA 3SQOL 2I07B 3RX5A 1R34A 4L5FE 3I2CL 5AG9A 2JNZA 3BVNA 1NC4B 3B83A 3EOBA 1U3NA 3QQDA 4H88H 2W0LA 3ZDXF 4AQAA 1TQUA 2MHAA 2QSQA 2YPLA 4KX8A 2K3HA 4L05A 5IMLA 2J8UB 1TCMA 2VQ1B 2GJRA 2HJLA 3MC0A 4YFLF 1F6LL 4KK8D 2BW4A 2KC0A 5DQJB 3LH2H 3CN0A 1ZIBA 3ZDZB 1IEAB 1QYGL 5AYQA 3DROA 1MLBA 2HFTA 4BUQA 2V9TA 2HRPL 2ED9A 3B5HA 3KMDA 5LGJA 4XNUH 1KYUA 4FCAA 1MJ7L 2JF1A 2I85A 3TCTA 4IBUA 4FP8H 2IGLA 1CDHA 1WAPA 4ODHH 2ZCHH 2BWIA 4V2CB 3L17A 1JWUB 3F05A 1MW3A 2YD8A 4G11A 4KRMB 1XCQB 4HWBA 4BH8A 1QSVA 4W68A 5GGQH 4BSVB 3X17A 5K5YA 3PWUB 4CGTA 5HHMD 1AE6L 1U93B 4LNRB 5DMIL 4IDJL 4HISA 4JFOB 4L0PB 4HIIB 4NO0B 4YR6B 3CSFA 4OZ4A 4C56B 3WHE0 1A1NB 3LZFH 2N3JA 1OTUC 5EBMA 5ACZA 1H6FA 1R6VA 3CDGB 3OZLA 2AFNA 2Y6TE 5J11B 4YBHA 3W5NA 3M45A 4DNLA 4K15A 4FL4B 1YJDC 3HB3C 3L95A 3HLAA 3US0A 2WAQA 4ZAKD 1R9FA 2X10A 3V8CA 3DKHA 3KYOA 1BAWA 3FQRA 1ZWIA 3QUHA 4I0PD 5CBEB 3OKNB 1KYFA 5A3IC 2QVKA 2NY3B 1XGRA 4J3BA 1P6FA 2HRGA 3GSQA 1SUJA 3T4YA 3UC2A 2ZAIA 2CO7A 1R0AL 4JM4L 2NY7L 1H9DA 1FSKB 1SJVA 1KYOK 2O6PA 5C86A 3MZTA 4IBTA 5E70A 3FFOA 2YPVA 1YEWA 4KTYA 1OTUD 5JLZB 4ECNA 1C16A 3ZKQD 1A7BA 3T71A 4BH8B 4WU7A 3OX8A 4H8UA 5DHYB 2B7DT 2BVOA 3MV8B 5JA8B 2Q3XA 2Y1AA 2O30A 5LHDA 3UP1A 4YHPB 3TBVA 4FXLA 1KOAA 2FBRA 2YMOA 2B1AL 3G5WA 4O51B 3ROOB 5HDRA 3QJVB 4KQ4H 5D2LE 4LCUB 5F70A 1XBDA 1K72A 4FKEA 1EJOL 4OR1A 3VYOA 4YDLB 2VR4A 4O58H 5MEOA 3NJIA 3BVWA 4LGSB 1QKZH 5DSCA 4U7KA 3S37X 3NCBB 3RWCB 3DROB 3VWJC 3I02B 2PN5A 1YEEH 3BAWA 4CL7A 1WJ3A 3ERXA 5HHVH 2DH2A 2DWEA 2YD2A 3SODB 1YPZA 3U2SB 2IH3A 2M2DA 5FW8A 1AAJA 3EG9A 2NY6D 4YSQA 1DBML 2AK4A 4K7PH 1H3TA 4PJDB 3C6SA 3VG0L 2B2XH 4PVBA 4S1DD 1MCFA 5EV7A 1RP9A 6CGTA 3CH8A 3KL5A 1KCKA 1ZPLA 3O3UN 3Q43A 1G87A 1UZGA 5EEXA 3L3OC 2L0DA 3D4YA 3UBXG 4UQ3A 4OJCA 4H8WC 1K5NA 1Y6MR 3HUJB 5ECGA 1NJ9B 2Z4TA 4G7YH 3QRLA 1OOWA 2DPKA 1KBKA 1GC1L 4PCYA 4KBPA 1RUML 3L3GB 5KJ7E 2I9LB 2GSIB 3RKDD 4AMWA 2A74C 4RMRA 5EWIH 3VFGH 3ISWA 2SODB 4WF7A 2EIJB 5JXAL 4F57H 3FQUA 3DOIA 3STLA 4YBQC 3G5YB 3E6FA 3LV3A 4PJGA 3ZO9A 1MCPL 5I71B 1JDAA 1UXLA 3BAJA 1J9CT 3KLAB 4BZ2A 4I3GA 3K6IA 4DP8X 1ZJBA 2C3GA 3LZPA 4LCCB 1QBLL 1FYTE 4APQB 1FFNA 3MX0B 3FCTB 1B6DA 5LBGA 3VX0A 9PCYA 2UYLA 5ADPH 4KVCH 3O6ML 3PNWA 1CFNA 1A6AB 2ZG2A 4GO9A 1HS6A 2DLEA 3QHTC 4LLMB 2R0LH 2OL3B 2B1HL 4PRHE 3EJSA 4KKCC 1NBZB 4LASH 4QRRE 1JV5B 2ZUWA 3UBXB 3QEGH 2AV1B 1GH7A 3FRPA 4PY8I 5JDJA 3V7AG 4MJJA 1E27A 2DL2A 1JV2A 3ARWA 4WK2B 1XWVA 3T4AC 3S97C 3SDCB 3SDAC 2P5ED 5HY9B 4KXCA 5I6KA 2UZYB 1KNOA 3IDNA 5AOLA 1HXYB 2OMWA 1AXSB 3MA7B 4TVSa 2Y7QA 3OMZA 4PY7A 3T0EB 4MBRA 4W9FC 1BVNT 5TE4H 1CE6B 4FYTA 5KYWB 3K2MC 4I9WD 1SHWA 2XTJB 3EJJX 3MRMB 2PO6D 5HVGB 1VFAB 1KTRL 3LXCA 4XPBL 1WA2X 1ZVNA 1YEKH 3WFEL 1N59B 3O11A 3PG2A 3O45B 5DMGC 2WOYA 2VXTL 1BVNP 4N2DA 3BAXA 3GUTA 4AM0A 3NJGA 3DGCR 3ORJA 1K2DA 3ME0A 2ITCA 3I9IA 5C0BE 2UUDK 4LCWA 4G6KH 4LLDB 5HYQA 1ZK9A 1BPLB 2XI9A 2XG5B 3C08H 4MB4A 4CMHC 4UTBA 1Y1DA 2OFQA 3BGMA 4NN6C 3L2LA 4NN6B 3GXDA 3ULVL 4JFEA 5FA4B 3NCEB 4G43A 3OKYA 5EU7C 4CN1A 2I9TA 2NDGA 4BUHA 2YD3A 2OMXA 2WINB 1L0QA 2FH6A 3LTVA 4O4YH 3QRBA 1QVOA 4RAVA 4XB7A 3ZMRA 2HAZA 1QSFA 1AZZC 1Z5LA 5EFIA 1OE2A 1GJUA 4BINA 3EGSA 4XO5A 2CCWA 1A22B 4YC2B 4Z7WF 4NDMA 5I74C 1YQ2A 1FJ1A 2HVKA 4MJIE 2BIIA 3HNSL 5IB1B 1DSFH 1NCGA 1UD2A 3WY4A 4HWEH 3F5WA 2FX7L 4PJAA 3VYPA 3A0OA 2QGDA 1XR8A 4LQFL 3DBXA 2VAAA 4RSVA 3I6LE 3HC0B 3C8KA 3O6MH 1ZTXL 1XSIA 5CJQH 3S4SG 2M26A 5CZVL 1Q9OB 2CIKB 4P4KA 5DRWA 1OSYA 1IAII 2ZOKB 4K7PL 4ALAL 4R7VA 4AVJA 2IFFL 2XIIA 4JJHA 4E9XA 5KJRH 5D96C 3VWKB 4AYFB 4HIEB 5I18H 3WN5B 4Y4FC 3KJ6L 5JDSB 3WFCL 5I1CH 4OKDA 5SV3A 4Z7WB 2G9HA 1S9XB 5J4MA 3UYRH 4OCLC 3EF7A 1NCBH 4HJSA 3SYOA 1L9NA 4JG0L 1MPAH 4ONOA 5CEXA 1CN4A 2EP6A 2EECA 2VDMB 4OM0L 2BSED 4GSDL 3ZE2E 1B88A 1EHAA 3OQ3B 1E3XA 5JDSA 4L2LA 3MLUL 1YHPA 3FAXA 2X41A 1I1AB 1AR2A 2VSMB 1S7WA 2BHUA 3NJXA 4PUBH 2OR9L 3V0VB 3VXRB 2QLVB 2QGEA 4LXFA 2NX5A 3UP6A 3ZQWA 1Q9OA 3VXPA 2WXHA 1LEIB 1LO3L 1Y6NR 3QJSB 4Y1AA 5HDBF 4Y5YA 4HMCA 1R24B 4H8VA 2LFEA 4KJWC 3O3DA 4B6ZA 1RZJH 5I8EA 1OWWA 3VH8B 2K7QA 2X6AA 1F02I 4KJWD 2V9UA 4RIRB 2VR8A 1B4RA 2OSYA 5ABAA 3A4DA 3RURA 2IXQB 4K7PY 4PI0A 1BYOA 3S35H 1UB6A 1QLEB 2ZWYA 4YDLC 4PMFA 4WCYH 1OT1A 4PV9B 4HKXA 4ZD3L 5KOMC 4QOKD 2GFBB 2H1PL 5B4MC 3SQBB 4WO4A 2E9JA 1MHPH 4LU5L 4L4VE 2FWUA 3MJ7A 3S6CA 2DW5A 4AC2A 1CL7L 2GFBA 4Y7MA 5F7DA 4K73A 5EUOB 4MCZB 1VAHA 2FO4B 3C6LB 2YMXH 4FQXA 4LLVA 5C0RL 2HUHA 3GJFA 4PP1D 1AOZA 2EZ0C 5GGVL 2R2HB 2ZWSA 3DWTA 4UNTA 3SGDI 4A63A 1ZV9A 3UTZB 2V3FA 3PV6B 1OCOB 5CFAA 1VFAA 2P80A 1R24A 1R3JB 2NY3C 5T3XD 4Y5YB 2AJSL 3BAIA 1FE8H 2YGOA 1DVFD 1XZWA 4Q4IA 3WO3B 1YNKH 5FECA 2X5PA 1F6FB 4WQOA 1S7TA 1H9VA 4QTHB 2LR4A 5D7JC 1FNAA 3LZFL 2BM3A 4U1LA 4P5MB 1Z9LA 4MNGE 4H1LB 1TG8A 1U95B 2JB6B 1K3IA 2D2CC 2B1OA 3LKOA 5GGTL 4BSWA 3ULUH 2X6BA 2ZWZA 3F84A 3SO3C 5BO1H 1G7JB 4QRSA 1OCRB 3MRLA 1C5CL 1ECZA 2CJ3A 3MRGB 4DKTA 4N2BA 4Y4FA 1SXSA 2IXQA 3ZT7A 3QORC 1U3ZA 4HDIB 1NPUA 2UYLB 1KGIA 1HINL 2A73B 1QATA 2OX5B 3HVNA 4AE0A 3TEUA 5I6OA 4CNIB 1U3YA 3NA4A 3O0RH 3JZ7A 2TAAA 2P28B 4C4KT 1I8KB 3P9LA 3V4VA 3MRIB 4EVNB 2H2SC 4KHTL 4PLJD 5F7KC 4R4BA 3CVHA 2XWRA 4FX5A 3CN3A 4KJQD 2NUPB 3OJVC 4N2LA 2LE9A 4P9HL 4DEUA 5BV7C 3S36X 4B0MM 5IF0A 1W72A 2CJUH 4WK0B 5HTSA 5JIHA 5L8LB 5ICUA 2PWFA 3B7UX 2AK4D 5D5ME 4LCIL 2CBQA 3LZLA 1RAMA 2QLYA 2DQMA 4IMKC 2V2XB 4TRPH 1ORSB 5AB9A 2AJ3B 4CC0A 2Q3AA 5H37A 3F5WB 3REWB 1F86A 4PW9A 2GIYA 4MMXA 4HAKA 3ZTDC 1C8QA 3P9WB 3VFPA 4Y88A 3LMJL 1MHHB 1FZMA 3KWWA 5GGTA 4DKDC 5D7IF 3MLWH 2OYMA 5ESVB 1MQKH 2A5UA 1JHLL 2GUOB 1XSOA 1EEYA 5A6IA 1CLOL 2AEOA 3RJDA 3GLDA 1TVHA 3IU3B 4L48A 5FF6A 4MQXC 3E38A 4YSSA 2PYEE 3PWPA 4FMVA 3ZKXC 3MGOB 1QVOB 1P4BL 4NZRL 4XMUA 4F8NA 5KSAA 3GLAA 1GHFL 4TOYL 3BPCA 5DR5L 3Q6GH 1WAAF 3WS3A 3BSHA 3HIZA 3BE1H 4PS4H 1DJIA 2OXHB 4FXKC 3US9A 2APXA 2FO1A 2R15A 3PDOB 2HLAB 3SGDH 1W91A 3F7RA 3ALPA 3HC0A 3O41B 1U8LA 3G08A 2AV7A 3N1PC 2OMVB 1T7XA 2X44D 1SPDA 4IBZA 3CHXA 4F2FA 4FFWC 4MCYA 3PHOB 1SY6H 2BRRL 1FQ9C 4PHXA 3D30A 3P77B 3JTTB 4NBZB 4NPYB 1CE6A 2J25A 4PJ8C 4XAWL 4XVOA 1J8HA 4M03A 4RISH 3GJEB 4ZUVB 1UACH 4UT9A 4NO3A 4RGNB 1SVCP 1XEUA 3ILPA 3IVKB 1XX9C 2QGBA 4Z7UA 1IEBA 1PIFA 1EEUA 3NJVA 3TCLB 3VQ2C 3I9GL 3LN9A 3RVXD 4ZMOA 4NC0B 2ZYHA 4ICWA 1GAFH 2EH7H 4JS7A 3TFKC 1QSED 4AG4H 4S1QL 3N5AA 3OKLA 1N7MH 5KUMA 4UQIM 4XHJD 4XPAL 3WJJC 1KIPA 3WEAA 4R5VA 2IDCA 3MCLH 2MJWA 3WO4C 4LLYA 3MACL 1TYRA 5LWYH 3SCMD 4C56A 5I1KH 3MO1A 2W9EH 2VNCA 3D85B 2OJZL 4TYUA 5IREA 3LKQA 3EH5B 4OY9A 1IAKA 3KPQA 5DO2C 4Z18A 5JPNC 3I85A 4WENB 5E23A 5ANME 5EOCL 3TURA 2H2PC 4YL4A 3L1EA 3MNVB 5K9QG 3IDNB 4LKXB 4RX4A 1VCBC 3L3HB 4TSAH 4OCYL 4Q74A 2E9BA 4EUPG 5I66A 5GSVA 1G7LA 5IMOA 4YZFE 2G5UA 8FABB 2BW5A 1NJ9A 3B3BA 3NA9L 5T3XL 3KLQA 5HDLA 3F7QA 2Z93B 3UTSD 5HVHB 4O9HH 4QMEA 2OL3A 4QRRA 1OGAB 2WYTA 3U7WL 2V5TA 4I0KA 2H0FA 4L4VB 2YPKB 2ARJA 4N0UE 4PJ8D 5E56A 2GJ6B 4FJYA 3X3GH 3PGFL 1FFNB 4G6FD 4MAUH 1F6AB 3KXFD 5BVPL 2H9GA 2V6HA 5DC2A 3VD9A 4P07A 2IADA 3FH8A 1NUGA 4XBGA 4H20H 3LMJH 3RWIA 3NSJA 1TQBC 2ZXWB 4HAGA 5T1KD 1F18A 2XV6B 4W4OC 1JERA 2UWEB 4E9QA 2Y69B 2VJ8A 3D69B 2J8UF 3I6GA 1TVDA 3QWOA 4NFDA 4ZQTA 4J3OH 2CNZA 4DZBB 3N1MC 1A1MB 2WIIA 4N5EC 3ZDZF 3IMUA 3MLRL 4WEUD 4ISVB 4PS4L 5AZ2L 4UTCA 2Y7NA 2YBGA 3KPRB 2BXYA 4UT9L 1YYLH 3JBG7 4ZOBA 5DQ9B 3HMWL 4XWGL 3BH9A 2V2WA 3M8OL 5DD5L 5HYIA 4IRZL 3HKZA 5GRJL 2DM2A 1UT2A 3EGXB 2BSBA 1G1KA 4IS6A 2ICES 4DGIL 4N86A 5F89B 3SDXF 1IJNA 4RWHA 5LBVA 5MENE 4M4RA 3PXLA 3BWSA 1PU0A 1B4JL 5I8KH 3OM3B 1IAMA 4MQ7B 2PO6C 3OKNA 1VB9A 3RWCA 4U05A 1U8NB 3S34L 4PRDA 3SPVA 1KTCA 1SJMA 1R5WB 2A38A 1ZE3H 2HJFB 4ANVA 2F5AH 2W65A 4Q9RL 3PIQA 2NY0D 1RZKL 2NW3A 3ATBA 3LN4A 3P11H 3FOMA 2J57A 2ADGA 2VZOA 5I1EH 1OL0A 1E6JL 1YN6A 2YOCA 4X8XA 2ZUXA 5DVKA 5F88A 4KRNA 2HT4D 4MD4B 1IJ9A 2V5MA 2YRPA 1T83A 3AGVA 4KKCD 4I77L 1K8DA 2V33A 1Z7JA 1EANA 4WO0A 1DVXA 2ZOUA 3HFFA 2IIJA 2FD6L 3DGGA 5MP6H 2IAND 2WOBA 4M3JA 1CUOA 1M6UA 1K9TA 1KLFA 4B27A 3JZYA 4J6RL 4NI6A 5FIEA 2J1KA 3DOHA 5I0WA 4XNDA 1AIZA 5CEYA 2KDGA 4L5FH 5M95B 1XGRB 1T7WA 4QNPE 2YR3A 4ENZA 2V5YA 4M7JH 2COVD 3TBTA 5DQ9A 3RZCC 3T3PF 5IOKA 4XCEA 1CXHA 3QUML 1AIFA 1XMEB 1ITBB 1QACA 1YECH 3FCSA 3FO0L 5A3ID 2AJYL 5DWUH 5F1NA 4F20A 1G5GA 1KIRB 1GS8A 2P5PA 5TJWK 5IMOB 2MWCA 1MLBB 4B9IA 1H3VA 1OPOA 5ESQA 5SWZB 4Y9EA 2QVMA 2WQ8A 5MERA 3QWOB 2VKXA 2VC2B 5LDSA 2E7MA 1OF0A 2DQTH 2XQYA 4OV5B 1SXBA 2EDMA 3AACA 5I71C 4UBDC 2XPYA 3RWIB 1GKOA 3QQDB 3GS7A 5E2JA 3NTCL 4XMKH 4XC1L 1ASOA 1JXGA 1E4WH 2WVVB 2GJZB 2I07A 4G8IB 4Z7QE 1DP0A 3HUJF 4PGDA 2FJFB 4UILL 3V4LA 2CGRL 4W6YB 2ZKMX 4HDIA 3IRZA 3QFJB 5CJQL 1HEHC 5GSRA 2WAHA 1MCHA 2V9RA 4DGYH 1SUHA 4NSKB 4DGUA 5B38A 1AHKA 3HC4L 3N43B 5LGJB 1T2XA 2FT8A 2DIBA 1OSEA 2YA0A 1T5XB 1HILA 3HPJB 1CLYH 4UZUA 3TPKA 3SE3C 1MLCA 4G7SB 1WWAX 4KRPC 4ZUSA 4P5MA 1DQTA 4K3DH 3IM1A 3RPIB 3U6RB 4PBVC 2EE9A 1OGTA 3I2CH 3RFRA 3X1BA 3VI3B 1OSPL 3EIFA 3LKPA 4HEPG 5DEZA 4OZHE 4P2QA 1A65A 2VQ1A 3EO9H 1N6QH 5JW4N 3EBAA 1E8WA 3IFLL 1KBGH 4XZ4A 2JJSC 1J18A 4QLWA 3AMKA 2F7QA 1UH3A 3AZUA 2GTZB 3GMOA 4MB5A 3ZTNL 1DQVA 3FSAA 4L4TB 1D6VH 3DURA 4OZFA 1OSPH 5DRNA 2NNAA 3LVEA 1ZA6B 3HFMH 4RNRB 4YBLC 3OJDB 4XE0A 3QDJE 1D5MB 3TT3L 1NKGA 2WXRA 3K72A 4HPYH 3VFTB 1L9PA 3FQXB 2FGZA 3SPVB 3HZYA 2GITB 1KIUA 1R3KA 4H44C 4L1LA 4LFHD 3VXSA 1KEML 5DA0B 4IOFC 4XMVA 1E4XI 1UM6L 2O4EA 1TPXB 2PTTA 2EVHA 2JIXD 4K5NA 3ILPB 3HS0C 3HHRB 1ZS8A 4HF5H 4ZFZA 1I7ZA 5HDQH 3D3VE 1U8HA 3RWGB 2A4EA 1XV8A 4UM9D 2H6PA 3MGTB 5CLXA 1ZT1A 4P2YA 2VO5A 4Z7NB 5ELIA 4N0UB 4BUGA 4FABH 5KSBA 2P5WD 4C4BA 4YAQB 2PXYC 4V2BA 3V0HA 3ELQA 1PS3A 2Q76B 4KQ3H 4L1BA 4XX5A 4DO6A 4IBLT 1T1ZB 4PSPA 3K1DA 4JQIL 4CW1B 1PD6A 3QQXA 5CSBA 3EH1A 4DERA 5HHXL 5D1ZI 1OAQL 2NX5B 2Q10A 1Q1JH 2MOVA 3LS4L 1KC5L 2BX5A 4RMUA 4ZPVA 4AQ8C 4YXLH 3BPOC 35C8H 4HG4J 1JGEA 4M7JL 3PCYA 4KNSA 4PLKC 2QSTA 4O02B 1XH3A 4OLWH 3HS0B 4N4YB 4BQ6A 1J0ZA 2WTRA 1NGYA 5E8PA 3A5VA 3H9SA 4Z7VA 4Y8AA 4XCCH 5D9SB 5CZKA 1UD5A 2E4FA 1TMCB 4DGYL 1DANT 1ROCA 1NCUA 2PLTA 2IH9A 3IDYC 3WIHA 3B6SA 2JKJA 2OJ1A 5A2CA 2DAVA 2WLIA 2YPKA 1NGPL 5ICXB 1PFCA 3BWAA 4JQVC 4XP6H 2FEDC 4CN4A 4QRRB 3ZDXE 3O2WH 4GEJA 4P3DA 1M1SA 5C08A 2HA1A 1E2VA 4ZOCA 1Y0LB 4EI0A 3P11L 4OD3L 1VADB 3IPBA 5BZDB 4N6RA 2FEDD 1HDMA 3Q8FA 4KZ0A 4K8RH 4H1LA 4WTZG 2VXVH 5I66B 1NC2A 2XN1A 3LY6A 2EE3A 1A4KA 4NKMB 3AM8C 3VE0B 4ZMLA 4P2CG 4P9MH 5CILL 1D2PA 3HN3A 2BSRA 3HAEA 4PJGF 1XCTB 3VU1A 4ELKA 2F1AA 4LSQH 2VDRB 2BIQA 4B9CA 1IILE 3NAAH 2XTJE 2P43B 5C2UB 1BX2B 5IV2A 2BNRB 5IOPB 4ZUTB 1BXUA 3MLSH 2WBJD 5INDB 2VERN 2ATAA 1T03L 1CBVH 4PRBA 2WLLB 2HUEA 1IEHA 2D4DA 1J1OL 1VLXA 1MN4A 1MHCA 1MZZA 3G6JB 2APBA 3FSVA 3UZEA 3AS2A 4QHNB 1B2YA 1BEYH 1JL8A 1SOSA 3HMWH 1NSNL 4G59C 4B41A 4U1NA 1E90A 1MAML 4LCWD 4OIAA 4UWQB 1U4EA 4B0MB 2MNWA 2VR5A 4G42B 2RQ8A 3SO5A 4OGXL 3A6BL 1RU9H 1TVBA 1ZOXA 3JQOB 3RX7A 5TPWL 4BFEA 1A4CA 5MENA 4R83A 1N8ZB 1EUUA 2VSKB 5I30H 4RGOL 1BW8A 2E46A 3M46A 5FECB 3LEVL 5F6HI 5HYJB 5B39A 4FFZL 3WDIA 3ILDA 4M8QA 2B3IA 2XZCH 4L8BB 3UTOA 4ELME 4G6MH 3VD5A 1XB8A 4ANWA 2J6EH 3DYOA 2YJQA 3O45A 1IFHL 4PCKA 4YHYC 1JTOA 3MUHL 3OJMB 3JXAA 4TQIA 1H3GA 5BCAA 2FGWH 1UM4H 1KBWA 3B2VL 1A8ZA 3KD4A 4Y19A 3S96B 3IN0A 3UTSE 3SGKA 4AGQA 4UOZA 1XCTA 3DX8A 4ELKB 1PY9A 4E0RB 4OGYL 3CMGA 4JFYA 5TF1L 2E56A 5E8EA 2FHCA 2J6EL 2WXPA 1O6SA 5SWSD 1ES0B 3HB3B 5C0DB 5IG7A 4GQ9H 2DQUL 3L13A 1F0LA 4BGLA 1NCAL 1OOAA 4S1DC 3BSZH 5EZPA 4HHGA 3ZHDA 4CMMA 2X4NB 5T5FA 2OMTB 2WKLA 5DC9B 5D4JA 2OMNA 2VXUH 4CVUA 2WBKA 1DJZA 3OAZK 3H9HB 5KEZA 1ZMYA 1WFNA 4JFPB 2BNRA 2XQ0A 3OMNB 3U7YH 4XGZB 4X6CE 2H8PA 4GRLB 4NKMA 4KI5C 2EH7L 3KPNA 4IBSA 2BSTB 2V5SA 3MLSL 25C8H 3VJ6B 2LLNA 2HRLA 2NY2B 2QSCH 3BVXA 5JUEL 4Y9CA 1VHPA 4LVNB 1J87A 3NA9H 5CEXB 2A73A 3WJMB 3L1FA 1NEZG 2Q1EA 3KLDA 7FABL 3MXWL 4LSUL 1S9XA 3ULUD 1DSWA 2IPUG 4TTGA 3ZW3A 4X5WB 4GPVA 3P1VA 1KACB 1ESOA 3BKML 3ZKMD 5GRVK 4LSPH 5DO8A 2OKMA 3GQFA 4NNXA 4YDNA 1G6RL 1ZXQA 1RIUL 5LLIC 2OMXB 2P47B 2WINA 1ML0A 4IK6A 4FZ8H 3VWKA 4Z9KB 4ZXBB 2B4CH 1AG0A 1XF2B 1R3KB 1MJ7H 2DQIH 1T1XA 2IBBA 4V1DB 3PWNA 4QHLB 4BZ2H 3I50H 4PRPE 2B3RA 4FMFA 1Z6JT 4YHPA 3DBXB 4ZFGH 2IPUK 1T22A 3BWUF 2PWEA 4A7SA 4LSRL 2RCSL 4M6AA 3UMNA 2Y2YA 1MG2C 1M2OA 1B90A 1VFBA 2JQZA 1OZTG 1SM3H 1M2VA 4WV1C 4WI6A 3F7YB 1Z3RA 1GS7A 3J27A 3CK0H 4ZSOA 1O7DC 4F7TA 4KX9A 4EN3C 2PXYD 3TJHD 5AENA 4BDVB 4UZGA 1TTBA 4PJ9D 1KY7A 4HJUA 1U8HB 3B9KC 3Q2VA 2ADFH 3RWGA 3BUYA 5EFIB 1QSFE 2ITEA 2R1XA 3SGKC 5IHBA 2OW7A 1GZPA 3QUYB 1MH5A 4TSCH 5CEZD 4G7VH 4AVIA 5GS1C 1PNDA 4FABL 2FYYB 2K3TA 3FQRB 2GBAA 1IC4L 4ODTH 3A6CH 5HGHB 4IQHA 3APCA 1N0XH 4XWOD 5DQDH 1SZNA 2Q0ZX 4OUOA 4ORZC 4PRHA 4OFQA 5AL8A 4DT2A 3SDAA 3T0EE 4HUNB 5DVMA 1MCEA 2Z64C 1N4XH 3MV8D 1H3XA 2CCLA 4A67A 2JK5A 4QHNA 2W95A 4PIRF 2OLDA 3O4LB 3K4ZA 1LO2H 3BT0A 5ACZB 5MHSD 1NDGA 4L8DA 1KENL 3ZE1B 1L0PA 3BH8A 1CD9B 1QABA 1S5HB 3SKNB 4L9LA 1IM9B 4LAQL 3GI9L 3IKKA 3NH7L 4Y8DC 1G6RH 3P2TA 4BKSC 4F7MB 1CJYA 1A7NH 1PZAA 4PWEA 3VDBA 3LKPB 4KJYB 4N3TA 3AAZB 4JPVH 1ZHNA 4BKLA 4KUZH 5MERB 1HDMB 5AKRA 4X4XA 4JZJA 1VKXA 3IBEA 1JGLH 2Z31C 4HIQA 3GM0A 1EA9C 3CZFA 1HSAA 2Z1PA 2G75B 3PDDA 4NSKA 4U4IA 2PTUA 5GQBA 2GBTA 1C9SA 1X5HA 1OTTC 3LZQA 1CZ8L 3FUIA 2V3EA 5HSFA 3B6SB 2EILB 3WHXB 3W82A 4ES8A 3ZE1F 1IV8A 4ACTA 4APQA 4PJDA 5FC9A 4HUUA 1E30A 3ZKSD 1W15A 5E8PB 1INQB 4FXKB 4OCXL 2RJMA 3KPOB 4U0RB 1NC4A 2B9AA 1WRFA 2WLMA 3KBHE 4OD1H 1E3FA 4QY8B 3VO0A 4N0CD 4MS6A 2YKKA 2HN7A 1NAKH 3G5VB 5FAAA 1ADWA 4FQJH 2NY0C 4YWGL 4MA8H 4UUJA 3UAJA 5FHBH 4AJVA 5IQMA 3T08A 1DCLA 3GBNL 3NTCH 1A6UH 2I9LA 3EDEA 2VLRA 4PREB 4P4KB 1A3QA 2YBRB 4H4NA 4NQXA 2FTAA 4YHLL 1OY3B 1OCCB 1JHKL 1SEBB 4RAUB 4L4JA 4Z7QB 5C9JB 4ANUA 1G7HA 4QT5B 4WFHD 4Y5YC 3EUUA 3OKEA 2R0KH 2YGPA 3UBFA 2WSDA 1BAFH 1F1AA 1VIWA 3C6SB 1W0VA 4WV1A 3BAEL 2JWYA 1QBLH 4G8FA 4LHQB 4WY7H 4AM0Q 4DH2A 3ZE2B 3GO1H 1AJ7L 3EZ8A 1HJBC 3L6FA 3MFFB 4EKJA 5GGRB 2G3MA 5DZNA 4ZMQA 3MLZL 4NUJB 1UURA 1ZANL 2BOCA 2J2ZB 2VDQH 2I24N 1O6VA 1VENA 3L3KA 3E0GA 1NCOA 5C6TH 1V3JA 2NCMA 4HD5A 2X42A 4MAYA 4PW4A 2FT6A 4HSAC 2EDEA 1OAYL 2QKSA 3FQXA 5F7EH 4FG6C 3D5OF 2DLFL 4X4ME 4EDXB 5DUPH 2NUTA 1OCZB 5I0ZA 3DPDA 1ANUA 4X99A 4DWHA 1E8XA 4BM7A 4UOJA 2Y6SD 3CDGA 5TQ0H 2E47A 4BSJA 3U0PA 1S7XB 1FRGL 2HN7B 1KB9J 4YE0A 5DRZB 1TKWA 2WXOA 5AVVB 3W5MA 1Q0XH 3CZJA 2F5AL 2EJ1A 5FGCE 1X7TA 2KBGA 2J3SA 1AGEA 1FVEA 5ILTL 5IBTH 4JKKA 1XCQA 2ICWB 2PXYA 4Y1SA 2I5YH 2Q5BA 1AGDA 2V2WB 3F58L 2GJ6A 3P3TA 1WIPA 3IJ9A 3X3FL 5HYEA 2VERA 4FQHA 1SJEB 4U2ZA 4UI2A 1XHHA 4HWBL 1HSAB 3ZTJH 4BD4A 2IOMA 5KVDH 1QFUH 2HFGL 3I6LD 1QUPA 3NDYE 4U1KB 4PJEF 1YEFL 3NIDE 3O6LH 4M43H 5C6WH 1A1MA 5IESH 1JYNA 1RUKL 1X9LA 4FQIH 5L2JB 2A99A 4YQXL 3ATEA 3D69A 4W9DC 2Q8AL 3N06B 4WO4C 2DTML 2ZJSH 2MH4A 2NYYC 4FTVA 4DSYA 1Z66A 1BM3L 2X7LA 5D2LA 1AQDA 4OI8A 4G6AC 4OF6A 1BQUA 5D93C 3IRCA 3LKQB 1ZT7B 3EOBB 3MRNA 4L8CA 2YAEA 2IANE 5DMGD 3GWJA 3KJ4C 2YO3A 5F1SA 4OV5A 1NIAA 4P48A 5I1GL 4IGBB 1UKQA 2ZNXA 4U49A 1JRHH 1HXMB 1ZANH 3CFDA 3F6LA 5DUPL 2QVFB 1IQWL 3FH5A 4OGQC 4UINH 2W07A 3VX1A 3EO1B 5FV1L 4UIMB 2XYCA 4NNYB 1ACXA 2DJMA 3OB0K 2Z93A 4OLVH 3V0FA 1ZGLB 3Q3GA 1E8ZA 1BZDA 1TETH 4HOMA 2AJXL 1Z2KA 1VGKB 1KCVH 3C60B 4NZTL 4FXGA 5F0PB 5FYJU 2CM6A 4L1TA 1KCUL 4NO3B 1AGDB 2X4TB 4MMXC 5I73B 4YZWA 5GGSB 5KJRL 4FQLH 4UM8B 4WI3A 1PKQA 5IBTL 3G6JF 3ZYZA 3VB8A 1TU2B 1H8SA 4C83A 2FIRT 2DWEB 3WNNA 3MV11 3VD0A 1AO7B 3VXUE 1DZBA 3QIWD 4E9SA 4NAMA 2B0SL 4U3XA 1NGXB 2ED8A 1KIPB 2C9RA 4B3EA 1PQZB 3DSFH 1CDCA 1HE8A 1GC1H 2ZKXA 2LU3A 1CTNA 1I8IB 1PSKH 2NUTB 3C5ZD 3PIQB 5FK9A 3GMLA 5E6IB 1L0YA 3VRLE 1I75A 1OK8A 2I60H 2D2OA 4MA8L 4O5LH 3DVGB 3DMMC 3CXDH 1YY8B 2ID5A 3N43F 4MJ5A 2HX8A 2ZSVA 4YUEH 4F7MA 4WKXA 3ZZQA 4X8JB 4EBQH 2ZUTA 4P5TC 3RVVC 1IM9A 4RA0C 4U0QB 2Z8VC 3HR5A 5B8CA 3M7OA 1MCNA 1HHJA 1L0XA 5CJBA 4GRWF 2A6JB 2E7LA 4JO1L 4MMXB 5I73C 4XP4H 2CGYA 3G3LA 4CKQA 4HJEA 4G82A 4GP5B 3INUL 1ZHLB 1DQJA 2EDDA 4WFHE 1MXGA 4DJMA 1ZLEA 3HE7D 4AMKH 4M9PA 1N64L 4XMZA 2XACC 1BIIB 5IW3A 4FNLH 4LAQH 2P46B 5KVEL 1MHEB 4ZFOB 3QUZB 1RUQH 3K1KC 4GRLA 2WCGA 2WQWA 2DLHA 5HHOB 1GY1A 3I75A 3LB6C 2FR4A 4RDQF 4TKWA 3LIUA 1EGJL 4R7LA 3OKKB 2JKSA 3F7VB 4JJ5B 2PW2B 2G9KA 1NBVL 1QLFA 2PO6A 4MZ3A 4UQCA 1FYHB 1J5OH 1OE1A 4CNIA 5ESVA 2WYZA 1X5YA 1F1DA 3VNYA 3MV7B 1ZGLP 1YEJH 3AQDA 4FZ8L 3ESVF 3L8QA 1T89C 3LHPL 3DUSA 4IDLA 2VDOL 2WXMA 3IB4A 3QRGH 2NSXA 4AEHL 4XXCC 3CX5J 2CBPA 4Q6IC 4M1DH 4U1JB 2G75A 4UT6A 3WIFA 1FCCA 2BDNH 4X5RA 4BXSV 3SBRA 1E8YA 1MFDL 1K4CA 1X9UA 3LEXA 4QXWA 5C0DA 1MCIA 4BZ1H 4JCMA 4TQ8A 1R3HA 1MCKA 3CMOH 1A6TA 4BZ1A 4F37K 3VI3E 4GH7B 1FV1A 4BFNA 1EZSA 2VLME 3R06B 2D4FA 3MMEA 5J1SC 2Z0BA 5I24A 5K1NA 4I87A 4FYRA 3IK2A 5FW6A 4NPKA 4JUSA 1DQLL 4WWOA 4J2XA 3V0IA 5ICZB 2EZ0D 2VLRE 2C3HA 4DN3L 1I8KA 3MO1B 3O3EA 3RUGE 5BS0E 1AD0B 2VDMH 1A2YA 2GHWB 3JV4B 3PP4H 4HG4K 3Q2LA 1MJ8H 4HK3J 5EORH 5KOVC 3PAUA 5EO1A 2BY2A 2DMBA 2Z7WA 5CU9A 5L88H 4R3SA 2WJ5A 2DMGA 5J06A 1HEJC 3ZIMA 3MUJA 4S10A 2AXGA 3SOTA 2Y23A 4IKLA 2FT7A 2YJLA 1IBGH 1PSKL 4NRXB 1QYGH 3O3AA 4X5PA 4PJBF 5I1IH 1ULVA 1RFDH 2XJKA 3FZUC 1JZ6A 1P5VA 4FFVC 2HSIA 3P4OB 4JM2F 5DI8A 2XCMC 2WP3O 3IDIB 2WTPA 4F9PA 4XNQB 1DL7L 4I3SL 2QSCL 4NPYA 4LNVA 1KN2H 3DA0A 4DPRA 1TZGL 1MHPL 3T65A 2DYRB 3WKPA 1GPOH 2VLLA 5L2KE 3DBSA 4MASA 1QLEH 5E9NA 4D9LL 1NAMH 1AZBA 3OPUA 1BX2A 3DUUB 2Y24A 3FPXA 5TH2A 2QPUA 4Y1AB 3TL5A 1A9BA 1P0SE 1EAJA 4P46B 4QHLA 1A1OB 4MDRA 3AY4A 3RVWC 1Q4NX 3O81A 4FG4A 3V0VA 3VXRA 1CYGA 4PD4K 1FNSH 3BPCB 3V4VL 3T8XB 5BZDA 1VEPA 1KEGL 3GBMH 3KXFB 5E5RB 1RUAL 3NJNA 1AGFA 4HYTB 4P3DB 2NMSA 2IG2L 1ONQB 2VWEC 1BD2D 4A2GA 4X6BB 2WK2A 4BBWA 3VXUA 3FMGL 2HFEA 2PYEA 2UX7A 3NEXA 3PWPE 1DQIA 4GW1A 4PJEE 1T6BX 4UM9B 3BPLC 5C0AB 3BEVB 4Y4FD 2AVGA 3IDIA 1AFVL 4FQCL 2OZ4L 3ZE0E 1ZLUK 1JG9A 2QTEA 4NT6B 4N8CH 3BMVA 2HVJB 3QDGB 2V2XA 2OK0L 1BEYL 1EEZA 3TN0A 1JGEB 3FZUD 1LDSA 1L3WA 1QFWH 5I1JH 2Q86B 3FN3A 4N9GA 2LV4A 3HZMA 3L4WA 1TJHL 3FQNA 3UTQB 3OF6A 2BZCA 5DD5H 2EXTA 4KY2A 3TYGL 1EAQA 5IGXL 5IR1A 3RX8A 1TIUA 3QYNA 4NT6A 1IC0A 4FYQA 3P40A 4KJPC 3P9LB 4L4TD 3V4VB 3JV4A 1IFHH 2F54D 4JREC 4NO2A 2Z92A 4CBZA 5I5JA 2WVSA 4F9LA 1MFAL 1A6WL 2XN9E 5F7AA 4XOBA 4KDVA 3TF7C 4W9GC 5CBAA 4PCSA 4HH8A 2F61A 1SBSH 4M61B 3MRHA 1FL5A 4DEPC 2WMPB 1AGFB 3B2UC 4XOEA 1QFPA 4P59H 3EYQC 4FXGC 1DBKH 3IDGA 4E5XA 4P2QD 3FHQA 3GBML 1VFOA 2JB6A 3GSRB 3O4OC 2XHNA 3I84A 2HKHL 1Q38A 4OCWL 4AUUA 4EXPX 3IPEA 1CD0A 3U46B 3TT1L 2APSA 2WM0A 1FZJA 2YD4A 5CMAB 3DIDA 1ZA6A 2IH8A 3MLZH 1Q0YH 3FTZA 4ETQA 4LCWE 4JDZB 2Y2TA 5ETUB 1OP9A 3U7WH 4XXWA 1JF6A 3P0YH 1OLLA 2WN2A 4HJ1A 2FQEA 5IB1A 4F2MB 5KVMC 5T3XE 1X5GA 4ZAKA 4L8BA 1FFOB 1IVLA 3NZUA 3NAAL 2Y25A 3SDAD 5JA9A 5E5MB 3IXTA 1RZQA 2RACA 4WW2F 1T5KA 2E0PA 1UH2A 4Y19D 5D1ZC 5LJYH 2FIKA 4WHYG 3D09A 2Q20A 5IFHL 2NR6D 4NC2B 4OLZH 5I2IA 4I1RA 4RGMC 3ZE0F 1BIIA 1HNGA 2F0CA 4JG9A 4DP0X 4EIUA 5EBGA 2F15A 1HZKA 2AXGB 2TSAA 4ZXBC 1JV5A 3QULA 1QD0A 2HVJA 1OTSD 3CFJA 2HFFB 5DURB 2H0PA 5KBMA 2OMUB 4JRXA 2B59A 1IGCH 1T21B 2Q76A 3E80A 2NY4D 3B4NA 1G9EA 2XWBA 4LSSH 4WZ9A 4YHOH 3MLYH 4J4PA 1CR9H 1JCVA 3G6JA 3OZ9H 4JPQA 3TV3L 2O26U 2YARA 1J1OH 1MJ8L 1A2YB 3X2QB 4D0BA 4X6BA 4PRBB 1VSCA 1WBYA 3DLQR 1CT8A 1UATA 4FQLL 2H0JA 3QI9A 3TC9A 4Z5RB 3NFSL 1AQHA 1GGYA 2C9UA 2IQ9H 4Y9FA 2VDNB 1PKOA 2VKWA 3IS0X 4JN1H 1X4ZA 4TM9A 5TK4A 1IGML 1XL6A 3L3IA 3NN8B 1A4KB 3WTWA 5BRZA 4OFPA 4R0LA 2VXSH 1DYZA 3K72B 4GLRI 4J3OC 4QRBA 4NLHA 4HFWB 4JPWH 4JPIA 4NQEE 1YJDH 5F1NB 4DVBA 3ARBD 1NBZA 3UBXA 3HCVB 4QPEA 4AZUA 3DTXB 3WCYA 3L81A 4B9YA 2D9QB 3IFNL 5DD0H 3WELA 1JAEA 1QA9A 3C6LC 4MWFB 5CF3A 2IGFL 5F7HA 2VDOH 3QRGL 1KB9K 4A04A 5EU4A 4WTZA 3T65B 4TQEL 3BT2L 5EB9A 4G7YL 3SZ6A 1IKFL 1SXCA 2NDFA 2F8IA 1E5BA 4I48A 1HYSC 2FQDA 3FFCD 1CD8A 3Q6GL 2ZX8A 3HS0A 2Q8AH 2ENQA 1JDCA 4L0YA 3NZHL 2J1XA 5LBSH 2GK0B 2ZT9C 4S1SH 3D3VD 5I6XB 5K9QI 3BDXA 1Q94A 3SE6A 1T5XA 1INEH 1UKTA 5L4MA 4IU2B 4QXVA 4P4KC 4XMKL 4LIQH 3QZWG 3C87A 4ERSH 2ENSA 3IGKA 5HHNA 2BINA 3A24A 3F7KA 5EO1B 4AMKL 2F5BL 3E3QE 3IMTA 1JFQH 2DQTL 4KKZA 1D6VL 1J12A 3H3PL 4TL4A 1YRKA 3KPLA 1DUZA 1EHXA 2RGSA 1EXHA 4KH9A 2X2IA 1BVOA 1AP2A 1E4HA 3ILEA 2LVCA 3VFMA 4ONHB 4U6VH 4QWWD 3AABA 1ZT1B 4P49A 3VMPA 4NDMB 3RAJH 2ZOWA 4G6AD 4YX2H 3IFPB 2WTOA 2CKBA 3VXME 2Q7YB 3BP6B 4ZFGL 1SMOA 3AU1B 1T04A 4Q0XL 5B3NA 1JGDA 3HAEH 1UJ3A 2EXYC 5DSCB 3GXUB 2VQTA 5K39B 5CKAA 2NY1D 2DV6A 1HQRB 4PYHA 3B2MA 4AL8L 1BQHB 1TR7A 2FD6H 3H4FA 1JZJA 3KBFA 2YUVA 2WLZA 1IC7H 1V3KA 2E8YA 1S9WB 3JV0A 4QRRD 3V6ZA 3MGAA 4PRHD 4LDEB 1WZKA 4IRJD 1A14L 4HK0A 3DSFL 5EBMB 3IFNH 3GUTB 3KGSA 1CXLA 2GTZA 5D96B 5T1LA 7FABH 5SX5K 1U30A 1IE4A 2NY1B 2J8UE 4C83B 3EO9L 1N6QL 4XP9H 5J12C 1FORL 4JFFE 3HNTH 4FQPA 1AYOA 3X1GA 1ED3A 1RURL 4NP4H 1O0VA 3DX7A 3TNNA 4DPAX 4BZ2L 3V95A 2OPCA 4U6HB 4KROC 5DC0A 5FHBL 2EEXA 3APNA 2Y2WA 3QUYC 1NMAH 3NABL 4ZS6D 1FA4A 2A83B 3O8XA 3QFJA 3CZSA 2X4SA 4XI5D 4XVJH 5EIVA 2F54A 4C55A 2CKBB 4K9EL 1KF9B 2NW2A 3BLKA 5CEZL 3KGUA 4QRPA 3TO4B 4GRLC 4WI0B 4H8QA 4HCGA 1KCBA 4QR7A 3EJUA 4WU5A 2N59A 1Q1PA 3PWUA 1Z3GL 3FTXA 3G5YA 3Q8BA 1DUZB 5C0ND 2BP8B 3WLWC 3CN1A 1G7HB 3C2AL 3QUZD 4QT5A 5B1KA 3KPRA 4L3AA 3GLZA 1YAIA 5HGDA 1A3LL 3MV7D 4D9QE 3X11B 1A3RL 4NZUH 5HHNB 2IAMB 3BAKA 4QTFA 3WN5C 4DGWC 3OKLB 3TNMB 1NCBL 3LX9A 3MBED 2N0KA 5DUBB 3Q06A 5KANI 5GGQL 1ZDSA 5IB3A 5TE6L 3A4AA 3M17A 1A66A 2XC8A 3RLSA 2KERA 5BVJB 4G72B 4FQHB 4RMWA 1C5DB 4FGMA 4Q6YA 1KJMB 3APMA 5F8RC 3TIDA 1JMZA 3DETD 3T4AB 4XZUA 4O9HL 1ACYH 1MIEL 2YPLB 4OCWH 3FBKA 2MCAA 3F12A 2X4PA 4M7LT 3Q2NA 3M8OH 2DKMA 1FO0B 4NKIH 4HHAB 3CFUA 4MCYB 4PJIE 2WO3B 4JFWA 3GZQA 3BIKB 3V0WL 3EXLA 3L54A 3G08B 5I1EL 1VPOL 1LK3L 3BZEB 2R51A 3K46A 4L0ZA 2XNAA 2OTUA 2MNJB 1U6AH 3R1GL 5GSVB 5MHSE 2H1LM 2FLBT 2C4XA 1MFMA 3QHFL 4IGBA 3P30L 3AG1B 4QAMB 3SY6A 5M7QA 2IMNA 3NPZB 2BP8A 3K0WA 4AYMC 3UTTB 3LRGA 3CMOL 1OP3H 1ZVYA 1QSEE 2W0FB 3UEZA 3H56A 1UM4L 2BWDA 1LDPH 3PWLA 3IU3A 5FF6B 4ERSL 5DJ6B 5EUKA 1XFPA 5FHAL 5EZIL 3QS2A 1H6EA 4XHJC 1TJIL 3AXIA 2P8MA 4UT7H 3IN2A 2CO7B 3T6QC 2QVIA 3ATAA 2NLJB 1B0IA 1M57B 2J1YA 3P0VH 5H35B 5C71A 1GSKA 3MLXL 4JQXC 3ZIYA 1P5UC 1MCCA 2Z8RA 2PPEA 1Z9OA 5CBEA 5HYJD 3KYAA 4IOSA 1BMGA 5J0BA 5J1AA 4ISVA 2VRAA 2W59A 5GS1A 4ZNCD 5I16B 2EQDA 2YBRA 5D71H 3FB5B 1GRWA 3PABA 3Q1SH 5L4JA 1G9ML 1JPFA 3BD4A 1GZPB 1I8LC 4KV5E 5IB5A 2EH8L 3QG6A 3CFCH 3ZPDA 5GJTL 5ANMA 4OZFH 1DANU 2V7HB 4OUUB 4UT6L 6PCYA 1J8HB 1BZ8A 2VLKA 1UJ3C 1BQLH 1LWHA 4OLUL 1ZRUA 2VISA 1MIMH 3H2PA 3K2UH 1C08A 2JLPA 4OH2A 4PJ9C 4XBGB 1JGVL 3OXSA 1OKEA 3EBHA 5JMRA 1M2VB 4TUKH 1ZJAA 4XNYL 2VLJB 3MACH 4HU8A 2IAMD 3GC3A 5J89A 5TDOA 5EC2A 2YFNA 2DQFB 2FO8A 1OCWL 3V6ZB 3Q48A 1P7KA 2R1WB 4ZBJA 3SDYL 3ESMA 3T0AA 1VZGA 3K71B 2G3XA 1CF1A 3QIBB 5E5LA 3K4AA 4D9LH 3VM5A 3GHBL 1H6TA 4FULA 4NN7C 3U9PH 1BAGA 1FPTH 4NXSA 4X98A 5AAPA 2Y1ZA 4POYA 5TE4L 3QIUD 4XVTH 1M05B 4LVEA 5DQJA 1J0IA 2WYHA 2EINB 3A4EA 4GXFA 4HUXA 3SDDC 4DTGL 4NQCE 4PJ8A 1MEXL 4XP6L 3ROLA 2H6UA 2HT3C 2J8UA 3K0YA 4YIQA 5CHNB 3F2LA 4ONHA 3PQYE 2WW8A 1PFOA 2DQGH 4GKNB 1PG7X 4KJPD 3RI5K 3UTSA 4L9LC 4L9LB 3UTZA 3T0DA 5E6UB 3QWQB 5F93C 3BE1L 4G1EB 4P23B 1C5BL 4KKQA 3CVDA 3QZPA 1MFBL 5IB2A 1GZHC 1DQDL 3DUHA 2F7IA 1EJ6A 2HMIC 3D4CA 4HBQA 3ZKNC 5AOKA 1GCFA 4NQXB 2AVFA 3N41F 3PF2A 3UPRB 3UPAA 2BSTA 3ENEA 4RA3A 3QXAA 4RZCB 5JW5B 1K6QH 1CQYA 2OMZB 2UY6B 2UZXA 3D8MA 4YSTA 2KZ1B 1X6NA 1W0WA 2GB2A 4HOZA 4BFBD 5C6PB 1BD2B 4Z78A 4KI5D 5HHXH 5A2AA 3LPOA 3U1QA 3BP7A 3CFIC 3D52A 1TTUA 1KZYA 2APVA 1L5GA 2E5EA 1KT2B 5D7KE 4CVZA 4YGAB 3BEVA 1BFOB 1S78D 3ABMB 4G6JH 4GP4B 4JX0A 2ZUSA 1H8NA 3MLWL 1QNIA 5DF0A 5EU4B 4L37A 4KTEL 1A3LH 4RDQG 4PTTA 2BDNL 2G5BA 5I30L 1JJUA 1G7PA 2PETA 4B9FA 1H3WM 3D50A 5IG7B 5D7EA 3W11D 1ES0A 2HKFL 2BP0A 3LHPH 4FNSA 5FLUA 3BDYH 3TCXA 5JIQA 1AXIB 4KKAD 5JIPA 3VW3L 4CVXB 3PWNB 1CLYL 1T1XB 2OXHA 4GAJL 4X9BA 2V9QA 5L7XL 4P23C 3GKZA 4XMWA 3TONA 4JB9L 4M7LL 1KFAH 4JE0A 2YLHA 3GZKA 2GJ6D 3T2QA 4Z7AA 1HESA 3QZBA 4NJAL 5HHPA 3PV6A 3ZY7A 1JXFA 4HWBH 5KVDL 2C1PB 4D0BB 4W9IC 1CFBA 1UA6H 2EDYA 3K6OA 4LHUG 5LCVH 3O6FD 5I1JL 1AACA 2B08A 1A9EB 5GGTH 3LDBB 4LPXA 1MCBA 4OJYA 2QADD 3W2DH 4ZS7L 3CTTA 5HP5A 2H6OA 4S2SB 4FF9A 2GT9A 3L7FB 4LPCA 3UGEA 4MGXA 4P5TA 1WT5A 2P48B 2BNQA 4GY4A 3EHBB 4MNGB 1TVBB 1A9VA 2XA8L 5I17A 3QUYA 1JK8A 1IL1B 3EYSL 3FUKA 5EPMB 3WNJA 1YC8A 3WFBH 4W9ZA 1HNFA 3FT3B 1YN7A 2BVPB 4LB8A 1KGCE 2DN7A 2QFPA 2J72A 2GJJA 1IC7L 2PF6A 3D39E 5EU6A 1AO7D 5FCUH 1X5ZA 4G1EA 4CU7A 1AD0A 1TXKA 5DJCA 2GBVA 1XGYH 2KZWA 4DP2X 2H41A 1XF3A 2OR9H 4DZ8B 4GKNA 3L4CA 2EDHA 3HI1B 1INDL 4ZPTB 1A6ZB 4ESKA 5BNXD 2GKIA 4F1SA 1D5IH 4OLXL 1QLEL 3L4YA 3IDXL 3GEFA 1FV1B 4URTB 1T20A 1FNGB 3HRZA 2NXYC 1KC5H 1TZIB 3D85D 4WFGE