1NICA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA02
1GY1A 1RCYA 4RH4A 2GI0A 2XWZA 2YXWA 2ZXWB 4GP5B 4A2EA 2A3TA 1ADWA 1OCRB 2Q5BA 1KBVA 2FNWA 4BXSV 3S3CB 2DWTA 1L9SA 1E5YA 2W8CA 2YQBA 4JHUA 1KDIA 1NINA 3H56A 1GS8A 1NIAA 3T6VA 3AG1B 2WO2B 5I6NA 1T5KA 3CVDA 4DP1X 4YSRA 3N2JA 3T6XA 1BXVA 1PY0A 2PPEA 5ANHA 1SNRA 1IBYA 1SDDB 2B3IA 3PLYA 3FSAA 2CBPA 1TKWA 1ZV2A 2P80D 4AX3A 2GC4C 1X9RA 4A68A 1AS8A 3X1EA 1L9PA 2XLLA 2IWFA 3NP3A 2GBAA 3X2QB 2UXGA 5B1BB 1WS8A 2JXMA 1AG6A 4CSZA 2FT8A 8PAZA 1PF3A 3IN0A 1L9RA 1UATA 1OOWA 1TEFA 3X1GA 3QQXA 1A65A 3FT0A 2GIMA 2PP7A 2PP9A 3GXUB 2BWDA 2IWKA 5AZUA 3SBQA 4BK5C 4QLWA 2HXAA 2IDSA 5AKRA 4KO7A 1BAWA 2GHZA 4HALA 3CDZA 4BDVB 2VN3A 2BP8A 3T6WA 1ZDSA 2IWEA 1OCOB 5B7MA 5I6KA 3NJNA 1RZPA 4KNSA 1CUOA 2HX9A 4YSOA 3JT2A 4F2EA 1NWPA 2ZWNA 1OF0A 1L9OA 1XMEB 2DV6A 3DTUB 3NJGA 3NSFA 1MG2C 4G70B 2J5WA 3NJHA 2QPEB 1PAZA 4ENZA 1CURA 1CC3A 1MZYA 4E9QA 2XXGA 7PAZA 2H5UA 1ET8A 2IDTA 2DY2A 1URIA 1AZBA 1ET7A 3IN2A 2DWSA 2GC7C 2PCFA 4JKNA 1GS6X 2YXVA 1SFDA 1RKRA 3TU6A 3QJRB 4HHGA 2PPFA 1ASOA 2TSAA 4GYBA 3C75A 1JZFA 4Q89A 1AACA 2HX8A 4WTQA 1JOIA 1JERA 1OCZB 5EHFA 3SQRA 3ABKB 4E9TA 1V54B 3AG4B 2N0MA 3TASA 2YAFA 3G5WA 1B3IA 3GYRA 4N4YB 4AI7A 1EHKB 1GR7A 2UXFA 3PAUA 4YVUA 3CG8A 1X9UA 3X1BA 1AZRA 2YAEA 1ASPA 1NWOA 1FFTB 2HRHA 4A2DA 1BEXA 1JZEA 2QDVA 3NJJA 2YAMA 2UX6A 2XUWA 3IE9A 4G7QB 4YSDA 2AFNA 2YARA 3QPKA 2PLTA 1IC0A 3UABA 1E5ZA 3H4HA 3EHBB 1QLEB 2IH9A 2BZ7A 1JZIA 2VSMB 4JHVA 3WKPA 2YAHA 2VMJA 2XXFA 2HRGA 1WAEA 1N70A 5I5JA 4YSQA 4HZ1A 2EINB 1GYCA 5E9NA 1ZIBA 2GSMB 2BP8B 2VM3A 5B1JA 1SFHA 3DIVA 4P5SA 2Q9OA 3ASNB 5I6OA 1BYOA 1TU2A 4W9ZA 4CSPA 3TBCA 2HZHA 2I7SA 5B1KA 1AG0A 2FJSA 4BWWA 1NIEA 1AZUA 2AVFA 3QJSB 4AKPA 3OD3A 3QJTB 3NJMA 1ZIAA 4NERA 4PAZA 2J57A 2XYBA 3AY2A 3FQ2A 3UACA 3OMAB 1CYWA 4YSAA 1NIFA 3AZUA 1MDAA 4AKOA 1KCWA 2CAKA 3ABMB 5IY5B 1E65A 3S8FB 4DP8X 3ABGA 1M57B 3X1NA 5B3SB 2EIJB 3FU7A 1HAWA 4A2FA 1F56A 1BYPA 1BQRA 4UF7C 2XVBA 1I53A 1A4BA 1KGYE 3PXLA 2NRDA 3BVDB 3WIAA 2XU9A 2VW4A 4HCFA 4M3HA 1JXGA 1XB3A 2PPDA 1TEGA 4A67A 1JVLA 4G72B 2IDUA 1BXUA 2BW4A 1MZZA 2QT6A 3GDCA 2EIKB 1GS7A 3V9CA 1W6WA 3TA4D 5F7BA 2VW7A 2CALA 2PCYA 4YVNA 1AAJA 1J9SA 3ZBMA 3IBOA 4E9WA 4UANA 3NYKA 3ZIYA 2WSDA 3S8GB 1NTDA 2H3XC 2DYSB 2P80A 3FU9A 1N68A 2FWLB 3FPYA 4YSUA 3WNIA 3FSVA 2HLEB 3RYMA 1FA4A 4BXVA 4EF3A 4KO5A 2IH8A 2X88A 3DKHA 2JKWA 2XX0A 4YL4A 3OQRA 1PZCA 2BP0B 1AIZA 3QJVB 3PAVA 4BWUA 1VLXA 4A66A 2E86A 3SBPA 2UXVA 3V9EA 3PPSA 5F7AA 4MFHA 3MBWB 4KOCA 7PCYA 1EZLA 1A8ZA 2AANA 5I6PA 1J9RA 3T6ZA 1J9QA 2GB2A 9PCYA 4P5RA 3D12B 1ID2A 3PAZA 4KNUA 1WA1X 3T71A 1JXFA 1PNDA 1AZCA 2PPCA 5I28A 5A7EA 1ZDQA 2PPAA 3SBRA 1PLCA 1SHXA 4NAJA 4YSSA 1HAUA 2I85A 3X1FA 1W6LA 2YAQA 1YLBB 3NT0A 1OCCB 2FTAA 1JZHA 1M56B 3NSCA 1L9QA 1M9WA 4GXFA 4KO6A 2IAAC 1CYXA 2Y69B 2IDQA 1AS6A 3FYIB 3WNJA 3NSYA 2BO0A 3AG2B 4W1TA 5I5IA 2XV3A 2UXTA 3S3BB 1ILUA 4G7RB 4TXVB 1WA2X 4DPCX 1KYAA 1IKOP 3N55A 5TK2A 3CDZB 4AZUA 5B7EA 2WO3B 1SF3A 3EH3B 4GP4B 4GY4A 2RACA 3FU8A 2JFCA 2CCWA 1XB6A 5PCYA 3UGEA 3EH4B 4NB7A 2QPDB 1XB8A 4DPBX 1PMYA 2OV0A 2FT7A 2XX1A 2BZCA 3NSDA 5B7FA 1AQ8A 4AKQA 1ZPUA 2OJ1A 5FC9A 4E9XA 1PLBA 3H4FA 2XV0A 3UAEA 1SF5A 1E67A 4KOBA 1GSKA 3T9WA 4YSPA 3AW5A 2R7EA 4KNTA 4UAHA 1HFUA 3OM3B 3QJUB 1PNCA 4F2FA 1OE2A 4M4RB 4YSTA 3ASOB 1ILSA 5I5MA 1A3ZA 4QKTA 2EILB 1KV7A 2FQFA 3ABLB 6PAZA 5PAZA 1PZBA 2TSBA 3EH5B 1NZRA 5AFAA 2ZONA 4X4KA 1OE3A 2YAOA 1OE1A 2LLNA 3EF4A 1NPJA 3BQVA 1PLAA 2OCCB 2AZUA 3QJQB 4G71B 2AZAA 4DP6X 4A2GA 3AG3B 4KO9A 1J9TA 5B1AB 2MTAA 1ASQA 1OV8A 1JXDA 4HAKA 3CZUB 4DP9X 3NJLA 4YSEA 5B1JC 1BQKA 3FS9A 4K9JA 6PCYA 1A4CA 1AZNA 1ET5A 5I6MA 1A4AA 3PCYA 1J5DA 4DP7X 1DYZA 2CUAA 3UADA 1IUZA 3ERXA 4BWTA 1BQ5A 2W88A 3FPXA 4ZK8A 3CVCA 3NP4A 4GP8B 3MX0B 3UAAA 4HHWA 1AANA 1WS7A 1AS7A 1JZJA 2BHFA 4E9VA 1KCBA 3NJFA 1GW0A 3HB3B 2EIMB 2J55A 5I26A 1PCSA 3HEIB 2MRYA 1AOZA 1WA0X 3FYEB 4E9YA 1SDDA 2FQGA 2FQDA 3WI9A 2CJ3A 2FQEA 2BW5A 5TK4A 1DZ0A 4PCYA 1IBZA 1SJMA 4HCGA 5D4HA 2B08A 3CVBA 2H47C 2VSKB 4FAAB 2BWIA 4HIPA 4F7KA 3TBBA 2YAPA 4HCIA 3FSWA 3ZX1A 4DP5X 3S3DB 2I7OA 2IDFA 3NJIA 3KW8A 1JVOA 4A2HA 2PP8A 4DP2X 1FWXA 5LDUA 4L0PB 4DPAX 1NICA 1NPNA 3WKQA 3ZDWA 2QDWA 1QNIA 1R1CA 3NJKA 1NDTA 2R7EB 1KDJA 1E30A 3L45A 4YSCA 3FQYA 5I6LA 5D4JA 1AR1B 3FU7B 3OMNB 4BDVA 1J5CA 1RZQA 1GY2A 2VM4A 2XV2A 2Y1AA 4DP0X 2FT6A 2X87A 3JTBA 3OMIB 2DYRB 1NIBA 1W8EA 3U25A 1QHQA 4E9SA 2VW6A 4G7SB 4WKXA 4N8UA 1V10A 4FA7B 1PZAA 3FSZA 4DP4X 1MG3C 1BXAA 5D4IA 3IEAA 1KBWA 1JZGA 2UX7A 3FQ1A 1ETJA 4Q8BA 1V55B 4E9RA 3KW7A 1SHWA 2HX7A 1L9TA 2J56A 1NIDA 2BP0A 2ZOOA 3WG7B
chains in the Genus database with same CATH superfamily
1TTFA 1RCYA 1JV2B 4X7DC 3GMQB 4HPYH 4H25A 4MJJA 1X44A 2W9DL 1H15B 1N8ZB 1ZA6B 2Y7SA 3TBVA 5LWYH 3P4OA 3VGFA 3MLZL 2QVTA 1SDAB 2WO2B 3ISRA 2GTQA 4APQD 1JWMA 2DJSA 2D3NA 1Q9KB 3MV11 3L5JA 3WL9A 2HPOA 4FXTA 5BV7B 5IG7A 3RVWC 4U6XA 4E41D 3JZ7A 4XI5C 1FL3A 3D2UB 1DN2A 2OSYA 2X2HA 4OF3A 3POCA 1OTSC 2P80D 4XPTH 2FEEL 4Y9BA 1HE7A 3S35H 5IKCB 1CK0L 1SBSL 4A68A 1F00I 3WTWA 4FC3E 4QI3A 9CGTA 3G5XB 3RTQD 1COBA 1GGIL 2IWFA 3CVHH 2KLTA 1MRCL 2VRQA 3T3PB 2JMRA 2LU4A 3HB3C 1EXHA 1QFWM 1E2WA 6FABL 1EGJA 1P5UA 5AVXB 2WMPB 1XBRA 3ZYZA 4ZO9A 4RMSA 3V7AE 1N6UA 2PP7A 3F01A 4YX2H 2VR3A 5SX5K 5L7XH 4WKZA 5I1KL 4NZUL 1FCGA 4JM0A 1N6QL 4LPTA 1Z9PA 1FGNL 3T5WA 1SMAA 1WQVT 4ZI8A 5LKNA 3D07A 1BAWA 2RA1A 5GIRB 3K6IA 4FHKA 3V0WL 3NFPB 1YYLH 4JFDB 3SBWA 1XCQB 4ZAKD 4PJ5A 3QSKB 3R06B 4PS3A 1EA9C 3V6BR 2WXHA 3ENEA 5AZ2L 2WQRA 2HX9A 4GW5B 5MEQA 4L9LB 2UY7B 1CICB 5CLWA 1PJ9A 4XHJC 1KCSL 1VEMA 3QCTL 2NSMA 1OM3H 5I1LB 4FQXD 1EQWA 2VMFA 1DBJL 3DTUB 4OFIA 1RZIB 3AREC 4ZUUB 3S5LB 1DJIA 1A6WL 1ZHNA 3FO2B 3LH2H 3KLLA 4GKSB 4ENZA 1MNNA 1A9VA 2F1AA 3NRQA 4I18C 5LGKA 1J7VR 3EDFA 1KXVC 1HHIA 1ZTXL 1C5CL 4OZHF 5F7FA 1AQHA 1ET7A 1MEXH 4ES9A 3P73A 3OZ9L 4HHAB 2DBLL 1FN4B 2GC7C 4LFHG 2N59A 2ZKHH 1VGKB 2EABA 2RH0A 4L8DA 2QADB 3SQOH 3BAEL 4E9LA 5JIIA 3SKNA 1F18A 3WDIA 3S96A 3QJRB 1BEYL 1GGBL 1HI6B 2CLVB 4Q89A 3IS1X 1KG0B 3NFSH 3ZKNC 1XEUA 3DI3B 3L95A 4WHDA 5E2WL 1F4WH 3IXTB 2GTWB 1FL6A 2D9CA 2EDHA 3I6KA 5GJTL 4B97A 2J8UE 1HXKA 1V05A 1NJ9B 1PPIA 2O61A 1UB6B 4L4JA 1S7RA 1B3IA 1CTNA 4N8PA 3MODL 5GISL 1PEZA 4N9OB 1ZLEA 2WUCL 1FNGA 4CA4A 1QMUA 1NCJA 2EIZA 3CG8A 4OI9A 2DTMH 5DD0H 1AC0A 4KTDL 4UT9A 1MH5B 5FA3A 1DSWA 1NAML 1LP9B 5CSGA 4LHQB 3A5VA 3FCTA 4OF8A 2NY1B 3CDFA 4LPWA 3P1VA 2QDVA 2NYKA 1OP5K 5F2FA 5F7YC 1OTTC 2YRPA 5I9QB 4YC2B 4TLKA 2XUWA 2XWRA 1FPTL 4N0CC 4D0BA 5EBMB 4CU7A 1HCZA 2PCPA 2ADGB 3FQ4A 4J3UA 1BOGA 1SLWA 3DVNA 2DQIL 4QRTA 4BELD 2KT6A 4LK4A 5KBPA 4QT5A 4HKXB 3NTCL 4WAFA 5TDPA 1GC1H 1T1XB 4KZEH 4OZFG 5J13B 4JZOA 4PJ9B 4GUPA 4AITA 4OU3A 4CAGA 3ARFD 1EJ8A 3ASNB 1D5RA 1AP2B 2FECI 2V4LA 1R5WA 4FEIA 2B15A 2HFGL 2QKSA 4R8WH 3O8XB 1NGXB 4HIJB 4F8OA 4PWHA 4LOUD 1SYVA 3UZQB 3KVDD 5AW5B 5K9KA 5E9DD 2K3TA 2AEWA 5DK3A 5IY5B 1G9NC 2WQXA 2XTSA 1RPKA 1C16A 4A55A 1LE5B 4NRXA 3VDAA 2EIJB 3ZMRA 2IH3A 1BYPA 1MVFA 4PWKA 5ETUB 3FAXA 4TUOB 3X3GH 4G7VL 3I2CL 1O9ZA 1IBDA 2JVUA 3I9GH 1MVUA 5DEZA 3WFBH 4XPFL 4ANXA 4NPJA 3FQUB 3TIDA 2VWEE 1JGDA 4Z7WE 5F0MB 2DMGA 1P7QB 2PYFB 4KKPA 4J3BA 3UZEC 4ONGL 2VGLM 1F6AA 3MBEB 1HL9A 5C2UB 3VI3A 4CDGC 1F41A 4OZFH 5FO2A 3C09B 2QLYA 2PTTA 4QNPE 2IG2H 4JY4A 2WLIA 3TVMC 3PGDB 3VFGH 3I50H 4KDWA 4JHWL 4MLSA 1P4BH 4LCUA 5CUSH 1NOAA 1A7OL 4B3VA 2NY0B 3ZBMA 4K2UH 4UANA 1Z5LA 2QQNH 2H3XC 3CFKA 1NM4A 2Y07H 1X5IA 2O6EA 4P4KB 4YLBA 5TE6L 3MJ6A 5HYQB 4U6HA 4FQHA 3RVUD 4S0HA 2YSSA 2GSIA 4Z7UF 4EF3A 4WI8A 3K4AA 5D1XE 4UOW0 4LLVB 5EF2A 3EW3B 4F5CE 3GRWH 2NXYC 2ZWLT 2BNQE 5DZAA 3SOBL 3V4UH 1KXQE 2IH1B 3B6SB 3UCQA 1I1AA 3SBPA 3VTTA 5A1AA 4WWKB 4HWBA 5CBEA 4JG9A 1KFAH 2ED9A 4YUEH 4FULA 4MFHA 3PWPE 1H6UA 2ZAIA 3VQMA 4BGDA 5JHLA 1WFTA 1J5IA 4X9YA 4OLVH 5E1HB 5I6PA 1UOKA 4LLYA 3E9TA 3VRIA 1ICTA 4U6VL 1URLA 4UT9L 3KVQA 4Z7QF 4Q14A 2B5IC 5JIMA 1I31A 5KSBA 1YN7A 4P5RA 1MCJA 4UQDA 4C83A 3UG5A 1GYAA 4I1NB 4U3SB 4UILL 4RRPM 4KJPD 4XCEA 5EUOA 4IBVA 2OW7A 4ZMTA 3MV7E 1HAUA 2H8PB 3FUFA 4F8NA 2EDKA 2J21A 5IWLA 3QIUC 4F7MA 2FTAA 5E1IA 2WXRA 2AK1L 4KXAA 3Q9PA 5D70H 5B38G 4HWUA 2QQLH 4CRPA 5I18L 2NLJB 2H26B 4NRYA 3TIEB 3WNJA 4DK6A 5JLZB 4LDCA 1KLGA 5DC0A 4UZUA 5H37A 3L17A 2OTUA 3FB6B 5IVXB 3BGMB 2NY3D 2NYYD 4U7KA 4Y4HB 2RBLA 3IMWA 4PGCB 5IFHH 4W9JC 1INEH 2F15A 3MLUH 4P5TB 3O3BB 1K8DB 4XTRD 3B7YA 4C56B 4M1CD 4XAKE 1S9KC 3W9EA 4JFFA 4OD2B 4TULH 3BPLC 4XC3L 4R4BB 3ZHNA 1XB8A 3VFPA 1Z32X 3VXOA 3QDGD 4PJAF 1JK9A 3BUBA 3CFNA 1DBBL 4MA3B 4U3CA 5HD8D 1DBKH 2OMUB 2VITB 4TQEH 3QK0A 3EGSB 4FS0A 3F00A 4RQQB 1JPST 4GFXA 4QTHA 3MXWH 4ZS6C 5GGTA 3PDOB 3V2AR 4YQXL 1UUNA 1MAKA 3QUXC 3DV6A 4NC1E 1CE1H 2R0KL 3NZUA 2EDXA 3HE6B 3HR5A 2YXMA 5D71L 3BZEB 1CD0A 1EEZA 4TOYL 3RKDC 3JUZA 4F58H 5C0DB 4X4KA 5CGBA 1H5BC 5E56A 4NBYB 3VXME 4M8VA 3CC5B 3HNVL 3D3VD 1EX0A 3HMWH 4RNRA 5D7EA 2QKIC 1ZVNA 1Q72H 2K0RA 1MCCA 5AVYB 4FNLL 1Z9MA 4KXBA 2O5ZL 3QYCA 4ZUWB 4A04A 3N1GC 2X38A 1JGVL 1LO5B 3NQIA 5G4MA 5C0AD 1CU4L 1U8KB 5DC2A 3C08H 4J5VA 3GK8H 5DGRA 1UURA 3HJEA 4ODVH 5INDB 4DQAA 4G5ZH 1JHKL 4EN3A 2G9KA 5DMJB 3B7RL 2DI9A 4X7SL 3V7AG 4M93B 1JV2A 5EOCJ 4CJ0A 3GMQA 4HS3B 4HF5L 4JM2C 4DP7X 1BECA 3BO8B 4XPBH 5JHDD 3IGKA 2F9BT 4KKLC 3U7YH 1H15A 3PJSA 1N8ZA 4HWBL 1FBIL 1ZA6A 4R90H 4WVRA 5IHUH 3NPSB 5EC1A 2BIQA 2OMXB 4P2RD 5DCCA 4PJIE 3P30H 1FAKT 5EORH 4E9VA 4I3RH 4Y5VC 1Q9KA 5L9DL 1I9IH 2YOCA 2AQ1A 2X09A 4OCNC 4ZFFA 4QLRA 4JZJB 1YEJH 3FH8A 4MRBA 3RL1B 2FQGA 4HFWB 3PHAA 5E4AA 3IAGC 3D2UA 1G6VK 2AABL 1CLOH 1H3VA 1OGTB 2A83A 5TK4A 2ZXDA 3HBGA 3ARBB 5IKCA 1KJ3L 3P2DA 1VEPA 3EFDL 4MCYB 3EYQC 2AERT 2JTDA 3MV9E 2BWIA 2WP3O 4LU5H 2Z8RA 4PP1D 2VAJA 5DMGD 5GRJL 4PEEA 4XP4H 1DANU 1F2XK 4OV5A 2CMRL 3CU7A 4L18A 2WMPA 3VX0A 3ARSA 4HMEA 4ECNA 5JO5B 1F86A 1AIFA 3BCFA 4JGUA 5LDUA 4L2YA 3NH7L 1HQRB 3WKQA 3GIZL 5A2AA 2VDPH 5DRZB 5MEOA 1PD0A 1MFUA 3AUVA 1L7TH 4N25A 1R0AH 1H3XA 3NFPA 1IC7L 2Y6SD 5JDJA 3MUY1 3GJEB 3R06A 1T83C 4FNTA 1J0ZA 4GW5A 4GS7B 1QEXA 4L9LA 4LCCA 2UY7A 1WWAX 1CICA 4LDEB 2EDJA 3U9PL 4A7TA 3KLAB 5I1LA 4YMPA 1MHEA 1FG2A 1U8JB 3RFRA 4FNSA 1JTPA 1Z3GL 1RZIA 5AKTA 4ZUUA 1KZYA 4DP4X 4LSSL 3IEAA 2HH0H 2B4CH 2APFA 3FO2A 3VVVA 1MFNA 1JZGA 3DX2A 2C3GA 4GKSA 4KWUA 4JGNA 4E9RA 2AMUA 1L9TA 3C5JA 3U1SH 1L9MA 2E7MA 2XQYG 3U9WA 4HHAA 3JVFC 5GGTL 1T6VN 1FN4A 4KTEL 4Q9BA 4WCYH 5D1ZC 4QJ5B 1VGKA 4RH4A 5B38B 1SUHA 3KH3A 2LLLA 4EUPG 3TEYA 1CDGA 3HTLX 3DPBB 3IDUA 3SGJC 3UYRH 1YEKH 3GSNB 3G9VA 2ZX9A 4W4OC 3BT2H 1L9SA 1HI6A 1XDTT 4QRPD 3SJVE 1A1NA 2CLVA 2FX8H 3W81A 5LVEA 2P45B 3RDTD 4OF0A 1MCPH 3GZOA 1MREH 2YPLD 1N26A 1WZKA 4NQXB 1E4XL 4U1IB 1IJNA 4NWUL 5DJYA 1HINL 2R0ZL 3IXTA 1T5KA 2PWFA 5LXGH 1ROWA 1YY8B 3N9GL 3CVDA 3DROB 4LCVA 3MLPA 3OSKA 3N50A 4PW4A 3RWCB 2BSRA 5CM1A 3CV5A 4UQCA 2ZTBA 5I1IL 3IFLL 1OT2A 3EZ8A 3FSAA 4WU7B 3P02A 4LNRB 4O9HL 1MRFL 3EO9L 4LSUL 4HJTA 1MH5A 3UMTA 1LP9A 2C9XA 2P26A 1CI5A 4XMWA 4MKTA 2FVNA 3NDZE 2YRZA 5I19L 1J0JA 1A5FL 3RU8L 4LSTL 5IQ7H 2XNAB 5EBMA 2NY6C 5KJ7E 3KGUA 2ADGA 2QGBA 2ZXCA 4G8GD 4K7PY 2AXFB 2WUBH 5T1DH 5K59E 5JHMA 4B95C 5AKSA 2BLFA 3FTSA 3OAZK 4HKXA 4LL1A 2J6EL 4ADJA 3ZQ9A 4MD5A 5BV7L 2OXGA 1E7VA 4EUPH 4M7LT 4PJ9A 3VWKC 1JPEA 5KS9E 3ZHFA 4XN8A 3VG0H 3EJZC 4H8QA 4NUGH 1QSFB 5B7MA 1WUZA 5E00A 4EXKA 1ID5I 2TRHA 2V6HA 2V3DA 4LPCA 4PJGF 4CILA 1AP2A 4FLRA 4DUWA 1ORQB 4OCMC 1YECL 3BIKB 1IBBA 3TZVB 4UYPA 4F8TA 2GJJA 3MJ8B 3H1ZA 4HIJA 4ELKB 2B4CC 3F58H 4BV1A 2J5WA 1J8HE 2VDPB 3RVVD 3UZQA 1CC3A 1MY5A 1G7IA 1X3DA 5AAPA 4Y16B 2IDTA 5I1HH 1HHHB 1TZ8A 1ADQH 2CDGA 2I27N 3T2LA 5ILTH 2R2CA 3QDJE 4ZTPH 3ROLB 1BBDH 1OAUH 2EECA 5IFJB 3U4AA 5ETUA 5DFVD 3LQAC 3PNWB 2CA4A 3FSOA 2HG5B 5DDHA 2X0WA 3C75A 3GMNB 1A14H 1MCOH 3L5XH 2L0DA 2V2XB 3OXRB 2PYFA 2NY2C 3R1GH 1NLBH 1INQA 1E4WL 1BVKA 1ZKAA 3QULB 5EOQL 1GL4B 3E0GA 4CN4A 1V54B 4HZLA 5DRNA 3H0TB 4JPVL 1IVLA 1EHKB 1B6UA 1O7SA 3QIBD 4K3DH 4AGLA 3PGDA 1IGFH 3GI9L 2XIBA 4GNKB 1GSMA 2BIPA 2DF3A 4GW1B 2AHIA 5IQLA 3CMOL 5INCA 3UTPD 3Q13A 1RUML 4M00A 4OFYA 5CZVL 1JVKA 3MYZA 3C8DA 4PRDB 2JKJA 4G7YL 4BINA 2XPZA 1FFTB 4U1JA 4P4KA 1QG3A 1PLGL 4JFZH 2UX6A 1XAKA 4M6AA 3P40A 1CCZA 4EVNB 2I9TB 1LO3H 3DX6B 4MYPA 4AQAB 1BG9A 4PJCF 5A6MA 4QRFA 5AVUB 1E5ZA 2IH1A 3H4HA 3B6SA 3VG9B 4N6QA 1IT9L 4JHBA 4OD1L 3P69A 4WWKA 1WWBX 3IMVA 3O11B 5KN5B 2J8UB 1GOFA 4PBVC 4OJFL 1T2QH 2N56A 1B88A 1C7TA 1E5BA 2JI2A 3GNML 3ULUL 1U3HD 4P2AA 5D5MF 5DJZB 4IJ3B 2YPKA 3LHAA 3GB7B 3IDJB 4HPYL 3GSRB 4YNYB 1PGRB 3IDNB 5TFSH 3SD2A 4GG6E 3RIFK 4PRBB 1UUSA 1T66D 5HJDA 4AEFA 5LWYL 2A4CA 2FEEI 5I1JH 3VRLE 2OULB 3BRGC 1J11A 3D50A 3NABH 3GBMH 2H8PA 2PO6A 3MJWA 5IESH 3FTGA 3BN9D 4EUPB 1VFBA 4R3SB 3ABGA 4NYLA 3OHXA 3L9RB 2HB0A 4JO4H 1OTUC 1VERA 5I8KL 2XVLA 4A2FA 4XPTL 2GFBA 3C5ZD 3E1ZA 2NLJA 2H26A 3S35L 1RIHH 2CR6A 4ZQTA 3ZGIA 5GS1A 4PB0H 4O5LH 5HGHA 5IVXA 3FB6A 4Y4HA 32C2A 4KXZI 3BEVB 1MRDH 4PGCA 1N0XH 1DDHB 3B1UA 2EE2A 4ZOBA 3QDAA 4P5TA 3O3BA 4JY6A 1JYWA 3VXRE 4Z7NB 2VWEC 4C56A 2NUPB 4FMFA 4A39A 5L7XL 1HEJC 3LTVA 3RZCB 2B1HL 4NEHB 3V9CA 5GZOA 3I84A 4OD2A 4KK5C 4R4BA 5FLUA 4MAYA 4YVNA 2G3ZA 4NKIH 3H3BC 2CDFA 4MA3A 4YAQB 2IAMB 1JPGB 1U2YA 4F1SA 1EFXB 3NCCB 2OMUA 2JTYA 1G7MB 1ZVHA 2VITA 4V2BA 2HLEB 2F54E 3EGSA 3GIVB 4L4VD 3R8BB 1EZVX 4OKVA 4RQQA 4YBQC 1SMDA 1AGBB 1PZDA 2P42B 1PSKH 2QSQA 1QAWA 4MQ7B 2HKHH 3LS4L 3L3IB 2MNWA 2V17L 2NTSP 4G6JL 4YDKH 1DJYA 1R17A 1PZSA 5D1XC 3LH2L 2F19L 2EXWC 5F7AA 4AL8C 3HE6A 3SKMB 7PCYA 3MNZB 2Z7UA 1MEXL 3CFEB 3SE9L 3GM8A 1AHWC 1M7IA 3MV8D 4X4MA 5C07E 3CN1A 2CHNA 1VF5C 4NNYA 3CC5A 3SQOL 2ADFH 2XY2A 4JO5A 1N3NA 4ONOA 3TA3D 4G8FA 3T6ZA 3QQ9C 1KCKA 3L4ZA 5F7EL 4ZUWA 1LK3L 3PQYE 4L8BB 1JXFA 1LO5A 5G55A 4AYBA 1SHXA 4E2OA 5FHBH 5INDA 2GKIA 1F4WL 1WYJA 2XTJE 5HDQH 5BRZA 4B96A 3JQOB 1KXHA 3X3FH 3O41A 1I1FA 3BO8A 3EG9A 4JRWA 4JO2H 4XPGH 5AYQA 1S7TB 3D9AH 4MJIB 4R0LB 2ALWA 3CX5K 4X7TB 2OQJB 2DTML 2OXHB 2OMXA 5DD0L 2WVUA 3PWPB 3GSVB 3W39B 4NT6B 4UWQB 3H3PL 1UM5H 3CIQA 1FNLA 4C4UA 2FWUA 1MCWW 4JZJA 3ZHKA 4FDWA 3WNNA 3ZMNA 2NX5D 3Q1SH 3RL1A 1TO4A 4HFWA 4JDVB 1FFPA 1OGTA 4GY4A 2BSEA 5AQ0A 5LGJB 1ZK9A 3ARBA 2WZPA 4PP2A 3MV7B 4MCYA 3FUEA 3KEDA 1GC1L 4GI6A 1XGPA 2VB5A 1UM6H 4ATWA 5GRUL 4WHCA 1SPDA 2Y36H 3ULAB 1JWSA 2WXJA 4PIBA 4IKJA 5JO5A 2XV0A 4WSJA 2A74B 3UAEA 2LU3A 2FUTA 1NMCC 5JXEA 1E67A 1HQRA 3CHPA 2O5NA 1L9NA 3FN0H 3RPIB 5DRZA 4LAQL 1A8JH 4R8WL 4Z7IA 4XWGH 1ERNA 1AXTH 5C0BA 3H2WA 4KH9A 1CFQB 2P8LA 4ODXB 1ILSA 2YD4A 2DKSA 3L3JB 3RA7H 4KJQD 4F27A 4NC1C 5BNXD 3ZVVA 6PAZA 1T7XA 4I0KA 4PJ7E 2WGXA 1OE3A 3MGTB 4O2EA 4MB5A 1VFAB 4XCNB 3A6BH 1IIKA 2R9HD 2RMNA 3KLAA 1NPJA 1S7SA 3BQVA 2EH8H 4HUWA 3QJQB 2F18A 4LMQE 3Q6FB 4A2GA 3CHOA 3ZT6A 4Y2NA 3I9GL 2VXTH 5ACLA 4LCIH 3ZTCC 3C6SB 3WFBL 4MXQC 3VFMA 3FFDB 3LPFA 4HEMA 2MTAA 3LD8B 4Y9FA 4H40A 1CGSH 3EZJB 3C12A 5B1JC 1EUTA 4L3EE 1AJ7H 4ORGA 1RSFA 4UM9D 5B38A 2JLLA 5HPOA 3AS0A 2IG2L 3VFGL 1TJXA 3GSNA 3I50L 1IUZA 4OUUA 4P2OD 2ZKYA 5FAAA 4BFRA 3N6YA 1P4BL 5CUSL 15C8H 2GEEA 2O30A 3CVCA 1ZGLP 3NP4A 2YUZA 1WS7A 3BFWA 2QPUA 5BVPH 1YY8A 2QQNL 3DROA 5IBUG 3VXMB 3I3BA 2XPGB 3RWCA 3RNKA 2Y22A 2K4AA 4H4NA 1P5UC 3B5GA 4LEOB 4M48L 5M95B 3TTYA 3AQXA 2WZ6A 3V4UL 1RZKH 4QYAA 4C55A 5DS1A 2FO8A 3GFUA 5F9WB 4YUEL 1XH1A 4DESA 4JO3H 1EEYA 2VDMH 3I85A 2J1YA 2UY6B 3UX9B 4DP2X 2X4SA 1XGTA 2OR9H 3NJKA 1NDTA 3O81A 2BP5M 4I77H 4KC3B 3L45A 4YGAB 1ZEAL 2VDNH 2KMWA 3LRLA 1HILB 5ESVB 5F6HI 3V4PH 4CN6A 5J1AB 1P9MA 4Y2DD 1DHKA 1AY1H 3AROA 2VZVA 4XWOC 1RL1A 4PJHA 5DWUH 4LQFH 1A4JB 4MD4B 2XIDA 1QSFA 3RIKA 3B3BA 4R2GB 2VW6A 4WRLA 4PHXA 3RJOA 2PMZA 5D70L 3DHMA 2QQLL 2DL2A 2JIXA 4FA7B 5EV7A 3TZVA 3MJ8A 3PWUB 4ELKA 5IOPB 3K2KA 2NY4D 4KU1A 3I6LD 1WFMA 2ED7A 2MWCA 1NDGB 4UOQA 4I13B 1HHHA 1KCUH 4FEMA 4MKMA 5IFHL 2EC9U 4MDJB 2VLRB 1LHZA 3JYBA 3MLUL 1CJYA 3ROLA 3OC8A 1PTZA 5IFJA 3I9IA 5J6SA 5I17B 1YMME 3PNWA 5GGRB 5HDRA 2HG5A 4TULL 1Q0EA 3CZLA 2ENSA 1ND0B 3GMNA 5DFTA 3TEXA 4BFOA 4UQAA 4CNIA 2ZXQA 2V2XA 3OXRA 3TBSB 3ARQA 2YSTA 3ILQD 3QULA 3VI4A 4DP1X 3IWUA 1DBKL 4GRLB 3V0HA 4TQEL 1BXVA 3LPOA 3F8UB 5AWNH 5C0EA 1K6QH 3BVWA 2Z4QB 2MCMA 3MXWL 2FR4A 3NAAL 3CWGA 2B7DT 5F7HA 2JQAA 5JPNA 3RWHB 5AW8B 3S3PA 4AT6B 3FQWA 4GAYB 2HVBA 4XMKH 1MWAH 3L6FB 4PMEA 1RV6X 5EO9A 2CNZA 3WXVL 1TO5A 5EA0H 1I3UA 4CSZA 1Z3RA 1RU9L 3GSNL 5KVGL 4Z7QE 1G0DA 2CO3A 4MA1C 4EVNA 3PHOB 4XMTA 2I9TA 4HEPA 2I60L 3DX6A 2BS9A 2O4EA 4QRRD 5TD4A 4AQAA 1KEMH 1WBXB 5DD1H 1Q72L 4KK9C 1OHQA 1MHPH 3SDCB 3BPOC 1KBPA 2LAGB 2ODHA 5KJRH 5KN5A 3IAQA 3NPZB 1UCTA 5AKRA 2J8UA 1A6AB 2ROYA 5CMAB 4HALA 3CDZA 4ODVL 4BDVB 5KUKA 3J7HA 2UWEB 1W8NA 1ZDSA 2IWEA 2V9RA 1L6PA 2VERA 3OR6B 2X6CA 3ARDB 5DJZA 1W0VB 3GB7A 4OM0H 3IDJA 4FCAA 4XPBL 4GSQA 3JT2A 3IDNA 1DVFC 1KGUA 3NA4A 4TQPA 4AEHH 3U7YL 4BH7A 1N6VA 1R5IB 5FYKE 5IHUL 1CVSC 1IFHH 2BX5A 2MQGA 3BRFA 3RVWD 4XI5D 3S37H 3PY9A 1JPTH 2QPEB 1VA9A 5EORL 4P4RB 3RLSA 4JDTH 3Q2WA 4I3RL 1OTSD 2VDNB 5KYUB 3FB5A 5D93C 1D5IL 1XT5A 1YEJL 3V4PB 3MNVB 4EUPA 1S7XA 2PYED 3K6FA 3LMJH 4JKWA 3IN2A 1KEGH 3L9RA 1XH3B 2DQEH 2YRBA 1THCA 4HBCL 5IEKB 1KGIA 4MMYB 3HB3D 4PGBB 2CH8A 4QTFA 3WFCH 4DOHE 3GSXB 2FBOJ 1JI1A 4P23B 2Y25A 2IXQB 2IOOA 3HUJF 1U6AH 3KPQA 1XSIA 3MCLL 1JZFA 4LU5L 5I1CH 1AACA 4L05A 4XNXL 2ZUWA 5E70A 3BEVA 5AZEL 4N6RB 3VFVB 1DDHA 5HY9B 2ATPB 3F7QA 4UDUB 1OLZA 4I9XA 5EHFA 3ABKB 4WFGD 3JT0A 1PEWA 2N0KA 4XXDB 4LF3B 5DUPL 4B9YA 1FSKB 2NUPA 3VGGA 2EKJA 4PG2C 4ENEC 3RZCA 3SQBB 3WKNA 1R3LB 2VDPL 1YEEH 1J8HB 2CJUL 1BFTA 5T5FH 4XR8C 2YLHA 1UWXH 4Z7VB 1R0AL 1XGYL 4YAQA 1EK3A 4IK6A 2BOBA 2IAMA 3GO1H 3TWYA 4XHJD 5CWSB 3QDJB 2WLNA 2GTZA 1O7DE 1EFXA 2C7UA 1G7MA 4HK3N 2GSGB 4X83A 2MFNA 1LO0H 2YD0A 1AGBA 2NQCA 1ECZA 3OJDB 4AJWA 3QUKA 1DJHA 4MQ7A 4EBQH 1JPSH 3L3IA 5IV2B 3OXSA 3U9UB 4FX5A 4TL4A 2HH0L 4BJLA 4TM9A 3HZ3A 1PFOA 3DX7B 4HSAC 1WAEA 1IGJB 4LGSB 4YK4B 3SKMA 4RBPK 3U1SL 3MNZA 5T3ZD 1E50A 3CFEA 2ADJB 1E4XI 1CBVH 1Q9OB 2EP6A 4WCYL 4X2UA 4PLOB 4BKTC 5JW5B 5C92A 3ZKND 1MWAB 3QAZC 3O6LH 3VWJB 4PD4K 3UYRL 1YEKL 1ZVSB 2NY5H 1D5XA 4U6TA 3BT2L 4L8BA 4DKEH 4OZGF 4WUUE 5IWLC 2FX8L 4TF4A 3LDBB 3ELAT 4EKXA 4AV4A 4HPHA 5LXGL 3HI1B 1QPPA 3AY2A 4WW2A 5MEND 5F3BB 4LESA 1KCWA 2CAKA 4XCCH 1FVCA 3KLSA 3QHFH 1QSED 1S7TA 1XX9C 4R26H 4MJIA 4R0LA 4DAGH 1XF2B 4X7TA 2OQJA 1OTTD 2E9BA 3GMOB 4HETA 1DQDH 1I3RB 5FGBA 4RLDA 1QRNB 1FIEA 3FU6A 3GSVA 4N85A 4PJXA 4NT6A 3NCBB 5ICZB 1VPOH 2CKNA 3UP1A 2GK2A 3QDMA 3TBTB 2JJWA 1T5XB 2ZJSH 3VXSB 5K9QG 5HGGS 1VGEH 5IQ7L 4GG6B 1M7XA 4JDVA 5FM5M 4D8PA 4A67A 2R4SL 3KYOB 3G6JF 3QRGL 3KPSE 3MV7A 1KELH 4IU3B 5F7BA 3V0GA 4UQ3A 4LOEA 2LFGA 5AOLA 4PLKC 3RHWK 1MAJA 4MXVF 4YHLL 1OD7A 3GSUB 1CF8H 3IDIB 3FU9A 4NUGL 2A74A 1DP0A 4BXVA 3RJQB 1MJ8H 4H44C 4WW1B 1GJUA 4ICXA 3B3IB 4MWFB 3SGEI 1B2YA 4X6DB 1ZLVH 3B9VA 5T5NF 3MUGB 1ZCRA 3F58L 2E86A 4LVOB 4ODXA 3L3JA 5E23A 5I15H 1EIBA 5I1HL 1G0XA 2P47B 1ADQL 4XN2A 5ILTL 2Q87A 3TF4A 1XF3B 3MGTA 3VMOA 5GGUB 4ZTPL 4ZMOA 4XCNA 1BBDL 1OAUL 1WD9A 1CGXA 3CQQA 5HGDA 5CIPH 4EN3C 2EDOA 1OCWH 4POYA 3Q6FA 2FLBT 4UYQA 3Q3GB 4YXHL 3T71A 4S0SD 3MOAH 3FFDA 1A14L 1MCOL 3QEQA 4QXGH 4Z95H 1XR8B 4BSJA 3DC0A 2VRKA 4Y0GA 3TVMD 1TKWB 3AACA 2F54B 3R1GL 2R15A 1GJWA 1NLBL 3X1FA 1IE4A 5A2KH 3QRBA 1N12A 1H8LA 2KUTA 2ATAA 3QQ4B 5DJCB 2XTJC 1H9VA 1M56B 1IGFL 1M9WA 2QHLA 2YFNA 2WCSA 2JH2A 1UC6A 3C6LB 3DK2A 4Y8DC 2CPCA 1G9MH 5IUCA 1CI3M 1JN6A 3DO7B 4HUUA 2CHDA 3EXLA 2AQQA 2NXYD 2XPGA 3MRPA 3ZDXF 4NOFA 4ZMXA 4KHXH 1U91B 3ARXA 1NUDA 4DK3A 1EO7A 4G1EB 1U58B 3DO4A 4HSQA 3CDCA 2RACA 1J05B 1LTXA 3IMSA 3EJJX 2R1WB 3FT4A 4URTB 4GRWF 1TZIB 4X4YB 1A7PH 3E2HC 4NC0B 4PWIA 4O02H 2C9PA 5HHPB 2E9GA 5B7FA 4AKQA 2APVA 2HTLC 4L3AA 4KMLB 5HI5C 4PRID 1I7ZB 4WWNA 3ESPA 5I2IB 5AB1A 4EDWH 5TFSL 5GS0C 3O6FB 2ID5A 1XH0A 4LPUA 3P2TA 4KNTA 5DD5H 1C5BH 4IJTA 2Z8WC 1P4UA 1UVQB 4C59B 4QHKI 1UZ6F 3CVIH 4F7PB 3V6OA 5FM5O 1AKJB 1MI5E 4FNRA 3QIUD 4LCCC 5D6DC 1LM8V 5J1AA 1ZS2A 3O9WA 5LNDA 2P1YA 1XQ4A 4H8VA 4L5FL 4M7LH 3GBML 2H3NA 1VZIA 4MD4A 3BPCB 3VGAB 3TYGH 4PWEA 3C2AH 5L2KE 4UMGA 4CMHB 4JO4L 2LR4A 1FV1B 3D1MC 1RJYB 3V5DB 1WVZA 4HV8A 2JKTM 5BOPA 1MJ7H 4OCLC 2WSPA 3F7VB 5E6YA 3ZE1E 4PB0L 5IOPA 4O5LL 1FFQA 1ROCA 1NDGA 4TQ8A 1MRDL 4JFEE 1N0XL 1JK8B 2ZSWB 4MDJA 2VLRA 1BFSA 2MHAB 1ZT4B 5I17A 2EDWA 4M7ZB 5BZWB 3HRZC 4H8WL 1N64H 2X4OA 5GGRA 4HULB 1ZLSH 5CEZD 5EOTB 4OZHB 1CR9H 3X17A 2WLJA 3IKCB 4OR1A 4ZXBA 1D9KC 4PTUA 1NPUA 5JW4M 3RWEB 2CG9X 2YD6A 4ZS6D 2D7MA 4XP6H 3GBDA 4TNWK 4GRLA 5TQ0H 3QUXD 3U46A 2MRYA 1FUNA 2VN6A 1VADA 3L3HA 5M7QA 4HQQL 2OSXA 3TT1L 2DBJA 2Z4QA 2FQDA 4U31A 1X5ZA 1PSKL 2R1XB 2HKHL 4LCWD 5EN3A 3RKDD 4YDKL 2DQGH 3RWHA 4FAAB 2EDNA 1NOFA 5SWSE 4FXKB 1M42A 4L3EB 4IGBA 4L8CA 3L6FA 1OAXH 4RRPA 2X1WL 3SPGA 3KW8A 3PHOA 5J13C 3CBJB 1AGDB 2M2DA 2ADFL 4TNWF 1UA3A 1NPNA 1WBXA 3O4OC 3SDCA 4HGMA 2HRLA 4HT1H 2GEQA 2IJ0C 2X4RB 3LN4B 1LEGA 5E0FA 5FYJL 3IMRA 1A6AA 4JM2D 1MJUH 4ZW3A 5CMAA 5I6LA 5EBGA 3JTSB 3RFZB 4BDVA 4KKLD 1DO6A 5FHBL 2UWEA 2VO5A 2AJZA 4GBXC 3H2PA 5HDQL 2AQNA 4W9HC 1GY2A 3ARDA 4EZLA 2XG4B 1K5NA 3VNYA 1M2VA 1W0VA 2EDFA 1RZ8B 1JMZA 4O02B 5B8CB 3NK4A 4WTWA 4E9SA 1RPUA 1R5IA 5ITFB 2GAZB 1XWVA 3HFML 1X4XA 1XZ0B 4AWJC 4ABUA 3T3MF 3WAJA 2DLGA 4UM8B 4KXDA 5DRWB 4P4RA 5FYKH 1KC5H 1UM5L 3TONA 3HBPA 3ES6B 4K94H 3D5OF 1K4DB 3V4PA 1S9VB 3MNVA 2HCZX 3AY4A 1D6EB 4ZMNA 5KYWB 3EYQD 5F0PB 5C0CD 3Q1SL 1I4FB 2ZOOA 1XH3A 4EKJA 3TJEH 3K4DA 5IEKA 4MMYA 4PGBA 2EC8A 4XXWC 4P23A 3QJHB 3O6KH 4GSDH 2IXQA 4XVUC 2BFGA 1OAZH 1GZQA 4AQEB 2EJ1A 3IDXL 1E6OL 4N6RA 5IMKA 3VFVA 5HY9A 4D9QE 5HHOD 3GJFH 4UDUA 2DMKA 4Z3TA 2BVPA 3TCLB 4XXDA 4LF3A 3VFUB 4AIOA 4CC4A 3N2JA 3QWRD 2F7QA 4JAMB 4U3XA 1CD8A 3FB7B 3QQDB 3SQBA 3B9KB 2Q86B 2EDEA 1UOVA 1EJ6A 3FN0L 3M1BA 3WLWC 4XH2B 1ZA3A 4Z7VA 1X9RA 4XWGL 4XO9A 1U8HA 4N2HA 1D7FA 3ZSTA 3KR3H 4NN5C 1G7LB 3JV6B 5CBAA 2JCCE 2HT2C 1S7WB 3QDJA 3RA7L 2C9VA 4Z3EA 1XF4B 2V5MA 1H8NA 2GSGA 1V7MH 1YMMB 2JXMA 2FT8A 5HHME 1S8DA 1FF5A 4NGHH 5DSCB 4GSXA 2AJ3B 3OJDA 3RUGE 3A6BL 4Y9EA 4GINA 4XNZC 4HYTB 3T8MA 5IV2A 3SY6A 4OLYL 2EH8L 3IU4H 2OX5B 4BKLB 4HZAA 4GSUA 4LVNB 4YXKH 5D1ZD 2VC2H 2VXTL 4LCIL 1JGLH 5IROA 3DX7A 4Z7UB 1B0IA 4B9KC 4PSPA 4NN7C 2NNAA 1WITA 1CGSL 5I74C 1CO1A 3PXJA 1CN4A 2ADJA 5F7LB 2WXLA 4ZUSB 1AJ7L 2N1KA 1Q9OA 2V5SA 2HRPH 1TPXC 1MW1A 3TYFB 1MWAA 5IMLB 3DVGB 3VWJA 1IFRA 5DD6A 1ZVSA 2BXYA 2PO6C 2LHAA 3QNXB 1SXCA 15C8L 3DO3A 3LYRA 3QB7C 4KHTL 4B60A 1AI1H 3OHXC 3FQNB 2BFVH 5D7IE 1P1ZB 1QW9A 3NJHA 4UV4H 5BVPL 4Z7QB 3HI1A 5CLTA 3ULSB 5F3BA 3RGVB 4D3CH 5GS1C 2EADA 1HKFA 3K4ZA 1XF2A 4EIBA 1F4AA 4FQLH 4Z77B 1NEPA 4K71C 3GMOA 4PS4H 2O6FA 1I3RA 5A43C 1QRNA 3ETTA 4R7LA 5ICZA 2NY6D 1QATA 4AK2A 5F1OB 5BO1H 5A40E 1U8NB 1ZD6A 2Z65C 43CAA 3FXIC 4PJBE 3P3TA 5J11B 1IKFH 1T5XA 1P69B 2VR7A 4JO3L 1JOIA 3M8OH 3VXSA 3SDXE 5ID0B 4KKCC 4GG6A 1Y1DA 4MAYC 1AHMA 2QJDA 4L8SA 1BPVA 1F3JA 1NGWA 2ICES 3L2NA 5DA0B 3WTSA 3VWKD 1IM3D 3IMUA 3KYOA 2OR9L 2E59A 5F44A 4Q6IC 4UOJA 4YVUA 1BBJB 4IU3A 2VDNL 4QHPA 3UERA 3X1BA 1RERA 3P9LB 3V4PL 4NQVB 5JZ7C 5DJXB 1B4RA 1AY1L 2GIXA 4YR6B 1QZNA 2KBGA 2YAEA 3GSUA 3JWNC 5DWUL 3B9AA 2BSBA 1MFEL 3AQYA 3HLKA 1J1OH 2C4FT 4DOHB 2R39A 1A6TB 4UQEA 2XVKA 4X98A 1W0YT 4AJYV 5ISZA 1AQKH 4P46B 3LZLA 3B3IA 3F6LA 4X6DA 5IGXH 1FC2D 3QC5X 4F7EB 3T0EC 3MUGA 2FH8A 3FBQA 4I0PC 1UCBH 2YAHA 4XO4A 4LRIA 4ZOEA 3I9AA 1N70A 1WE5A 4PS8A 4RMWA 5KTEH 2VISB 2J1WA 1XF3A 4WTZA 2G0KA 4BK5A 5GGUA 4YDJB 4P5SA 5FUOH 3ZUCA 1BYOA 4W9ZA 2NY2D 3INUL 4LLUB 3Q3GA 1FH2A 4HA1A 5DRXB 3R18A 1TVHA 3NFNB 4G9FD 1XR8A 1IQWH 3HR6A 5JDSB 2OCJA 2F54A 1QA9B 4NERA 3OWRA 4IMLB 4IRSB 1NAKL 2F2HA 2VC2B 2YO3A 1USQA 1CFMA 2ZYHA 4Q52A 5CHNB 3QQ4A 2YA2A 4X8XA 3UBXA 1Y7VA 3QI9B 3S8FB 2HVJA 4H2AA 3X1NA 3UTQB 4JZJC 3VGBA 4YIQA 5AL8A 5IIEB 4KRLB 3C6LA 4ABWA 3NZHH 5DGQA 3GHEL 1M2OA 3SYOA 1SOKA 2IPTH 1KGYE 3DO7A 4LEXH 4WGKA 4XMKL 1MWAL 2JQZA 4KROB 5EA0L 4J3XA 4HCFA 1U91A 1YY9D 3SY0A 4G1EA 1LO4H 2F8IA 1TEGA 4WUUB 1ED3B 4G72B 2IDUA 2VSDA 4WWID 5HHNB 3T8VA 1J05A 1KEML 3PWJB 5DD1L 5T1LB 1MHPL 4PV9B 3MRBB 5GZNA 1TZIA 5SWZB 4X4YA 4EI0A 5D2LF 2CALA 4I1PA 5AW0B 2OTWB 1GMEA 2Y9RT 5HHPA 5I0WA 3RIAK 4WK0B 1JZ7A 3ZIYA 3GS4A 1DDTA 5SX4I 5DJAB 3UPCA 1HT6A 3KGRA 3LAFA 3H7LA 2WXGA 3PF2A 5IK3B 1I7ZA 5TPWH 4B9JA 3ARTA 4JLRA 5I2IA 3HHSB 4F20A 3O6FA 4WEBH 3QEUA 3QNFA 1CLYH 1IFHL 2DZEA 4JKMA 1AKJA 2G2NA 3S37L 1OGPA 1JPTL 3F64A 1OTUD 2UXVA 4H0GA 3V9EA 4JDTL 1HHKB 2VLJE 3BPCA 3MMEB 2OJZL 2AANA 2Q3ZA 2PXYD 3KPSB 1KEGL 5D7HA 4M02A 1FV1A 3OKLB 2A5UA 1RJYA 1HX0A 3V5DA 3K6OA 5TDOB 3WFCL 2E7LA 5JPMB 2KH2B 4NPYA 4NO5A 5DZJA 1J9QA 5KBMA 5MI0B 3MLYL 4KNUA 3F7VA 5EEXA 1U6AL 3GPEA 3WMPA 3O3AB 2HJFB 4X6BA 2IGLA 2D8KA 1TQTA 3ECUA 5D2NB 3GEFA 4FQ2L 3FKUS 3D51A 4KK5D 5BMFL 1J1XH 4PJ8B 1ZT4A 3L2MA 5E03A 4Z7OF 5BZWA 5EULV 2DLFH 2VLKD 3UTTD 4GXFA 1YEEL 5EOTA 1K8IB 5CNHA 4OZHA 4CW1A 2L7QA 1LMKA 3MZGB 3IKCA 1TTCA 1RULL 4H88H 3BMWA 3H9SA 3TFBA 4FADA 2DM3A 4YBQD 5FEBA 3EXJA 3AGWA 4R6UA 3RWEA 3MRDB 1CD1B 3GO1L 4D2NA 4HAGA 4NI3A 1DBMH 3BQUC 2G5RA 1J10A 1KYFA 4JKLA 4LSQH 1BWWA 5D1XD 2AJSL 3IDYB 1IKOP 1LO0L 5CN3A 2EXWD 3L81A 2BNQD 2YIHA 1SF3A 3IGAB 1JPSL 4EBQL 4OZIE 1YPZF 4JS7A 2OR7A 4MS6A 3UGEA 4R83A 3Q2VA 4FXKA 3BDYL 1G7HB 4C8XA 3EBIA 4KZDH 3VFSB 3QQ9D 1CWVA 2P46B 1XL6A 3WTVA 1CBVL 1IGCH 3IPBA 5F9OH 3K5SA 4ANWA 1BVOA 2JJSA 3QCUH 2OJ1A 1PU0A 1AGDA 4UTAA 4UIMB 3U2SA 4JG1H 1QEWA 1R3IL 1I7RA 3IFPB 5KANG 3U7WL 4QOKA 2NY5L 3AW5A 4JPIB 4XAWL 3WEMA 1O9WA 5CN1A 2ZCLH 4DKEL 2X4RA 3LN4A 4NNPL 2CLRB 1R24B 1X5YA 3JTSA 2V33A 1M1XB 3BVUA 5B3JE 2EUWA 3S0PA 5JORB 1M53A 5E6UB 2AW2A 2E7BA 4MSWB 1AZVA 1RZ8A 2TSBA 4FL4B 4LPXA 3SPVB 4KY1H 1S5HA 3QHFL 5B8CA 5F7MC 1NZRA 5HJ3A 3B2UC 4R26L 3B2DC 1PG7X 4UDTB 5ITFA 3SPJA 2GAZA 1BZ7A 3TL5A 3PUUA 1XZ0A 1X6NA 2KYIA 1DQDL 5F6IC 5HHVH 1RSYA 1ODUA 5I82A 4UM8A 5DRWA 3T4AC 4PJGB 2B20A 4YHOH 4LCYA 1RUQH 1BVZA 5IB1B 1NFIA 1KBGH 1K4DA 2DQMA 2K9FB 2CUMA 1VGEL 3NJLA 4UBDC 1I4FA 4RAHA 4WI9A 3HIZA 1A4CA 2P52A 3S9DB 1A4AA 4XAKD 4W9KC 4PJ6A 1HZKA 2P5WD 3FQXB 1E3FA 3GXTA 3KPTA 4PJDF 4K73A 4AQEA 5LG6A 4DCQA 2FB4H 4HHWA 5KSBF 5L2KB 3BSGA 1A66A 4M9PA 5DC9B 2G3MA 3TCLA 2FBJL 4CKVX 1IGIH 2ZICA 5I26A 3VFUA 5JPNC 1M3IA 4JAMA 4QO1A 1JF1A 4X9GA 5KZCB 3ELQA 1MJ8L 3FB7A 2DJMA 3AS2A 3QQDA 3OB0K 4JPWH 3ZE1B 1YUHB 5GSRB 4Y1AE 1FNFA 4OFPA 4XH2A 1OF2B 2B08A 2ZNWA 4JFEB 3TO4A 4N2DA 1DCEA 3RWJB 1G7LA 1NSNH 1S7WA 5I15L 1XF4A 3BP7B 3UYOD 4XPHH 3CN2A 1YMMA 1T7WA 5EWIL 4MXQD 4WIQA 1RZ7H 4M61B 3EFOB 1OCWL 2OX5A 2CNYA 4G6KH 4AIEA 5CZKA 3MOAL 3TN0C 1QI4A 4Z7UA 1EHXA 1XGQB 1LWHA 1JF5A 5T3XD 2X9YA 1J5CA 2QFRA 3ZTDC 2C7FA 4ZUSA 1F3DJ 2VDQH 5IW1B 3FONB 4AH2B 1MVYA 4W9CC 3CHXA 3D33A 3TYFA 3RI5F 5IMLA 3DVGA 5AW9B 3IF1B 5SWSB 1G87A 3SO3B 3IFNH 3MLVH 2J2ZB 2PETA 3FQNA 1G9ML 5D5MB 2YBRB 1P1ZA 4JK0D 1IRAY 4PRNB 2YMXL 2G75B 3ZZ1A 4ZNEE 3ULSA 5E1QA 2XWTB 4KQ3H 3KAAA 1SHWA 1IEAB 1NIDA 3DK0A 1D2OA 4KHXL 1FRGH 3BP6B 1XD0A 2VRAA 3FQRA 4U7MA 1CB4A 5C2BL 2A9CA 3DXAB 1IAIM 4GP5B 3BAYA 1JYVA 3MV9D 5F9JA 4BXSV 3ZDZF 1VKXA 1A7PL 2DWTA 1C7SA 3CU1A 5F7KC 4X6EB 4AV0A 3H56A 4MYWB 1NIAA 2A2QT 3M1CA 1WDAA 2BZDA 4O02L 5DS8B 5C09A 5ID0A 1HWGB 4GAJH 5G2NA 3BFQG 3UOAB 3KHOA 2XBDA 4YSRA 3BVNB 2RQ8A 2YJQA 3GLZA 1L0XA 5DQ9B 5IB5B 4R5VA 4XWOD 3ZTNH 4EDWL 1NUNB 1C5BL 1BBJA 2MOVA 3RNQB 1KTCA 2X9ZA 1RK1B 4KI5E 4NQVA 2N3JA 5DJXA 4JBSA 3DGCR 4YR6A 5CCKL 2PNDA 2A1WL 4M7LL 3X2QB 4IRJA 1NBCA 4U6YB 3TJHD 4DN4H 4D9LH 3TYGL 4MB1A 3C2AL 1A6TA 3UCRA 3DYOA 3E6HA 4X99B 4BQBA 4P46A 4PJAA 1BX2A 1EEUA 4H8PA 3REVB 2IWKA 1MJ7L 3OKKB 2HXAA 5IB2B 1ACXA 1W72H 4HDIB 2Z1PA 3LCYA 3QUZB 2VISA 4IBTA 2H6UA 1SJHB 4DTGH 4KK6C 4M5ZH 4YDJA 1C5DA 3Q8CA 1QX1A 3FU3A 2EVIA 4QRAA 3IPEA 4PSRA 1MPAH 4LP8A 1N64L 4WW2C 3SJVD 4JQIH 4LLUA 1ZLSL 3DGGB 5DRXA 4I48A 1U8OB 1CR9L 1FYTE 3NFNA 2Z8SA 4F3FB 5E08H 5EU7E 4XMPH 5D4QA 5AUMB 4G8AC 5D7JB 5JDSA 1AR1C 1QA9A 1SLUA 2IQAB 5HHMB 4IMLA 4IRSA 3TF7C 5FGBC 2GBTA 1LEKA 1CURA 4XP6L 2JKXA 3LRHA 2D3JA 5TQ0L 3RUGB 5EH1A 1WCBA 3KDMB 5CHNA 1MFAH 1DQLH 4TNVK 1N5YL 4LKCB 4PVLA 4R9HA 2F53B 4N86A 3X11B 2ADYA 2VDQB 2VZ3A 1NFAA 5J6HB 5IIEA 2C4XA 3E8UL 4PJEE 1KWGA 4KX7A 3QDGE 5EEWA 1IO4C 1OAXL 2BVEA 1OT4A 4JANB 2H2PC 3UZVB 3SQRA 1BLNB 1EO8H 5HHNA 4NC2B 1ED3A 2WC7A 2QR0A 3OKDB 4P48A 1B9ZA 3PWJA 1BIIA 5T1LA 1ZPLA 2K78A 4HT1L 3MRBA 4NQQA 4TNVF 1KXTA 5D7IB 5SWZA 3D85B 4JEGB 1TQUA 3VU2A 4JM4H 1X9UA 5AYUH 4NUQA 3MRJA 2OTWA 3OKNB 1NANH 4L1DA 2HUHA 1DVFD 3WEXB 4KRNA 1OIOA 1Z9LA 4ONFH 4F24A 2A6KB 4N87A 5DJAA 2BVOB 3QORC 2NZIA 4YWGL 2WBWB 2CO4A 3NJJA 4RMTA 3HHSA 4I3GA 1BA9A 4G80A 1R3KA 3QP3A 4G7QB 4YSDA 4ISVB 4J8RB 5C0JB 2R69H 3SDDC 1KPVB 2Z64C 1B0RA 2MNJB 3O4LE 3D34A 4GQQA 3C5XA 4D7BA 1BF8A 1P84J 2I25N 4AIXA 4JHVA 8FABA 5C0AE 3ULUF 5IHZB 3OKOB 1HHKA 1KC5L 2V37A 2VMDA 3MMEA 4K94L 3BVTA 3ZR6A 1LP9F 3D39E 2VM3A 1RURL 3TWCH 3LD8C 1WUNT 4ZMWA 4DQOH 2OMTB 3HBZA 3QIWC 1BV8A 2APTA 4GKOA 5TDOA 1L4IA 1BQLH 4CSPA 1TYRA 5KAQG 5JPMA 1TTAA 3KBPA 5ESQB 4JCMA 4GXVH 1NGQL 4CDHA 1HXYB 1TJGH 2W0PA 4HGWB 3O3AA 4P2RE 2HJFA 3D18B 4BIKA 1DVSA 3ZSSA 4ENED 3KPRA 4UNTA 3QJTB 5D2NA 4RIRA 4IRZH 1K2DB 2ZUVA 2IADB 3FQ2A 2IV8A 1W72B 2EXYD 4XP9L 2KS0A 4W9DC 4G8EB 5FO8A 3V9FA 1D3CA 1K8IA 1B0WA 1YYCA 4M62H 4FFZA 4RFEB 5DURD 4HU2A 3DSNA 2XI9A 1VCAA 1DVYA 2FIRT 1CFSB 3KR3L 3MRDA 1CD1A 1MQ8A 3MHZA 4RMRA 4XN5A 5AOMA 5HHXH 5I30H 3DJTA 3PL6C 4LIQL 4DVRH 5SV3A 3JWOC 2Y7LA 3BVDB 4LBAA 3WLBA 4G9DB 1V7ML 5E6IB 4U4BA 4NGHL 4JFWA 3VM5A 4JRYA 3EO0B 1WHPA 3IGAA 1OAKH 1OKEA 1OSZB 1E3XA 2Z3FA 4YXKL 5HXMA 2VC2L 3LIZA 1UG9A 1JGLL 1U95B 4PJFE 3ARGC 3FHEA 4WHTB 1GAFH 5IVOA 3VFSA 3P4MB 3F6IA 4LHUA 4HS8H 2BNRB 4ALAL 3V6OC 4JE0A 2QHRH 2A4EA 2HRPL 3O9WC 4UIMA 3MO1B 3FSVA 3IFPA 3ZO0A 1RUKH 5I8EB 1T6BX 2XN9B 3C9NA 1AMXA 4GI9A 3UMNA 1PZCA 1D7CA 3GTNA 1HQ4B 2CLRA 5E8NB 1R24A 2BFVL 3LIUA 2Z35B 3QC6X 1HEHC 1IKNC 3ISWA 1M1XA 4RWYH 1PD6A 4C4KT 3HPLA 1IGMH 2OMZB 1OHZA 4MXWH 1BM3H 3PE9A 3RGBA 4MSWA 1NCHA 4D3CL 3O2DH 2QFPA 3SPVA 5AVQB 2GJ6B 1A8ZA 4QF1B 2JF1A 4HXAH 2F5BH 2UUDH 4UDTA 1RY7B 3C8KA 2FL5A 2X6BA 5L6YL 4K5NA 1G94A 3K6DA 4HXBH 2HMIC 1T5WB 2XQBH 4QRPE 3EHBC 5ITBH 1AZCA 1MCIA 4PJGA 4QKXB 5FS5A 4MMXB 3TS8A 5KWYC 2YPLE 1IKFL 2OL3A 3M8OL 2K70A 4YSSA 5F7WC 2OZ4H 4XMXA 3VXRD 2BMKB 4ZXBC 4H26B 4Y4KC 5T1KD 1OPGH 1TYJA 3HG1B 4PLKD 4PBXA 2CPUA 5GRZA 4ANVA 3EO1B 1MCRA 3FQXA 3PS6A 3VGHA 4LQ1A 4FJ6A 1TYEB 2YWZA 4YHYC 4JRXE 2ZUYA 3SYQA 2Y69B 1JNNH 5DWPA 5DZNA 3NSYA 5L2KA 1KSRA 2BVQB 5FUZH 4N8VG 4JKPL 1KPUB 1J1OL 1MCFA 4TXVB 2FEDC 4FXGB 4X6FB 4UI2A 1AQKL 2GITA 4IGBC 2O5YH 4AZUA 1YUHA 5GSRA 1T3FA 3KS0J 4ZSOB 1JBJA 1RUPH 3LXUX 4HP5A 3TESA 2YZ1A 1AVAA 3HN5A 4JFEA 1BVLB 1CGVA 1SHMA 2AV7B 2IALB 4APQB 1ZK5A 2AI0H 3WY4A 3D06A 1PMYA 2OV0A 3FAWA 4EN3D 3BP7A 5KTEL 4R7XA 4E41B 5C07D 1DUYA 3I9PA 1UJ3C 3MCYA 3P77B 4MZIA 2Y1ZA 5FUOL 5EIIG 3AWEA 5FC9A 4Y19D 3U1QA 5J8OA 2DQDH 1JYXA 2VXQA 3S5YA 3VXUA 3PQYD 3RTQB 4WTXA 5DK2B 4YLCA 1RZJH 2MCAA 1A22B 2N7AA 1MN4A 2DW5A 4AW4A 1GJIA 1WICA 4OF6A 1LDSA 2OI9C 3KLHD 4WHYG 2B1AH 1IQWL 1CS6A 2XTJD 1MCQA 4M4RB 3VH8G 4PJCA 3G5ZB 3EOAB 5GS2D 5IW1A 2XICA 3FONA 4N2EA 3TP4A 1A3ZA 4P3WA 2FJHB 2IDCA 4A38A 5JTWA 4RA0C 4Q0XH 1ZLUH 2Y1YA 3AY4C 3DOHA 2Q7NA 2J2ZA 4ETQA 1LVEA 5D5MA 4OCYH 2AP2A 2YBRA 5BOZG 4HX1B 4ZAKB 3DHPA 4PRNA 4ACPA 5E2UH 4WFFD 1CGYA 1RH8A 2G75A 2IPTL 2BNUB 1A64A 3HN3A 3L7FB 4LEXL 2XWTA 5HDOA 3IE4A 3D25A 4Y88A 4TL5A 3FUHA 2OMNA 2JK5B 4HKJB 1U3NA 4ICWA 1IL1A 3M6DA 1A9EA 2XN0A 3HG2A 4K9JA 5LAXB 3WN5C 2KPWA 4FQXB 3DXAA 1SQ2N 2NOYA 4PWJA 1JV5B 1RP9A 1AFVH 2HTLD 4PFEA 3UTPE 5HI5D 1XCTB 5B39G 3I75A 4E5XG 3QEGL 2DQFB 3IK2A 1LQSR 5GS0D 2RB8A 2DM7A 2YWYA 1AS7A 4P5MB 3APFA 5IJVA 4QCIA 5I8OH 3NCWA 1KCBA 4ZX3A 4WI4A 5ECGA 5DJ6B 5EU4B 3HUJB 4WHYH 4K7PL 2UV3A 4WNSA 4WEBL 3BKYH 3CUPB 3RNQA 2ZG3A 5CD3A 1CLYL 4R7DB 4WGWB 1RK1A 3FQTA 4QXUL 4YBLB 4KV5E 5DHVA 4F9LA 4G43B 4U6YA 3SZ6A 3OTTA 5FUCE 2I7OA 2QTVA 2ZOWA 3P3RA 4X99A 5DJ8B 5IROC 4LSVH 1LXMA 4IHBA 4MRCA 4DPAX 4W4NA 1H6FA 3MNMA 3OKKA 2PWHA 3EYFB 2WNXA 3WN6A 4GLRH 1IC5H 4YSCA 4HDIA 2X6AA 1A7NH 1RD6A 3QUZA 3REWB 1YEHH 1GH7A 1HH6B 1SJHA 2AEOA 2AQPA 1H9DA 1J1XL 1QUNB 3BRDA 3FUNA 2VM4A 1H6TA 1JNLH 1DQIA 1D9KD 4N2MA 2DLFL 5JXAL 5I6XB 3CC1A 3DGGA 4N8UA 4OQTH 5IZ7A 1U8OA 4TVPD 1FZKB 3BZ5A 3OSVA 4N0UB 4P59H 4H88L 4LGPB 1PVHA 2JJTA 5D7JA 4ERSH 1GTFA 1EAPB 4H1LG 1BXAA 1VRSA 3TH2T 1G4RA 2C9QA 2IQAA 3LJ3A 3ARFB 3U4EB 1JNHB 3SCMC 1DBML 5GJSH 5K33A 3LV3B 2VXQL 3KLQA 4OZGB 2J56A 2WCPA 5HDBE 5DHEA 1GKOA 2JKNA 4NDMB 3KZ8A 3X11A 4A7VA 2F53A 3D4YA 3QJZA 5MEPB 1YRKA 2YJLA 3J2PA 4A2EA 2A3TA 4CC1A 4L8SC 4ELME 2FK9A 5E8DL 4TPRL 4PPTA 4JHUA 3K2IA 5F89B 5E9DB 2ZAHA 4N8VB 3U36A 4BCXA 4KZDL 3QZNA 2ZX6A 5K69A 2XZQL 5IM7B 1ACYL 3UAJA 2M26A 1ZHKB 4JANA 3D69B 4TS6A 4Y4FC 3BAXA 3UZVA 4N3UA 2A7BA 1BLNA 3QCUL 4A37A 3OKDA 4F9PC 4JG1L 1KCVH 1SNRA 3GXNA 3A6OA 4GBXD 1NOLA 3D85A 5F88B 1FO0H 3PWNB 3T8XB 2K3HA 3OMZA 2GC4C 4I1RA 3DSFH 3WEXA 5C6PB 2Z31C 1HSBB 2A6KA 1TENA 2XLLA 3G6JB 3D0LB 4FZ8L 5EIIB 3ZYJA 4BFEA 4KI5C 3WXWL 4AQ1B 1IQDA 2WBJC 5K93A 3GPSA 4KY1L 1PF3A 4H1LH 4CJ1A 3CLEH 4XN9A 1OOWA 1N5AA 1OW0A 4W6XB 5C0JA 2VQ1B 1KPVA 3ATAA 2PP9A 2BJMH 3H7BB 5HHVL 3WY3A 4BK5C 4Z5RB 1CG9B 3ZDYE 1LO2H 4B27A 3VH8B 5ACZB 5KSAD 4AC4A 5CR1A 4JDEB 4NZRH 5L2JB 3OKOA 1RUQL 2QGDA 2NY7H 1B2WH 4KJWC 2WWKT 1UHVA 4XVUD 1YYMH 3B1TA 1HNFA 2R29H 4P57B 2E56A 1RZPA 3SE4A 3ISYA 2ZWSA 4C4KO 4DERA 5T33H 3JWDC 3W5NA 4JFOB 1FLRL 2GCYB 2BCKA 1XGRA 5IMOB 4CN1A 4AJVA 1XMEB 2DV6A 2FB4L 4HS6A 4J3SA 4CC0A 5AW2B 2KLRA 1EPFA 1XHHA 1BAFH 4P04A 1CBJA 1K2DA 3CTTA 3F85A 3WLWD 2OYPA 1IGIL 5EU7C 3FN9A 3K72B 5JNYB 2C5DC 3X13B 2NX5E 3AWGA 3QJFB 4G8EA 1AZBA 3SB3A 1QWHA 1QWNA 1TQWA 2DYPD 3BAKA 4JPWL 4K07A 4QXWA 3WNKA 3FZUC 4O2CB 4DO4A 4G6FD 3EAKA 4E5XB 3U82B 4XHQA 3ME0B 5AW3B 1AO7E 3WS3B 3QARA 1AKPA 4I5BB 2X2JA 4DFHA 4N2CA 4RGOH 4A7SA 4WY7H 5GZNC 2HKAA 4WTQA 2YKKA 5E6IA 5MHSE 1KB5H 1RZ7L 4JUSA 2KC0A 3EO0A 1B3JA 1UOWA 2V8MA 3A6CL 1WIPA 4N4YB 1FZOA 4U0RC 1OSZA 4G6KL 1HIML 2NY3B 3O45A 1U95A 3BSHA 3L4TA 2KQMA 4WHTA 3P4MA 3S36X 5TTRA 1I85A 3KL0A 3T4YB 2BNRA 2PO6D 1OZUA 4JX0A 2VDQL 3M88A 5DVNA 5J5EA 4OFVA 2QMKA 4GRWB 1F11B 3MO1A 3DMMC 5EU6E 5H94B 3HZKB 3HVNA 3IE9A 3MN8A 3OGCB 4PJEB 2XBZA 2XN9A 1I3GH 1EUUA 4HUXA 3S2CA 5CJOH 3QDGB 1GYUA 3MLVL 1HQ4A 3LKNB 2Z35A 1DUZB 5I71B 4OCSH 5D96C 4P2QE 2BRQA 1SOXA 2ADIB 2DN7A 2P8MB 3N0PB 3GZPA 1FO0B 2OMZA 2JV6A 4UNUA 3Q06A 2LT9A 4HZ1A 5KOMC 2BXZA 4ZX6A 2GJ6A 3DIVA 1OP5H 1XTMA 4Z3GA 3NCYP 4NM8H 2Y2TA 1H3UA 2A6DB 3SDAA 1H6EA 2VQUA 4WI6A 1T5WA 4KKCD 3CX5J 4MAYD 2EZ0C 1NIEA 3HAEG 3HC2A 1PX4A 2R69A 3V4VA 4KUZH 4MMXA 4OGAC 4F2MB 2Z7ZA 1DQKA 3BXNB 4GAJL 1U93B 3MUJA 5JA8B 3EYVB 2BMKA 3WCYA 4H26A 3TO2B 1DJWA 2FD6L 4WSGA 5EIQA 3D3VB 2J8UF 3HG1A 1T1ZB 4KFZC 1LK2A 1UEYA 5JZ7D 1I8IB 3EO1A 3ZTNL 4UQ2B 1AMYA 4JMNA 1RP8A 5C0AB 4P8QA 5D1QE 3VMPA 4ZODA 2CLZB 4RZCB 4DETA 2HLFC 2OMVB 3D39B 2V5TA 4BZYA 4PW3A 2OYKA 1S4IA 3WO3B 2GJRA 4FQJH 4DN4L 4D9LL 2Z92B 5JHDB 3T0ED 4I0PD 3G5YA 4K3JL 1JCVA 4JFXB 3RL2A 3VQ2C 3MLWH 4ZSOA 3BP5A 4P2RB 4YZFE 3BJLA 2FAUA 2EIKB 5DHXB 2L7EA 1BVLA 1F6FB 4MA7L 2AV7A 2Y5EA 2C8NA 4KFMA 3S48A 1W72L 3BSZH 3HC3H 5BRZD 4U0QB 1GOGA 2CE6A 4E41A 1E5UI 3I02A 5A3IC 2ICEB 4DTGL 5FFLA 3HAEH 2ZSVB 2B1OA 1BVNT 2LOEA 2P80A 3LEVL 2Z91A 3SKUD 1NDMB 1JXJA 4B7LA 2Y24A 3RTQA 2IH8A 2ITDA 1BZDA 1HHJB 1UD8A 4JQIL 5DK2A 4G83A 2A4ZA 1HYSC 5AKVA 1KB5B 3IJ8A 5DS2A 5E08L 1VLXA 4M4RA 1QWUA 1Y18B 4RFOL 3G5ZA 3EOAA 2D0GA 4KQ4L 1JDDA 1JTOA 2FJHA 4XVTH 5A7BA 2BINA 1MFAL 1J5OL 5DUJA 5DZOA 1CZ8H 1DQLL 3RP1A 2BSED 2XA3A 2MPAH 2WZPD 3DVIA 1N2RA 1R34A 4KGLA 4S1SH 5J0BA 3BFOA 1QOKA 1EWHA 3H9HB 3ZHDA 4HX1A 3R8QA 4ZAKA 2C1OA 2X05A 2R51A 5HYSB 1J0IA 2CO6A 4MNGA 4X6CE 2BNUA 1UJTA 4EZKA 2W0KA 3SBRA 3WJJA 1KY7A 1F4YH 4Z7WF 2JK5A 4HKJA 4IIQB 1Z7JA 2EEBA 1EO8L 1NCGA 4R97C 3T3MB 4XN1A 1PL3A 4FQXA 3RDJA 4IBWA 1W16A 3KLDA 4M4PA 4GMSH 2H41A 1I1YB 3BPNC 4QNPF 1IGTB 1JV5A 1E27B 1DQQB 4FF9A 4JM4L 1XCTA 5AYUL 5C0BD 4LAJH 3WNPA 2CJTA 4GH7B 2DQFA 2A73B 3MRMA 1GGCH 2FE0A 2IDQA 5KVEH 3ECBA 4ONFL 3AG2B 3S3BB 3TO4C 5DJ6A 4DNLA 3HUJA 3R4RA 2G30A 1E4JA 1GZHC 4K7FB 2OZ4A 1SXAA 3CUPA 5TK2A 4QRPB 2R69L 3NACH 4QRRE 4R7DA 3RDTB 2HKFH 3EH3B 4AIZB 2ZCHL 2XRAH 1I1CA 3FU8A 3KL5A 1O9VA 4RGMC 2YPLB 3RILA 4ILDA 1PQZB 3HLAA 2EDLA 4JNXA 4G43A 1TZAA 3L5IA 1WAPA 3C87A 4PRHA 1Q0YH 4OLZH 5LG1A 2WYZA 3QXWA 4IOSA 3LEXB 1XVSA 4E9XA 3H4FA 2W94A 5CP3H 1BQLL 4J2QA 1OWRM 2CO2A 3GMLB 3AITA 2X10A 4WJ5B 1ESOA 4WF7A 3EYFA 4RMUA 5GGSY 3EJUA 3I3DA 3D48R 3S7GA 1TJGL 4XE5B 4JG5A 4RVBA 3IETB 4PGDB 2DRUA 4XB3A 2YGOA 3PWVB 3SDYH 3PAYA 5C0RL 2NDFA 1HH6A 4IRZL 3RRQA 3ASOB 5DZ9A 2B59B 1S6NA 1QUNA 1O5PA 4G8GB 5FO7B 4ZQKA 1A2YA 4N68A 3S34L 3RE0A 2Y7QB 1MFCH 4NQCE 4CL7A 4EI5C 2XG5A 3HAEB 3BQUD 4M62L 2DJ4A 4HISA 1FZKA 4N0UA 2C3WA 3WO4C 5CINH 3ZE2E 3DTXA 2AZAA 2YHGA 4K4KA 4QGYA 5E4IA 5HHXL 1S3KH 2IANA 3ARFA 3QUYC 5I30L 1JNHA 4G1MB 4NO3A 3ZTEA 3LV3A 4DVRL 1OV8A 4AM0B 3MACH 4OZGA 1NA8A 3P4LA 4DP9X 2ITCB 1NFDE 5MEPA 5F9DC 2FYYA 2EEAA 4ZZKA 1X9QA 1DYZA 3E80A 2OS7A 4P99A 2CUAA 1OAKL 2PTUA 1WV7T 4KITB 2WLMA 3SD5A 5E8OB 4UCFA 3CSYA 3HHMA 5F89A 1NUFA 5E9DA 4N8VA 2ED8A 3EOYG 5ICUA 3AU1B 1GAFL 1Z9SB 1FNSH 5F71A 1PIGA 4U33A 5HVHB 3D69A 3A4EA 4HBQA 2BY1A 3A4AA 3L3OA 3OF6D 1PCSA 1UH2A 1X5GA 3MGOA 5HGBB 3Q8FA 4IRJC 2QZ5A 5C70A 5F88A 2A0LC 2CJ3A 4CVWA 1MI5D 1UENA 3T8XA 3MBXL 3RX5A 3WIFB 1SJMA 2H9GA 4LLQB 4PRPE 3B2UD 4RWYL 1HSBA 4S1QH 5J89A 1IGML 2RHEA 3PIQA 3G6JA 3KH4A 3D0LA 2VLLA 1BM3L 5DYOB 2D4DA 1BFOB 4LSRH 5EO1B 5A2CA 3S3DB 3QIBB 1ZT1B 1ZS8B 3NJIA 1HOEA 4ODTH 2F5BL 4R7NB 3U7AA 1HN1A 1D6VL 2VQ1A 4DN3L 2XT1B 2J71A 4WV1C 5FUCC 2PW1B 2Q6WB 2ARJQ 3H7BA 4HXBL 5AVWB 2XQBL 4Z5RA 4UBDD 4HW6A 2R8SH 3G6DL 3VH8A 5ACZA 2DQUH 5ITBL 4JJOA 1G9EA 1XXFC 1IE5A 2KKQA 2HT4C 4K8RC 1Q38A 1A3RH 2LABA 1F3RB 2OZ4L 4P3CH 5FA4B 4KMTH 3QUGA 3LKOB 4AVHA 7FABH 5MENE 4M7JH 4PTTB 3IRZA 1OPGL 2TAAA 4Y1TA 3DARA 3V0JA 2FT6A 3MUZ1 4U1SB 1QSEE 1TETH 2AKRA 4ZYKB 5KG9A 4POUB 4BZ1A 3BDBA 4JFOA 3BGFC 2Z0UA 4NO0D 2GCYA 3WIHH 2QVKA 5IMOA 5C3IA 2YKLL 2LTQC 4ALAC 2EYRA 3QUMH 1YAIA 1R19A 2CR3A 4LSDA 3ZRCC 3P4NB 2VDKB 2P44B 4PJIF 3OPZL 1FVEB 4AJ0A 1U3HB 4AUJA 4GUCA 5FPIA 5FUZL 1KIRB 1WZMA 4PS7A 3BD4A 1GRWA 3QQ3A 3ZZSA 3K72A 5LDSA 1U8LA 3LZPA 3X13A 1R3JA 5IQNA 2B2XH 2O5YL 4WI0B 5H2BA 1GY1A 4L9DA 1RUPL 2N7BA 4E5XA 3ME0A 3NRFA 2WXIA 3WS3A 1K72A 3V79C 2B3RA 3F7LA 1F13A 3S3CB 4I5BA 2NYZA 4OQTA 3WMSA 1GS8A 1G5AA 5E2VH 1IZKA 3F3HA 2CU9A 5ESAB 5IW6A 3BMVA 1ZV9A 2JB5L 3WEAA 3DX8B 3TN0D 4PV1C 2DICA 3O6ML 4FQCH 3SIKA 1I8LC 2DWEB 5H35A 1GXEA 3C5ZB 4OB5L 2PPEA 4I9WE 4JREB 4LL9A 3FH7A 4KJYB 2X4QB 2FSEB 4NO2B 3VO0A 2B3IA 2XKNB 2XV6B 2XWDA 2LVCA 2O5XL 4DZ8A 2B1AL 1I9EA 3T4YA 4XVJH 3TXAA 1MCNA 3O0LA 3WFDH 3DRQB 1F11A 1GW6A 3K3QA 4YDVA 2HWZH 3HZKA 4Q6YA 4XP1H 3OGCA 5H94A 5AD0B 3CFBB 4PJEA 3IN0A 2QV2A 2G3XA 4DKAA 4TSBH 4ELMB 1TEFA 5DR5H 4Q0XL 4P9ML 3MRRB 3LZRA 4PD4J 3UFIA 1XXDC 2OR8A 3LKNA 3MSPA 4X7CC 3TH3T 2ADIA 5E2UL 4BH8B 4OIIL 1FO0A 4KO7A 5LBSH 4KTYA 1Z5YD 5H8DA 4ACTA 4KRMB 3T6WA 2E8ZA 1E0OB 4GEJA 2GPZA 2J88H 2A6DA 3W57A 4RX4D 3TEWA 1CUOA 2G4EA 4L4TE 3S98A 1JE6A 3BWZA 1N4XH 4W70A 1OO2A 1R3HB 4D9QD 4F2MA 3IGFA 3OAZH 3BXNA 3Q48A 1U93A 3PGFH 4GI8A 4KK8C 3MV8B 3EDKA 3EYVA 5LLIC 3MJ9H 1CIUA 3N43B 2EVFA 3D3VA 3TA3B 2VXSL 1T1ZA 2W65B 1ET8A 5DD3L 5FDYA 5KEZA 2Y7OA 4NI6A 1I8IA 1K4CB 3V5KA 1X5AA 2X1PA 4UQ2A 3BKYL 4IK7A 4BBWA 3ZDYB 1NCIA 5AVSB 3QO1B 3WAKA 4AENB 3LQZB 1WWWX 4F57H 4NQSA 5B22A 1KIPB 2R29A 1O6TA 1UKTA 2WWMC 5KOVC 2CLZA 3LXBA 4RZCA 4RCAA 2X0UA 4NZFA 2F61A 2OMVA 1V7NH 3HZYA 4EO5A 4YFLI 2F1BA 4OT1H 2Z92A 5JHDA 2W80C 3AVEA 3L3DB 3QUMB 1HWWA 4FNQA 4BZ1L 4LSVL 1NGPH 1CL7H 2EEDA 4JFXA 2ZUSA 1MDTA 1ZSDB 1S46A 3TEUA 7TAAA 1AGFB 4ZMYA 4P2RA 2MOGA 4RMBA 4JGMA 1RLWA 4AYFA 4K9EH 4A6YA 5K59F 2Z7WA 2DMHA 3KJ4C 4KK6D 4DT2A 1WJ3A 4X50A 2ZOLB 4ZO6A 1QASA 4Y5XC 1Q0XL 2ZPKH 1CDUA 1A7NL 1AH1A 1AZRA 1YEHL 4B7IA 5F7NC 2NX5B 3C60C 2YEZB 5KYXB 4ATTA 2ICEA 4D9RE 1OALA 5C3TA 5KS9F 4JN2B 1K3IA 1TIUA 1JNLL 4E68A 1NDMA 5JIDA 2YAMA 3KPLB 1FFOB 3SPCA 3OLEA 1AR1D 3MFFB 5GPRA 3FJTA 1HHJA 3QPKA 2UYLB 4OQTL 2N7SA 2PLTA 1I8UA 1KB5A 3N1FC 1IC0A 4P59L 1E8WA 4GQ9H 3QZMA 3QDMD 2IH9A 1Y18A 1CFVH 2BZ7A 3I3EA 2ZCKH 2Y4SA 3MREB 3N40P 2XETA 5GJSL 5EU5A 4ZMVA 4GIOA 6TAAA 5JR1H 5J12C 3HI5L 4PMFA 3ZKXC 1PBYA 3FDWA 1TNMA 5DUMH 3H53A 2NCMA 1P4IH 5JQ6H 4JDZB 1X5FA 3H9HA 3BH9B 2H2PD 5CEZE 2JJUA 1G9HA 1QABA 4HOXA 5HYSA 4F93B 1AZUA 3ZLQC 1J8KA 1BD2E 3PP3K 1R9FA 3K6SB 1PDKB 3NIDE 1ZIAA 5HGAB 1KZQA 4FKEA 4IIQA 3TM6A 3OMAB 4YSAA 3ALXA 2XHNA <