1NICA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA02
2YAQA 2HX8A 2PPCA 5AZUA 1A4CA 1JZFA 2WO3B 2DV6A 2AZUA 3QJUB 2Y69B 1PLCA 2FQGA 4E9WA 4F2FA 2QDVA 2FNWA 4YSDA 4BK5C 1V10A 3DTUB 2BO0A 4HCIA 2IDFA 5I6LA 1X9RA 2IWKA 4UF7C 4BDVA 1CURA 2TSBA 1KDIA 2PCFA 2YAFA 2FQDA 1KBWA 3ABGA 1PZBA 2PPFA 3IEAA 3BQVA 5E9NA 1M56B 2QT6A 1NIFA 2J5WA 4DP5X 1L9SA 2OJ1A 2JXMA 4DP1X 1BAWA 2BP0B 3ABMB 3CZUB 2FTAA 2DWSA 1TEFA 3QJVB 3FU7B 3QJRB 4Q89A 3NJLA 4YSAA 3EHBB 1KCBA 1OE2A 1BXAA 1PAZA 6PCYA 2BW4A 3NYKA 1HAWA 4G71B 1B3IA 1AS8A 4W1TA 3X1BA 3GXUB 1EHKB 3S3DB 4DP4X 2MTAA 4YVNA 2UXTA 3N2JA 2Q5BA 3NSFA 2GC7C 3X1FA 1PY0A 2JFCA 3AY2A 2EIKB 2N0MA 6PAZA 4YSUA 1GS6X 2ZXWB 1AG0A 1WA0X 2HXAA 1SF3A 1A8ZA 1WA2X 3DKHA 3OQRA 9PCYA 5D4JA 4GP8B 1X9UA 2BZ7A 2GSMB 4YVUA 2XWZA 1IBYA 1JVLA 4QKTA 1DYZA 2TSAA 4BXVA 1JZEA 3ZIYA 3NSDA 1E65A 4AZUA 4ENZA 4YSQA 3QQXA 4YSRA 2ZONA 4DPCX 2AFNA 2UX7A 1IUZA 4EF3A 1J5CA 2YAHA 1OV8A 3FT0A 3IN0A 1URIA 2HRHA 3EH3B 5AFAA 3X1EA 3PLYA 4NERA 1OE3A 2XV2A 1BEXA 1GY2A 1KDJA 3HB3B 2VM3A 1KV7A 1IKOP 4TXVB 5I5IA 3ZBMA 2PPDA 2R7EB 4WTQA 2Y1AA 3MX0B 1AACA 3L45A 5I6PA 1AIZA 2EINB 1A65A 1N70A 4KO9A 1ASOA 2XX1A 3NJNA 4FA7B 3HEIB 3FSVA 3WG7B 2GIMA 2PLTA 3WKPA 1SJMA 1E67A 4QLWA 2IDSA 3UAEA 4YSPA 3NSYA 1AS6A 4W9ZA 4DP7X 1A3ZA 4N4YB 5PAZA 1NINA 2VW7A 5TK2A 2IAAC 2HLEB 2VM4A 3T6VA 1PLBA 1QLEB 2BZCA 4YL4A 3CDZA 1F56A 3UABA 1PZCA 3DIVA 2IDTA 1TKWA 4HZ1A 2CJ3A 4DPAX 3JT2A 1MZZA 2HX7A 2PP7A 3S3CB 2HX9A 3ZX1A 1J9QA 4RH4A 4KO5A 1HFUA 2IDUA 5FC9A 3NP3A 3NJFA 1TU2A 1AQ8A 2AZAA 3MBWB 2CUAA 3UADA 1GY1A 1W8EA 3ERXA 5I5MA 4X4KA 4PAZA 3G5WA 4G7RB 4KO7A 7PCYA 2CBPA 1PLAA 3EF4A 1E30A 2XU9A 4A67A 3FU8A 4DPBX 1N68A 1AOZA 2XYBA 1M9WA 1V54B 1ID2A 3TASA 2J55A 1OE1A 5B1AB 4GY4A 4YSOA 1WS8A 2BP8A 1IC0A 1AS7A 1W6WA 1MG3C 3C75A 3WKQA 4BWTA 1GR7A 3SBQA 2AANA 2RACA 3FSAA 1ILSA 1J9TA 4DP2X 3NJKA 1OCRB 1WS7A 1PNDA 2PPEA 2H3XC 1JVOA 1SF5A 1T5KA 3CG8A 3PCYA 1MDAA 3T6ZA 1OCOB 3SBRA 5I6MA 3D12B 4HALA 4BDVB 2B3IA 3TBBA 1FA4A 3FQ2A 1NICA 3NJMA 1PZAA 2FJSA 1L9QA 1JXDA 2H47C 3N55A 3BVDB 3T71A 1PF3A 5I26A 1ILUA 1SDDA 5B1BB 1AAJA 1XB8A 4BWWA 1JZJA 3NJIA 4YSCA 3S8GB 2BP8B 1BYPA 3FQ1A 5D4IA 1NIBA 2R7EA 3ASNB 3ZDWA 1RKRA 2I85A 4AKOA 1ZDQA 4GXFA 4KOCA 2XV0A 2YAPA 3GDCA 3QJTB 1AZBA 5I6KA 1L9OA 1AZRA 4AI7A 4E9SA 4DP8X 3FS9A 1L9PA 1SHWA 4BXSV 2YXVA 2XLLA 3X2QB 1OCZB 1RZQA 4G7SB 2W8CA 1RCYA 2DYRB 3H4FA 2QPEB 3AG3B 5B1JC 4E9VA 1JXGA 3EH4B 2VSMB 3CDZB 4E9QA 4G70B 2YXWA 1EZLA 3V9CA 3S8FB 2WO2B 4NAJA 1AZCA 4PCYA 2FQEA 4K9JA 4KNSA 3IBOA 2CCWA 3TBCA 1SHXA 2P80A 3X1GA 1JOIA 3T6XA 4UANA 3FYEB 1PCSA 3SBPA 3S3BB 3UAAA 3AG1B 1JZHA 3QJSB 2IWFA 2VN3A 2YARA 3OD3A 4HHWA 3IN2A 2UXGA 3PAZA 3NP4A 3AG2B 2FQFA 2QPDB 4N8UA 1AR1B 1BQRA 3FPXA 2XUWA 1SDDB 3NJHA 1FWXA 1L9RA 1R1CA 2ZWNA 3GYRA 1KBVA 1OCCB 3FU7A 2VMJA 3PPSA 4AKPA 1BXVA 1J9RA 1IBZA 4A2DA 1JERA 2IWEA 2CAKA 3WIAA 5A7EA 4ZK8A 4A2GA 2B08A 1VLXA 5B1JA 1I53A 2J56A 5I5JA 4M4RB 3KW8A 1TEGA 1OOWA 1NWOA 1GSKA 1QHQA 3EH5B 2EIJB 2I7OA 1AZNA 1QNIA 2AVFA 3ABLB 2PP8A 1NIAA 5B7EA 4DP9X 2J57A 1AG6A 2XV3A 3FQYA 4DP0X 1YLBB 2X88A 1JZIA 2A3TA 3AG4B 2GBAA 1PNCA 4JHUA 4GP4B 2LLNA 1NWPA 2JKWA 3NJGA 2E86A 4CSZA 2H5UA 1WA1X 4F2EA 1NTDA 1BQKA 1ET7A 1XB3A 3RYMA 2XVBA 2IDQA 1DZ0A 4AX3A 1NIDA 4L0PB 4KNUA 1NZRA 4HHGA 2W88A 4F7KA 3PAUA 3AZUA 3PXLA 2DYSB 2I7SA 2GHZA 5D4HA 3T9WA 1ET8A 3FSZA 4E9XA 1A4BA 2Q9OA 4NB7A 1E5YA 4E9RA 1J9SA 1W6LA 3WI9A 5F7BA 3SQRA 4CSPA 5PCYA 1GS8A 2UXFA 1OF0A 3CVDA 4AKQA 2FWLB 1E5ZA 1NDTA 1ZPUA 1NIEA 4FAAB 2EILB 8PAZA 1SNRA 4A68A 2EIMB 1HAUA 2P80D 3KW7A 3QJQB 3T6WA 1XB6A 2FT6A 2XX0A 3V9EA 3X1NA 2FT7A 1ZIAA 2BP0A 4YSEA 1JXFA 3FPYA 1V55B 3FU9A 1CC3A 2IH8A 5I6OA 4YSSA 1MZYA 5AKRA 5B7FA 3NSCA 3JTBA 2HRGA 1WAEA 1BQ5A 2X87A 4G72B 4WKXA 3TU6A 5B1KA 4P5RA 2YAMA 1GS7A 1M57B 2VW4A 5LDUA 3ABKB 1CUOA 3FSWA 2BWDA 2YAEA 4HAKA 4M3HA 3H4HA 3QPKA 3WNJA 3OMAB 2UX6A 1FFTB 1JZGA 2PPAA 4Q8BA 1BXUA 1CYXA 3CVCA 1CYWA 3PAVA 7PAZA 3WNIA 3NJJA 4A2FA 2UXVA 5B7MA 1KYAA 4G7QB 3OMIB 4UAHA 2XXFA 3UGEA 3U25A 1XMEB 4A2EA 3IE9A 4YSTA 1KGYE 5ANHA 2GB2A 4HCFA 3AW5A 4GP5B 1ASQA 1MG2C 1NPNA 3FYIB 1AANA 3UACA 3OM3B 4DP6X 2XXGA 4A66A 5F7AA 1PMYA 1NPJA 2BHFA 2QDWA 4BWUA 5I6NA 4JKNA 1A4AA 1SFDA 4GYBA 1GYCA 2CALA 2DY2A 5IY5B 1AZUA 2VSKB 2VW6A 2HZHA 5EHFA 4KNTA 5B3SB 3OMNB 4KOBA 2PP9A 2OV0A 1ZV2A 4HIPA 2GI0A 2IH9A 3ASOB 4E9TA 2YAOA 2FT8A 5TK4A 1L9TA 1ZDSA 4P5SA 2NRDA 1ZIBA 3NT0A 1KCWA 4E9YA 5I28A 3CVBA 1GW0A 1ET5A 4KO6A 1ADWA 4A2HA 1BYOA 1J5DA 2BW5A 2GC4C 2OCCB 3H56A 1RZPA 4JHVA 2MRYA 3TA4D 2WSDA 1ASPA 1UATA 2DWTA 1ETJA 2ZOOA 4HCGA 4MFHA 2BWIA 2PCYA 1SFHA 2YQBA
chains in the Genus database with same CATH superfamily
3EYQD 4R0LA 1MAMH 2QSCH 4HGWB 1U6AH 2FSDA 2P42B 3ZY7A 1B0RB 1IX2A 3P4NB 1RIVH 1ROWA 5JNYB 1Q72L 1RUQL 5DLLA 4F57H 5IZ7A 1GJWA 4WGWB 4XNQB 3MUZ1 2P5EB 1N0LB 1CN4A 4YSDA 3ZYJA 4H26A 1V10A 1O6SA 1VIWA 2NSMA 4N24A 1N7MH 4TOYL 5DZNA 5C0BB 5J06A 3K0WA 1LNUA 4P05A 4TUJA 4K2UL 1CURA 5EU6E 1U2YA 2CK2A 2PCFA 2CUIA 2FQDA 3ALWA 4PRPD 1CXLA 1DQVA 1CLVA 1EFXA 1A2YA 2GITB 1EH9A 3BQVA 4NQDE 2I27N 3F7YB 4H44C 3RIKA 2FO8A 4X9BA 4X4ZA 5BNXD 1UOLA 1ZK9A 5C92A 1DSWA 2R0KL 3IS1X 3K6SA 4ETQB 2Y6SD 1XF5A 5I75B 4HWZA 5TGBB 3TL5A 1CGSH 3FQNA 4P5MB 5DHXB 3VXUE 1CDGA 4EZMA 2DWSA 3LTVA 2BHUA 5DLMH 3QZWA 2EEDA 2BW4A 2COQA 1Z9PA 1EHKB 4NJ9L 5L2KE 1KJVB 3VU2A 4MYPA 4PREA 1GMIA 3D30A 2NY2D 5IROD 3FTGB 2NLJA 4R2GD 3VYPA 4YHLH 1B2WL 4HKBA 5DF0A 1TSRA 5KVFL 2X40A 4OIFA 1UVQA 1IC4H 1A6TA 1XCWA 2GFBB 1TZHA 3CFQA 3A0OA 2PCPB 2XWZA 1JVLA 4QKTA 5CR8A 5C0JA 2BXYA 3APNA 3ETBJ 1KYOK 1PZUB 4LRNL 4L4TB 4I4WA 3O8XD 3CD4A 4XHQA 2WBJB 5CN3A 3Q1SL 5EUKA 4KKAC 2GUYA 5D1XE 1G6RB 1Q0EA 4JFZH 3UIZA 1UWYA 4HMEA 4MCYB 4CNIA 2GFBA 5HHMD 1KMGA 4KH2A 4A63A 5CILL 3GUTA 3QCUL 4CILA 1OKEA 3ARFC 4ZNEA 3KYKH 1LEIB 2B1HL 3IWUA 4N0FA 5ESAA 3WFZA 2YFNA 1K4CB 3ESMA 3FONA 4Q2ZB 5HXMA 4ZJ9A 3S34L 4X4XB 4G80B 3U0PB 2Y1AA 3FZUC 1UENA 1GTNA 2C5DC 4P9MH 1U8QA 3NJNA 3FN0H 1DE4A 4FFVD 4LBEA 4AH2B 1JYXA 5TE6L 1HINL 1OW0C 1XCTB 4QI3A 2YEZB 5ES4B 1SPDA 3QYCA 5C08D 2CO7A 3C6LB 4YSPA 2IADB 3NSYA 1AHWB 4QT5A 3VD3A 1QUNA 1OARH 4K55A 3X11B 1IGIL 1IM3B 1LO2L 4CSSA 1R33A 1HEHC 3D51A 4N0UE 1AQKH 4XAKD 3QWOB 2D0FA 3MBEA 4YHML 4HW6A 4ZFOL 1WF5A 2VZUA 4HV8A 2F54D 5C09D 3O8XA 4OM1L 5MEPB 1RP9A 3GMMA 1F4YH 2XWCA 5BS0A 3B9DA 4MDIA 2HFTA 4LSDA 5CIPH 4APQC 4YDLB 2IALA 5KYYB 1SHSA 5DS1A 5IJDC 5FC9A 4I2XE 4EXPX 4FQHA 1S5HB 4OZHE 3ECBB 3ATAA 1JJUA 3AWFA 1YEDB 2AZAA 4Z7UB 4HX1B 4KUZL 3KXFB 1MCQA 4OT1L 3B2UC 4UNUA 4ODWB 3GMMB 5IROA 1A7NH 4JKKA 4S1SL 1YZZA 1AQKL 5DD0H 4QXUH 3KYMA 4AJ0A 4DSYA 1FVCA 1P1ZB 4A67A 3N04A 4AOFA 3I9GH 5GS2D 4DF9A 3WO4C 4HFWB 5DUJA 2YRZA 3TASA 5E8PB 2ZCHL 1KBPA 5EA0L 1WGOA 3MZGB 3V4PL 4I0PC 3V4VH 4ZW3A 2OMYB 2NXYD 3DHPA 4EMZA 4AK1A 3FUNA 2NOYA 3WD5H 4KHTL 4PYHA 3RWIB 4K94H 5D71L 1NFAA 1YMME 5E8PA 4UZUA 1EGJL 3MYJA 1XGPA 4G8EA 5I76B 3ULVD 5AL0A 3SJVB 3EOBA 1MDAA 2IPKB 4G8IA 1VFAB 3PPEA 1FNLA 3F5WB 3JV6B 4R90L 1EJFA 4PJDF 3QI9C 4TRPH 4HETA 2CKBA 1QBBA 4KXCA 1YEIH 3D6GA 5KSVB 1F58H 1MCRA 2DTMH 4BDVB 4EOWH 4NBYB 4MNQD 4X42A 2JK5B 3O9WB 1A3LH 4HIJB 3BVNA 1NICA 3RWCB 4G7YH 2N4IA 3QEGL 2CKNA 4M5TA 1LL1A 2W0FB 4LCWD 4WJ5B 3WXVH 4FDWA 1Q9WB 4LPXA 3VMNA 1UQSA 2ED6A 3VSUA 3T3MF 4IRSD 4DAGH 3KPPB 3OMZA 4QTHB 4F1SA 1U0QA 2OR9H 2BOCA 2EIZB 1K5NA 2J71A 5D4IA 3WN5B 1LP9A 5DFVD 2XZQL 3AS1A 2I85A 4JPQA 5FOJA 4MZRA 3ZE2F 1EAQA 5E6IA 3GSUB 3MV11 3CU7A 1R0AH 3BGMB 2F2HA 4AGNA 3AS0A 1O7SA 1DBBH 1FIGL 3ARQA 5IF0A 4HH9B 4KKPA 4OLVH 4U1LB 3TVMB 1OCZB 2AVGA 5H37A 2BC4A 3V4VL 4RAUB 1T5XB 5EFIB 4DVBA 3AACA 3VI3E 2FO1A 3PWPE 1HCVA 1E7VA 1NC2D 5IW3A 3O8XC 2YPLE 4NHUA 3GRBA 1DFBH 5A2FA 2VLRA 3CQPA 2VDQB 2C3WA 3MV7A 4O2EA 4QY8A 5ID1A 5I17B 2W65A 3TV8A 3T0WA 2ESVD 1ACZA 2KT6A 1P5UA 2L0DA 4K9JA 2XWJA 3C5JA 3IBOA 3HB3D 3IMTA 4F7CB 4OT1H 2B0SL 1Y0LB 4FFYA 3HLAA 4PWFA 1IT9L 4L3EA 3QFDB 5C0EB 1RZ7L 2BRRL 2WCPA 2VZ3A 4W81A 3WMSA 5HI5C 3LZNA 4V2BA 3LQZA 3KWUA 2J2ZB 1LD9A 4DTGH 4XNZB 3GSQA 1JCKA 3HR5B 5HDBF 1IFGA 5IG7A 1RJCA 1QG3A 2VLKA 1MHPH 5C0CE 2QQNL 4OCXH 3B37A 3RZCD 1KLGB 1SEBA 4HIIB 3MLZH 4MMYB 4DN3L 2FH6A 3PXHA 3HC3H 1Z9SA 3PXJA 2FK9A 2JH2A 3NRPA 3V5HA 4HKZA 3KW8A 4F80A 1H5BB 3D18B 2L04A 2EIJB 4QYOB 3GWJA 5T1JA 3IDIB 2H32B 4K5OA 3SKUD 2ETWA 3BKMH 3CC5B 3REVB 3FN0L 4E0RA 3VWKB 4K3DL 3LMJL 4DP9X 1A7BA 2Y06H 5IW6B 2Y2YA 3QI9A 4PYGA 5C0NC 5D96B 1FC2D 5KVEH 1F4HA 3BJ91 3EKCA 3KVDD 1SEQL 3KLAB 4G8FB 1OT4A 2C9AA 1R4XA 1XH0A 3ARBD 3I3BA 2MKLC 3RZCC 3IDIA 4W70A 1KCKA 2H5UA 4OLZH 5EU6A 3PL6B 2Q7NA 2A74C 3KPRA 4BHUA 1R24A 1UH4A 2YHGA 1MF2H 4MAYD 3MNWB 4AX3A 1P5VB 4L0PB 1M6UA 3HE6C 4KNUA 2FIKA 4Z95L 1KTDA 1ZT4A 2JSFA 4IJ3C 3SDDA 2CWRA 5C0RH 2QMJA 2HRPL 2Q9OA 1LDSA 3JWOL 3BUYA 4B7IA 3OJVC 4JRYA 1YN6B 4N22A 3ARRA 4FXGB 4WUKL 1ICTA 1NAMA 3FCTA 5C0IA 3MAWA 5LN4A 5EOCH 3UOAB 5ICZB 3US1A 4AT6A 1SOQA 1FZJB 1NDTA 2QADD 2EILB 1BG9A 4X7EC 2EIMB 2WVSA 5DO2C 1LE5B 4MQXC 3C6EA 2J25A 1S7VB 2OYPA 2X6VA 4JO3H 3FU9A 3TH4T 5DJYB 3A4DA 3TF4A 1E4HA 3RWGB 4PP1C 3RIAK 3S0PA 43CAB 1D9KB 1DHKA 3RZWA 1JMXA 1H3UA 1T0NA 3JZYA 1P7QB 4OF0A 4AZ8B 1F2XK 4JFVA 2YC1A 2YAMA 3N9GH 4XXCC 4N1HB 4MNGE 2X09A 1U21A 1ZKAA 1S7VA 4PJDB 5CCJA 5AW2B 5T5FA 4ALAC 1QSFD 5CKAA 3GO1H 4X6DB 1UZ8A 2VXUL 4LEOA 1ECZA 1N59B 3IJ9A 2JCCB 2DIAA 4P2RA 1IAKA 2WLJA 2CCLA 5IVXF 1G9ML 2I26N 3R4RA 3FT2B 3W37A 3HAEH 1FI8C 4UDUB 5F9OH 1AFVL 2PYFB 4JW3A 4MKTA 2WIIB 5F97E 5HD8C 3MACL 5FGCB 4FFYH 1XO8A 5EZJA 4HS3B 4EZKA 3TNNB 4GP5B 2B9AA 1ASQA 4PWJA 4JY4A 3E6HB 4PRNA 3US9A 3HFMH 4DP6X 1N10A 4LLQA 4WU5B 1UD8A 5CZVH 5EZIH 5IMLA 5J6HB 3WENA 2BHFA 3HG1A 2IANA 3S9DB 5EWIL 5H4ZA 2HMIC 3EYOB 2DY2A 3ZHFA 2VDKL 1DUZB 1FFNA 2VLMD 3HI6L 4YDJB 1TT6A 2ZWSA 4NN5C 1AR1D 4MASA 3TWYA 3MLXL 1DO5A 4M7KL 4B27A 2D3JA 5KBPA 4MJ2A 1LO5A 4JFED 3T0AA 5AUMA 3ROOB 4P3WA 1EXHA 3BZFA 3HHSA 2AQTA 1AO7D 3B5TA 2E27H 4P5TC 1AXSA 3GKWH 1GW0A 3HI5L 4N90E 3VXRE 2DWYA 2GI7A 1ET5A 1ORQA 4GBXB 3U4KA 2NSQA 5AOIA 3CFJB 3BPCB 3TA4D 2MRYA 1UACH 5FO9B 2IG2L 3DJTA 3DSFL 2DEYX 1A7NL 3MRJA 1NKOA 2ZKYA 1MI5D 4WFGE 4AVJA 1BQLH 4B6ZA 5TGBA 1DQDL 1A47A 2PPCA 1P4UA 1E6OH 3FCSA 5E9AA 3LZFH 1EZUA 2DD8H 3CVIH 4OD1H 2W38A 1IQWH 5KSUA 2O30A 43C9B 4GG8B 2C3VB 4X83A 4Z78B 5CEXA 4QXGL 4JFEE 2WUBL 3EJRA 4LHJB 2Z64C 4OD2B 3M1BA 4NPYA 4AMXA 2R4SH 1T80A 2VL5A 1WK0A 5SWZB 4WU7B 4JPKH 1HZKA 4NRXA 2ORBH 1OT1A 1QOKA 1T66C 4MJ5A 5C0CA 4BUQA 1L9SA 2JXMA 4NUGL 5E8DL 1HX0A 4DP1X 4DGYH 1M7UA 4Z3TA 3LKPA 3KWWA 1BVNP 1NLBH 1IGMH 4Z7UF 2XBDA 2HTKD 5BMFL 3MNVB 3S5YA 5AWNL 5H94B 5C7XL 4QHUB 3GKZA 5IW1A 1T89A 2WXQA 3E6FA 4UOW1 3QQ3B 3QIWD 3SOTA 3CLWA 1XXFC 4I2XB 1KCBA 3FO9B 1RUAH 4PWGA 1PAZA 5ECJE 2DKUA 1ETZA 2EICA 5KBLA 4L3EE 2BIPA 3U0TA 5B8CC 3QQ9C 1UB5B 3D39B 2BOLA 4FLSA 1LEIA 1JGDA 3J27A 5KZCB 3Q5YA 1U8PA 3AY2A 3NTCH 2OL3B 1FCGA 5CU5A 4F33A 4PJAF 3DRQB 1L7IL 2Q86A 3GM8A 4GAYA 4N2HA 1ERNA 1ETZB 1WA0X 5DD1L 3QG7H 4NQCD 2VYRE 2G60L 5JA8B 4LBEB 4AH2A 1KC5H 4MJ6A 2QVMA 2CDGB 2W07A 2UVFA 3GRWA 3S8WA 2RR3A 5D7KE 3FT4B 1WIUA 3IAQA 1E6JH 1UKTA 4JFXB 3QAQA 1RIHH 5HHME 1G0YR 1XL6A 2QSVA 3AC0A 3GJEA 5IMOB 5D7IB 5F88A 3QQXA 2P1YA 2OSYA 1IUZA 2BSTA 2X0UA 5E6RB 3FCGA 1FLTX 2ENYA 5DUBA 3S35X 1URIA 2XQBL 1MWAH 4WK0B 1TMCB 4JDZA 1NAML 3MBEB 4V1DE 3BRDA 4FXKB 4OFYA 3D3VE 5KYXA 2YEQA 5ALCH 2YMOA 3L1FA 3L5WB 3LKRB 4HKJA 3N42B 4DEWA 1ZA6A 2WYZA 3NA4A 2EAEA 1K3ZA 2H32H 4OGYL 5I6PA 4F9LC 2YQGA 4LFHG 5HGBB 2ZQKA 3ESPA 4XP1H 3H55A 1JZDC 1N70A 5T5FH 5CD3B 3QH3A 2XC8A 3KL3A 4G42A 2HKFL 1UKSA 3ULVC 1S9YB 2BNRB 1KJ2H 4Y9FA 4DN4L 1RK0A 3EYVA 5T5NF 4G6KL 2VDRH 3NRFA 2C4FT 2NY3C 2EEBA 2HFFA 4M56A 4I0CC 2DL9A 1SUJA 2MFNA 3OLGA 3ASWA 2K0RA 3EGSA 4XH2B 3MXVL 4L1LA 2NZ9D 2OQJB 3B7UX 4PVLA 5IB4B 3EGXA 5FM8A 5B3JE 4IIQB 1HOCA 2G75A 4Z0XB 1CLZH 3UABA 2DQJL 4DKFH 4HIQA 3SY0B 4WFGD 3KJ4C 4M48L 2WGXA 2FSEB 4YWGL 1V7ML 2HX7A 3DC0A 1MEXL 4OTXL 4RH4A 1JTPA 4B3VA 4Z7NE 1EHXA 5CU9A 4EIBA 1XR8A 4KJYA 1NCOA 4WVRA 2NCMA 2WUCL 2P8LA 3QARA 4ODUB 1A6WL 2W91A 5DZ9A 1DLFH 4PGDA 1B0GA 4PRIB 1NFDF 4IIQC 4QOKA 2AXHA 5BMFH 1BJMA 1E4XL 2P8MB 3FFDA 3G5WA 4KO7A 4LVNB 5E1AA 4ZMNA 5JXAH 1EXGA 5B4MD 2F6AA 4ZMZA 2HJFB 3FB6B 3EF4A 3O0RL 3V6ZB 3K1DA 4R4BA 5D5MA 3V10A 5CUSH 4DHLA 4F2ME 4NS0A 5IWLC 3QZMA 4ES9A 1BQSA 1RP8A 3QZOA 5IHUH 4L3EB 2OTPA 3EF7A 5AVZB 3CHRA 2CR6A 3GS0A 2ZKMX 3WEBA 3ZK0A 2AV7A 1BM3L 1SOKA 3VRIB 4LSQH 2D4FA 3ISYA 4XMXA 5E2WH 1JI2A 5I19L 3UBFA 3B2XA 4EIGB 4JFDD 5J3HC 2G3NA 1ILSA 4KKQA 4L0YA 3VNYA 2MKWA 3AABA 1CE6A 2YO3A 4NZTL 3CNKA 2DKSA 3PNWB 2Y3NA 3U79A 4AMKH 3BZDA 1KXVC 5FK9B 3FU6A 2APXA 4HZAA 5MENA 3VFNA 1F4XL 2F1EA 4S1DC 4KFZC 4N0UA 2G4GA 1OGTB 3FT1A 2I07A 3HRZC 3RVVD 3L9BA 1FVEB 3R1GH 4L8SB 5J1TC 5GJTH 2OP4H 2QZQA 2ZUWA 3RWDB 4UNTA 1MLBA 4YLBA 2VDPB 1FA4A 1MUJB 4N5ED 1L0PA 2A4EA 3I74A 5CEYB 3GC3A 3OF6D 5D1QC 1QTSA 2XICA 3QDMB 1DQQB 3AVEA 1JPTH 3JVFC 4WO4C 4DN3H 1PFOA 3MGTB 4KZDH 2VABA 3SPVB 3P3UA 3SDDC 1PVHA 3WNLA 1QEWA 1GYUA 1X4YA 4J5VA 4K07A 4WUUD 4MNQB 1MFAH 1INQA 2Z4TA 1BZ8A 4X7DC 2D03H 3KYNB 2YLHA 1KLFB 4BCYA 1MFEL 1TJGL 1M7IA 4OFKA 2VWEC 3KPRB 1ZDQA 4IBWA 2ZOKB 4MQ7A 1PLGL 5E4IA 2Q20A 3HAEA 2WY3B 4U33A 1I7RA 3SE4C 4D94A 3OKEB 1GZHC 4DP8X 1MHEB 2FYYA 3FRUA 4ZX5A 4Y4KD 1F11A 35C8H 3QUMH 2R27A 4F20A 5L9DH 3RKDC 4F2MA 5DMKB 5EU3A 1HHIA 4EQ3A 1JK8B 4N2KA 3EADA 1QO3A 2VJ8A 1UZ6F 5FX3A 3AY4A 32C2B 2BMKB 3OZ9H 4X8GA 4U0RB 1FFPB 2XWBA 4L5FL 4X2UA 1T4KB 4U3CA 2ESVE 4TVSa 3WO4B 3CV5A 4D0DB 2P48B 2R1WB 5DMYA 5GGVL 3CSTA 1AZCA 3RGHA 2K70A 1KJ2B 2R0LH 3HVDA 2VIRB 2FWOA 2I25N 3L48A 4AYBA 3QZLA 3O45B 5TH2A 1IVTA 1OO2A 4J3OD 3OAZK 4LCWE 2G2RB 2X1XR 5EBWA 5SX4I 1JYVA 4PLJD 1NAKL 1WFJA 2ODIA 3M17A 1ZXKA 4CBZA 2FQFA 1VFBB 5LG1A 4L37B 5LHDA 1C1EL 3EJSA 4JO3L 2MWCA 2XA3A 3QQ4A 5IQLA 4PTTB 3WE6B 3E0GA 2PXYD 1YPZF 3GM0A 3N1PC 4OKVB 4S2SB 1LEKB 4UDUA 2WVVB 3SDXF 3TCXA 5AZEH 4HUMB 2F54B 5CINL 5ISZB 1W72L 1XD0A 2TAAA 3MLSL 1FZMB 3LHAA 1CICD 3QK0A 3WXVL 3VGHA 2ADYA 2X9ZA 5DHVH 2QKIB 3RL2B 4NO3B 4UOJA 5IJKC 3EZJB 4J6RH 2GBUA 3WTVA 3IMBA 3RA7L 3H9SD 4EI5D 5FB8B 5KSAC 4X7CC 2PP8A 3FHAA 5D1ZD 3ARWA 3IDJA 3CZFA 3OPUA 1YEIL 1I9EA 2AXFB 1D5BB 4XP6L 4OU3A 4UUJA 4Y2OB 1IEAB 2X88A 4ZMPA 5DUPL 2APVA 3T2QA 5MEOA 4JLRB 1PNCA 3WTSA 2C7FA 1KCLA 1PKOA 4QCIA 2WBJC 3EXJA 1BQKA 3VSVA 3GFUA 1UYWH 3BSGA 2X9YA 5E5MA 3BP7A 4NSKB 4DOHE 5BV7H 1NIDA 3UO8B 2YKKA 4NCC2 1ML0A 1T7ZA 1W0WB 5FWQA 4HHGA 3SDXB 5T3XE 3PAUA 4U3XA 3EJPA 2X4OA 4KTEH 4FL4C 2IPUK 5FYJD 3BLKA 5FYLD 4NB7A 1E5YA 4U7KA 2XSKA 3MGOB 3EFDH 2Z9TA 1QYGL 2R8SH 1DQTA 3TJHC 1T7WA 1DJYA 4FAAB 5KANI 5DT1L 1ADQH 5F9JA 4Y19A 1SLVA 1L7IH 3PFUA 4YSEA 2FT7A 2XXMB 2BP0A 4WHTB 3RNKA 4PV9A 3QRLA 5BVPH 1INDL 4DWHA 3MRHB 4GSDH 4WENB 4IU3A 3N0PB 5I8KH 5K9OA 5CGMA 1CU4L 2BOBA 2M26A 3IJYA 4UIMA 4PJ5A 5C0ND 3T4AC 4C4BA 1LE9B 3NZ8A 1YUHB 1WAAA 3LNFA 3N44B 4N2CA 2R4RH 5SWZD 4P5TD 1VERA 2J8UA 5IEHB 4LPCA 1IM9B 3GSNL 3G9VA 4HIXL 1VEMA 5E94A 1FFTB 1O6VA 4LF3B 1IGML 1D5XA 2H0FA 2AQRA 2R69A 3UBXG 4RRPM 4M8RA 6CGTA 1DVSA 3O3EA 1ZHKB 2ED7A 2ZF9A 2AK4B 3NJJA 3SQBB 3VWKD 1RVFL 5JPMC 1G7MA 1DJIA 3FTWA 1FG2A 2MHAB 2XN1A 1HCZA 3Q5TA 4XVUC 3KYMB 1F0LA 4Q0XH 3BO8A 5I18L 5C0GA 1NMCB 2VXTL 2NXZB 5IIEA 4JKPH 1QWUA 3QJXA 2VSCA 2ZUTA 4CMMB 2WLMA 1I7TA 2MOGA 4TLTA 3HKFA 3RZCB 3NMEA 4FTVA 3VH8B 2ROYA 1RK7A 1JGUL 4WNQB 5D2LB 1AYRA 2XZQH 3I9IA 3QZNA 4JM2D 4ZPTB 5ICUA 3B8YA 3O4LA 5ABDE 3H7BB 2VW6A 3FN3A 4F7MA 2DQHL 2HVKB 5JQ6L 2DJ4A 1RJYA 4OJCA 2GI0A 2Q3AA 4FQ2H 1Z0NA 3EHBC 2X4PB 1ZLSH 3RGBA 4FFZH 3CN4A 1MRFL 3OBAA 4HJIA 4K4KA 1IEBB 4XGZB 3M7OA 3D2TA 3M1BB 3ULAB 2B3RA 3L4UA 4JVPA 3VQ2C 1KG0B 1HHKB 4DO5A 3RU8L 1KWGA 3QQDA 1AKJA 5ANME 1OANA 3SQOH 2XN0A 3SZKC 4PWIA 4B60A 1X5LA 4XCYA 3D7PA 4W68A 4ADIA 3U2SB 1SYVB 1F41A 4XZUA 4PP1D 5CMAB 4MFHA 3NIFE 4HAGA 1NC2B 2E4TA 4LSPH 4Z7WF 1MCLA 5CFAA 2A83A 1SY6H 1Y6KR 2I60H 2PF6A 5E9DA 4ZX4A 2WO3B 5DGRA 2VR6A 5D7LD 3ESVF 4NM4L 2Y23A 3T8XB 4MB3A 3HLKA 1HNYA 3G3LA 3B9AA 1J05B 4K94L 4WTWA 1JHKL 3VXTB 4YZFF 3QE5A 2Y36H 3SKMA 5E08L 2BO0A 3KYAA 1KJMB 1XGQA 3IJSB 3RU8H 1FAIH 3ULVF 2R0KH 3GSVB 1E90A 2HP4A 4O2CA 3QWRA 3ZDZB 1Y1UA 4TSBH 2F19H 4YUEH 3AS3A 5IB3B 5FUZL 4FFZL 2WOYA 3S98A 3MREB 1WIOA 3CXHJ 4XR8C 1IGYB 2ZOUA 5DD1H 2AAAA 3DO4A 4OF5A 5AVVB 2OCJA 4UI2A 2XTSA 1GPOL 4YNYA 4LEBA 1JGUH 3BYTA 4WI5A 3UBXI 3DBXA 15C8L 1FSKC 1S3KH 1EERB 5LNEA 5ITFB 3HMWL 5TDOA 2WZPA 4I5BB 3FK3A 5C2BH 2YXMA 5C86A 2WSKA 4LSUH 5ACZA 3QIUA 1UGKA 4J3XA 1NGWA 1ZOXA 4E36A 4JRXD 5C0BA 2FZ3A 4NZUH 3A6BL 2OI9C 1FYTA 4GUPB 2D0GA 1J18A 1EV2E 2L3BA 3VXUB 3E1F1 1FFOB 4ELMA 1KFAL 1T2XA 4MB1A 1A8ZA 4GKSB 2MH4A 1DBKL 2JI2A 3DKHA 4Z7UE 2YQ2A 3LNEA 1YNTF 3WFHB 4FP8L 3TA3B 4C56E 4YVUA 1CXEA 1CG9B 2WP3T 3I3DA 3TEUA 4G8FA 4RGNC 1FVDA 5L2KD 4FQXC 3EYUH 4GRWH 4B41A 2APWA 4HAFA 4U6HB 4MJIB 4ZO6A 1HQRB 4G2AA 4ELKB 1JAEA 2VMCA 2YPVL 4H8WC 4P2CG 2IDCA 3WIHH 3L7EA 5E24E 1MHCA 1A1NA 1OE3A 3LDBC 2LFEA 3V5HB 2DD8L 3CVIL 3QW9A 3IDMA 3CMGA 3KHQA 3NBNA 3D48R 2NX5A 4L4VE 2X42A 1S7RA 5DQJA 4LMQE 3EJUA 5JTWA 4CN6A 4GIOA 1JSYA 4Z0BH 1IJNA 4AWJC 3VI4A 4ALAH 4EVNA 1WWWX 4JFZL 2V9RA 1DJXA 5C0IB 1JIBA 3II1A 4PJHF 3GXDA 3NFPA 4M7ZB 3Q8EA 3I85A 4NXSA 3NPSB 3FSVA 2OSXA 5EDXA 5I1HH 1RURH 2OJZL 3LDBB 5D7HA 3ZDXE 4GAGH 4CJ0A 4QLWA 3RGVC 2B5IB 3LKNB 5EN2A 3TV3L 1CFNA 4DP7X 4MVBC 4N8VG 3UCQA 4ENED 5AG9A 2GTWB 3V7MA 2VM4A 4RIRA 3QDHA 3C2AL 3WNMA 3MLRL 2FATH 2H2PD 1G87A 4F9PC 1TJIH 5ESAB 5J89A 1YC7A 3VFUB 3S3SA 4PI2A 3RFZA 3MRKA 1YAIA 1NBVL 2IDUA 3SDDD 4AT6B 3KGRA 3HFML 3GEWB 1S9WB 4YX2L 3TJEH 4KXZI 1AO7E 3MBWB 2J6EA 3FTVA 1P2CB 3QJZA 4Y16D 1JFQH 4HIHA 1IT9H 3V95A 5GZOA 3KPRD 5I5MA 3S88H 2DQTH 3KPLB 4YBQD 3ZKND 3NSJA 1BF5A 2HT4D 3ULSB 3MLYH 5CJXA 3QIBD 3TVMD 3T3ME 1IGCL 5T3XL 3TP4A 3LH2H 3G7TA 1AOZA 3VXQB 5SX5K 1M9WA 2WM0A 1IQDB 1CF8H 4RWHA 1G9MH 2J55A 2J20A 2MIZA 1WCQA 1OE1A 1TYEB 3MUGA 3QZWB 4LQ1A 1J0ZA 1DQIA 1WS8A 1A4KB 4GMSL 5JR1H 1N7ML 4BZYA 1G7QA 1IC0A 4JFPB 4XVTH 5FO7B 5JQHC 1AMYA 3L3JB 3O11A 2IPTL 3OTTA 3R0NA 2IALB 5D72L 1BG1A 2NY4B 1W16A 2IOMA 4JGMA 1HZHL 2ZT9C 3DYMA 4H8WH 4HK0A 4PJGA 1NGQH 4AE0A 4GG6B 1A9EB 3WDHA 2XFXB 3CG8A 4N1EA 4EAEA 2CMRH 1S9XA 5TJWK 2DQCH 5I6MA 4C54A 2A77H 4GT7A 1N5YL 4QRPA 5I74C 1PY9A 4FJ6A 1EUUA 2H6UA 4XNBA 4MRBA 2JKIS 4K3HA 1BIIA 1KXQE 4N86A 5IKCA 4HHAA 3RX9A 4H8HA 4H8QA 2X1OA 3T71A 3ZT7A 3D05A 1PF3A 1ILUA 4KMLB 2BNUA 4L4VB 4H88L 3FT3B 3LX9A 4H1LB 4I9XA 3RWIA 4FYSA 2I24N 3ZQ9A 3DO3A 4IBUA 3NZHH 3MRBA 4LARL 2WNKA 4FEMA 4ODXB 4RFNB 4RSVA 3X13B 3BRGC 4G1MB 4RSYA 4WKZA 1ZGLB 2KYIA 1S7XA 3OXSB 4QTFA 1BVOA 5I1KL 2Z35B 3HW7A 1PLGH 2CA4A 1Q0YL 4R2GC 1HEZA 4DO4A 2IFFL 4I48A 5J7CC 1W0WA 5IVXE 4ABWA 4AI7A 2I69A 1S7UB 3KWTA 3RJQB 5FYKL 2A6KB 4P59H 5DCCA 3ZGHA 3ZGIA 2YXVA 2XLLA 4YDKH 3D06A 3C08L 1CB4A 3NACL 1NEZB 2GJ6D 1QHOA 2RB8A 3AREB 2C9QA 4AGMA 4N2GA 4FMVA 5FDWA 2VDQL 4TNFA 2N01B 2ZE0A 1BVKA 4FNQA 3S5ZA 1PKQE 1MWOA 3ML9A 1F5WA 2V4LA 2G5UA 2VUOA 4LSSL 4NO3A 3GSNH 1IKNC 4HWEH 2VDLL 3PWPD 1F97A 3FYEB 4FQCL 2J4WL 3RX7A 1FJ1B 4LKXA 3T0EE 4LCWA 4F58L 2RQ8A 1NBYA 3NP4A 2IXQB 1PQZA 4P9HL 4Z3IA 1M7XA 5IOPB 1T5WB 4U1IA 5JYMA 2CPCA 4IJTA 4BKLA 5D1QD 5HHXH 4QHKI 2XIIA 3L3GA 2Y1VA 4R9HA 5HHQB 2B0SH 3GDBA 2L4OA 1HKLL 1TZAA 5LCVH 3V8CA 1BXVA 5GRJH 3ARGC 1IO4C 1IJ9A 4HUWA 1OAUL 1QMUA 3O3AA 5F93C 5JPNC 4TTDC 3WIAA 4Z3GA 1MELA 3CDGA 5FEBA 3QZPA 1U33A 3AMKA 1KB9J 2BSRA 3CFTA 2XWJB 2HJKB 3LEYL 1QLRA 1BECA 4CMMA 3U7WL 4XC1L 5KG9B 3SJVA 1S8DB 4B5EA 5EBLA 1MQKL 1WFNA 3S5LA 1NGXB 3GS4A 2H3KA 1I1YA 1M7DB 5HHMB 3PWLA 4GW5A 3BESR 1OCWH 3ZHLA 1KTRL 1XWVA 3PV7A 4CL7A 2J2ZA 5GGTL 1T6WA 2X3BA 1S9YA 2DMCA 1DJSA 1E5AA 5EOQL 3S5LB 1KCSH 4NENB 1MVUA 3LPGA 4PVBA 4ZAKD 4JM2C 4Q52A 2V7HA 4FXKA 4FC3E 1XGYH 5L2JB 3FBKA 4JZNB 3K4AA 3QEQD 4F7KA 5CZKA 2PXYB 2Y6TE 5D4HA 3T9WA 4PUBL 5FXCH 2HPOA 1I9JH 1AGFA 1WICA 5F7LB 5I71C 5DK2B 5PCYA 4N8CH 2F54E 3CQQA 2X2UA 3MFGB 3L6FA 4H5SB 4KJQC 3UP6A 3TIDA 8PAZA 4OLXH 5LUMA 2H2SD 4OGAD 4NWUH 4Z7OE 5DRZB 5BQ7A 5EOQH 4ORZC 3ARED 4F8QA 3RIFK 5SWSB 1ZHNA 3IGLA 2DM3A 1KGWA 4UQ3B 2Q8AH 3FPYA 2WTRB 3VJ6B 2ZKHH 2WQRA 3QPXL 5I6OA 1KT2B 2NY6D 5EUOB 2A6JB 5F3FA 2XTLA 2NY3B 3FMGH 4GSUA 3TEXA 5HHOD 1R5IB 4XMZA 5IB4A 3JV0A 4P5RA 3I50H 4POUB 4ZO7A 5KUMA 4K8RC 3WEXB 3TNMA 3GHEL 1OP3K 1UFGA 3ZL1A 3BVVA 1BBDL 5EULV 2GJ6A 2YAEA 4XPGH 4J1UB 3WKYA 2O61B 1HHHB 4OCSH 4W93A 4Q0XL 2H6OA 4XCFL 2EDDA 2Y7OA 5IJCC 3IGAA 5EA0H 4JRYB 1NUNB 1MIML 3BAEL 4KKRA 4N8PA 1OAUH 3ILDA 1OP5K 5J4MA 3FF7A 5KJ7E 3GXTA 2VDRB 5I1EL 2BWQA 3QJFB 4L3FA 4N2MA 1H3TA 3QUGA 4PJ8D 2XTJC 2CLZB 4HIXH 1A7QL 4OFVA 3NQIA 2Y0SA 2BVPB 1A9BB 2RJMA 3D0LA 3EGDB 1VADB 4FKHA 5E56A 1PIGA 1KGCE 5J1SC 3IU3B 4AG4L 1HKLH 1PSKH 5DJ6A 4A6YH 1I8KB 3WUWA 1A6UH 4EBQH 5IVXB 3FYIB 1B0WA 1AANA 1RZJL 2YIHA 3V2AR 4YL9A 4PM1A 3LD8C 2EDKA 4B9ZA 4Z3EA 1PG7H 2M83A 5KSBB 4S1QL 4FFZA 4AW4A 4I1PA 3P2BA 1Q72H 1RUQH 3VWJC 1IE5A 4HWEL 4IKKA 1OSZB 4EKJA 3VFGL 1CWVA 4FD0A 4MBRA 5JXEC 3BWZA 2NY4D 5F1OB 5AOZA 2X53A 1E8XA 2VDLH 4JUSA 5LAXB 2Y1YA 1FL6B 2BK8A 3FH8A 1KBKA 4AL8H 2ICWA 2GUOA 5IBTL 4GS7B 4KXAA 4OF8A 4U1LA 2WVUA 3C8HA 1BOGB 2QGEA 4PVMA 4YHOL 3VAEA 5D2LF 4B3EA 2AQNA 2DLEA 3BUDA 4XMLH 3GMRA 1ZXQA 1HTYA 3OWEA 4J3WA 2Y07H 1MAJA 4QAWA 4NKDA 2HUHA 1GGIL 4GT0A 2AJZB 3G6JA 5CD5C 2QJDA 5DTFB 2A99A 5D8JH 4X8JB 4AC2A 4JHVA 1P6FA 3CSYA 4JR9H 4IW4C 1DN0B 1H15A 1KV3A 3CSPA 3V0IA 5FUOL 1MW1A 4JCLA 2B15A 4MJ4A 5I1IH 4JCWA 2QSTA 5CF3A 2PCYA 5BRZD 3F7LA 3FB7A 2GSIB 1QQDA 1BQLL 3CZGA 4NQED 4JFFD 3WUWG 4OZIF 1DFXA 1X5KA 3L2NA 3QJUB 4X6CF 3WIIL 4DKEH 2EECA 5GGUB 3QIBA 4X4ME 2DQEH 4PD4K 4AYEC 1JNJA 5HYQA 1E5BA 4P23D 3KAAA 5D5ME 3RPIA 1XZ0A 5D4QA 1WRFA 3BE1L 4JDTL 4MMZB 5J6GB 1MFCH 3L4XA 5H2BA 3KVPA 4MD5B 5CJQH 1BM3H 1PZBA 3QXWA 3VXSD 3EG9B 1I1FA 2VXQA 4D2NA 3OKEA 3IEAA 2F74A 3WMQA 4ZPVB 1KCUL 1LO0H 4LSVH 5TF0A 1II4E 2VT0A 5DZPA 5HYQB 1GKEA 1NUFA 2A1WH 3TGXA 1R3LA 1XEDA 2M2DA 3IFPB 2IBZX 5J9PA 5JPNA 1MCWM 4M9PA 3ZL4H 3CZUB 2BMKA 1JF6A 1XCQB 4PRIE 5INDB 2JB6A 3BDBA 3CZJA 4UV7H 1AO7B 5MERA 3UPRB 2FRGP 1H3XA 1YMHA 4K7PY 4G9DB 3QJRB 4UU9B 2WXFA 5EF2A 3C6SA 2NTSP 4RFEB 3QEHA 6PCYA 3Q8AA 1Y07A 3P4MB 1FC1A 2EEXA 3AGWA 5C08E 4I3SL 1T04B 4AJYV 4P2RB 3G5VA 5FM5M 3MO1B 3A47A 3IDMB 1X7TA 1V7MH 1Q9KA 4UU9A 3EO9L 1MFMA 1WQVT 1GS6X 4MX7A 3SZ6A 5KVEE 2Z1PA 2OXHB 2F7OA 2HXAA 2OJEA 2D3NA 2XZCH 2Q6WB 3UYPA 4ODHL 4PJFF 2ZWLT 2BZ7A 1E8YA 4AIEA 3NVQA 1GGCL 4GIPD 3GPEA 1IEAA 2VO8A 2MOQA 1MIEH 3T8VA 1C5DA 1DVFD 1K4CA 5TQ2L 4F1ZA 5L4MA 3NOIA 5HI5D 3S88L 5J13B 4FTDA 2DQIL 2BSEA 4Z7VF 3ZVVA 1KB9K 5FPIA 5F3HB 3T2NL 3ZOAA 3HMXL 1FZMA 3OZKA 1E4WH 3N91A 2V5RA 2VLME 5MEQA 3N85L 2D9CA 3FXIC 4CGTA 3DPDA 4EIUA 1U91B 3IXAA 3P0YL 4C59B 2N7AA 2KUTA 1I85C 1T21A 4KKNA 5ALCL 3SY6A 3IE4A 2FATL 3AMLA 2O5NA 3X11A 3FTXA 3MRRB 5T5NG 3N41B 4F8NA 3HNTL 1LLAA 3MLUH 1FYTD 1UM5H 4P4RA 4Y1AB 2BY2A 2CG9X 1P84J 4JPIA 4X7TA 3VW3L 2ADGA 1KCUH 4NN6C 3BIKA 1QRKA 3ZHKA 1E9PA 2Z0BA 2WZPD 3VX1A 5E5MB 4DJMA 4GLRH 1TPXC 4NQSA 5B38B 3KPSA 3MI6A 1ZE3C 3BAWA 5JIIA 5IESH 4POYA 4W6YB 4UILH 1YUHA 1C16A 4O02B 4PJBB 1UWEH 3G6AA 4NQXA 4NNYA 4ZD3L 3DJZA 1AZVA 2XN9D 4WI9A 1TO5A 3FSOA 2VDOL 3HE6A 1A3RL 1WC7A 3MRDA 3NEXA 3TF7C 5GGQH 4IU2B 1RH8A 4BFGA 4N5UA 1X5ZA 1W8EA 5HDLA 3UTPD 3ERXA 4D9LH 2JELL 2ALAA 4M6AA 4O00A 5EMYA 2VDNH 3OR7A 3VI3F 5FO8B 2OMYA 4UQBA 3I84A 1VGKB 2HSIA 2UZIL 5L8JB 3F85A 1IAIL 5JIKA 4KK6C 5L88H 1RU9L 5A16B 4CW1A 1FE8H 1N8OE 4XNXL 4YO0A 3T08A 4PJIE 5DJ2A 5B1AB 2ZG1A 4KY1H 4GPVA 4UQ9A 4F15C 1PD0A 3IS0X 1E4XH 4NUMA 4HF5L 1MG3C 4JN2B 3ZN6A 4UNVA 3H7BA 4U6VL 5TPWL 3UTSA 5DRXB 1ZRUA 3FSAA 4UOZA 1OCRB 1S7WA 1E4KA 4HK3N 4HOMA 1T0MB 4M5YL 4YHNB 1U30A 5DO8A 3RWCA 5B39G 4BRVA 4OKDA 1T20A 2X10A 4MJ6B 4S11A 2A9NL 4L2YA 3U6RB 2KDYA 4H1LH 2QHRH 2WBKA 1TTGA 1A7QH 3DVNA 3WLWD 4GW4B 1S7UA 1U2CA 4IBYA 5CO1A 1VJSA 5EU7E 1ACYL 2QADC 1KCRL 3L3IA 3BW9A 4NBZB 3IRPX 1K5NB 3MCLL 5JPMA 4JM2A 1JXDA 3N55A 1GYWA 4IKNA 3CE1A 2X4NA 4OD2A 5JIHA 2CBTA 4PJIA 1SVBA 1I1YB 2WXPA 3F7VB 7CGTA 3GSXA 1QFWM 2MOVA 1KB5A 4F8OA 2Y7SA 1KTLB 2CO7B 2P5WE 4NQUA 1IKNA 3ZTJH 3NIFB 4XPAL 1ETB1 1G7JA 4EN3B 5CJ5A 3WTXA 4LXFA 4YE4H 4HZLA 5IR1B 2K7PA 2R7EA 2ICEB 2NY1D 1QA9B 1RKRA 3BKCL 3HPLB 2GTQA 2X9XA 4HISA 2UY7A 2WSPA 4GXFA 3C5ZB 2YKLL 2XV0A 3SE9L 2F8VA 3QQDB 1ZHLB 2A6DB 5C6TH 4JGNA 4Z5RA 5KYWA 4XZ4A 1U8IB 5C6TL 1G7JB 2BNRA 4WUUB 4XBMA 4Q9BA 4KKBD 3ZMRA 2VLRB 4O2EB 4QY8B 4NWUL 4GEJA 4XPBH 1HESA 1GGBH 4P5TA 4U1IB 1QW8A 4P4KA 5C2UB 4FQ1L 3WJLA 1QSEE 3CFNA 5FOBB 1E2ZA 3DX8B 3MVSA 4WEBH 3OR6B 1X7SA 4G1EA 3MQIA 2G75B 4KBPA 4Z0XA 4GXUM 3UERA 1YDPB 1LK3L 4UTAH 1I4FB 5DYFA 5JQ6H 3QUMA 2WO2B 1ES0B 2RH0A 4P4KB 4LP8A 4PJFE 2FQEA 2LQRA 1JPFB 2EDXA 1DQJA 2CCWA 3DV6B 4GKNB 1Z5HA 2HJKA 4L3CB 4XBGB 4Y19D 4L18A 3P69A 4Y1AD 3AY4C 4MNGB 5IMOA 5IUCA 1L3NA 2YR3A 4KROC 1WFOA 3FRPB 4J7RA 1QPKA 1R46A 2E74C 2OR8A 2V7NA 3MRMA 4OGXH 4WSKA 1E5UI 1R3KA 1CPUA 1KN4L 4CUCA 4IRSC 2WLHA 5D71H 3QPQD 5B8CB 1RJLB 2MNWA 2FO4B 1YN7B 4NM8L 5C09E 2ARJA 3FPXA 2XUWA 2VQ1B 2OS7A 1IBGH 2O6PA 3MJ8B 3BUTA 5D1ZI 3L5WA 4HKJB 4FJZA 4CJ1A 3DMMB 2VMJA 3SDAC 4JKPL 1AP2B 1U8JA 2GK2A 1ORSA 2NYYD 3DOIA 1M05B 5EEWA 5HGBA 3Q9QA 1S9VB 2PWHA 3GGWB 1JERA 5JXEA 1FNGA 1LWJA 5E8DH 4F91B 4QJ5B 2YJLA 3C09B 1NANH 2CDFA 3V4PB 1I53A 3PQYA 3K81A 1TEGA 1OOWA 4PLKD 3QXAA 4B0MB 1AZNA 1QNIA 4GBXC 5HHVL 2BVOA 1FCCA 4OCMC 3PHQB 3ABLB 1CE6B 2YD2A 3QDGD 4WDIA 4NOBA 2E56A 2VR3A 4FKKA 1SN0A 4KRNA 1Q9WA 3VFNB 2XV3A 3CLEH 1UM4L 1NMAH 5HYJD 2F1AA 1ZCRA 5KOVC 1P7KB 4R2GB 3LN4A 3P0VL 1EXUA 2OZNA 2CRYA 4MHHG 3MTRA 1NWPA 3SY0A 2X89D 3HUJE 4JJHA 2JKWA 3L3HB 1TQSA 1H0DA 3L08A 3ZL2A 2FB4H 3HI1B 3BN9C 2EXYC 4WW1A 4JFHE 3W9DA 5D1XD 1NAMB 2XVBA 1HJBC 3GUFA 1RUKL 3QFJD 2GJZB 4WY7H 4X7SL 2A9MH 2N1TE 4BFOA 1S7RB 3NDZE 4EZJA 1SLUA 3CZNA 1NDMA 4M1DH 3ZSTA 4KTEL 1A4BA 1TQUA 1IFRA 3DVIA 3PG2A 2CJUH 1OLZA 3TIEA 3SQRA 4Q4EA 2NUPB 1FH2A 1AQDA 4OM0L 4RMBA 3HA0A 1OF0A 1DCEA 3ULUH 1SNRA 3JV4A 3AXLA 4LCIH 1NJ9A 2V2TA 4N2IA 4X6DA 2X6UA 2VE6B 4GAAA 1M4KA 4X4XA 3U46A 4MCMA 4HOXA 3UDWC 4PJHA 1HHIB 3E3QC 4HQQH 4E41B 4NQDB 2OW7A 5CD5D 1I8KA 2JLLA 4J3OH 1L9MA 3KR3H 5G5DB 1UXLA 2LE9A 2PYED 4NXKA 4YAQA 2XG4B 2FBRA 3MV7E 3TFKC 1NJ9B 4B9CA 2V2TB 1JI1A 2YGOA 4RQQA 1N8ZA 4M3HA 2QLVB 4MA3B 4XVSL 4ELDA 2KL6A 5CGYC 5D9SB 5ITBH 1GZPB 1PZDA 1E4KC 4KRPC 1WISA 3L5XL 2Y9RT 5IG7B 3TESA 2BSCA 4EIZC 4JL1A 4KXZH 1NCGA 1JZGA 3T0BA 5F9OL 2CJSA 3QNZB 1YYLH 4JE0A 5DJ0B 2PUQT 4WFHD 4XB3A 4GRLD 4K73A 4YPGA 3MXWL 2EC9T 3E6HA 3FOMB 4PRNB 1FNEB 1BBJA 2UXVA 4XX5A 3Q6GH 4G6JL 1G1CA 2WLLB 1DR9A 3HNVL 1SN2A 3GZKA 4QO1B 1LWRA 2P49B 3EW3B 1U36A 3G5VB 4YSTA 4P5KB 1Z1WA 3JWNE 1PZ3A 1LO3H 2IQ9L 3C2SA 4HCFA 1L9NA 2ITCB 3AW5A 3FF8A 1NGYA 2A6IA 1CICB 2CJTA 2R69H 1NAKH 3J07A 3NEEA 4FRWA 1AJ7L 3U4BL 5AZ2L 5FYLL 1LO5B 3VGEA 3T0DA 4KKLC 3DUUB 2QEJA 1LO3L 1GYCA 4MS6A 3UG3A 4U1SB 3WKMH 4Q6YA 5C9KA 3QB7C 2ITEA 1SMAA 1O5DT 3BKYL 4N3UA 5C0JB 2DMGA 3SDYH 2NNRA 2Z31B 3CHOA 3Q6GL 1OGAD 4AGLA 3TX4A 3A67L 2B2XH 3S4SB 3VGAB 1JPGA 2AEPH 3X14A 4PGEB 4XT1C 3QG6A 4ZUTA 4APQB 4AQZA 3MOQA 4ONFL 4OV6F 3RJOA 1J11A 2WO4A 1YYLL 5LJYH 2YPKA 1J5DA 1G7IB 3ZQXA 1ZEAH 3GIVB 4ZOAA 2XG5B 5BRZE 5I74B 4ZUSB 1JPGB 1ASPA 2KI6A 4F57L 2BH0A 3THMH 2V2WB 4N2AA 4NDMB 2UZXB 1TFPA 3EBGA 4TV3A 3QG6B 4ZUTB 1U6AL 2JKNA 4A2MA 4JPWH 4R7NB 3VG0L 2B59B 4JL2A 3JXAA 1H6FA 3FQNB 1JHLL 5K5YA 2ZUXA 5JW5B 1XCTA 3P2DA 2XDHA 1ETA1 1UOVA 4O4YH 4BINA 4CVWA 1A1MA 2XWTB 4HQQL 3D85A 3MLRH 2V2WA 2JK5A 3K2UH 3WE1A 5FUOH 3C60D 3VFRB 4OCNC 5I1IL 3NABH 1AC6A 2WXLA 1IM9D 3PJNA 4FHJA 4GFTB 4FXTA 4JFFB 2PTTB 2BNQD 4KHTH 4HDIA 1WHOA 2YAFA 2VLJB 4DO6A 3FCBA 4DK3A 1ZAGA 2ZUUA 4YQXH 3LKOA 4OZIB 1BAFL 3SO3B 4YH6A 2Z31D 2YJQA 4GAGL 2PO6A 1WZLA 1MJJA 1RPKA 1TZHB 2A9ML 3ME0B 4TLSA 5TE7H 4BZ2L 1S5IH 1SJXA 2XTJB 4EEEA 3PWNB 2A9BA 4GO8A 4IMKA 5B3JF 8FABA 1MWAB 4M9OA 5F89A 1DDHB 4BKLB 1OXYA 4BQBA 2F15A 5B22A 3RWFB 1WBXA 1S78D 3NFNB 3BSZA 2P8PA 4M7JL 2CCVA 1JD7A 5AW0B 1T6BX 3N06B 1E40A 5EZJB 1RULH 3ULVL 3CDGB 1YY8B 2X4TA 4G7VL 3F00A 4MZ3A 1UM4H 2UXTA 2GC7C 1Y18A 1YYML 1SJHB 3CX5J 4NEHB 1MH5A 3P0VH 3GXNA 2EDBA 6PAZA 4FYRA 3IGFA 4C4KO 5DRWA 4XBPB 2OMXB 3ZTCC 2TRHA 4NO2A 2CU9A 5IEKB 3TOPA 4XOEA 2AI0H 1RQ5A 5CUSL 4YDJA 4KI5F 1E4XI 3B6SA 4UMGA 4HJGA 3ZTJG 2QKIC 1P0SE 4XN4A 4NO5B 2EYRB 4HCRA 1LQSR 2R39A 3HRZA 2CUHA 2Z8WC 1U8KA 4PG9B 1JVKA 3W82A 1DN2A 2ZX5A 4HU2A 3VGFA 4F7PB 4OCLC 4RRPA 2Z8RA 4ZUVB 5FV2A 3RRQA 4PRBB 1BFVL 1H9VA 3MV01 1MEXH 3OHXC 1XF1A 4N2FA 4U3SA 1BEXA 3RTQA 2NY5C 4DEPC 4EI5B 1V3KA 3O8XB 2GSGB 4LHUG 5I0DA 4AXWB 4WTQA 3DPBB 4LSTL 3QUKB 3HG0A 1V3LA 5LBSL 5C3IA 2EINB 3K71A 3APFA 1AD0B 4MBOA 3LY6A 2ENQA 2ZAIA 3UDWA 2H26A 4ODBD 3IU4L 3QSKB 4JY5H 4OZFB 2AJSL 4XXWC 1FBIL 1I8AA 2KLTA 3OHXB 4B9YA 2VDRL 3WKPA 3HBZA 3BQUA 2C34A 2X89A 2YQ3A 3BX7C 3U2SA 3K80A 4W9ZA 7FABL 4J27A 4FS0A 5HGHB 1YEKL 5F7YC 1NINA 1UT9A 2NY0D 4UTAL 5HDRA 3GK8L 2CK0H 1OP4A 4NYLB 4ACPA 3QIWA 2IFGA 4X6BA 2ZTBA 3UTTE 4X6EB 1C5BL 5C0CB 4NN7C 2G9KA 5CIPB 3CMOL 2YOAA 2PXYC 4N2NA 1U58B 4HZ1A 5D2NA 4L2LA 3WELA 4BFBD 1KCSL 1SY6L 3BXNA 5JMRA 5JIDA 2YKLH 3GNML 3L6FB 4H5SA 2XQYG 1T03L 3E6FB 3WHXB 4C55A 2QR0A 3U30B 1H5BC 1S7WB 4O02L 4BA8A 2CHXA 4M61A 1Z9OA 2NY5L 4UM8B 2G0LA 3NGBB 1U58A 5TDPB 1GC1H 3BKCH 3PHAA 4J3BA 2Q87A 2XA8L 1E6JL 4XOCA 2ICCA 3V7AE 1MHHA 1B4JL 2XU9A 3LXCA 3Q9PA 5IHZB 1WIPA 1N68A 5DJ6B 1FN4B 4KAQL 1HWGB 4ES8A 3QG7L 2ZG3A 4ZUWA 5TD4A 5AVYB 2FD6L 4U05A 2OULB 3MJ7A 1Y7VA 4FQPA 3AAZB 5DVNA 4YSOA 2ZNXA 5GXBB 5DEGB 3LS4H 3MCLH 1QSEB 4KGLA 2RCSH 4J23A 1FFRA 4X7FC 1GR7A 1CL7H 1ZA3B 5ETUB 3K72A 4F24A 3MLWH 1JF5A 4QRUB 1F1AA 1HILB 4X0KB 3FO2B 3OKNA 3UC2A 5EEXA 4J3VA 4U1JA 5IJKA 2C1PA 4LMQI 4Z7VA 4ANUA 4GUCA 2FR4A 3R7RA 4KVCH 3GXMA 4JDZB 1UA6H 1NFDA 1T7XA 1C7TA 4NO0A 1KB5H 2EDHA 1GHFH 3BEWB 4P4KD 3VFOB 4U49A 1TCRA 3RX5A 1NLBL 4NC1C 1ZLVH 4U6VH 2EO9A 2L7EA 5TPWH 3QORC 4CKVX 1NCCL 3SKMB 3FQ2A 2NDGA 4A38A 4PU2A 2IAND 4QJ3B 1QLFB 4I18C 3LRSA 3ES6B 4KVNH 3WFDL 3E80A 4ZMYA 2K1MA 4JQXC 3DX8A 5IJVA 4LPYA 2F8XC 1KZQA 1S4IA 4YLQT 2Q0ZX 4XPHL 3IMUA 2ZYRA 1JZ4A 5HI4C 3WDJA 5I66A 4P5MA 1IAII 4NHCL 1XSOA 4JJ5A 2V0AA 4H2CA 1F11B 4JAMB 3ASNB 4MSWB 1YA5A 1AGCA 3LKSA 4P9ML 1DVUA 1KPRB 2H9GB 4XCCH 1CR9H 4LNVA 4FG6D 5CAYB 3KJ6H 1N3NB 3QC5X 3QAZB 2CGRL 3F6JA 5EZPA 4MNGA 1P5VA 1X7QB 3BAXA 5EH1A 3UBXA 1HH9A 4LCCB 1SXAA 1DDTA 3AXHA 4N2BA 2DQGL 4OUUA 2R23B 1KN2H 3FS9A 1DQDH 3DSNA 5FA3B 4D0DA 3L3DA 1HU8A 1CFMA 2APBA 2WPGA 3SE6A 1QBAA 4ATTA 4K23H 2ARJB 1HK6A 2GK0B 1VRSA 2Z3FA 4IHBA 3TT1L 3JTTA 1LXMA 4DUVA 5FKPB 3VX0A 3ETTA 4UILL 3DI2B 3EFDL 3GMLB 5C70A 4AUUA 4YC2B 3RUGF 4HJ1A 4Y2DC 1EK3A 5E8NA 1MY7A 5JO5A 3U4AA 1X5HA 5I15L 3UTZA 5KS9A 4L9DA 2HLFD 1A9VA 1DZBA 2VDLB 1R6VA 2VDKH 4C56D 4MCYA 2WTOA 4HKZB 4KDTC 4NN5B 2YC1B 5F0MB 1HQRA 5FGCE 3M8OL 3AG1B 1KEGH 3GHBH 4IHOA 1TZIB 2VN3A 3OD3A 3MJWA 4H7VA 4U3HA 3GSRB 3DI3B 4JRYD 5AB2A 4PTUB 2B16A 3JWNG 1AR1B 3O6FB 1HZHH 4HT1L 4HWZB 1XXDC 1X5AA 2ZWNA 4RCAA 4G9DA 4IOFD 4LAJH 2C8NA 4KMQA 2X2IA 4HXBL 1HYSD 1KENL 4EDXA 4XVTL 5JOEA 3GSRA 2MQCA 4PBWD 1OM3H 4NLAA 4RDBA 3UTTB 3DGGA 1PU0A 1G7HA 3IBEA 4XMVA 4K0OA 4NBXB 3LKPB 1OGTA 3OZLA 5AYUL 3TEZA 2WKOF 5KJRL 5DHYA 2CIKA 3GZQA 1I1AA 3OXRA 3UROR 1C12B 2D31B 3GI8L 4G6ML 1C8PA 5AYUH 3BC9A 3CPLB 4WCYL 4ZOCA 3VDCA 5F1NB 3C5SA 3DGCR 3WY1A 4S0SD 5EIQA 4KK9D 3RWJB 5F1SA 3VWKC 5JLZA 3GEFA 1N19A 5MP6H 5I16B 3QEUA 3VFSB 4PJ5E 5LCVA 3QXVA 3EO1B 3HG4A 5GGVY 1KGIA 1JZ3A 1DP0A 5GRYA 3BPLB 2PCPA 5EU5B 5C07D 5CHNB 3TFBA 3TJEL 3VE0A 4RAVA 3D0VA 3VU1A 2OYMA 4C56B 5IOPA 1OF2B 3U4BH 1S7TA 4NKMB 1SDYA 3L3GB 5E70A 3VCLB 4C47A 3FW6A 2R69L 3MOBL 1QSFB 2Y72A 5CEZL 4GAYB 2Q86B 3U9UA 5D2NC 3ARYA 3F6IA 2W9LA 4LE8A 3LZQA 2GTZA 3M1CA 3VXRA 4LPTA 5I5RA 4ZTOL 4A7GF 4BELD 1DQMH 5I1JH 1CDCA 2F0CA 5KAQG 3CFJA 1HXMB 5C08B 4O51B 3ZTNH 2X2YA 3LEVH 5L4FA 1U3HD 4HBCH 3OZ9L 4IM8A 3WUZA 2O5XL 1UT2A 1GS8A 5DHVB 4G5ZH 4R3SA 2BSTB 3JT0A 1IVLA 4GMTL 2G3XA 1NIEA 5BUPA 3F7YA 5K1JA 2Q76A 4P04A 1M1XB 4FOMA 3DOSB 2DQEL 1MY5A 4LIQL 3TT1H 1I8IA 3LNGA 1LMIA 2ZP0T 5F9AC 1F86A 1JHTA 2DLGA 1G7QB 3DJ9A 4YSSA 3VFRA 2VLRD 4NZRH 2MPAH 2BDNL 2HPTA 1O7VA 1P9MA 3TBSA 2VLJA 2CKBB 3DOSA 2GJJA 1CUOA 3EYFA 4JPVL 2BIIA 4RGMC 1G7MB 3MC0A 3OAYK 1J5OH 5GS1A 2WWNA 3EYVB 3EJYD 4PBXA 4HH8A 5L7XL 2OMVB 4XN1A 5H94A 2YPLB 1OM9A 2X28A 4WJ5A 3UXFA 3B83A 3OKMA 4JFOB 1YCSA 2OMZA 4X6CE 3O2VH 3UTQB 1PS3A 2QPSA 3QYMA 5B7MA 2AJUH 2BVQA 2IAMB 4LCWB 3VM7A 2NTFB 4LSRL 1UT1A 1YRKA 1B6UA 4JQVA 4YHIB 2X2JA 1CBVH 2ZP8A 3ZT6A 3QUYB 1NGZB 2ZYSA 3TBYA 1NPNA 2E6JA 2E9JA 4GW4A 2Q7YA 2XOTA 4Y2NA 5FW7A 4F8PA 1WYJA 4F8TA 2P3YA 4XVJH 3CZSA 2WYIA 1CLOL 3KM1A 5HYSG 4PV8B 1JNHA 4ZTPH 4H0LC 3VXSA 2J7LA 3C8KB 3THML 5FECB 3RB5A 1AZUA 4QKXB 3RIFF 1CFBA 2QZ5A 3VVWA 4KNTA 3H3BC 2DM4A 4PJEE 4A6YL 5HVHB 4TF4A 1CZ8L 2JWYA 3K4DA 1M3JA 1ZLWK 4KKCC 3NIGB 3HG2A 2A9DA 2FEDC 3V0FA 2BX5A 3ZU8A 4HOWA 3MCKB 4A7VA 1EJ8A 4KI5C 2PO6C 4NQEA 4PRPB 4PEEA 3WJLC 1ZIBA 3QO1A 2FD6H 3CH1B 2WZ0A 1CO1A 3CCHB 5GGRA 3KYOB 4HCRH 1WUNT 1HI6A 3GBNL 3IJ8A 1U8IA 3CZEA 1IM3A 1B4JH 3LOWA 4D7BA 4Z77A 2DWTA 2H6PA 4HUUA 1YEJL 4G6AC 3NCWA 2KZ1B 4J8QA 2W0KA 4APXB 1HCFX 1KB5B 5AZUA 3F2LA 4R5XA 5EZOH 1VFUA 3KBPA 4K71B 1HSAB 3BYYA 3TCLA 4ZSOA 1FJ1A 3T4AA 1PLCA 4HULB 2QDVA 3FMGL 1BQHA 3TT3H 3UEQA 2EDLA 1GRWA 3G5ZB 1A6PA 3WXWL 4EN3C 2RALA 2OR9L 2J6WA 2Y5QA 1T2JA 3PABB 2QVFB 2V5MA 2F5BH 4HWBL 5I1AA 3QEQB 4CAGA 5F6HI 1HH6B 3RY6C 1A14L 3B3IB 3QDMD 4L3CA 5K39A 3SDAA 1USQA 1I9JL 1X3DA 3NCMA 4IIQA 4TSAH 3SGKC 3LV3B 1JZ7A 2X70A 1VFMA 4KX8A 2BCKA 1HE7A 3DX6B 1MCDA 3G5ZA 1JG9A 7FABH 1BFSA 1I9IL 1R3JA 3AQDA 4L4JA 1MRFH 4RAUA 2EVFA 3QFGA 4N28A 5KUKA 5CJXC 5FOBA 2VN5A 1G5AA 1DQLH 3FB7B 3MBED 1UXSB 4HC1H 4WLCA 1WLHA 4UWQB 1B0RA 3P4NA 1LMKA 4WI7A 1HAWA 3FB5A 3FTZA 4TUKH 4HJTA 3EJZD 5F0LB 2H1PL 2LHAA 3DYPA 4FLOA 4I13B 1ZT1B 4IS6A 4P4KC 1QSED 5IHWA 2H2PC 3WSQL 3V5KB 5LAPA 1AE6L 4AXWA 5F7UA 2EIZA 3HLAB 4HWUA 4ZFFA 1QKZH 1OP9A 3D69A 4KROB 4Z7OB 4FE9A 4BFJA 1L5GA 4PHZA 3QBTB 3U6XS 4KXBA 4Y1AE 1DO6A 3K6SB 3FH5A 4LT7A 4RVBA 4NJAL 5CJOH 4KZEL 2EDRA 3ARDC 4WTZA 2HT3C 1P69B 2ZNWA 2V5TA 3IFLL 4TPRH 2OTWB 1T5XA 1NFDB 4Q56A 5DZJA 1SMDA 2R4RL 5KWYC 1KBBA 4N0UB 3W81A 2QPUA 2PCXA 3UJJL 3KS0J 1P7QA 5F7FA 1IKOP 1TIUA 3KVQA 4J3TA 3RHWK 1QASA 2ED8A 3CVHA 1OB0A 2FDBP 1TUPA 2Y7MA 4TM9A 1HQ4B 3L45A 1WG3A 2YMXH 2XNAB 5TE4L 2P5PA 3O3DB 4BQ9A 1FHNA 3HZMB 5T1LB 3W1ZA 4EI6A 2NW3B 3ARDD 1EO7A 3QUZB 5EORH 1VPOH 4PGDB 3WG7B 1CD8A 4TTGA 4DGYL 1E67A 5EC1A 3C60B 3SPCA 4TNGA 1VAHA 5DA0B 1S5IL 4G43A 4GKOA 1UXWA 4XPTL 3ESNA 3ALPA 2UZYA 3BZ4A 5TE6H 5L7XH 3NDYE 1XF2B 4ZAKB 3HPJA 3RVUD 1OLLA 2EUXA 1PZCA 5FA4B 1HT6A 3BGFB 3FKUS 2C3HA 1X4XA 1AXTH 3N6YA 1YMMA 3KBFA 2WXIA 8CGTA 3S3CB 2HX9A 1X5IA 3H3KA 4P59L 5EOCJ 3ZPDA 2VDOH 4KI5D 4GBXD 3MRLA 4YNYB 5HDWA 5LBVA 3S36L 32C2A 1P4LB 2FEDD 4WV1B 4AYMC 4AJWA 4U1JB 3GJFB 3DSFH 4Q9RL 4PMEA 4YJZL 2OXGA 3EIFA 3PHSA 3VG0H 5IW6A 3DOHA 1U8MA 2AP2A 5CM1A 2B14A 5F0JB 1NBZA 5DJCB 2C9SA 2VB5A 4OZGA 3IVKB 4U1MA 2V3DA 4YR6A 3GF8A 3VXME 2AW2A 4GSRA 4NQSB 5B38A 2F58L 4H88H 4S1DD 1A6VL 1QI3A 5CJBA 2E7LA 3AT0A 5KVFH 3PL6A 1B90A 4HPOL 3QEHB 4WI4A 1CGWA 4AEIH 2DWEB 1YYCA 2BFGA 4LP4A 4IYKA 3H9SB 3STLA 1BPVA 3L1OH 1LTXA 4R4NC 4DGUA 3IFNL 5DJ0A 2RACA 2R0WL 5C1MB 1MRDH 3HE6B 4G59C 4D9RE 4UM9A 4BFFA 4WUUE 1CTMA 5I6XB 3QS2A 1NL0L 1Z5YD 2YD8A 5D72H 3O41A 1Z66A 4XX1G 3SBRA 1ZLDA 4RMVA 5JUEH 1AI1H 1PCXA 3PWVB 2RGSA 4JFFE 3BIBX 4GEIA 4ENEC 2WAQA 3KLLA 3TBBA 4KMTH 4UM9B 1BMZA 3UO1L 4AV5A 4L4TA 1FIEA 2BP3A 4WU7A 5J6SA 1BV8A 3Q44A 1NCTA 1SLXA 2ICWJ 4ODXA 5DJYA 2WJ7A 1L9QA 4U2YA 1MRCH 4MMZA 5GGVH 3WHE0 2Z35A 3BSHA 2P47B 3EO1A 5K9QG 1KIUB 2E9IA 3U9PH 1SDDA 3B2UD 4QRQB 5DO2D 3SDDB 3Q2LA 5FS5A 5B38G 4FQIH 3P4OA 1KENH 1Z32X 1HXKA 3FQ1A 3TH3T 1TETH 2WLKA 3IF1B 4DZBB 1FL5B 3L95B 3P73A 3RFZC 4ADJA 4XMPL 2NXYB 2ZCKH 5EO9A 5JHDA 1CD9B 1NBVH 5AW5B 2CO6B 1AXSB 4NNPL 1FYTE 4Y89A 4ETYA 5FIEA 4FADA 1NL0H 4E9SA 1P6AB 4OZ4A 2YSSB 1WBYB 2LVCA 3PGCB 5KBNC 5GZOC 4NQVA 1G4MA 5HJDA 1O5PA 3X2QB 43CAA 3O6FA 5I1LB 4L4VD 1MJ8L 4O5LH 3GIZL 2EO1A 2NXYC 3S4SG 1LEKA 1E0OB 1P4IH 1IAIH 2WGNB 5JW4Q 3RUGE 2QHLA 2Y1ZA 2BRQA 2KLRA 5F7NC 3ENEA 5MEPA 2O5ZL 2BS71 5C07A 2VDNL 5DWUH 2JMRA 1WZ1H 3PWJA 1CXKA 2QKIA 2OP4L 4O2FB 3X1GA 4FHKA 1B9KA 4UANA 4GQQA 1KYOJ 4X9HA 2PYFA 2XQYK 4RBPH 4HHWA 3EYSL 2VN6A 4Y88A 4ALAL 1ZWIA 3VDAA 4PPTA 5GGSY 2AJXL 1CDIA 1HSBA 3OL2A 3WIHL 3FBQA 2QVKA 4OF6A 1OF2A 3C6LD 1F4AA 3TA3D 1KBVA 2F8IA 4X9FA 2WMPB 1N26A 4JFOA 1A7PL 3MRCA 4Y5XA 3VXPA 5GZOD 1KIRB 4I1NB 4JEGB 3V4UL 1R19A 4UT6A 2ID5A 5CCKH 4A2DA 3EYOA 4Y4HB 2CAKA 2HVBA 1VKXA 3IJHA 3U0TB 2EE9A 1RJZA 2OLDA 5ID1B 3GPSA 4QRPB 1EEZA 3BRFA 2ZICA 2J56A 5I5JA 4CU8A 1JPFA 5T1KB 5IBLD 5IFJB 2QSQA 1UJ3B 5IM7B 3P4LA 3OKOB 5J1AB 3BPOC 2IV9A 3IDNA 5MI0B 3EOBB 3MHZA 5B7EA 2J57A 1LK2A 1I3RB 2F53E 3KPMB 2PYEB 3NCJH 4DFIA 3QXTA 1FZKB 3BUBA 5IVOA 1IGFL 3E8VA 3VFWB 1IARB 2W94A 3VFGH 4AQOA 2EDOA 2HLFC 4GP4B 2C7UA 5IM7A 3GINA 3HR5A 1RK1B 3SYOA 1U8OA 2E86A 2D2CC 4RETB 4CSZA 5HPMB 3HFFA 4XMPH 3H0TA 1A6UL 4EBQL 3UJJH 4F5CE 4LSUL 1TQWA 3MLWL 5C8JA 5LKNA 4JG1L 2AGJL 4NUPA 1PGRB 2Z92B 3MFFA 15C8H 1R5VA 1S3KL 4U3SB 1OD7A 4C83B 5GGRB 4FQIL 3QIWB 4YDVB 2W88A 1GPOH 4RX4A 2X4QA 5F7DB 5IMKB 1DLHB 4KK6D 3LEXB 4E9XA 3H0TB 5KSBE 5JHDE 1FP5A 1QRNE 3W2DH 1J9SA 4L8CA 5F7BA 3FFOA 2A74A 3QNYB 5E7FA 3QFJB 1X6NA 2UXFA 5HJGA 3ZE1F 3IETB 4W4OA 3ZO9A 3L9YA 4QHMA 2FWLB 5AYQA 1MCJA 2FWSA 4NQQA 4WEBL 4LLDA 4FI8A 1HAUA 1I85A 3QJQB 3DETD 3Q01A 2FT6A 2XX0A 1D6VH 1VZHA 3B1UA 3JWOC 1BBDH 4MQSB 4LOVA 2O61A 1CC3A 3L3KB 3LN9A 4NM4H 4LBAA 2ZJSH 1KOAA 2BC4B 3I50L 3S3PA 2KZBA 3JTBA 4CADB 2A4CA 5B1KA 3G6JF 1PL3A 3ROLB 4PJCA 1NFKA 3B9KA 1XGPB 4G8EB 5I76A 3MOAH 4E0RB 4OJFL 1DVYA 4XXWA 1XEUA 3LQAL 1A6ZB 3NCYP 2JTYA 2ZOLA 1ACXA 1U8LB 3F04A 4LK4A 5CBAA 2ZXGA 1M2VB 2YGPA 1F8TL 4PGCA 4PJIF 4U7SA 5C0FB 4JZOB 1I82A 3O9WD 2A1WL 1X5FA 3N50A 3JQOB 4Y19E 3SQOL 2VAJA 3K72B 4M43H 4G7YL 1UD2A 2ZOTA 5E8OB 5A2IH 2P8LB 4ODUA 2WXGA 5JPMB 1FLRH 1I75A 3SPVA 2X0WA 3TTSA 2V7NB 1FF5A 4IK7A 1JNLH 1B3JA 4KITB 2DTML 4EOWL 3L4WA 2XKNA 1EMTL 5CD3A 3DK2A 2F7RA 2XACC 5ANHA 1GYAA 2AJ3A 2J5LB 3CFDB 4LQFH 5D5MB 5I73C 2PWFA 3KS0H 3V0VA 3WIIH 4Y1TA 3BVUA 4MQ7B 1FL6A 4OI7A 3MBXH 3DK0A 1XV8A 3VYOA 2XG4A 1TJXA 1P6WA 4ZODA 3SPHA 1AXIB 3RY5A 1PYWB 3SGEI 5E1HB 3K74B 1MW2A 1OQOA 2H0JA 3BP5A 4XCCL 2XY2A 4XBEH 1J1PH 2A83B 5E9DB 1CS6A 1CCZA 1N59A 2VSKB 3JWDC 1MDTA 2O6FA 1CG9A 1QAWA 3H3PL 3LZRA 3VFPB 2J5LC 3ZKXC 3OMNB 5BOJA 4ODSH 1PZ2A 2EDNA 3POHA 1U41A 4JY6B 1QNZL 3SGKA 2VLRE 2ZCHH 1GC1C 4APQD 1URLA 4S10A 3JUYA 3U4EA 1J0HA 2ZD0A 2R29L 4M8UA 4P2OA 1JGEB 3MA7B 4ZBJA 5FF6B 3TYGH 4F27A 3QYNA 4X6CA 5BOPA 4PI0A 2OK0L 1LHZA 5I28A 2AI0L 2KDGA 4MCNA 4Y2DA 4Z7WE 2Q8BH 4OV5B 3HIZA 1HN1A 5F96L 2JQAA 2O26U 1MI5E 2OCCB 4HLEA 1RZPA 1T1WA 4KHXH 4YHYB 5KS9F 4R7LA 4X8CA 2ERJB 4PSRA 3JYBA 4KVCL 4QTIL 5GISL 5FF6A 1EAPA 3FO1B 4OCYL 3QHZH 4D9LL 1N5AB 3WY3A 4YHKL 5G2NA 3BH9B 3NUKA 3ZE2E 1UCTA 3UAFA 5I66B 5E8NB 1ZT4B 1CL7L 1DBML 3BH8B 1YEHL 4ONGH 1TFHA 4XE0A 3S5LG 4G3YL 4GAJH 1NFDE 1WCBB 6TAAA 3GSWB 5ANMA 3IFPA 4I18A 4LRIA 4AUYA 2GT9B 3IGUA 4LU5L 4M93C 3AWGA 4BFNA 4IRJA 4RMSA 4TQ8A 1CDJA 1B0GB 2PPFA 3IRZA 4PRIA 3W0WB 1LE5A 3GMQB 1KPVA 1BF2A 1HNFA 1OK8A 3D1MC 4UQ2B 3CXDH 1BAFH 5DHDA 3VD0A 5IHHA 2P5EA 3D25A 5AW1B 5I1GL 3VWJD 1GC1L 1UD5A 5EU3B 4ISVB 1ZGLA 2FJHB 4XBEL 1ZVSA 5F7KC 4M7KH 4UOW0 2NR6A 4JG0L 4LOUC 3WFBH 4YDKL 2BNQE 4X5RA 5EPMA 3QUYC 4GO6B 1U8CA 1DANT 4FG4A 3AQXA 3MKKA 2AV7B 3MBXL 4MNHB 3RJDA 4O9HH 4E41D 3JBG7 4G71B 1B3IA 5DUPH 3WJJC 1SVCP 2WBJD 2RFXA 2DS4A 2MTAA 1YNLL 3S36X 1PX3A 2LW3A 4G6FD 5GS2H 1I9RH 3MV9D 5CXPA 3OJDB 4HC1L 2EDTA 3CVHB 3DMMC 3EJCA 1QEWB 2YGVA 4YSUA 2VL5B 3NZHL 3GSOA 3ATEA 5SWZA 3A6CL 3T2LA 3II2A 5ESQA 1WP6A 2DWDA 2DH3A 5T1DH 1A7OH 4Q6IC 5CS7A 5M7QA 4HXAH 2R2EA 2E9WA 3QFJE 3C09C 2X1PA 3G6JE 2K8QA 2VJ0A 4Y9CA 5BRQA 4PJAA 3B4NA 1F8TH 3MNVA 8FABB 2GCYA 3QISA 1J88A 3D52A 5INCB 1TOXA 4KQ4H 5J6HA 4YSQA 3N43F 2VZ1A 3B2PA 4XODA 3BKYH 4PJXF 1G7HB 1Q8MA 2VLKE 4TUJB 5DQ9A 5LBSH 5BRPA 2HRHA 2P24B 3QRBA 5AZEL 5BS0B 3HPJB 3VXUD 3PP3H 4M5ZH 4GJTB 3TZVB 1EFXB 3WLBA 4KK5D 1XTMA 1UB5A 5HGDA 3WS6C 5K9OB 2YD3A 2PPDA 5GIRB 4K9EC 3MX0B 3UZQA 3HJ0A 4QXTB 4WQOA 4P2OC 1BP3B 2APFA 4OAWB 1YEJH 2YK1L 1ZT7B 5DK3A 3LSOA 3R7QA 3OGCA 2VDPL 4ZFZA 1URZA 5AW4B 2PYEE 1U8HB 3CBJB 4FQLL 2BNUB 2F53B 4XX1E 4CC4C 1NQBA 2CBQA 5L0QC 2E46A 4UV7L 2DLFL 3L7FB 3B9KC 1M53A 1UZ8B 4MDJA 5CSZB 5EOCL 4QXTA 1CF8L 4XC3L 2V37A 4GW1A 4JANA 3FAXA 4Y4KB 3D50A 2J3SA 5LCVL 3EUUA