1NICA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA02
3FU9A 1WA2X 4A66A 2QPEB 3ABKB 1RZPA 1CC3A 1OCOB 3FYIB 3PXLA 5I28A 1PNCA 2YAQA 1JXDA 3WNJA 3KW7A 1I53A 4DP8X 4JKNA 4CSPA 3OMNB 3L45A 4MFHA 1E30A 2QPDB 3NJGA 4EF3A 3TA4D 1CYWA 3QJQB 4KO6A 3NJMA 4M4RB 4E9RA 4F7KA 3TBCA 1XB3A 4E9TA 2W88A 3IEAA 2X88A 5I6OA 5TK4A 1AACA 2GI0A 2Q5BA 3PPSA 2IDFA 4A67A 1E65A 2XYBA 4E9VA 2OJ1A 4DPAX 3SBPA 3S3CB 2I85A 2BW5A 4YSUA 1M57B 2PP9A 3QJTB 1KBWA 4P5RA 3OM3B 2OCCB 1JZIA 4DPCX 4UAHA 3QQXA 1AS8A 1X9UA 1JXGA 2RACA 3FT0A 1BQRA 2YAMA 2GSMB 3X1BA 1SF3A 3TASA 1MZZA 2AZUA 2DWTA 3T9WA 3CZUB 2TSBA 3X1FA 4GY4A 3UACA 1W6LA 5D4JA 3NSYA 3FSZA 1NICA 3FU8A 3H4FA 3FQ1A 1AANA 4YSOA 1PLCA 3UADA 3AG1B 2H5UA 4BDVA 4YSEA 1HAWA 3ZDWA 2Q9OA 5I6LA 2YAOA 1M9WA 1AAJA 3WI9A 2LLNA 4E9QA 2PPAA 1TKWA 2H3XC 3UAAA 4HCGA 4YVNA 4AZUA 2YXVA 2AZAA 1KDIA 3FS9A 5B7EA 2VMJA 3AG4B 4WTQA 3EH5B 4G71B 3FSWA 3N2JA 4A68A 4AKOA 1GY2A 3NSCA 1XB8A 4NB7A 1XMEB 4HHWA 3SBQA 2FQFA 2YAHA 1BXUA 2BWIA 4JHVA 3NJKA 2FT8A 1RKRA 1NIDA 4KNUA 3UABA 3AZUA 1EZLA 4YSCA 4CSZA 1NDTA 2FJSA 1MG2C 2E86A 4UF7C 1PNDA 2Y69B 2PCFA 1SF5A 2MRYA 3FSAA 3TU6A 4ZK8A 1EHKB 1ASOA 2DV6A 5IY5B 4WKXA 1KCWA 1NTDA 1KYAA 3S8GB 3ZBMA 1ZIBA 3CVCA 2FTAA 4FA7B 3QJVB 3HB3B 2HLEB 4ENZA 5I5MA 3BVDB 1TU2A 3NJIA 1NZRA 1SDDB 1NPJA 2HRHA 3OD3A 4NERA 3JTBA 5B3SB 1ZPUA 4YSAA 2R7EA 1A3ZA 3IN2A 3CG8A 1L9TA 2PLTA 1QHQA 1E5YA 3ASOB 3D12B 4GP4B 2HRGA 3QJSB 1AZNA 1SHWA 1AZRA 2VW4A 1XB6A 3V9CA 3HEIB 2YAEA 2QDVA 3X1EA 2BP0A 4F2FA 3NSFA 3PAZA 5F7BA 1BQ5A 1ETJA 1AOZA 2VM4A 3ERXA 1L9QA 1KBVA 1CURA 3CVBA 3S8FB 4NAJA 1NIEA 4W9ZA 1GW0A 7PCYA 1ET7A 1M56B 2FQDA 2JKWA 2EIKB 5EHFA 2GIMA 3X1GA 2IDUA 5B7MA 5AKRA 5AFAA 6PAZA 2X87A 4DP1X 3AG3B 1JZEA 7PAZA 3ASNB 4A2GA 1W6WA 3EH4B 2MTAA 2FT6A 2IH8A 2UXVA 4W1TA 1JERA 1JZFA 2XVBA 5I5JA 1KGYE 4GP5B 3T6XA 4KOBA 1A4BA 3IN0A 1ZDSA 2HX8A 2VN3A 3PAVA 3S3BB 5LDUA 2YQBA 5FC9A 3X2QB 2IH9A 2R7EB 3NT0A 4KNSA 4BWWA 5I6NA 2UXGA 1V55B 2BWDA 1OCZB 3QPKA 4HCFA 2EINB 2IWKA 2W8CA 1ZV2A 3ZIYA 3QJUB 2YAPA 3FYEB 2BP8A 1QNIA 2XUWA 1V54B 3H4HA 4HALA 3NJNA 5B1AB 5B1BB 2XV2A 1L9OA 2HX7A 3UGEA 4PCYA 2IWEA 2FWLB 3FU7A 2YXWA 4HCIA 1SFDA 2AFNA 2XXFA 2A3TA 1AG6A 1OV8A 1J9TA 3G5WA 1GYCA 1OCCB 2JXMA 2BZCA 2WO3B 2B3IA 1JXFA 1PLAA 2YAFA 3X1NA 4DP7X 1NIBA 2ZOOA 2AVFA 1CYXA 2IAAC 3TBBA 1IKOP 1E67A 5B1JA 2P80A 3NJLA 2PCYA 3GDCA 2EILB 1PMYA 5I6MA 2I7OA 5E9NA 3WG7B 3WKPA 3KW8A 4BWTA 4QLWA 1OE1A 1HFUA 1NIFA 2J56A 3OMAB 1JVLA 1PCSA 2PPFA 4E9SA 1ASPA 3T71A 1J5CA 4E9WA 2XV3A 1OOWA 1ILUA 1WS8A 5PCYA 1PF3A 1AG0A 4DP9X 1W8EA 1GR7A 3T6WA 1IUZA 1A4AA 2I7SA 1NPNA 1SJMA 1TEGA 4DP0X 8PAZA 3NP4A 4YSDA 5B1KA 4N4YB 2BP8B 1OE3A 2QDWA 3UAEA 4AKPA 4E9XA 1OF0A 2QT6A 1GSKA 5B1JC 3AW5A 1A8ZA 4BDVB 3AY2A 3FU7B 1SHXA 3PCYA 3GYRA 3GXUB 1JZJA 2FT7A 4HZ1A 4DP5X 2FQEA 1F56A 1URIA 2BO0A 3CVDA 4X4KA 4DPBX 1MZYA 4QKTA 1AZCA 4PAZA 4JHUA 4YSRA 3QJRB 2Y1AA 3SQRA 1L9PA 2XWZA 4GP8B 1V10A 4A2FA 3FPXA 1WAEA 3ABMB 1WA1X 3MBWB 1L9SA 2XX0A 3AG2B 1AZUA 2H47C 4KO9A 5AZUA 1J9SA 1QLEB 4HHGA 3ZX1A 1RZQA 4FAAB 2XXGA 2OV0A 3NYKA 3C75A 4G72B 3SBRA 1GS7A 1JZHA 5ANHA 1ILSA 2IWFA 1A4CA 2CCWA 4A2HA 5I5IA 4YSTA 1OE2A 4KO5A 1BAWA 1N68A 1YLBB 1UATA 4UANA 1BQKA 2JFCA 4BXVA 3NJHA 3CDZA 1R1CA 1OCRB 1ASQA 1AS6A 2FNWA 4HIPA 3EF4A 1NWPA 3BQVA 1ZIAA 4KO7A 3RYMA 1MDAA 2GBAA 5A7EA 3NJFA 1E5ZA 2VW6A 1AZBA 4DP2X 1PY0A 4P5SA 4YSQA 2PP8A 1VLXA 2UXTA 5I6PA 1KCBA 2CJ3A 1CUOA 3FQ2A 1WS7A 2BW4A 2IDSA 1IBYA 2J5WA 1FWXA 2IDQA 3N55A 2XLLA 1AS7A 1SFHA 3PAUA 2GC4C 1KDJA 4M3HA 4Q8BA 3DKHA 3WNIA 3T6ZA 3NSDA 4YSSA 3U25A 2ZWNA 5B7FA 2B08A 4HAKA 3MX0B 3ABGA 3NP3A 1GS8A 4Q89A 1WA0X 3DIVA 2VSMB 2BP0B 1IBZA 2EIMB 2UXFA 4GXFA 2ZONA 2YARA 2IDTA 2J55A 1PZBA 1NIAA 2HZHA 2PPDA 2WO2B 1B3IA 4BK5C 1DYZA 2VSKB 4N8UA 4RH4A 1JZGA 9PCYA 1HAUA 1ID2A 1BYPA 2PP7A 1DZ0A 2J57A 1BXAA 4YL4A 5F7AA 1SNRA 3FPYA 1ET8A 2UX6A 3CDZB 2N0MA 1L9RA 4AX3A 2DYSB 2ZXWB 3ABLB 3NJJA 1X9RA 2VM3A 4G7RB 4A2EA 3FQYA 1SDDA 1ZDQA 1JOIA 2PPCA 2TSAA 3JT2A 1ADWA 1ET5A 1PZAA 3WIAA 4AKQA 2GC7C 1IC0A 1BEXA 1MG3C 6PCYA 3PLYA 5I6KA 4L0PB 2CBPA 2HX9A 2CALA 1NINA 3WKQA 4BXSV 4E9YA 4DP6X 4GYBA 3EHBB 4TXVB 1PAZA 4A2DA 4DP4X 2DYRB 1J9QA 5TK2A 4AI7A 3FSVA 2CAKA 3T6VA 5D4HA 2EIJB 1AR1B 1J9RA 2CUAA 1PZCA 1GS6X 4BWUA 1J5DA 2XV0A 4G7QB 2DY2A 2BHFA 3DTUB 3OMIB 3EH3B 1JVOA 5PAZA 2DWSA 4YSPA 2WSDA 2HXAA 5I26A 1PLBA 2GHZA 1GY1A 2GB2A 2AANA 3V9EA 3OQRA 1FA4A 4G70B 2PPEA 2VW7A 1BXVA 4YVUA 1N70A 1AIZA 1AQ8A 2UX7A 1RCYA 2P80D 1T5KA 3H56A 1BYOA 2FQGA 1TEFA 3S3DB 2NRDA 2BZ7A 4KOCA 3IBOA 2XU9A 1NWOA 1KV7A 1FFTB 4K9JA 4G7SB 4KNTA 5D4IA 2XX1A 3IE9A 1A65A 4F2EA
chains in the Genus database with same CATH superfamily
2G30A 4ZMYA 3TN0B 2MCMA 4K3DL 5EBLA 3QDMB 3IDGB 2J6EH 3Q6GH 1TOXA 4L8DA 3D8MA 3HS0C 4RDBA 4HP5A 4M1DL 3GZKA 3QEUB 1WFMA 3KLKA 2CDGB 2Y25A 1E5CA 1A1NA 4L3EA 4S1QH 2FD6H 3ARXA 1OKEA 3LZFH 2W81C 2ZOWA 2ZPKH 2E74C 2DQGH 4FQJL 1NCCH 4FZEH 3HFFA 5TK4A 3ULAB 1AACA 1TFHA 4KDWA 3HBQA 1G0YR 5BRZA 1M7UA 2GKIA 3N0AA 2ENSA 3BKYL 2WXNA 1Q8MA 4OJDH 4WRLA 3GLEA 1WAPA 4NPKA 2C7FA 2VLKE 1M57B 3EJRA 3FCUB 1QUNB 3KL0A 4YHPB 5AAPA 2VTFA 4DPCX 5F6HJ 2NQ3A 3ECVA 4H7VA 4JHAH 4YHYC 4AEIH 2H9GA 4P2OD 1JNHB 4R96A 5IHUH 1ZTXL 2ESVA 5DHDA 5L4FA 1KLGA 4ANUA 1MFMA 4LVHC 4KK5C 1BPLB 1HHGB 3GB7B 2XG4A 2IPUG 3RX9A 1OTUC 1YPZF 2AZUA 2ZWYA 3DXAD 1NDMB 4FTVA 3TVMB 4J2XA 1BF2A 2DLEA 2VXVL 2FBRA 3LPPA 1NCWL 2QGEA 1YNLH 1G7MB 4Z0XA 1PLCA 4AIZB 2RQ8A 2XDHA 4UTAA 4MQ7B 1ORQB 1WK0A 3E2HB 4P9ML 3GDBA 4QRRD 2IPKB 4WFGD 1JNNH 3K5RA 3LH2L 1FYTE 5MERA 4IK6A 2I69A 1MUJB 2L7JA 4PBWD 5DCCA 5F70A 3HG1B 1TJHH 1E42A 1UM4L 3CHPA 1A6ZA 4YVNA 5E6SB 3S5LB 2FZ3A 3AGWA 2FB4L 1ACYH 5LDSA 2ALAA 1KBKA 3ZUCA 35C8L 5CJQH 1SZNA 4FC3E 5EWIH 4A68A 4HZAA 3ZRFC 1MFEL 1BFTA 5KVDE 2GJ6A 1W0YT 5DVPA 1BXXA 4EZKA 4J8QA 5LAPA 3FQWA 2VQ1A 1ES0B 4K5LA 2PYFA 3NJKA 2CA3A 2LU4A 4BH7A 3AT0A 2AEPL 2CMRH 2XZCH 4XCEB 1MPAL 3QIUC 1CE6A 3S36H 3QQ3A 3NK4A 3NJVA 3S7GA 1A7RL 1K2DA 1NFDA 3TEWA 1AD9B 4PJ5A 3NJXA 4GS7C 4MSWA 3ZBMA 4HQQL 1RUAH 3V0JA 4WI0B 3DGGB 3CVHH 2XPGA 2JELL 2AI0H 3PJSA 3SBWC 4D94A 5JXEA 1YEEL 2HLEB 2F54D 1R33A 4S10A 4NRXA 1OSZA 5GS1C 1AFVH 3GBMH 1BBJA 3ML8A 4HIQA 1OF2A 2DH3A 1JV2B 3H6AA 3IDJA 1MCIA 4PRAA 1OP9A 4HFWA 4MJ2A 1BYNA 4W9CC 1FI8C 1KEML 3ZDZB 3MUY1 4AC4A 4X6BB 2PLTA 3Q6FB 5BV7L 5B3JE 2XYCA 1MY5A 1KBBA 3RVTC 1JN6A 2HRGA 4FI8A 5AVWB 1AZNA 2H7WA 4IBLT 3DDFA 1RLWA 4OCYH 2UWEE 4FFVC 4YBQD 1U2CA 4AQOA 5FF6B 3LB6D 4BSVA 2QVTA 4AYGA 2ITDB 4PRPA 1BQ5A 4XX5A 1WGOA 2CG9X 3UBHA 4APQB 2FSEA 4ZXBB 2MWCA 1TPXC 2HTLD 1GW0A 1S7XB 4MNHA 4RX4D 4WW2A 1KPUB 3GBLA 4F57H 2QR0B 5FDWB 2PWDA 2OMNA 2GIMA 3ARSA 5E56A 1HL9A 1P5VA 2IQAB 3HG2A 3B43A 5EZIH 5JIQA 1N59A 3EDDA 4FQ2H 3AG3B 4ETQB 4DWHA 1DANT 3T0BA 5I1GL 3C6LD 3BWAB 3KMDA 4Y8DC 1V7NH 4PJAE 4HOMA 2L7UA 4P2QB 1JERA 3U9PL 2Y5TB 1Y07A 3GMRB 1SUHA 4QXUH 2IG2H 1TU2B 4S1RL 4CN6A 1QWNA 1U8PA 2L8AA 4MQSB 5CILL 4I0PB 3OJ2C 4EI6B 4LVNC 4R6UA 1P2CA 5I1JL 3EW3B 5C0IB 1QLRB 3RJOA 3TWCL 2PXYB 4PRID 1L7TH 1TJXA 2WZ0A 2OSXA 1ZV2A 4NFDA 5GRVK 3MRJA 2PTTA 2PYEA 3CFKA 3HHMA 5T1LB 4BH8A 2Q10A 1T22A 3GJEB 4Z7QF 1U21A 5FYLD 2FWLB 4UOW1 2YXWA 4GBXD 4F2MA 3H55A 3G5WA 1A1NB 5DS2A 1WV7T 1F6AA 2YD7A 2RQEA 1DEEA 1OCCB 4L3EB 5LBSH 5C3TA 3K2UH 1AXIB 3ES6B 1S7TB 4MB1A 2EDEA 5EF3A 4DP7X 1E9QA 1K4CA 4OY9A 4P2RD 4F24A 5JIPA 5DLML 5E03A 3CVHA 4U2YA 4IMLA 1OB1B 2BVOA 2P80A 5C0ND 3A4AA 3GDCA 5I0YA 3SYCA 1LTXA 3WTWA 2YRPA 3SE3A 1LMIA 1I1FB 1EUUA 2ENQA 2DLFL 2FJFA 2GFBB 3NIGB 3HBPA 1P6FA 2VLRE 1DQTA 5FUCE 5GS3A 1I9JL 3L5HA 2X4UA 3TONA 1BF8A 3LMJL 4F15C 5I66B 1N6QL 1HSBA 2OMXB 1KLGB 3U83A 3P3RA 1SVCP 3V4VB 1S7UB 1WD8A 4ELDA 3FUMA 1JNLH 4FTVB 4NCC1 4CVZA 4ODVL 1A4AA 2I7SA 1R4XA 3ZTJH 2GCYA 4ZW3A 4R7DB 3NP4A 2BFGA 1NMAH 1HH9A 3QNFA 4HXAH 3BCFA 3TZVC 4Z0XB 3SGKC 5JLZA 4C83A 3WFCL 1KY7A 5L2KD 3AW5A 2WXFA 2P43B 3KYMA 1KTLA 5MERB 1UZ6E 3R1GH 3H9SA 3LKQB 3QXDB 1LP9E 3U2JA 3S88H 1H6TA 4S0HA 4IRZH 3QUML 1MJ8L 1A6VL 2D3LA 5HJGA 4LCVA 2FZ3B 3WAJA 5EF0A 5ISZB 4RIRA 5JA9A 1LM8V 2A6DA 1NOFA 4YXLH 3VD1A 5DQDL 1P6AB 1QZ1A 5T5FH 1L9SA 1GZPA 3GLZA 3I9GL 2CUHA 4OLWL 3RFRA 2WWOA 4H88H 4ZNEA 4MNGA 2YRLA 3MYJA 2GJ6B 2BNUA 2HH0H 3NYKA 4L9DA 2R39A 2VQ1B 1FC2D 5D70H 4MMXB 4N1EA 4I3RH 4NQDD 1XCQA 3BRFA 4PJ6A 3TO4A 3FH5A 5KG9A 2F1EA 3JXAA 1YLBB 4Y4FC 3QQ3B 1PG7X 3HS8A 2C1PB 3ZL4H 4KKZA 1Y0LB 2EABA 2Q7YB 1JYNA 1AQDB 4KK9C 3P0YH 1BVNT 4PJ5B 4F9LC 3P11L 1GHFL 3TJPA 1FH5L 1EBPA 3BJLA 4HIPA 1OM3H 3CHSA 3MACL 1AGEB 3SYAA 3NACL 2PETA 2OR8A 4YL9A 1T20B 3PJSB 1JHLH 3TO2A 4Z76A 1XF5A 2C3HA 5GISL 1BEYL 1R3IL 1UXSA 5DFVC 1E5ZA 5LBSA 3CVIH 4GMTL 4QRPE 3RGVD 4ES8A 4XNYL 1JWSA 4TKWA 4XP9L 5I6PA 1YMMD 1VZHA 3WNOA 1G1YA 2JMRA 3TPKA 5D1XE 1OF2B 2Y7LA 4GW5B 4S1DD 5IQNA 4JPIA 1BAFH 1DVYA 4HFWB 5CCKH 3C6SB 2QKIB 5M94B 4NOFA 4EXKA 3CHOA 4XP5L 4XWOC 2MTPA 5K59E 4Q8BA 3BVXA 3EJZC 3VXMB 1Z9SB 5F71A 1CL7I 1EZUA 1RZFH 4YE4H 5AVZB 2A38A 2WUCH 1MFCH 3QDAA 5G5DA 3O2DL 4ODTL 2K6WA 4M5SA 1DVFD 4BSVB 4KJWD 4LHUG 1IBZA 2ZONA 5C97A 4MA3B 4FLHA 4QRTA 1IGIH 3ZXAC 2FSEB 4YDKL 3NCYP 2WP3O 1PZ2A 4FYTA 2E56A 3FFDB 3X11A 2M26A 3L4YA 4FG6D 2ED6A 2VB5A 4TTGA 2OK0L 1DUYB 2N0MA 4YXHL 5JPMA 4D0DB 3ARGB 1NGZA 2BRRL 1A9EB 2JF1A 5KBNC 2YXMA 3Q8AA 3JWOC 3MRDA 4A2EA 2QZQA 3VWKA 3TEYA 1SLWA 2ZYHA 3SDYL 1IBGL 1JD9A 2LOEA 5ITFA 3H0TB 2BIPA 2HG0A 1CFMA 3EYQC 4FCAA 4IRZA 4XVTH 2ZE0A 2JI3A 4PQXA 1U8PB 1AO7A 3LZOA 1FFOB 2Y7OA 3S4SA 2IH3B 3ZTDC 3IMSA 1IGFH 1MCKA 3A67L 3LZRA 4KK8D 4PP1D 1EIBA 2DY2A 7CGTA 4CJ1A 3MRJB 4WWKA 2F5BH 4KJYA 1T89C 3TS8A 2RB8A 4MJIA 2MPAH 4POZC 2QL1A 4X6DE 4HXBH 2RFXA 3DV6A 4L4TD 4F2MB 2E5EA 1UQSA 1EWHA 3RDTB 5D1ZC 1CICA 3PQYA 1L9NA 2Q3AA 3P69A 1GKEA 2VE6A 4LSPL 5D1QE 1IAIL 2R69H 3NCEB 4NLHA 1OT1A 5LJYH 5DQJB 4KKRA 4AH2A 1QSVA 4C56D 3QB7C 3BP4B 3U7WH 2JB6A 1X44A 2CHDA 2WVSA 4AYFB 3NCCB 4RQQB 4K23H 1IAOA 3TA3B 3ME0B 3Q48A 1IBBA 4R7NA 2NXYC 1TTRA 4KOCA 1UWYA 5A7BA 1ECYA 3IBOA 2QJDA 2FJFB 3B9VA 3CXDH 2O5NA 1U33A 5J06A 1RZ8A 3QEGH 4LF3B 4Y89A 5GJSH 3RX7A 1DHKA 3L2NA 4S0TD 4MAUL 5AB1A 4Z8FH 1KTKE 5JPNC 4G6JH 3EKCA 4N2MA 2WXQA 1XGRB 3WNJA 4DGYH 2LU3A 3VTMA 2D9QB 3FN0L 4GQZA 4CVZB 5IFJA 32C2A 1HHHB 4X9GA 1KN2L 1EH9A 3ARDD 3LIZH 2DD8H 3MUHL 4DKAA 1LE9A 4FG0A 3DUHA 3V0WL 4P5KB 4AEFA 5BUAA 4FLQA 5JLZB 5IW1A 2V7HA 1QSFE 1XB3A 4NAMA 4D3CL 3VWJD 4RFOH 4MRBA 3EFDL 1DZBA 1KTLB 1W8NA 3KWUA 3KPQA 4N5ED 3NESA 5F9WC 3A4FA 5T3XH 3QXTA 1E65A 1Z5YD 4FMKA 1QSEB 3BAEH 2ZICA 4JM4H 3BT2H 2AJUH 4TLSA 5CZVH 4Y1TA 3WNNA 4RIRB 3MOBL 4EEEA 3OM3B 4BK4A 3O8XC 5CFAA 4UAHA 3T6QC 3T1FB 4U1LA 2XACC 3ARVA 4W4NA 1KXTA 2JWYA 3G5YB 3MRHB 2F1BA 2BNUB 5A1AA 3WN5A 2HG5B 4N20A 3DX6A 1J8HD 2P5PA 3ARFD 3ILEA 4PJIE 2N01B 5IM7B 4UV4H 4A7VA 3VG0H 4X98A 1G7JA 4H2AA 1XCQB 2TRYA 2R0KH 1P7QB 4AQEB 4O58H 3MLRL 2N3JA 4ISVA 3QDJE 5SWSB 1FSKB 4IMKC 5HDLA 3LD8B 4N8VA 3MV8B 5G55A 3X13A 5IFAL 1N5YH 1YYMH 1Q0XL 2ZZUT 3E38A 1I1AA 4JGMA 5JHDE 2VC2H 5T3ZL 3ZKND 1CU4L 3RG1C 4LSUL 1BZQK 5CLTA 1M1XA 3TO2B 1C5DB 4KGJA 5ESVB 4Z76B 1TKWA 5C6WH 1ZAGA 2XQYA 4AZUA 4W4OA 4PJ9B 4DW2H 1UASA 2R69A 4YHOH 1FF5A 4XMXA 4P4KD 5DUBB 5FM8A 5B7EA 5EIIA 2W0FA 2DLTA 4B9JA 1UB5B 1SOXA 2OJEA 1TYEB 1ETB1 2VLLA 4I89A 3P40A 4QY8A 4H0IA 4JPIB 1EXUA 2EC9T 3JV6A 3B2VL 3N44B 5EEYA 3O0LA 4JFOA 2GYSA 3CLFH 3NSCA 3ZY7A 1XB8A 5DC4B 1NCJA 5CF3A 1ZSHA 3V6FA 43CAB 5IV2A 4PS8A 1OZUA 1NC4D 4PWIA 3QZOA 4YX2L 3RNKA 2FT8A 3VD4A 3D05A 4Q7DA 5G5DB 4YPJA 3C09C 1W72A 3MROA 4HDIB 4DN3H 1G4MA 1XGPB 1SF5A 2DWEA 2DIAA 2MRYA 2WD0A 3FSAA 3UO1H 2IANB 4MAYA 3RBSA 2HUHA 2DQTL 4HS6A 4OQ1A 3L6FA 1OB0A 2MOGA 5IY5B 4JZOA 2ZJSH 1CT8A 4OKVA 1MVYA 3SDXA 1JI2A 3RGBA 4L4VD 8CGTA 4KI1A 3LIZA 3X11B 4UTCA 2WXLA 1ZIBA 2AJVL 3DX0A 3I6SA 3QUZC 4J3TA 4RGOH 4DN4H 5I8KH 5DF0A 1YEHL 4PVLA 4Z7OB 1KC5L 4IDLA 1OHQA 1MRFL 1FVDA 1E9PA 4XR8C 2AJXL 3MRDB 2R1YA 4JGUA 4J23A 3VWKB 1WICA 3D7PA 2YPKA 4NHCH 1YHPA 1AIFA 4PJCA 4HGKC 5AYUL 4C8XA 3VI4E 4XNUH 3CG8A 1PZSA 1T0MA 3L3KB 2P3YA 1N64H 2R9HD 4X8JB 4WWNA 3JVFC 1BMGA 1ZCRA 1UOLA 4K8RC 4LVOB 5IMKA 2FEDC 2IPTH 4W6XB 1OQOA 3TV3L 1QVOA 3TPUA 2JJWA 3ILPB 2WBXA 3QIBC 3T2PA 2KH2B 4LRNL 3PAZA 3NTCL 3PJNA 4QMEA 3RVUD 4PLKC 4AYEC 1PZ5A 1J9CT 5K9OA 4LQFL 3WV0A 3S8FB 3STLA 1NIEA 3GBNL 4R83A 3KYOA 1UQSB 2ENYA 2ZKMX 4JLRA 1ET7A 4YHKH 1F41A 5SX4H 4YMPA 3GSRB 2JJUA 4GLRI 4IM8A 5IKCA 4ACTA 4NN5C 2V8MA 1N10A 4MJJA 3X12A 2VKXA 1Z2KA 4U0RC 3F7YA 3P0VH 2WLMA 4L9LC 4OCSL 3VRJB 3FBKA 4OQTL 2WWKT 3MQIA 4EQ2A 1IGTA 2CR3A 2FO1A 5I9QB 2RA1A 4PR5B 2IAMA 4O2CA 3C5ZD 2NY2C 4BZ1H 1IAOB 4F37F 3J07A 5CCJA 2EDRA 4R7NB 3V0GA 2H26B 2CO7A 4K3DH 4AV0A 2XVBA 1J0KA 4FRWA 5I1DA 1DVTA 4LCUA 2WMPA 4Y19E 3BIBX 3JVGA 4XOEA 3UJJL 4M1DH 1CGWA 3X2QB 3M8OH 5J3HC 1MAJA 4IDJL 1DVXA 1D9KA 2BWDA 3OHXC 4OFPA 1OCZB 5I8CA 3MRPB 3PF2A 1NGPL 5IMMA 2EINB 3FQNA 3VACA 5E6ZA 4AQ1C 4WTZA 2VISB 4MLSA 2CIKB 4M61B 1OAYH 4NO0D 2HX7A 4X42A 4NT6A 4YLBA 5B38G 5IFJB 2CJUH 3VXUB 5DMIL 3BAWA 3HG5A 4Q9QH 2BNRD 4LGPB 2BOCA 4W93A 2DQ6A 4XCCL 4X7CC 5HYJA 3IM1A 4I48A 1DL7L 2EQDA 2R2HA 3KL5A 4UQ2B 4JM2F 4P07A 5AL0A 3VFVA 1UM5H 3KPQB 3HMWL 1IKOP 1E5BA 4OGYH 3B9AA 3EO1A 3O3EA 1VGEH 4R5VA 5I1IL 5I6MA 1KLUA 3TYGH 4HWEH 3KS0H 3U4EA 3U36A 1J8RA 4BKLA 3B9KA 4M6AA 1JYWA 5ITBL 4JO4L 2VXVH 1ZV5A 4U1LB 2DN7A 3DMMB 1KXTB 5A2CA 3HNTL 1PCSA 1YECH 4LFHD 1E9OA 2XVLA 5DYOA 4ZUUA 3SSGA 2JLLA 5DJ6A 2ZNWA 4RWYH 3V0AC 2XV3A 2B1OA 3H3KA 1ILUA 2V6HA 3S3SA 5AYQA 3QDME 3D39E 4DKFH 1A3QA 3NAAH 3T6WA 5E5RB 3D2UA 1JPSL 4HJJH 3KG5A 3QI9A 3ZDYB 3HZKA 2XN0A 4NQXA 3ZPDA 3BEVA 1SEBB 3TBSA 4CNIB 3SPGA 1MI5A 1NUGA 3FU7B 3OR7B 4GO8A 4ZYKB 3FTGB 1XGYH 3GKWL 3LN5B 4F7EB 3QRGL 1M1XB 4HSQA 4EVNA 4NKIL 1BLIA 4QTIL 1TKWB 5IUCA 2ZKHH 2XWZA 1FBIL 5EIIB 1PKQA 2W0FB 2RH0A 4RZCB 4Z7VF 3VGFA 4B97A 4X6CB 5GGVY 2OJEB 2BJMH 2E9GA 1ZRUA 3BAIA 2AEPH 2WXRA 3JV6B 1AZUA 3T0EC 4BZ1A 2NR6D 4XN5A 3WKML 5LNEA 5MEOA 1F1DA 2G3MA 1BVLB 2VMDA 1KGIA 4ZUVB 5AB0A 4JEGB 1E5UI 3QORD 1FGNH 3V6FB 5IV2B 2R83A 4NIKB 4MYPA 3L5WB 1GS7A 1EDQA 1ML0A 4TN9A 1EEYA 1ZV9A 5I5IA 3F5WB 1ZWIB 1RU9H 4NYLB 2JELH 1KEGL 1YEIL 2RCSL 3SKOA 4P46D 1CGSL 4BFJA 3CUPB 2BFVL 4Y1AB 4HG4K 1LL1A 2ZOKA 2ZXGA 4JZOB 2NZIA 2C3VB 3K4DA 3SDXB 4YBLC 3NEOA 2QV2A 4AL8H 4FQQB 3RYMA 1ZT7A 1P4IH 3T3PB 5D5MF 1B2WL 3S5ZA 1IAIM 2VW6A 2WBJB 4ZZFA 5E24E 3DIDA 3HG1E 4B7LA 4DP2X 5BV7H 5F1SA 4TSCL 2UXTA 5L8KB 1P7HL 2R1YB 4PB9H 3CDCA 2AEWA 3S34L 1C7SA 2YEZB 1GTFA 3OG6B 1DSFL 2EEAA 1ZLWK 1AIFB 1IBYA 4X4XA 3WIFA 5EU5A 4NZ8A 3ULUF 5HJ3A 2HKFH 4J7RA 3FU6A 2GJRA 3UGUA 5HD8C 5E8OA 1Q9KA 5JHLH 4HWZA 3T3MB 3C6LB 5B7FA 2OQJB 4FF9A 4PJBA 2DM7A 2BSBA 1ERNA 3KPRA 4RGMB 2FX8H 3DETC 4KV5F 2XKUA 4R4BB 1U8OB 1JD7A 3LSOA 1KIQB 4LU5L 1JTOA 3SCMA 4AE1A 5JOPE 1CZ8H 4NENB 1E40A 3STLB 5FW7A 3KDMA 1CVRA 3M1BA 4JLRB 4MXQD 2ED8A 4H44C 2VDNL 4M5ZH 4XNZB 1HNYA 25C8L 2OSLB 3F83A 3MJ9H 4XPAH 4LARH 1RUKL 3QHFL 3U9PH 2Y7MA 4S1RH 2NYKA 3WBDA 2CIIA 4M03A 4UILL 3F7YB 5JO5B 3S37X 5I1JH 2VC2B 4GBXB 1IGTB 1HIML 4K15A 3NZUA 3WIAA 4AKQA 2X44D 1BEXA 3UJIH 3W37A 4LCIL 4MCYA 2XFXA 1ZLWH 3WKQA 2XWXA 1NINA 4KTDL 3ZDZE 5I1DB 4X4YA 4LMQI 4A2DA 4XBMA 3JV5A 5J1AB 3MTXA 3G5XA 4AI7A 1XGQA 1RUQL 2YSTA 3K6DA 1D9KB 5C0GA 2NLJA 1MCQA 2PR9A 5IMMB 4A38A 3FQNB 2EH8L 2XV0A 2CNYA 1XF2A 4OF0A 3OJDA 5PAZA 1KACB 1U91A 2XWBA 5IVXA 5IB1B 2HXAA 5DLMH 3I6GA 5C07D 1O6SB 1PLBA 5EOCJ 1EVUA 1B3JA 4RMBA 5F1OB 1DLFL 1NCAL 5CP3A 1Y6MR 4OI7A 1R75A 4ELMF 4PJXA 3MREB 4JRXA 2R2HB 4TNWF 4ZTPL 3BP6B 3CFEB 2IPUK 3LRSB 1IAII 2KZBA 1BOGA 3VFVB 5EU6A 1F4XH 3MPCA 3LKSB 2VL5A 3Q2NA 3A47A 2DQCL 4M62H 4XZUB 1JDDA 1N6QH 3DBXA 2EUZA 1GPOH 2R1XB 5L2KB 4H8WC 3S3DB 5LUMA 2P8LA 4P2QE 3UZVA 4LCWA 4XVSH 1WBYA 3U4EB 4F1ZA 3VFPA 4BKLB 1CFBA 1AJ7H 4KNTA 2JCCF 2EEDA 3FTSA 4P2AA 2YN3A 4TVPD 4TSBH 4ONGL 1E9OB 5DYOB 1QW8A 3V5KA 1SYVB 5I28A 5DHVH 2E8YA 3WFCH 5E0FA 3MXVH 1OAZL 1YEDA 5JHLA 3BQUD 3UTTB 4JX0A 2X1XR 3T65B 4JKNA 1IC4H 4PJGA 4PV1C 5C09D 1BFOB 5FO7A 3GSVA 3QI9B 4IRSC 5IMOB 1NGQH 3QUMH 1G9MH 1MJ8H 1H8OA 3BEVB 4L3EE 3BAJA 3P4MA 4NQSA 5JXEC 4Z7UB 5DZVA 4C4KT 3K4ZA 1MCWW 2ICWA 3GIZH 5K93A 5I6OA 2BHZA 1LQBC 2QSVA 3W57A 4PMEA 4NRZB 1ZK9A 2WLJA 1CQKA 4N0FA 4F33A 3GSUA 2J12B 3BXNA 2JKNA 1I7UA 4LESA 1D5XA 2EIDA 1M7DA 5CZXD 3QJTB 4IJ3C 3O9WD 4FG2A 3VRIA 3L3HA 3D09A 4K55A 3IWUA 1UTDA 4MJ4A 3NIGE 3US1A 1LK3L 2E59A 3PABB 4V1DD 1BA9A 4L0YA 3Q9QA 5CEZE 1JS4A 1YMMB 2NNAB 4WWID 3K71A 5KN5A 1XF4A 2WWKO 1QOKA 3G08B 1XF3A 3EOYG 4YR6B 4R97C 5FKAB 3T8VA 4XMUA 1EEYB 3NACH 4FTVE 2B1AL 4I0CC 4ZO6A 5FGSA 3TIEA 1F90L 5AW5B 1BBDH 1GA2A 3D3VA 5DO8A 4XNYH 5IB2B 2QPFA 4G8EB 1Z9NA 4YSOA 4DVBB 4WW2C 1QI3A 4BDVA 3MGTB 1U3HA 3O3AA 5D7LA 3VXSD 1DVFB 5MHSD 3S6CA 2H2PD 1U8IA 2WIMA 1V05A 2XWEA 3KPSA 5CUSH 2LLNA 5HPMB 5E2TL 4K3HA 3JTSA 3MN8A 4HCGA 4RMRA 1TTFA 2Z0BA 4XP5H 4MCZB 1X5KA 1T0NB 4U1IA 5B4MC 3ZYIA 5ISZE 4F8OA 4AJWA 3TIDB 1F4WH 4DCQA 4X4XB 3WIFB 4ODTH 3B3IA 3NFSL 4QO1B 3VH8A 2K1MA 5IVZA 4X9IA 3G9VA 3QJHB 4OZIA 3IWVA 4F91B 1Y1DA 1ZS2A 4TULL 5I1KL 5KZCB 4HULB 2GJ6E 1MFBL 1NAML 5E8OB 2FQFA 4YDKH 3MRGB 4NP4H 4X5WB 3WIIH 2CGZA 2ZCLH 1B4TA 2X4TA 3L9YA 4YK4B 4JFTA 3ZHDA 4XN7A 3W3BA 3CX5K 5DHVA 4ZDHA 4R8WL 1CLYL 1ASOA 2BRRH 1EFXD 3EZJB 1ONQA 3JBG7 4NQCD 3UAFA 5IEHA 1JSYA 4UQ3B 4PJ5E 5I1AB 1MHHA 2ADJA 2N56A 1JXJA 1J18A 1H15A 1KPVB 4UBDD 3CVCA 3VB9A 4U1KA 2LLLA 3B7YA 3QUMA 4R0LA 5GZOA 4ENZA 1FVCB 4AK1A 2VERA 5SV4A 3RZCA 4HWUA 4HK0A 1PPIA 3ARTA 3SE3C 1N3NA 3Q7JA 2R2BA 4L4TB 5E2VH 5C0DA 2VDOL 1G7PA 3K72A 3D07A 4HS3A 4ZQKA 3CZLA 3CFDB 5AZ2H 4WTWA 1MIEL 1GVIA 5ALBL 4LLAA 2AXHA 1UHVA 5DD3L 4C56B 1WFTA 2GI7A 2XRAL 1BGXL 1YN6A 2WYHA 3VXME 4RFNC 1A5FL 2XTJC 3BKMH 3WJMB 1DBJL 2NLJB 2Y06H 2VAAA 1XB6A 3HBZA 3U1SH 5B21A 1FDLL 2QDVA 4WK2B 2BP0A 3VXNA 3JWDL 3AQDA 3Q9PA 1XF2B 1QR1B 3VW3H 3KPPB 1JK8A 3MLYH 5F7BA 5BUPA 2VH5L 1ETJA 4KNQA 4WUKH 1M7XA 1OGTB 5BQ7B 1QACA 4HIIA 3B5TA 1TVHA 4Z1PA 1FL6A 1GRWA 2ILLA 1X7QB 3X14A 3REVA 1XT5A 3QXAB 2YIHA 1FGVL 2QVKA 1B0IA 2XXCB 4JRXB 3RKPA 1J1OL 2EO9A 2BDNL 5FWRA 1UOKA 3K6IA 3PREA 3CXHK 2CBMA 5ETUA 1RQ5A 3ETTA 4HH9A 2CO6A 2E0PA 5EU6B 2QELA 3N06B 4GW1A 3TBWA 3TLRA 3NIDB 3PWUA 3FQUA 4M1CC 1QRND 4P23D 1VSCA 3UTQA 4XMPL 3UZVB 3VWJB 4J6RH 3K3QA 4ZMNA 4WCYH 4K7PY 3S3BB 1BVKB 3FCBA 3G6JB 4CMHC 1WP6A 4FKKA 1CFVH 4ETYA 1NAKH 3WD5L 5SWQA 3RHWK 3GI8L 4K3EL 1NOLA 5E2UH 3V0WH 5TFSH 4Y16A 1RZ7H 3V5KB 4MWFA 3TO4C 1ZJBA 3L1OH 2WLYA 1Q1PA 3B2MA 3U7AA 4D9LL 3L3OC 3OWRA 4XX1E 4D3CH 4XBPA 2XV2A 2D0HA 3HKZA 3QCTH 2FLBT 2APXA 3S9DB 2HN7A 3TYFA 5L9DL 3GSVB 4QRAA 1RVFH 1J9TA 1C5CL 4CDHA 5DMGD 2EDTA 2APSA 3R7RA 4F2ME 5E4IA 3ETSA 4HUXB 2AJ3A 4OZGA 3WFDL 4KRPC 1NIBA 2B20A 4JFXB 2HJKA 3QAZB 1DVSA 3N9GH 2ICWB 3DA0A 2YD2A 1JTPA 4GIAA 2OAAA 4ESKA 3QQ9C 1XSIA 2H6OA 3W56A 4F33B 4YAQA 1WBZB 2EILB 4ZAKC 3D1MC 2UZIL 3WKPA 2QMJA 1D5XB 4QGTA 1HWGB 2BSTA 4YHNB 1AR1C 1HFUA 3I02A 5EB9A 5DJZA 5AYTA 2Q8AH 2X6BA 3RWGB 3VFTA 4K71C 2E7LA 4MX7A 3RVWD 2CA4A 4HPOL 5IVOA 2QVFB 3TURA 2WB7A 3B7TA 3OMAB 2QQKH 4NP9A 1JF1B 4QJ3B 3N04A 2V7NA 4XPBL 4W9JC 3VTAA 3AREA 4RAHA 3BZEB 3ZL2A 4P4RA 5IFAH 1J5CA 2W9EL 1VF5C 1Q0XH 4IGBA 4JFFD 4E36A 4TRPH 4IKLA 2P5WA 3WE1A 2G75B 4OJCA 1S78C 4I1PA 4P3CH 1TITA 4M6MH 5AVQB 1JAEA 1XH1A 2DMBA 1I3GL 3HNSL 5E8DL 4F7CA 5AW9B 3FQ4A 1I7RA 4NFBA 1PVHA 5DD5L 4BDVB 3O3AB 4XBGB 3GYRA 5JPMC 3NBNA 3ZVVA 3D30A 2MHAB 3QUXC 3OKEA 2E75C 2FQEA 1U8IB 1YEFH 4CVXA 3JTSB 3FCTB 4PS4H 5KOVC 1KCLA 2Y1ZA 3W9EA 3WFHA 1MRCL 1QSEE 4KUZL 3ZJAA 1L9PA 3A23A 1PL3A 2V9UA 5I2IB 2NW2A 1RURH 4L4VB 2ZQKA 1WAEA 4U6YA 5MEQB 4FNTA 4JRFA 3ABMB 3WCYA 4ZW5A 5AW3B 4RETB 2H47C 4KO9A 1BPVA 2WJ7A 3QWOA 1FZJA 3U9UA 4ZNEE 3VMPA 2XXGA 3V6ZA 2KQNA 4ZUSA 3C75A 2WVUA 3F01A 1QPKA 2R0ZL 2JSFA 4FNSA 4WWKC 3VXOB 2I07A 3UTSD 2BPBA 1AE6H 2ROXA 4G6KH 4H1LA 5DHVB 3QUGA 1TJIL 1CDUA 1JPTL 5SWSE 1CICC 4FFWD 3IAQA 3JUYA 3V4PH 1ASQA 4LSSH 1MLCA 2AJXH 3MV8E 3ORJA 1U3YA 1MHHB 5EU7C 1SXCA 3IGUA 4UZSA 5F89A 5INCB 3U0TB 5E6IA 1H15B 4I2XB 5I75B 2LQRA 3EFOA 5AYUH 3DO7A 3FOMA 3O2WH 4G8GA 4R0LB 3FFCB 5FYJD 4G7VL 3QYNA 5E95B 5CLXA 4R5XA 4HK0B 1G87A 1BF5A 1E43A 4P9HH 2R2BB 2Y36L 1ANUA 4RWHA 1G7PB 2JQAA 3K72B 3MGAA 4JDEB 4HS3B 5AOKA 3VXRA 2RD0A 3CDFA 3RFZB 1YAZA 4DFHA 4NKOB 3GHPA 1S7VB 4MZIA 4Y2DA 3PGCB 3PAUA 4O9HH 4C4KO 3H54A 1GYAA 4FJYA 4JE4B 1HZKA 3VMNA 1YN6B 3DOIA 4DO6A 1OSPH 5B22A 2A9NH 1T6WA 2B08A 3C5ZB 3EFFB 2G5UA 3DK0A 3X17A 3MV9D 3VXPA 2VAAB 3K8MA 4OD1L 1QNZH 4PRDB 2QHLA 4JRYA 1IAKA 2BP0B 2EIMB 4GXFA 4K2UL 4NUJB 4ANKA 4Q97A 2IDTA 5I1LB 3ESVF 2IANE 3P4OA 1B3IA 1D5MB 4NNYA 2VSKB 1EJ6A 1URLA 1DZ0A 3HLAA 3REVB 4H40A 5EEVA 5GZNA 5ABDE 1YO4A 4NJAH 4FS0A 4YH6A 4Z7OE 2ZXWB 3JWNC 3T08A 3ZLQC 5I71C 1X9RA 2X89D 1JWUA 2YFNA 3BZFB 1UKQA 4HH9B 1TZGL 2P46B 5T1MB 3TBWB 4ZD3H 4P57A 1E28A 1OEZW 1NGPH 3PWUB 4J3OD 4Y9EA 4YBHA 5HGDB 1OGSA 2F7QA 5C3LD 1KFGA 5JMOC 3BFQG 2OR9L 4G5AA 1BV8A 4JO3H 4ODSL 4NQEB 3MLXL 3TNNB 1PGRB 5IBLC 3WN5C 3FSVA 1WZ1L 1FV1A 1QPPA 2A5UA 2VR6A 5D4HA 4BFRA 5JW3L 3HHSA 3I3BA 2XHNA 4HKBA 2F58L 1GS6X 1KOAA 4K5OA 4MWFB 5TH2A 3MGOA 5F9JA 3I6KA 3QIWA 2NUTA 2DS4A 4BQBA 1T3FA 5J11B 4Z23A 3FHEA 1U58B 4LDLB 2WSDA 4ZX4A 3TYFB 4PJ8A 5KW9L 4HIJB 4DAGL 1XIWD 3CFCL 2GJJA 3VX1A 2AAVA 2IH1B 2HFEB 2DF3A 3J2PA 1FA4A 1G9HA 1BFVL 2VW7A 2Z31D 4PJ7F 1NBZB 3D6GA 4W4OC 1EQWA 3HZMB 4M8UA 1ND0A 5I73B 4UTBL 4JO4H 2YD9A 2GAZA 3KE0A 1U6AL 2KLRA 2HP4A 3B3BA 3VE0B 3DIFB 3ZZ1A 2K9UA 4JFEA 4LHUA 3N1PC 2BSTB 3I02B 4F7TB 5DJZB 3VFTB 2NYZA 5D4IA 1MAMH 2ADFL 3ZDXB 2VJ0A 3LNHA 1ECZA 2IGLA 4R2GB 4OJEH 1NC2A 1WIPA 1BZDA 3QFJD 1FG2B 5CP7A 3IDXL 3N3EA 3AREB 1Y6NR 3FYIB 4U4BA 4LCCA 4LKXB 4N90D 4I3SH 5DUPH 5J1TC 5D7JB 4HJSA 5GRYA 2Y2WA 2B1HL 4H20L 4MAYC 1C16B 3LXBA 3L48A 3RY4A 5DYFA 1HQRA 3VXUE 2FRGP 1CFQA 4QTIH 3GSNL 2VDPL 1TTGA 1VENA 3U1QA 3ULVD 3ZZSA 5GGQL 2GBUA 3NJMA 4PJFB 4JO8A 1X5XA 1FAKT 4YNYA 1S9WB 4LAJH 4C55A 1FBIH 1LO3L 4BFIA 3M7FB 4AG4L 2XZAH 1NLDL 1ZLEA 3SE8H 4QRQA 3OKEB 3O4OC 3QP3A 4KJQD 5CD3A 1RH8A 3BKJH 3S48A 1GMIA 2BSRA 4GG6F 3QS2A 2Z8RA 2OJ1A 3OKDA 2VDLL 4ONFH 2Y6SC 2Z64C 4YZFE 4BFKA 9CGTA 1GTNA 1J1PH 1WBXA 2HTKD 3BKCL 4XTRD 1U36A 1O9WA 1JZIA 2KMWA 4WFGE 4NKMB 4K94L 5JDSA 2APTA 1S9XA 3D85B 1QFWL 4LAQL 4GUPA 1AS8A 1GIGH 2YUZA 2WZ6A 1CR9H 3QWOB 4PJHB 1RHFA 4WHTA 2AK4A 1FZJB 3C8HA 3O0RL 4DO4A 1CYGA 2NCMA 1KXQA 2BFVH 5T1DL 2OYPA 4NO5A 2GTZA 4A6YL 2YD1A 3NFPA 1MZZA 1AKJA 3UG4A 4O51B 5D4JA 1U8NA 3CC5A 4WK0B 5D1XC 1OM9A 3EBIA 2JB5L 2JTYA 1N26A 4RGND 1N19A 3ZDYE 3LZLA 4DQOL 3QARA 1W0WA 3K8KA 1TTAA 4LNRB 5F89B 4Y4KB 1SJEB 4WU7B 2E3VA 3D34A 3IJSA 4G8GB 5FCUH 3ZGHA 4YJZL 1RJZA 2NQDA 4KUCD 5FKPB 4DTGL 2IAMC 5CIPA 1PFCA 3GI9H 8FABA 2NY5L 3FS9A 1O0VA 3UXFA 3UIZA 2FECL 2A1WL 1YEKH 2VMJA 3EHBD 3MV01 1E2ZA 4U7SA 5GQBA 4HU8A 4N6QA 3VXRB 4XOBA 2R0LH 1AXTH 4X6CE 5C1MB 4JO5A 3JVGC 2N1KA 2NY1D 3QNZA 4PHZA 1MLBB 1CDGA 4PLJD 3HFML 5CNHA 2O61A 2F5AL 4LHQB 5C8JA 4JQXA 4KXDA 5EV7A 3UL4A 3K2IA 2XZQL 4EDXA 2BWIA 3GS4A 4Z3IA 4Z7AA 3GKZA 4J27A 1GJUA 5DRZA 5CKAA 1JBJA 3RIAF 4C59B 1NDTA 2VDNH 3EJUA 4JRYB 4JHWL 1RUKH 5F9DC 3LZNA 4WK4B 2VDQL 1UZ8A 4UILH 3SE9H 3DVGA 1W0VB 4Y1AE 3VYNA 1ZT4B 4LEEA 3S8GB 3F12B 1RPKA 3OSKA 1WEJL 3P73A 1R34A 4ELKA 2MEJB 2XI9A 3SDXE 4EIGB 3RWCA 4IOFD 5CJ5A 3CBJB 2IALA 4GXUM 2WB1A 1T1XA 3T3PE 1NGXB 3QJVB 1RK1B 4KTDH 1TSHA 2NY0C 5IB3A 5BVPH 3C5XA 3BVDB 4NZTL 5C6TH 3GJFK 1RUQH 4LOEA 4N2FA 4WFHE 4XWGL 3QO0A 4NQQA 2BVQB 3LHAA 3B9KC 2EH8H 1A22B 4N0CD 3IN2A 5T3XE 4OVUA 3O81A 3EBHA 3L4UA 2VDKL 1QHQA 1WJ3A 2LAGB 3DUSA 4NC1C 4B96A 3EG9B 3NDYE 3QSKB 4NAQA 4LLVA 4YN3A 1FV1B 3T3ME 2OTPA 4JZJB 1LO2H 1T1YA 1S8DB 2EDYA 4CJ0A 4FA6A 5DJ2A 3UMNA 4JGNA 3OJVC 5TH2B 1RJCA 2AV7A 3MGOB 3QG7H 2ADYA 2GABA 3I6KB 3LJ3A 2NUTB 1X5IA 3O11A 1UD8A 2RALA 2X4NA 1G7HA 3ZHLA 1XGZA 1SOKA 2HCZX 2KC0A 4PJ8B 4ZFOB 5LCVL 3GEWB 3P0GB 2FQDA 5LVEA 3MV7D 2DIBA 3Q01A 1T21A 1T4KA 3V4PB 1MCHA 5HI4C 6PAZA 1T6BX 2GEQA 1H6UA 1ND0B 5FYLE 4XPFL 4KHTL 3QDGA 4AVJA 1S9KC 3IDIA 3LNGA 5MEND 5INDA 3DJSA 3GJFH 3DSFL 1YJDC 4ONGH 3FO1B 3RWDA 1PG7H 5HYSG 3TJHD 4LIQL 1OAZH 1DJIA 3CPUA 3WMPA 3LRHA 2HX8A 2X70A 4JKKA 4TTDD 3E8UH 5KSBB 1E3FA 4JPSA 2BSEA 2QFRA 4IBYA 4I18B 3AT9A 3QJXA 4Z77A 1YN7B 3MRFA 4OKDA 3VFRB 4NI3A 4NZRH 1J5HA 4K4KA 4LCCB 2YAPA 3O9WB 4JUSA 5HI5D 1ACZA 2CPCA 5G4OA 3FZUD 1EAPB 3W9DB 2OULB 3TT1H 5L4JA 2JKTM 1CDCA 1E4WH 4XVJH 2MCG1 3O3DB 5AKVA 2UVEA 3ULUL 3AACA 1FORH 1CFQB 5E4AA 4JRWA 5AW1B 5K9JH 2YKLH 1KCVL 2F7PA 2CD0A 3GNMH 1WO2A 2XFGB 5IP4A 2NNXA 1YPZA 2OP4L 3FQTA 2DQJL 4XXCA 4BFIB 1NCOA 4FQXC 3KWWB 1OAUL 2N1TE 3EGSB 3IDYB 4WUUA 4XAWH 2MOQA 3PGFL 4JQVA 1OT2A 2FHCA 4OLYH 3VGAC 3TV8A 2BSRB 2DYPA 2ZSWA 3VDCA 4A55A 5KBDA 1BZ9A 2BVEA 5EZJB 1VGKA 4WO4A 1TR7A 5L2KE 2CDFB 2FEJA 1K72A 4G42A 3H42L 3BDBA 1YNTB 3ENEA 5JDSB 1S9XB 1WIUA 2J56A 2B1AH 1OPGL 3B1UA 4O2FB 4AE0A 3HC0A 5I0VA 2AK4B 3QEQA 2YUXA 5DK2B 4B0MM 1F90H 4XRCA 4S2SA 4E41D 4ZO9A 2W59A 2R2EB 1S5HA 5JZ7C 1BJ8A 2GTZB 2Z34A 1NM4A 1A7NH 3CQFA 3NFPB 3FMGL 3W1ZA 5EO0B 3L2LA 1HU8A 3UTTE 2YMOA 4Y9CA 3SCMC 3SO3B 2X0WA 3TCLB 1E0OB 3ZKXB 3TBYB 4N2GA 5LKNA 5JOEA 4OJFH 1W0WB 1EZVY 1BZ8A 3IJYA 2B39A 2X4PA 3L4XA 4L1HA 5IMLB 4CUCA 4R4NC 4Z7UE 4XNDA 1GL4B 1OSYA 4MJHA 2ARWA 3IJSB 3BVVA 4QKTA 1RJZB 8FABB 1Y18A 2V0AA 2Y2TA 4NZJA 3AB0B 1EFXB 2JLPA 4TULH 2DIJA 3S98A 2PCPB 1UT1A 2HAZA 1XEDA 2AQPA 2NYYD 2EDDA 4ONOA 1OTSD 3FPXA 3MODH 5T1KB 5CBEB 1HQ4A 1UKSA 4PRHB 1SDAB 3B1TA 4B27A 5B38A 2Q7NA 2D2CC 3PJLA 3A4EA 3GJFA 5CR8A 4OGXL 5K9QG 3K6FA 2VABA 4FFZH 4J8RA 3ML9A 2HJLB 5C8JB 4MRCA 5I5RA 5GPRA 3HE6A 2ZUYA 3I85A 1DBKH 1K8DA 1YMME 4PRNA 3WDJA 1T5XB 3E6HB 1FNSL 4WY7H 3STBA 3QVAA 3VSUA 4QXTA 2WWMD 3DXAA 4IRJA 1F4YL 3WELA 3OQ3B 2EXYD 3DJZA 3MLWL 2DI8A 2NOYA 4LEOB 2WV3A 1UJ3B 3BFOA 1FNLA 3WUWG 3GMQA 4XP4H 4WW2F 5HHXH 4J2QA 5E8NB 4XPHL 3QHZH 2ATPA 2VDOH 4ZTOL 4QRRA 2OMZB 4GAYB 4KO7A 4XCFL 1CXLA 4OUUB 1MSPA 1T1XB 5ALBH 5A2JH 3SY6A 1UURA 4DGVL 1D2PA 1QYGL 5DD3H 4TUJB 4HHAB 1Q9OA 1X5JA 2E7DA 4BELD 4F7TA 2DDQH 1BGXH 1MFVA 5BV7C 1MCFA 1SN2A 5EMYA 4A2HA 2FJUB 4DEPC 1H3TA 1R3LA 2QGDA 4NPYB 2RMNA 2EXWD 1WFUA 2XLLA 3DVIA 3PV6B 4M3HA 1AMXA 2QTEA 3F00A 2E7MA 1J87A 2ZCHL 5HDRA 5JW4Q 1U2YA 3KJ4C 5HDOA 1T1YB 2F7RA 3NP3A 5JW4N 1GS8A 5TGBB 5LQBH 4Q89A 1I8MA 5CGYC 1DQLH 3NCXA 3VVVA 3L1FA 3BE1L 3GTVA 3EYUL 5J12C 4BYHA 3MRMA 3O11B 1WCQA 1J1OH 3KDPB 4LP4A 1G7HB 5DHXB 3SQBA 4OD3L 4N8UA 2CLRA 1RJLB 4HEME 3EJYD 4XNAA 3UPRB 1OCWL 4LL4A 4MBRA 2NT1A 3BIAX 5TE7H 3SD2A 1BXAA 2EYSB 1JDCA 1H3XA 4GQQA 1QO3B 2VLKD 5BJTA 5EUKA 1C12A 4BEIA 5BPPA 2AV1A 2O5XL 4JNXA 5DFTA 5AB9A 5E6UB 2F54A 3MNVB 2XN9A 3GXNA 1QTSA 4X5QA 2YA2A 3QDGB 4MD5A 4LOVA 4ZJ9A 4L4TE 5INDB 2OMBA 5C9JA 1S5IL 3MCLL 4L5FL 1A7PL 1MNUL 3QUYD 2YQ3A 4EE2A 3ZR6A 4LPWA 2EE9A 3QO1A 5L2JA 4U6HA 1X6LA 3HVDA 3TM6A 4GYBA 1NAMA 1BZOA 4Q6YA 1QFWM 1S7QA 3N42F 4C56E 2ICES 3T6VA 1N67A 1OGAA 3MRFB 1KJMB 4G7QB 1MXGA 4HWNA 4I3GA 4RA3A 3ZMRA 1LNUB 2IEPA 4WEBH 1BD2D 4YPGA 3US9A 1FYTD 4PHXA 4M6OL 3RWEB 4OGQC 2XOTA 1E50A 1U3HC 1CBJA 3OLEA 4XVOA 1G9NL 2BIHA 1AGDA 1YPZB 2RR3A 4ATWA 4EBQL 4EUPB 1COBA 5C0EA 4U1HA 1YUHA 3W39B 5EO9B 1GGIL 3QNXA 1SMDA 1I8AA 4IYKA 4WUUB 2CHWA 1R5WB 2ICEA 3PWVB 4ZMTA 3K2MC 5C0AA 1QBBA 3GHEH 4LSDA 3UBXI 5EU6E 3BWUC 2DYPB 4GSQA 1HDMB 5EFIB 4BA0A 1CVSC 1E4JA 2W0PA 5FEBA 3NIDE 1VGKB 3UAJA 3CFJB 5BZDA 2W9EH 5CGBA 3GQFA 1NLBH 4O2EB 2EKJA 4K9JA 4MB4A 3T8XB 1I82A 2WPGA 1R24B 4XNQB 4IEFB 2CJSA 3AADB 1FQ9C 2FYYA 1T0PB 2XX1A 1QQDB 1JCKA 3G6JE 4X80H 1CE1H 3HC0B 3AS1A 1CFNA 4G1MB 4TPRL 4PRIA 1RFDH 3QNYB 4WI8A 3MFGB 1WWAX 2BMKB 1HCYA 2CUIA 1IM9A 3RUGB 5E8DH 5C92A 3HNSH 1I3GH 2VLJA 3PWNB 5F9OL 1F6LL 4Y2OA 2EIZA 2WLLB 2VOTA 2OJZH 1XAKA 5C0BD 3UTOA 3OXSB 5LGHL 3MXWH 1KGXA 2JJTA 2NY6B 3FO2A 1MJ7H 1UGNA 4LCYA 3ZYZA 1E4XH 1S2EA 3NN8A 4E9RA 1E6OL 2FEEL 2HA1A 4PVMA 5A3IC 4GFTB 1SYSB 1ODAA 3SPJA 4P2RA 2GI0A 4L3CB 4ZPTA 3LKRA 2XYBA 4JG5A 4XPGH 1TT6A 4HKJB 4KVNL 1KB9J 5GS0D 5D72L 2GY7B 1MW3A 1BREA 2NDFA 2R0ZH 2BS8A 1ZEAH 2VQTA 2XVGA 4PN6A 1B0RA 3O41B 4B41A 4EN3D 4HKZA 1X9UA 3H2PA 1QFWI 2B9BA 1O75A 4MMYB 1FNHA 5DD0H 1OTUD 1K8DB 4PRNB 3KGTA 5HHVL 3ZQXA 2VYRE 5IEKB 1I8LA 2OMWA 5D6CA 5F6IB 3BP5B 2Q76A 3GHBH 3CZUB 4FYQA 2AQ1A 3GM8A 3SJVA 4KKAD 4H26B 1XCXA 1VEMA 5F3FA 4KKLC 1R3HA 4G7VH 1FFPB 5ES4B 1ODUA 2A9BA 1Q0YH 1WFIA 3UADA 2IQ9L 2H5UA 4M48L 5SWZD 1YYLL 2AMUA 3MV9B 3D0VA 3DHJA 4H5SA 4TF4A 7FABL 4LLDA 2LHAA 2NY3C 4P06A 5C2UB 4GO6B 5BNXD 5E2JA 3PGDA 3M7OA 2NXZD 3RA7H 2IDCA 3LPFA 5IFHH 1TQCC 4ODUA 1KCRH 4XMLH 1I85A 5J8OA 5GGSA 1R5VA 5E2WH 1P69B 1VCBC 3ZRCC 3KVDD 5KBPA 4GAFB 4KI5E 4L1DA 4L4VE 3WO3B 2XETA 4OD1H 5ICUA 1NSNL 2FUTA 5JXAL 2OMUA 1CD1B 1AR2A 4FZ8L 4TQHA 2DQFA 5AW2B 4K2UH 4NB7A 4N2LA 3Q2WA 3F85A 4Q2ZB 4Y16C 1BXUA 1FIGH 3QZBA 4PB0L 2CLZA 2UY7A 3G5ZA 1KTBA 4XO5A 2QFPA 3MOAL 4KROB 4NQDA 2WLKA 3BFWA 1FZKA 1GOGA 4HC1L 3GK8L 1RSFA 2EH7L 4YDJA 1O7DC 2IJ0C 2HJFB 4ZT1A 3MRMB 3UBGA 1A6TA 4UV7H 5JQIB 3A6BH 4HMDA 2AITA 2PW2B 1VACB 1L6ZA 5JW5B 1C5BL 4I7ZC 3KPTA 1CTOA 1ADQH 4Z7QB 2ZCZA 2FTAA 3IRZA 4I2XE 4MMZA 3N1GC 4PGCA 5BJTB 3IFLL 3HB3B 1C12B 2WYTA 3VXQB 2AV1B 2OR9H 3FFCE 5ANMB 3RGVA 4LE8A 4UCFA 2ZYRA 1INQB 2FJHB 2XN9B 2YFOA 2NUPA 3DPBA 3MLXH 4WLCA 1NOAA 2VLRD 5FA3A 3O3BB 5H35B 1XBRA 4HPYL 5JW3H 2AJZB 3D18B 2AGJL 5C9JB 2EVJA 1I7TA 2E7LC 2Z31B 3CJJA 5FGBC 4E0RA 4TLKA 3GXIA 2DIEA 3HC2A 2IF7A 2X1PA 3QO1B 5F88A 3JV4A 4U6HB 4Y4HB 4OR1A 4J39A 3WFEH 1IKNA 5HY9A 2E9IA 3IU4L 3ARBD 2W95A 3CFCH 4KAQL 1BWMA 2VDMB 1CGTA 4TVSa 1EO8H 3ET9F 4LZKA 5KEZA 1ITBB 2DLIA 1V3MA 1XCTB 4PW9A 2BINA 5EOCL 4PJAF 4YPGB 3HI1A 3OV6A 3V0VB 2X28A 3QFJB 3SDDA 2FATH 4PY8J 3CFTA 3P9LB 3PHAA 4M3KB 4MZ2A 1NUDA 2HT2D 4WFFE 1AGDB 3TT3H 5C0EB 1QBLL 4U1HB 1FN4A 4IBTA 3SDCD 1S7SA 3QNXB 3EGXA 5HGHB 2JJVA 4CA4A 4RISL 2ICEB 1AGFA 4BA8A 3ESPA 5C0AB 1UC6A 2ADFH 2V9TA 3CLEL 5AOJA 3NZHL 4F37K 3RP1A 3HC3L 1WYJA 3WNKA 2RJMA 2VN3A 1JV5A 2AAAA 3RU8H 2B1HH 2P42B 3BN3B 4M5YH 4NQEE 2FYYB 3EOTH 1V55B 2AXFA 1DBAH 5IBTL 3RAJL 3DX8A 4ODWA 2VLJB 1TXKA 4JG1H 4Y2OB 2BP8A 1E6JL 4XI5C 1SVBA 2LLGA 5HGAA 4E68A 4PCYA 3TCTA 1PU0A 2A83B 2W60A 3AXHA 4JPWL 2A6KB 5IK3B 3WKYA 4GIPD 1UEMA 2VDLH 4JVUA 5E6IC 3HS9A 2BZCA 4KXZI 4B5EA 3PU7A 3BKCH 5CO1A 1H0DA 4RNRA 4Y5XB 5HYQA 3MMEA 4ZW6A 5LGKA 4K94H 1RK0A 1J0JA 2C8NA 2YD6A 4LDOB 4JMNA 4LAQH 3ZKMD 4HAFA 4NKDA 3MNWA 3NJLA 1ADQA 4PREA 1GC1L 3O0RH 3ZHFA 3I50H 3EO9H 4QLWA 3EO0A 2IIJA 1OE1A 4A7TA 3DURA 5LO7A 4Y2DC 3MRNB 3MFFB 2MH4A 5BRQA 3A21A 4TUKH 5ELIA 3CNKA 5GRZA 3ZDXE 2ZG2A 4UMGA 4K9EL 3P3TA 2NX5D 4GKZA 4OF7A 3MCKA 1T80A 2F19H 5DI8B 3X3FH 4DQOH 4ENEC 5JUEH 1WS8A 4LLMB 3KYNA 3S37H 4X5LA 5JNYA 4AM0A 2WIIA 1TJGL 3SJVB 1P4LB 2YQ2A 4ZW8A 3U30B 5IB5A 1QTYT 3ARDA 3STZA 3BVNA 4N0UA 4UI2A 2YZ1A 5LAXA 1OE3A 3GSQA 2QDWA 5ENWB 3WEXA 4AKPA 4BGDA 4WI9A 1OHZA 4NWUL 2ZAGA 5HVHC 4GAJL 4PJFE 3AY2A 5DZJA 2AP2A 4UTBA 3CSPA 2CE6A 2JXMB 2J1XA 5ID1A 3OX8A 2GJPA 1ZHKB 1OWRM 4PJCF 1XD0A 4ODUB 1D5BA 3C60D 4GP8B 4P59L 5GGSB 3AAZB 3FHAA 4NKQB 4KDVA 1KB5L 2D7QA 3MBWB 2X7LB 2XX0A 4TLUA 3VFOA 3FAXA 2QADD 3IS1X 4KMTH 4R7LA 3O4LB 2JKLA 3LKOA 4PJHE 3CU1A 3REWB 3V52L 4G72B 3CN4A 1J8HA 2CLZB 3QIWC 4FJ6A 5LGYA 4Y4FD 4GKSB 4L2YA 1WEJH 2CCWA 3GMLA 5DWUL 3UDWC 4MDIB 3GSNA 3WS3A 2WCGA 3EBGA 3HZYA 3MLTB 1C1EL 4GKNB 3I3DA 4JS7A 5D1QD 5H94A 3FT1A 4QF1B 2JNZA 3L3IB 3LKPA 2V4LA 1S9VA 4ZOBA 4NZTH 2OKMA 4B9PA 1IEAA 3UYPA 3HMXL 3QZWG 4K7PX 1D6VH 1E27B 5DFVD 4Q4IA 3RLSA 4PW4A 4GI8A 1EEQA 1X7TA 2YEVB 2Z8WC 2FNBA 1EDYA 2FGWH 4HYTB 4XCYA 2DJ4A 4G8GE 4WJ5B 2QLVB 5DJAA 2VDKH 1USQA 2X40A 3DPBB 4YHZL 5FA3B 4P4KA 3RVXC 4UINH 3EJJX 3G04A 3FQRB 3ECQA 2Z4QB 2XWJA 3LV3B 2J21A 4KQ4L 4XWOD 3SYOA 3OKOA 2A6IA 3VXRE 5C2BH 4E0RB 3LXAA 3LNEA 4MDJA 3W2DL 5IG7B 5IGXL 4UDTB 2VUYA 3JV4B 2BNQA 1HHJA 2B2XL 4A6YA 5I76B 4X5RA 5ILTL 4ZFGL 5MENB 4YHLH 5C7XL 1AXSB 1JRHH 1NC4A 3LNFA 1HCVA 1JGUH 4H25A 3HE7A 2HRPH 1XGUA 3DIVA 3ARGC 4I85A 3B2PA 3PFUA 4PI0A 1QSFD 4JRYE 4LEXH 1FAIL 3KYKH 5KVEL 4PI2A 1AVAA 4KHTH 3AWEA 4YC2B 3RTQD 3FQXA 4UM9D 1ZPLA 1N8OE 3BZ5A 3WTXA 4KZEL 3PWJA 5FIEA 3WKNA 2DBLL 3MBED 3FQYA 1QABA 1SDDA 2X9XA 3N1MC 1CI3M 3EYQD 5AW6B 5E94B 3WHXB 3FN3A 1WQVT 1IRAY 2F61A 4JM2A 3FB6A 5F7EH 5IQOA 2XIIA 3F6JA 6PCYA 4ANXA 4TUUA 2CALA 4X6DF 4KH2A 1TUPA 3UYOD 1IFGA 3IMWA 1L9MA 1JV5B 5AOIA 4G3YL 5BCAA 5IT2L 5F21B 2KUTA 5EUOA 4YXKL 1I7ZA 3OG4B 5D7KE 3CV5A 1INEH 3MRKA 3ULUH 1BM3H 4GJTB 2AXFB 4KMQA 4G8IA 1P5UA 3QDJD 3H9YA 3R0NA 1BHGA 4KXZH 4QAWA 3R7QA 1UXLA 4Y1SA 4I8DA 3APFA 1M6OB 2IBZY 2VERN 1TEYA 4JY5L 5JHDD 4UB0H 3CQQA 4HSCX 2WAQA 5CSGA 4FCHA 4FABL 3PGFH 1G6RH 1XX9C 3TA3C 2G9HA 1OANA 2KZWA 1MF2L 4TVPE 4L05A 1JZ5A 4AEHL 1T04A 4OLXL 3N40P 2PPEA 4YEEA 5CBAA 4JDZA 5EF2A 3PL6B 1E8YA 1H0DB 2ZX8A 4NUGH 3MMEB 2ATKA 4TNWK 1HX0A 4HIHA 5E1IA 1CI5A 1T5KA 4PGBB 1MCEA 2NXYD 4JJ5A 3MNWB 5I82A 2H3NB 3E6FA 2AVGA 4NOBA 2X4RA 4QOKA 4HIXL 4UDUA 2MJWA 3X3GL 4JREC 4M8QA 1XHHA 4W9DC 5I1HH 2DEYX 3DURB 1DLHA 1EPFA 3BZ4B 3IRCA 1MFDL 4JQXC 1AHWB 2YSSB 3F7VA 3GMPB 2APVA 3ZW3A 2VZUA 3LQAL 5KSBE 2O5ZL 4KX8A 3CHRA 4Z7VA 4ZS6C 4F2EA 4GKZB 3KYAA 3EGDB 2FYVA 2CGYA 2J6WA 1KIUB 3MCKB 1B4JL 1UZGA 4HLZG 1CC3A 4MHHG 2ENPA 3ROOA 4AM0B 3ISRA 3DX9A 4RAUB 3F8UB 5LCVA 4P5MA 5GHWH 4NN6C 3BLKA 4PD4J 5IB5B 1UGKA 4Z9KB 4N0UB 4PG2C 1U93B 4M9OA 3LN4A 1ESOA 2LU7A 1OP5K 1YQVL 4R4FL 5IHBA 1S9YA 1TCRA 4KH9A 4RFEA 3FUJA 3LIUA 1M7IA 1Q9WB 1KCKA 2CBQA 5LGJA 2Q5BA 4RMTA 4OGXH 4A67A 1QA9A 4IBZA 3DC0A 4K5MA 4ZZKA 5E99L 4OT1H 2QGCA 1BQLL 4A63A 3GS0A 5ESQB 3S3CB 1D5BB 1T66D 4XBEL 4N25A 3V7AG 1LE5A 5DD6A 1TO4A 2MQCA 4QCIB 4FE9A 3LD8C 2XWDA 3U2SB 1PYWA 2O5YL 4QT5B 5HSFA 4JK0D 4PJBF 2AK4E 3VNYA 5FOBB 3D25B 1NBCA 2XQBL 1KTRL 4S0SD 5FUZH 4FXGA 3U6RA 4NI6A 5B1CA 3BGAA 2X2UA 3S35L 5KVFL 4GY4A 4XCFH 2Z92B 1W6LA 4FX5A 5J13C 1ZD6A 1U8MB 5LNDA 5H94B 2DQIL 3FU8A 3ESNA 4LXFA 4PV8B 4F20A 1B4RA 3VD9A 5K39B 4HIEA 3UYPB 3QIUA 2NY7L 1OP5H 1HAWA 1OP4A 2Q9OA 3IB4A 1VFUA 3WI9A 3BPOC 3GFUA 4E9QA 3MJWA 4ABVA 4Y9BA 3BLBA 5DJAB 1PBYA 1AMYA 3WLWC 3H7LA 3V8OA 5FECA 5AL8A 3V0FA 2ZCHH 2CKBL 4KPHH 3L5XL 3N2JA 2XWJB 4OCXH 4PRHE 2DMCA 2NR6A 3GSOB 1REIA 3BE1H 1E4KA 3PP4L 3RJDA 1S7WB 4P5TD 4MDRA 4LL9A 1F58H 1HHJB 1PX3A 4JHVA 3QORA 3M6DA 2B4CL 4RMQA 1EZSA 3QUYB 2HWZL 5FGCB 4DETA 5LB1A 1KFAL 5KJRH 4GRLA 1I8UA 3OKNA 2YA1A 3FTYA 3VUAA 3ZHKA 4PVNA 2NNRA 4F7PB 2OZNA 1DQJA 1P1ZB 2R56H 1FVEA 2IVFC 3T4YB 3DI3B 3F3HA 4B9FA 2WCSA 3RWJB 5IR1A 1YEGL 2JJSC 2V9RA 4J12A 4PJXF 2VIRA 1KYAA 1VKXA 1DQQB 4BM7A 2W9LA 3MCLH 2B59A 1A7PH 1D3CA 4IQHA 4UM8A 1LEIB 5IOPB 4FA7B 4JQVC 3FRUA 4JM0A 1VESA 5FHBH 1UD4A 1BD2B 1JWMB 3VDBA 3PWJB 3DYOA 4JPKH 4FQHB 1SDDB 4LSTL 1A4JA 4FLRA 4WO4C 4XE0A 5IESH 3KL3A 3DTXA 3GRBA 3FU5A 4N9GA 3ESOA 5CHNA 4ELMA 3P2DA 4AK2A 1OAKL 3IGFA 1A3ZA 1UCBL 3ROLA 3TN0D 1ED3A 4UUJB 5IREA 5IJBC 3DOSA 3QDMD 1SM3H 2OYKA 1ZHNA 4AQZA 1I7ZB 3WEMA 1EERB 1AZRA 3PDGA 1NEUA 2J2ZB 4RA0C 1TQTA 3B37A 2Q1EA 1G9NH 4N22A 3DX2A 4PJGF 4X4MA 3WENA 5HYFA 2X4SA 2OTUA 5HVWA 3QEHA 3BPNC 5E5LA 1JPFA 3S96A 3SEPA 3CZSA 4JY4A 2G9HB 1PS3A 4YO0A 1B9ZA 4AGOA 2BY2A 1HILA 2W38A 3ELQA 3HS0B 3Q1SH 2IWGA 1XGTA 3HPLA 5T33L 1R0AH 5EHFA 4JDZB 4PPTA 1LD9A 2JH2A 3DJ9A 3NA9H 2VL4A 3FO9A 5C0BB 2D9CA 3UCRA 1PAMA 3CGTA 4DP1X 3LEVL 2NY2D 2F08A 4HIHB 1U8KA 3CN0A 2CM5A 3QDGE 1GZHA 3IXAA 3E6FB 2H1XA 4TPRH 2XWTA 3C8KB 4W1TA 3MO1B 4PJEB 3FRPB 4P2OC 5LXGH 2A73B 1IBDA 1K4DB 1P7KA 3HE6C 5LGHH 2D3VA 2JKRM 2R7EB 4AYSA 1AI1H 1U4FA 4Z7VB 4YUEL 1FL5B 3TOPA 3QQDA 3IMVA 3MLPA 1A7OL 1WC7A 1BG9A 4IRJC 3Q8BA 4YHYB 3K1DA 4D8OA 4OTXL 1E6OH 4LT7A 1SQ2N 3CU7A 5BZWA 3ROOB 3H4HA 1OARH 3NJNA 4Y2NA 2BY0A 1HTYA 1B0GB 4XE5B 5HTSA 5TF1H 1IBFA 4P5MB 4LVHB 2V37A 2QBWA 1CBVL 4GRWF 3BDYL 1AG6A 3HG1D 1AP2B 1YPZE 3X1NA 1KB3A 4BZ2L 2D0GA 1OO2A 4WUUE 5E9DB 2W65B 5TE6H 3TZVA 3SGKA 3ATEA 2OCFD 3TBBA 5BS0B 1RERA 4JQIH 3BWUF 2IO5A 1DFXA 4ZMOA 4OIFA 2PCYA 4K5PA 1MNNA 4U3SA 3MKKA 5SWZB 5D5MB 4WF7A 1NIFA 4LHJB 4HS8H 1LE5B 2XG5A 5DD6B 4F3FB 1J05A 3QH3A 3KLAB 3BUYB 5IJDC 3GD1C 4I5BA 1QKZL 1BX2B 2CO2A 3PY9A 4NO2B 1NKGA 4UT6H 3OF6A 3LS4H 2D4DA 3RUGE 4E9WA 3AWFA 2V5SA 5JOPD 4M48H 3UZEA 3QYMA 4NJ9L 2VXTL 3HA0A 1BQHA 3BQUA 4PTUB 3VFSA 1GR7A 4DP9X 2J1YA 3JWNG 5D8JL 4FNQA 3B8YA 5ICXB 2RHEA 1X9QA 1DR9A 4GUQA 3QWRA 4ZG1A 3M88A 4U3HA 5AVXB 4ZSOA 2DW5A 3LQZB 5HYSA 4HIEB 3QIUB 2B14A 3D4ZA 1CD9B 1G6RB 2V2XA 1UD2A 2WNKA 4GSDH 4GG8A 1LK2A 1NSNH 5C08A 1KXVA 3Q8FA 4L37B 4F9LA 4GS7B 3RY6A 2D7TL 3EYVB 4JHUA 1DUZB 1TETL 4NCC2 3SQRA 2MMXA 1DVZA 4XN4A 5DVKA 1LEKB 5F7NC 3T0ED 3INUL 4QXWA 5EG6C 2Q87A 4TOYH 3EH2A 3QULA 3MOAH 5GS1B 4N8VG 4WEMB 4IU2B 1P4BL 1HXMB 1QLEB 4PGJA 1UG9A 1UD3A 4UT9L 5FYJE 4V1DA 12E8H 3VCLA 5DK3A 4YBQC 3FB5B 3AQZA 1FO0H 2I32A 3H3PL 5DJCB 2WLHA 3LB6C 4APQD 4ZXBD 4DZ8B 2XQYG 1Z9MA 4NO3A 3FT2A 2DTMH 3LHPH 1OE2A 3ECBB 15C8H 1ZVSA 4YFDB 2ORBL 1D7BA 3W0WA 4P8QA 4OGZA 1FP5A 1KPRB 2HTLC 1QSZA 4BFBD 1M53A 3FUNA 4Y9FA 3ELAT 5BZXA 3OPZL 2VIRB 1DJGA 5CU9A 4DUVA 4J6IA 3MV9E 4XPTH 3LEXA 4YIQB 4A37A 2B59B 4JR9L 3CH1A 4X99A 1UT9A 3NJFA 5HDWA 1DSWA 3QXUA 5GSRB 4O02L 1TPXB 5I74C 1WZAA 4YSQA 2R27A 4NC2B 1VLXA 2F7IA 3ARUA 3EAKA 3UAJC 1L3NA 3DRTA 1QHOA 4ELMB 1G4RA 3A6CH 1YMHB 2ZUUA 2YPLA 3JTTA 5I17A 3L4WA 4D9QE 4OM0H 1G7QB 2PXYD 3SKJL 4Z3HA 5KS9F 5HD8D 3L7FB 4UZGA 4JDVB 3V5DA 1M05A 1AS7A 2Y9RT 5A6IA 1XTLA 2OX5B 3JWDC 4FL4C 5T1LD 4JUTA 2JKJA 4HWBH 4XT1C 5L88L 1AQKL 3CSYB 1WZKA 1JHTA 4LVNB 4QHNA 1NCBL 2JCCB 1QBLH 4NC0B 4L3ED 2Q3ZA 2JJTC 1MIMH 4D2NA 3FT3A 4JJHA 2GY5A 4GBXC 1I9RL 3V6OA 2OTUB 1NIAA 2HKHH 3QEHB 4D0CA 4RH4A 4NQCA 1PZDA 4Q9BA 4OZGF 1JPFB 1SRDA 1W2KT 4UIKH 4JY4B 2ZUQC 2YN5A 4AENB 1CDIA 3RNQB 3MBXL 1SJXA 2PP7A 3VD0A 4JY6A 2Y7QA 1HILB 5GGTL 1UD6A 1SNRA 1TENA 4UNTA 3LKNA 1LD9B 2ADGB 3HC3H 4Z7QE 3FO9B 3APNA 3MOQA 5D1ZA 5C0NC 5ANME 1OW0A 3RY5A 2PPCA 2XN9E 4HUMB 5CLWA 3ZE0B 3MRIA 3MJ8B 4TQEH 4U1NA 4WI5A 4CC4A 5CEZD 2X2YA 3BP7A 5IBTH 3RAJH 5KVDL 4L0PB 2CBPA 3OL2A 2GITA 5FYJU 2XKSA 3WUWA 2C9PA 4TXVB 1P7KB 2X1OA 3WL9B 1MHEB 4FNPA 1NGYB 4FTVD 1IGMH 2CNZA 2EP6A 5SV3A 2ZUXA 1I8LC 2J8UF 5TE4L 3PP3K 2FWOA 3PHOB 1WC7B 4FNLL 4JPWH 4Q9RL 3OXRA 3V6BR 1DANU 3SY0A 1WVZA 5BZWB 3DUUA 1QFUH 4F15B 4N0YL 3VM5A 4OAWB 2L7QA 2NX5B 1G6VK 3QFJE 5ESAA 1BG1A 1GC1H 1T7WA 1Q72H 4J3UA 3DROB 1IGJB 5DD1L 1PLGH 1HESA 4N8CL 4I0KA 3THML 5KYWA 1DBML 1UWGL 5ISZD 1PKOA 3BPCB 4APXB 4F58L 1I85C 5DJ0A 3GBDA 5C0AE 4FADA 3FCSA 3DTDA 3RTLA 2EYTB 2WVVA 4K9EH 3DV4B 3ULVE 4U3SB 2Z1KA 2GJ6D 1OT4A 2MNWA 5GS0L 4IOIA 5FO8A 3U4BH 3EOAA 3GXTA 1J05B 1NGWB 2VT0A 2R4SH 4A66A 3Q13A 5F7YC 1G7IA 1T2QL 2AQ3A 4K8RH 4LSVL 5FFGA 1G0XA 4PUBH 3PP3H 4Y5VC 4NWUH 2BY1A 4GAJH 3U0PA 2VLJE 3LDBC 4PJ5D 4OIIL 1DO5A 2COVD 5D7SH 3UJTL 4K7PL 4HWBA 1BMZA 1WGVA 1A0QH 1M6UA 1QEWA 1SY6H 4HVBA 3QCVL 3HG0A 4U33A 4UQCA 4L8BA 4BK5A 5JXED 2Q2LA 4KO6A 1WZLA 4XVUD 2XBDA 5HYSB 3OAUL 4MMZC 4Y4FB 4E9TA 1KB5H 2W88A 3U7YH 2WQVA 4IMKA 3RGVC 4XMKH 4GG8B 1LK2B 4JN1H 1IM3A 3VGGA 2Y6TE 2IDFA 5DJXA 4G6MH 3K7UA 3IF1A 2GBVA 3DX7B 2VLME 2UZPA 3GT6A 3FOLB 5FM5O 1UKTA 3VXMD 4P5RA 4O4YH 4Q58C 1QTPA 5IWLC 4ZFFA 5LNGA 3QULB 4M7LT 1IKNC 1T7XA 1SEQH 2DICA 4OUOA 4V2CB 5D96C 5EN2A 3Q43A 5F1NB 4BUHA 3BH8A 4ECNA 4Z3TA 1Y1UA 4YHIB 2WXHA 3VCLB 4H0GA 3LEYH 1JPGB 4JPVL 1F3JB 5ERWA 4Q0XL 3W11D 2GSMB 2Z91B 3HMXH 3QFGA 5IIEA 2DWTA 2K7PA 5EPMA 4BRVA 4NO3B 4MXVF 3NSYA 3SJVE 2PTUA 1DBBH 2Q7AA 5G4NA 3DPDA 1QLFB 4AMKL 5ECJE 4FG6C 4NRYB 1A7BA 5EU3B 2YJLA 1LWJA 1Q94A 3LEXB 1H3UA 4LPXA 2FX7H 3HUJB 3V4UH 3W2DH 2FWUA 1G5AA 1NDGA 3HRZC 5IGXH 5DURD 3VI3A 5FLVA 1KDIA 2K7QA 5AAMA 5E08L 1W80A 3OLIA 4EAEA 4ZFGH 1JG9A 4N2OA 4OZ4B 4WI7A 3D33A 4X0NA 4UM9B 4Z18A 1DE4B 2YPLB 3ZO0A 1GZQB 1UH2A 4JDTL 1GY2A 4IHOA 4KY1H 1M05B 1MOEA 4N2KA 1HEZB 3F7KA 3O4LE 2PYED 4OSUH 2YMTA 1KYFA 2ZOLA 5KVEH 3NFNB 2ODHA 5DMYA 1KN4L 4KK8C 4PP1C 2CH8A 3KWVA 4AMXA 3AZUA 4PGEB 4D0BA 1RZIA 3JQOB 2C1OA 2E86A 4UQIM 3RIAK 3UTSA 5JR1H 3N41F 4Z3JA 3BRDA 1R5IB 1L6PA 1MCRA 3HPJA 5F7UA 5I30H 4KZEH 4PYGA 2A9ML 1DFBH 1Z0MA 2DV6A 2DBLH 2GJZA 5ALCL 4X6FA 1SY6A 1F1GA 4HZLB 3OMZA 2ZKXA 4G43A 3LKNB 3IJHA 5F7DA 1GJIA 2VO5A 5D1ZB 4IKIA 3NK3A 2VITB 1KB5A 5IT2H 1NZRA 2EC8A 2VXUL 4K3JH 2FL5B 4PJ7A 1I3RA 4U1NB 3GO1L 3TFKD 3MLZL 4L9LA 5I1EL 4U1SB 5EZLA 3RL2B 3VGEA 4A04A 2GITB 5D2NA 4BQ6A 1TTCA 4KC3B 2Y4SA 2BRQA 5DDHA 2G9KA 4ALAL 3E8VA 4FOMA 3ECWA 5KJ4A 5C0JB 1SHMA 2KS0A 3FB7B 2NXYB 2ZXCA 3POHA 3QPXL 3OB8A 4HGWA 4GT7A 2XNAA 5MENE 2GT9A 4TNVF 1RHHA 4M1GL 5HI3D 4AEHH 1QR4A 4XGZA 4Q4EA 4EOWL 1Z3GH 1HINL 3ARDC 4DO5A 3I84A 2FE0A 2D03L 1FO0B 4ADIA 1TFPA 3HMXA 3RVVD 4AQ1A 5JPNB 4CC0A 3ZU8A 1FFNA 5FK9A 4WU5A 1H19A 2VRKA 5ESAB 5AZEL 1SN0A 3VWJC 1RIUH 1NBYB 3EYSH 4GQPH 4LOFA 1C08B