1NICA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 88
structure length 333
sequence length 333
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nicA02
3NJFA 2J57A 4A67A 4KNSA 2IDUA 2YAPA 4ZK8A 1AAJA 5AFAA 3FSZA 1PAZA 4QLWA 4E9SA 4RH4A 4AKOA 1A4BA 2P80A 2DWSA 1MG2C 2FWLB 1KYAA 1E67A 2XYBA 4EF3A 1BYPA 3NSDA 3AW5A 1AS7A 1OF0A 3X1GA 3ABKB 3JTBA 1PY0A 4YSRA 4A2DA 1JOIA 1PLCA 1SJMA 3IN0A 1GS6X 1EHKB 1AS8A 1J9RA 2FTAA 2QDVA 1NZRA 4NAJA 2YXWA 2UXVA 4MFHA 1BXAA 1AG0A 3FSVA 4M4RB 5I26A 2H47C 2XXGA 1N70A 2WO2B 4DPBX 2BZCA 5I5JA 3WNJA 4DP5X 1BXVA 1HFUA 2YAFA 3DTUB 2IH8A 3GDCA 1FA4A 1JZEA 4G7QB 3X1NA 2AANA 2BWIA 5B7EA 3TU6A 4G7SB 3UABA 2J55A 4FAAB 2EIKB 3QJTB 4GXFA 2UX7A 3H4HA 2TSAA 5FC9A 1W6LA 2UXGA 3FYIB 1A4AA 4UF7C 2PPEA 2GI0A 1GY1A 2UXTA 2QT6A 4AKQA 4DP1X 4YVNA 3T6XA 2FQGA 5I6PA 1NINA 2HLEB 1L9PA 5B3SB 1QLEB 4HALA 5D4HA 2GBAA 4F7KA 3FPYA 1L9TA 5TK2A 1SHWA 4GP8B 5ANHA 1W8EA 1GR7A 1L9QA 1BEXA 1L9OA 2BWDA 2BP8A 4HCFA 1SF5A 3ZDWA 3NT0A 1PNDA 2X88A 2YAHA 3T9WA 4YSPA 1HAUA 2HRGA 2W8CA 1J5CA 3G5WA 2HZHA 3PCYA 1RZQA 4N4YB 2DY2A 3OQRA 2BW5A 3ABLB 1ILSA 1ASPA 3RYMA 3AY2A 3PAZA 4NB7A 4L0PB 2B08A 3FU9A 2XU9A 1N68A 1GY2A 1WA2X 4DPAX 3FQ2A 4F2EA 5D4JA 2FJSA 3T6WA 2OV0A 4YSOA 3OMIB 1AACA 2YAMA 4W9ZA 4DP8X 2ZWNA 1DYZA 1XB8A 1TKWA 2LLNA 3CG8A 4BK5C 2AFNA 1ET8A 1EZLA 4KO7A 1PCSA 1TEFA 2PP9A 2CCWA 4YSDA 7PCYA 3D12B 4DP4X 1RZPA 1JERA 2XV2A 3MBWB 4GP5B 3OD3A 1MDAA 3CVDA 5B7MA 1WA1X 1OE1A 5I6LA 5LDUA 3TA4D 2AZAA 3DIVA 4BWUA 1L9RA 2XLLA 3EHBB 5I6NA 3WG7B 1E30A 3QJRB 5D4IA 4YSSA 3ASOB 5AZUA 2TSBA 3AG3B 1M57B 3PXLA 3EH5B 3MX0B 1NICA 4BXVA 4DPCX 1GSKA 2I85A 5PAZA 1J5DA 1IC0A 2MRYA 2BZ7A 4YSAA 1A65A 1KV7A 2J56A 1AG6A 1BYOA 3AG2B 3IBOA 5I6OA 1SDDA 5B1JC 2VW4A 1V10A 3FYEB 4E9YA 1VLXA 2EIJB 2FQEA 2IWFA 4W1TA 1OE2A 4AKPA 2BP8B 2CBPA 3X2QB 3T71A 3HB3B 2CALA 4AZUA 4DP0X 4JKNA 1URIA 2OCCB 4YSEA 2UXFA 4YSQA 2ZXWB 1UATA 2GIMA 3EH4B 1JZFA 1PNCA 4K9JA 5IY5B 5E9NA 2QDWA 2VW6A 1AIZA 4A68A 3QJSB 1GS8A 1GYCA 2N0MA 1WA0X 3ZX1A 2E86A 2UX6A 4GP4B 4KO6A 2FT6A 5B1AB 2GC4C 3V9EA 4PCYA 2XVBA 3IEAA 1JZHA 4HAKA 1RKRA 1L9SA 3IE9A 1PLBA 2RACA 3NJNA 3OM3B 2HRHA 4DP2X 1BQRA 2AVFA 1A4CA 2DYRB 3QQXA 3WI9A 1ASOA 2FQFA 2YQBA 1MZYA 3UADA 2PP8A 2IAAC 1ZV2A 3OMAB 1NTDA 4ENZA 2IWKA 3PAVA 4G7RB 1AOZA 5AKRA 2XV3A 4JHUA 4KNUA 4DP9X 3S8FB 4DP6X 4N8UA 3FT0A 3WNIA 1KCBA 6PCYA 1YLBB 1M9WA 4UAHA 3CVCA 1IBZA 2YAOA 4P5RA 1JXFA 2DYSB 4A2EA 3FSAA 3QPKA 1AQ8A 1CUOA 3NJKA 2ZOOA 3UACA 1PMYA 4E9VA 6PAZA 5F7BA 2PLTA 4KNTA 3PPSA 1F56A 1AZBA 2BO0A 3CZUB 3S3CB 3GXUB 1X9UA 1ZPUA 1W6WA 1IKOP 1ET7A 1KDJA 2JFCA 4YVUA 3NSFA 1SDDB 3KW8A 1HAWA 2VW7A 1AR1B 1FFTB 4JHVA 1J9TA 1ID2A 3DKHA 1XB6A 1QNIA 1ZDSA 2PPDA 2VSMB 2QPDB 2WO3B 3S3DB 5B1BB 3N55A 2DV6A 2YAQA 1JXDA 2P80D 2VN3A 3WIAA 1WS7A 1JZGA 4P5SA 3NJMA 3HEIB 1OCRB 3FU7A 2CUAA 1FWXA 1ET5A 2GB2A 5I6MA 3UAAA 4KOCA 1SFHA 1KCWA 4YSUA 2JKWA 2GC7C 2H5UA 1A8ZA 2FNWA 2Y69B 4A2GA 1CYXA 3AG1B 3FU8A 3SBRA 2IH9A 1JVOA 2BW4A 1NIFA 1OCZB 1PLAA 1R1CA 5I28A 2GHZA 1AZNA 3CVBA 3TBCA 1BXUA 1CC3A 3NP3A 3NJHA 1OCCB 1OOWA 3FQYA 4A2HA 4WKXA 4G71B 1KBVA 2IDFA 3NJIA 4G72B 1AANA 3FSWA 3TASA 1OV8A 2W88A 3JT2A 3NP4A 3U25A 1ASQA 3T6VA 2BP0A 4WTQA 2VM4A 2A3TA 2PCYA 3FQ1A 2EILB 3QJUB 1A3ZA 3UGEA 3QJQB 1KDIA 1JVLA 5PCYA 1AZCA 4E9WA 4E9TA 2EINB 1XB3A 2XX0A 1E5YA 4AI7A 2IDQA 3BQVA 2DWTA 3NSYA 1J9QA 3NSCA 4CSPA 3AZUA 4AX3A 2PCFA 1V55B 2XV0A 4GY4A 3ABMB 4QKTA 5I6KA 1JXGA 2J5WA 3SBPA 4HHWA 3NJGA 3FS9A 1JZIA 3X1FA 1PZBA 3WKPA 4YL4A 3C75A 3BVDB 4DP7X 2HX7A 1M56B 2HX9A 2YARA 4E9RA 1I53A 3NYKA 1ADWA 2R7EA 3V9CA 7PAZA 3OMNB 2HXAA 1SHXA 2FT8A 2HX8A 4HZ1A 4HCGA 4YSTA 4E9XA 5B7FA 4UANA 2ZONA 2GSMB 3ERXA 2OJ1A 3NJJA 3EF4A 2XUWA 4NERA 4BDVA 1X9RA 3FU7B 1E65A 1NPNA 4HCIA 9PCYA 2XX1A 2X87A 3SBQA 2CJ3A 2PP7A 3IN2A 3L45A 2B3IA 3EH3B 4M3HA 1NIDA 4HIPA 1WAEA 5TK4A 3AG4B 1KGYE 4F2FA 1PF3A 4E9QA 2BHFA 1OE3A 2MTAA 4X4KA 1PZCA 3UAEA 1SF3A 3S8GB 1MZZA 1AS6A 2CAKA 3X1BA 1OCOB 2YAEA 3TBBA 1JZJA 4KO9A 1T5KA 2FQDA 1DZ0A 1NPJA 2VM3A 4KO5A 3ZBMA 3ABGA 1NIEA 2WSDA 1PZAA 2IDTA 5B1KA 1NIAA 1V54B 3T6ZA 3CDZB 1NDTA 3ZIYA 2I7OA 3SQRA 5I5MA 1ILUA 3WKQA 1BQ5A 1AZRA 2VMJA 2XXFA 1TU2A 3GYRA 4CSZA 1GS7A 4BWWA 1RCYA 1E5ZA 2XWZA 3ASNB 2BP0B 2PPFA 4Q89A 4BWTA 4KOBA 1TEGA 2Q9OA 1WS8A 1IUZA 2VSKB 5B1JA 3PAUA 4G70B 1B3IA 1BQKA 1SNRA 1ETJA 4A2FA 1NWOA 1KBWA 8PAZA 1MG3C 2IDSA 1NIBA 2PPAA 3S3BB 4FA7B 3QJVB 1ZIBA 2PPCA 2Q5BA 3PLYA 5I5IA 5EHFA 1ZIAA 4GYBA 1ZDQA 2FT7A 2AZUA 4A66A 4HHGA 1BAWA 2QPEB 1J9SA 5A7EA 3N2JA 1QHQA 1CYWA 1GW0A 1AZUA 4YSCA 1CURA 3X1EA 2I7SA 2R7EB 1NWPA 3H4FA 3NJLA 4TXVB 2YXVA 4Q8BA 3CDZA 1XMEB 2H3XC 5F7AA 4BDVB 2Y1AA 3KW7A 3FPXA 4BXSV 2NRDA 3H56A 1IBYA 4PAZA 2IWEA 1SFDA 2EIMB 2JXMA
chains in the Genus database with same CATH superfamily
1RUQL 1VEPA 4MCYA 5T5NG 1TF4A 2R0ZL 3QQ9D 1IILE 4MXVF 1K2DB 5TE4H 4WFHD 4JG0L 4H40A 1T7XA 4FL4C 4P23C 1CFVL 1O9VA 3VW3H 1E4KA 2ZD0A 4X6CF 2E27L 3HG4A 4E41E 2IBGA 1I82A 2EDHA 5BRZD 4UTAH 5TGBA 3LS4L 4S1QL 1PY0A 1BOGB 5GIRA 4L8SC 5KANI 4Y8DC 4QO1B 2VKXA 3FUIA 3UMTA 5E4EC 4WAFA 3R06A 3PE9A 4HWBA 5DMGC 1NUNB 4KNQA 3HRPA 2EIZA 1ZTMA 2EADA 2H47C 4FQJH 1R3LA 4MS6A 3ZQ9A 1E8YA 1AZZC 2AQ1A 1UWEL 2COVD 4PBDA 4J3OG 5T33L 5AG9A 3BXNB 3S35L 3DOIA 5DDHB 2X2UA 3H7LA 3DUUA 3HAEG 3ZR5A 1FA4A 1SM3L 4DNLA 2J20A 3ET9F 5TE7L 1GA2A 3LH9A 3TU6A 1YEWA 5IUSA 4JRYD 1WZAA 1ORSA 5CR1A 4FLHA 1L7TL 2OTUA 1FGVL 1KXTA 4K9EC 4GMSL 1E9OA 3ZE1F 3WFCL 4MD0A 1WWWX 4GXFA 1B4TA 1EDQA 3DTXB 4HSQA 1BZ8A 1WSST 3QPXH 1H3PH 2R0KH 4FKKA 1P7QD 4HG4K 3ZKXB 4PVNA 2PPEA 2GI0A 3OF6A 3PHOB 1GAFL 1T1XB 3TFKD 4MCZB 3F5WB 5EU5B 4LCIL 4CU8A 1NINA 4FFYA 3I9GL 2XN2A 5F88B 4YPGB 4AH2B 4OF0A 4YHNB 5LCVH 2HVKB 1BOGA 2AMUA 2NY0B 4IEFB 2IF7A 1YECL 3KWTA 1SHWA 1Z2KA 1XTLA 4HGWB 4HIIB 1DEDA 3T0EC 3GHEL 3GK8H 4ZSOB 1SF5A 2RTTA 5KBPA 2X88A 3RTQD 3T9WA 2E56A 4YSPA 2XOTA 3GEFA 2ZJSH 4H1LB 5AOZA 1KJ2B 5DDHA 2EDJA 4X42A 4N0UB 3DA0A 1PEZA 4TSAH 3RYMA 1D7FA 2V37A 3B9KD 3LTVA 3X12B 2ICES 2EIEA 4LOFA 2DQJL 3K5RA 2ZUXA 3FN0L 4U33A 3MJGX 1FYTD 1PCXA 2VXUL 2FEDC 1E5AA 1HQ4B 2VR7A 4IKKA 3ZO9A 3PRZA 4F9LA 1J0ZA 4QRSB 3GMPB 3WDIA 4W9ZA 1CU4L 3IT8D 4PJ9A 4IHBA 3PHOA 5IQ7L 3UO1L 1YJDL 5F0MB 4MCZA 3F5WA 2ZTBA 1FP5A 5EU5A 4CSSA 3CFDB 5IFJA 5K1NA 3LXAA 4KZEL 1FL3A 4YHIB 4U0RB 1NCBH 1J8HE 5F88A 3WIHH 1OW0A 4P9ML 2OYMA 3LVTA 4YHNA 3WY1A 3ARTA 1CR9L 1U36A 2AV7B 3VXNB 2PUQT 4PJ5E 5GXBB 3X13B 4AOFA 4HGWA 2Y22A 4HIIA 4EO5A 5D96C 3DIFB 5B7MA 2D3JA 1ZGLB 3H3BC 4ZSOA 1OK8A 1TOXA 3ARPA 4UOW1 4ZODA 3DIVA 4H1LA 4FQ2L 3T4YA 3BGFB 3QJRB 3QG6B 1KJ2A 3N43F 1XD1A 3LEVH 4XGZB 1Q1PA 4IBUA 2Y23A 4N0UA 3LHPH 1CBVL 4M7KL 3MTXA 4DEWA 3NIGB 3TJEH 1ETA1 2APTA 3P9MB 3X12A 5B8CC 2DJMA 2EUZA 3B2UC 2YKLL 4M93C 3FT4B 3HG1D 1HQ4A 3LS5H 4G43A 3MLZH 4Y4HA 3GXIA 1BF2A 3QZLA 4D9QD 2L04A 4O9HL 4DW2L 2UV3A 3WSQH 3BP7A 3ARBB 5D1ZB 1PD0A 3CLWA 4WNQA 3VFRB 5IGXH 1OE2A 4JPKH 2YS4A 4YHIA 4WU7A 2WWKO 3EJSA 1KCVH 5FO7B 2AJ3B 4V1DD 4AZUA 1G7PA 2BOCA 5AW5B 3WN5C 1FDLL 3VXNA 4AWJC 3QDAA 4KUCF 4R3SB 3VQ1C 4OGXL 4AQEB 3C9NB 2XN9D 3V6OA 4CL7A 5K9QG 4KVPA 1XR9B 1ZGLA 3AUVA 4BA0A 5H94B 4J2XA 4JMXA 5F8RC 4GRWB 4K4KA 1CYGA 5FYKH 1OGAD 2QQNH 3QEQE 3B34A 4OFYA 4CVZB 5KSBA 4JPIA 3GLAA 5F6HI 3OBAA 4BGDA 3PNRB 1OQXA 3SDXE 2GSGB 5C0AE 1E5CA 4XGZA 5C09D 3K3QA 3U2SB 1AD9B 1BZQK 3CLFH 3UEQA 2DM4A 3LQAL 1OP9A 1YO4A 1IGFH 4U1KA 4XZUA 2BFVH 3I2CH 4KY1H 2YSTA 2FX7L 2FQFA 4ODTL 3FT4A 1SPDA 2PTTB 3FTGB 3GSQB 1NM9A 2F19L 3SGKA 2CKNA 1OLLA 2IAND 2Z93B 1VZGA 3EJZD 1YNLH 4DOHE 2I5YL 4S0TD 4U1HB 2E9JA 4PS4H 5I1JL 5I8CA 2BY0A 4ADIA 2F5BL 4FQQB 2H26B 2AJZB 4HKXB 4WFEE 2Q7YA 1J0YA 2DLFL 5E00B 3WLWD 3TWCH 2YD1A 1QSFE 3HLAB 5AVSB 4G59C 2D7TH 2ZOOA 4R3SA 4JM2F 5DA4A 5FFOA 4AQEA 1JCVA 3C9NA 2NDFA 1A14H 3L81A 5FUCC 4X80L 1EXGA 4OCYH 4M48L 3D50A 4K07A 1XR9A 2NY4C 5T3ZH 2DWDA 3CN2A 4KNTA 5D1XB 5H94A 5JQ6L 1VGKB 2FJHB 3LHAA 1ZXQA 3VWKC 2Z9TA 1BMWA 1A66A 4CVZA 2XTSA 5FHBH 3ARGA 1RY7B 2NX5D 3S88L 4ZBJA 5F96H 2IPKB 5AOMA 2CLZB 2CG9X 5FXCH 4LCYB 3U2SA 1SDDB 3WEOA 4HJGB 2KZ1B 4LBEA 2XVGA 4G1EA 1OARH 3OB0H 4MNQA 2ZXAA 1XCTB 2Y25A 3DROA 1IC7L 5FX3A 3L6FA 5B1BB 2Z8SA 1F3JB 4WO4B 4LVOB 5LGJB 4LLWA 3C5XA 1LVEA 1D7CA 5FFGA 1N64H 4ANUA 5DMIL 5E2UL 2Z93A 5H35B 3FU7A 1JYVA 1TZIB 1F4XH 4XMLL 4NPKA 1ZTXH 4Z7VE 3FQRB 4TUKH 1MN4A 2BDNL 2GYSA 3B3IB 4GRLC 2AJZA 4HKXA 5E00A 5A3IC 4F8PA 4W9KC 1EXUA 3OAUH 2O61B 2MKLC 3AU1B 4M62L 2DTML 1QKZH 4U1IB 5HDQH 1NCDH 4J1UB 4P2RB 3SE6A 3OLGA 3U0PB 3TPUB 1E4WL 2ZKHH 4M3JA 4ZD3H 3O4LD 2FJHA 3KYKL 1MHPH 2VN4A 4CW1B 3DO7A 5KSUB 1CL7H 5L4MA 4Y1AD 1E6OL 3V2AR 2OCJA 1KBVA 2IPKA 2CLZA 1YMMD 4LCYA 1W15A 3LKNA 4N2OA 4QPEA 5ALCH 3ZO0A 2YK1L 5IMOB 3VFGH 4J39A 3G6DL 3HG3A 5AVWB 1XCTA 1TTAA 3SGEI 3E6HB 3QB7C 1H8LA 3ARUA 1F3JA 2PCYA 2QFPA 1ZV5A 3SDAA 3U46B 5LGJA 4N3TA 4P4RB 1K4CA 2B4CH 2I60H 4ZMVA 3VVVA 4GO8A 1F90H 3HI6L 1GGCH 3F6JA 1JVLA 4DF9A 4FQPA 3OHMB 2IG2L 4YMPA 6FABL 5H35A 5J9PB 4J28A 1J0IA 1D2PA 2WQVA 2Y24A 1TZIA 1SYSB 3CCHA 2JCCE 1YN7B 3B3IA 2WOYA 4HEME 5IHHA 1GXEA 1LDPH 4HFWA 2D7QA 4ETQB 3VQLA 2O61A 3AU1A 5BXFB 2IBZX 2V17L 4BQ8A 3ILQD 2WYHA 2LU7A 3FS9A 3WDJA 4YDKH 3LPFA 4U1IA 3K4AA 3SZ6A 4J1UA 3IWVA 1X6LA 4MS8C 4P2RA 3U0PA 1S7TB 3QQ4B 1WRFA 3UJJL 4FXLA 2C4XA 5DVOA 4CW1A 2A4EA 5KSUA 1KTRL 4OFQA 1MRDL 4YBLB 1GMIA 3CC5A 1F58H 1OT4A 3NZUA 4OZHB 2CDEB 2IALB 1FN4A 2XRAL 2XPYA 1QOKA 3BUQA 2MIZA 1NGQH 1NSNL 2XUWA 5EA0L 3OGOE 3ILDA 4N2LA 2WQRA 4GSDL 4PJXB 3IMSA 3QUZC 4D0BB 2H32B 3E6HA 1UUNA 4NKMB 1NFDA 3U46A 1ZVHA 4M02A 1YC7A 1U3ZA 3WY3A 4P4KC 1ZHBB 2GBUA 4LLUB 2MEJB 3UERA 5J9PA 4L8DB 4LCWD 2W9DL 3ATEA 3H7BB 4UOJA 2EZ0C 3SDXF 4AENA 1WWCA 15C8L 1I9IL 1Q72L 2MTAA 4Y4KD 1XO8A 1YN7A 3ATDA 5ACZB 3VO0A 1MZZA 2FE0A 5F3HA 1S6NA 2IGLA 5IK3B 1DUZB 4JRWA 4IDJL 2FQDA 4OM1L 5FUOH 3UG5A 4OBRA 3T65B 1E6JL 2CGRL 5L0QB 3A6OA 5CCJA 1S7TA 4XMPH 2OMYB 3TEYA 3EDKA 2UVEA 2ESVB 4M8QB 5JW4N 3RWEB 4XC3H 5I19L 3TFBA 4X6DE 5EO9A 4TRPH 4XCEB 4A55A 5AOKA 3U9PH 1NL0L 5CD3B 4OZHA 2CDEA 2IALA 2RA1A 3O4OC 4KOBA 4TNGA 5T1LD 2ADYA 1N0LA 4ZX4A 1N0XH 5I1CH 3PAUA 4JFDD 1T7WA 1LNUB 4UDUB 2EEBA 2O93L 5ERWA 3TV3L 3JQOB 4PJXA 1BLIA 1NC2D 1XH3B 1UD2A 2DLTA 3EGDB 4OCRL 4OFDA 1ZHLA 4QXUH 4U7SA 3S34H 4FA7B 5ITBL 3RX8A 2PPCA 5F9JB 2ZUVA 2J43A 1ZHBA 2BERA 2P5ED 4GYBA 5I5IA 4L8DA 5BO1L 4JG0H 3K91A 1RZJC 2OFQA 3FFDB 1LWHA 1Y18B 2B0SL 5FLVA 1CFVH 1JXKA 2NY7L 2EIDA 2BOLA 2E27H 4Y9EA 4RFNC 5I6XC 4WZ9A 2VMCA 1ICTA 3GIZL 3LS4H 4S1QH 4L37B 4G8GD 3B9VA 3ZL4L 2BVEA 3RPKA 2I7SA 2BRQA 4NOFA 1BAGA 4TXVB 2CGYA 4BSWB 1KYUA 3T65A 4XXDB 4JQIL 3NEXA 2OMYA 4AM0B 4P59L 1CXIA 2ESVA 2PR4L 3DPDA 3F2LA 4FC3E 1FF5A 4M8QA 1T6BX 4APQC 4Z7VF 1A6UL 4HUCA 6PAZA 3TEXA 4XCEA 5CD3A 1J5OL 1RZFH 1OZTG 3LYRA 3TONA 2K9UA 1IC5L 1SM3H 3O6MH 5KVFE 1CQYA 1VFBA 5TE7H 3ZIMA 5IOPB 1JK8A 2XQ0A 3L4CA 3HNSL 4Z3TA 1BX2A 4UDUA 5EBMB 1JGIA 1KTLB 3KPOA 2EYTB 4IRJD 1FGVH 1FPTL 5C8JB 4X6CB 1FNGB 2ATKB 3ORJA 4GMSH 3UBXG 3WFCH 4TOYL 3VD5A 3DK2A 1HIML 4WJ5A 4BRVA 5F9JA 2OMUA 5CU5A 1CDUA 3HN3A 2VITA 4QOKB 2GEQA 4OZGE 3D39E 2R29L 3HR5A 3QISA 1GS6X 2Y9RT 3FFDA 3VFNB 3LKPA 2P52A 4LCIH 4PWHA 4I89A 2WW8A 5KYWB 2MNUA 1YYCA 3MV9B 1X5FA 2H3KA 2WKGA 3IMWA 3MRDB 4JE0A 3MHZA 4M7LT 1KPVA 4P46A 1YECH 4F92B 1HEZB 3BJLA 2H4EA 3T2OA 2O30A 1HT6A 5KUMA 2F7RA 3KXFB 1JMZA 3GS7A 3D2UB 3DVGB 2X5PA 3INOA 4G7QB 1J0HA 2B20A 1I1CA 1QWHA 2NY3B 4PRAB 2NYYC 3DX7B 4JFOB 4GJTB 3PWPB 3RAJH 2D7PA 4WF7A 2BJML 2JCCF 2X42A 4U1MB 3ZE1B 1DCEA 1FAKT 4DKFL 1KENL 2ADJA 4XN9A 4NUPA 2I9LA 1TTRA 1ZAGA 1T2JA 4NKDB 4OIAA 5BCAA 3P3RA 5IHBA 3K0YA 4TQHA 4MQSB 1W0VB 5EBMA 1KTLA 2Y6SD 4R4NC 1U91B 4R0LC 5LQBL 2EYTA 5C8JA 2FSEA 4X6CA 5CEXA 1FNGA 2VXUH 4JG9A 2AXGB 3MAWA 2GBAA 3RJQB 1Q9LA 1CU4H 4I1NB 1G5GA 5GZOD 1U2HA 1FAIL 3DJSA 1HWGB 5SV3A 3UO1H 1EEZA 4A7GA 5IQ7H 3VFNA 1UVQB 5GRZA 1FLTX 5KYWA 1BVNT 2FEEI 3E1ZA 4WI0A 5KSVB 2Y07L 3MRDA 2YAHA 3BWAA 3P4NB 4IIQA 4P9MH 4AGNA 3L3JA 3KPRE 5EO1B 1MJ8L 1HEZA 3HJEA 3VXUA 2HMIC 1LEKA 1J5CA 4N4YB 2NY1C 4X5XB 1KYFA 4FRWA 2YIHA 5KVGL 3FJTA 1N18A 2X1XR 3AY2A 1PKQE 4OBSA 3ZGIA 4PRAA 5EG6C 1CJYA 2JNZA 3V4PB 3PWPA 4O2CA 1WFTA 5D4JA 3LRKA 4FQ2H 4N2KA 4U1MA 4HUVB 4B9FA 2P24B 4ZMPA 1WFOA 2CK2A 5MP6L 4MDIB 5B22A 2PTVA 1QD0A 1CBVH 4M7KH 5IW6B 1XB8A 2O26U 5JQIB 3MUJA 4KI5C 4N5UA 1AVAA 2YKLH 2YRPA 3CWGA 2WQ8A 4HUXB 2CXKA 4OT1H 1D5IL 1CXFA 2AXGA 1PCSA 3OB0K 2J8OA 2DM7A 3L1GA 1M7XA 1MCDA 3D12B 4N25A 5JDSB 1OP5K 3PIQB 4O9HH 4X6DF 1QFWI 4HWBL 4GP5B 3B2PA 5LAXB 3UJIL 1UVQA 4ZT1A 4KHXL 1WA1X 2WV3A 3NIDE 3W9DA 5KSVA 3CXDL 3P4NA 3VCLB 5EN2B 4IOFC 3ML8A 2D4DA 4IOSD 1FDLH 5AW6B 4WTXA 1OAXL 3N43B 4OGXH 4M6MH 2R27A 5AZUA 4G8FB 2TSBA 4G83A 1HYRC 3EYVB 8FABB 5EMYA 3BHBB 1YNTF 2K45A 4BXVA 2P1YA 4JFXB 1PAMA 2NCMA 3V4PA 1LE9A 5KYYB 4Y4FD 4HOZA 4HUVA 2P24A 4JO3L 4IJTA 5J3HC 1BYOA 5A6MA 3CZKA 2BHZA 2IFFL 3PDOB 1TCMA 4POZC 3ECUA 3LQAH 4FFYL 1HWWA 3PV6B 1RP9A 4PRHB 4AIZA 2FVNA 4BZYA 2PXYD 4ODTH 4EIUA 3GTNA 1DL7L 2Z1PA 4J3TA 2F19H 3ULVC 4QCIB 4D2NA 4FNRA 2VW6A 1LL1A 4K7PX 3ETBJ 3FF7A 3CFJB 3BZDA 3UBFA 2Q1EA 2ZCZA 3A4EA 4RETB 3HG2A 2F5BH 3VCLA 3WS6A 1KV3A 1DQVA 3GXFA 2PETA 5EN2A 2QV4A 3VG9C 5I0XA 4PN6A 5JW5A 3WTWA 1D9KA 1UWGL 2IPTL 3MOQA 3V9EA 4E41B 2X9YA 2KPWA 5JLZB 1TZHB 4G8FA 2Q8BL 4X80H 1PLBA 4M48H 3EYVA 1DTUA 3EJJX 3J8F7 3OM3B 3QIBC 8FABA 4OZGF 3PWUB 1VACB 3WJLC 4JFFE 3WI9A 4L2LA 1CLVA 1FZOB 4QHPA 2VDKH 4BM7A 5JQ6H 4JFXA 4P5MA 1IMHC 2ADFL 2ZG2A 3UADA 1GGBH 4RGOH 4AV5A 3EDDA 1B6UA 3KH4A 4J5VA 2OL3B 3PV6A 1UA3A 4PRHA 2B8OT 4BD4A 4FA6A 5KUKA 2LLLA 4ICXA 4RGNC 4CA4A 1IC7H 2R9HD 2NXYD 4ERSL 1SYVA 1YEGL 1AQ8A 1TTCA 4QCIA 3CMOL 3TCLB 2IADA 5DMIH 4ZS7L 5E2UH 3UACA 4JM2B 5C71A 5HHVL 4LEBA 5F7BA 2OXHB 3MJ9H 3Q6FB 2BDNH 1GGIL 2PLTA 4ZDHB 4Q74A 5E6IB 3IGFA 4M62H 2VZ1A 2X4OB 3D4ZA 1Q0XL 2CO4A 2VLKE 4I13B 4F5CE 1HN1A 1MCNA 4YVUA 5CP7B 1BZ7B 1TZHA 2PYED 2QPFA 4HXBH 3PNWB 1HDMB 4FG6D 1A1NA 1PD1A 3LIZA 3QJHB 4DGVL 1BFOB 1E4WH 1FFTB 1J9TA 1VFAB 1FZOA 2GIXA 2PWGA 3KYKH 2PPDA 1L0QA 3OSVA 2VJ0A 3D0VB 1AHWB 3HC4L 1BLNB 2PR9A 4FQLL 5DJXB 3VH8B 2YK1H 4Y5VB 1CLZL 5E0QA 3LN4B 4CJ1A 2WZ5A 4ZAKB 2FBJL 2GB2A 3G6DH 4UT6A 4U7KA 2QGEA 4M6NL 4ZFGL 2R1WB 4MJ6B 4PLJD 5KTEL 5DD1L 3IDJB 3ISWA 3AG1B 3TCLA 3HI6H 1CGYA 3RVXD 1R1CA 3GMLB 4TSCL 1JZ2A 3O6FC 4R26H 2W5PA 4XHJD 1MJJB 4DKAA 2O5NA 1I9EA 1BXUA 1KPRB 3Q6FA 4H0HB 4ZDHA 3QK0A 2H8PA 5E6IA 1G1CA 3BP6B 5F0JB 4PJAE 2X4OA 4U31A 2DM2A 4WKXA 2JTYA 3CUPA 2QPSA 2V17H 3QZWB 3SSGA 1VESA 1J8HB 1P6AB 1W72B 1Q1JH 1REIA 3CQFA 4PS8A 5LGKA 3L3HA 2FH8A 4JM4H 3PNWA 3QJHA 3FTSA 5GRXG 4PJ5B 1BFOA 3U82B 3UJJH 4ABUA 4AYEC 3BMVA 2FB4L 1KJMB 3OF6D 1KCKA 1S5IL 3O8XA 1MRDH 3NIDF 1AHWA 1DJWA 3TA3A 4QRPA 3MNZB 4J8QA 4S1SL 5DJXA 3VH8A 3B6SA 4EAEA 5BV7C 3N42F 1HXYB 5CILH 1NSNH 4ZAKA 3EDFA 3V52H 5EA0H 3H3PL 3Q2VA 1OAKH 3NZ8A 4GSDH 5D7JA 1ZLVH 2XWBA 1HNFA 1GZQB 2H6PA 2R1WA 3F58L 3NSCA 5I8OL 4YQXH 1P5UC 2DKUA 3ZKNC 2W9EL 5BZXA 2YJLA 1QZNA 1YA5A 1TCRB 2W9DH 5TE6L 2Q7NA 2FL5B 4K8RL 3X1FA 4MNHB 1UZ8B 1SN0A 4XX5A 15C8H 1I9IH 1MJJA 1Q72H 4AIOA 3R0MA 1MFNA 4PRNB 1KC5L 3RWCB 3ZUCA 3RVTC 4X7CC 3B9DA 4BUGA 4GH7B 2D8KA 2PYFB 3JTTB 1QA9A 4KQ4L 4IDJH 3WL9B 4OM1H 5D8JL 5IJBC 2C9UA 1ORQB 5AAWC 2YQGA 1E6JH 3W2DL 4HETA 3RVWD 3ZTEA 1X44A 3PFQA 2OJ1A 5AL8A 4DZ8B 2VR6A 3ARFA 4PJ9D 3OJVC 1NBZA 4OFIA 1QHPA 1RZGA 5I19H 3QHZL 2XX1A 4R84A 3BW9B 4NO3A 2QPUA 1NL0H 3QEQB 3S97C 4FFWD 3QUXC 4RMWA 3HBGA 4X4ME 2FZ3B 1IJ9A 2MQCA 3SDXB 4NO0B 5C0AB 2NY0D 4F2FA 4X4KA 3H9HB 3TV3H 1KY6A 1EDHA 4UBDD 4QYAA 4OCRH 5ITBH 3TLRA 1KCUL 2ITDB 1ZD6A 2YAEA 4HOXA 4L4VE 2J71A 1CF8H 3QJFB 2DIJA 3LN5B 5AOIA 3KYNA 5BO1H 2JKSA 2FL5A 1HZLA 1XSJA 4MNHA 1UZ8A 2B0SH 1NIAA 1V54B 2O6CA 3M86A 4PM1A 4AL8C 2OQJB 1FFOB 1NOAA 4BV1A 3I50L 3RWCA 3PQYE 2X4UB 4NNYB 2ICWJ 3RI5F 3GIZH 2PYFA 2VLMD 2WWMC 3JTTA 3E6FB 1FFPB 3MRCB 2X09A 3RRQA 3LDBC 3KPLB 2YD7A 1CDCA 2ISDA 1U8CB 1HYSC 4JQIH 4MAYC 5GGUA 4XVJL 2AQTA 4Y4HD 3ARVA 4G7VL 1OAUL 2IOOA 4DZ8A 4L2YA 1RFDL 2VLRE 4BFOA 1LGVA 5FUZL 5HI4D 1NOLA 3OKOB 1A6UH 3SOTA 1I8LA 3BW9A 3BC9A 1J5OH 4PW4A 2ZX9A 1ZOXA 2GUOA 3QEQA 1IC5H 4UNIA 3T8XB 3AADB 3A3YB 2FZ3A 2AZUA 3HNSH 5FHAL 5E0FA 4RVBA 5MEOB 3H9HA 5BOPA 1FPTH 3VSUA 2DQCL 4TOYH 5BW7C 1HIMH 4OV5A 4XO9A 4XNDA 1OAYH 1X9QA 3QJFA 2R29H 2Z31C 3BVUA 4OQTL 3II1A 3OVUB 4OFYD 3H55A 4YE0A 1N6UA 4L48A 4JPQA 1FFOA 1TENA 4HULB 3DJZA 5KYXB 1QFWM 4Z7VB 3E6FA 1FFPA 5DZLA 2CIIB 1KXVA 5JIMA 5HHME 2YRZA 3KPLA 5IBLC 3MJ8A 2YAPA 1U8CA 3JZ7A 1NKRA 4LOVA 5ABAA 3QUHA 4TTDC 3F6IA 4KRPD 3FCSB 4IBLT 3PWJB 5J6HA 2EACA 2R0WH 2QSQA 2BJMH 2YUXA 4PBWD 4WIQA 3OKOA 3X11A 3ARBD 5D1ZD 1KENH 1OM3H 2B7DT 2G2RA 3DI2B 3X1GA 3TCTA 2CKBB 3C8KA 2GTZB 4PJAF 1IBHA 3T8XA 1TVDA 3TBSB 1JGDA 1SJHB 3SDCA 2J88L 2NY5L 4OI7A 5MEOA 3I6KB 4EQ2A 2K3HA 4MDJB 1YMHB 3Q8CA 4HH9B 2BNRB 5I5RA 1TFPA 2BSRA 4L18A 2NNAA 4K3GA 3TTYA 3L48A 1FAIH 5ECGA 3C5ZC 4DP5X 1BXVA 2YAFA 4AMWA 1MFVA 3ARGD 3APDA 2K7PA 2R0LL 2Y07H 3RWJB 1S7WB 1SVBA 2DL2A 3GRWA 2ADIB 5KYXA 4KTEL 2ED6A 4MNQD 35C8L 1BD2E 5E9DA 5ETUB 4Q9CA 1HOEA 1T83C 3V9FA 1FL5B 1GY1A 1AI1L 5ICYB 3PWJA 3U9UB 2A9CA 2X44D 1E27A 1M6OB 4ZOEA 1LYQA 3WXWL 1EHNA 3HW7A 4GAJL 1QASA 2YA1A 5MP6H 3MUY1 2GTZA 4GQPH 4NX0A 4Q9QH 5J1TC 1ITBB 1Z5LB 2W94A 3BN9C 5EC2A 2W81C 1XCXA 3TBSA 2E7CA 1MAML 2IXQB 3T3PE 1I8MB 5ESAB 4D3CL 3OTTA 5HYJE 3PPEA 2H1LM 3I6KA 2JWYA 3T0AA 1KWGA 1GGUA 3K2UL 4MDJA 4HH9A 4UZSA 1IM3B 1D5IH 5JIKA 2BNRA 3FAXA 3NABH 1SOQA 3VXME 2AEQH 4MSWA 4L05A 2VISB 4NQEB 1DLHB 2HRGA 3Q5OA 5D1XD 1YEIH 3UAJC 4HWBH 4EDXB 3LRGA 4JCLA 3HJ0A 4KPHH 3CXDH 5GS1B 1GIGL 1S7WA 1QSVA 3FH8A 2WY3B 3MNDA 2XXMB 2VMEA 4BIKA 4B50A 3FB8B 1T7YA 4HEMA 2APSA 1BA9A 2V9UA 4LMQE 3GZOA 5J1AB 2G2PA 5ETUA 3BP4B 2GJJA 2MOGA 3QIWC 3SDAD 3TT3H 5CJXC 1C12A 2D4FA 3NCEB 1M71B 5CCKL 4MQXC 3EYQD 4ZPTB 3O2VL 1C5CL 1QUNB 1JTTA 5C6TL 3L4VA 2IFFH 4R90L 1KPUB 1Z5LA 2WVSA 4FFYH 2JTDA 1TYRA 3D69B 2IXQA 3UTZB 1IEBB 1Q38A 1UKQA 2ID5A 1U3HB 4WSGA 3G6JB 3F6LA 4UB0L 1IX2A 1IM3A 1OPGL 5LDUA 5LWYL 4W6WB 3TA4D 3GSRA 4P2RD 2GTWA 4WHTB 4QJ4B 2OKMA 4NQEA 1DLHA 4G8AC 5ID1B 4HFUH 4YSSA 1CGVA 4EDXA 2UYLB 1AH1A 1M57B 2GSIA 2XZQL 1I3RB 1YNTB 3F84A 3RILA 3MX0B 5FECB 1MY7A 5GS1A 4AXWB 1D5BB 1OHQA 3GSVA 4Z0BL 3FB8A 1UWGH 2IPTH 1RHHA 2VDMB 4GSRA 4MA3B 1KV7A 3LEXA 2VB5A 3A47A 1I85A 5J5EA 2X3CA 5DD3L 1JPGB 5J8OA 1SDYA 5DT1H 5B1JC 2Q8BH 2R39A 5DURD 4LOEA 2HFFA 4WV1A 1N3NB 3TF4A 3HS0C 1O5DT 4WFGD 4KK8C 3RWIB 1MXDA 4R5VA 1KGCE 1JHTA 4W1TA 1TEYA 2GK2A 1RSYA 1M71A 5E6RB 3BLPX 2CALA 4FXKA 3DARA 4BQ6A 4Z7UB 4OJCA 1QUNA 2AITA 5TF1L 1T5WB 2TRHA 1KPUA 2VERA 3CFIC 3CFTA 1UATA 2CR0A 4HK0B 1XVSA 3F01A 1IEBA 2R8SL 4FFVD 3RIFK 5LNDA 1GS8A 1EBPA 3G6JA 4X99A 5IB5B 5L2KE 4ERSH 1YEGH 2HJLA 5MHSD 1RUMH 1ZLVK 5EIVA 4ZS7H 5GS0C 1OALA 4M9PA 3W3BA 5FA4B 2AQQA 1I3RA 1KIUB 3D39B 4GQQA 4H1LH 4OZGB 4YEEA 1GGIH 3B43A 3MX0A 1UC6A 5IM7B 5CZVL 1H0DB 5IQMA 1KJ2H 2LGNA 5KAQF 4RDQG 4YDVB 1Q0XH 2D2OA 4ZOCA 4P5KA 1WEJL 4BSVB 1JPGA 4DGVH 1HEHC 4L4JA 4POYA 3ZRSA 2QQLH 2WBJA 2ZWKA 2HKFL 2XVLA 2WXIA 2RCSL 5E4EB 5H4YA 5J11C 3I02B 2G75B 4Z7UA 3HC4H 3QZWG 1T5WA 1BREA 4WFFE 4FQLH 2C5DC 1CLZH 4C4KT 2VAAB 4RLDA 5DUML 1S9KC 4HK0A 1YY9D 1IV8A 3BCDA 1S7UB 4N2GA 3VYNA 2VDRL 2YKKA 4M6NH 4UQEA 4IBVA 4ZFGH 3DJ9A 3TEZA 3BQUB 4ZYKA 2LV4A 5KTEH 5DD1H 3CZUB 3GXUB 3ZRFC 2ESVD 4TSCH 1T89A 2AEIT 1PTZA 1EAQA 3GMOB 3V4PL 1J9CT 3I6LD 3QNYB 3F62A 4JKKA 1CBJA 4UIKH 3T3PF 2DQIL 5JYMA 3OKMB 3HFML 4P23A 2QPDB 2X1QA 5L88L 4XT1C 5CEZD 4KJYA 4BSVA 5BVPL 1WK0A 2MWCA 4LDOB 5AOLA 1A21A 4L8SA 3KPRB 5ISZE 1PDKB 1J86A 4UQDA 3P3TA 3FW6A 3JZYA 1ZGLP 1JRHI 3QO1B 3US1A 2NPLX 2BSSA 5KYUA 4YGAB 5K9QI 4FABL 3B3BA 2GC7C 5FDYA 3IDYB 5DHXB 2G75A 2ROXA 1PKQB 5HHPB 1CYXA 3CFBB 3SBRA 2K3TA 4ODSH 4S1SH 3FTVA 4UQ9A 1JZ7A 3TJHD 4PLOB 1PLAA 3ZK0A 1DE4A 3UCRA 1E4XI 3CVBA 2WBWB 2F53B 3TBCA 4P46D 3WJMB 1W0WB 3SKUD 2FO4B 3U0WL 1JDCA 3LVEA 5MERB 4E5XB 3A5VA 4JL1A 4ZMNA 4GKNA 3F58H 4G8EB 5I8OH 2EXTA 1O75A 1KEML 1Y6MR 1GW6A 1K8IA 2DIAA 4JPVL 4V2BA 4A2HA 3QQDA 4OR1A 2WVVB 3ASWA 4LNRB 5TE6H 4AYDC 2V9RA 4ANXA 3FSWA 1VJSA 4GRWH 5F7MC 4F3FB 1UCBH 1P6FA 5C0JB 3N5AA 4U6HA 1KC5H 2KYIA 2N0KA 3EOAB 2E4FA 2VXSL 4Y8AA 5DJAA 1LEIB 4R7XA 2X4QA 4KQ4H 1K4DB 3B1UA 4WTQA 3R19A 2VM4A 3NIDB 3GUFA 1O0VA 2CBOA 2FATL 3VJ6B 4W4NA 3IDGA 4WRLA 3W2DH 2WTRB 4YR6A 2Z8RA 5FYLE 3N42B 3GMMB 4NC2B 5EU7E 1ZS2A 3QO1A 5GRWA 2VXQH 3ZE2E 3T0EA 4HAFA 3QHZH 5GSRB 5ABZA 3BDYH 5E5LA 4AX3A 3CFBA 4EEEA 4JS7A 3MXVH 4XHQA 4R9HA 1U4FA 3NJGA 4J6RL 1PZBA 2PWEA 4UAOC 5IBUG 4GG6E 2C3HA 2F53A 2DAVA 2WGXA 3IJEB 1W0WA 5AAMC 1UADC 2FO4A 2IMNA 1MRCL 2C9PA 3CD4A 5HP5A 5MERA 3D2UD 6CGTA 5I76B 2A0LD 1R46A 3SE9L 3VI3A 5J4MA 2F6AA 5JHAA 2YPLE 3L54A 4M93B 3LIZL 3LZOA 3CBJB 4IJ3B 4AQAA 3PWPD 3QUKB 1NKGA 2VQTA 3OPUA 3WOVA 2QKIC 4NP4H 1E65A 1LEIA 2BSBA 4CBPA 3FMGL 2AABL 1K4DA 1DBAL 2JCWA 4HH8A 1UZ6F 2J8HA 1GL4B 2XNAB 3VJ6A 1AGCA 4UT6L 4JDZB 1SN2A 4NAQA 1G7QB 2J8UE 3WN5B 5HDLA 1T4KB 3GMMA 4XVJH 2HN7B 3PYCA 2HWZL 1OAUH 4G7VH 2XTJC 1RFDH 2W60A 4X4YB 3LXCA 2WTOA 1NGWB 1K85A 3UYRH 2X0UA 4JFFB 4WI9A 2I26N 2YR3A 3BPCA 2ZZUT 2HVBA 3TBYB 3QI9B 4C56E 5CLYA 5FHAH 4BJLA 5JOEA 1UD4A 4N20A 2BVQB 4JN2B 5F9WC 1CDIA 3IJEA 2MJWA 3F85A 4KHTL 1J88A 2DQCH 4GSUA 4RISL 4TL5A 5B8CA 1MFMA 4QXTB 1KY7A 1DFBH 1GOHA 1G7LB 2A83A 5CIPB 2DD8L 2Y2YA 2XWTA 3TN0B 3QUKA 1ZVYA 3S5LB 4RZCB 4WNJA 4G70B 3D4YA 4A2FA 1BXXA 5DJ8A 2VDQL 2CLVB 2IDSA 1HX0A 1LD9A 4K15A 2UZYB 3MR9B 1E9QA 1P5VB 3NQIA 3RPBA 2PCXA 1PPIA 1U8QB 3CFQA 4OIIH 4ZW5A 2WKOF 4HWUA 4NUMA 1LEGA 1LLAA 3CDCA 4JDZA 3VACA 1I7RA 5AKSA 3WN5A 2G0LA 2VLKB 3WLBB 2I07B 4OFKA 5IIEB 3UZVA 1ZV9A 1I8UA 1J5IA 1TXKA 4X4YA 2WYIA 1A6VH 3AU0A 5T3XE 3HBPA 1A4KB 2NY4B 3SYPA 4X0KB 4FXGC 1OAZL 2ADGA 3LH2H 4R7DB 2IIJA 1U8LB 1QI5A 4JZJB 2NT0A 4GBXC 3S36L 4IBYA 4NQTA 3KPTA 4NO2B 2BVQA 4JN2A 2NY5H 4LSDA 5D6DC 3UJTL 2Y72A 3FCTB 4JFQB 1L3NA 4B3EA 5DD6B 5ALBL 4XE5B 2EE9A 2ZAGA 5CCGE 1JZGA 1G7LA 4R7LA 5CIPA 3B9AA 3RKDC 1JZ5A 5IQNA 1D5RA 2ARJQ 3CX5K 4URKA 4XP1L 3S5LA 1PY9A 3S98A 3WNOA 3N06B 4I3SH 4ICWA 4N5ED 5DVNA 3RBGA 1SUJA 3ZTJH 5IB4A 2B9AA 1BYPA 1U8KB 4PRHD 5BZDB 2RHEA 2ICWA 2XWEA 3N44F 1P5VA 2ZUYA 1VKXB 2FYYB 1YUKB 2EYSA 4PJAB 1ZJBA 2VN6A 2H2PC 5ILTL 3TF7C 4OLVL 4XVOA 2I07A 2FJFB 1LP9E 2OMWB 2UXVA 3BLKA 5JYLA 2LAGB 2NTSP 1JVKA 4GAJH 3U48A 3ALPA 2Y5QA 2HG5B 4X0KA 4JJ5B 1N70A 3VWKA 4PG2C 4L9DA 4R7DA 2Z7WA 4FE9A 1ZSDB 4PRPA 5F7UA 1OB1B 1AGFB 4NO2A 2EC9U 4Q14A 4D3CH 5CINL 3GSNA 2CRYA 4HIQA 2DLHA 3STLB 4K3JL 5DD6A 4LEXL 3QAZC 4L9LB 5ESQB 1MJUH 3RDJA 3U1SH 4YUEL 4OZIE 1JG9A 3ZE2F 4FAAB 1V3KA 2NSMA 1B4JH 3MRHB 3WU1A 2UXGA 3FYIB 4HMCA 2NNFA 4YHKL 3D3VE 2VSDA 2ZXBA 4AKQA 5E1AA 5LGHL 2D0FA 5M94B 4GG6F 3RL2B 1U8KA 1LTXA 1TMQA 2PWHA 3EJQA 4GRLA 4PJGB 1VKXA 1RZKL 2FYYA 4L8CA 5CHNB 3JWNH 5CEZH 4YDMA 3WXVL 2CNYA 4HA1A 1XCWA 2BWDA 1X5JA 1UB6A 3NT0A 1SBSL 5I18L 3HG5A 3OWEA 4MQ7B 3O2VH 4MKTA 1C5CH 1HAUA 4W9LC 4ZFZB 4R90H 3NTCL 1JGLL 2A1WL 1ZSDA 4HUWB 5E6ID 1AGFA 5AB0A 5IESL 1A1MB 1XL4A 2J8UF 3D85A 1JGEB 1FFQA 2BY1A 2DQHL 4UB0H 3L9YA 2BVUA 1OPGH 3GINA 4LIQH 3OKYA 5LWYH 1GKOA 1EWHA 2O4EA 1MNUL 4AK2A 5LDSA 1NCTA 3CSFA 3UBXI 3MRHA 5AWNL 2VH5H 5ABDE 1YVLA 1PJ9A 1G7IA 2EP6A 4L4VB 2LABA 1KLFB 3L3OB 4G5ZL 1PL3A 4XPGL 2BIOA 3MNWB 2O5YL 3IKKA 4Z0BH 4ZAKD 5F0PB 1EZLA 3LSOB 1GZPB 3V0AC 5K9JL 3PQYB 3ENEA 3QUMA 3GBDA 4PJGA 5DD3H 1F1AA 4K94H 2JKIS 5CHNA 2YEQA 3VRIA 1RQ5A 4H8PA 2F74A 2AGJL 2GJRA 3LD8B 2R2BA 1YEFL 2V2TB 3QXUA 2G4EA 4Y2DC 4LSSL 2VLRB 5TF1H 4XO3A 1CF1A 2HPOA 1HINH 4FLRA 2V5TA 4OVUA 2PWDA 3NEEA 4HLZH 5C0IB 1EXHA 2R8SH 2XKNB 5GRUL 1A1MA 2C1PA 3GRWL 4FI8A 3T0VA 1J8HD 3EFFB 1JGEA 4X4MA 1JHLH 3QRLA 3NJXA 3D7PA 2CR3A 5A16B 5I0VA 4JFHE 3QUZA 4Q6YA 5DMKA 2DQMA 3ARFD 3V79C 3Q05A 1MELA 4PWIA 3RNKA 1XR8B 4MA8L 1Y07A 2HFGL 4KVCL 4P4KA 4O58L 4XBPA 3U1QA 5HVHC 1ZT7B 4TLSA 1X3DA 4X6EA 3BT2L 3MNWA 5F71A 4AKPA 1EJFA 5LG6A 4JPSA 3LSOA 1GZPA 1TQCB 3CDFA 1WEJH 4G7YL 3VFTB 1ZK9A 4Y5YC 4NQCA 5AVXB 2GIMA 4U6XB 1JZFA 5HHMB 5I9QC 5J6SA 3LRSB 1FG9C 1NAKH 3WNNA 1WBXB 3MOAL 2Y36H 3M7FB 4KRMB 1B0WA 1LQBC 2RCSH 4WNSA 5I1DB 2V2TA 4YFDB 4KO6A 5JIQA 4NQDA 2VLRA 4LPUA 2DQ6A 5CWSB 1U8NB 2OXGA 3IRPX 4XBGA 4QD2E 3GM0A 3AGVA 5AKTA 2BOBA 3FRPB 4KKBD 2V7NB 2OX5B 3G04B 2VDRH 5IROC 1A02N 1A7RL 1KZYA 4Y1TA 1IZKA 4K5NA 2E7LC 1NMAL 2V5YA 1LP9F 3MRQB 1W8NA 4LPCA 4YDIH 3KEHA 1A6TB 5A16A 2IAAC 4RNRB 4FTVA 1KTJA 3OMAB 2IWKA 3FTZA 2Y7LA 1XR8A 3V4PH 3AACA 2A74C 5HDOA 5KS9B 3MROB 3LRLA 3HMXA 4HKBB 1PYWB 4QXUL 1OPOA 2DQIH 3QEQD 1VFOA 4XXWC 1LO2L 4G6JL 2IPUG 1RJLB 3ARZA 5D7IE 2ZP0T 2X6AA 4NO0D 5L88H 3IDMB 3IMVA 3NSXA 4RDBA 1ZANL 3QPKA 1GYAA 1DVQA 4WW1B 3VFTA 1ACXA 5DQDL 1ROCA 4OZIF 4YO0A 1LQSR 1P6WA 2C7UB 3LRSA 5DMJB 4XO4A 1QNZH 1I1RA 1WBXA 4HJIA 2WXNA 4DEPC 4FABH 1KN4L 2XPZA 5I1DA 2K4WA 1F56A 3ZJAA 3F7PC 2B1HH 3BI9X 2NQ3A 5CWSA 5T1JA 1EHXA 4APQA 1F8TL 4KTDL 3M7OA 2QHRL 4EBQL 3FRPA 2YOAA 3PP3H 2V7NA 3KW8A 2MQ0A 2NW3B 2AJUL 2OX5A 3G04A 4LSVL 1EUTA 2DF3A 3U0WH 1QPKA 3QDGE 1Q9KA 3VVWA 2XQBH 3B2VL 3T3PB 4LGPB 1ZDSA 4ONFL 4JPVH 4O51B 5HYJB 1A6TA 4R0LB 5DK3A 2P9RA 4RNRA 1XZWA 4GW4B 4Q9BA 4Y2LA 3QXTA 3VWJC 4LU5L 4HMDA 3NJMA 1MCJA 1EFQA 2MKWA 5KS9A 3MROA 4P57A 1PYWA 5I6MA 4ZTPH 3MMEB 2LFEA 2XQYG 2YEZB 3HOGA 5IFAH 3V7AG 1WF5A 3SDCD 3IKCA 2FATH 2Y69B 4WW1A 3DXAE 1QR4A 2R56L 4HPOL 3T1FA 4BZ2A 4S0HA 3CFKB 1TG8A 2C7UA 2GHZA 1HJBC 3CZGA 2NY1B 1V3JA 1YEEL 1U9KA 2VJ8A 3D9AL 5EZLB 4AV0A 2G5RA 2VZ3A 3DJTA 3LB6D 4X5WB 1LMKA 3QWQB 4L3CA 3N3EA 3L3DB 4O4YL 5IHUL 1GPOL 4NC0B 3L8QA 4GXUN 1PY4A 4G71B 4FQIL 4BFIB 2VNCA 1JIBA 4J6RH 2HT4D 1FHGA 4UI2A 3RY6C 2NW3A 2W88A 3TIEB 3JT2A 5E9DD 3PJSA 3QWRA 4PS3A 1KMGA 1BQHG 1VCAA 3IDUA 4WUUB 3U25A 4Z95L 3NDYE 4JHAL 1ASQA 4O51A 4R0LA 1NEZA 2BHUA 3U7AA 1MCEA 1V7ML 3LIZH 3EFDL 1NBCA 1DQJA 5I1GH 5PCYA 4L0ZA 1O9ZA 2BXZA 1RK0B 3KL5A 3FQWA 1Y7VA 1XB3A 1OGTB 3MMEA 3DO3A 3LEYL 2YEZA 4LF3B 3FMGH 2AABH 1UGKA 2EJ1A 1I3GH 3FUFA 5I6KA 3F7RA 3O2WL 2XWCA 4BH8A 2X10A 4APXA 2BNRD 5C0GB 2IAMC 1B2WH 3CFKA 3ZKMC 2MSPA 3ZSSA 5AVUB 3PWNB 5C9JA 1FVDB 1VPOL 2YD5A 1XGRA 3R1GL 2HX7A 3WTYA 3L3DA 4ZNCD 5I1LA 5F3BB 1TU2B 4D9RD 7PAZA 3S37L 2HJFA 3CE1A 5I1AA 3VXPB 2AXHA 1K6QL 2DEXX 5KVDE 1HL8A 2I24N 3NESA 3TIEA 4XN8A 3EF4A 1Z9PA 4RISH 3ARSA 1JWSB 4WUUA 2Q2EB 3RDTC 2ZYSA 3CSYA 9PCYA 1OK0A 1EQWA 5M95B 2X87A 2OI9C 3Q1EA 3L45A 4EN3C 1U93A 3RWDB 3QNFA 3EYUH 3B37A 1O5PA 1TR7A 1OGTA 2XN0A 4YFLF 5DJ2A 1SF3A 4LF3A 3G3LA 1T0PB 2CAKA 5IHZA 3LKSB 5JPMC 4F8QA 4G5AA 3VG9B 3RB5A 4PCTA 1IM3D 1U58B 5C92A 3KCWA 2WSDA 3EZJB 1OAJA 5B1KA 4NQED 3PWNA 2RMNA 3LXUX 3PREA 4PJ8B 1QACA 4K9EL 5C0EB 2Y1YA 4YK4C 4HVBA 1TU2A 1UASA 2XN1A 3ASNB 4UT7L 2BP0B 4Q89A 2CWRA 3CK0L 2ZF9A 1FNHA 5FWQA 4NN6B 1DVFC 1NANH 3NG5A 3ZYOA 2ENYA 1ETJA 5GGRY 3KCPB 3MGTA 2NMSA 2P42B 1BG9A 1JWSA 2RFXB 1LO5A 3V5DB 4W70A 1IFGA 3RX9A 4IU2A 3KJ4B 1FSKC 1FFRA 5K93A 1TUPA 2Q5BA 4Q6IC 2XT1B 5AG8A 3RWDA 3L3IB 4JY5H 1X6NA 5CD5C 3JWOC 3DMMB 5HDWA 4AMXA 2VIRB 1MWAB 1NMCB 2BVOB 1R4XA 3D30A 4JRXE 1RUAL 4GEJA 3LKSA 5CEYB 4UZUA 3N04A 3SCMC 4RRPG 1ZE3H 3X1EA 1RSFA 4P9HC 3BZFB 1ZLDA 1U0QA 4OLVH 1U58A 5IBTH 5L4IA 1X5MA 2GEEA 3BZEB 3IGUA 3R8BB 2A6IA 5K9KB 4L5FL 1KGJA 1MFEH 2VZUA 1CLOH 5ISZB 3QIBA 5IQLA 3DGGB 3WO3B 2G0KA 5F93C 2KL6A 1Q9WB 3WJLA 2E4TA 1CFQB 4QRUA 2NRDA 4YBHA 3MRJA 3H2QA 3CN1A 5F6IC 1HILB 2KZBA 4O02B 5DUBB 1S7RA 2K8MA 2NXZB 5CINH 3GMNB 3AWGA 4E9SA 2K6ZA 1DEEB 2ZKWA 4K3JH 1CDJA 4LEXH 2RFXA 2XYBA 5HD8D 1TQVA 4YUEH 1XWVA 3N44B 1E0OB 1M3JA 2WBJD 3NUKA 2WKOA 4XZ4A 4YSRA 1DVSA 3L3IA 4YHKH 2QTVA 2X4RA 2F0CA 1Z6JT 2QDVA 2VIRA 5LGHH 1ZGLM 1MWAA 3O6FB 2BVOA 1QSZA 3S9DB 4N2CA 3V0WL 1A47A 3MV7E 1I3UA 4N3UA 2HT3D 4NNPL 4LGRB 5CEYA 3ECQA 4UMGA 3RFZB 1QBAA 1CL7I 3WE6B 3BZFA 3BD5A 1RUPL 4OQ1A 3VI4E 3WXVH 4W9FC 3ZQWA 3P3YA 3DTUB 3IRCA 2WLLB 2G3MA 4XNBA 2AEWA 5F89B 4G6ML 3ZLQC 5ISZA 1MDTA 2D7NA 1SBSH 3DGGA 3FTXA 5F7NC 4JHBA 1Q9WA 4MLIA 4OLUL 3TYFA 1CFQA 3D39D 3ZE2B 3NTCH 3B8YA 2UX7A 1TZOA 1HILA 4O02A 1RIHH 4P23D 4NZRL 4PJCA 1FI8C 5IESH 4UF7C 4YH6A 4WWOA 5DZJA 4ZX3A 2DQHH 1TTGA 4D0CB 4GG6B 5I6PA 2QV2A 4YAQB 1Z0MA 2APBA 3NCWA 4NN7C 4EIBA 3K71A 1MNUH 1UD6A 1FFNB 5AWNH 3O6LL 1P5UB 4A6YB 4Q58C 1JF6A 3RQ3A 2YPLB 5CSZA 5EN3A 4FMVA 3VNYA 1BEXA 4G5ZH 4XPGH 5IKCA 3O6FA 2WPGA 2NW2A 2HLAB 1GJUA 1A7QL 3P2TA 5K9JH 5D1QE 3F12B 3UYPB 1LMIA 4ODUB 3SE4C 4ABQA 4OB5L 3WE6A 2X0WA 1V3MA 3BQUD 4PLJC 4ZUUB 4WDIB 1DO6A 1IC4H 3OQRA 5JXEC 2EVIA 4YBQC 2WLLA 3RVXC 3DURB 2AGJH 2J8UB 4JKPL 4EI5B 4NQSB 4XHJC 4JX0A 2B08A 1OSEA 4LSSH 2W65A 4HT1L 4XO5A 2OV0A 1CVSC 3OKLB 4RMSA 1PG7W 1JZ6A 2WLKA 2ZWNA 1XH2A 2FLRT 3GRWH 1UXLA 2NR6C 4FMFA 4BK5C 4C56B 4D0CA 4PJDB 4PRBB 1MEXL 3LZLA 2CCWA 1FFNA 1P5UA 3QA3A 4WW2F 1O6TA 1RZPA 4RFEA 1J0JA 3ECVA 2C9AA 4MA8H 2HFGH 3BYYA 3DX4A 3BDBA 4O58H 4EUPB 2D0HA 2CKBH 3KWXA 8CGTA 2HLAA 1WQVT 1W0YT 2F61A 2X40A 2UY7A 3UYPA 2F53D 3ZHDA 2Y7SA 3BWUC 4ODUA 5KG9B 2OBGA 2B1OA 1BF8A 1E30A 3GSNL 2GW5A 4FADA 4CAGA 3TT1L 4ZUUA 1RK7A 3QNXB 1D5MA 5ESVA 1S7SA 3AG3B 4IYKA 3KD4A 5AAWA 4U1NB 2W0KA 2FEDD 4MAYB 4M4PA 4NQSA 3VB9A 2I85A 5IT2L 1A3QA 3H54A 4PY8J 1CQKA 2ZAHA 2O72A 3DVNB 4CILA 3PF2A 3GS4A 1F5WA 2OULB 1DLFL 5K5YA 1QI3A 1X5LA 2BRRL 3WEMA 2ZUTA 4B9JA 1T6VN 4E68A 4A7QA 1A7RH 3D34A 3QUXA 3S7GA 1B6DA 1NMAH 1QW8A 1U8JA 2HRLA 4PJDA 1A1OA 3VUAA 4DN4H 4JGJA 4PRBA 4KKLD 2EDKA 1BWWA 4JKNA 5HJ3B 2CK0L 3Q8FA 4U49A 2UXFA 3I75B 1NBQA 4OIBA 4X9YA 2OJEB 4UTBA 2Z91A 4AW7A 3CX2A 1QSEE 2Z31B 2H0PA 1AIZA 3NACL 5K1VA 1LO2H 4G6JH 2C9VA 3S0PA 3P54A 1WAAA 3E1F1 5FGBA 5FO8B 5JW3L 2APVA 3APNA 2D73A 4GEIA 1ZANH 5KG9A 3WTTA 3HC0A 1UJTA 4EKJA 5DQDH 2WQUA 5C0CA 1UOLA 3FBKA 1U8OB 4MNGE 1ITCA 3QNXA 1UENA 1MFDL 3B2UD 1RP8A 1BQRA 4HOMA 2DYRB 3APMA 3KWVA 1KN4H 2AP2A 4MAYA 5GGSY 1KEGH 1I7TB 2H9GB 3OGCA 1LP9B 1WGOA 5DHVB 3DVNA 2P5PA 1QBLL 1XCQA 1F8TH 1HZHL 1A9EA 3QO0A 4XP4L 1MCQA 4KTDH 4G7RB 2B9BA 3GBLA 4EBQH 3F7VA 1HHJB 1KIQB 3UTTB 3WFBL 4JHUA 1TLMA 3MKGA 1MRFL 1L5GB 4J2QA 2FBOJ 3VI4F 3B2VH 3GSUB 4Y9CA 3QUML 2ZUWA 4ONFH 4Z7OF 1BZDA 1IAII 5DRNB 5JOPE 3LAFA 3Q5YA 3UYOD 5BW7A 5HJ3A 3CV5A 1HE7A 3AAZB 3B56A 3MJWA 2HKHH 5DWPA 2OJEA 4KJWD 3BJ91 3PXJA 4OZIB 2ZX8A 2Z31A 1PSKH 5IF0B 3I9PA 3QI9D 5FO8A 3D3VB 2EVHA 1OT1A 5KANG 3D4CA 3QJOA 4WI3A 4OGYL 3ETTA 4ZMXA 3MLTB 1KB9J 2IH1B 3WS3B 3D1MC 2R56H 4HPOH 1YQVH 1IKOP 1QZ1A 3OSKA 2L3BA 5EIIG 2EE6A 1U8OA 2OP4L 3ZVVA 1YEEH 4UIMB 3D9AH 4Y0GA 2OSLB 5TDPB 2D3VA 1VIWA 3DETC 3NH7L 1I7TA 3BGFC 4QWWC 1XB6A 2XG5A 2J5LC 1GPOH 3MXWL 3N9GL 1S8DB 5DHVA 2WO3B 3C2AL 3N1MC 1WBYB 1ETB1 3GIVB 4UTAA 1QRNE 1Q9OB 3UTTA 1HHJA 1KIQA 5EPMB 3UCQA 1ROWA 1L5GA 2VDMH 1VSCA 1ZWIB 3GSUA 4MMXC 2OMTA 4Z95H 5E9AA 1C1EH 4JHAH 4K2UL 5DRNA 1E4HA 3W9EB 1J18A 5AYTA 1V7MH 1DSWA 3E38A 4LKXA 3EFDH 3V95A 3EZ8A 3BUPA 1RUKL 3MRMB 2JQZA 1WHPA 1WZ1L 2X3BA 1LO3L 3ARBC 3NPZB 4HIHA 4PP1C 1JVOA 4K3DL 5D1ZC 1PX8A 2QHLA 1V5JA 1MCWW 2JELL 2NY4D 2J1ZA 2VABB 4OGQC 5B4MC 4OZIA 3AT9A 1EV2E 1AD0B 3VWKD 3LEYH 4GW1B 5F9OL 4PRPD 5DZOA 1JV2B 3MLTA 3KVQA 4QHUB 3S4SG 4JN1H 3BGMA 3VQMA 1JWMB 2BY3A 4XB3A 3O2WH 2CD0A 2GY5A 3AQZA 3V8OA 1H6UA 2EUWA 2AK4A 4LHUA 4NHCL 3TASA 5DC0A 4TM9A 4PJBE 3UTSE 5CJOL 1U92A 1VPOH 2OSLA 1T83A 1B0GB 1T22B 3R1GH 5TDPA 1QVOB 4GPVA 4AE0A 4JAMA 3PXHA 1S8DA 1UXWB 4B60A 3S37H 5E2VL 2EILB 3HFFA 4AEFA 3HMXL 1A3ZA 4LLQB 4PEEA 1Q9OA 5I82A 5EPMA 1RZJL 3UPCA 2MPVA 4LVHC 1ZWIA 1PQZB 3ARDB 3BEVB 3W9EA 2W38A 4QRTB 3AJ7A 2WUCL 3AZUA 2XV0A 2VABA 2R2EB 3ZHLA 3UAJA 2P28B 4L8BA 2DPKA 4XE0A 3RA7H 1CDYA 3BVDB 1JV2A 2H1PL 4O00A 1I8AA 3NEOA 1TJIL 2XWRA 3D85D 3KMDA 2YD8A 2F1BA 5DZPA 1D6VH 1NQBA 3EFOB 1RIUL 2PW2A 2NNXA 5D1XC 3CHSA 3WENA 1IB5A 5H37A 3QIWA 1B0GA 1T22A 2CNZA 2KQMA 3UL4A 3U4KA 4KJQC 1QVOA 5BS0B 1UXWA 3IJSA 5CJXA 3SBQA 4NZTL 2F18A 4UT7H 1BHGA 4ZQKB 3UZQA 4AMKL 3V4LA 3GMRB 3V4VB 3VFMA 3I9IA 4ACTA 1NIDA 4U4IA 4HIPA 5EZPA 4B5ZA 5DVPA 2GFBB 4WO4C 1B4LA 1CFTB 1DBJL 2ZXQA 4JFYA 5J56B 2QTEA 2YD3A 3BEVA 1YEKH 4QRTA 4BZ2L 5T5NF 3EIFA 4G3YL 2YA2A 3CH8A 4MS8D 3IB4A 3I6SA 4KO9A 2DI8A 1DN0A 1SXCA 1CDBA 1H15A 2R2EA 4M5ZL 4X8CA 2VZTA 3NK3A 4X5RA 1EFXA 5D7EA 3CFMA 4JJOA 1RUAH 1IIIA 4CSZA 5EF3A 2VDPL 3ALWA 5EU4B 3EFOA 4FLSA 3KYAA 4NWUH 3QUZD 4KX9A 4L5FH 5B1JA 2DI9A 4R5TA 3PDGA 5DC9B 5SWSA 3HS0A 4NCC2 5BS0A 2XETA 3WFHB 4P4KD 4CKVX 1AJ7L 3QJVB 4J3OF 4NQXB 4ZOAA 1RD6A 1F3DH 2EZ0D 5DJ0B 1A4JB 4ZQKA 4E9LA 1CZ8L 4OH2A 3GMRA 1DDTA 3V4VA 3IJYB 4F80A 5E5MB 4P2QA 3QCTL 1SLWA 3EJTA 5HJBA 4NQCD 5DFVC 3HB3C 5HHNB 4Y19A 3QDGB 2V7HA 1P7HL 4FNSA 5GJSL 2WCSA 4TLTA 1S4IA 4WTZA 1ACYL 5D71L 3IBEA 2CDFA 2HT2C 3AQXA 3QVAA 3KHOA 1YDPB 3AREB 4NQDD 4W68A 2VLRD 4K71B 4P3DB 5B38B 5AW3B 1F02I 1OF2A 4X7TB 1EUUA 4NNXB 3V0WH 2E9BA 5CMAB 4U1LB 4XMWA 2Y6TE 1VEMA 4LKCB 4ODHL 4GUPA 3SY6A 4FD0A 2A6JA 5EU4A 3HZKB 1PFOA 2MCMA 4MB5A 2NTFB 3GD1C 4G6MH 1EZVX 4EI6B 3FF8A 1QI4A 5GJTL 3QQ3B 1NUFA 2G9KA 4YBLC 4F57L 2ARJB 4OLUH 4OGAC 3CIAA 3WFHA 2H2SC 3IM1A 3NFPA 1U8HB 1M7DB 1JPSL 2FHFA 4NZRH 1MVYA 2YBGA 3IJYA 4JRLA 1G1OA 5D7SH 1HHKB 2NY2C 4L1BA 2XA8L 1I1AB 3HHRB 4PJBF 1UXSA 3QYMA 5HHNA 3KBEA 3QDGA 2YOCA 1CE6B 1YAIA 1AGBA 3OZLA 2VLJE 4BE5A 4JKWA 3VE0B 3FO1A 3U0TB 5IUCA 5ID0A 1YDPA 4A7SA 1AFVL 3FOLA 1OD9A 2V33A 3BMWA 4PY7B 4CDHA 3TEWA 3TV8A 4APQD 4X7TA 2FBRA 4FHJA 1YY9C 4NNXA 1A7QH 1Z5YD 4U1LA 4LKCA 5B39B 1YCSA 2BSTB 4BSJA 1NGPL 4EXPX 2BNUA 3TGXA 5BMFH 2IOMA 1WZMA 2CM5A 3ILEA 4IQHA 2JJVA 5F7HA 4ES9A 2NTFA 4PMFA 3AS0A 1IM9B 4JKPH 3VD4A 4GUOA 4EI6A 3SY0A 3SYQA 5CIPH 4GKLA 3PABB 2AAAA 3LNEA 3UH8A 1ULVA 3ULVL 1EVUA 1IRAY 3BSGA 2QR0B 3TS8A 1W8EA 1FNFA 1HHKA 1N12A 2AQ2A 4HU8A 2BP8A 3IVKA 5DQ9B 1MEXH 4ZXBC 2WIMA 1CE6A 1MFAL 3W82A 3GB7B 1N4XL 3VE0A 5K69A 3U0TA 3K1DA 1IAIM 3O0RH 1CGUA 2NYYD 5JW4Q 4PJHE 1TLKA 3KPSE 1S7VB 1MCPL 3WO4B 1AHMA 3CHQA 3PAZA 2H1XA 1JGVL 5AZEL 3Q8AA 4L23A 5DS8B 3FQ2A 4BE6A 4JM0A 5I73B 4G9DB 3CPUA 3QWRD 2IDCA 4KFZC 4JQVC 3TT1H 2XG4A 3HZVB 1RJZB 4R4ND 3IU4H 4F2MB 5HYJD 5IJVB 2VERN 4YWGL 3HZMB 4I0KA 2A9NL 5IT2H 1S3KH 3PABA 4PBXA 3BX7C 2XBDA 3V6ZB 4KH2A 4BKLB 5I17A 5I0WA 1HK6A 2PP9A 1DLFH 4LPWA 7PCYA 1KCRL 2BRRH 1G0XA 2QFRA 2VMDA 4WW2B 1MWAL 4MA1C 1TQTA 2OM5A 4K94C 3BPNB 5FW6A 1SJXA 2XV2A 3FOMB 5DQ9A 5AAMA 4FXTA 2NY1D 3E80A 4HUKB 4B9IA 2ZXEB 4XR8C 2XLLA 3VSTA 2CK0H 2BS71 4NCC1 1TJHL 4JGMA 3BVTA 1BIHA 2LVCA 2EIBA 3QFDA 4R7VA 4G82A 5JW3H 1S7VA 3DYOA 2Y7QB 1A0QH 5INCB 3B2XA 1O9WA 2VXTL 3OG4B 2QKIA 4O02L 5DS8A 2F58H 2MRYA 1KXQE 1LK2A 4YSAA 4G9DA 1A65A 2WNXA 3ZUNC 4HJJL 4MMZC 4WUUD 4KI5D 4F2MA 5IJVA 1MFDH 1AXTH 2VW4A 1FYTA 4I5BB 2NY3C 4A37A 3NOIA 3PHSA 2FWOA 4LLVB 1VLXA 1DDHA 3HZMA 2JQMA 2QSVA 4PJFE 2EVFA 4FHKA 4JUSA 5KZCB 3V6ZA 1QBLH 5IHWA 1CWVA 2P44B 2HUHA 1HZHH 4WI5A 4XP4H 2OCCB 2ALAA 1Z9OA 2AXJA 2DWXA 3MODH 4LAJH 3CAFA 4K23L 4GBXB 3EOBB 4ODWA 4IOFD 3QUMH 3D09A 3ESMA 1IAOB 1SXZA 2CO7B 4QHMB 2ZP8A 4W9EC 3SJVB 4BZ1A 5F1SA 3NIFE 4LAQL 1OQOA 2VYRE 2JLLA 1TQWA 1A9BB 2J1XA 1X4YA 4L3EE 2DQEH 4HIJB 3IDXH 4LO9A 3IS1X 1H3TA 1OVZA 4AGOA 2CPUA 3GZQA 1HL9A 4JFEE 2GI7A 1JPTL 3NSJA 5INCA 5K1JA 4Z5RB 5J3HD 5HPMB 2OR7A 4POZD 3CLEL 3KGRA 2JKJA 3UPRB 4ENZA 3FT3A 2AMGA 2IV9A 5BV7L 1QPXA 4N2MA 4ZW6A 2OP4H 4ZUVB 4YLCA 4HGKC 3ZKSD 3LKRB 43CAA 1MCSA 1SXAA 4UM8A 3VMPA 3VI4B 3BRFA 4BGLA 3G5VB 3NH7H 1DANU 3ULVD 1M9WA 3N9GH 4Z7OB 5HI3C 5AQ0A 3C2AH 4M1GH 2L0DA 1BM3L 1TZAA 4XNMB 4FXGA 1CDGA 4TL4A 4WHDA 5D7HA 3ZMNA 2KDYA 4GBXA 5AB1A 3CU1A 4LPVA 4KQ0A 5K33A 4K2UH 32C2B 3PPSA 5D6DA 5FF6B 3JV6B 1ZCRA 5FKPA 2NOYA 4XP6L 1WZ1H 4PJ8D 1LO3H 2C7FA 1BQSA 1T1WB 3QAZB 1X9UA 3OXRB 4K3DH 2C26A 4R97C 3ZOAA 2JELH 3WMSA 4ECNA 3DK0A 3NSFA 4PRIB 4M00A 4XPHL 2G5UA 1AR1B 2DOCA 3OB8A 2VN7A 4Z5RA 3VXSB 5HPMA 2KMWA 3DKHA 1QNIA 2EH7H 3L5WA 3B4NA 2ITCA 4YHYB 2A6DB 3ZHNA 1X7SA 5D1QB 1FGNL 4P2CG 5T5FH 4P5SA 1XBRA 5G4NA 1SRDA 2WXLA 1OCRB 4LLAA 5CJOH 5FDWB 1KULA 2MQGA 3R7QA 1AO7B 1SFHA 1KCWA 4PJHF 3ZTNL 1CDHA 4MGXA 4UTBL 2XKSA 2GJPA 5E2VH 2MNJB 4F9PC 3HMXH 4H8WH 4LL1A 1QWNA 4D7PA 3FU8A 1RZJH 2VQ1B 4PG2A 1IEAB 5DEFB 4AL8L 1A6ZB 1ZS8A 1AGDA 1QMUA 1NDMB 2Z4TA 3MA7B 2CU9A 32C2A 5INDB 2AXFB 3JV6A 3P1VA 1WBZA 4MVBC 3FC8A 4AM0Q 5ISZD 5D70L 1T1WA 4F7CB 1XDTT 2KH2B 2L7JA 3MUZ1 5C08E 4A2LA 2P45B 4PRIA 4WJG3 5KVEE 2XWJA 4MB4A 2XI9A 2NX5A 1XH1A 3JXAA 2H1PH 3VXSA 4PRDB 4GIPD 1T04B 2MCG1 5F7EL 5D2NE 2Z7YA 3N91A 4WI8A 2M2DA 3VFSB 1RIUH 3CX5J 2HVJB 4KMTH 2P5WB 4G9FB 4XOCA 1R24A 3F00A 4HWNA 4X9HA 1HL5A 3WGVB 1CG9A 4E9TA 5FDWA 4PP2B 2F7PA 2E47A 1AO7A 3WD5L 2WXMA 2IDQA 4ZPVB 3B7SA 4Z7WF 1TTBA 5DRXA 4NZTH 2ZOWA 3O6FD 5DS2A 1BFSA 2OCFD 4Y2DB 4MJIA 2VQ1A 3Q5TA 3QXWA 1IEAA 1JZIA 3KNBB 4HSCX 4J8RB 3X14B 3KZ8A 3D6GA 4N9OB 1DBJH 2TRYA 1JYWA 3QWOB 1CGSL 4PJ7E 4D94A 4HZAA 2DMBA 4DP7X 2FR4A 3L4UA 3BUYB 2AXFA 5INDA 4BZ2H 4PJFF 3HTLX 5MI0B 4JM2C 3KE0A 4LARL 4JLRA 4P06A 1T3FA 1XL6A 5G5DB 1MAJA 3SKOB 1MI5A 4XVSH 1GSMA 1K8DB 1E3XA 4M5ZH 5SX5H 2N7BA 5TE4L 1UURA 4DFIA 1HI6A 4FFTA 1WYJA 4NERA 3NCBB 5DK2A 1QR1B 1IBGH 4PRDA 4JO1L 1T04A 4UTAL 1T1YB 5HVHB 3HNTL 4K5PA 3SPJA 3NIFF 2JJSC 3K6SB 3VFSA 2XY2A 2XFXB 2P5WA 1B0RB 1SLVA 4W9HC 5DJDB 3KPPA 4G9FA 4B6ZA 5HYFA 1BP3B 5IB1B 1I9RL 1DVUA 4Y5YB 5B38G 1WWBX 1PF3A 4DO6A 2NQCA 1A7PL 5FM5M 1PZCA 3LY6A 3RI5K 3MREA 3KLQA 3L95B 4ZPVA 1EVTC 1AJ7H 2KKQA 4XH2B 1H5BB 1SJVA 1G9EA 4ODBD 4Y5VC 4X9GA 1CZ8H 1CTMA 4OCXL 4Y2DA 3V5KB 1XGYL 5AVYB 2OJZH 1NPJA 4CN6A 3RVTD 1NIEA 3FHQA 3QCTH 4J8RA 3X14A 2WHVA 3L4ZA 25C8H 3SO5A 3QWOA 5CUSL 4F20A 1J8RA 3GM8A 3BUYA 4YDNA 2HRPH 4L4TA 5GJSH 1UXMA 2XXFA 3M07A 1ACYH 4P99A 2XWZA 1AP2A 2JXMB 5DZVA 3SKOA 4ELKB 1H3PL 2R0KL 4ELMA 4ETYA 1UACL 4QNPE 3MRNA 4FQHB 5ADOL 2VMFA 3AFLA 2XJLA 1K8DA 5SX4I 3O3EB 2CRMA 1DSFL 3B5GA 1BQKA 1SNRA 3C6SB 2FWUA 4TVUA 1NKOA 2MQ3A 5C7ZA 1WJ3A 2DQFA 1F6FB 4ODHH 4NPYB 3VA2C 1TYEB 3S3BB 1LE5A 3DBXB 4WWPA 4GMTL 1G0YR 5DJDA 3OKNB 3BRDA 4GO9A 3HAEB 4A04A 2I69A 1Q4NX 3RP1A 5IB1A 4Y5YA 2P8MB 3H8NA 2KHAA 4QRQA 2CUIA 4LCWA 4W4OC 4XH2A 3TVMB 4DEPB 1H5BA 2A9MH 4FQCL 4L3FA 3WEXB 1KB5B 3V5KA 2WJ5A 4LOUC 1ZE3C 1J48A 2ZX6A 1T5XA 1KFAL 4HWEH 4N2HA 2WWMD 2XA8H 5C0CD 2WB7A 3CHPA 4MYPA 5IROA 4PB9H 3LPWA 5HGDA 2E7LA 3BAEL 4LLDB 1HYSD 3MCKB 4MAYD 2JXMA 3NJFA 1AFVH 3QR0A 4HKJA 4CMMB 1MCLA 1OP4A 2GHWB 3KM2A 2P48B 3MRFA 2I25N 4PGDB 5DJYB 2EQDA 3EO1B 1CXKA 4JFSA 4RH4A 3C6SA 2A74A 2P80A 3QEGH 4N8VG 2A38A 2DWSA 3VX1A 5GZNC 1NGPH 2CO6A 4XXWA 1EAOA 3DBXA 4FJ6A 3JYCA 1OF0A 4OJEH 4OD1L 3REWA 1O7DE 3JTBA 3V5HA 2XIBA 4A2DA 3CZNA 3HAEA 4KKZA 4B9KC 4EJ1C 1AS8A 2E74C 5AW7B 3MLWL 2LAAA 1EBAA 4XMVA 2AJVL 1BXAA 3WFDL 1F1DA 4RAVB 3UTSB 5IMLB 3ULVH 2Z31D 3MJ9A 4WKZA 1S9WB 4XBEL 1CIDA 1TT6A 1PU0A 5EC1B 4RIRB 3WEXA 1KB5A 4U1GB 4ZX6A 5I5JA 4LFHG 3QDJE 1UB5A 1EH9A 3BRGC 1T1ZB 1NM4A 3LHPL 1ZLUK 3FU6A 4G8GA 1Z9LA 3X1NA 5CU9A 1T21A 2OZ4A 2QQQA 2J21A 4DVRH 3DTDA 4HIEB 3LS5L 3MCKA 3MLZL 4CJ0A 4AJVA 4EXKA 1F18A 2EIKB 3QJTB 4TTDD 3H4HA 2Y7MA 3TBTA 3VXOB 4H4NA 4X4XB 3VWJA 4BK8A 3AS1A 4PGDA 4LSRL 5DJYA 3ZY7A 1FZKA 3DUSA 4ZW3A 3MRRB 3RWFA 1I4FB 5IGXL 3IMTA 3UTTD 1H3GA 4N87A 1JGVH 4YIQB 5AZEH 1KCVL 2AHIA 1DQDL 3V4VL 1BAFL 2FEEL 4QMEA 4HC1A 3RIKA 1QLEB 4PJ7F 4DKDC 2FGZA 4HJTA 4NRZB 1RL1A 1X5XA 1HE8A 1KTCA 2XWXA 4YWGH 2A9NH 4LNVA 1TVBB 3QZOA 1AKPA 3V0IA 3PV7A 4RAVA 5IMLA 5FYKL 1S9WA 5I1IH 1N10A 3GBNH 5EC1A 4RIRA 1WE5A 2X38A 5GS0L 1CXEA 1MWAH 4WHYH 5T3ZE 2W8CA 3QCUL 5C0BE 1T1ZA 3I85A 3ISRA 4GNKB 1MPAL 4KUZL 2EEXA 2WXKA 1P69B 1EK3A 1M05A 3QT2A 3RY6A 4LP8A 2WGNB 3CU7A 2P4AB 4B7IA 3FQTB 5ES4B 2EKSB 3G5XB 1AQKL 3S3PA 3TNNB 4ONHA 5IEHB 1IQWL 1TJHH 2PO6C 2ZCLL 2OI9B 1G9MC 1AACA 1T20B 4LEOB 4EN3B 5F9AC 1YNLL 1QFWL 1QRKA 4UUJB 1XBDA 1I4FA 3L3GB 2ZKMX 1KTKE 4YIQA 3BKML 4O02H 1WT5C 1HEJC 3MLYL 5D5MA 5FGCB 2VO5A 3BN9D 4WFHE 4HJJH 2VLLA 2Y1ZA 2X4SB 5JPMB 4NRZA 3QORC 3HVNA 4U3SB 4UQ3B 5I1EL 4OTXL 2WSKA 3CSBA 1VZIA 2IAMA 4QNPF 1YPZA 2EECA 4OW6A 3TO2A 5BRZE 1RIVL 2IV8A 1BWMA 5I6LA 3UAJD 3EO9L 2PCPB 1BBJB 2ZUQB 3GPEA 5FHBL 4YK4B 5I6NA 5F96L 1K72A 1KIPA 4AZ8B 3RGVB 5DMYA 1T6WA 2C3VA 4HJ0C 5ANMB 4YHML 1OARL 1DVFB 4LAQH 1Y1UA 2E46A 5PAZA 3FQTA 2EKSA 4MKMA 5CLZA 5CN1A 4D8PB 3TNNA 2WO4A 3RDTA 1F2QA 3QIWD 3MRLB 5FYLH 4FF9A 5FYJE 4JRYE 4DGWC 1NC4B 2AQRA 4LEOA 4EN3A 1DQQA 4DK5A 1V10A 3BEWB 4MQXD 1OANA 2FQEA 2GY7B 3FRUB 3LXBA 4UUJA 3L3GA 2DYPA 1A3LL 4ALAC 3CFCL 3PU7A 3T71A 1IBBA 3BIKB 4BEIA 3ARDD 1FZMB 4FG4A 5BV7H 5D2LE 2Z7UA 5JPMA 3B2DC 3SCMB 4GG8A 2QVKA 2Y5EA 4U3SA 4HKZA 1NCDL 2QDWA 5E9NA 5HDQL 5IY5B 1CS6A 2C1OA 4DK6A 4YHOH 4CSTA 4WGWB 4A6YH 5IMMB 2C9QA 2PCPA 1E9PA 1EFXD 1BM3H 2GC4C 4BQCA 3G5ZA 1A3RH 1R9FA 4AZ8A 2YRBA 5ALCL 5ANMA 1YY8A 5IZ7A 2HRHA 4DP2X 1DVFA 5F7KC 4YZWA 3ZYZA 5CKAA 1OSPL 3QUGA 3RU8H 2X6UA 5SWSD 4XP6H 4D8PA 1MZYA 1PIGA 3FO9A 4FCHA 4HV8A 3MFFB 3PAVA 4KK8D 3MRLA 4H20H 5BS0D 5I2IB 2VLJB 4MMYB 2W0FB 4Q6IA