1DBML

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL01
3JWOH 2YPLB 4TSBH 4IMKC 5CD3A 1GL4B 1NUDA 2AP2A 3ZDXE 1EX0A 5E2WH 5GGVY 3STLB 1F00I 4NCC1 3UAJD 1RHHA 4LCCC 3MJ8B 3VG0L 5IP4A 4NQXA 1FNLA 5EZLA 5L9DL 5E1AB 3OKMB 3S88L 2NX5A 1J1PL 4PJ8D 3TN0B 4EJ1C 1NMBL 1S7UA 3TN0C 4DEPC 4WU5A 3AY4C 3ARQA 3H9ZA 4WI2A 5EPMB 2Q6WB 3KYKL 1EUTA 4LOUC 4BQBA 4WFGE 5L2JA 2OK0L 4M7ZB 3MLUL 1UC6A 2P5EA 4NJAH 1IFHL 1XF5A 5FKPA 3K8LA 5CJQH 5I1AB 1WEJL 4PFEA 3V6FB 3DVGB 3KPPB 1L7TH 3AS1A 4NQDD 2V6HA 3T2PA 3VXSE 4XCYB 1WJ3A 1XAUA 4F9LA 4PRBB 4TUJB 4ZO9A 4RWYL 1A6ZA 1K8DB 4GW5A 5EO0A 3MREA 4TYUA 4NHCH 3EYVB 2VISB 1FDLL 3ZKMC 3BZEA 3KYMA 2J88H 4L4JA 4ZUWA 4CN6A 4QRPA 4NDMA 1KC5L 4JY5L 4P9HL 4JPWL 3RIAK 1ZKAA 4Q9QL 5M94B 2CQVA 1JN6A 4OZFB 2GUOA 1NC2A 5SWZA 4N0UA 3BD5A 1INEL 4U1NA 1GGCL 4GAGL 5IHBA 2ICCA 3I02A 2AJ3A 3MA9L 2L0DA 2ESVD 3O3DA 1KTRL 1LD9B 1VA9A 4YDLC 1R24B 2VWEC 4YDLB 3T2NL 1QBML 5DJ6B 3FAWA 4TSAL 4Q74A 1HINH 5E1HB 4PGDB 3OKEB 2KBGA 3GIVB 3WXVH 4Z77A 4NFDA 4ZUUA 3ULUC 3VGAC 5DRWA 2Y4SA 5KW9L 1WBZB 4Z7OF 3OJDA 5TPWL 4KDVA 1AGFA 5I76B 1RJLA 5AAWA 4B50A 3KWWA 5ISZE 1EBAA 4OGXL 3FQWB 3HUJF 1WFOA 3WFEL 4XAKE 3QWOB 4PTTB 4OZIF 1H8OA 1TITA 3ORJA 3NBNA 4HS6B 2C3GA 2R9HD 5C0FB 1BM3H 4PJXB 5DC4B 3RVWD 4ZS7L 1MI5D 2VXQL 4F2MA 5FYLL 4XVTH 4DFIA 1XT5A 3MRQA 4R4NC 2YN5A 2BDNL 1HSBA 4PLJC 3S3JA 4EI5A 3FT2A 4P2OD 3FONA 3C5ZA 3OAZH 4S1DD 4P2QE 4U1SA 4UILL 5I1LB 1EBPA 5I15L 1DE4B 4OQ1A 4AQOA 1F2XK 4QRRB 1NCDL 1QFHA 2H8PA 1GGBL 5CS7A 4R3SA 3MV8E 4YHPB 4JFDA 3X12B 1MHEB 4QWWD 3IJSB 2IH1A 5D70H 3MRIB 4S1SL 2NYYC 4TVPE 5D2NB 5D2NC 4B7IA 4Z78B 2F8OA 5GS0L 5KSAD 2ICEA 1EHLL 4GKNB 3VW3H 1JNJA 1K4DA 4P2RA 3RVVD 2PW1B 4FTVB 1N64L 4V1DD 5I18H 5HPMA 1F02I 1OSZB 3VU2A 3EJYC 1Z0MA 4ODUB 3EO9H 4M4RA 4DN3L 4NQVB 4PBVC 1A6PA 2VDNH 2J8UB 4XNQB 3KPMA 5BVJA 1IEBA 2DYPD 3RWEA 5FUOL 3TFKC 5C0BE 1ODAA 2FO4A 2O5YL 4TTGA 4PP2A 4KTDL 1S78D 3MA7B 4L1HA 1OQXA 2DWDB 2JCCE 1UADC 4GQ9H 4Q6IB 3HI1B 2AW2A 3PWPA 1HE7A 1MFEH 3DUHA 4CL7A 4R2GB 4R2GC 1NANI 4L3EE 2RIKA 3W0WB 5KS9A 1EXUB 1M71A 4MJID 5FA4A 1PY4A 4OBSA 3GKZA 3MCLL 2L7UA 2X42A 3MXVL 4NO3A 1DFBL 3FRUB 4UIMB 5B4MC 1KXVC 2BVEA 3L9RA 3X13A 5I30H 5C07E 5HDLA 1AKJD 1OGAA 4MAYC 4XRCA 2Q7NA 2NY7L 3MV9B 4LLQB 4WWID 2C3XA 2EIZB 4R7DB 3RVTD 4NRZB 3ZDXF 1SJXA 1IL1A 5HGDA 1Y18A 4N8VB 2WUBL 2HJLA 3D87B 1TTUA 3PE9A 3HPLB 2QR0B 5TGBA 4N5ED 4DKFH 4QXUH 5DLMH 3WNMA 5F3BB 1TZHB 2HN7B 2NY6B 3P73A 4IRJC 3LV3B 5J06A 2OYPA 2UYLB 2FO1A 4C4KO 4H8WH 4B0MM 1VADA 2EE9A 1DZBA 1B0WA 3QUZD 2IPKA 4Z7WE 3BUYB 2VLJB 2BSTB 4PJBE 1EO8L 2I5YL 2CDGB 1RZKL 2AK4E 3DBXA 3BZFA 5IVXB 5C3TA 2QTEA 4KMTH 1OCWL 2DAVA 4LVNC 4LVNB 4U0RB 4RNRB 4U0RC 3VXUE 2NMSA 3GJEA 5KSUA 1I3GH 3U6RA 4Z95H 2D31B 3OZ9H 1OT1A 5EOCJ 1OP5H 3ZYIA 5B8CB 1A7OH 5B8CC 2PETA 5GRUH 4MXQD 1R3LA 3IS1X 2IMNA 1FORL 4UT6L 4OLWL 5E8OB 3K8MA 5DHVB 1P69B 1FH5H 3HNTH 4KKBD 5CBEA 4XPGL 3FT4B 3GBMH 1KJ3H 1Y6MR 5DURD 5A2FA 1MJUH 4Q6YA 4HIEA 5C0GA 4JY4B 5ALBH 1R5WB 3RJQB 3CXDL 5C2BH 3TNMA 3HZYA 5DVOA 2VQTA 1SYVB 2GK2A 4PRPE 1UWXH 5DC9B 4OCNC 1OLZA 3IDJA 1RZJC 3PWLB 3WO3B 1KXQE 1EHXA 1G9NH 1W72L 3OSKA 1F3DH 1MCWW 3FB6B 5EUKA 3I50H 4QHNA 2R1YB 5EZIH 1X5JA 4PS4L 5C0AE 2X6MA 2MCPL 1T4KA 3GRWL 4JFXA 3LKOB 4OCRL 1TTFA 5LGHH 4EZMA 3TBWA 2PNDA 3GMLB 4KKNA 5CILL 5FDWB 3VI4E 3BKCH 4UT9L 1BFVL 1VFUA 1KCUH 2GJ6D 4X6EA 3MJGX 5TDNB 1ITCA 4O2EB 1T1ZA 3EOBB 5DGRA 5DJ2B 1DQJA 5GHWL 4PB9H 3F7QA 1VEMA 3UTSE 5E9DB 5B3JE 1A2YB 2IJ0C 4IIQC 2IFGA 2BSRA 4G8GD 1FBIH 1YYML 3SDYH 3CZFA 5HYSA 3ZDZE 4J4PD 1FNEA 3LQZA 2R0KH 2FEDC 1P4LB 3LEXA 4X7CC 5DD6B 1TZIA 2JELH 1HI6B 3VFWA 2YOCA 2X4TB 3MLXL 1CDJA 1HHHA 4JZNB 3A6CL 5K9QG 3CGTA 5M95B 4Y4KB 4Y4KC 3VFPA 3PWNA 2IANA 5I0ZA 4LCWD 1KTLA 5GSVB 4HJ0D 3WFDH 3TT3H 5FGBA 1T7WA 2EKSB 2P24B 2QSTA 1DN0A 2XA8L 4MQSB 4AIOA 5C0RH 2XACC 3GJFB 5LXGH 4ZUTA 2FLBT 5L6YL 4YR6A 1UG9A 5F88A 1D7FA 4LCIL 3VRJA 1BD2E 1SMOA 3OGCB 3D2UD 3DSFH 1S5IL 4MJ5A 5DQDL 1EGJH 7CGTA 5FYLE 4G8FB 1P1ZA 3IS0X 1CCZA 1TENA 3D25A 2DQUH 1G6RA 3QPXL 5IEKA 3LN9A 1A1OA 4NBXB 1A14L 1GIGH 1NANH 3DGCR 5T1KB 1WT5C 3WL9A 4LKCA 2WM0A 2IC2A 1AR1C 1A3RL 1J0HA 3MLTA 3C08L 3LDBB 4O2FB 3SKJH 4BZ2L 3RGVD 4K7FB 3G6AB 1T5XB 3QO0A 4DZ8B 3O81A 1INQB 5C70A 1ZGLM 2RBLA 3QEQD 2VR9A 3LN4B 5DEFA 2EH7L 5HYJB 3NACH 1N59A 3MQIA 4OLXL 4MX7B 3BO8A 4IRSC 1QSFA 2DQIH 4OF6A 3VDBA 3RY5A 4PRAA 4Z7WF 3GHEH 3IVKB 1C7SA 3QIWA 4GUPA 4I3GA 1NBZA 4X6FA 5F1NB 4WENB 1QLRA 1L4IA 4WUKL 3SCMB 3SCMC 4ZFGL 4C55A 3ARYA 1IGYA 2Q87A 1P7HL 1YQVH 3PGCB 1DQQB 3JV5A 4UNVA 4N0FB 4Y1AA 2KDGA 5IOPA 3SN6N 1WF5A 5FECB 4KK5D 3AS3A 1I7RB 2KKQA 1G7PB 4QOKD 3SDXE 2H32B 3O45A 4AEIH 3TVMD 1ADQL 2AV1B 4OI9A 3DROA 2A83A 3OAYK 3OX8B 2DBLL 2A9MH 3MACH 2AJZB 3QIBD 1G7LB 2F58L 4KQ3L 3LEYL 1OAQL 3LKRA 1SVCP 1J7VR 3EYUL 2Y9RT 3WNPA 5C08D 1R3KA 4YE4L 1J1XH 1GHFL 4M8QA 5BW7C 4L3AA 2OTPA 3EOYG 3BWUC 2IEPA 3V4VH 4A6YB 1DR9A 5I66B 4OKVA 1EAJA 4U6TA 4L29A 1WSST 1QUNA 2PR4L 1MH5B 2B0SL 1BEYH 4ELME 3IFPB 1C08A 1A4KA 4WJ5A 3MXWH 1IEAA 3T0EA 4MXWH 4NQUA 4QYOB 4YQXH 5KG9A 2BJMH 5I16B 2YD8A 3C6LB 3C6LC 2ADIB 2PXYB 2P46B 2PXYC 4PUBL 3L3IA 2B1HL 5E6ZA 3WUWA 3MNZB 4PJGB 2V9RA 5T3ZH 1VFBB 1IZKA 4ISVB 3TIEB 4ONFL 3WIFA 3VI4F 3JV6A 2C1OB 1ND0A 4XP1H 4NUJA 5DJXB 5IT2H 1KTDB 4D9QD 1IM3B 1JF1A 5MENB 5D6DA 4PR5A 2BRRH 2VLRB 5L2KA 2BXYA 4JANB 4M7KL 2NY1D 1YN6B 1JPFB 1U58B 3DX8A 5IQ7L 3O6FB 3O6FC 1OP3H 5LQBL 3GO1H 3AAZA 2ESVE 3V0VB 3ZDZF 3DYPA 2LV4A 4E0RA 1MWAB 3RWHA 1CFSA 4Q9BA 4OD1H 4NZUH 1UEYA 2P5WD 1UXSB 1T21A 1RPQA 1H3WM 3GM8A 4HIIB 5EA0H 3UO1H 4PRHB 2ZJSL 8FABB 4M8VA 1A6UH 1F11B 2VMFA 1S7WB 1OHQA 5FYJU 3KXFA 4D3CH 5SWQB 2O61A 2ZSWB 2CLZB 2AJSL 4HK3N 3QH3B 4RGND 3BKML 1D6VH 3T4AB 1Q94A 1FFRA 3MLRH 2ZUVA 1MI5E 4KVNL 5JXAL 3NABL 1GC1L 4HDIA 2GAZB 4CMMB 1QA9A 2YD9A 2A6DB 3X14A 5FGSA 1S9VB 4KJQD 3VXSA 5BVPH 1IGJB 1LP9E 4L8BB 3KDMB 3RUGB 5JW5B 3BN3B 1KFAH 3BEWA 3BGMB 3BP4A 4MNHA 4KMQA 5J11B 4X4YA 1F8TH 5BO1L 1XF4A 2NY2B 3IXAA 4F7TA 3GSUB 4PRDA 4QGYA 2IAMD 4MAUH 1P4BH 5LCVH 1CDYA 4V1DE 4CVZA 4XP9H 3QJFA 3Q6FA 4GBXD 4LEXH 3FCTB 1AXSB 1ETZB 3O2DH 3EYQD 1E27A 4GMSH 1IGCH 3PWVA 4ALAL 1DQML 4RISL 3NA4A 4L8SB 4UU9B 4L8SC 4G9FB 1CDUA 2OP4L 5IROC 3OR6A 4MA3A 3HAEA 3DYOA 5JPNB 3MV11 2NW3A 3E6FB 3IYLW 4XXCA 1NUFA 5DQ9B 1S7XA 2P42B 1U6AL 3QDJA 1PY9A 1NBVL 2R0WL 3V7MA 4I0CC 1SM3H 5IVZA 1P6FA 1PKQB 1UWEL 1YPZB 4LARH 5ISZA 1FFPA 1X3DA 2J12B 1XCTA 1F6FB 5ECJE 3DV4B 4YX2L 2ICWA 1AQDB 4DN4L 1JWSB 4F3FB 3VD9A 2E9IA 4W4NA 4F37F 3EGSB 4YZFE 2JLLA 3KLAA 4U49A 1FE8H 3RU8H 1JL8A 3TH4T 1HZHL 3WLBB 3SJVA 4WNQA 2VB5A 4DOHB 1YYLL 1G1CA 4Q9RH 1I7ZA 4M43H 1MQKH 3L3GA 43C9A 3FTGA 4CGTA 3D39B 2W0FB 1BZ7B 2X1XR 4U1KB 4TPRH 1TJHH 2Q1EA 2F5BH 3LB6D 1FAIL 1RMFL 2ZOKB 4JRYD 3L3OA 2BNRD 3NZHH 2Q86A 2VDRL 5IFHL 4R90L 1ZA3A 4X9BA 3TBYB 1NC4A 1WFUA 5HGBB 1UJ3B 2OK0H 1UJ3C 3MLUH 4ELMF 2R2EB 4S2SA 4FQXA 1KN4H 1LEGA 1BFOA 4NRXA 4MA1B 4MA1C 4YO0A 1QFUH 3IFNH 4PBXA 4S10A 2XG4A 1AO7A 4FMKA 4YHIB 3EYSH 4RWYH 2JK5B 4X6CB 4WUUD 4QRQA 3JWDC 5F21B 5C0BA 5J7CC 1RVFL 2H6PA 1KC5H 3I84A 3QEHB 4JN2A 1SY6A 4JPWH 1AGDA 1JZ3A 4WW2F 3VG9B 3TJHD 3QB7C 3VG9C 4EN3B 5JLZB 3GMQA 2FJHA 2JCCA 2JB5L 4JFHE 1U3HB 5EOCH 1U3HC 1PKOA 4OZFH 1I1AD 3FN9A 3A0OA 5IG7A 2BXZA 1HKFA 4MVBD 2X4QB 3G9AB 3D0VB 4KJWD 5ERWB 2YS4A 3FQUB 3LKPA 1Z5LB 2LABA 5KSBE 1C5CH 3LEVL 5D7JB 5KJRL 4KK6D 2CIKA 3O2WL 2Z35B 4PJIE 4NNPH 1MRCH 3DUSA 4TSAH 3QFJE 5EUOB 1DBKH 4NM8L 3BH9A 1WWAX 5GZOD 3JTTB 5E6ID 3V0AC 3A6OA 4BH7A 2C4FU 1A7RL 2CKBB 4FFVC 3T09A 5GRWA 4Z8FL 3KPRE 4DVBA 4XNMA 2HG5A 1Y0LB 4POUB 4TUKL 4DCQA 3SDDA 3UP1A 5AD0A 4NQTA 2OTUA 2Z31D 3WFEH 5LWYH 3G04B 3STBA 5D1XB 5D1XC 4RMRA 5DD1L 5IFAH 2CK0L 3P4LA 2PO6A 3PF2A 4GSDL 3S5LB 1N3NA 1RY7B 5AYUL 3R06B 3MRKB 4U33A 4D0BA 5ADPH 4XVJH 3HLAA 2R56L 3IFOB 5J6GB 1INDH 4GLRI 3DARA 2GY5A 1M7DA 4PJBA 3VE0A 2XZAL 2GJ6E 2FSEA 3O8XA 2PYEB 4OD2A 5CJ8A 5DUBA 1WV7T 1LP9F 1RK1A 4LSQL 4AT6A 2H1PH 4NN7B 3ILPB 4NN7C 3GFUA 2NY5L 5HGAA 4EIGB 1IQWL 1QEWB 3MLSL 4G7VH 3KPOA 2EDWA 5KOMC 1I9JH 3QJHA 4G8GE 1BFSA 1R3JB 5ANMB 1MRDL 3IDNB 5F7EL 4FQ2L 4XHQA 1G0XA 1I1FB 1N64H 2XA3A 4HUXB 4FQHB 2YD6A 1IZJA 1CR9L 3AS2A 4J6RL 1HQ4B 1T3FA 1Y6KR 5L0QB 5L0QC 4LCYB 5IB3B 2EEDA 2WINB 5FUOH 5DZLA 2EIBA 5FKAB 2HT2D 4PJDB 3UC0L 3S34L 3SE9L 3WD5L 2EXWD 3VA6A 3FO2A 4LCWE 5F9JB 1OWRM 4JLRA 1I8MA 3T1WA 1GRWA 1A7QL 2GY7B 3ZKND 1L9MA 1NDGA 4XB7A 3BEVA 1J11A 2QKIA 1YNTB 3DGGA 3ULVC 5FA3A 3T65B 3ULSB 1F4XL 3JTSB 5FM4A 3TJEL 3OAZK 3AUVA 1I85A 4M6OH 3BDXA 1OLLA 3MOAH 4NYLA 3PV6A 1M7XA 1XF5B 3IU3A 5DJCB 5J1TC 2ZNXA 4YZFF 3OKLA 1RZIB 4Y2DB 4BM7A 2IQ9H 4HF5L 3FKUS 4P5TC 4P5TB 1BAFL 4Y2DC 5DQJB 1TTGA 4Z7UA 5T5FL 4KTEH 2FBJH 2NY7H 2XRAL 3U0PA 4F9LC 5TDOA 1JGUL 5IM7B 3BOVA 5BV7H 3CH1A 3CVHL 1FFQA 5B21A 2VE6A 2F54A 1F4WH 3G6JB 5CZKA 3UTSA 3U0WH 1ZS8B 4HUMB 1CG9A 4I77L 3LHPL 1BVLA 1XGQA 3QEQE 2YPLD 2NTSP 1LQSR 1JRHL 4L4TA 5ETUA 1C1EH 5HI3D 2N56A 1G9EA 1VPOH 4JKPH 4LDEB 2E9JA 5IHUH 5C7XL 1WIPA 3CAFA 3AREB 1RZKH 3AREC 3E3QC 3TN0D 5ILTH 2CDFA 3T8XA 1EZVX 3V6OE 1XGUA 1XGPB 3UPRA 4JM2B 4JM2C 1F6LL 4XVSL 2A74B 4LVHB 3W9DB 4GO6B 1Q0YH 1RUPL 1RULL 1N0XH 4K3JH 2BHZA 4H26B 1MCPL 2VQUA 1LEIB 1PX4A 4K8RH 3B83A 3KWWB 1FVCA 4AY0A 1D6EA 3BISA 4M62L 5F89A 1CLOL 3L5XH 4RBPH 5I1CL 3ARBB 3ARBC 4WWKB 5IB1A 1FORH 3IAGC 3VXNB 1ACYH 4Y16A 3OXRB 5C08E 4XPGH 3WFCH 4EI6B 1Q9WB 3HNSH 3MRQB 4KUCD 4ONHA 5TJWK 3FT2B 5JOFB 3TZVA 1KB5L 3Q2CA 3LQAH 1OB1A 4OZGE 1YJDC 2R2HA 1RIUH 5F6IB 5F6IC 1FVDB 4YC2B 25C8L 4LLMA 4YC2C 4P57B 1W72H 4NQSB 1IM9A 4EBQL 5EO9A 4H25A 3N1GC 3ES6B 1V7NH 1HNFA 4OCSL 4NO0A 3SKNA 3ULUD 3WKML 2MCPH 4FQIL 3O11A 3BDYL 3HC3L 2Y06L 1ZE3C 4OCRH 2V9TA 3VMPA 5DMYA 4DVRH 1TXKA 4FXKA 4GW4B 5IQ9A 5AZ2L 1AXTH 1WBYA 4PP2B 3T4YB 1OP5K 1W0VB 3VXQA 3VWJA 5LGJB 2F15A 2B5IB 2B5IC 2OJZH 2DLIA 4R4ND 3S96B 4P3DB 5HHPB 1XGYH 4GLRH 4PLJD 3AFLA 5F96H 4O51A 2X4SB 5E00A 1MFNA 5DR5L 4ENEC 1JZ4A 3R0MA 5IVNA 3SDXA 2H26B 4QRRD 4U7KA 2CO7B 2NY3B 2NY3C 5D6CB 4K94H 4O2CA 3MCKA 5TH2B 3IFLL 3MLXH 2P5WE 1OW0A 3KJ4B 3KJ4C 1CLCA 1U0QA 2NYYD 1UWXK 3TPUA 2FATH 1W2KT 2E8ZA 3MRCB 1MQ8A 2CD0A 2B4CH 3OTTA 5GGSB 4OQTH 5I19H 4PJCE 4FTVD 3IF1A 1MHHA 1MJ8H 4PJHA 5L7XL 4KFZC 5LKNA 5F7FA 2BZDA 3S97C 3GJFH 3FO1B 3RL1B 4EUPA 2YXMA 5L6YH 4NCDA 4ELMA 3MUGB 4NT6A 5F7NC 4Y5XB 2KQMA 4Y5XC 1ZOXA 4YHOH 43CAB 1HILA 4NQDA 1U8QA 1FG2B 5EC2A 3GEWB 4HKZB 3KPSA 5C0CB 1PG7L 1KCRH 1K5NB 1PG7X 4Z7QE 4BSVA 2IALB 2VIRA 3HB3C 1LK3H 4R2GD 4PTUA 3W0WD 3BZFB 2V5RA 5HHMB 3VFTA 4DZBB 3L95A 3GMRB 5KANI 3S36H 4QHMB 1YEDA 2FD6H 4RX4D 5FAAA 2WZPD 3P40A 5DJ8A 3DXAB 4N90D 3FO9A 3GM0A 5IW3A 5B4MD 5HY9B 1J8HD 1CS6A 3SHSA 4PB0H 4KJYB 1J05B 5I6XB 5I6XC 1MHCB 5J9PB 3MV9D 5F9AC 2EO1A 4HEPG 5E8PB 1CXFA 3UYRL 5EU4A 4GG6B 4K07A 2FZ3A 4JPKL 3U46B 1N8ZB 4LSPH 5F7YC 2WSKA 2ESVA 3IDIB 4X9HA 5F3HA 2OL3H 2VABB 4KMLB 3DUUA 5CSZA 1VFMA 3RX5A 5I1KL 2NY6D 4NNXB 3FHAA 2HFFB 3WIHH 1PYWA 4XCFL 1DDHB 4X6DA 4MA8L 5DK2B 2UV3A 3RWDB 3V0WL 2VLJD 4Z7VB 4HWEL 5E5UB 5E2TH 2PUQT 1CFQA 2DI7A 1YEGH 1KYOK 4UI2A 2YSSA 1N4XL 3ARDB 3ARDC 4TULH 2K7QA 3WEXA 4PY8I 1JHTA 4BH8A 4UMGA 5GRYA 2D03H 5HYQB 2OTWB 3UJJL 4KAQH 1VACA 5HHVL 1U8IB 2OX5A 1LNUA 1NCBH 2OM5A 5DFVC 2Z8WC 4HPOL 4K8RD 4YE4H 4ETQB 3IDXL 1IBGL 2ARJA 4P2OA 1I1CA 1CQKA 4A6YH 3HHRB 1RJYA 1FLRL 3GSNL 1HHGA 3U9PL 1OAYH 4K3EH 1KPUA 4LGPB 5GPRA 1A22B 2FIKB 2HJFA 1KNOB 1FL5A 2BNUA 4U1LA 2B20A 1J12A 3BH8B 4OZGF 3BESR 1TQBC 5E7BA 1BQUA 1KN2H 4OUOA 1D5BB 1RUML 4GH7B 1TDQA 3ULUL 5GIRA 3EDDA 4YLQT 1NKOA 2HTLC 1XH3A 5CJXC 2XWTB 2XNAA 3L3KB 4V1DA 3CFCL 1B6DA 5I9QB 1WISA 1JPGB 4BQ9A 3BZ4A 2GQHA 7FABL 3CDGB 3B3IA 4OCLC 3WNLA 5CZXC 5D9SB 4WUUE 2FR4B 2GTZB 2FIRT 1F97A 1FYTE 5HHQB 2XTJC 4MMZC 5D2LE 2UVFA 3B5TA 5JIKA 1ZEAL 2C7UA 1EV2E 1JGVL 4XXDB 3BWAB 4UUJA 1ZT4B 2HH0L 3QCUL 2G75A 1JNHB 2YEZB 4DTGL 4P9ML 2AQ2A 2IPUK 4DWHA 1FPTH 4XNXH 3VCLA 2YBRB 5FGBC 3MFFA 4L8DB 4GKSA 5L88L 1X4XA 1SJVA 2HLFC 1C16A 4N9GB 4UOW1 3T0AA 1BBJB 4K9EC 4MJIA 4KK8C 4OCXL 1QD0A 3HRPA 5E9DD 4LVEA 5GGRA 5ID1A 3HA0A 1EFXB 3BGFB 3BGFC 3OB0H 2ZP0T 1AKJA 3MJ7A 1SYSB 5CJ5A 1XF2B 5KSVB 5DJDA 2O5ZH 4JQXC 2FEDD 1EUUA 4PJCF 4QHUB 4OZ4A 2ZPKH 2G60L 4J3VA 4E41E 5JW4Q 1L6XA 4OF8A 4OUUB 4KRPB 4KRPC 3BKMH 4PV9A 4ZYKA 1QFWI 5GRJL 2OQJB 4LSVH 1EZVY 4Y4KD 5JXAH 3NABH 1ULVA 4PRNA 3QUZA 4M6NL 5CUSL 3WE6A 1KELL 1F4HA 4DGVL 2ID5A 1I9IH 1MF2L 2BERA 1ROWA 1T6VN 3MRHA 2X1QA 3ZYJA 4IM8A 3WXWL 3QUYB 4Z7QF 3QUYC 1KIQA 2D4DA 3IKCB 4JPVH 1OP3K 1V3JA 3HI6L 3V5DB 5BO1H 4PJ7B 3M1BB 2Z91A 4ODVL 3U1SH 4Y1AB 5F44A 1SHMA 1S7VB 1H3UA 5T1KD 3HFML 4DUVA 5IBTL 4PJAB 1U8LB 4JKKA 3GGWA 4X4XA 1AR1D 1CDIA 1FGNL 2FGWL 4RISH 1FL6B 4F8QA 5KSBA 4MQTB 1YNKH 5GJTL 3HMXL 4J3TA 5DK0B 3ET9F 3NFPA 3SGKA 1JNNH 3G08B 4PJIA 5FCUL 5FO7A 3QDGE 2R0LH 2YD2A 1CIUA 2EDYA 4NFBA 3AXLB 4P2YA 5HYJD 2E7LA 1LO2L 2HTKC 4YBHA 4JAMA 3BPOC 1NGZA 3H7LA 1UM5L 1ZA6A 4TN9A 3MNWA 2W91A 3GHBH 3O41B 3CLFL 1U42A 4G6MH 4X7EC 1ZHLA 3SCMD 3QNXA 5DC0A 1MCHA 5GGUA 1AD0A 1JFQL 2CSPA 3PHSA 4H1LG 3MLWL 3F5WA 5C6WH 1MCLA 3TNNB 3MRMA 1HZHH 2VDPL 4LSTH 1JZ6A 2OJEB 1S9WA 5GS1A 2A1WL 2XKNA 3U2SB 4ACPA 2Q8AL 2AVGA 1BVZA 3QXDA 4JJ5B 4R96B 2ADJA 2R8SH 5KTEH 2QSCH 2Y1VA 2CRYA 1P7QA 2AEPL 4YFEA 2R1XA 2PF6A 4IMLA 2AABH 5MEOA 4KI5C 1T22B 1A21A 2GSGB 1BLNB 3HE7B 4G8GA 3HE7C 4GXUN 2YXFA 1VB9A 4FQLL 2XY2A 1EHAA 3VFOA 4MCYA 3QUMA 4MD5A 5HHNB 5EO1B 2C3HA 3T77A 4P5KB 1SJHA 5IIEB 4PG9B 1S3KH 2J6EL 4RGOL 1D9KB 1AC0A 1YY9C 3RWHB 2DQCH 3IETA 3BYYA 3WS3A 5CWSA 5I8CA 4OSUH 3S4SG 2APFA 1RVFH 4ODWB 3KS0J 3RPKA 2VC2L 4JFEE 1NLDH 5I8EB 4DAGL 4LCWA 4ZO6A 3CC5A 3C6LD 2PXYD 4KWUA 4HIXL 3GSQB 2YRLA 3OR7A 4FNLH 2X4NA 3PGFL 5T1DH 3X11A 5T1LB 4JFZH 1R5VB 2APVA 4LKXA 1BMGA 4G3YL 4ZFOA 4N0YH 4R97C 3BE1H 2ZOLA 1EEZA 3LEVH 5I1IL 5KJRH 5ICZA 3D2UA 4P59L 2DQTL 4OCWL 5MEND 2WAHA 1HKLL 1MAML 4BQ6A 2VLRD 1OSPL 5E08L 4ERSH 1A7RH 4DKAA 1KACB 5GGTH 3F62A 4N68A 3GSXA 5F9WC 3EYOB 3O6FD 1GOGA 1ORSB 2B2XL 1XIWB 5EU5A 3MRJB 1XIWC 2MMXA 3FJTA 1R3IL 2IBBA 4AK1A 2VWEE 2BVYA 3MOBH 4KHTH 4X4YB 1JPTL 3RGVA 2PYFA 3UX9B 1CVSC 1Q9OA 3F12A 3ULUE 1E4KA 1BBDH 2GK0A 3LSOB 5I1GL 4PRHD 3P9WB 3QEQA 2DS4A 2VN4A 5JW4N 5C6TH 5D7IA 1BQHA 2EYTA 4PREA 1FL3A 1OTTC 3ZE0F 1FNGB 2VXSH 4X0KB 4HLZG 3ZYOA 1BJ1J 2A73A 3WSQL 1MFAL 2FJFB 5FF6B 3UMTA 1RSFA 4U1JA 2VAAB 3VMOA 3AMKA 3V6OA 1QSEE 4AZ8A 2V2TB 2J5LC 5CMAB 5IUSA 1QFWH 1HOCB 5IB2B 4PJXE 2QLVB 1IQWH 5IFJB 4XXCC 3INUL 4FQ1H 4GKZB 2P7TB 3PP4H 3LRGA 4MNGB 3QZWG 4CRPA 3CDYA 4OT1H 5DSCB 4XP4L 4PYHA 4TOYL 4QOKA 2HT4C 3B9AA 4QY8A 4APQB 4APQC 1G7MB 4QRRE 3TVMA 5LAXA 1HSAB 1QBLL 2HT3D 2ICWB 2FECL 1GCFA 4LPTA 2HA1A 1X5KA 2V7NA 1WIOA 4CU6A 3BHBA 4YAQB 4JQIL 4LCUA 4U2YA 3QIBA 4GRMA 5D7SH 5GGQH 3EYFB 1XF3B 5D2NE 1T66C 1VDGA 5IR1A 3UC0H 3BPCA 5C08A 1U3JA 2QEJA 5CINH 4KZDL 2Q76B 4MCZA 3GMNA 1AIFA 3CFBA 2YN3A 4Z76B 4ZUSA 2CJUH 1CGXA 4OZGA 4UV4H 2O5XL 4G9FD 5JNYB 3AROA 3KPTA 3ZDYE 1F4XH 3BPLB 3BPLC 2QQLL 2VZVA 4ZFZB 2R4RL 4XNZB 1PJ9A 3IT8D 1RU9H 1WGOA 2DMBA 2C1PB 4FQXC 2BY0A 4UT7L 2BOCB 4F33A 5GRVK 1D5ZB 4H5SB 4WV1B 5T3XL 3SBWA 1VENA 5FV1L 2CLRA 1GOFA 3SO3B 3SGJA 4NZJA 1JGUH 3WS6C 4XTRC 2F53B 4UTBL 4PBWD 5HHOB 2H6PB 1J8HE 4NRYA 1JVKA 2QQNH 4XB8A 2JJWA 3GMQB 2BSED 4JVPA 1E6JL 4I77H 3C5SB 4LSUH 4TQEH 4JO2L 1UZ8A 3MV9E 3D39D 1MLBB 4NKOB 1KG0A 3ECBB 3X3GH 3X3FL 5IW1B 2EYRB 1WC7A 5I1DA 2XQBL 1ZMYA 3D85A 5B39B 4HH9A 3L5HA 1K4CA 4GW1B 1T1WA 3EIFA 3HR5A 5FHBH 2BVQB 2P5WA 3BPNB 3BPNC 1OM3H 1KCVL 3M17B 5F97E 5KVDH 4NQCE 4HUUA 1T0MA 4CN4A 1G7IA 3MNVB 5F8QC 2ADGB 1GZPA 4X8JB 4F37K 1P4IL 4U6XA 5FYKD 4QXGL 4W4OC 5TE4L 1GZQB 3FQXA 4DCQB 5AD0B 2BCKA 4YNYA 5IVXE 4PD4J 3SDDC 2OR9L 4S1QL 4QNPE 2X7LA 3QDHA 4F7PB 4CADB 4G5ZH 1VHPA 4FN0A 2JJTA 3U7YH 3L7FA 1NFKA 2MKWA 2PO6C 4LLVB 3MUZ1 4YFLI 1KIRA 1N3NB 4EN3D 4GRWB 3K1KC 4AG4H 4DQOL 1PFCA 1U3HD 5EORL 5IKCA 2CRMA 1JGEA 4LPWA 1U3YA 4KUCF 1CDGA 3WHXA 1M7DB 1YMMB 1ZT7A 4X7SL 5TE7L 3RL2B 1S9YA 3VH8B 1PZUB 2G5BA 5DS8B 1JJUA 1MWAL 5D7JD 4ZG1A 3P2TA 1PQZA 3FN0L 1RZ8B 2GFBB 3KJ6H 3O6KH 4YFLF 1LE9A 4EBQH 1NFDE 2RJMA 1SEBA 3H7BA 3LKNA 3G5VA 1A6TA 2IAMA 1AGBA 1DUYB 2KUTA 4FFVD 2HFEB 2ED7A 1QVOA 4FZ8L 5CEXB 2HVKB 3BKJL 1XCQA 2BHYA 1Q9KB 2AJXL 4GBXA 5F7DA 4D9LL 3P9LA 4FQIH 4GT7A 3ULUF 3DO7B 3W82A 1KBGL 3IGAB 1T1YA 5FHAL 3JVGA 1UCBL 2EXYC 2IH3B 2JTDA 4JZJA 1LO0L 5D1XD 1CDHA 1CD1A 1NCWH 3VXOB 4HUWB 2FJGB 1X6LA 4RZCB 2HJKB 5DD5L 4E9LA 1KGCD 4JR9L 4RBPK 1CFTB 4PJXF 1PZ5A 3FO2B 1U8NB 3TH2T 5I1HL 3EZJB 3VXTA 3LKQA 5JORA 5F9OL 3MLVH 4HFWA 1WTGT 4H1LA 2HLAB 2PYED 3GMMB 3PWJA 3VFVA 3KLSA 5GRZA 1C8PA 4MJ6B 3K4ZA 1I85C 1FIGL 3WHE0 3IU3B 1MCCA 5FUCC 1N6QH 3NAAL 5C0JB 4WHYH 4DW2L 5MEPA 2VLMD 5ICXA 5EZJA 3IDMA 4OLZL 4PJFB 3SDAB 3SDAC 2IFFL 2VO5A 3G5XA 4JRYA 4OF5A 4LAJH 2BNRA 2FHFA 4CDGC 1IAII 1FGVH 2XZCH 3CVHA 4NSKB 1JMXA 2AQ3A 3CFJA 4U4BA 2RCSL 2NQCA 2HFTA 4E5XA 3HG1B 3W2DL 3ZKQD 3KPQB 3NA9L 1HHJB 3QULB 1VGKB 2VXUL 3IU4H 2L7JA 2GCYA 1NL0L 1UGNA 5D7LE 3BQUB 4XC1L 1ZLUK 3ULVD 4GAYB 3QWQB 1UB5B 1YMHA 4LEOB 3D3VB 1SJEB 3UPAA 4XP5L 3BKYL 4M7JH 4WUUA 1NLBL 3O6LL 3UPRB 4NZRH 2BFVL 4CNIA 5D2LA 3DX6A 2AKRA 2CK2A 4FQQB 1OGTB 2OZ4H 5CLTA 4Y2DD 4P5TD 1RUKH 2NW2B 4RAHA 4LP5A 1ES0A 1I1AA 4MD0B 4X9IA 1HYSD 4NWUL 5DHYA 3BDBA 3BD3A 4K3DH 4ZODA 1J0IA 3MLZH 2EDBA 4NUGL 6CGTA 3RTQB 3RTQC 2R23A 4HIJB 5ESAA 1S7SA 5IEHA 1QYGH 1FVEA 1OF2A 1EAPA 4WI9A 4N8VG 2PCPA 1IGMH 2UZIL 5H2BB 5I1KH 5E6IA 4Y16C 3P4OA 3GJFK 3ARGB 3ARGC 5HYJE 3VWKB 2A6IA 3HS0A 5FYKL 2ARWA 3GI8H 3BXNB 4LFHD 4XBPA 3RWFA 4PLNC 5IMOB 3TZVC 1UB6A 3ARED 4R0LC 4PRIB 4R0LB 3UTQB 1QOKA 2I07B 4WFFD 4HCRH 1U8OB 3JWDL 3TBSB 5KVMC 1H5BB 4JM2D 4Y4FB 4Y4FC 3VXPB 3NOIA 3EOTH 4QNPF 2X05A 2VERN 1TVDA 5EG6C 3THMH 1CE1H 4LHUB 1N5AB 3UJJH 32C2A 2VDLL 2GHWB 5TQ0H 3RX7A 3B6SA 1KJ2B 1EDQA 3QG6B 2VZ1A 3N9GH 4OZHB 2QQKL 1A7NH 5D5MB 3NGBB 4KHXH 3NGBC 1FLRH 3ARBD 1HHKB 2H2SC 3U9PH 4YGAB 4BSJA 3QZWA 1P7KA 2AEQH 5IHZA 4Y5YB 3SKMB 2OR8A 4Y5YC 4QKXB 5EZOH 3UTTB 5LBSH 1QRNB 4RRPA 3CSGA 3VWJC 2EIEA 2VXTL 4KQ4H 1RUMH 1RZ7L 3VDCA 2BC4B 3ALXA 3A6BH 3BT2L 4NKMA 5SWSB 1BFTA 5FK9A 1NFDF 1QQDB 3ISWA 3CCHB 1HH9A 1P84J 2DF3A 3GK8L 3K80A 1A0QH 1YDPA 4ZAKB 4HKJA 1FFNB 1R5IA 2MCG1 2VJXA 2W9DH 3I6GA 1Q1JL 1B4JL 5C9JB 3O9WB 1HCVA 3O9WC 4D2NA 4XVUC 1JGVH 4XGZB 4Y5VB 1MFDH 1LO4H 3T2OA 1R6VA 4YHYB 3NCFB 3MR9A 4G80B 4PJGE 2FRGP 3IDYC 3DRTB 1I9RH 2BVOB 2Z0BA 1FYHB 4JB9H 3EDEA 2FWOB 4I2XE 4AM0B 2MHAB 5BS0A 1JTTA 2ZKHL 3L1OH 4KDTC 4N8CH 5MENE 1VERA 2IGFH 2VLRE 4AL8H 4XPBL 2R0ZH 1LEKA 4W81A 5GSRB 5HYEA 2RR3A 3I2CH 5E5MA 4ENED 2X40A 3HMWL 3EKCA 4MDIB 1OTUD 4MSWA 5T33L 3VFSA 4YHNA 4HEME 1NAMB 1I4FA 2NY3D 3R0NA 5BXFA 2E27L 5EOTA 4OV6F 3MODH 4PRHE 5GRJH 3GIZL 3QYCA 4JN1L 2YPLA 4IMKA 4AH2B 1IVLA 1BJ1H 3WO4B 3M07A 3WO4C 3STLA 3SGEI 4PGEB 3ULVL 3MJ8A 1IAIH 3MBEB 3MBEC 1OL0A 3OKMA 5E1AA 3VFMB 4HKBB 3BFOA 3TN0A 1N5YH 5EPMA 2Q6WA 5EWIH 1G9ML 4LIQL 4X80H 4GG8B 4P3CL 5IW6B 2Y25A 5I1AA 3V6FA 3DVGA 3KPPA 4ODVH 3B9KB 3P3YA 3B9KC 4XCYA 5C0CD 1E0OB 1HEZB 4PRBA 4TUJA 3QXVA 3RUGE 1K8DA 5DUML 4EQ2A 3OB0K 3EYVA 5HHMD 1K3ZA 2VISA 2BNQB 1FGNH 2FGWH 2HRPH 4JFYB 2Y07H 3LH2L 2GYSA 2YD3A 1XR8B 3BAEH 3DXAD 1IKNC 3NMEA 1L9NA 2W60B 3CFEB 3B8YA 4OZFA 4LQFH 3PDOB 1YECL 1NCUA 3NPSC 4P2OC 1HXMB 3OKKB 2KZ1B 4G9FE 4IDJL 4M00A 2VTFA 1LD9A 1R24A 5IESL 5CGYD 5DJAB 3B5GA 3OV6A 5DJ6A 5E8DL 1WBXB 1V3KA 1O7VA 3SE3C 5E95B 3T0BA 4RCAA 4PGDA 5MP6H 3OKEA 3QQ4B 1DQTA 3GIVA 5K9JL 1BIHA 4ODSL 2XPGB 2AV7B 1WBZA 4FQCH 2ADFL 1CIDA 4WEBL 3FFCE 3RVVC 3WNKA 5I76A 1YPZE 1CD9B 3TT1L 2FB4L 3FQWA 3I3EA 4FA8A 3LS5H 3QWOA 5DT1L 1UWGH 4PTTA 3QBTB 3BIAX 3ARDD 1URLA 4U1HA 2E9BA 4HS6A 3GUTB 2MQ0A 4TRPL 2AEPH 2GT9B 4FXLA 4XAWL 3C87A 5C0FA 4HS3B 5F7HA 4PJXA 4LK4A 5DVKA 4DOHE 1PEWA 2R29L 3D39E 5DFVD 4OGAC 1CD0A 1L0YA 2V5TA 1AD9B 1I8IB 3Q3GB 2EDRA 1BQSA 3ETBF 3RWGB 1ZXQA 1DE4A 1YJDL 2Z93B 4QRRA 2J6EH 1P9MC 2D0FA 4RGOH 3B2UC 1TNMA 1FO0B 3WDHA 1OAKH 4RAUB 1KF9B 4YHLL 2FEEL 2OI9B 4YHPA 3WFBL 3X12A 1MHEA 2W0LA 3IJSA 3O0RL 3MRIA 4Z78A 4O4YL 1MEXH 4RIRB 1RQ5A 2ZCKL 2HTLD 4GKNA 5FYKE 5K33A 2PW1A 4FTVA 4OIBA 1MRFL 5EB9A 4Y88A 1OSZA 4ODUA 1DEDA 4NQVA 4NP4L 2YHGA 4YEEA 2J8UA 1VEPA 4PJGF 4J12A 4XNQA 5DMGC 2LE9A 5INDB 5I1IH 1KENL 1EMTH 3QFDB 2Q8BL 5F7LB 1MELA 1KULA 1KCLA 3BZDA 3MRGB 3MA7A 2DWDA 3BP5B 3WLWC 4Y4HA 3QIUB 3QIUC 4LGSB 4Q6IA 3HI1A 4U7MA 4PJEE 1B3JA 3ILQC 4NM4L 3WE6B 3O2VL 1OWWA 3MRPB 3TH3T 4ZTOH 4XCCL 3VI3E 3W0WA 1EXUA 3OF6A 1WFNA 4KK8D 3UPCA 4RX4A 1QR4A 4OF3A 1I75A 1FNSH 1EFXD 1NFIA 3EOAB 3FRUA 4GXVH 4UIMA 4CMHC 4CMHB 1QFPA 4ZPTB 4WCYL 4U05A 3RY6C 5E8EB 5C6PB 1TZGH 5I1GH 4V2BA 3MV9A 3MLYL 1V3MA 3H9HB 4LLQA 2VLKE 2XG5A 2EIZA 4R7DA 4NRZA 1KCSH 4LBEB 4N8VA 1MIML 3TIDB 4X4XB 4YDJB 1CZ8H 2VH5H 4RWHA 3HPLA 5FOBA 2QR0A 1BQLL 2JJSC 4KRPD 2I60L 5F3BA 1QLEL 1KGCE 1Q9LB 3IXTA 1TZHA 2FX9H 2HN7A 3RKDD 4KKBC 2GSIB 4YXLL 3DVIA 3LV3A 4JEGB 3RAJL 2UYLA 3EBAA 5TF0A 1SMAA 3SGEH 3D69B 1RIVL 3BUYA 2EDFA 2VLJA 3LS4H 4PV8B 5A40E 2BSTA 1H15B 4GAJH 2NPLX 2CDGA 3ZKXC 3QA3B 5EN2B 5KVFL 3QUYD 5IB4B 5IVXA 4R26H 1T5WB 3RUGF 3MJ6A 2BVTA 2VOTA 1TCRB 4RNRA 4K7PH 1PW3A 4HS8L 1AD0B 4BFIB 2AJVL 5ANME 4Y1AD 1B6UA 2VLME 2D31A 4IJ3B 4IJ3C 4KZDH 4RMTA 1WAAA 1OD7A 5B8CA 3QCTL 4UQ3B 5SV4A 1FC2D 3OQ3B 5GRXG 1DBMH 2YK1H 4G43B 1CXHA 3DMMB 3VRIB 4KPHH 4UB0L 1RJZB 2O5XH 3PL6C 3PL6B 3JXAA 5E8OA 2XN9E 2QHRL 5DHVA 4ZUVB 1JHKL 5CHNB 2BOBB 4PJDE 5DA4A 2V7HB 2ZG2A 3FT4A 4WTZG 3H9SB 4JY4A 1F5WA 4LLUA 4MZ3A 1R5WA 5DHXB 1VGEH 4NC0B 3OPZL 2R4SL 2HTKD 5D96B 3ULVE 3QG7H 5D96C 3QRFM 4HXBH 3PP3H 5JIHA 2AJUL 1SYVA 1Q72H 2QV2A 5T3XH 4NN6B 4NN6C 4LP4A 1YPZF 3BIKB 3PWLA 3RNKB 5C0IB 5AAMA 2X41A 4LIQE 3FB6A 3CFIC 4S0SD 3ZT5A 2R1YA 4TSCH 4ZTPL 2QSQA 2D7TH 2R1WB 4HPYH 4YPJA 1V5JA 3LKOA 4HJ0C 3RPIB 3ZYZA 3GMLA 5FDWA 3DJ9A 1HXYB 3RP1A 1BIIB 3FB8B 4HK3J 4WEMB 1A3LL 1CF8H 5TDNA 4O2EA 1JGLH 3EOBA 5DJ2A 1JE6A 1U95B 3G6JE 2APXA 1EH9A 1B88A 4XMPL 3TESA 1WZKA 5E9DA 5DJ0B 4X5LA 5DXWA 5DD3H 4OLYH 1A2YA 1M05B 5JHLL 1X5AA 4KI5D 2LTQB 2LTQC 3QEGH 1KCVH 1AI1L 1BVKB 1FFOB 5SWZE 3HE7D 3T0XA 1Z3GL 2ERJC 3O4LB 1JWUB 1P4IH 3TPKA 3EUUA 4QXGH 3R1GL 1P4LA 5DD6A 3E3QE 1FNFA 1HI6A 1D9KD 1YY9D 2WQ8A 2X4TA 3QDAA 1ZANH 4I4WB 4C56B 1DBBL 4JZNA 3RI5K 4HXAH 3F12B 3LZFL 1ZTXH 4Y4KA 4OQTA 3EO0B 5F71A 3WNNA 5GSVA 3FQTB 5J89A 5EORH 2O93L 5KVGL 5EU6B 5T1LD 4PJEF 2EKSA 2P24A 4P46B 4P46C 4IRZH 3GJFA 4HQQL 3MJ9A 4K9EL 3O3EB 5CSBA 3OGCA 3VI3F 1U8JB 4G8FA 1F90L 4H8WC 5TF1L 4AMKL 2YPVH 3W5MA 1CLYL 3ALWA 4L4VB 1S9KC 1G6VK 1WWWX 1G6RL 1KB9J 5CP7B 4JO1H 4FABL 4L5FL 1N7MH 2XYCA 3WMSA 1J1OL 4UV7L 5T1KA 2FL5B 1JYWA 1XIWD 3B9EA 5IBUG 3NCYP 1UKQA 4UIKL 4O2FA 1MCKA 3BMVA 4ELKB 2R39A 4JFDE 4K7FA 3G6AA 1T5XA 2VXVH 4DZ8A 5DD5H 4MD4B 1INQA 1MIEL 4BFBD 4P23B 4P23C 3BPCB 3GNML 5MERB 4B41A 3LN4A 1XGRB 5I1HH 4F8TA 3S5LG 1OTTD 2Z8RA 4MX7A 5CJOH 4Z0XB 1RUQH 4H88H 3SQBA 1OAZL 3IVKA 4TVSa 3ZTJG 2AGJL 5F1NA 4WI8A 4TNWK 3SCMA 4M7LH 3QI9B 3QI9C 4EXKA 1UVQB 1KCKA 3NCBB 5GISH 3PGCA 5H37H 3SOBL 3WIHA 3UJIL 1DQQA 5GS2H 1U41A 3MO1B 4NZTH 4F58H 3PWPE 4N0FA 4RFOH 4J3XA 1YEIH 5AZEH 3UBXG 2XT1B 5FECA 4XNUH 1KT2B 1EJOL 1WZMA 1I7RA 2GTWB 1YEJL 4NC1C 4M03A 2HT4D 1G7PA 2WMPA 4APQD 3ZTNH 2H32A 4OLZH 3T0DA 4FHBD 3F7PC 3JUYA 3STZB 2HWZH 2AV1A 4C83B 3VFGH 2XZQH 1RV6X 2CGRH 1WFTA 3OX8A 4XBGB 5T5NF 2QJDA 2XI9A 1DQDL 2AJZA 4M6ML 1G7LA 5A3ID 2CUHA 5T5NG 1T66D 1CL7I 4FP8L 5D71L 5B38B 5LVEA 1U3ZA 1AGCB 5BW7A 1UQSB 1F45A 4YBQC 1NL0H 5A2KH 4A6YA 3TCXA 5CEYB 2JJUA 1A6AB 3C5JB 5I66A 2BSSB 3ULVF 1CI5A 1MH5A 5DVNA 2DMCA 3O3UN 4HH9B 2EE6A 4JFQB 3IFPA 1IQDB 3QP3A 2BFVH 1J8KA 3DHMA 4NKDB 4XP6L 4NZDA 4MA7L 2ATKB 3GBNL 4JKLA 4QYOA 5I16A 1OT2A 3V2AR 2YRZA 5F70A 3C6LA 2ADIA 2PXYA 3TBTB 4POYA 1D5MB 3MNZA 1AE6L 2DQJL 3MV7B 4PJGA 2ZUQB 4KGJA 2DDQH 1VFBA 2YC1B 2R2BB 5HHME 4ISVA 3TIEA 1DLHB 1T6WA 4OFKA 4XTRD 2F53D 1FN4B 2C1OA 3K2UH 5CP3A 2XWBB 5DJXA 4LPCA 1JK8A 1QKZL 1KTDA 3TYGL 5HHOD 1H8SA 5ACMA 3GSVB 4M1GH 1IM3A 4CDHA 1RIHH 3G6JF 5MENA 5DMKB 1IAKB 2VLRA 3OWEA 1P53A 4XNYL 3OKOB 4JANA 1LO5B 1YN6A 2GITA 1JPFA 1U58A 4KJQC 3O6FA 3RHWK 3GSRB 4GG6E 2PW2B 4LU5H 4UDTB 1MY7A 4QEGA 3K7UA 4LSRL 3V0VA 5GGSY 2X89D 1HK6A 4OLEA 1MWAA 4HWBH 5JOEA 3D9AL 3GI9L 5J8OA 4LFHG 1FZMB 2VL5B 5BZDB 5FO8B 3O3BB 1UXSA 1T7VA 2M2DA 3LKNB 5CZVL 4HIIA 2V5YA 4D8PB 1ACZA 4PRHA 4J8RB 1EO5A 1AGBB 8FABA 1F11A 3NCMA 4HBCL 2VDLH 4Z7VE 1S7WA 2HP4A 1PEZA 5JQ6L 1UH4A 2J8OA 2PN5A 5SWQA 2QADB 2ZSWA 2NNAB 2CLZA 3VMNA 3QH3A 3F7YB 3T4AA 4ZDHB 3ZLQC 1I3VA 4HC1A 1QNZL 4YHML 4RAVB 3MBXL 2GAZA 1RZ7H 4CMMA 5D8JL 3VGGA 5FGCB 3AVEA 3S7GA 3T2QA 2A6DA 4I18B 4I18C 1S9VA 1YMMD 4L8BA 2NXYB 2NXYC 2VUOA 3KDMA 5JW5A 1Q38A 3BGMA 3P77B 1UACL 1PSKL 3QXTA 4LAQH 4JZOB 4QRTB 4JHWH 1Q1JH 5DTFB 2APBA 3GSUA 2AI0L 4NN5B 5CIPH 1X9QA 2F19H 4U6YB 3FCTA 1AXSA 1ETZA 5ICXB 5EZJB 1JNLL 1K2DB 1XR9B 2R2CA 4NHUB 3LB6C 5JHDB 4LRNH 4L8SA 4ORGB 4UU9A 4O58H 4OB5H 3BI9X 3HN3A 4G9FA 4WTZA 2XTJE 5IROA 2GW5A 4P4KB 4P4KC 4KZEL 5JPNA 3E6FA 4CVXB 4NNYB 2RHEA 4RSVA 3TWCH 2IANE 5DQ9A 1KEGL 4C4KT 5E8NB 1MVFA 1PKQA 1YPZA 3HMWH 4URTB 3U4BL 3DV4A 1AQDA 3P30L 4HG4J 2E6JA 1NAMH 1JWSA 4F3FA 3EGSA 1YNLH 4Q0XH 3UTPE 3DLQR 3DX6B 1UYWL 2PTVA 3WLBA 3TJHC 1S8DB 5IJVB 3GIZH 2W0FA 1IMHC 1BZ7A 4U1KA 1CICB 2EDXA 1WCBB 5B22A 1QR1B 2X4PB 1DQLH 3SDAD 4QXTB 2ZOKA 4MHHG 3VGEA 2CLVB 3V7AE 5FYJD 5ITFB 5BQ7B 1JV5B 2DQEH 4KK6C 4YHKH 4JCLA 3V8CA 5JUEL 5AWNH 1CL7H 1G9MH 1OAUL 4MB5A 3TBYA 4PLOB 3HG1D 5HGBA 1UJ3A 3K3QA 3QSKB 1T7ZA 5E6IC 4AEHL 2CPCA 2R2EA 4FFYL 2NXZB 3OAUL 2NXZC 3B9VA 3BQUD 3DX7B 4G6KH 1YY8B 4YHIA 3B2VH 3D3VD 5I73C 2JK5A 3NN8B 1K6QL 2FHBA 4B53A 4X6CA 2YMXL 2YR3A 4XC3H 4FOMA 3WIIH 4LASH 1GGIH 3QEHA 4TNVF 4PJ7E 1SY6L 1PGRB 2VDMH 3CUPB 4JPIA 4EN3A 5JLZA 3ARSA 2Z92B 4Y1AE 5BOPA 1U3HA 3OKNB 2EYSB 3MX0A 1KUMA 1JPSH 2B1AH 1YECH 2X4QA 3D0VA 2PTTB 3QRGH 3BP6B 2ZCLL 5ERWA 4HGKC 3FQUA 1Z5LA 1SEQH 3CLEL 3Q1SH 4L3EB 3RTQD 4O00A 4TUOB 5D7JA 4YGVA 1CK0L 3BRDA 2Z35A 1T2JA 3ZO0A 3PV7A 1Z9SA 1E4XL 5EUOA 5E8DH 3MRBB 3JTTA 3MGTB 2CKBA 3MGAA 2PTUA 3ARGD 3ZT7A 4ODSH 2VZSA 1U8HB 4WEBH 5F9DC 1K8IB 3UEZA 4GRLB 4GRLC 1Y0LA 3B43A 1RFDL 4Z7VF 4PRID 1JI2A 2A77L 3G04A 1C5DB 5D1XA 2UZXB 5DK3A 4P4RA 4Y4FD 3T0EE 4UINL 4ZFFB 4XAWH 5IVOA 3S5LA 2R69L 3R06A 1ONQB 5IK3B 3KAAA 4LHUD 3RZCC 3RZCB 12E8H 3MRKA 3V4UL 4NQEB 4QHKJ 3IFOA 5J6GA 3OXSB 5BJTB 1D5IL 4X4MA 4Z7WB 1IC5H 2WIIB 1KPRB 2PYEA 1OAXL 2H2SD 4EDWL 3RY4A 3J7HA 3ILPA 3UTTD 1QEWA 2DTML 4O9HH 4XPAL 1QRND 4KI5E 3VXUB 2IG2H 2YKLL 4OD3H 4OTXL 4XWGL 4O4YH 4O5LL 2D7OA 1R3JA 5ANMA 4QO1A 5SWSD 3IDNA 1AJ7L 1I1FA 1MNUL 4HUXA 3CZJA 4YIQB 4FQHA 4QT5B 1NGPH 2X9WA 4ZAKD 3O3AB 4YXKH 1B2WH 1HQ4A 5HYSG 1NGQH 2I26N 4NP4H 4LCYA 5IB3A 3SPVB 3SE8H 2CRZA 3O9WD 4HFUL 1QTYT 5FKAA 4X6BB 4PJDA 3LIZH 2Q8BH 3WJJA 4XVUD 1WZ1L 5F9JA 4R7NB 1C5BH 1JZ5A 2E7BA 1H9VA 5HI3C 2W07A 3O2VH 1YNTA 3KXFE 4BQ8A 1DBJH 1GPOH 3MRDB 3QXAB 4PRPB 2P47B 3T65A 4AIZB 4JHAH 3ULSA 2W38A 3JTSA 1F58H 5DI8B 2ZUSA 3HI5L 4M7ZC 3MGOB 3NTCL 3S9DB 5DJCA 5C0AB 1RZIA 2YA1A 4Y2DA 4P5TA 4WCYH 5DQJA 4JY6B 4ZO8A 1X5LA 4P3WA 3KPSD 1RD6A 4S0TD 1JYXA 5IM7A 4IHOB 4KGLA 2DI8A 1DL7L 2HFGL 1HNGA 4NGHL 5ID0B 3G6JA 4LNRB 2H9GB 3RA7H 2ENSA 2W1NA 4P9HC 1L7IL 2B7DT 4PD4K 1FNHA 1LMKA 3U4EB 4CN1A 1ZS8A 5ICYB 1MVUB 1QLEH 1NKRA 2ZUWA 1BPVA 2LU7A 3V7AG 4YXLH 2F74B 4XPFL 2YUZA 3V5HB 3MBED 2Y36H 2E6PA 3PJSB 3T3PE 4M5YH 4HULB 3AREA 2Y5EA 3V52L 1F4YL 2AQ1A 1X6NA 1XGPA 5FXCH 3KYOB 1J87A 35C8L 2AXGB 4JM2A 1T0NB 2A74A 4BJLA 3W9DA 3IKKA 2SEBA 2HKFH 1CLZL 3HE6B 3FMGL 1U2CA 4H26A 1I3RB 3QDJE 3V6ZA 1UXWB 1LEIA 4YWGH 3B9KD 5JPMB 5CCKH 2HKHL 1R0AH 1EPFA 3NZ8B 2CXGA 3FZUC 1LDPL 3DTXB 1UFUA 3ARBA 2CMRL 2BNQD 4WWKA 4U1HB 5E2UL 1CBVH 1BD2B 1S7TB 5DYOB 3VXNA 4XPTL 5TDPB 3SJVE 3V5KB 3OXRA 1TJIL 4EI6A 1Q9WA 2ICES 1TETL 1YUHB 5C71A 4KKLC 3RNQB 5JOFA 5E03A 5HI4C 4EVNB 4NJ9H 4P48A 2XXMB 3PHOB 2AJUH 3H3PL 1MCFA 4U1IB 4L8CB 1KIUA 2VDKL 3VRLE 3I3DA 1FVDA 4LLDB 3ZE1E 3RIFF 2VDQH 3CD4A 4XPHL 1I9EA 4P57A 2C26A 4NQSA 1AQKL 2AJYH 3ES6A 5I1JL 5DRNB 2L4OA 4YXHL 4ZS6C 4AQ1B 1ZGLB 1CFVL 2VYRE 2ZSVB 1KJ2L 1CFBA 4XBEL 2E3VA 1AO7E 4ONOA 5C0DB 3DECA 3KPLB 5CBAB 3RVUD 4GW4A 3WUWG 5GZNC 3T4YA 1W0VA 3V79C 1X5IA 5IMLB 1MCOH 4Y4HB 4OCYL 4Y4HC 5LGJA 4N1EA 4H20L 4Q6IC 3S96A 4P3DA 5HHPA 4HZLB 4OV5B 4OGAD 2P48B 2WBKA 2X4SA 1F2QA 3UTOA 5JIPA 3BUTA 3WYRA 4OFYD 1HDMB 2H26A 3MUJA 5D6CA 3REWB 3B2UD 5TH2A 3G6DL 1Z9MA 2DLGA 1EERB 3PP3K 3MPCA 1NFIB 4Q9CA 4R4FH 2DQGL 3MRCA 5EU7C 1BWMA 5GGSA 4QHKI 4K23H 5I74B 5I74C 3S35L 3S35X 5KVGH 5BV7B 1WVZA 5BV7C 3TCLB 4M1CC 2YWZA 1UM4H 3NH7L 5DMGD 4X9FA 4KRNA 3FO1A 5FOBB 3RL1A 5INCB 1AH1A 3MUGA 3IXTB 1MJ7L 1PBYA 3WLWD 2NY6C 3KNBA 4GRWE 3QIUD 4Y5XA 4U3XA 1TPXB 1TPXC 43CAA 1IT9L 3ILQD 5DEGB 2HYMA 1FG2A 4HKZA 5C0CA 3OHXB 4FABH 1K5NA 1MJJB 3JUZA 3EDJA 2IALA 1MREH 3MTRA 1J86A 3GSWB 1RZKC 3K81A 4ONGL 4XMLH 3PABB 4DZBA 1ZLSH 3GMRA 3QDMA 4QHMA 4WW2B 4WW2C 3QWRD 1AFVH 3U7WH 3VFRB 3DXAA 3K4DA 1MFBL 2CRIA 5HY9A 2A2QT 1NCTA 2VSDA 4OLVH 4RMWA 5FO9B 3D0LB 2DWEB 4KJYA 1J05A 4PGJA 3FB7B 1MHCA 3NCJL 4K8RC 1S7RB 4KY1L 5E5RB 5J9PA 5JW3L 4UTAL 5E8PA 3OB8A 4U31A 4GG6A 3QCVL 3U46A 1N8ZA 3AM8C 3IDIA 2UY7A 2VABA 3CX5K 1E4WH 5CJBA 3P0YH 1P6AB 3T3PF 5DD0H 1LO3L 5I0DA 4YUEH 1NSNH 4NNXA 3SDCB 3O4OB 2HFFA 3O4OC 3SDCC 3HAEG 1DDHA 2XKSA 4LLUB 5DK2A 3RWDA 4Z7VA 4UZGA 3U4AA 4X5XB 3LQAC 1EJOH 3HC4L 3VJ6B 5KN5B 2CIIB 3P0VL 1P84K 3ARDA 5L8JB 1W72B 4S11A 2DM2A 3S3PA 1MI5B 1DQDH 5FUCE 1A3QA 1YEHL 5HYQA 2OTWA 3MFGB 1U8IA 2CUIA 5F7UA 4Z7UE 5EU3B 4ETQA 1DSFH 2XZZA 1LP9B 2EH8L 3V4PL 4G6JL 3DMMD 1FZKB 2Z8SA 2F54E 4OLUL 1MPAL 2AXFB 2FIKA 3KG5A 3PL6D 1KNOA 1NMAH 1P7QD 1XF1A 3BH8A 5K9QI 2FX7H 2KZWA 3HG1E 1JYVA 3TLRA 1D5BA 2NZ9D 1CXLA 5GGVH 3VRLF 3ZE1F 1C12B 4FFZH 5KSAB 3H9SD 4L4TE 4N5UA 4M48L 2EDEA 3GBNH 1GYAA 5CJXA 2XWTA 3L3KA 5J0BA 3W39B 5CEZH 5DUPL 1NMCB 1NMCC 1JPGA 1TJGH 3D3VE 3EO1A 5I8KL 3CDGA 1AE6H 2FDBP 2FR4A 5D9SA 4K94C 2DD8H 2GTZA 4PLKC 2VR4A 1KEMH 2XWJB 4LHQB 2DLFL 1OQOA 4GXUM 5HHQA 2UVEA 1UA6H 3TYGH 3NFNB 4XXDA 3BWAA 1RUAH 4OM0H 4N1CA 1ZT4A 3MOQA 1NAKH 2B4CC 3BX7C 2H3NB 1JNHA 2YEZA 3B9DA 4XNYH 2Y72A 3GSOB 2JCCF 5HSFA 2YBRA 4L8DA 3PXJA 5CSGA 2V17H 3CK0H 3TV3H 3GKWL 4N9GA 3EJZC 1BBJA 2VZOA 1VFOA 3Q5TA 1E28B 5TE6H 3ZL4L 4JG0L 3LQMA 3MRLB 1EFXA 3Q6GL 5FUZL 4F80A 5ALCH 4I3RL 1CU4L 3KLDA 5D7KD 4JDZB 5EOQH 4R8WL 2J1KA 2W92A 5CZVH 4A2MA 1CFNB 3O4LD 1F3RB 1SYSA 3MUY1 1XF2A 5KSVA 5CD5C 1D5XB 4JQXA 1ZVSB 2ZUUA 1NGYB 4QHUA 1A6WH 3RWCB 1WICA 4OUUA 4C56D 3LDBC 4XMKH 4AYFA 2APWA 4NBYB 4QLRA 2OQJA 3JWOL 2M1KA 4TSBL 5DA0B 4HJGB 1QNZH 4YHMH 3X17A 5E2WL 5E99H 1YC8A 1OPGH 5EU6D 4P46D 2E7CA 3CVIH 3WN5B 2ZCHH 3WN5C 5H35B 2AERT 1WTLA 2OL3B 3QUYA 3I6LD 1CXIA 2XFXB 4PJBF 1GGYA 1S7QB 5JW4M 1HN1A 4HAFA 1PSKH 3DI2B 4NJAL 3IKCA 4KUZH 5CJQL 2DL2A 3VH8G 3V5DA 5BRZB 4PJ7A 3M1BA 2OMBA 3BRFA 3P9MB 1L7TL 4L4VD 3WFHB 5SWSE 4JQVA 3BVNB 2AI0H 3U30B 1F3JB 1S7VA 15C8H 2K9UA 3PWUB 4LDOB 4NHCL 4M1DH 1U8LA 4PJAA 4RGMB 4RGMC 4NPYB 1FL6A 5FGRA 2E7HA 3HZVB 2A9NH 4Q7DA 1IKFH 5DK0A 4YHZL 1UENA 1P2CB 1DLFL 3G08A 3MSPA 3CJJA 3QFJB 4HV8B 1BP3B 1PDKA 1XGTB 3KPNB 4P23D 3AXLA 3REVB 3CSYB 5GXBB 3Q5OA 2H2PC 3KPRB 3LMJH 4PJHE 4OJFH 3DVFA 1A7PL 3ZSSA 1YC7A 1N0LA 2CH8A 2W9EL 4HH8A 3O41A 1HINL 3OL2A 3QI9D 5E2VH 3WXVL 1YEFH 3PGDB 1UYWH 1IGTB 3TNNA 2OJEA 4NQDE 3KPSE 3U2SA 2NCMA 1RURH 4Z7UF 1JGDB 4JJ5A 1BZ9B 4R96A 1ZV5A 2HAZA 4G7YH 2GJ6B 4LRIC 1Z9LA 3LRSB 1BM3L 1JK8B 5C8JB 1NUGA 5I8OH 3FFDB 2Z9TA 5TFSH 4XVTL 1HWHB 4JRWA 1T22A 2B39A 2GSGA 1BLNA 1EVUA 5B3JF 3HE7A 4TVPH 4KRMB 3QNZB 2BP3A 2GITB 3VGHA 4DKDC 4X98B 3QUML 4YBQD 5HHNA 4NFCA 5EO1A 4F7CB 1U36A 5ITBL 4P5KA 5DVMA 5IIEA 4PG9A 2MTPA 1I7UB 2Z4QB 3D85D 4D9RD 1D9KA 1K6QH 1ZHKB 4QXWA 4LMQE 5DJYB 3SKOA 4JFPB 2X70B 5KVEL 1T1XB 5D70L 1J0YA 4ODWA 2ZUTA 1T2QH 3VW3L 4MB4A 4X6DE 5I8EA 1PG7W 4Z6AT 5HHXH 5I18L 3R4DA 1W0WB 3GSQA 5T1LA 2EEBA 1R5VA 1VSCA 3MV7D 3S8WA 3OG6B 4ZFOL 2ZCLH 1IAMA 5ABDE 2BNQE 3WFZA 3CLEH 3ZT6A 5A2IH 1RZFH 5AG8A 1CK0H 2BHUA 5IF0B 4GQ9L 4KROB 2K1MA 4KROC 3EYOA 1ORSA 4RFNB 1S5HB 1XIWA 4RFNC 3MRJA 3I75B 2QBWA 1BGXH 1RFDH 3IDGB 1PLGH 3M8OH 2HT3C 3HNVL 4XZUB 3C9NB 5J11C 1YEKH 4LNVA 3F58H 4WHTB 4BZ1H 3BW9B 3ZHLA 5I30L 3UJTH 2NY2C 3LSOA 2R69H 3N85H 4F7EB 3NFSH 3PQYA 3JBG7 1J5OH 4NWTH 2IQAB 4W70A 1FNGA 2V2WB 1MUJB 4X0KA 1JUFB 2FJFA 5FF6A 1IGFH 3P11L 2VAAA 4DKFL 4QXUL 2G2RB 5DLML 2V2TA 3F8UB 5CMAA 2DOCA 1HOCA 5IB2A 1MHPL 1KSRA 5IFJA 3EHBC 4GKZA 1IE5A 5JDJA 2P7TA 4H8WL 5FIEA 4MNGA 4MLIA 1KJMB 2VKXA 1IC7H 3A67L 4XWGH 5DSCA 4F15B 4F15C 1OARH 4APQA 2NXYD 1MNUH 3I9GL 1G7MA 1HSAA 1PAMA 4D94A 1QO3B 4KMTL 4MJIE 3ROOB 1ZLWH 3SDXF 1J0JA 4UOW0 4YAQA 1C7TA 3LOWA 4ODTH 3I3BA 3MRRA 3WJLA 4PY7B 3N0PB 3EYFA 1XF3A 3H9YA 1I3GL 2YD7A 4Z95L 5J1SC 3OZ9L 2Q76A 4KJPC 1A7OL 3K2MC 5GRUL 2DQFB 1UM6L 1FCCA 4Z76A 3VG0H 5JHDD 4QGTA 5L9DH 3ROLB 4PJHF 3S88H 1J1PH 4CBPA 1NMBH 4P4KD 5JNYA 4NCC2 2AK1L 4OAWB 1FH5L 2X4OB 5K9KB 3KYKH 4ZFZA 2HMIC 5EIIB 3N1MC 5FM5M 1MJUL 1IFHH 5ALBL 4EUPG 2C1PA 3BGAA 5C2BL 2OSLB 1WEJH 4WO4B 3Q48A 4J1UB 3D18B 3FN3A 2BOCA 4JKWA 1D5ZA 4H5SA 3WUZA 4WV1A 2YPKB 4YK4B 4YK4C 2E5EA 5IMMB 5LJYH 3E0GA 1G9NL 4XAKD 3WS6A 2F53A 1FDLH 1A5FL 3I50L 1NBQA 5HHOA 3PNWB 5EZIL 1YZZA 3VD4A 4JY5H 4P9HH 4JPIB 4EN3C 4WDIB 1IARB 3C5SA 4Q9QH 1JF5A 3OGOE 3TEUA 5LGHL 5GGRY 1MLBA 5ESVB 4XPFH 1INEH 4M61B 4NKOA 1CICD 3ARWA 3BKCL 3ECBA 5IW1A 2EYRA 1KCUL 1GGCH 5T3ZD 4GAGH 1JMZA 2N7BA 2X89A 5B39A 3MA9H 5D7JC 4YGVB 1U93B 3L7EB 3V52H 1F4YH 4GW1A 1ED3B 3T2NH 1QBMH 2BVQA 4L3CA 3M17A 3NCCB 1FBIL 3MNVA 3RKPA 3SDYL 1T83C 2ADGA 5D72L 4X8JA 2NXZD 2I25N 5HJ3B 4PJCB 5KW9H 4W4OA 2R0KL 5TPWH 1FV1B 4D0DB 1GZQA 4X6DF 2JELL 2ZG3A 3C60B 2HKHH 1KB9K 3C60C 4Q58C 3RBSA 4OGXH 4WRLA 3LKSB 4RFEB 4F7PA 2CMRH 4CADA 2X44D 3BSZL 1KLUB 3QQ3B 4P4RB 5JO5B 4LLVA 3U7AA 4OCMC 4ZS7H 5DFTA 1E4JA 2VXQH 5FYLH 1JWMB 3WFDL 1LE5B 2BDNH 4MQ7B 4OFIA 4YPGB 5C0RL 1YMMA 5LXGL 4UILH 5HGGS 4DUWA 4L3ED 3RL2A 5I15H 3VH8A 5DS8A 4FFWC 1NCDH 1QSZA 1L0QA 4RMQA 1RZ8A 2GFBA 2Y5TB 1GGBH 4HIHB 2BK8A 1KJVB 2DQUL 3ELAT 1F6AB 5K93A 4OI7A 4S1SH 2N4IA 5I1JH 1MFCL 4YXHH 1DUYA 5GS0H 2V5SA 1U8MB 1GIGL 2HFEA 1EHLH 5CEXA 2HVKA 3S98A 1Q9KA 4O02L 3DO7A 4GRLD 5EIVA 3IGAA 3LCYA 4BFEA 4DN3H 2IH3A 1K9TA 1IC4L 5JMOC 3SKJL 3MUHL 3IAQA 5F1SA 3VXOA 4HUWA 2FJGA 2WV3A 4RZCA 2HJKA 2O5YH 5EBWB 4KKCC 4KTDH 3PHQB 3WJJC 3DURB 3QUKB 4OCYH 3MZGB 3RZCD 1CFTA 1U8NA 4NQED 4JJHA 3NACL 2LU4A 3TBVB 1Q8MA 2HLAA 3GMMA 1CTOA 1RK0B 5DF0A 1RJCA 2WNGA 4MJ6A 5J3HD 5BS0D 1OTSC 1YQVL 3L5IA 2CO6B 5H94B 3QO1B 2VAJA 3DHJA 3VXUD 4KKAD 3MCLH 3MXVH 5E24E 1DFBH 3MLPA 2Y6SC 4Q97A 5C0JA 1A9BB 4HD9A 3U79A 3CMGA 1KXTB 1JZ2A 4R4BB 4PJFA 1HYSC 1HQRB 3SDAA 2EZ0C 4X99B 4KC3B 2BVUA 5DRXB 5F1IB 4NSKA 2WUBH 5HPOA 1FIEA 5CAYB 2A9ML 3MACL 2CR6A 3QHFL 4L9DA 3HG1A 1FAKT 5ENWB 5J56B 3RJDA 1J1XL 3KPQA 1HHJA 4LSSL 3QULA 1VGKA 5D7IE 2LVCA 3V4VL 5I71B 3BQUA 5EU6E 4BKLB 4GAYA 1UB5A 3S4SB 3HPJB 4LEOA 1EO8H 4PRPD 3D3VA 1SJEA 2I5YH 3I6LE 2QSVA 4ODXB 4LL9A 1BEYL 3MYJB 2V5MA 1FYTB 3MXWL 4MXWL 4LVHC 1OCWH 1F3DJ 2SEBB 2BJML 4FQQA 3L3HB 5C0AD 1OGTA 4WW1B 5JIIA 1VFAB 3V6ZB 1YQ2A 2NW2A 4MD0A 4X9GA 4QOKE 4FXGB 5T3ZL 2QHLA 3P0GB 2YD4A 3QCVH 3RTQA 4ETYA 4XP1L 4HIJA 4WWKC 5IT2L 4UT6H 1CGUA 4OLWH 2EEAA 5KSBF 3FQNB 1BWWA 4U6HB 1J0KA 2BRRL 1GGTA 5H2BA 4MJ4A 2WQRA 4PJIF 5KZCB 3ARGA 3VWKA 3HCVB 4LF3B 5BZWB 3GO1L 3BXNA 3CXDH 1AHWB 5IMOA 1AHWC 4Y8DC 3AC0A 1KB5B 5J4MA 3HC4H 4R0LA 3UTQA 4PRIA 3U83A 2I07A 2Z31B 2BX5A 4E41B 1U8OA 3OKDB 3TBSA 3UCRA 1H5BA 2H45A 4Y4FA 3VXPA 1AP2B 3TO2B 3UO1L 3HE6D 3MV01 4LHUA 1A6UL 4PS4H 1N5AA 3GRWH 1KJ2A 4NC1E 4D3CL 3QG6A 2AXHA 4K2UL 1RAMA 4YDKL 4OZHA 1PX3A 5CILH 1I3UA 4UT9H 3FZUD 5D5MA 1BFVH 2WW8A 1HHKA 4I5BB 4WFED 4OLUH 3MLRL 4QRSB 3UXFA 4D9QE 4Y5YA 5GHWH 1BD2D 3SKMA 3UTTA 1ZLUH 1H3GA 1QRNA 5DFWH 1ERNA 5I2IB 5K9OB 2BC4A 3T04D 4CKVX 5SWSA 2N7AA 5CGTA 4KKLD 3VFUB 1YYMH 1QQDA 5BVPL 4LPXA 2Y23A 3CCHA 1BX2B 1M1SA 5HI4D 2HVJB 5DUPH 1OTUC 5F7WC 2P44B 4ZAKA 1KFAL 5E94B 1FFNA 5SX5H 1Z0NA 1F8TL 1I8LA 2JB6B 2DLFH 5C9JA 1A47A 3O9WA 4HG4K 3QDGB 3A6CH 4HGWA 4XGZA 4Y5VA 5E4IA 2VRAA 4ZS6D 1P4BL 5LCVL 3RZWA 4LEXL 3O2DL 2IADA 4GMSL 5BMFL 1IGCL 2VL4A 4G80A 4L9LB 4L9LC 1I7TB 3DRTA 2XA8H 2BVOA 4JVUA 4RGNE 1V7ML 2FWOA 5EFIB 4AM0A 2MHAA 2I27N 4JFOB 5GZND 4KDTA 4ZOCA 4LCIH 4S1RL 3VXMB 1S5IH 3KNBB 4Y4HD 1U91B 5DQDH 1SQ2N 4I3RH 2XTLA 5GSRA 5C0EB 3HZMB 4R8WH 3QPXH 1A14H 3RWJA 4LARL 3BJLA 4MDIA 4Z0BL 3KYAA 1NAMA 3UTZB 3OF6D 1FZJA 1RZGA 3IJYB 3QDMB 3QR2A 1II4E 1A3RH 4BELD 1FE8L 3C08H 4TTDC 4BZ2H 5DMJB 4Q9RL 4M43L 1MQKL 2P8PB 4MWFB 4AH2A 3JWNC 1TJHL 4TPRL 2F5BL 4K3GA 1DUZB 4LCCB 4PGEA 2EH7H 4X7FC 3MBEA 4OLXH 5D7IF 4M1CD 4Y19B 3VFMA 4HKBA 4ZD3L 3NZHL 4DEPB 3C8KB 1BQHG 1PVHA 2VZTA 4J3OC 5CGYC 1KIPB 3KYNB 4GG8A 4WUKH 2FCBA 4ZFGH 5IW6A 2W0PA 1BOGB 4P5MB 4LLWB 4BUGA 4JDVB 1KN4L 4JFEB 5FGCE 4IEFB 1CDCA 1QFUL 1AXIB 1CD8A 3IFNL 3B9KA 2D3VA 2EC9T 3FOMB 3EYSL 1HEZA 4MDJB 5EC1B 4IS6B 5E4EB 5E4EC 5IB5B 1DP0A 4GJTB 4WI4A 4F9PA 5EIQA 4JRXB 1ADQH 2BNQA 4OGYL 4JFYA 4EXPX 3CMOL 4XI5D 1O0VA 1XR8A 1IKNA 4YHZH 1G84A 2DBLH 1DLFH 2VN7A 1A8JH 2W60A 5EOCL 2F58H 3CFEA 4KQ3H 3LEYH 1OAQH 1DANT 3EYUH 3H3BC 4D0CA 3PDOA 1GHFH 3N1QC 4HX1B 2ED9A 1HXMA 4JRYE 5JHDE 3OKKA 1SVZA 1C5CL 2BNRE 4LLAA 3GSNB 4DK6A 1A7PH 2PR4H 5DO2C 2W9EH 4NNPL 1MRCL 5DJAA 1DBKL 2B0SH 3I6KB 1WBXA 3SE3A 4WU7B 3QQ4A 4WI5A 3SDCD 3VGAB 4QTHB 2XPGA 2AV7A 4MS8C 4XCNA 1UKTA 5I9QC 4PUBH 4XH2B 2B1HH 3EO1B 5LWYL 5M7QA 1G7QB 3FO0L 5IFAL 3GUTA 4ONFH 1QSEB 5AUMB 3QQ9C 3L6FB 2GT9A 3IRPX 4HS3A 4YDIL 5ADPL 4XVJL 3CXHJ 1INDL 3P4NB 1DEEB 1FRGL 4M7KH 1HWGB 1AD9A 2WK2A 1I8IA 3FHQA 3Q3GA 1UH2A 5T3ZE 5B38G 3JV0A 3OKYA 3QUMH 3RWGA 5IQ7H 3EFFB 5LQBH 4OFYA 1T89C 5ITBH 2Z93A 5DJZB 2H1PL 1P9MA 3HRZB 4Y2OA 5SV3A 1TLKA 3FOLB 3DV6B 5GRVL 1FO0A 4G7VL 4RAUA 1I9JL 2G9HB 3ZHKA 4ZSOB 5KVEH 4RIRA 1U8KA 3K74B 2APTA 2ZJSH 4XCEB 4H0IA 3RWIB 3R8QA 4LPUA 1W0YT 4PLKD 1NBYB 2AJSH 3BN9C 2P8LB 5I17A 5ESQB 5INDA 3QFDA 3C09B 3C09C 3MRGA 3BP5A 3RKDC 4E42B 3QIUA 4KVNH 3L3JB 1GC1H 1CE6B 3MRPA 4LDLB 2HRLA 4G9DB 1TNNA 4X5WB 1XMWA 3EJZD 3HNVH 1A9EB 3CIQA 4M6OL 3MOAL 3QWRA 4EDXB 3EOAA 2G5RA 1J8HB 2IQ9L 1NGWB 4ZPTA 3RY6A 5E8EA 4KTEL 4CVWA 4JQVC 5TQ2L 4MAYB 4Z9KB 4IOFC 2FBJL 2W65A 2CDEA 3H9HA 5CD5D 2DQHL 5BV7L 5L8LB 4KI1A 4HK0B 4LBEA 2VUYA 1F4WL 3TIDA 4ALAH 4YDJA 1DQMH 5GS3A 1X7QB 2JJSA 3H6JA 3P11H 4OFPA 5DZNA 1BECA 1T04A 1ZSDB 2OP4H 3U0WL 4UDUB 4IRJB 1MHPH 1Q9LA 2GSIA 2EDNA 4NQCB 1C1EL 2J8HA 5JDSB 4NQEE 1VPOL 3CDFA 4JKPL 1U6AH 3D69A 3A67H 2MQCA 4C57C 5IHUL 1NBVH 2R0WH 1CTNA 4PV8A 2BMKB 1H15A 4B5EA 4CAGA 1UWEH 5ILTL 3QA3A 3U9UB 5EN2A 5IB4A 3GB7B 1CGTA 3I9GH 4YX2H 1T5WA 5BS0E 2ITDB 1FSKB 1FSKC 4DN4H 1Q0YL 1TCRA 1N0XL 4K3JL 2A6KB 1M6OB 4BFIA 5BRZD 4J3SA 1OY3B 4JFHD 1YYLH 4K8RL 3TP4A 1JRHI 4UQ3A 3L5XL 4G43A 1UM6H 3DMMA 1FAIH 1RMFH 3QNYB 4MNQB 3VRIA 2GJZB 1RJZA 3KHQA 3PL6A 5D1QB 5D1QC 4ZUVA 2AK1H 2VDRH 5CHNA 5IFHH 4R90H 1ACYL 2BOBA 2NLJB 3ZHDA 2V7HA 3QFJD 3WFCL 3HNSL 3DIFB 2IPUG 1NFDB 1Z2KA 2YPLE 1TCMA 3H9SA 1CGWA 3MZTA 4X7TB 2H2PD 3KPRD 3LQAL 1T80A 1RIUL 1J88A 1RZJL 3BIKA 3RNKA 5C0IA 1D9KC 3U48A 1A64A 3CH8A 3SKOB 1A5FH 4HUVB 1V7NL 4G6AD 3H42L 1A4JB 1WWCA 3SE4C 5D2LF 2R1WA 4C58B 2JB5H 3Q0HA 1ZLWK 4FRWA 3RPIA 1HXYA 1BIIA 3FB8A 4DVRL 1OP9A 5DZOA 1U95A 1AXTL 4UQ2B 3QEUB 3SKUD 5DJ0A 3O2WH 1A1MB 3VXRB 4IIQB 1M05A 2OJZL 5FM5O 3FQRB 5A16B 1FFOA 1BVKA 4NM8H 1XGYL 2NTFB 1NEZB 5F96L 5GQBA 5D72H 3O4LA 4F7MB 1JWUA 1ZT1B 3S37L 3P4MB 3S37X 4Z8FH 3GMOB 4RDQF 2BY1A 4HT1L 4K94L 4TUKH 1Q0XL 4RDQG 2FYYB 4I4WA 4HW6A 2MJWA 4C56A 3C6SB 4RMVA 3BSZH 5DD1H 1IC1A 4NO2B 2CK0H 2FATL 2B4CL 3PUCA 4ZQKB 4GSDH 4OQTL 5I19L 3EO0A 1F13A 5AYUH 1R3HB 3FQTA 3PQYB 1MJ8L 2R56H 2VQ1B 5D7LB 2UWEB 1G7JB 5HTSA 5EU6A 4P46A 3EFDL 5JQHC 4I48B 4N0RA 2XZAH 3ARXA 5JXEC 4WFEE 2MQ3A 2VDOL 1AGEA 3MJ9L 3BP7B 5IJKC 3O3EA 1JI1A 4LSQH 1QLFB 3RDTB 3RDTC 2NY5H 3SGDI 1U8JA 3MLSH 4YHOL 4L4VA 1MCNA 3U36B 5CP7A 1KCRL 1MFCH 2ZG1A 4KROD 1MRDH 4RRPG 3JV4B 1MLCB 1LK3L 5F7EH 3FT3B 4FQ2H 2FL5A 5F8RC 4O02H 1H0DB 4HHAB 4BSWB 3S36L 1CR9H 3S36X 4HBQA 3DX9B 1MCQA 2FD6L 4J6RH 4KTYA 3TO4B 3TO4C 1IC4H 3VGFA 4ELKA 3MRRB 5K59E 3WJLC 5A3IC 3DETC 2NY2D 4MD4A 4PB0L 4G42B 4P23A 2VLLB 3TA3B 3TA3C 3S34H 3SE9H 5MERA 3WD5H 3ZMRA 4FTVE 1XGRA 4ZXBA 3T3ME 1A7QH 3MROB 4IRSB 4LSPL 4Z0XA 1MCJA 1KLGB 2OL3L 4NO5B 2J8UE 4H1LH 1DBAL 2J3SA 4PJ5B 3QI9A 1VESA 1H8NA 2DLTA 1EEQA 1UVQA 5EBLB 3TJEH 3EHBD 4XNZC 3WIHL 1MOEA 3I85A 3MRFB 3MO1A 2D7NA 1GH7A 3W11D 1T7YA 4HF5H 3G5ZB 5T5FH 1BAFH 3HUJA 1KT2A 2GTWA 5E2TL 2KL6A 4WV1C 4OZIA 1YEGL 2XRAH 3W0WE 4C83A 3SO3C