1DBML

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
b'DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL01
4DEPB 2DQCH 3H6JA 3ARED 4WENB 3MRMB 5ITBL 1J0YA 4PJ9B 2YK1H 5CAYB 5EC2A 1UXSB 4NM8H 3FCTA 5LGHL 2R4RL 1RZKH 2VXUL 1ZVSB 2NYYD 4MXWH 1BREA 2Z8RA 3MBEA 4MA8L 1KGCE 2APTA 4MDIA 1S9YB 4HQQL 4M62H 5F1NA 4WO4B 3S37L 1Q0XH 2ICEB 4XPBH 3QQ9D 4G6MH 3T0EB 3AREC 1C16B 5DYOB 4HIEA 4OLXL 3FAXA 4MWFB 4ZG1A 4DK3A 3ZMRA 1P7KA 3O6MH 2EE3A 1PQZA 3BP7A 1RUQH 4QGTA 3BFOA 4TNVK 2ZSWA 3G08B 4R97C 4LASL 3EYSH 1FZKA 2DKUA 4Y89A 3PL6B 2FL5A 5DQJA 3D2UA 3I2CH 3H0TA 1MCOH 5D7IF 1CCZA 3IFPB 2I60H 1HHHB 4HEPG 3L3HB 2BVUA 4FXGB 4HPYH 5GGRY 3V5DA 5CBAA 1I85C 4QNPF 4X80L 1N4XH 3VWKB 4D0BB 1QRNA 3ZDYF 1BZ7B 4C4KT 4EDXB 2ED7A 3DROB 2A73B 4JHWH 1I7RB 2O5ZH 4ZUTB 4LQFL 1TJHL 1ZHLB 1WCQA 2DQHH 3A6OA 3L5IA 4U2ZA 1G7LA 3WNNA 1MHHB 4YHOL 5I1CH 4IOIB 3V6OE 2JJTC 2GIYA 1JI1A 4MAUL 5IFHL 2VLRD 2W65A 2QADD 4R4ND 5DXWA 3TN0D 5DSCA 3V2AR 2A0LD 2AEPL 4GH7B 5MI0B 4X98A 4LFHD 5FM4A 2YRZA 4LLVA 2PCPB 5IB2A 4X7TA 2DBLL 5I8OL 1T2QL 4OLYL 4HLZG 4XNUL 5T3XE 1K8DB 4HH8A 3HI5H 4MNHB 2F5AL 3GBLA 1FNSH 4JFDD 5C6TH 1M7XA 4XPTH 5ERWA 3ROLB 1RVFL 2GHWB 4TNVF 3QUMA 1G9NL 1FYTA 2VITA 3PXJA 1JZ8A 2IADB 1AGDB 1IGFH 2X1WL 5CHNA 2V5TA 1F4XL 2PKDA 5D1ZD 2OJZL 1N3NB 2A0LC 1FBIL 2A9NH 4XP5L 1DBBL 4Y19E 4LARH 1QR4A 4XHJD 3LH2L 1FVCB 4JM2A 1CD8A 3BXNB 5L2KE 4FRWA 5EU4A 3GEWB 2NXYB 3IB4A 3OGOE 4IRJA 3QO0A 1W2KT 4MQXC 2XI9A 4QTHA 5F7DB 3LRSA 3S3PA 25C8H 1S3KL 1AY1L 4QHNB 4LPWA 1A22B 1L7TH 4LPUA 2NR6D 1C5BL 3VXNB 4R6UA 3STLA 1AE6H 5I1EH 1KJ2L 2PXYC 5DWUH 1HINL 3Q3GB 3JV6A 4KU1A 2NY6C 5B39G 5I6XB 5FYJD 1JPGB 4Y19B 4KQ3H 4XHJC 1JBJA 3P4LA 1GHFH 1MWAL 2DLEA 2EDWA 5MERA 4D2NA 4GRLA 2I9TB 1U93B 3V4PL 5D71L 2FJGA 2APBA 5DD1H 5L2KB 2YD9A 5JW4M 4Z76B 5H2BA 4QT5B 2GY7B 1JHTA 5C86A 4F33B 2HVJB 4YE4H 4ALAL 3LB6D 3MOAH 4Y4KA 2NR6C 5JDSA 4OZFH 3AY4C 4QRUA 4MAYB 2QQKH 1WCBA 4XVJH 1CE6A 1EIBA 4K8RC 1MELA 3LMJL 5DJAB 3IYLW 4E5XB 3QNZA 1U36A 5J6GA 4P9HC 5IHLB 5ICXB 2X1PA 2X2YA 4IJ3B 3IXTA 3NCMA 3MBED 1FC1A 1UB6A 4LMQI 5D1QC 4XBGB 5I1DB 2J8UF 1DUYB 4OCRL 4PB0L 5F9OL 2AXJA 5A2FA 2IF7A 2JELH 5F9AC 2MSPA 3QULB 2WUCL 2Q3AA 3CDFA 2WSKA 3MGTA 1HH9B 5DJZB 3C5ZB 5LCVL 2FEDD 2FB4L 2FZ3A 3O9WA 1ZLSH 4I4WA 1S7WA 3DGGA 4FQHB 2VL4A 5EZOL 3RTQB 3T8XA 5IMMB 4O4YH 2W9EL 4U1NB 4H0HB 2IH3A 1MPAL 3BP5A 4L3CB 3D85B 3I9GH 5F7HA 3D2UD 1K6QL 5DHXB 4ONFL 3MJ6A 4EI6A 3EFDH 4JRXD 1RIHH 4RZCA 2R2BB 2P24B 4QWWD 2MOVA 1QFWH 5B39A 2GJ6D 4NQXB 3GKWH 1CLYL 1H8SA 1QRND 3GHBL 4NWUH 4D9LL 4P2OD 2VC2L 1FORH 4RX4D 3ZT7A 5FYLL 1JYXA 5CGMA 5IB4B 3O81A 5DMGC 1X5IA 1H9VA 4PRNB 4GSDH 4MHHI 1CLZL 5CIPA 3C6LB 4XNMB 3UX9B 3QI9B 2H32A 5F1IA 1T80A 2Q7NA 3LS5H 3ZKND 1QLEH 1ZVYA 2Z92A 1OGAA 1D3CA 3V0WH 3HC4L 1QVOB 3JTTB 4C4KO 1V7ML 1HQRA 1M05B 1XIWA 3UZEA 4MA7L 5BZWA 3ULUH 1YY8B 1QFUH 1JNNL 2DYPB 2IAMC 4PRPD 5C0AA 1JHLH 4P2OC 4HUUB 3AMLA 1I7ZB 3QHFH 4LSDA 4K7PX 3DMMB 1MY7A 5TE4L 4DZ8B 3L5WA 4LVOC 5IMKB 3LRHA 3AC0A 3GSWB 3WUWB 4WW2B 4Y2DA 1UKTA 2ZG2A 4MA1B 3EOTL 1FYTD 2OXHA 1OD9A 4PRBA 1ZLUH 2XZCH 3LSOB 1IGYA 2YUVA 1OD7A 4U1SB 3BH9B 4NHUA 1QPPA 3SGKC 1HXYA 1EEYB 2X89A 3HMWL 4QY8A 4AEHL 5D2NE 3EAKA 3TESA 3WMSA 4RFOL 4XRCB 5I74B 3V7AE 5DVMA 4MNGE 4RGOL 3KPRD 1YUHA 5BS0A 3L3KB 4FQ2H 4HPOH 5E95B 1PY4A 3P0VH 3ARFD 1F90H 5AZ2H 1CXIA 4MJ4A 4MB5A 2J6EL 3DI3B 1LP9A 4TOYH 4V1DE 4WI5A 5E2WL 6CGTA 4ODUB 5DTFB 3VH8G 3CSYA 2DOCA 4L1DA 4KDTA 4GMTH 4OCSH 4X6EA 4PRIE 4HC1H 5ELIA 5CLTA 1D5IH 5BCAA 3RX5A 2JLLA 3UPRB 1MIEH 4IS6A 5D70H 5CJ8A 1XF4A 1S8DA 3TO4A 3VFGL 1WZ1L 5C9JA 1V3MA 5DEGA 4NGHH 3GMRA 4GRLD 4ONHA 5KSAB 3DRTA 5MP6H 3EYFB 1R5WA 2DI9A 5I1AA 3WFZA 2V2TB 3REWA 4OM0H 2ITDB 4HS6A 1WK0A 4V1DB 1MNUH 1HHIB 1MF2H 4NNYA 5BZDB 2EYTB 5FA3A 1R3IH 3GIVB 3TIDA 1K3ZA 4Y4KD 1EEUA 3IAPA 3HLAB 4PRIB 3HE7C 1OAKL 1QG3A 1LO5A 1INEL 3TNNB 4XAKE 3L5HA 1AHWB 4IEFB 3RUGE 3L7EA 1CT8B 1BQLL 1NMBH 1VB9A 2QR0A 3F58H 2DI7A 1YDPB 3PE9A 4P3CL 3WLWD 4ERSL 2EDYA 4KMTL 5FEBA 1NCWL 1NMAL 1II4E 3VXSB 5EWIH 1DN0B 3GSOA 2AABL 5A2KH 3ARBC 5GGUB 2BZDA 3BKYH 3MRFA 3NN8B 1CFBA 1T1YB 2EKSA 5I15L 3BPCB 2CDGA 2VYRE 1C1EL 2F54E 5GGRA 1BFVL 3EO0B 2V9RA 2YD7A 3QG7H 3SOBL 2P7TB 3WO4B 1ZLVK 3QO1A 3K8KA 3U9UB 4PJ7B 1F13A 4DUXA 5IEKB 3MMEB 2PYEA 1CFQB 1DQJB 1DQML 2IQAA 4LEXL 4XWOC 3RUGB 3SDCB 2PW2A 2P44B 3KPOA 1T83C 1S7SA 2D7QA 3RZCB 4LIQE 4NUGL 4OZFB 3QHZH 1VFBB 4QRSB 4YZFF 1T21A 2GAZB 2VAAB 3QIUB 3F12B 4HX1B 1ORQA 5SX4H 3BEWA 3W39A 1NGWB 5D72H 2X1XR 3VFVB 2R2HB 3VFTB 4QHLA 3WFDH 4NT6A 2F54B 1KENL 1OTUD 3MV9A 4HG4K 2X9XA 4FTVD 1Q1JH 5DO2D 3TCLB 2P42B 2GQHA 5FM8A 1M1SA 1CDUA 2W60A 4YR6B 2H3NA 3ZTNH 3ZE1F 1RK1B 3O6LL 4G5ZL 5MEOB 4TNWK 5FOBB 3VG9B 4XVUC 4GRWH 1CFSA 3AU1A 4P5KB 3KYOB 3CU1A 4OSUH 4R2GB 5F7EL 2Y72A 5T3XL 4L3AA 3J8F7 3GZKA 4UV7L 1D9KA 3D9AL 3RGHA 1K4CB 1IT9L 3WNPA 5ICYB 1KLGB 4H0IA 4JQXC 1NANH 4B41A 5I1GL 4MSWB 4NZJA 3U7AA 2FYYA 1HN1A 4X0KA 3U36A 2Y5TA 4FZEH 4DQOL 1UM6L 5DO2C 3DVNB 2OM5A 5IIEB 1FIEA 3IS1X 2OR9H 4L4TE 3D18A 4LL9A 1HNFA 2AK1L 5EO9A 2XTJC 5BRZE 4HFUH 4DUWA 5LWYL 4EN3A 4KUZL 3BO8A 1D5BB 4AG4H 4O9HH 1WITA 3S35L 1MJJB 1HOCB 1BWMA 4HKXB 2P5WE 1KF9B 2VXTL 1U8NB 2HT2D 5TPWH 5I30L 2UVFA 4GAJL 3TBWB 1B88A 5JLZA 2C3WA 3FONB 4OCXH 1DBAH 4B0MM 4B53A 5DFVC 1HH6A 5FGBA 1UCTA 3CMGA 3GBNH 2FWOB 2YUWA 5FK9B 2BSRB 3FOMA 2X89D 5DRWA 4L4TB 4OLWL 5JQ6H 4TNWF 5BRZB 1NAML 2W0FB 4K3DH 4Y5VB 2MMXA 1CL7H 4WGVB 3TNMA 2DQIL 2FD6H 3T65A 4I18A 4PP1C 4J3VA 2P5WB 2ZPKL 5TFSH 3SQOH 3RWJB 4I9WE 5EOTA 2FX7L 2WBJD 2P47B 5L8KB 3LQAH 2O61A 3ZE0E 4NDMB 1T1ZA 5HGBB 4POZD 5DHYB 4R0LC 3VFSB 3JVGC 4LGRB 3VRJB 2X4TA 1SM3H 5E9DA 3B9KB 4MX7B 4PB9L 1JV5A 4KHXL 1UWXH 3TO4D 5C0GA 5HYJE 4F8QA 4KY1H 4G8GD 2FX8L 2DQCL 2IBZY 3I6KB 3FOLB 2EC8A 4GW1A 4B7LA 2YK1L 2D7OA 1LO0H 1JL8A 3GSNH 1KNOA 5F44A 3ZO0A 1RZKL 2BVPB 43C9B 4MLIA 1EXUB 4JLRA 4P5TC 3GDBA 5INDA 5BMFH 1SVCP 3EUUA 4Q7DA 4HH9B 1EZVX 2C1PB 3IFOB 4M03A 3D3VD 4M62L 4OZGA 1Z0NA 2GEEA 4I77H 4PRHD 4DTGH 3TIEB 3J7HA 5HYJB 1Q0XL 4LHUA 1ETZA 1TNMA 3L6FA 4OCWH 3RI5K 5C6WH 4BA8A 5EOQH 5ADOH 1F3JB 2PO6B 5HVHC 5KVGH 2BSSA 5IV2B 4AY0A 5IMOA 1P1ZB 2HN7B 1HWGB 2XWJB 5FV1L 5IR1A 3WHE0 2LTQC 5AAMA 2APXA 2EH8L 5EZLA 5F21B 3EYSL 1A5FH 1PZUB 1Y18A 5CCKH 2PYED 3I2CL 4NOBA 1NUNB 1MCOL 4OLZH 5AD0A 1R3HB 2I60L 3QAZC 4X7FC 1GXEA 1JPFB 5DUBA 3O41B 4JKMA 2YWZA 5F89A 3P9LA 1LE9B 2HYMA 3L5JA 3P4NA 2WUBH 5BOPA 3HC3H 2P8LA 2ORBH 3LKQB 3KPSE 4YK4B 5FYJU 3DBXB 4JHWL 5TGBB 3WO3B 2O5ZL 3ET9F 2DQHL 3UTZA 4OGAD 5FO9B 2GCYB 1LNUB 3N0PB 5B8CB 4OLVL 1BWWA 5I1CL 1U8JB 2W9DH 1FJ1B 1S78D 1A1MB 4H8WH 4K71C 1L6XA 1CGWA 4KRPB 4CVXB 3RI5F 4EI5B 3I3BA 3GMQA 4X6BB 4W4OC 1D9KD 3ULVD 3GO1L 5IVXA 4NO3A 3MRBB 2OI9C 5B3NA 4I0PC 2GK2A 3KPSB 5JHDD 2CUHA 2DS4A 4LSTH 4HBQA 2WBKA 5HDBE 1F4AA 4OGAC 5GPRA 4LNRB 3JZ7A 5J12B 3BUTA 3MLWL 5IFAH 1KBGH 1G1YA 2EYSA 3FMGH 1CGYA 1ZHKB 2ADGA 1IGFL 5DJCB 5C2UB 5K33A 3H8NA 3CCHB 3MRJA 2Z35B 3AROA 2ATKB 1I8LA 1NCUA 4FQXB 1R5VA 2A9NL 3SGDI 4LARL 4X9GA 2DWDA 2P8PB 4F15C 5ILTH 5CEZE 4FQIH 3FB8A 1KN2H 4Q9QH 2PUQT 5IBTH 1CN4A 4KDWA 4Y16C 3Q6GL 1NCTA 4KJWD 3K80A 1MRCH 4UQ3A 2FRGP 1D5ZA 4MNQD 4BSVA 2WQ8A 3CFBA 25C8L 1KIRB 1L7TL 3VGAB 2BSTA 1ZT1A 4OUUB 2XFXB 3KLAB 1IKNC 1B2WL 2JK5A 4OFPA 1ZVHA 1AGEB 1ZWIB 3DIFB 4KQ3L 1GHFL 1DE4A 5GGSY 1FFPB 1YN7A 4Z7UF 4ZNEA 5DD1L 1T7WA 3NIFF 1ONQB 3SKNB 4PJFA 4ODSH 1JK8A 4KI5C 4JRYA 2YRPA 5E9DD 2VQ1A 3MV7A 3OB8A 4YDJA 2X4RA 1A4KA 4YE4L 3MA7B 2DQUH 3MOAL 3V7MA 1RULL 1VADB 3LN4B 4KROB 2QQKL 2J8UA 4LVHB 5C09E 4M5ZH 2X1QA 3QXDA 5K9QI 4HIHA 4DGVH 1I3UA 3IVKA 2FIKA 4UNVA 4GKSA 1PAMA 4LF3B 3TCXA 3MNZA 2EE9A 1KIQA 2ILLA 4UINL 2F53A 1YEIH 3U0TA 5ISZD 5B3JF 1W0VB 1GGIH 1T7ZA 5E6ZA 2WP3T 3VFRB 3RIAK 5C0CE 1I1YB 1F6AB 3MV11 1P4LA 3R8QA 1QHPA 5FB8A 2JELL 4FNLL 2QV2A 2WIIA 3QQNA 4M48H 1NBZB 4BQBA 4Z78B 4ONGH 3NGBB 1N5YH 1HIMH 4Y7MA 5B21A 1FZOB 1J86A 5C09B 3K3QA 3JV0A 4G8EB 2G60H 2XV6B 1BZQK 1H3PH 2EECA 1TENA 1KT2A 2P48B 4GW5A 2UVEA 4HWBH 3LEXA 4QXUH 3HS0A 3X14A 3INUH 4O4YL 5HYSA 4U31A 3VXPA 4F3FA 3SDAB 3IGAA 3GSNB 1VGKA 1UM5H 3I9GL 4YHIA 1BECA 1DDHA 5C0CB 1BJMA 2V2XA 3IAQA 3ARPA 5KZCB 1T7XA 5HHOA 1GOGA 1RIHL 1QSFD 5IBLD 2PYFB 1X7QA 4G80B 4K7PH 1QFWL 5ACLA 2R2EB 3VRLF 3GKWL 3L3IB 1IEBA 4NSKB 5DMKB 3IAGC 1CGSH 1BD2D 1RK0A 3UJIH 4DKFH 4Z7WE 1E27B 1X4ZA 3GM0A 3RJQB 2RJMA 1NGPH 5C0NC 2NY1B 4TUJB 5FUZL 5LAXB 3KLDA 2X6MA 4GSDL 2ZG1A 4ELMF 2IBGA 5HJ3A 3O8XD 2W91A 3JUYA 4U33A 3LS5L 4XBPA 3RIAF 4UDUB 2OTWB 5I0ZA 1T89C 3V0WL 4PBWD 3PV6B 2E7HA 4NQEA 3G5YA 1CE1H 3G6JE 4JHZA 2HLAA 1OW0A 3TJHD 3ULUL 2ZSVB 4XTRD 3ALPA 4PV9A 1RHFA 1JHLL 2XZAH 1E4KA 2AK4A 4EOWH 3QDME 4Z7WB 1FFNB 4KJYA 3CFKA 5DJDA 5DS8A 1MFNA 4OTXH 3RWHA 2WM0A 5ACZB 1S9WB 3CDGB 1UZ8A 3QFJE 4WWKB 1NGYA 3MNVA 2XZCL 2GY5A 3K1KC 2AJXH 5L0QC 5HPOA 4JDVB 1BEYH 3MLYH 3MNWA 4GG8B 4JO1H 3PWNB 3G6JB 2H9GA 5SWZB 3DSNA 5TDOB 1H3UA 4L29B 4XTRC 4WFFD 4KK6D 1F4HA 3BVNA 1CBVH 4JFYA 3CAFA 1WWAX 3FRUB 3OKOA 3TF7C 2CK2A 3AS3A 1KYOK 5HYEA 3OKEA 4HPOL 3UTQB 3QDMB 1AGBB 1F90L 5AZ2L 4RAVB 4TOYL 1U8MA 4Y4FC 1IQDB 3VXTA 4HGMA 3RHWF 3V0AC 4BFBD 5B38A 3GFUA 3L95A 4GMTL 4OCSL 2PTTB 4HC1L 4ENED 1S9XB 1AKJD 4LKCB 4F2MB 1D5IL 2WANA 3TYGH 3MA9H 1U3HA 3AAZB 3OR7B 5DK3A 1QTYT 3FO9A 1MIEL 3OKLA 5D70L 4M6MH 2EZ0D 3MXVH 1U8QA 4YUEH 1CGVA 5DJYA 3E0GA 2IPTH 3N1MC 4NGHL 5DEZA 3WJJC 4RA3A 3WXWH 1AGFA 5MP6L 5T1LA 1FNLA 4OV6F 5JPNB 3P2TA 1I7TA 1J1XH 5EH1A 1WZKA 4OM0L 3QQ3B 1MF2L 3MRQB 3RVWC 5IW6B 1R3IL 4M7JH 3PABA 1YN6B 1R0AH 5D7JA 1A9EB 1NGXA 3SJVA 2AXGA 3BRDA 3QDJB 3MYJB 1N6QL 3CDYA 2MPAH 5J1SC 4HKBA 3I50H 4ZPVA 3ZKXB 1IL1A 2CDFB 3MLRL 4UU9B 5JUEL 2CRIA 3RNQA 3EDDA 1E4WH 2O5YH 4PJIE 4PY8I 1IC4H 1QEWB 5EWIL 4GXVH 3O2DH 4H5SB 1N26A 3MO1A 1S7QB 1M71B 4F57H 2F53D 4EVNA 3BKYL 1KEGH 2DMBA 1ZA3A 2I07B 3BGMB 4G8FA 2F8OA 1TZGL 1FO0H 3QG7L 1WEJH 4P4RB 2XNAB 1N8ZA 4OLEA 1AD9B 2XQBL 4R96A 5EO0A 5D7LD 2AEQH 4P99A 1KUMA 1MH5A 3D69B 3HG1A 2C3VA 1WBZB 4JN1H 2WBWB 2WP3O 4NN5B 3QHZL 3O0RH 4PJIB 3HNSH 5TE7H 3T0BA 4YXLH 3DO3A 4XX1G 5AAWA 1RUAL 4AM0A 4JZOB 1F5WA 3JSSA 2EDRA 1DL7H 2N4IA 3UTTD 3EYOB 4F9LA 1MHCA 5IVOA 3C9NA 3WFDL 4N9OB 1WFUA 4LCCC 1SYSB 2X05A 1CDYA 2ZWLT 4DN4H 4ORGB 43CAB 1BJ1H 3QDHA 1MREL 5D2LA 1T1XB 3G9AB 4UILL 4Y5XB 4CL7A 5HHOD 1I1AB 4O2CA 1NUFA 4TSBH 1IGJB 4HK0A 3C2AH 1ZLUK 3ZTNL 4ZFFA 1R3JB 5JR1H 4HMEA 1INQA 2J4WH 2ZG3A 1KPRA 4ELKA 4S2SB 1KXVC 5L8LB 4NZUH 4OSUL 5I16B 2FH6A 3DURB 4NQCE 4PJ8A 1NGQH 4PY8J 4ZXBA 3MROB 4S1DD 2V5MA 3B5GA 3O4OB 3W9EA 3FQUB 2YD3A 4P5MA 5GSRB 1T5WB 2CUIA 2VDKH 4F7EB 2ZUTA 4JFED 1FNAA 4YHKH 2OR9L 3RVVC 4W68A 1E6JH 5DRXB 2WIMA 2YSSA 4MVBD 4HFUL 5MENE 4KMQA 5DK0A 2FO4B 2ZKHL 4PGZA 4MMZC 4RQQB 4AG4L 4JVUA 3S4SB 1DLFH 1AQDA 4NZRL 1CU4H 4NQCB 5TPWL 3UTPD 1OOAA 3FB6A 3MC0A 2ZNWA 1U95A 2ARJA 4OCXL 1DBAL 2XZZA 3N85H 4TPRH 5CBEA 4CU6A 5EBMA 4Q2ZA 1AQKH 2VTFA 2Y06H 3PDDA 3ARXA 3ILQC 3MRMA 4PJ9A 1MCSA 3X13A 3RWDA 1T1WB 3IETB 4N0CD 5GGSA 1AP2B 3MRHA 5ESAB 4LDLB 5MEPB 4BFGA 1K4DA 4A6YH 5I8EB 5HSFA 1ZVSA 2L7UA 1YY9C 2VWEC 4Y4HA 3C60B 2P43B 2J6EA 5JQ6L 4RNRA 4JPVL 4K3DL 5MENB 5C0EB 1CL7L 4P48A 1M7IB 1S9YA 4JANB 5EULV 1RHHB 3VI3F 1RZ8A 4M6OL 3K4DA 3DSFL 1G7IB 1I9JH 5TFSL 1OAUL 1OARH 2DICA 3OHXB 3O45A 2PR4H 4IDJL 4LSQH 3ULSA 4WHYH 2DKMA 3TV3H 3JWNC 2ICEA 3P9WB 1EBPA 1R3KB 4GUPB 3T0EA 4YXKH 4RISH 4YBQC 3ZT5A 5DYOA 2DM7A 5IHZB 1T7VA 2R8SH 1UZ6F 4MWFA 5FYKD 3QNYB 4OGXL 3WN5B 4LGSB 4AENB 4Q0XH 1J05B 1A6AB 2R1WA 4KY1L 1BMGA 1C5CH 1OM3L 4HMCA 4HS8H 3BN9D 2BNRB 2IPKB 1C7TA 1U91B 3TA3C 1A2YA 2DWEA 1HHHA 3DV4B 3GSNL 2R56H 4FXGA 1C5DB 3FFCE 5GGVY 3RNKB 5BMFL 3VWKA 4D0BA 5BJTA 1BZ7A 4NN7C 4PLJD 3THMH 4YDLC 5IP4A 4HHAB 3SJVD 4QXGL 4D8PB 1MUJA 1F11B 3DROA 3DTXB 1UA6L 2A73A 1ZHLA 3D0LB 3B9AA 1YPZE 4DTGL 4NCC1 2E6QA 5CKGA 1DVFA 4OCWL 5I75C 4YFLF 2R9HD 1SBSH 2LVCA 4G9FA 4IOIA 4UUJB 5EOQL 3T2QA 3V5HA 2CIKB 5ADOL 3GI8L 5KVGL 4HEME 1HI6B 4MXQD 2NXZB 1I4FB 3C5JB 3C5SB 3MACH 4NO0B 4R4BA 3RL1A 4U6XB 1Z3GH 3R8BB 4HJJH 3MRLA 2IANE 3FFCB 4PG2C 1U8HB 3MLVH 4K3JH 1EFXA 1ZT7A 4P9HH 4GRMA 1OAYH 5IQ7H 4RFNB 4HKZA 1WBXB 4OD2B 2KDGA 1K8DA 3BW9B 2PW1B 2DB8A 4C83B 3MRNB 4OLZL 4YPGA 3R1GH 2HA1A 1IQWH 3HG1D 1XGTA 3GKZA 4HJGA 3A0OA 3QCTH 3ALWA 5EU6E 4LCWD 2IADA 1AGDA 1H5BC 1T0MA 3X12A 1C8PA 2ORBL 1LVEA 3V8CA 4MXQC 1D6EA 2NY0D 3SDDC 1QA9A 5D6DC 1HSBA 3OKDA 5CD3B 4PR5A 5DI8A 3UBXG 2IANB 4NO5A 1FVCA 3ETBF 2VXQH 1C08B 3F7QA 1RURH 3MLUL 3IRPX 4H8WL 3MFGB 4WW1B 3E2HC 1PZ5B 3BESR 4E0RA 1U58B 5GXBB 2NTFA 4PGEB 5F7DA 2J8HA 4H26B 1JF1B 4QHNA 3A6BH 1EJOH 3NIGE 4PJ8D 4ZXBD 5EU6B 1AXSB 3VXNA 4GRWF 1XH3B 3FN0L 3W0WA 1IEAB 5BVPL 1FIGH 5A1AA 4JKLA 3NZ8B 3A67H 4LSTL 1JPGA 4LCIH 4Y19A 3QISA 2CJUH 5E5UB 5IFAL 1KBGL 1DZBA 3FMGL 5HPMA 3LZFH 5L2KA 5IEHB 4P2RE 1KXTB 4RCAA 1CXLA 4YBHA 5I0DA 3VFPB 2G2RB 4CN6A 5T1DL 1CR9H 3B2UD 1RZGB 4F33A 1U8LB 3T1WA 5ILTL 4FQIL 5INCB 4NKIL 1QFWI 4Q9QL 5IBTL 4J8RB 3TM6A 3HR5B 2XA8H 5HHVH 2KZWA 1KYOJ 3WIIL 4H88H 1MRCL 2OK0H 4U1IA 1NAMA 3NH7H 5HHQB 2H2SC 3IDGA 2MCPH 5ICXA 4M1CC 2FR4B 3WYRA 4BM7A 3ZYJA 4JFQB 3WFCL 2QKIA 3H7BA 3BAEH 4XBGA 3U2SB 1CLCA 3WUWG 1KIUA 5DK2A 1DUYA 3BEVB 1JGEA 1TZHB 4RGNC 1Q72L 4LBEB 5KOMC 3QULA 5M95B 4IRSC 2ZOKA 4XB7A 2VLRE 4M7LL 4PJCF 1EK3A 5DJZA 4X6CE 3C5ZA 1ORSA 2HMID 3EOBA 3VJ6A 4D0CB 5I9QC 3DX6B 1LDPH 2GTZB 1R3LB 2DQUL 5IMMA 2OMNA 2E6JA 4U1NA 3MCLH 4OFIA 4YHYC 4PFEA 4JFDE 3JWDC 5A2LH 4A6YB 1QO3A 4Q9RL 5LQBL 4DGVL 1CXEA 4PYHA 5EBGA 5EO1B 1NFDF 5TQ0L 4WI3A 4QF1B 2R2BA 3E6HB 3KAAA 4AIOA 4JVWA 1YEIL 1SEQL 4AT6B 2Q76B 4NQXA 4ZS7L 2VLRB 1GGIL 2QADB 1VKXA 4OV5B 3TN0B 1FVEB 4X6CB 2BVQB 1NEZA 3D0VA 3QPQD 1DBJL 4OGZA 1BFTA 5IB4A 3V7AG 4X6DE 4R7DA 4XHQA 4M48L 3QI9A 5AWNH 4DGIH 4G9FD 3KPPB 1Z5LA 4ONGL 1N5YL 1HIML 3RVUD 1XZ0B 4JFDB 1X3DA 4JM2C 1DBMH 1QVOA 2G60L 4BK5A 4W6YB 5KW9H 1H3PL 2BK8A 2YZ8A 3BRFA 4HWBL 4UT6L 2EC9T 3T1FB 5KSUB 2ZZUT 3AM8A 2BXYA 4QXUL 1QR1B 3EHBC 2OZ4H 3RBGA 3INUL 5J89A 3L9RB 3BIBX 3MRKB 1RU9H 4NRXA 5EU5A 2AV7A 1XF3B 5D1ZB 1P69B 4HUUA 1H3TA 1G7HB 3QPQC 3DXAD 5KS9E 2UYLB 4APQD 2DLFL 5FYJE 4JO3H 4DZ8A 4U1JA 2XPGB 1F4YH 5IMKA 1JPTH 2HKFH 4X6DB 2EDLA 3GSWA 4WW2A 4MCZB 3QBTB 3DV6A 3QNXB 3VXRD 4PREA 1N6VA 1MLCB 3IXAB 1Z0MA 3HAEB 3LSOA 4Q58C 1FNGB 3BH9A 2B4CC 1YEGH 2LABA 3TGXA 4DKFL 1AJ7H 3GSUB 3BUYB 4YHZH 2VABA 2YPLD 1EEYA 3L1OL 2VDQH 2IALB 5L6YL 1V3KA 1R24B 2AJZA 3RY5A 4HT1H 5I73C 5DA0B 1BFSA 4WHCA 4OF5A 3E3QE 4EZMA 4YLQT 5FM5M 4APQC 3EIFA 1I1FB 3QZWA 1JZ5A 5HHME 4JHBA 2B0SH 1CE1L 3OJ2C 5JPMA 3KDMB 2EO1A 4MJID 5DTFA 5KN5A 4F7CB 1QFOA 5E4EC 3O6FC 3IDYC 2XZAL 3W0WD 4EOWL 3UPRA 2ERJC 2YD4A 4AMKL 4FQCH 4JKPH 2ITCB 4OTXL 4L8DB 1BBJB 1LE5A 3HFML 2CLRA 2AJXL 3JBG7 1BEYL 4HXAH 2V2TA 3MLYL 5HHMB 4JO1L 3QEHB 3ZKQD 2ITDA 3HMXH 3W81A 5MHSD 1P53A 5DUPH 1HHIA 1S9VB 3H3PL 3MBEB 4DZBA 2GSIB 2VDMH 3HLAA 1U3YA 3R06B 4ZFOL 3OKKA 3P77B 4MDIB 2IBBA 3VFNA 1CT8A 5ABDE 4XP1H 3KPTA 2Z8VC 1MCJA 1KN4H 5J56B 1G7MB 4JRXE 1A3RL 1N2RA 3EJZD 1YDPA 2H6PA 1A6ZA 3G5ZA 2WQRA 2JIXA 3VXSA 3F6IA 2GJ6E 3VDAA 2K9UA 1QRNE 2R23B 3UTSA 4EXKA 1ZANL 1NANI 4HIEB 2KZ1B 3TYGL 3MA9L 1MI5D 5F1OB 4U7SA 3BPCA 4ZYKB 5IHUH 4ZQKB 1EHNA 5T33L 4M6ML 5E8OA 5K59E 3BP7B 3MXVL 1A3LH 3ZTJH 1YZZA 2ZSWB 2NPLX 3JTSB 1DBKH 4OZHF 3U9UA 3WXWL 4PJ7A 2FL5B 3QUXA 5IEKA 5DQJB 3D2UB 3MMEA 1DQJA 3TP4A 1CS6A 4CJ0A 4Z7NE 1J1XL 1X6LA 4JRXB 1X4XA 4OZFA 2X4PB 4OAWA 3CXDL 5DGRA 4QRSA 5CJOH 1AO7A 2GAZA 2VAAA 3F12A 4PRPE 2GJ6B 3I6LD 1BVLA 4M7JL 1E6OH 1QRNB 4U7KA 1XIWC 1KEMH 5F72S 4P2OB 5EUOE 1A7OL 1R0AL 2HT3D 3VFTA 3IRZA 3UJJH 3JWOH 4HK3J 1TIUA 4QRQA 2F54A 4GBXC 2VZUA 4IDLA 3CXHK 4WEBH 1E4WL 1FYTE 3O2DL 3ABZA 1RK1A 3ARDD 1CL7I 5MEOA 5FOBA 2W65B 3I85A 8FABA 3CC5A 3C6SB 3KYOA 4X98B 4ODTH 4U1KA 4PRPB 2X4QA 1WEJL 4M6AA 5IB2B 1K4CA 8CGTA 5EUOB 5ICYA 1KLGA 3OX8B 1TCMA 4MSWA 1AD0A 4CJ1A 2KPNA 5ERWB 4ZUSB 1UG9A 3QUMB 4JN1L 3DVNA 2H8PB 2R4SL 2WW8A 3O0RL 2C1OA 1FYTB 2XXMB 1DL7L 2X5PA 1PEWA 5CHNB 1NSNH 2HJFB 4XC3H 3KPQB 5FF6B 2GFBB 4DN4L 5IM7B 3ISWA 1HOCA 4AEFA 4PGBB 1MLBB 1I3RB 3D39A 1JIBA 3C2AL 5E4IA 1OTSD 3BQUA 4MD5A 3ARFB 2J4WL 4LLYB 3TT1L 2EDNA 2ED9A 4UOW1 5F88A 3AGVA 1MCFA 2V2WB 4IRJB 3TC9A 3QO0B 1L7IH 2FWOA 4NZUL 4QTHB 1X5LA 4NKDA 2I9LA 3U4AA 1U9KA 2QBWA 1TVBA 2EDXA 2LFGA 4L4TA 3STLB 5ADPH 2QSQA 2Z8SA 3G9VA 5BRZA 2UWEF 3HTLX 4Y5VA 1GOFA 4JY5H 5BXFA 3PHQA 4HMDA 3JV6B 3WEXB 4G7VH 4XNZB 2ENYA 1RZ7H 2B7DT 2YS4A 2VDKL 1UFUA 4ODVH 4GRLB 4YHKL 1E6JL 5DHYA 3VFSA 1E4XH 3WS6C 3VRJA 1WC7B 2E27H 3QIWC 2C4FT 2J5LB 5H2BB 1UXWA 3OR6A 4JR9H 4PJDA 5H94A 1DLFL 5ESVB 1JHTB 3B8YA 3B9KA 4MX7A 4Y5YA 1YJDL 4LCYA 3RY6C 4Y4KB 3OV6A 5JDSB 3MJGX 5EB9A 3U9PH 4QRUB 2B5IB 3TFKD 1DEEB 4NN6B 3I6KA 5JZ7D 1TLKA 1WCBB 2Y06L 4FZ8H 1CE6B 2W92A 1MVFA 3DETD 2JB6A 5FHAL 4JRWA 3HRZB 1EO5A 4BZ1H 3ZDZF 5F9WB 2LQRA 5E03A 2ED8A 4A6YL 2W0LA 3H9HA 1KJ3H 4OCMC 3IXTB 1EXUA 1FSKC 3KPNA 4NFCA 3SE3A 4HH9A 4KVCH 1KACB 1YMMD 4WFGD 4XP6L 3L3JA 2JJSA 1FCCA 4JFXA 4FTVE 2C1PA 2DIAA 1I9JL 5DJ0A 4HC1A 1OARL 4HIXH 5EZIH 2PR4L 3TIEA 4HSQA 1S7XA 2JIXD 1K5NA 3VGFA 1A6TA 1F3JA 1GGCH 3DWTA 4RISL 3MREA 2HN7A 3ULVH 3RDTD 2R8SL 2XWJA 4I4WB 4PJBF 3DGGB 4Q0XL 3T8XB 2ARJQ 4OI8A 3O11A 3TWCH 3WKNA 2XWTB 3ARGD 1C5CL 4MD4A 3MLTA 1OGAE 4HS8L 3QUXD 2BHYA 1IKFH 5DA4A 4FTVB 3O3BB 4XPHH 4GQPH 1EA9C 1R3HA 1I8IB 2R56L 5HGAB 4M93B 1AO7D 3V4VH 1JUFA 2VZVA 5SX5K 3LKQA 2H45A 2VO5A 2HKHH 3B83A 3DBXA 4N9GA 4WFEE 3S88H 1PG7X 4Z7OF 4TVPD 5FO9A 3OG6B 5CIPB 1CIDA 3UAJD 5CZXC 2H32B 3ARGC 5F1IB 2XIDA 1SBSL 1U8JA 3GMNA 1YEKH 1FJ1A 4CU7A 2AS5M 2B1HH 2Z92B 5F1KC 3H9YA 2X70A 1RFDH 3OJDB 3PQYA 5CILH 5J6HB 1TTGA 3OG4B 3F5WB 3MACL 2X44D 1HQRB 1EH9A 1Z3GL 3QRGH 1NEUA 4LRNH 5FYJL 5DUMH 2OP4L 2MHAA 3MLVL 4K3JL 5T3ZE 1J5OL 5SWSD 2C26A 3PG2A 2V5SA 4P9HL 1OAYL 4L9LC 5IQ7L 4FFZL 3P73B 4L8SA 5BS0E 1CFVL 1WICA 1LP9E 3L5WB 5FKAB 3WXVH 5IJKC 1P5UA 1UCBH 4CMHC 5CP7A 4GT7A 4Y2DB 5J3HC 4R0LB 3SDYH 3QXVA 3CCHA 1PSKH 3NTCH 1HXYB 5D96C 4QY8B 2XYCA 1WFNA 4NIKB 1VFOA 4WCYH 1QFPA 2VXQL 5HVGB 4MMXC 1YUHB 5BS0B 3DPBA 3I3DA 3SCMD 4K94H 1LP9B 5IOPA 3LAFA 5KSBE 2WBJB 3BWAB 4NHCH 1DQLL 4K7PY 5HDQH 3A6BL 5I18H 1EJOL 4X6EB 3MCKB 1A6VH 5IB1A 2VDNL 4OUUA 5H37H 3LCYA 2NW3A 2CO6B 5I1IH 4IS6B 4JO4L 1QBML 3LQMA 1LK2A 1S8DB 2YD5A 3A67L 3TO4B 1ZWIA 4LCIL 4NNPH 4JPKH 5DEGB 3GMRB 4N8CH 5EU3B 1FFPA 3DUSB 3DRTB 3VMOA 1R5WB 5I1AB 3SCMC 4V2BA 1ZHNA 3SKNA 2RFXA 4RMSA 4HS6B 5KSBB 4LP5A 2LTQB 2EICA 2AQ3A 5D1XA 2R1YA 3BT2H 4ONOA 4C56A 5GHWL 3O3EA 4E41A 1LO5B 4CW1B 2YRLA 2PYEE 5LG1A 1ZHBA 4EIZC 3CFJB 3L7EB 2XA8L 5HHVL 3PWJB 4DKEL 5L9DL 1WIOA 5C07A 3D3VB 1O0VA 3LIZL 2OK0L 2BHUA 3B8SA 3TH2T 4XNYH 3I6GA 4GAYB 1ROWA 4N90D 3NH7L 4GKZB 2MCPL 1RJZB 1QLRB 2OJEA 3GSOB 4OCNC 3EYVA 5EBWB 1FGVH 1W8NA 1NC4A 3MRFB 1FE8H 3BAEL 3MV8A 2EKSB 2CDGB 4FQQB 1YECL 4PP2B 3HRPA 5GGRB 3VFRA 4WV1A 1ACZA 2XY1A 5HI5C 1SMAA 2FEEI 3M07A 2ESVD 4KHTH 2P8MA 4KRNA 2NY2D 2ADFL 3QO1B 2XN9A 1NBZA 3F7PC 1WWBX 3WSQH 4LLMA 4Z78A 3H42H 1SEBB 2PYEB 3EYUH 4WEMB 5IBUB 2PW2B 3D1MC 2BNQA 3KPOB 3UJTH 4G8EA 1MRDH 3BP4A 1LDPL 3G6AB 1T21B 5KJRL 2Y7QA 4UAOB 3W39B 3IU4H 3ULVE 2CGRH 5DD3H 3QUML 4GOSA 4RWYH 2E8ZA 5JHDE 3GSNA 3SKJL 4ZNCD 5C0DA 5C0CA 3TPUB 3CXHJ 1CVRA 2Q86A 4YQXH 2PYFA 4R4FH 2BY3A 3ESUF 2D4DA 2R2EA 5JOPD 3VGBA 2VSDA 4P23D 1TDQA 4NM4L 3VWJC 2R0ZL 1FN4A 3AU1B 4LPYA 2FBOJ 1I8LC 3LV3B 4QLRA 1D9KB 1QD0A 3SKMB 5AWNL 4DGIL 5EUKA 2LU4A 5CMAB 2J88L 5JHDB 1L6ZA 1NJ9B 2Y5TB 3PQYD 4OF7A 4BH7B 3PV6A 3RZWA 2OSLB 4PBXA 5KW9L 4LMQE 1CZ8H 2ZSVA 2OZ4L 3D18B 3U7YH 3SY0A 5EO9B 4QCIB 4P23C 2OLDA 4EN3B 1RZIA 1O7SA 3OL2A 3BO8B 1IBGH 1NDGB 1MFDL 4OBRA 1HYSC 3LOWA 1JPTL 3RUGF 3ZE2F 1SVZA 2DIJA 5ACZA 5CLWA 3S36L 5JLZB 5I71B 4G8IB 4PRDA 4F80A 3CDGA 1RZJC 1HH6B 2VN7A 3CSBA 4H1LH 5E9DE 2ENSA 1YEGL 1AJ7L 2AJYH 3G6JA 4YHZL 5EA0H 5SWZA 3FOMB 3IDNB 1ZAGA 2VDQL 5IF0B 5C7XL 1KCRL 3ORJA 5DRWB 3FRUA 4M8VA 1DANT 4LVNC 1CF8H 2YPVL 4DFIA 5A2IH 5EIIB 5JW4N 4ZOAA 3T65B 4I18B 3K81A 3QDMA 1OP5H 2B0SL 4RAVA 2R0LL 4TVSa 5KVEH 5EOTB 3BHBA 1IQDA 5E6ID 4YEEA 3HUJF 3P4OA 1T1ZB 2XACC 1X5XA 1CICA 3TVMC 2PTTA 4IHOB 4LKCA 4F2MA 2X4TB 5E9DB 2F19H 4Q6IB 2CR6A 5HYQB 3WFBL 3GIZH 1JV5B 4JFHD 4JKPL 4NBYB 4JG1H 5KTEH 2O93L 3STZB 5C0GB 4CKVX 2V5YA 2EKJA 4U6YA 3KHQA 3VI4E 5JPNA 2FGZA 5A40E 3HMXL 3IJYB 3HC0A 5E6IC 4X9BA 3QXWA 3MRQA 5D1XD 3QEQD 4ZOBA 3ZDYE 5IW6A 4HWNA 4JLRB 5ISZB 4JAMB 5INDB 4CAGA 1JWUA 4E41D 3FHAA 3UEZA 4M6NL 3QDJA 4YFEA 1A02N 1P5VA 2D31A 4XP1L 4H25A 5M7QA 5C07D 2CDFA 3SO3B 1KN4L 2IPUG 1QSFE 1ZE3C 1ETZB 2EDHA 1QEWA 1YYLH 4XVTL 1S7QA 1M71A 3S4SG 4YNYA 5BW7C 1ZTXH 1NC4D 5IMOB 1QYGL 3MV8D 5IHUL 4HUWA 2I07A 4PJXA 5IR1B 5T5NG 4KKCD 1A3LL 5HGHA 1ZGLP 2SEBB 4P46D 4RMRA 1EEZB 5IK3B 4O58H 1DBKL 1LHZA 1FPTL 4JG0H 2XN9D 3OXRA 1A14H 4UBDD 1WBYB 4GFTB 3Q5TA 1ZLWH 4EUPG 2IG2H 3BZFA 3U6RB 2BNQD 3D69A 1EX0A 5DUBB 4LLDB 1EZVY 1QSFB 2LU3A 5CJOL 5F89B 3SGJA 3P4NB 3P0YL 5EN2B 3SDXF 1E6OL 1KEML 2P8LB 4JZOA 1YEDA 3OAYH 1BD2B 1FNEB 2YA0A 3QPXL 3UJJL 3JWOL 1MHEB 1SYSA 3NABH 4J3SA 5CINH 3EJYC 43CAA 4KJPD 2J2ZA 4KKCC 2QQLH 1T1XA 1IC7L 3O8XB 1IGJA 4WFHE 3T4YA 3DVGA 4UBDC 3GNMH 1NCAH 1R3JA 5TQ2H 2MNUA 3ZE0F 1N64H 2VNCA 6FABH 2CPCA 2VR9A 4LU5H 3BYTA 4CVZA 1S7VB 2NY4D 1IMHC 4ODTL 1MFCH 4K2UL 4WFFE 3GMQB 3IKKA 5I16A 3DURA 2WLYA 3RP1A 1XR9B 4NO3B 4HWBA 4N0UB 3FO0H 4KFZC 4KJPC 5I1LA 1K8IA 5C3LD 2UZIH 3T08A 3FQUA 4GS7B 5FYKH 1T5WA 5JIPA 3G6DH 5E1HB 3ZYZA 2M26A 3WIHH 2EYSB 2Z31A 4LGPB 3O2VH 5DRXA 1IM3A 3MRJB 4MJ5A 1NSNL 4XC3L 2FO4A 3ZDXE 2WWMC 4WIQA 4RQQA 1R5VB 4I3RH 5DGQA 4XVSH 2DWDB 5T1KD 3FB8B 4B5EA 1TXKA 3TH4T 3L3OB 4ZO7A 3STBA 4LSRH 4PJFE 1HXMB 1ADQH 3K8MA 2E5EA 1GCFA 1GGYA 3VGEA 5A43C 3MUGA 1FRGL 3IETA 1L7IL 1Z9LA 1D5ZB 4X5XB 4BSVB 1MCDA 4GMSL 1AP2A 3CFBB 5ESAA 5C0BA 5TH2A 4JDZA 5BVJA 1XGUA 2EDKA 1EGJH 5ADPL 3C60A 3OAUH 1ZT1B 4O02L 5TF0A 4BH8A 4IOFC 3VMPA 1TPXC 5C0EA 2XXCB 2J8UE 3TZVA 4JY5L 1M7IA 4JZJC 3LEYH 4JANA 4MQSB 2JK5B 5D7JC 3VA2C 3W2DL 1KV3A 2R0KH 2I5YL 5LXGH 2YOCA 4G7VL 1RUPH 3OHXA 1DE4B 1U6AH 4O51A 1YQVL 2EE6A 4ODVL 2O26U 4XP9H 1OCWH 1YN7B 3NPZB 2F53E 4TUKH 1S7UA 5FFLA 5LGKA 3S3JA 1E4XL 1P9MA 1MCKA 4PJFB 1LO3H 1JK8B 4JR9L 2VQ1B 4G3YH 4NWTH 4YDJB 2UUDH 1P7HL 3LKPB 4JE4B 1J05A 1A6AA 2IH1A 1T4KA 2KQMA 1OTTD 1KB5H 5CD5D 2J8UB 5IWLA 3QXDB 2BNRA 4HIHB 1JF5A 1U91A 3IVKB 2FIKB 2CLVA 5DJXB 4ZFOA 3SE9H 3MRGA 4BZ1L 1FL5A 3DJ9A 2GKIA 1KIQB 5IESH 2AQ1A 1C5DA 2F53B 5C08D 3UTTE 3U0TB 3GSXA 5GRZA 1QOKA 3QA3A 3CZFA 5FUCC 1WZLA 2AAVA 1F11A 3DTXA 4M7KH 4F9LC 3BJLA 3PNWB 1P4LB 3CFEB 1UENA 2HH0H 5HHOE 4HIXL 5EZIL 3RU8H 2ZUWA 4BQ8A 5DJ8B 4RGMC 2WIIB 3U1SH 1ZLVH 4QRTA 4UUJA 1IC5L 1CLOH 2BY0A 4PJGF 1B0GB 1BLNA 1GGCL 4P4KC 5HDBF 5CD5C 1PG7H 1KCUH 4Z6AT 4TULH 4L8CA 3ULVL 3T3ME 1HI6A 3SO5A 4GW5B 5JMOC 2YKLH 1LEIB 1X9QA 1ZA6A 3KXFD 4LRIC 4IMLB 3LEXB 4PBVC 3SE4A 7CGTA 1X4YA 3X14B 3BE1L 3PGDA 3UTTB 3V52L 1U8HA 3IGAB 2D2OA 4N8VB 1X44A 2CRZA 4QRPA 2NNAA 4OD2A 2P5EA 4YHIB 3BW9A 5GRVK 1DDHB 1PFCA 4XPHL 5HDLA 2C7UB 5HHOB 3PJSA 1X7QB 3HE6D 2HTKD 1YEJH 4OD1H 3V4VL 1TJGL 1FL3A 1TQCC 2D0FA 5SWQA 3GK8L 1BQSA 4HUVA 1RK0B 1RIUH 1W0YT 2HKHL 4RSVA 3O2DA 1JGUH 3QWRD 1KTDA 3UTPE 1SY6H 1ZT4A 2VLJD 4U1MB 4NQDD 1LEGA 3NA4A 5D7KE 3OAZH 4PGCA 2LV4A 2QHRL 2B1HL 1RFDL 5CILL 4L5FL 4X4ZA 1FO0A 4WW1A 4DCQB 5J8OA 4LOUD 4DEPC 4HWZB 3S96B 2HLAB 1U58A 4PJ9C 3QRGL 1KULA 3JWDH 2OX5A 2HTKC 1RUML 1JF1A 3BD5A 4LRNL 1BQHB 5DUML 2IQ9H 1AXSA 5GZOC 2VUOA 2RR3A 4QOKA 4Z0BH 2CO7B 3W9DB 4KJYB 3OJMB 5DS8B 5C2BH 3NZ8A 5TDNB 2BOBB 2E9IA 5KOVC 4DFHA 5A3IC 3F7YA 1UWGH 3MNVB 2Z31D 4WO4C 2BMKB 3AREA 3SDYL 4KGJA 5FYKE 1PSKL 3MNWB 1F3DH 4LOUC 3T0EC 3WHE1 3FT2B 1BM3H 2H9GB 3WD5H 4HW6A 4L4VD 4XCNB 3BVNB 4WCYL 2BVOB 1RJYA 3ZHKA 3X3GH 3FO1B 4K94L 3AS1A 1NMCB 3PL6C 4RMVA 2W07A 3WKMH 1HDMB 3B5TA 3KPMB 3RPKA 5HHQA 3WE6B 5C0BD 5B38B 1GAFH 3L95B 5HDQL 5I18L 3QDGA 2FR4A 2QLVB 2JTDA 5J13C 3SJVE 5L88H 3VGGA 1WSST 3U2SA 4PJAF 5CZVL 3MR9A 5JW4R 2XWBA 5DJYB 3CSGA 1JHKL 5I1KH 3BEVA 5KANG 4FFWD 3NBNA 3HAEG 4JPKL 3V6FA 4LBEA 4N8CL 2BNUB 2JJTA 2APFA 4OM1H 5AG8A 1IEHA 3HZVB 3WDHA 1INDL 4X4MA 5KG9A 1JPSH 1I7TB 4BK4A 4S1RL 1U41A 1T5XB 2XKSA 1JGLL 2RB8A 4MA3B 3VDCA 3ELAT 3NAAH 4YZFE 1IGCH 2Y07L 2MTPA 4LPXA 2DLTA 2IEPA 4Z7WF 5MI0C 2ADIB 4CMMA 1NGXB 2HRLA 3SJVB 4BJLA 3VXMA 3KYNB 5F7UA 3UO1H 1ZS8A 4HLZH 4HKBB 4NBXB 4ZPVB 1AR1D 3Q48A 5I8KH 1IL1B 4A6YA 3HG1E 1CK0H 1AXTH 4XNYL 5EO1A 5JO5B 4FFWC 2HTLD 4ZTPH 4QF1A 3ZE1E 2YR3A 2ZUQC 4N5EC 2OR8A 3AB0C 3BD3A 3MO1B 1T3FB 1FGVL 4AT6A 2Q76A 1FE8L 2VLRA 2D9CA 3V6OC 4OV5A 3TN0A 3L5XL 1FVEA 3HHRB 1OT2A 1ZA3B 4G8FB 5D2LE 2HT4D 5TF1L 1V7NH 5HI3D 4KHTL 4PJHA 1N8ZB 3U7WH 4R96B 5F3HA 4KKAD 3WSQL 2CLZB 1XEDA 3H42L 3KPPA 1DN2A 3EYUL 1XZ0A 3C09B 4JFDA 3NCYP 3TT3L 4P2QA 1EFQA 3HG1B 2C3VB 1RAMA 3WNKA 1MRDL 1WZMA 2NXYC 5AUMA 4LCWB 1QR1A 3GRWH 5FOJA 1F97A 3CMOH 2CGRL 4R3SA 1F58H 3L9RA 1AR2A 1XCTB 5DD3L 4RAUA 1MHCB 4RWYL 4YX2H 5BV7B 3C9NB 2NY0B 3MRKA 2PXYA 4QRPD 2XQYG 1G7HA 3FO2A 3SN6N 2NY3B 5HGGS 2LU7A 1B0RB 4O2CB 4X6DA 2FO1A 4MCZA 4R4FL 4X7SH 4DJMA 4HK0B 1ITBB 3QNXA 4YFDB 4ZFFB 5I6XC 1F4WH 2XZQL 1MLCA 2Y6SC 2DQTH 4ELKB 2FBJL 3GSUA 3BUYA 1MCNA 4K3EH 2OR7A 4XCEB 4PJ8B 2X4UB 1MJ8H 4ZXBB 2YMXH 5JOEA 3MX0A 2YHGA 2CRMA 4I2XE 32C2B 1A7QH 1I1FA 4MAYC 5KVFH 2QL1A 3PWPA 1RZFH 3KDMA 3T4AB 1CZ8L 5DQ9B 2YSSB 4F7CA 1AC0A 5D1QA 3WBDA 4X4YA 5DK0B 1J0IA 1FL6A 2NX5D 3RTQD 2C5DC 1IBGL 4IJ3C 4QOKD 2HWZH 3E6FB 2ITCA 3BSZH 3NCJL 3S5LA 3FL7A 4L8DA 1KCSH 1U95B 1XT5A 2ZUUA 1UEYA 2XG5A 5EBMB 3JUZA 4Q2ZB 2V17H 4I2XB 3ILPB 5DD6A 3X13B 3RWDB 1TJIL 3QEHA 5I9QB 3PP3H 2DQDL 1GRWA 5GGSB 3MRHB 5EA0L 1D5MA 2F5BH 1K4DB 3C5ZC 2G75A 1S9VA 4LSVL 4Y4HB 2ZCHL 4YHYB 3WS3A 2E7LC 1SYVB 2GSIA 3QEUB 3R06A 4RNRB 5FUOH 3P77A 4ZFZA 3RTQC 1OLZA 1RZ8B 2R29H 2AJSH 1BAFH 2Q6WA 2J3SA 1G7MA 3S7GA 5KVEL 4PUBL 3O45B 2NW2A 2DQEL 5L2JA 3ULSB 5DRZB 3Q2CA 2MQ3A 2EIEA 4TSCH 2R23A 3QDGD 1M4KA 5ID0B 1YC8A 4I13B 2AGJL 2BC4B 2F19L 2YN5A 2YZ1A 3VFUA 4ZYKA 2XY2A 4ZQKA 2D9QB 3GIZL 4G6JL 5E08H 4JG1L 5KTEL 3OZ9H 3T2NL 2R1WB 2O5XH 3GSVA 4G9FE 2CKNA 3JTSA 3CUPA 4X8JB 3WL9B 1MHPL 3C6LC 1NCCH 2CKBH 2J7LA 1G7JA 4M43L 1U8KA 2AI0H 1A2YB 2DWEB 4JRXA 1GC1C 2X4PA 3Q6FB 2BHZA 3X11B 2ZUYA 1WVZA 4M3JA 2GJ6A 2IAMA 3IDJA 4FP8H 5BJTB 4P2OA 5GJTH 1YYML 4H20H 4W81A 3VXMD 1MUJB 3DXAE 4RX4A 3FQRB 2BOCA 5D5MF 1JI2A 1DFBH 2N56A 4KTDH 2VDPL 4HXBH 2IC2A 3DMMC 1DVFB 4LP4A 3V5HB 4G9FB 3B2VH 1RSFA 1BVKB 1A7RL 3FZUD 3M8OH 1YNKH 1YYLL 3BMWA 5JW3H 3DX8B 4WY7L 1CTNA 4Q97A 1ZTXL 2EEBA 3VD7A 4MA1C 5J57B 1Q9KA 3IFLL 2YPLE 4J4PC 4R4BB 3RL1B 3C6SA 4FFVD 1W8OA 5AYUH 3MRLB 4KRMB 4PRPA 3PIQA 4A2LA 2A83A 4MGXA 1EFXB 4JG0L 5EUOA 1ZT7B 3MRCA 4GRMB 1A14L 2Z4QA 3KPLB 4HKZB 3OX8A 1E4XI 3DXAB 3S3SA 5I74C 2IG2L 1VGEL 4YPGB 4P2QD 4ZUSA 2YPKB 4MJIE 2H8PA 4MQXD 1XGTB 3LKSA 3LEVH 2G5BA 3VXRB 4HJGB 4U3HA 1S5IL 3FZUC 3C8HA 5ACMA 3DOSA 4JEGB 4V1DD 3X12B 1T0MB 3RIFF 3GB7B 3IDYB 3W0WE 4U0QB 3D87B 2HJFA 1D6EB 3KPQA 5FF6A 1QA9B 2GFBA 1HSBB 2PXYD 3OKDB 1GGUA 1I9RH 2YPLB 3NABL 4X6FA 1ZXQA 2A9MH 2MCG1 3SBWA 5L7XH 5IM7A 1A7NH 4FFVC 4PGBA 2NY6D 2QQLL 4M1GL 5E2TH 5GS3A 4PR5B 1MLBA 5DI8B 1I3RA 4NO5B 1MIMH 4R8WH 4P3DA 4P49A 3GNML 1NCAL 1CFTB 5D2NC 3KPRA 3ARFA 4LLYA 6FABL 2V2WA 5EFIA 5KSAC 4E0RB 4LU5L 4U6VH 7FABH 4JPIB 4MJIB 2NTFB 2ATPB 1MFCL 3N9GH 1XGQA 1YNTB 5K9JH 4KMLB 5D6CA 3BH8B 1Y0LA 2ZUSA 2XRAH 1X5AA 4YIQA 1LO4H 4FQPA 1QSEA 2NCMA 2GUOB 2VXVH 2F8VA 3W0WB 1GZPB 5MEQA 2BFVH 4XCCL 1OP5K 3FO0L 3RGVD 4NOFA 2OZ4A 2JCCF 1AHWC 2UZIL 4K8RD 4XAKD 3WEXA 1MJ7H 3PWPD 5FYKL 3WIHL 4Z7UE 3TBTA 2D0HA 5GGVH 3O2VL 4OKVA 5HPMB 4MJ2A 2VJXA 4KAQH 5D1QD 1CD1A 5HBBA 2YC1A 1WC7A 4ZUWB 3S6CA 1MCLA 4ZSOB 4I3RL 3H9SD 4N0FB 5ESVA 1FAIL 4XVSL 12E8H 5DMJB 3KVQA 3QT2A 1F00I 4G7YH 5E8PA 4I48A 1YPZF 1DEEA 4LSRL 1QQDB 4PJEF 3WO4C 3W5MA 3TEUA 3RGVC 4V2CB 1T83A 1ADQL 4JGJA 4U1IB 2EDDA 3SDCC 4CADB 2OTUA 1NAMB 3HRZA 1BIHA 3IDGB 1NCNA 4D3CH 3PGFL 3RZCC 2G5RA 4JCLA 4F37K 4Z7UB 1EMTH 3K1DA 1EGJL 1TQBB 5BO1L 3OAUL 4R2GD 2QKIB 3H7BB 4TVPH 3QIUC 3LS4H 1MI5B 3N1PC 4YDIH 5DK2B 3LEYL 3VG0H 3ZKMC 5D7SL 1T04A 2R0KL 3GMOB 1J8HD 1JGEB 2OL3H 4NO2A 5J7CC 4XP9L 2DQGH 2ZOKB 3EDEA 4OF3A 4DW2H 2GSGA 2XG4A 1LO3L 1QSZA 2CIIB 5K9KA 1ORSB 3EOBB 4NWTL 3VJ6B 1CI5A 2ZJSH 5DMGD 4DGYH 3WDIA 2JKXA 2B2XH 4R2GC 3RWGA 2XWTA 4WHTA 3BP6A 4FMKA 4JQXA 1A8JH 5C8JA 1PGRB 3HMXA 2Z93A 3PHOB 1KB5L 1ZLWK 4ZFGL 4XP4L 4E42A 1QO3B 2CRYA 4FTVA 3O3BA 3O2WL 1KCKA 5BV7L 2MWCA 2XICA 1I8IA 1NDMB 3SE9L 1J88A 1CIUA 5HGAA 3ARDB 4PJGA 2E7MA 2IAMD 3OAYK 2A77L 4YHMH 3FQWA 1VKXB 2X10A 5IVNA 1NEZB 3PP4L 3FB7A 3D0VB 3UMTA 4D9QE 2HH0L 4YXHH 4F37F 3BN3B 3RU8L 4R7DB 3V79C 5I66A 5I1HL 5GRUH 5HHXH 1T66C 1Z5LB 4HFWB 1CLOL 5ENWA 1B9ZA 1PG7L 1KCUL 3OJDA 4TULL 5J6HA 5C0JB 2VISB 3F5WA 5C0IA 1AH1A 2YKLL 2X9YA 1KCVH 2BVTA 2D7NA 4J1UA 1ZK9A 2CKBB 3QUZD 2DD8H 4Z8FH 4NZTH 4U7MA 4NRXB 5EU5B 2AV7B 3P73A 3OQ3B 4ZO9A 5FKAA 1QNZH 4U1JB 4JJ5A 1CFNA 3DV6B 5EG6C 4PREB 3CVIL 4R0LA 2VZTA 4OJFH 1IGMH 3GJFK 1RIUL 2EC9U 3WV0A 2VABB 1JGUL 1B3JA 3DX9B 5HD8D 4KK8D 1SY6L 5IBUG 5DR5H 5F7FA 3QUZC 2AJZB 3B9KC 4OT1L 4XGZA 1SJHB 5HYJD 1MJUH 1I75A 3DUUA 4FABL 3QZWB 5JPMB 4IRZH 2WBJA 3BWAA 2P1YA 3JWDL 2YA2A 4X6CF 4WU5A 5KN5B 4QTIH 1FSKB 4P5TA 4JFFA 2Y4SA 3MCKA 1ZOXA 2OQJB 1QSED 3HE7D 1P7QA 4DWHA 4QRRD 2FGWH 1UQSB 4Z0BL 5B4MC 1W72H 1PVHA 5ITFA 1EUUA 5HD8C 4KK8C 3HNTH 2JJSC 4M4RA 4G8GA 3VXSE 4Z5RB 3LHPL 1I8KB 1JPST 3UTSE 5EU3A 1LE5B 2VXSH 3ARBD 3DUSA 1FG2B 4IBLT 1KCLA 2CLRB 4CDHA 1X5YA 2RBLA 4J3UA 5EOCJ 2VE6A 2PO6C 4YWGH 2UUDK 3WD5L 3KLHD 5KSBA 5JW5B 1UJ3C 5GS1B 1VCAA 4XMKH 5FM5O 4DZBB 2M8XA 3OKKB 4PJ7E 4CW1A 4S1QL 1XF2B 3VFNB 3CFJA 4XWOD 3PWJA 4XAWH 3S9DB 4M00A 4PS4L 3D3VA 1E4JA 2QQNH 3X3GL 4MJ6B 1N2RB 2NY5C 4PRHA 1ZSDA 3PWVB 3WKML 4GAYA 2H6PB 1A6ZB 3G5ZB 1AO7E 4GKZA 2JIXB 2GYSA 1VFUA 3CX5J 1RJZA 1QLRA 3T3PE 3TH3T 3O3AB 3UTSB 2VQUA 5E2JA 1WWCA 5EBWA 4Y8AA 5F6HI 5L88L 3RDTB 3S35X 3FJTA 4FQQA 4PP2A 3KLHC 5E8OB 1JZ4A 1YC7A 3IDIB 4YK4C 5ICZA 1NFIA 3MLSH 3ARGB 5KS9F 4XI5C 4GG6A 3SPVA 4OM1L 3QUXB 4JREC 1SEBA 5B8CC 1KLUB 4ZTOL 4XVUD 4NC1E 4X7DC 4OAWB 1IGCL 3T09A 3V5KB 1AO7B 2VLKD 3G6AA 1Q0YH 3GI9H 4FQXD 1BVLB 4W4OA 4KRPC 5SWSE 4EI5C 1CG9A 4YC2B 4XXCC 1JWSB 2VXUH 4LVEA 5EIVA 3UO1L 4I1NB 4MA8H 2YXFA 4I0PA 4QRQB 5I8KL 2FJHA 1URLA 2BVEA 3TPUA 1DTUA 4U1HB 2W0PA 2XTLA 1MFBL 4ZTPL 1IGTB 3UZVB 1EV2E 4GLRI 3S98A 3RKDC 2XTJD 1T6VN 5IW3A 2OL3B 3OSKA 3ARVA 8FABB 1NPUA 3CC5B 5DFWH 1M6OA 4KXZH 4F8TA 1V7NL 4U1KB 3LD8B 3LV3A 4FQXC 3UP1A 5J1AA 2X4QB 3AS2A 3N1FC 3D39E 3OAZK 5SWSB 3U7WL 1MCWW 4Y16A 5IROC 3SKMA 4RRPA 1D7FA 3WFEH 4TN9A 3OF6D 4FG6C 1AD0B 3QIBD 4QHKI 5CMAA 4KVNH 5DFVD 5F6HJ 5JHDA 1NJ9A 2I26N 5CEZD 5FV2A 4BH7A 4RAHA 3AXLB 2OSLA 5HVWA 1P2CB 1LD9A 1UM4H 2C1OB 2JF1A 4PGDB 3HZKA 4FHBD 1FH5H 4G9DA 1NL0L 4P2CG 4MHHG 1F58L 1CGUA 4QCIA 1KTRL 1OLLA 2LVEA 3UYRH 5F9DC 1IKNA 3VGAC 4J3OC 3ULUE 4DOHE 3I02A 1NDGA 4LHUG 4EQ2A 4PP1D 3T0AA 4P2YA 4AEEA 4LQFH 2IGFL 4X7SL 3D39B 4RIRB 4G8IA 4M9PA 1F4WL 3BQUB 3QIBC 4MD5B 4YHOH 3SCMB 5JA9A 5F88B 4X9IA 4F58H 3BZEA 4PJDE 4XPFH 4HBCH 4MNQA 2JJUA 3GJEB 5IFHH 3CVHH 1OB1B 4K3EL 3IDNA 4NKDB 2I9LB 4OFYA 5IF0A 1MJ8L 4LNVA 1TVBB 2GI7A 5K59F 4IOSD 1MCPH 3VI3E 2HLFC 3KYMA 1A7QL 2DBLH 3PHQB 5BXFB 5EIIA 1Z2KA 4DOHB 4OLYH 4XC1L 2E9JA 1SJXA 4KROC 5KVFL 1EHXA 4N90E 1L0QA 4LVHC 2F5AH 1OP3H 5C09D 4GKNB 1RVFH 4Z7NF 3PF2A 4HZLA 4P5TD 4JFFD 3I84A 1IAMA 4IHOA 1ZMYA 4LEOA 1UZ6E 1P7QD 4HV8B 4QHKJ 4LLAA 5DMYA 1UXWB 3OR6B 1KSRA 4PJDB 4DVRH 4Q6IA 3VFOA 5H94B 4FQJL 5JORB 2HWZL 5HYQA 4P9MH 4Y5YB 1G9MC 2VDOL 3LKNA 4LCYB 1MCCA 2FHCA 3BSZL 2VH5L 1TITA 3STZA 1KCSL 3KJ4B 5F6IB 1DBBH 1FVDA 4PY7B 5H35B 4XPAL 2P4AB 1QKZH 3LH2H 2V17L 3NGBC 2YUXA 2JB6B 4NM8L 3G04A 3IJYA 4Z0XA 2Y25A 3N50A 5DURB 3QFDA 3H9HB 2P46B 4MXWL 3KPNB 4HS3B 4JAMA 5ISZA 1S3KH 2C4FU 1VACB 3L3JB 4YDKH 3M1BA 2NZ9D 4JFXB 1G6RH 3SDAC 4E9LA 3FRPA 4JM2F 1T03H 1I9EA 2ESVB 2AJSL 1KJ2H 5DJ0B 2GK0B 1A1NA 2NY2B 4M9OA 1S7XB 3MYZA 4G6FD 4XPBL 1K5NB 1W72B 2B20A 4G6ML 5JHLH 1A6TB 1MWAH 3MREB 2PTVA 5D7IA 3V4PH 5D71H 3MRDB 3GMLA 3O6ML 5ID1B 1RUQL 5E08L 3C8KB 1PYWA 3OZ9L 2SEBA 3O11B 3EKCA 1EEZA 4UQ2B 4UV4H 4ZODA 5IK3A 3RFZC 2JE8A 2O5XL 2NY1C 1FP5A 4KRLB 4MD4B 4ALAH 3MLTB 1WBYA 3PQYE 2NZ9C 1T89A 2CKBL 5CSZA 3NPSB 4WWKD 3U6RA 3L7FB 2AI0L 4DVBA 4LLDA 1QSFA 4HPYL 4LCUA 3LMJH 2GJJA 1N4XL 4FP8L 5EN2A 4QHMA 4KTYA 1JUFB 4P23B 5GJTL 1N0LA 5E94B 1BD2A 1FNEA 4H20L 3UC0H 1MHEA 1FFOB 4I0PD 4N9GB 3VW3H 4JFPB 5EU7E 4KKBC 1MCHA 3DHJA 4KTDL 2GITB 4HXBL 2R39A 4OCRH 3B2VL 3O8XA 3M8OL 3GMNB 1YNKL 2EDJA 5JW3L 2X70B 3PQYB 4WWKC 1RJLA 2YBRB 3QFJD 5CGTA 3TBYB 2H1PH 1S7VA 1S9KC 3QQ4A 3UROR 4NFBA 5AYUL 5EPMA 2FB4H 4GRWE 4RMWA 5E8EB 1XR9A 2MHAB 5E00A 5GRWA 1U3JA 4Y16D 4H8WC 4WU7B 4L8SB 2VQTA 3HI5L 1IZKA 4FXLA 4N0UA 1MPAH 5E8NA 1FNSL 5C6TL 4XPTL 4Y4FA 3EYQD 4NUJB 5CP7B 4ONFH 2DM4A 4U0RB 1G7QA 4NC2B 3EJJX 1IVLA 3GHBH 1CLYH 2RIKA 3QG6B 1I9RL 4XCYB 5L7XL 2A9ML 4JFHE 2EIDA 5D4QA 2LE9A 5E2TL 1VFAA 5HGDA 4GRWB 4C57C 3WJJA 2VLMD 3L3OA 4R8WL 1UKQA 2HRPH 4GAFB 5J1TC 3L3GA 2E8YA 1HXMA 1O5DT 3CJJA 3VD4A 3BWUC 3NZHH 4QEGA 5IOPB 3PP3K 4KI5D 3EYQC 5HYSG 4X5XA 5E6IB 3HC4H 3QEQE 3N9GL 3T2PA 4C56E 4OFYD 4E41E 1LO4L 5IB1B 3CDCA 1AKJA 4YGVB 4JFOA 2VXVL 1AE6L 1SMOA 4YBLB 5I1EL 4OBSA 2NW3B 5C07E 3VRIB 4Z7QE 5DWUL 2AXHA 2BP3A 4AL8H 1LK2B 3RJDA 4P3WA 3ZKXC 3ARTA 4PGJA 3BDYH 5GGVL 1QSVA 3QJFA 4PJCE 2VUYA 5JXED 3EOTH 3MV8E 4KAQL 1ZHNB 4WUKH 2RFXB 1LO2H 1WQVT 1BBDH 4WI2A 4X9HA 2E9WA 5D1XB 2VSCA 3QEQB 2R1YB 3LKPA 3WDJA 2W59A 4C56B 3ZYOA 4H1LA 4NJAH 3O3EB 4WJ5A 2XN9E 3HMWH 1EAPA 4I8DA 4E41B 3KR3H 4AEHH 1ZHBB 3EFFA 3CVHB 3TPKA 5CGYC 3BPOB 1J8KA 4KDVA 1I1AD 5IT2H 5E1AB 2BNQE 5C07B 4JPWH 4XVJL 3C87A 3BPNB 3I6GB 1BQHG 5DJXA 4O00A 3B9VA 1D6VH 2OJEB 1JP5A 5C70A 3BGFB 3EYVB 4NN5C 5E2WH 5T5FH 3T0VA 4UT9H 5JXEC 1NC4B 4TVPL 4PJCB 1ULVA 2R0WH 3LS4L 3MV8B 3DNKA 2FCBA 4LCCA 2X4OA 4ZAKD 2RCSH 3K74B 4WV1B 3SKOA 5AEAA 3PNWA 3CIQA 1M7DA 3CFEA 1DSFH 4P46B 4LDEB 2P8MB 2R69H 1VERA 3MSPA 2OL3L 1BOGA 5DJ8A 2XKUA 2NTSP 3VFGH 1WZ1H 2XN9B 2DQGL 5D7LA 3CGTA 4LLMB 4Y5XC 1B0GA 3T77B 1I1AC 4C59B 4DW2L 3FT4B 2BNQB 3FQXA 4L8BB 4YPJA 5HYFA 1NFDB 2M2DA 3BPLB 3GGWA 5C0ND 1AXIB 3QUYD 3BP4B 1LEIA 2QSCH 1ZLSL 4BQ6A 4IMLA 1IM9A 1JVKA 2Y7QB 2ZJSL 1LQSR 5EDXA 2VERN 2APWA 1XF5A 1H15A 3UTTA 2V9QA 1Q9WA 1WLHA 4N8VA 4F7TB 4EIGB 5CWSB 2AXFB 4ZAKC 4UNTA 5C0DB 1INEH 5E70A 3D5OF 1X5HA 4JDTH 5B38G 5J11B 1F3RB 1BQLH 2C7UA 3EFDL 2Q86B 3O4OC 2FJFB 4KMTH 1NCWH 2DMCA 3OXSB 4NWUL 4YHML 4M7ZB 4EBQH 4HAFA 1CDCA 2K1MA 1FN4B 3IF1A 1FORL 2NY4B 3CPLA 3QUYC 3BIKA 2CSPA 5I15H 3T0XA 3G5VA 3EDFA 4AIZA 5GRUL 3RHWK 4U1MA 1FZMB 5EUKB 3RBSA 3SOBH 1QLEL 4WI6A 3Q5YA 4KK5D 1LMKA 4MS8D 4BSWB 4NQSA 4DCQA 3P0GB 2QSTA 4HWZA 5SWZE 3S96A 4JFEA 5KAQG 4J2XA 3QCVH 4NUGH 4K3GA 4UOW0 1QFUL 3FKUS 3SY0B 1BQHA 4O2EB 2DD8L 1DLHA 4NZTL 3TBSA 1RZIB 2H26B 2R2CA 1P84J 3C60C 5AZEH 1OWWA 3GM8A 3QHFL 4MB4A 3W9DA 3HZMA 3MCG1 4YHPA 4JJHA 1QNZL 5TDNA 1OGTB 2BOBA 4Y4FD 4HGKC 4PRDB 3GHEH 4L9DA 5DJ2A 1NCBH 1UACH 4WI9A 5GGQH 4CU8A 2BMKA 1J0HA 4KK5C 4OJFL 4MS8C 1IGML 3OGCB 2AKRB 5F1SA 1F3DJ 3FT2A 2W0KA 4CGTA 2EYRB 1TZIA 1PDKA 1HKFA 1BF8A 4XCNA 3WN5C 4EKXA 2KUTA 5CFHA 5T3XH 1I8MA 5EBLB 1BGXH 4UV7H 2BVOA 2F15A 1LEKB 4FQ2L 2V7HA 3P0VL 5I1GH 2EE2A 3TA3A 3FO1A 2OYPA 3BHBB 1GPOH 4DQOH 1HDMA 1QLFA 2EXWC 3KPMA 4U4BA 3P4OB 5C08E 3WE6A 3RVWD 4QTIL 4ZMAT 3C08H 1CICB 1Z9OA 5LGJB 1IAIM 3QDJE 2FGWL 1VHPA 3FFCD 5BQ7B 1U0QA 4ZDHA 1W72L 3WIHA 1YMHA 4Q6YA 4KUZH 4XCFH 1P6FA 3CFDB 3HNTL 3S35H 1A0QH 3D48R 3WHXB 1J12A 2VB5A 1DANU 1FLRH 4LAJH 2BNUA 2VXTH 4N1CA 4U6YB 5I30H 2VXSL 4OB5H 3HZVA 1VEOA 3OTTA 1T5XA 4YWGL 4PJXE 5JDJA 4MA3A 3HC0B 1MNUL 1KC5H 1JZ6A 2NXZC 1BFOA 5A16B 5C08B 1I3VA 4GO6B 1JWUB 1ADQA 1S5HA 2ADIA 5A2JH 4HWUA 3KYNA 4ETYA 2D31B 4OLWH 3VE0A 4XAWL 1NMBL 4H25B 4JGMA 1WF5A 2QQNL 3F58L 1EGJA 4RFNC 5JO5A 1TVDA 2ZPKH 2EIBA 1H5BA 1T3FA 3PGCA 4YNYB 4LSSH 5TDPA 1PEZA 4MQ7A 4HUWB 4P59H 4YAQA 4PJXB 3KXFB 5K9QG 3DVFA 2VLJE 5HGHB 4BKLB 3NCEB 4NQDE 3MLSL 4OZIF 2G9HA 4KHXH 3U79A 2ZCKH 3OXRB 3EO1A 2CLZA 2F8XC 3LQZA 3BZFB 2A1WH 3NCBB 3HE6B 1TVHB 1KB5A 1IM9D 1Q0YL 3GI9L 4LCWA 5ANMA 1V8HA 1U3ZA 1XGPB 5F70A 5CEXB 1XCTA 1YEDB 5D72L 5DD5H 5SX5H 1OL0A 5F93C 3P4MA 4BELD 2B39A 2A6DA 1Q1JL 2VLJB 1C12A 4FN0A 1IAKB 1MCBA 4NQDB 1B0RA 3NCFB 2R15A 3T4YB 3DVGB 3RVVD 2KKQA 2ZCLH 5I19H 2IJ0C 3X3FH 3ALXA 4L4VE 4CVZB 3DRQA 5ALBH 5EC1A 1NH6A 4P2RD 3RWEB 1J1PH 3NCYS 4XCEA 2X4UA 2A6JB 2UWEE 4OZGF 1GC1H 1WUNT 2NYYC 3WFEL 1WAAF 1F8TH 2EH8H 3K0WA 32C2A 4KVNL 5I1JH 3ILQD 4FZEL 4ODHH 5I1LB 4IIQC 1K8IB 3DX7B 2L7JA 1UM4L 3BKMH 3VI4F 5C0BE 1ZV5A 3GMMA 2V7NB 3T4AA 1FGNH 2GT9B 1FH5L 2Z31B 3UYOD 1JWMA 1YY9D 3PDGA 5J13B 5DQ9A 1IM3B 1A7BA 4MJ5B 3U30B 3T0WA 3QQ9C 3UYRL 4LLUA 1PKQA 1RD6A 4O9HL 1OVZA 1T0NA 4L4VB 4CN1A 3E6FA 4NKOB 1WTLA 1Q9OA 1Q94B 4U1GB 1KIPB 2UWEB 4IRSA 4JGUA 1XR8B 4OLVH 4YBQD 4I2XA 3ILPA 1SY6A 4NRZB 5FXCH 2HFEB 4F58L 3MUGB 3R0MA 4PJ5A 4XPFL 5JIHA 4HBCL 3ZDZE 3GBNL 3NIDF 1YJDC 3CVHL 1A9BB 3DVIA 3LDBC 5DHVH 4JDZB 5C0BB 1A21A 4TUOA 5TH2B 5BVJB 1XGUB 4BH8B 1SYVA 3QEUA 1KG0B 1MCPL 4IMKA 3TZVB 4HF5H 3IKCA 2FD6L 2BNRE 2AJVH 3HI1B 3GO1H 4QKXB 2J8OA 1LK3H 4OCYH 3T2OA 3TA3D 3SQOL 4NKMA 4O51B 3LQAL 5DRZA 2ZUQB 3AB0B 3H3KA 1MVUA 3WIFA 1S7UB 1XGRA 4J23A 3MLWH 5ID0A 5FDWA 1SM3L 2BC4A 4DVRL 1UB5A 1IAOB 4PJBE 4CRPA 2QADC 3PV7A 4R4NC 5IVXF 3TN0C 4P9ML 5KBNC 2IH1B 1T4KB 4Y1AA 3QSKB 3UPCA 1QKZL 4S0SD 4X8JA 3WL9A 4OKDA 2X7LB 1G7PA 4JB9H 2AEWA 3Q6GH 3WJLC 2HFTA 2CLVB 4ZFOB 1LO0L 3G5XB 3MRGB 3QP3A 5GZND 1FL5B 2C9AA 3Q6FA 3X11A 4NBZB 1U8PB 2AJ3B 4BUHA 3GSXB 1PBYA 3QA3B 4QRPE 3CZFB 1NUGA 1GZQB 2P5EE 4YDKL 3HKFA 2V9TA 3FQRA 2ID5A 1G6RL 1T03L 4PJBB 5JOFB 3F7RA 5D1ZC 1B2WH 4Z7OE 4I77L 4NCDA 3F7VA 4QRTB 1BVKA 5T1MB 3NFPB 3UXFA 1BLNB 5JHLL 3V4UH 3DX8A 3U4EB 5FA4A 1WT5C 3LRGA 4L8CB 3S34H 1HHKB 3SDDD 3VFMB 3VGDA 3VXQB 5GZNC 1ZA6B 2WK2A 3N1GC 3RX7A 3ZDXF 3IS0X 3PWLB 4UV4L 4K8RH 4GKOA 3PGDB 1OQXA 4C58B 1AIFB 1N7MH 1TCRB 4KZEH 1MCEA 4QRPB 1A5FL 2BDNH 3KPLA 1RULH 2NNAB 3RPIA 2P5EB 5CCKL 3DXAA 5F71A 4APQA 1T20B 4OI9A 1T22A 2YPKA 1AFVH 5CS7A 3PJSB 4PJFF 1T0PB 3VXRA 5GRJH 5HHMD 2HJKA 2DM2A 2WUBL 1FL3B 3HC3L 5CP3H 2NX5E 3GB7A 3O6FA 5SWQB 4UINH 4HUVB 4QOKE 3UC0L 4D0DA 3VW3L 2YPLA 1KTDB 1ZEAH 1F2XK 1PY9A 1ZT4B 4JN2B 1LEGB 4PGCB 4FQLH 3LB6C 2W9DL 3TJEH 4FNLH 1CFTA 3KS0J 4LIQH 1OAZH 2FECL 1FO0B 3M17B 1ZGLM 3SEPA 3QEGH 5FO7A 1UEMA 2DL2A 3UBXB 3E3QC 1DQDH 3MGOA 3MQIA 2H1PL 4JPIA 2CMRH 4MJIA 1FHGA 5TJWK 3E8UH 2ATPA 2UY7A 1YNTA 4KC3B 3P11H 4I3SH 3BH8A 4ODWA 2NX5B 2GUOA 4PPTA 4QOKB 3MBEC 1GZPA 4OLUH 1JYNA 2FH8A 4MZ2A 3GRWA 1OP3K 1VDGA 3VU2A 1ITCA 2QQQA 2EDOA 2H2SD 3B6SA 3F7YB 3QDGE 3REVB 1NEZG 4M1CD 3AREB 1K2DA 1KTLA 4LK4A 4K55A 4LKXA 2A6KB 2DQFB 4ZUWA 5IB3A 2XKNB 4ZSOA 3EGSB 4N0FA 2FEDC 4RGND 3QB7C 4R97B 5FUZH 1HHGB 1KN2L 3ARWA 4HGWA 4EQ3A 2BRRH 1RJYB 3ARZA 4IRSD 2HRPL 4X4ME 4BFEA 1QQDA 5ESQA 4LDOB 3RVTD 1FNFA 2MFNA 2DTMH 3NZHL 3ZHDA 4PJ5D 4CADA 2BRQA 4U6HB 3VGHA 2Q8BH 3T3MF 3QDGB 4ZUUA 4MXVE 4Z7UA 3O6KH 1VPOH 2WNGA 4QWWC 3VXME 4R7NA 1MI5A 3FN9A 3MR9B 1MQKH 3HNVH 4GBXA 2XWBB 3QHTC 4AL8L 3B9EA 3N06B 3GMOA 1AGCB 3V6FB 3EZ8A 1QHOA 3BDYL 2NLJB 3RVTC 5KG9B 5F7LB 1HCFX 5TE6H 3ZKNC 4WUKL 4ODSL 1A6WH 1LO2L 2CIIA 3EO9H 4PYGA 4MLSA 1DQTA 1BBDL 4PJHE 1RIVH 4HUXA 3NA9H 4NJAL 4CMMB 1TETH 1QP1A 3MJ7B 4Y1AD 3QZWG 4DUVA 3KR3L 2N7BA 3VXMB 5D8JH 1ZS8B 3PHOA 5IT2L 5DHVB 1CDJA 4M5ZL 4WTXA 4P2QE 2KQNA 4JM2D 4JPWL 2GJZA 1NDMA 2K3TA 1D6VL 4YH6A 4IRJD 5DZLA 3ARDA 3EHBD 5IVZA 5T5FL 4UT9L 3LKRB 2R0WL 3VD3A 2AJUH 4PG9B 1P4BH 2HJLB 2RCSL 3BRGC 1QBLH 1DSFL 5IJVB 4PJHB 2R69L 3SBWC 1JE6A 3T04D 1V3LA 4D9RD 5F3HB 5GS2H 4Q9CA 4J3WA 4HFWA 5D2NB 3CX2A 4P2QB 5C0JA 1ACYH 4MNGB 2VISA 5DD0H 4NZDA 3SGEH 3U0PB 3ARFC 2QSCL 5AUMB 4IRJC 3GSRA 5E99H 3OBAA 4MYWB 4R3SB 2CKBA 2NY5H 4RAUB 5CJBA 2PXYB 1UM5L 3FO2B 2OCFD 3VCLA 2NY6B 1N6QH 4JDTL 3PWPE 4Z18A 3ZE2E 5DZOA 4ELMA 3MLRH 5JUEH 1HSAA 3O4LA 4K7PL 1CDIA 4XNZC 3L3DA 5F8QC 1I1CA 4N5UA 4EBQL 1R5IA 4YFLI 4GRLC 2NY7H 3WS6A 3O6FD 1CGSL 3QIWA 1U8IA 3UJIL 3H9SE 1NGPL 3P30H 5KAQF 3DX9A 2YEZA 3RY6A 1UH2A 2J5LC 1XCQA 1TZGH 4Y4KC 1SJHA 4OZFG 1FDLH 3RGVB 1OAQH 2XQBH 3MPCA 2B5IC 2AW2A 2HG5B 2R1XA 1IJ9A 3PWPB 4NN6C 2FEEL 3HUJE 2FSEA 3S8WA 1P4IH 3NFNB 3QCVL 3WLWC 5CJXA 1BF2A 3IDMB 3RWIB 3O9WD 3OB0K 5F9WC 4O5LH 5D1QB 5GJSH 2OQJA 4X4YB 1RUAH 1FL6B 3EOAB 2B1AH 5AZEL 1UQSA 1K85A 3H9SB 2XA3A 1J8HE 3VH8A 3IJSA 4O2FA 4Z7VF 5GIRA 3S5LB 3IU3B 4OUOA 5GS0D 1MREH 4YDVA 4Z5RA 3GHEL 4UILH 4FQ1H 1I8KA 2Q8AH 1NCBL 1UACL 4JO2H 5GGQL 1FG2A 3CZJA 4PTTB 5DD6B 5AYQA 1IGIH 2YD1A 5JIKA 1XMWA 3HUJB 1D5MB 5JW5A 2G75B 1HZHH 5DDHA 5GS1A 1HKLH <