1DBML

Molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
DVVMTQIPLSLPVNLGDQASISCRSSQSLIHSNGNTYLHWYLQKPGQSPKLLMYKVSNRFYGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQSSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA DB3 FAB (LIGHT CHAIN)
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1dbmL01
1DVFB 4KUCD 3E2HC 3W82A 4GKSA 3F5WA 5GRXG 4OD2A 2CMRL 1O7SA 1FBIL 2DQIH 1EO8H 2MQ3A 2J6EH 4PJXF 1A1MB 1PYWB 1RJZA 1A4JB 1I4FA 4L1HA 2OI9B 3O2VH 5TPWL 3F65A 3C09B 2Q76A 3CFJA 1BBDH 4HGMA 4HUVB 3G5VA 1T1XB 2FGWL 5TQ0L 1RIUL 2VRAA 3P73A 2Y6SD 4NO5A 4HBCH 4N8CL 4OZFA 3V5DA 1U3JA 1P84J 2FBJH 1QG3A 1JN6A 3HR6A 1W0YT 5JLZA 3FB8B 2ADFL 3PF2A 5T1DL 2HFTA 4H5SA 5IHLB 1RZKL 5INCA 2IWGA 3TF7C 3WN5C 1JUFA 3DTXB 5HVHC 1YDPA 4YFLI 4LNRA 5JMRA 4PRHE 2ZG3A 4I18B 2GK0B 5F1IA 4IIQC 5GRUH 4R0LC 3KR3L 2Y5TB 2BVOA 1A14L 4EVNA 1EAPB 4UIKL 1YC8A 1D9KA 1QSFE 1A6AB 2I60L 3PWVB 3C9NA 4HQQL 4AM0B 4NRZA 4OJFL 1S7QA 2EZ0D 1R3IH 1YNKL 1A6WH 4ZNCD 3GIVB 4HQQH 3B5GA 4KXZI 4HUMB 3DV4B 2F15A 1T2JA 5ABDE 5D7LA 1LP9B 3H7LA 1XMWA 4JLRB 2EDBA 3BEWB 5FCUH 3VDBA 4JM2F 4P2RB 4ZXBD 1CE6A 2P48B 2AK4E 1HHJA 2K9UA 3PDDA 5I74C 1IQWL 1M05B 4P4RA 1TZIA 4C56B 2GTZB 3X14A 3O3UN 3BD3A 2NTFB 3I9GH 5EWIH 3HMXA 1I7RB 2F5BL 1CFSA 3HNVH 3U1SH 2QTEA 3HS0A 1MFCL 2X7LA 1YEGL 4E42A 3BMWA 3VFRB 5IEHB 1ZA6A 2X1OA 1RZKC 1WT5A 4KI5D 4WFGE 4NKIL 2RIKA 2BNQA 1C1EH 4HLJA 4KI5F 2BMKB 2PW2B 1A7RH 3KPLB 1IBGH 1WICA 2XYCA 1YEJL 5EZOH 2H2SD 3I9GL 3MGOB 2Y6SC 1AP2A 3SDAC 4RGNB 4C4KT 2VZ3A 1OTUC 2HFGL 3PHOA 4LCWD 5E8EB 5E4IA 5F71A 1X6NA 1FVEB 2BCKA 4BK5A 4WV1B 5K9JL 1K9TA 1NMBH 1ZT1A 1NANH 2WINA 5F9WB 1AXTL 1YN7A 1LO4L 5I9QB 3I02A 1JWUB 3GSNH 4J1UB 1UYWL 2AEIT 4WCYH 3CVHL 2R2BB 4NQDB 3UDWA 3BQUC 2I26N 1PEZA 1T2QL 5FGSA 5IOPA 3MLUL 3X11A 5F6HJ 3ROOA 2JTDA 4OKDA 3QXAA 3OL2A 3UBXB 5K9QG 2Q7YB 3JWOH 3L1OH 1KJ3H 3VXUD 3WIIL 4W4OA 3S96B 5ITBL 1NGXA 1A1OB 1MRCH 2BDNL 1GGUA 1NAKH 5D71H 4LHUD 1U8NB 2DLIA 2VSCA 5F9DC 2J4WL 2P44B 5IJKC 4XP9L 3GBNH 2UYLB 4HULB 4ZUWB 5JXEC 2ARJB 2H45A 4P2QD 3WXWL 3NCJL 4ENEC 1LD9B 2HVJB 2XY1A 3KPQA 4GRWB 1PZ5B 3QH3B 3Q1SL 3QNXB 5HHVL 4LPXA 4TNVF 2VH5L 3BFOA 1DQJA 4K3HA 3ZKMD 3CFEB 1MCIA 3TV3H 3EUUA 1K4CA 4P4KB 1E28B 1QSVA 5CGMA 1XGYL 2FEDD 2P5EA 1QFHA 3PHSA 4FFYH 1KTLA 3O4OC 1U9KA 4OF8A 5LWYH 1G9EA 2NYYD 4U1MA 3QDHA 1UYWH 1G6RA 1FYTE 4AEFA 5I6XB 2CLVA 2CJUH 3AREA 2VL5A 4X4ME 4HC1H 4UV7H 3TA3B 4U1LA 1ITCA 4PUBH 5DUMH 1EUTA 4D94A 1N6QH 3PGDA 4R7DA 2R4RH 2GJJA 2ED9A 4L3CA 3NFSH 1ACYH 4NUGL 1J86A 5IB4B 1MJ7H 3QA3A 3QXAB 4GAYB 5CILH 4XNMB 5GGRB 2XA8H 4DCQB 1FZOB 3E6FA 1G7LA 2OYPA 3NFPA 3RQ3A 5C0BA 5GRJH 3QP3A 1ZHKB 1FL6A 5TH2A 2RCSH 3GMNA 5I2IA 2DS4A 3ZZ1A 4D0BA 4ZD3H 1U2HA 1UZ8B 1PFCA 1EO7A 3CSYA 2HJKB 4L29A 3TH3T 3WUWG 1YNTA 1QSED 5DQDH 4BKLA 3O6FD 3O3EA 3JWDL 1G7JB 3EYUH 4AENA 3GJEB 2HH0H 4XXDA 1NGWB 1TNMA 2P7TB 1CK0L 2DI8A 3LB6D 2VAAA 5DEGB 5EBWB 2BRQA 2N56A 2IQ9L 3LKOB 1W8OA 1YEKL 2QL1A 3CFEA 2YPVL 5EO0B 4FNLH 2JK5B 4EN3A 1GAFH 4XZUB 1M7XA 5LGJB 5JPNA 4KTEL 5JO5A 5DYOA 2YUXA 2YKLL 1HHHA 3NCBB 3RHWK 4LBEB 3KPSD 4PY8I 3RVXD 4H8WH 3LQZB 1K6QL 4Y19B 4MJID 2YN3A 1S9YA 5I74B 4YXLH 2AJXL 5IJVA 1CWVA 3PL6C 2VLJE 3UMTA 4C4KO 1HXYB 1RULL 2APVA 5FHBH 2ZNWA 3WDJA 4PRIB 3AAZB 3CFCL 3TN0D 4H8WL 1T5XB 4Z77B 2XACC 3H8NA 5JHDB 4POZD 3PNWA 1RJYB 5J1AA 6FABH 1U41A 4AYFA 4Z0BL 4NNPH 1M7DA 4JGUA 3CLEH 4RWHA 3GMQA 5EFIA 9CGTA 3O2WL 4RISH 1PVHA 5EOCH 2P8PA 2O5XL 3WJJC 5DK0B 1MFCH 2G60L 4B50A 4IIQB 2AXFA 1PQZB 4PJBF 3HI6L 4XI5D 1PKOA 4Z7NF 3VXSB 4C56D 4X99B 2Z4QA 1NAMB 1RZIA 5JMOC 5TE6L 2JB5L 1A4JA 2VR9A 3OKDB 4ZNEE 3QUZC 1MCPL 5D1XA 2GFBA 1JNLH 5E7BA 4KAQL 2NY2D 3SDCA 4FMKA 1OP5K 1QQDB 2C1OB 1WZMA 2FWOA 3U7AA 2WMPA 1G1YA 1YYML 4OZ4A 2NY1B 1A3QA 3CPLA 5B8CB 4LRNL 1I9IL 3UYRL 5FHBL 1KIRA 3DX9B 4K3EH 2DI9A 3Q0HA 4JCLA 4HZAA 2DQDH 3O9WA 4KU1A 5I66B 1DVFC 1VFUA 3VGAB 5IEKA 3D85A 4CJ0A 4ZFFB 1KLUA 3IFNL 3ARFD 5A2IH 4L1DA 3FCTB 3HUJF 2JB6B 4NCDA 4WHTB 5LWYL 3MLTB 1J12A 1G84A 1QVOA 4TNWK 4NQED 1IGIH 2BVQA 3O41A 3SGDH 2QQLL 2PTVA 2Q8BL 5IMOB 2P5WD 3RVUD 1BEYH 4IJ3C 2VH5H 4ZPTB 5HDBF 5DC9B 4UBDD 3AY4C 4XPBL 4FQHB 4YO0A 3EFFB 2ZP0T 5EG6C 1EPFA 2I9LB 1GHFL 4UZGA 5HI3D 1S7RB 3G5ZB 4BJLA 5J3HC 1LEIA 4OUUA 5I71B 4N1EA 1NCNA 3EKCA 2V2TB 3TIDA 3BPLC 5DJCB 2BVEA 4XB7A 5CEXA 4KZEH 3P9LB 2W9EH 4PG9A 2UWEB 4WHDA 3KAAA 1I8MB 4JRXE 3B5TA 3U2SA 1RV6X 4QHMA 2DDQH 3IDIB 1A7OH 5CJ8A 3TWCH 1WTGT 4WEUD 2WK2A 3ARFB 3WJLA 3GIZH 5ALCH 2E6JA 2XTJC 1EBAA 4F8QA 1MI5A 3SDXA 3O2DL 1MJ8H 1C5CL 1F4XL 1UB6B 3GIZL 4XMLH 2ZJSH 1KCRH 4Q58C 5H37G 3HI5L 4TTGA 1DQMH 5C86A 5DHVA 3QULB 1T0NA 2COQA 1I9EA 1ZHNB 1X3DA 1DQDH 1KC5L 4XNYL 3UJIL 1RMFL 4U2ZA 2VDPH 4JN1L 2D9CA 3D0LA 3O3DA 2E7HA 3BEVB 3FB7A 3ZE1E 1FNEB 4YHIB 2X1PA 4JPVH 2EH8H 5BS0B 5CFHA 1NCDH 4M7LT 5CKGA 5H35B 4D9QD 3CK0L 4MMZC 3TO4D 3PJSB 2E7CA 3DBXB 3WFCL 4TUKH 1J0JA 1RJLA 1FVDB 3QCUL 3BKCH 1EFXA 4H1LH 4M6AA 5FUZL 1L6ZA 3V6ZA 1TZGH 2Y7QB 3QQ4A 3HTLX 4L3AA 3KG5A 1A6TB 4AH2B 2OMBA 4JRYE 2WV3A 3IDJB 1I7ZB 1L9MA 1LK2A 3MUY1 4X6FA 5D1ZA 3WHE1 3SQOH 4YDIL 2HMIC 3MRKA 4P46A 4M02A 3GNML 1P6FA 2F19H 4PJ8B 4MQ7A 1RUML 3PWNA 5KVFH 1A3LH 2AJXH 5J7CC 1RK0A 1FZJB 3D39A 4UAOB 3HRZB 5JZ7C 1KLGB 1YYMH 1IZJA 4DEPC 5DR5H 5IBUB 4J4PD 4APQC 2FX8H 3ZTJH 1SBBA 4BQ8A 5F9JB 3B5HA 4M1DH 3WLWD 3L3JB 4U3XA 4IDJL 4N0CD 1RZFL 3BEVA 2HFEA 3UDWC 4ZOAA 1G6VK 5JIKA 4FP8L 2VXUH 3RX5A 4X6DB 1IC4H 2X4NA 3ULUD 3C60C 1KPVA 3MLZH 4Z7OE 1KN4L 3NACH 4HFUL 2IC2A 3NABL 4HUXB 1GC1L 4KKLC 1INDL 2D7MA 3D9AH 1KEGH 4HUWB 4QCIB 3TPUB 4QY8B 1S7SA 3UPAA 2I07B 3DECA 3TT3H 4IHOA 1IM9B 1U8JA 2MKWA 4O2CB 2GFBB 2MJWA 5C0IA 3ZYZA 1H3TA 3DX6B 4O02H 3KPPA 1NDGA 3TBYA 2WP3O 1BVLB 5E94A 3ULUE 2EIBA 3RNKB 3B2UD 4X6EA 1EDQA 4ENED 4FQXB 4WTWA 2DQCH 5JHDE 5J6HA 1IC7L 3DV6B 3KS0H 5I1IL 1CLYH 4LPYA 3GJFK 3G08A 5CLTA 4IS6B 4L8DA 3G6DL 4Z6AT 2GY7B 2YN5A 5KTEH 1S8DB 2VWEC 5ISZE 2J88H 4OV5A 2VLJB 5ANMA 3VRJA 4LLMB 3H9YA 1UXWB 2UUDK 1JIBA 3EHBC 4PBVC 4ZOBA 3MLXL 3T0DA 1IILE 4WHTA 3WXVH 5J1SC 3TZVB 5CZXC 4TPRH 1WJ3A 4JRXB 1KGCE 4PY7A 1FPTL 2J8UA 2E9WA 4YNYB 1T5XA 4H88L 3SO3C 4BSWB 1KCVH 2OL3L 3O45B 1OPGH 4QRRB 5BZWA 2O61B 4LLWA 3QQ3B 4LMQE 3RHWF 3VXOA 1U8KB 4HEME 1MQKH 4O9HL 2WSKA 5EULV 1U8QA 3KNBB 4J3XA 5T33L 1E4XL 3VGBA 1MIEL 3VXNB 2LVCA 4GXVL 4W4OC 2DQUL 4Z7UA 5F70A 3W0WD 4QT5A 4QRSB 2D9QB 3HCVB 3OJ2C 1OGAA 4KQ3L 3BPNB 4L5FH 5GGTL 1ZLUH 1RZ8B 3CVHB 3X3FH 1ORQA 1MF2L 2X89D 4PRPA 3IDNA 2BVTA 5FM4A 2P8LA 3CC5B 3TFKC 3UP1A 5CHNA 4Z7NE 2VLLA 5IMLB 3H7BB 5CIPB 4GW4A 1LE5B 4EQ2A 3ARBD 4MJ5B 1F4WL 2HTLC 3UYOD 2NR6D 3W9EB 2X4SB 1KPUB 3RL1B 4PV9A 4S10A 3ZTNL 5SV4A 3LHPH 3TN0B 1XGYH 4NRYA 5C6WH 4Y5VA 2KKQA 3T65B 3MO1B 1UKTA 3TZVC 4LAJH 2YD4A 5D7IE 4CDGC 3S98A 3BPOC 3QXUA 3TO4A 1MIEH 1IFHL 3ZL4H 4NN5B 3ARVA 2QQKL 4HH9B 3MUZ1 4X5WB 3QWRA 1S9VA 1B6DA 1GCFA 2NX5D 3P4NA 1ED3A 3EYOB 1UWXH 4LHUB 4NHUB 2OTUB 3MLSL 4F7TA 1J1OL 3ELAT 4X7FC 3BXNB 5KBNC 3QQ3A 4BSVA 2FO4A 5C08D 3VXSE 3GJFB 3GMRA 1F6LL 1CU4L 4LU5H 3U0PB 3ULVD 2VN7A 1Z3GL 4RGNE 2CO6B 1CICC 1FORH 4KROD 3OPZL 4NKQB 4D0BB 3AMKA 3LKQB 1I1YB 1QEWA 4M5ZL 1BZ9A 2HJKA 2PO6D 1WC7A 5C09D 2CKBL 4IMLB 4P99A 1KFAH 4BFGA 3INUH 3MACH 2XXCB 4KK8C 3QG7L 2C3XA 2XZZA 4PJIF 2QSVA 3SGJA 3V4UH 5KSUA 5DEGA 4HLZH 3QRFM 5C0NC 2G9HA 3BJLA 2Q86A 4XZUA 5DA0B 4AEHH 2HTKD 3RWEB 4FTVE 3JSSA 1SY6H 2YD8A 4FTVB 1N0LA 2B1AH 3RA7H 3SO5A 3WL9B 1IKFL 4RGND 4WWKD 3CH1A 2J7LA 1N6UA 4PV9B 4S1SL 4O02L 4LRNH 1QBBA 2C7UB 5ID1A 3GM8A 5GGVH 3TBSA 3MRPB 4H26B 4X8JB 2NMSA 2ADFH 3O8XD 5EORH 3QFJB 2A74B 3QHFH 1Y6MR 5GGQL 3VRJB 3MR9A 4F7EB 1S5IH 2DQFB 4EBQH 4HJGA 4YFLF 5ENWB 3NIDF 3OGCA 3S88L 4YQXL 4ONFL 5B38B 4IRJA 4PJCB 4L3CB 2QLVB 1FYTA 3BIKB 1HIML 5SWQB 1JZ3A 5GHWH 1L6XA 5L2JB 2EICA 3LEYH 3QFDB 1FN4A 1DFBH 5FCUL 4ODTL 3S34H 4OSUH 1UWGH 3VXOB 4RISL 3QQ4B 1KJ2H 3MROB 3JTTA 1ZTXL 4WFFD 1TFHA 3BDYH 1CCZA 5H94A 4G8FA 1HHKA 1F90H 1C7SA 5BO1H 1NCAL 4PR5A 4F15C 4FQLH 3VXPA 1MIML 1INEH 3F58H 4TOYL 3MPCA 5K9QI 2HG5A 1IGYA 3F7VB 1A7OL 3L6FB 3I50H 1WAAA 4QYOA 3S5LA 5MP6L 1QO3B 4DGVH 2UZIL 1W72A 2IH1B 3H9HB 4WJ5B 4POUB 5DDHB 2R1YB 1MFEL 2FL5A 4XC1L 3L3DB 2M26A 1DUZB 1KPUA 3O6KH 4DGIH 5D1XD 4PY7B 3LDBC 4X9IA 2F53E 1R5VB 1NAML 1XH3B 3G9VA 4YXHH 2DWEB 2YC1B 1BLNA 5C0EA 1NSNH 4MVBC 4ZAKB 3RWDB 1MAKA 1BWWA 2CRYA 4I13B 1IGTB 3OJDA 1QA9B 1CF8H 4MWFB 5E6IC 3QHZL 2FNBA 1U8MB 5GJTH 4QF1A 2Q7YA 1V7NL 4GSDH 1I7UB 2M8XA 1KJMA 3N1PC 4TQEL 2XWJB 3NH7L 2APTA 5CEYA 2EXYC 2XG4A 1F6AB 3EJJX 1EGJA 4GKSB 1S7VB 4JFQB 1KCSH 3V79C 3O4LE 4OI8A 1P7QB 5KN5B 3D39D 4I4WA 5D72H 1RPQA 1HSAA 4PJFF 4EN3C 3O6LH 4GRWH 5E1AA 1KB5L 1UB5B 3G5VB 5C0IB 3FMGL 1NFDF 3UTSA 1MJ7L 3ARDB 1U6AH 1QPPA 3CJJA 3ME0A 4UNUA 2R1WB 1HOCA 1DTUA 1PX3A 2BY1A 4KK9D 4BUHA 4LEOB 3QJFB 5DO2D 5EZIL 4JRYD 1JYVA 2AERT 2VXVH 1FJ1A 4CW1A 5J8OA 3MRGB 3ZKXB 2CJUL 1OLLA 3G08B 5K59E 3UC0H 1KJVA 1YN6A 2D7NA 1G7IB 2GK0A 4YPGA 1MREH 3MJ9L 4PGBB 4RRPA 1D6EB 1GZQB 4PJ7B 5LQBL 1A8JH 4Z7UE 5EOQL 4H25B 2VQ1B 3HZVB 5GJSH 5DJ6B 5IV2B 4P23A 4J3TA 4KUCF 3V8OA 4XWOD 4OCRL 3BSZH 1QFPA 4R0LB 3LH2H 4F37K 5JR1H 4NO0A 4OZGF 4OTXH 3DBXA 4R90H 2P24A 3O6FC 2VQTA 1ROWA 4EN3D 3V4PL 4XAWH 4ETQB 2W0KA 5IW6B 3X12B 5IVXB 3ZYJA 1NAKL 3RVWD 4HK3J 5DVOA 1FNHA 3QZWB 5FAAA 3S3PA 5BV7L 1A14H 1EFXD 1EH9A 4XGZA 3BZFA 4XAKE 5HHME 5GSRB 3JTSA 1OB1B 5C09B 5T5NF 3SOBH 3L5IA 4W68A 4KH2A 2DBLH 1T03H 4NT6A 1ZGLP 1MCOL 3MRKB 2Q87A 2C1OA 1R3LA 4DZBB 4HMCA 4HUVA 4WI5A 2RJMA 2ADGA 1ZTXH 3P4MB 2XA3A 4OZFB 3V5DB 1DBML 2IAND 3AB0B 3D69B 5JR1L 4OCSH 4R8WH 2XWTB 3TT1H 1I8LA 3VXMD 4G43B 5FUZH 4LSQL 1CK0H 4NKMA 4K8RD 4J3VA 3PIQA 1GZQA 5EU7E 2FB4L 3QIUD 1SJEA 4U1GC 1G9MC 3TEUA 5F3BB 3RBGA 5BOZG 3T0EB 5FDWA 2XXMB 1EVUA 1RK1B 3HE7C 5IM7B 3O9WD 4IRSC 4JG1H 1TJIL 3AS2A 4E5XB 4OCSL 4P23D 1MRDH 2OJEB 4JFFE 5MEND 4JAMA 2IALA 2IGFH 5ESAB 1KIQA 3FB7B 4JRWA 5AZEL 3O6ML 4N8VB 3NABH 4IM8A 2KH2B 1F3DJ 4JFXB 4Y5YC 5C8JA 3S4SA 4JHWL 4I3RL 3ULSB 3WYRA 5HGHA 5CEZE 2XWBB 4HXAH 4PREA 4ZOEA 1MELA 4G6KH 3F7YB 3LN5B 1J0YA 2FH8A 1BQLL 5IW1A 1OSPH 4CGTA 4B41A 4DZ8A 1CGWA 2WBJD 4U7KA 3LSOA 4QHMB 1R3LB 5J11B 4AIXA 4MDJA 3MRJA 4NQCD 2ARWA 2DB8A 3VFGL 3RPKA 2MMXA 1LMKA 3TCLB 2JCCF 3QUZD 5HPMB 1C7TA 1ZAGA 1F3DH 3H9HA 4PJAF 1Q0XH 3CX5J 2OL3A 3SE4A 5LKNA 4Y19E 1U8HB 5ECJE 1UQSA 2R2HB 4CADB 4FS0A 5DHVB 3I3EA 4EEEA 1I1AB 4AY0A 4RRPG 1WZKA 5E9DB 3TYFA 2AJZB 4OF7A 2A6IA 4KRMB 4WW1B 1UJ3C 1X7QB 5F9OL 4WUUA 2XZAL 2IPUG 3IFNH 4N68A 3FFCA 4FZ8L 3CDYA 4YLQT 5FYJD 4OZIE 4JDVB 1MCBA 4X80H 3Q5OA 4FG6D 4RBPH 4OM0L 1BFOA 4G5ZH 1F6AA 2DL9A 3TO2B 5DURD 1AC6A 1U6AL 5IG7B 4QTHA 1S7VA 4JFQA 3K8LA 5L2JA 1HHIB 1DJSA 5FYLE 1ACZA 5ADPH 4V1DB 3WFHA 3O6LL 1EJ6A 5DRXA 3QXTA 1T04A 5CCKH 4WCYL 1ZA3A 1EAJA 5T1LA 4J6RL 4M7JL 4KROC 1K3IA 3WIHA 1R5IA 4NGHH 4LRIC 4K55A 2EKSB 3IAGC 3ARDA 4OZFG 1OTUD 5DJ2B 4OT1L 5JW4Q 4G42A 3SCMC 3MLWH 4ZSOB 4PRPB 2ZWLT 2NXYB 5ADPL 2OTWA 4TSCH 2JIXA 5DFWH 3V8CA 3IFPA 5EU6A 5D6CB 5ERWB 1ZVHA 4GRLC 2D7QA 3QH3A 3QNXA 2X9XA 4ACPA 1I8IB 1FG2B 1CYGA 4Y8DC 3RIFF 2B39A 3EYQD 5F7NC 3PABA 2DM4A 3HG1D 4P57B 5D96C 3ROLA 4P4KA 4BZ2L 2N4IA 3DIFA 1EZVY 5T33H 1YY8B 2PKDA 5FV2A 2F5AL 3X3GL 1S3KL 1C08B 5J9PB 5HHMB 5BV7C 5K59F 5I73C 3SGKC 3QO0A 5JXEA 3CFIC 2CLRB 5T1MB 1EK3A 3JBG7 1E6JL 1XIWA 1TQCB 4HS8L 2YC1A 4M5YL 1D5BB 3I6KA 5FGRA 5IVNA 3IDMA 4RAUB 3TZVA 1CLZL 2BVUA 5HDLA 4KK9C 1A1OA 5E08H 3SDYL 2R2CA 1Q1JH 4HX1A 3IJSB 3VXME 1XGRB 4M9PA 3CZFA 5L2KB 3RWFA 3V4PH 32C2A 4JO3L 4YWGH 3SKMA 4DVRH 4HMDA 5L2KE 4P2OA 4YEFA 3KPRB 3HMXH 5EH1A 3T0EE 3OAUL 2DI7A 1CVSC 4ZO8A 4OF5A 5AD0B 1KT2B 12E8H 2HAZA 1EVTC 4V2BA 4NWTH 5KSAB 4Y4FC 1VENA 2PYFA 4M43H 5FUCE 3FTGB 5BV7H 3IJYB 3C60B 3T08A 4I1NB 4WUKH 3JWDH 3MRCB 3RWEA 1NGWA 5DFVC 5CWSA 2PW2A 5DSCA 3IU3A 4LP5A 1HI6A 1MLBA 1UCBH 4G9FB 3ZKNC 1S7WA 5A43C 5EBMA 2EXWC 5T1KA 1BOYA 1HYSC 3H7BA 1XF1A 5CIPA 5L2KD 3WLWC 2Y25A 2XY2A 5I30L 4Y4FA 2W0PA 3BKCL 1MJUL 4Y5XA 3NIGF 1HN1A 3NPZB 1TNNA 2EDEA 3TBVA 4Y5VB 3KGRA 3BP5A 4B7IA 4UDTB 4ZTPH 5C09E 2CUHA 3REWA 1G7LB 1X5IA 4G7VH 3MBEB 1MJJB 3RA7L 3LIZH 5BRZD 3P0VH 5HDOA 1DUYA 4P2QA 4HPOL 2O5ZL 4MVBD 4U6HB 1DQDL 1KC5H 4XNYH 5DUBA 2DTMH 1CFQA 5MHSE 4CNIB 1HCVA 3IJHA 2I27N 1DL7L 4JDVA 4KI5E 4CVWA 1XF2B 2YUWA 5IFJA 1JV5B 1LDSA 1FAIL 5I1EH 3OKKB 4PP2A 3KLAB 4OGYH 4OD2B 3GMPB 5ACZB 2W91A 4HT1H 1NBZA 1C8PA 3MRLA 3BGMA 4JPIA 3C09C 4UBDC 3OSKA 2OI9C 1JHLL 4JFEE 4UOW0 4MA7H 5DK2B 1CVRA 2R0KL 2VDLL 3ZKXC 4L8SA 3GEWB 5FYLL 1WAAF 4F58L 3HUJB 3EDFA 2I25N 5FGBA 1BJ8A 5SWZA 1JN6B 1OAZL 4QGTA 4ZSOA 1YNLL 4PJ5A 4K7PH 1J0KA 1AGDA 4JFFB 1BGXL 2OTWB 3W9DA 4HXBH 4TUJA 5EC2A 5JNYA 3U4EB 3DGGB 1LO3H 4FNLL 3VG9C 2ZCLL 3CSGA 2LU7A 1YEHL 4N9GB 1MI5E 3SDXE 2VUYA 4YAQB 2ZG2A 1G6RB 2C4XA 4RNRB 3RDTC 4OV5B 2DMKA 1EEYB 1NC4B 4LLVA 2DN7A 1WWBX 1EGJH 3C9NB 4JZJC 4PLJD 5FOBB 4KK5D 1ED3B 2YZ8A 3EYOA 1MCLA 4QNPE 2EECA 1F02I 1B0RA 2KDGA 1KB5A 4O5LH 4QOKE 3P3YA 1PBYA 2MQCA 1U93A 2PN5A 4G8EB 2WWKT 3U4BL 5LAXA 4CJ1A 5ESAA 3CLFL 2MHAA 2W0FB 4H20H 2H2PC 3LZFL 1TDQA 1VHPA 2VLRA 5K9JH 2O61A 2XI9A 3BWAB 4U31A 3CMOL 1NMAL 3OKNA 1QOKA 3RKPA 3M17B 5ALCL 1D5IL 5HYJE 1K5NA 1RHHB 4NOFA 4ORGB 4K23H 3G04B 3HS0B 3KYOB 2N1KA 3DUHA 3P0YL 4IOSD 1D5ZB 3ULVE 1ZA6B 2AXGB 1DEEA 4WIQA 3ZE0E 3LD8B 2ZOLB 4MQXD 2BNQB 3HNSH 4O2EB 3S34L 2YA1A 2X4QA 1I3GL 1NLDH 3TIDB 3ZE0F 3MV9D 1NC4D 3VRIA 2A9MH 3P9LA 4KJQD 3CDGB 5SWZD 4WUKL 1SM3L 3RWJA 2YBRA 1QLFB 2D0HA 5HGAB 4UIMA 3RGVC 1P4LB 2DM3A 3RWIB 2EE6A 4OFYD 4RAHA 4U7SA 3DRQB 1Y0LB 4OCYH 1WEJH 4YZFE 1JZ5A 5IMMB 1KJ2A 4OCMC 5D2LA 3TYFB 5ICYB 1MCQA 2CXKA 1JGEA 4GQ9L 1KEMH 2EDQA 1R24B 5HHNA 4DGYH 5T5FH 4PIRF 4NJ9L 5IB1B 2HTLD 4DWHA 5B3JF 1EAPA 3L9RA 5GIRA 1WWWX 5A16A 2N7AA 3MV9E 3PV6A 1OAKH 3C08L 1T89C 4P49A 5D1ZD 1HKLL 4P23C 1XCTA 4HKBA 5FUOL 4HHAB 5BS0A 3WIIH 2J1KA 2ZZUT 4KMLB 5E56A 2O5YH 3F5WB 4GW1A 5JW3H 4XGZB 3EDEA 1OP3H 1CDUA 5D9SA 2Y7QA 1T89A 2BZDA 4RFNC 4OAWA 4OQTH 4JY4A 1JGLH 4LEXL 2EDDA 4N1CA 4ODWB 4AT6B 1LO4H 5M94B 3TBYB 5GGVY 4D8PB 3VWJA 2VDRL 4D3CL 4BZ2H 1BBDL 5C0FB 2C3WA 5SX4I 2H2SC 1Z9OA 1I9JL 4DKEL 3OTTA 4TVPL 2CRIA 5HSFA 4NKOB 3IDUA 5EU4B 4WW2B 4Q2ZB 2XN9D 2Q8AH 5I1KH 5ITFA 1UM4L 3C6LB 3O81A 5EOTB 3FONA 2Q8AL 2OQJA 4PJ5B 1JTPA 4MQ7B 5D70L 3VGFA 1QNZH 3F6IA 3RWIA 4ONFH 4MA8L 3L3OA 5T5NG 3AMLA 3WFBH 3K8MA 2R0WL 3DUUB 1T0NB 3MBXH 4JO4H 4WWID 5E6IB 1A3RH 4OFIA 1B0WA 1HNFA 3G9AB 2ZSVB 1XCQB 2YA0A 5E99L 1AIFB 4HWEH 1HYSD 2IH3B 3NIDE 4NJAL 1L7TL 3CCHB 5KOVC 4HZLB 4OLUH 5F7WC 1IGJB 2V2XA 4POZC 4JN2B 2OSLA 3TN0C 4MNQB 4A2MA 1KSRA 2O5YL 3TESA 4XPAH 1KJMB 5HHXH 3QHTC 5CZXD 3T77B 3FO9B 4L8BB 1U42A 4M6OH 3BKYL 3V5KB 3AVEA 3FO0H 1MNUH 5T3XL 2CIIB 1DANT 4FN0A 3WS3B 4F37F 1R3IL 4KVNH 2QSTA 3KJ4C 2DQTL 4J3OC 2KZ1B 4R96B 4RMUA 5E8OB 5DJDA 4DAGH 1QPXA 5IB3B 4U6XB 1WIUA 4K07A 4KUZH 3DVGA 3TJEL 2NY3D 2YPVH 4URTB 3AB0C 1J11A 4DKFH 4O58H 4Y4KD 5MENB 3QJFA 2GTWB 1VPOL 1FJ1B 4UV4L 1MFDH 4KMTL 2OQJB 3MLVL 2AQ1A 4J23A 4OCLC 2YD9A 1FLRL 5F7FA 3BHBB 1OOAA 2Z35B 3MOBH 3LY6A 1YC7A 3FL7A 2G75A 3DURA 4G3YH 2P5WA 2X4UB 4XMPH 2IH1A 5KS9F 1SVZA 3SHSA 3MRRB 4WTZG 2R1YA 4LDOB 4RGOH 4TSAL 1DLHA 5L9DH 2NNAA 2YHGA 4G8GE 1IGJA 1B0RB 5DD1L 5JDSB 2PTTA 4UDTA 1BVKB 2R29L 2IMNA 3MNWA 4OZHF 3HG1E 3T1FA 3PQYB 1ES0B 4X7SL 5I1EL 1WSST 1AO7B 1I8KB 3MLUH 1U95A 5CZVH 4XCYA 3W2DL 1AXSA 5IB2A 4OFDA 4F7PA 1FL5B 4K7FA 3TT3L 5IWLA 5D72L 3VMNA 3BESR 4QF1B 3OXRA 1EHLL 1KEGL 4JRYB 1XF5A 3V0AC 1I7UA 2XICA 1JWMA 1TJIH 3DPBA 3PWPA 5GRVK 5IFJB 4WNQA 4HV8A 1IRAY 3U36A 3AXLB 4PP2B 1HH6B 3W39A 4JM4L 1LP9F 2V7HB 3BGAA 2HVKB 1C16B 3AUVA 4CRPA 5I15H 4Y5YB 3BQUB 3V7AG 3PWPE 2G5BA 3ET9F 1KACB 3T3PE 1T3FA 3KLDA 4L8SB 3V6FB 4CMHB 4JVWA 1KXTB 2BY2A 5J13B 1CICB 1RFDH 5C08E 1FNAA 7FABL 1OHQA 5EN2B 2ZUYA 3KPOA 1AFVL 3MCG1 1TTFA 2OL3H 4XTRC 1A9EA 1UXSB 5EWIL 3CPLB 4RWYH 2BJMH 1JGUH 3MTRA 1KULA 3UTQB 1J8KA 4NN7B 5LGJA 4U1GB 4UB0H 5GSVA 3RGHA 4KV5E 1VADB 1T66C 1UCTA 4MD4B 5D4QA 5HYJA 4JQIH 4QRPA 3QR2A 5TE4L 1EEYA 3DVFA 4LLVB 5T1MA 3VA2C 3MZTA 4QHLA 2NY0D 1JNNL 1CGSH 5F1NA 2PETA 1ZHLA 1HH9B 3QIWA 1ZHBA 3BW9B 4IRJB 3PQYD 5IOPB 4YHZH 4HKZB 3QSKB 4U1SB 5EIIB 3HZKB 4W4NA 2Z31A 1LEGB 4XPHH 1ZE3C 2VABB 1Q1JL 2DJSA 1NGZA 5LAXB 5CJBA 1LO0H 3PL6A 3DO7B 4XXCA 4HJ0C 2VR5A 5FGBC 2FDBP 1TPXC 3IDXH 4IRSB 3HG1B 3CX5K 3P2TA 1BQHA 1D3CA 5IFAL 3MA9H 1XAUA 4TUKL 2VDKL 1UEMA 3P4OA 3WD5L 4F8TA 2V2WB 4P5TD 2G5RA 3GMQB 1EUUA 3TC9A 1CBVH 1OM3H 4WVRA 5CD3A 2AK4B 1YEIH 3B2VL 1NCDL 3DRTB 2XN9A 2R4SH 1YECH 2XKSA 4QTIH 1I1YA 2NZ9C 2IBZY 2VAAB 5DD5H 2CLZA 1RFDL 2HKHL 5JIPA 2VLKD 1MCFA 1OL0A 1BFSA 3A6OA 3MRCA 3QHFL 3P0GB 2GKIA 1U92B 4G42B 3HUJE 2GJ6D 5EN2A 1IAOA 3BH9B 5IIEB 1DQJB 1P9MC 4NNXA 1VFBA 3B2VH 5JW3L 4GQPH 5CGYC 1J0ZA 4WU5B 2FB4H 4NRYB 4KDTC 4CBPA 1X5AA 2AABH 2RGSA 3FN0L 4LSQH 1T22A 3D3VB 5I1CL 1AHWA 1RZGB 4IDJH 1T7VA 1BWMA 2ICWB 4UILL 2CLVB 4RA0C 3NCYS 5GISH 2DM2A 1N7MH 4HCRA 1QRNB 5F1NB 4NP4L 2NNAB 5DD6A 2ZUWA 1P1ZB 2KUTA 4NC1C 2VLKE 4ZUVB 4NHUA 3HZKA 3IB4A 1FL3B 1MHCA 1B3JA 1FE8H 4ODSL 1A3LL 3U83A 4OCYL 2V6HA 2IQ9H 3IDMB 3MREB 4PJ9B 4K7FB 2IQAA 4JY6A 2G2RA 3VFMB 2P5EE 1NL0L 1DVFD 2HH0L 3RVVC 1T2XA 3BE1L 1LO3L 1FP5A 3KNBA 3MV11 3D0VA 1R0AH 4K7PL 2Y36L 2E3VA 4K8RL 4Y4HD 2FRGP 1X5FA 2PNDA 1MFDL 1F13A 3EFDL 3LD8C 5JOFA 1FO0A 4XRCA 3H42H 1CXIA 1G7PB 1CFTA 3FT4A 4Y5YA 4XPBH 1HDMA 3ARBA 3H2WA 3S36X 1NBYB 3EW3B 2R8SH 2FHCA 1YUHA 2X2YA 3QI9A 2X4UA 1CXHA 5IR1B 5C0BE 5LGKA 5F6IB 1LE5A 1J1XH 1N4XL 1XGUB 2LU3A 4ZO9A 1U8HA 4HGKC 3T0WA 3WNOA 4OLZH 1NFIA 3QDJE 5JDSA 3U4BH 2XKNB 1NQBA 2ZCHL 4GOSA 1G7HA 4HWUA 2W1NA 3MNWB 3MV7D 3MRNB 2IH3A 1KTDA 4ERSH 5AAWA 2EE3A 4GMTH 5L0QB 3MBED 4PRNB 1TZHB 4X6DA 1GSMA 3TO4C 2W92A 1REIA 4L5FL 3DROB 5T3XD 3RIFK 1VGEH 2AEPL 2W38A 4HX1B 4PS4H 3QIWB 3GI8L 5MEQA 2R2EB 1I75A 5B38G 3IGAB 5IP4A 3LKNA 3NA9L 3MYJB 4OZGA 4MJIA 2HRPL 2QHRH 1LNUB 5CSBA 3GHEL 4X9FA 1AGEA 3BPOB 3EYVA 3CFDB 3N9GL 3E3QC 3G5YA 2EIDA 3T0AA 1OAYH 3PGFH 2FX9H 1D9KD 4U1JA 4G6FD 1B4JL 3N1FC 1XF4B 3K4ZA 4XP9H 3RWHB 4TQEH 1P53A 1G6RL 2JLLA 1HHJB 4H88H 5TE6H 5I1AA 2XQYK 1JHKL 4LPWA 4C56A 3FRPG 1VKXA 5IB5A 1PZUB 4XMKH 4TRPL 3LAFA 1T7YA 2DJ4A 1WVZA 1SBSL 2WNGA 5EO1B 3VGAC 4X6EB 4QWWC 4HAFA 3WKMH 2C4FU 1NSNL 5DJXB 3IYLW 3MLXH 4H5SB 2Q8BH 3DTXA 2R1XA 1H8OA 3U7YL 4Z0BH 3QT2A 4I18C 3ETBF 4RMRA 2FGZA 4LCWA 2VZVA 1F3JA 1L0YA 2C3GA 4JO3H 3KPMA 1TCMA 3MGOA 2VXTL 3FT3B 4D0CA 2G75B 3MACL 2Y5TA 4XAKD 4M7KL 3K2UH 1ADQA 3GSNL 1T1YB 5L7XL 5GS0H 5F3BA 3B43A 1EMTH 3SDYH 3SOBL 4RQQB 1CDCA 3DSNA 3STBA 1NGPH 3QIBD 3RGVA 1AJ7H 5IJKA 1SBSH 3MRQA 4E5XA 4ZDHA 4HUNB 4MCYB 4E0RB 1DDHA 4WWKB 5C6TH 1E6JH 3S4SG 3SN6N 3VFUB 3HZYB 2VXTH 4JREC 3U46A 4N8VA 4F7PB 4X9GA 4JDZB 3VXTA 1J05B 3LS5L 1OP3K 3CZJA 2MPAL 3RL2A 4NUJA 5HTSA 5H2BB 3UROR 3JWDC 4M3JA 1F11B 3UCRA 5HHQB 1S9XA 5I17A 3ZL4L 4Y2DA 3KPTA 1IAKA 2HKHH 1VERA 1YEDA 5EIVA 2GCYA 1IL1B 2H1PL 2DD8H 3MLZL 2ZKHL 5KSVA 1JVKA 3OKNB 4XB8A 5FM5O 2J8UF 4BQBA 4RAVB 1NLBL 4OCNC 4KJQC 2VOTA 4WW2A 1RMFH 4YFEA 5D7JA 4QRQB 4LDEB 4LEXH 4NN7C 4OF6A 2DQEL 3MODL 4Y4FD 2MPAH 3NCMA 1J1PH 3TVMB 1D5XA 3R1GL 4G9FD 3C2SA 1Y6NR 2PYED 4P9HC 2CR6A 4YPGB 1BP3B 4U2YA 1S7TB 1JFQL 1NMCC 1D6EA 5E6IA 2A6JA 3QDGA 4ZFZB 1YDPB 2YBRB 2YRLA 4U0QB 5E8DH 3FT2B 3VI4E 5JW4M 1YEEL 3ARED 2CUIA 5FOBA 4KRPD 3SCMB 3GM0A 5DJ8A 5EPMA 3U9UA 2VDOH 1A7NH 4X6CB 5CJ5A 4XBGB 4MAUH 5E2UH 4NO0B 4XNZC 4L3ED 2AEWA 4HGWB 4S0SD 3BI9X 3U30B 4P46C 3TBTA 2A2QT 2X4OA 5I8EB 1EXUB 2SEBA 2BY0A 1S7UA 2OTPA 2B4CH 4NDMB 2A0LD 3TPKA 1T21A 5KSBB 3RL2B 1HNGA 4C59B 3TVMD 3QUKB 4HBCL 3QZWA 4PJCF 3M17A 5E8PA 3ECBA 1XCTB 4Y2DB 2PXYD 4I3SL 4PTUA 4JKWA 5GGUB 4F9PC 4NFBA 4B0MM 1JYWA 1FG9C 3BISA 5GSRA 2WWMC 4L4VE 1NCCH 3IF1A 4ODSH 5JTWA 2YZ1A 3N1GC 1DEEB 1NUGA 1QHPA 4MS8D 1RVFL 4WO4A 5EZJB 2E6PA 4JPIB 1KG0A 2GT9A 1ZWIB 1JPFB 5D1QB 1Z2KA 1KF9B 4JFHE 3GO1H 4NP4H 2J6EA 5E7FA 2C3VB 5T3XH 2IAMD 4QRTB 3QI9C 4ZOCA 1YUHB 3QI9B 2WWKO 4I0PC 1QQDA 4F9PA 1A7NL 1MVUB 1JZ7A 1NL0H 2BHZA 2WW8A 5GRJL 4UIMB 4DQOH 4NKOA 1SMOA 1T5WB 5DJXA 3QJHB 4JPWL 5E8NA 2YPLA 5GZNC 3QB7C 5EUOA 4UDUA 2BSED 3BZ4A 3IAPA 4OB5H 4PJIB 1VFOA 2OBGA 4L3EE 4YPJA 2E5EA 2MTPA 4QRUA 3VXRA 4G6ML 5DQ9A 1S7XA 4PRNA 4JANA 3BDYL 3ILPA 3FFCD 4WU7B 5FM8A 3DROA 4CVXB 4LSPL 4ODVH 3EYQC 4NKIH 3RVUC 2DQFA 1CD1A 4J6RH 2F53B 4PTTB 2KL6A 3ARDD 5I8KL 5DZOA 2UWEF 3C5JB 1O5DT 3BUTA 3HNVL 4JRXD 3KJ4B 5D2NE 1P9MA 2B20A 3EO0B 4OZIA 2BNUA 5GS2H 1IQWH 4F33B 3UTTE 4FFZH 5LXGH 2P24B 5KVDH 1U58A 3QO1B 4JQVA 3MNVB 1WBXB 1BJ1J 1DEDA 1SYVA 3BD4A 5TE7L 3ULVL 1MAMH 2AJYL 5LBSL 3PQYE 4KKAC 4O2FB 4U49A 3QFJE 2BVPB 3QG6B 1Q9WA 6FABL 5JOPD 4R97B 3U1SL 2IPTL 1UJ3A 5EO9B 3VFWA 2XTJB 1MFEH 5EBWA 5CAYB 3OAZH 3VWKA 5EB9A 1TETL 5HYQB 1BQLH 3U4AA 4RMQA 2WIIA 3E6HB 4N0UA 5HPOA 5L88L 3WE6A 1QLEH 1JHLH 3VWJD 3EOTH 3D3VE 4HDIB 1OCWL 3HR5B 4JCMA 4GAGH 4QWWD 4WI3A 1S78D 1YPZE 2DLFL 1TJHH 4L4TD 1QR1B 3T1WA 1P69B 5IR1A 1S9YB 2DQGH 2HT3C 3KPRE 2QKIB 1XGUA 3DXAD 1UH3A 4YR6B 3A6CL 1KEML 4M61B 1LO2H 3QEHB 5GZND 4G80B 3ARGB 5LGHH 1A2YA 2C7UA 5ELIA 1N5YL 5I8OL 2IANA 3LH2L 4FQIH 3VRLF 5IHUL 3P4NB 5ICZA 3MBEA 3CFBB 4I48A 1NGQL 2HTKC 4ZUTA 2V9RA 4JDZA 3P9MB 1IEHA 1GOFA 2DICA 3O3BA 5INDB 1T1ZB 4LQFH 4MA1B 4GKNB 2W9DL 1G6RH 3VE0A 3NFPB 1NC2A 2H1PH 4PY8J 2O93L 5F7LB 4P5MA 4MLSA 2A1WH 4ZUSA 3VXMA 1FGNH 3HPJA 4X8XA 5I1JL 4X9HA 3KLAA 5IHZA 1WF5A 1E6OH 1WWAX 3GI9L 3CZFB 5L2KA 5BZDB 2CDFB 4WDIB 3VD3A 5MI0B 3SGKA 5F88B 4NBYB 4PRHD 4F7MB 3BVNA 1MH5A 4UAOC 4OD3H 4YXKH 2CLZB 3GI8H 2W9DH 1N5AA 4GO6B 5BRZE 3O2DH 1QBLL 1NMAH 1V7ML 3EBAA 5F3HA 1IJ9A 3HC4H 3HAEG 5J57B 3MXWH 3CVHA 3DETC 1QSFD 3GSQB 1ZLSH 4M9OA 4OI7A 1IAOB 5JIIA 4HG4K 3L7FB 4P57A 4D9LL 3K80A 2FX8L 5C0AB 3U7WL 4DK6A 3JV0A 1CICA 1A6VL 3IU3B 1IGMH 4YHZL 1U3ZA 1CFVL 3Q3GA 1KPRA 3M1BA 1PX4A 2MOVA 4LSTL 2BSRA 2IJ0C 1K4DA 1H5BA 3LQAL 3INUL 5CIPH 1Q72L 1P4IL 3NOIA 5E9DA 5IJVB 1CXEA 1NCUA 3NFNB 4Z7OF 3U30C 5BXFB 3G6JF 4MD4A 4ODXA 5L0QC 2OCFD 4ZQKA 4FA8A 4KJPC 5E4EC 4L4TA 2EDXA 2HLAB 5C2UB 1VEOA 3LV3A 3LEVL 1DP0A 3OXRB 3QUYD 4H0IA 1S9VB 2YOCA 1J1OH 3VE0B 1IZKA 2BP3A 2OTUA 3QEGH 4LP4A 3WLBA 5EIIA 2DQTH 3KS0J 2IG2L 3KYAA 4MJ6A 3TO2A 4PJEB 3SDAB 1KNOA 5EU6D 2NX5E 3FO0L 3PL6B 3N9GH 2VXVL 5D7LB 5AYUL 5TF0A 4NYLA 2VLKB 3MMEB 1MWAL 1QR4A 3QO1A 3MJ6A 4RMTA 4P4KD 4FQCL 2VC2H 3WSQH 1T1XA 1T3FB 1I1CA 3KPPB 4LCCA 4Y16D 3KYMA 2HJFA 1JFQH 2FATH 4MHHI 3MV8D 3BYTA 4DAGL 3GK8H 2X7LB 1G9NC 4MMXC 2BRRH 1E28A 1IC7H 3UJJL 3ZT5A 4Y4KC 3VU2A 2DRUA 4I18A 1PG7X 2NY5L 4G6MH 1FG2A 1F00I 4PJIA 5F96H 5HHXL 2OR7A 4X7CC 3FQTA 1IT9H 1B6UA 4HIJA 3PABB 4J8RB 2VMFA 4TUOA 4LCCC 4XCCL 1L0QA 3Q48A 4PJDB 4GKZA 1NPUA 5ANMB 5T1LD 3ESVF 2C26A 4OCXH 2CPCA 1HIMH 1ZHLB 3RWGA 1X4XA 4YX2L 5HY9B 3SDAD 4GAJH 5DEFA 3BW9A 4ZQKB 3MV7B 4NN5C 4G80A 2Z31B 3K2MC 1QSZA 2FBOJ 4YBHA 2XZCL 3U9PL 3IFOB 4HXBL 2AK1H 2HFEB 3FO2B 1GC1H 1J8HD 4JQVC 1XR8B 4UT6L 1WFUA 3VA6A 4KRPB 1KTKE 2V2WA 3CFCH 4ZFOA 1P6AB 4KV5F 2AK4A 2CH8A 1G9NH 4GT7A 1S9KC 2VLRE 3GBML 1J0IA 3PL6D 5GGUA 3AC0A 2X9WA 3C6SA 4K8RC 3B3IA 3QPXL 4WHYH 4Z7UB 1E4XI 3VWKC 1MHEA 2AXHA 3QEQB 4LFHG 5KANI 5D7SH 1V5JA 5FO8A 3BZFB 3UPRA 1S5HA 1CGUA 3KPLA 4LGPB 1TTGA 3WCYA 2K7QA 2HT4D 3IAQA 1N5AB 5B39B 5B39G 4M00A 3V2AR 2VLLB 1BVLA 5E94B 5AUMA 2IBGA 4JKMA 3IETB 1NMBL 5SX5K 3S3SA 4LLQB 4WI7A 1BF8A 2AEQH 1G9MH 4P2OD 4LNRB 3ULUL 3HZVA 4YDJA 3QIUC 5EC1A 3PWJA 4MXQD 3VGDA 1J88A 1WBZA 3MRIB 2BVOB 4OTXL 3GI9H 3BYYA 3D5OF 4M4RA 1MCCA 4WWKA 4JQXA 3NAAH 4OZHE 4DFHA 4FQ2L 2GY5A 1G7MA 5I15L 4JO2H 4U1SA 1GVIA 3QCUH 5E6ZA 1ODAA 4QRRD 3L9RB 3GDBA 4KVCH 1D5MB 1DN0B 2GW5A 2H32B 1KTRL 4Z7WB 2BNUB 3LRSA 1NDMB 2ZKHH 3IXAB 3CMOH 3WEXA 4QCIA 3TPUA 5DHVH 1RJLB 1K5NB 3AGVA 1JF6A 1YEDB 4NQUA 1U8LA 3KPNA 4H1LB 1R3HA 5I73B 3RUGB 1IL1A 4S0TD 5DWUH 5T1LB 1WCBA 1MOEA 1HYRC 1UVQA 1GYAA 1NBVH 1X5HA 4GW1B 4M7JH 5EZIH 1I3UA 2XG5A 1T20A 4PP1C 5MHSD 1JZ4A 4ELME 3DETD 3HZMA 1VKXB 2PCPB 3EDDA 3MXVH 3OAZK 2UZYB 1IGCL 1NUFA 4QRRE 3LSOB 4PJ7F 5BVPL 1B0GB 3MUGB 1AJ7L 4FQCH 1SY6L 4ONGL 2V17H 2P5WB 3MRGA 4J7RA 5FYJH 5DRZB 5ICYA 3T0EC 4XAWL 3V0WL 1A02N 4N9GA 3V4UL 4NQEB 2YR3A 4BUGA 1NEZG 3TIEA 3RZCC 2ZPKH 3VFPB 2FEEL 2P45B 3GRWA 2FBJL 1Q8MA 3RJQB 1QRKA 3RFZC 1BECA 4XVJL 2DQHH 2VISA 3K3QA 4LASL 3BSZL 4PJBB 3T4YB 2CK0H 4N8VG 1IQDA 1YEFL 4MJ2A 3LN9A 3HE6B 4ZYKA 2V2XB 4UU9A 2J6EL 3I6GB 4Z76B 4X9BA 1MVFA 1P7HL 1WV7T 4PJ9D 5ANME 3HPLB 2MHAB 4MCZB 4CVUA 1CD8A 1F58L 1U8LB 4OD1H 3B9VA 4KVNL 4Y4HC 5E2TL 3RUGF 1WCBB 1DL7H 2ICEA 3V5KA 2XZCH 4PGDA 4JHZA 2E27L 1JGDB 3U9PH 5TDOB 3QYCA 2B2XL 2JJSC 4FABH 5E6YA 1T6VN 4NBZB 2VIRA 4LCYB 1DANU 1AXTH 4G8FB 3RVVD 4EKXA 1RJZB 5ESQA 3FN0H 5HVHB 2Q76B 3CFJB 5BVPH 3X17A 1IM9A 2M1KA 3CU7A 3FFDB 2E9IA 5E8DL 4GRLD 4FQLL 1FO0B 4LL9A 4PG9B 3SGEH 1BQHG 4U6VH 1B2WL 2R1XB 1T4KA 5CBAB 1E4KA 2GUOA 3BP4B 3UPRB 5HYSA 1JI2A 1MCHA 3MUGA 4AEIH 2KPNA 1HHHB 4DZBA 3SJVA 1WGOA 5C08A 1A47A 3VG0H 3L3OB 5B39A 2R69L 4JHAL 2GITA 1QO3A 1I3RA 2Z9TA 4Q6IB 2JIXD 5TF1L 2I5YH 4XP6H 4RQQA 4PJEE 1IEAB 4OZ4B 25C8H 2NY4B 4PRPE 3ARGC 1EGJL 4XHJD 1FFNA 1A4KA 3MRQB 3SJVE 5L6YL 4UNVA 1YZZA 5IMMA 1DDHB 1FPTH 1G7HB 4YDJB 3NFNA 4E41D 1K2DB 4XCNB 3VXRD 3BT2H 3JV6A 2D0GA 2YD6A 4P5TB 3LQAC 4RFOH 5AYUH 5TQ2L 4U7MA 1PLGL 3OF6A 1NAMH 3TFKD 5HGGS 3VH8B 2YSSA 4LSTH 2LFGA 5EORL 4Q0XL 5EZLA 2XWJA 3C5SA 3L3IB 2ITCB 3CXHJ 5D7IA 4K3DH 3QAZB 4OJFH 3ARFC 1BOGA 3QAZC 2HFFA 4YHKL 5GPRA 3DHJA 2HP4A 5IF0B 3O0RH 4K3JH 4XCFH 2Z4QB 4WFEE 1NEZB 3OKEB 1NBZB 5SWSA 4U1JB 3VDCA 5I1LB 2F9BT 3FJTA 3KVQA 3GMOB 1U91B 2VITA 1Q0YH 1I1FB 2DWDA 1MFAL 2DQDL 5IROA 3QQ9D 3E1F1 3SKOB 2I9LA 5D96B 3BD5A 4TNWF 1MIMH 3CVIH 3UTSB 5KAQG 3GJEA 4LLAA 4OM1L 5H94B 3FN3A 1FNGB 4GFTB 3GSRB 4NJ9H 2R0LH 5C0ND 4DVRL 3GB7B 2VXSH 5EU4A 4L4VA 3L7EA 1AGDB 4JFFA 3MJ8A 5J89A 4XVUC 4LSRL 1UA6H 5BVJA 5JOEA 4JHBA 3QIBC 1VSCA 5GZOC 4XWOC 2MCG1 4LCWB 4Z7QF 1A0QH 4E41E 3CDCA 5IEKB 4PGBA 4TUOB 2V7NB 3MV8B 5DMIL 2GI7A 1QYGL 2YK1L 2DIJA 1RUAH 2VTFA 1PD6A 2NLJA 2WIMA 3TGXA 2IANB 5DMIH 1OWRM 4M8VA 5CSZB 4P9HL 3LKPA 1GC1C 1MREL 5J0BA 4PJHA 3NTCL 1Q9KA 4R7NB 5D7LD 1FH5L 5F1KC 4G6FB 2UY6A 2IADA 3QFDA 1IC1A 5KW9H 2M2DA 2ZJSL 4ZUSB 2VLRB 1MUJA 5DUBB 1FSKC 4LQFL 2I9TB 3LHPL 5HI5D 4HG4J 4Z5RB 3X13A 1CXFA 3QQNA 1FZMA 4Z7VB 4ZSOE 5HYEA 5JA9A 5DTFB 3I2CL 5GS1B 4YDLC 3D18A 1HQ4B 1FDLL 3VXSA 4F57L 2ARJA 1N5YH 4DN4H 4L8CB 1YY9C 4KPHL 3V6FA 1JNHB 4JY5L 3RKDC 3T8XA 1AI1H 1PZ5A 4OD1L 1AGCA 4TSBL 1ZLVH 5DK2A 1DE4A 3UTOA 3BP7B 5KSAC 1I1RA 5E9DD 4XNUH 1WEJL 1GGTA 4JKLA 4FQJH 1AE6L 5B22A 2V9TA 3IETA 1QTYT 4LVOB 3BH9A 1BZQK 1QACA 4MNHB 2PXYB 5HYJB 3RIAF 3UTZA 5JDJA 3CK0H 3VD4A 1C08A 5J9PA 4HWBH 5IKCB 4JKPH 1MWAA 4JO1L 3ES6B 3D3VA 3MLSH 1H3XA 5IQ9A 1F2XK 2WUBH 4ZFFA 1CL7H 4AG4L 4JDTH 1BQSA 3LV3B 3TNNB 2F8OA 4KGJA 4NZUH 3REVB 3CXDL 3WNMA 4BM7A 1TZGL 1FDLH 3DMMA 1ND0B 3UZEA 4TN9A 5HYSG 4JLRA 4G6KL 4QRRA 1HILA 3LPFA 4FQJL 2EZ0C 2EIZA 4APQD 4LLWB 4MB5A 2B5IC 1P4IH 2EDNA 4RMSA 3GHBL 4I3RH 4GBXB 1XGRA 4MXWL 2A77H 5I2IB 1IKNC 4PRID 1LWRA 5T3ZL 1X5XA 3RWFB 2UY7A 1X5YA 3VW3H 1LDPL 3CAFA 3AROA 4NZTH 3T2NL 3DUSB 3C6LC 4DQOL 5AWNL 3FOMB 5E99H 4FABL 2IGFL 4HJJL 2R0WH 3HCVA 3MBXL 2PYEB 1NLBH 1QSFB 2A6DA 2D31B 3RY5A 5T3ZH 3MRJB 4LOUC 3TBWB 3HR5A 5KG9B 3BP7A 2D7OA 4MX7B 3TCLA 2R8SL 3OR6B 3QIUB 5I1KL 4Q6IC 4KKBC 2VC2L 3FB8A 3B9AA 2ZCLH 4HCRH 1Q9OA 3DV6A 3MV9A 1LE9A 4G6AC 1QSEE 2UZXB 1QP1A 1VDGA 1K2DA 2FJFA 3HLAB 1CIUA 1QSEB 2VZUA 4PJXB 1ZT4B 4P9ML 4NM4H 4X6BB 1H5BB 1T03L 1OY3B 5IQ7H 1AY1L 3O3BB 1BQUA 3VCLB 4LAQH 4AJ0A 3ZTJG 2LAGB 3MX0A 4MA7L 1KYOJ 4U1HB 1A0QL 3AFLA 3ABZA 1VB9A 2EC8A 5MI0C 2EIZB 4R7NA 3KDMA 2A38A 4K94H 1H0DA 1FCCA 3HPLA 3NCYP 1IGIL 3OKEA 3WIFB 1LP9A 2X1XR 4PJCE 5T5FL 4MXQC 2YKLH 3SE9L 5IB3A 1SYVB 2FO1A 5C0CA 5KZCB 4OM1H 4JG0H 2DQCL 2DLFH 4KAQH 1BMGA 3QUZB 2BFVL 2AV7B 3SDDD 4PRAA 2VL4A 5TGBB 1G0DA 1MY5A 1ZANL 2IEPA 2UVFA 4YK4C 2XNAA 1YNTB 4L4VB 3C87A 4E42B 1EZVX 3WO4B 3HNTH 3C8DA 3V7MA 4OGAD 1TLKA 5DMJB 2ESVB 2R23A 3BDXA 2WIIB 3SO3B 4U0RC 5CJOL 5C7XL 2A9ML 1UG9A 4JO2L 1JHTA 2IPTH 1HWHB 4EZMA 1AQDB 5BQ7B 1FC2D 2A6JB 2VZTA 1PY9A 4GLRI 3T0EA 4RFOL 1RZJC 4LSUH 3V6OE 1IEAA 3ALWA 1F4HA 3RPIA 4M61A 4EI5B 5FF6A 2Y1VA 4K7PX 1FGVH 5JZ7D 2J5LB 3TN0A 3ULUH 1NJ9B 2ZG1A 1W2KT 2ZSVA 2DD8L 3ARUA 3EOAA 4JZJB 4PJIE 2AJ3B 2BOCA 3JV6B 1CDBA 4WEBH 2SEBB 4WI6A 4ERSL 3C2AH 5A2KH 2I5YL 3Q5YA 1Z9LA 3IFLH 4JN2A 4MQSB 4PJGB 4PRBB 2NY4D 2YEZA 5AG9A 2F8XC 3VXUB 2BNRD 4MNQA 4OLWH 4TVSa 4QOKD 5E5MA 4GRLA 3C5ZC 3N0PB 4S2SA 2CRZA 1KGCD 1R6VA 3B9KA 1F58H 5D7IB 2Q6WB 2FJGA 3NGBC 4NUJB 1NFKA 4CMMB 4U1KB 4DKDC 5J6GA 2FJHB 3WS3A 5I1LA 1P4BH 4V2CB 2X70B 1NUDA 4LKCA 1AGFA 1D6VL 1OB1A 3OPZH 5C09A 1MEXH 1BIIA 4KKNA 1OAKL 1TETH 1F4YL 5L8LB 1H8NA 4M7KH 2DQJH 1EEZB 3HB3C 2ESVA 4KZEL 1JGUL 2X4PB 3NN8B 4ZAKD 3RNQA 4YDVB 4X6CF 3U48A 3KPMB 2AI0L 3IDYB 4JFPA 3RJDA 3X3GH 3L5XH 1QD0A 2QQKH 4QLRA 1JPGB 5AUMB 4WW2F 1AH1A 5J56B 1VEPA 1UB6A 2ESVE 3F8UB 1P4LA 4MZ2A 5ISZA 3AS0A 4R2GD 1X5JA 1OT2A 1I3VA 1CQYA 3DYOA 1KJ3L 3EYUL 1Q72H 3VRLE 3TLRA 2NY5C 3BIBX 1GGBL 3PWJB 1RIHL 1P7KA 4K9EH 5D7JC 3FQRA 1A1NA 2VUOA 4ZTOH 1KV3A 1NBVL 1EHXA 3VXUA 4RMWA 5FA3B 2AGJL 3BAEH 1HEZB 3V5HA 5I8EA 3EHBD 2X1QA 4S2SB 4MD5B 3BDBA 4HHAA 3I75A 1F2QA 4NDMA 5I18L 2HKFH 5C8JB 1D5MA 5JXAL 4KJYB 2A77L 1X44A 3MXVL 2F58H 3QRGL 4LCYA 4QXWA 5IWLC 5FO8B 5KSBF 3KPNB 4H1LA 4I4WB 3MJ9A 3VXSD 5J06A 2GK2A 2AGJH 1DQTA 2GTWA 4QRQA 4JY4B 2VLRD 4WO4B 2W07A 4LGRB 4I3GA 4TULH 5IB5B 1B90A 1EIBA 2QADC 3S5LG 3VDAA 1LEIB 1CL7L 3MOBL 5F9WC 4Q9RH 5C3LD 2X41A 1XF3B 2FWOB 4MDJB 5F93C 5DJCA 1JE6A 4BFBD 1UM5L 1J1XL 1N4XH 2YUZA 1KN4H 3MV7E 4HWBL 3HZMB 5B8CA 1OAXH 5EOTA 1UACL 4LARL 4Z7WE 5H37H 5ALBH 4H26A 2NY6D 1ZANH 1F3JB 4RGMC 3FRPA 1JWSB 5EBLA 5EOCL 3VXQA 1NC4A 4JGMA 5DRZA 2B8OT 2VQ1A 1JZ2A 5DDHA 3VI3E 3BRFA 5F6IC 3RWGB 3L3HB 3SE9H 4EIGB 1N3NA 2IANE 3QWOB 4HZLA 1LILA 1R0AL 3B9KD 3UX9B 3FHQA 4E0RA 2H32A 4OFYA 1YMME 3MRFA 2Q1EA 1MCJA 1U3HA 1EO5A 1HE7A 2XN9E 1BFTA 1RULH 2W0FA 4ZPTA 4FXLA 1F3RB 3NZHH 4W6WB 4HWNA 1OP9A 1M7DB 2VDQH 3Q6FA 2MCPH 4ZFOB 5EFIB 1HKFA 3RY4A 4WGVB 3D0VB 4X6DF 4XVTH 4M6NL 4GRLB 4RCAA 2BOBB 1RZKH 3QUZA 4XNXH 1HHKB 1EV2E 4WUUD 4HWEL 2L7JA 5I75B 1OGTA 2F54A 4MDIA 4XH2B 3IJYA 1KJ2L 2EDYA 3V6OC 1N59B 1GZPA 1RSFA 1NH6A 1UEYA 3BZDA 5ALBL 2FECL 1JL8A 5HVGB 4HWZB 3WNLA 1F45A 1WLHA 3WO4C 4FXGB 3PWUA 4LGSB 1FV1A 4P2RE 4L4VD 2Y07H 4M1GH 1NLDL 5A2FA 4FQ2H 1WZ1H 1OAYL 5C9JA 3T04D 4CUCA 1NFIB 2GSIA 1R5VA 3TA3A 5HD8C 1MFBL 5ACLA 4RFEA 3HLAA 4GAJL 4I8DA 4YAQA 5FKAB 1CGSL 3FHAA 1XIWB 4GRWF 5DGQA 4K94C 4S1QH 2MCPL 2JB6A 1P1ZA 3VJ6A 3AU1A 4JQIL 3IGAA 1Q0YL 4X80L 3QEUB 1RUKL 3B9KC 5C0BB 5C0RH 2QBWA 1Z5LB 1BQHB 1LO0L 5CGTA 5CD3B 2GSGB 5FM5M 5HI4D 1MSPA 4YO0B 1KCVL 4H1LG 4ORZC 4G9FE 1S9WA 4WI4A 2A9NH 1BD2D 2AJYH 3L3GA 5LBSH 5AD0A 2IAMA 3RVTD 4LCCB 1IMHC 2CDFA 3PE9A 4GS7C 3QIBB 1DLFL 1CR9H 3RTQB 2P7TA 3IVKB 3QUML 3SGEI 3JXAA 3BPCA 3WXVL 1MQ8A 3K4DA 5FYKE 3BKJL 2EDRA 5CINL 4MD0B 2HMID 4N0RA 5EOQH 4FFVC 2CIKB 2B4CL 1WAAE 2Q7NA 1MLBB 1HI6B 3MA7B 3MCKA 1GXEA 5FYJE 1IGML 1NMCB 2PXYA 2C4FT 5FO7B 3WDHA 4TULL 4LDLB 2GSIB 4M8QA 2Y23A 3LEXB 5I19H 3ARBC 5E4EB 3QUYB 3T09A 4Y1AA 4GUPB 4ONGH 5K9KB 1IGFH 5DHXB 1YEEH 1C5CH 1VGKB 1WFNA 2VL5B 2AJSH 1BM3H 4PRIA 3VH8A 4UQ3A 1CI5A 4JREB 4Z77A 3GBLA 1KB9K 2HKFL 4KY1H 2HT2C 4NJAH 5IT2L 1XFPA 4F7TB 2A0LC 1T6WA 1DUYB 2NY5H 2DDQL 4PJFB 4PJ8D 4JFZL 3UYPA 1QRND 4BSVB 4OZIB 3P77B 3HKFA 5ID0A 1T80A 1MRDL 2ILLA 3SDDB 4WFHE 1U8NA 5IVXF 2VERN 4N5UA 4PJDE 4J2XA 2P47B 1INDH 5DRXB 4FRWA 3VW3L 3S37H 3LIZL 35C8L 1TQBC 2NY2B 3GMOA 4R6UA 1MUJB 4ZO7A 1ZA3B 3X3FL 3DO3A 4MXWH 2XTLA 2DMCA 4MAYD 2GTZA 5FYKD 5CINH 2QADB 1NCBL 1DBBL 2NY1C 5TDPA 4O58L 3BJ91 4S11A 5FGCE 1MWAH 5I19L 3TT1L 2EH7L 2HLFC 3VWKB 4FQXA 3CXDH 4PB0H 3VFNB 2QSCH 4ZXBB 4XMPL 3GJFH 4GXUM 4FMFA 3FB5B 4BZ1L 2EC9T 2KBGA 5FOJA 1YJDH 2E7LC 1F42A 3ZLQC 1LO5A 4XCEB 4KK8D 3S35H 3J7HA 5FYJL 5JOPE 4YBQC 3DOSA 5FYLH 5IMLA 2DBJA 3HC3L 3LKRB 2XQYG 3T0VA 4MJ5A 5I76B 4MNQD 1WQVT 4Y1AB 4MNHA 1FFOA 2ICCA 1G0YR 4CDHA 4Z7VE 3LQZA 5C0DA 4QXUH 2EE2A 2EYTA 3DVNB 2PTTB 5C3TA 4J1UA 1AIFA 1XGQA 1V3JA 4WEMB 2X5PA 5B4MC 4GLRH 1JPST 4DTGL 1R3KB 1FL5A 1IAIM 3WFDL 4WUUB 3WDIA 5I1IH 2D7TH 2VB5A 2ZUTA 5D2NB 1II4E 4Y2DC 1U8QB 3W11C 4OSUL 2GJZB 2QR0B 4U3HA 3MRMA 4YUEL 1MCPH 3L3IA 4PREB 2IQAB 2DLHA 3BXNA 4LVEA 5F1OB 3AXLA 4KJYA 5KVDL 3RZCB 3F7RA 8CGTA 1OTSC 4XMKL 3GJFA 3GMRB 3STLA 1A9BB 2CGRH 1ZLUK 3DWTA 3T3MF 5I0ZA 3QZWG 1S7SB 3WFHB 2VZOA 5EU3B 1JBJA 3B8SA 1GZPB 5F21B 3RVWC 3DX7B 1IBGL 3DARA 3P11L 5KSAA 4UNTA 1MRFL 1J10A 2P8LB 1R5WA 3OGOE 1R5IB 1A5FH 5GGQH 4A2LA 5HPMA 1KBGH 1VESA 1B9ZA 3KPQB 2OL3B 4N0CC 2WBJA 2H9GB 5E70A 4PLNC 4PJAB 2ED7A 3HB3D 2X4SA 2FSEA 2FIRT 4LCUA 3PDGA 4M6NH 3DUUA 5E2VL 2ERJB 3EJYD 1GGCH 3BZ4B 3T2QA 1KB5H 3ZDZF 4IS6A 4ODHH 3K81A 1FLTX 2EDJA 4XPFL 5KZCD 3SY0A 4LIQE 4RGMB 4R97C 2ADJB 2YWYA 3H3BC 3D2UA 4P3CH 4K71C 1EHLH 1F8TL 1N64L 1U8IA 2WBWB 4N8PA 5DXWA 2L4OA 3B83A 1CD1B 3HMXL 1WITA 1BZ7A 2OS7A 4HFWB 3MFGB 1S7QB 5GZOD 1X4ZA 3SCMA 3BOVA 1GGBH 4PLKD 1K8DA 3QI9D 4JRXA 4X6CA 4KQ3H 4L8BA 2XQBL 4Z76A 3MRFB 1BX2A 4W70A 5EU5A 1HHIA 1SHMA 3QHZH 3ARWA 4CN4A 4AMKL 3TWCL 5HVFB 3EOYG 2IBZX 1A22B 3WKNA 2GIYA 2NXYD 1U8KA 4X6CE 2ATKB 4O2FA 4P4RB 3QG6A 1TCRB 3RX8A 3ARPA 2X4TA 5BS0E 2YPLD 2BSSA 5B21A 3QDJA 2F54D 3CU1A 1ZEAL 3V0WH 3DI2B 1PG7L 2FHBA 2JIXB 4C54A 2BERA 5D71L 4U6TA 2KQMA 2ORBL 2E8YA 1QFOA 3GHEH 4JJ5B 2Z91A 1TENA 1I4FB 2EYRA 2R0ZH 2BNRB 2JCCB 1S7TA 1T7XA 4IRZH 3QDAA 4MZ3A 3V0VA 2PCPA 1I8MA 1ITBB 4ZFZA 2J8OA 5CILL 1IEBA 2HN7B 3CXHK 5F44A 4WO4D 4C57C 1JK8B 3RKDD 3HRZA 4G7YH 5FHAH 3TYGL 3MLYH 3PV7A 1YN7B 3MRIA 2JJTC 1P7QD 4BK4A 4OLWL 3UTTA 4M6OL 4AQOA 2FEEI 5DS8B 1LGVA 3OX8A 4WHCA 1Q94B 3QULA 3MGAA 1S7UB 2W60A 2X4NB 2APFA 2EO1A 3LRSB 3IFOA 5CD5D 4IRZL 4LF3A 1N26A 4NQVA 4NRZB 3WEXB 5C0EB 1N6VA 1FIEA 5HHOD 4ZUUB 3T2OA 3FO9A 3MLPA 4WRLA 1JGVH 3RUGA 1Q9LB 5DI8B 1U2CA 4OFVA 1CD9B 3CH8A 5CJQL 1S9XB 5I17B 4KJWC 1RIHH 2GCYB 4JR9H 2JB5H 2IFFH 1PW3A 1QBAA 4NRXA 4Y7MA 4CMMA 4YHMH 1P7QA 4BH7A 4JJ5A 4QNPF 1E4KC 4R4NC 5IFAH 3FOLA 4OLYL 2NY7L 4NPYB 5IHUH 2VN4A 2YD3A 3W0WA 1JNJA 4AIOA 1FE8L 2RFXB 4X83A 4F3FA 4PJDF 4AL8L 1CLOL 5ETUA 4KMQA 4BH8A 4KZDL 3MOQA 1OAZH 4U33A 3L3DA 1Y0LA 4AL8H 1NFDB 3VD7A 5D7SL 5EC2B 1T66D 1MCWW 2PO6A 4ISVB 5IUSA 5I16B 1KIRB 3DX9A 3J8F7 5DS8A 5DT1H 4MSWA 4YK4B 5I66A 4XXCC 3T0ED 5GGSA 1IQDB 4Y2OA 2ADJA 5IM7A 1A7PL 5HXMA 1BHGA 4RZCA 1GPOL 4ZS7H 1INEL 4TOYH 2NX5A 3E8UL 3OGCB 1NCAH 2VE6A 2OK0H 3MOAH 4G8GA 1L7TH 1QVOB 5CEYB 4ZUUA 3T3ME 1LNUA 1U93B 4Q6YA 1DN0A 2FJGB 4LCWE 3KDMB 1GAFL 5ID0B 5K93A 3IXAA 2O5ZH 2Y06L 5IMOA 4OF0A 2ZUVA 1OAQL 1MRFH 5EU3A 1XF4A 3O2VL 1R3HB 5TPWH 1UWXK 4G7VL 4OIAA 3EJYC 4GH7B 4N0FB 2J12B 1X6LA 4S1DD 3R4DA 4X98A 3TNMA 2HRLA 2X4TB 4KDTA 3JTSB 4HIXH 4IRJD 4M1DL 2BY3A 2JF1A 4ZXBA 2ZCHH 4F7CA 1H3GA 1UA6L 2ENSA 4NQEE 5JO5B 3LB6C 2HG5B 3ZHLA 3NA9H 1G7IA 4CU8A 1FHGA 2RHEA 3K0WA 1YPZF 2BNRA 2JCCA 5FEBA 1S7WB 1K8IB 3ARFA 1NBYA 3D2UB 4RMVA 2DQGL 2AEPH 3HC0B 5T1KB 5C6TL 5EBGA 1L0XA 4ZS7L 4G8IA 1TIUA 3GRWH 5I76A 4NQEA 4GMTL 2DQUH 2XFXB 4HFWA 1NGPL 4LVHB 1MY7A 1V3MA 3MV7A 3KWWA 3Q1SH 1HXYA 4H20L 4M7LL 4PLOB 5HDQL 2BSRB 1FL3A 1UZ6E 3N1QC 1NJ9A 3EYFA 1XH3A 5GS0L 4HH9A 4X5WA 3BP5B 3P4LA 1GOGA 1T1ZA 2XPGA 4LSSL 3I85A 2X4RB 4LCIL 4OIBA 3WHXB 1JF1A 2WUCH 1RJYA 4KHTL 4HEPG 1V7NH 3PUCA 4GSDL 5C0GB 1OARH 1GHFH 1CIDA 3DO7A 1CXKA 3QBTB 1AD9A 4QXTA 4PYHA 2I24N 3QUMH 1XF2A 4MJIB 2ARJQ 1RHFA 2CKNA 1GIGH 4Z5RA 2ZOLA 3DI3B 2MKLC 4UOJA 5FXCH 5TDNA 2LABA 4PJGF 3GSXB 3ARBB 4QXGH 4XBEL 5E1HB 5IVOA 3O8XA 4KFZC 4QRSA 3ZDZE 3U6RB 2Z8RA 2Q86B 5GISL 4F57H 1RZ8A 2D4DA 3JUYA 2HRPH 3DMMD 1DBJL 1X5ZA 1HK6A 2V7NA 3MV8A 5HD8D 4NN6B 2XKNA 4M8QB 5BV7B 1ACYL 4TSCL 3D3VD 3GSWB 4WV1A 1AR2A 1F4WH 5DRWB 2JELH 3PGDB 1QSEA 4R7DB 1MHHA 4IJ3B 3KWWB 1UWEL 4YDKL 3QFJA 3ARGA 3NCEB 5C0AD 3SKUD 2DQEH 3MODH 5D5MA 4PJBE 1WT5C 3S37X 1A6ZA 3B9EA 4R3SA 3I6KB 4JG1L 3HRPA 2ZSWB 1CT8A 2CD0A 2IADB 3QUMB 1OQOA 1KIPA 1CZ8L 5DQJA 4P9HH 1PKQA 5E6ID 5IK3A 4ZTPL 3BMVA 3UBXA 3OJVC 4JRYA 4YHLH 2X89A 1VPOH 1IKNA 1VEMA 4FQQA 1KN2H 2VLKA 3MMEA 4LVOC 3BN9C 3VXNA 5CJXA 4PLJC 2WBJC 2PR4H 4OZHB 3VFMA 4DKEH 3QUXC 1AE6H 3VXMB 2NXZD 3KPRA 4L3EA 4UTBH 2E7BA 3JWNC 3O3AB 3O2DA 5CBEA 2P8PB 1JNHA 5C0CE 1FSKB 2VLJD 1RZJL 2UV3A 1CN4A 1C16A 3LS5H 1FIGH 1H3PL 4EXKA 3LKQA 3BKMH 1OAUL 2AQ3A 4JO1H 4N0FA 1T1WB 4PGJA 3LKOA 4PR5B 4Y5XC 2CO7B 2DQJL 4HWZA 2XZQH 3LS4H 3BE1H 5CMAA 3GUTA 3QDGD 1WUNT 3MRBA 3GSRA 3D1MC 3HHRB 1A7PH 3BPCB 5D1XB 2F19L 2X05A 4G9FA 4XPAL 2PO6C 1F6FB 4EDXA 1MHPH 3OMZA 3T65A 4WY7H 2H6PA 1YMHB 3Q3GB 4KJWD 4PJAE 2AXJA 1MHHB 1FIGL 2A6KA 4POYA 3KYNA 1N7ML 5SWSD 1BFVL 1F8TH 1A3RL 5E08L 3LEXA 1JJUA 4JEGB 4NQCE 4NO2B 4DVBA 5I1CH 1DSFH 3E0GA 3RP1A 4ALAH 4KDVA 1KN2L 4NFDA 4Z0XA 2DJUA 5CP7A 2FO4B 4PJEF 4YEEA 2QJDA 3UJTH 1ZS8B 2YUVA 5DHYB 4UT6H 3QWQB 4IRJC 3EDJA 4X6DE 3QFJD 1B4JH 4YJZL 2R56L 1WBYB 3P77A 2B1HL 2H26B 5MEPA 4HUUA 1JGLL 5TDOA 4W6YB 2R69H 2IAMB 2L0DA 4MA3A 1IAIL 5DTFA 3RTQA 2XV6B 4YZFF 1PSKH 5KVGL 5CZVL 1D5IH 3K1KC 4UMGA 3PXJA 4XNQA 3QRGH 4X6FB 5CEZL 3F12A 3W81A 3HNTL 3T8XB 5D6CA 5J4MA 1H3VA 4L4TE 3NCCB 3OKLB 3KLSA 4FP8H 3UBXI 4G9DB 1CTOA 3MA7A 5L9DL 4NNXB 4PD4K 3O8XB 3TA3D 4CMHC 3HC0A 5DZNA 3PHOB 3WUZA 3RTQC 4NWUH 1X5GA 4TTDC 3MRRA 5ETUB 3JV4B 1ZVSB 1T5WA 3U0WH 5K9OB 5FHAL 3K8KA 3TYGH 1FLRH 5E8NB 4Q0XH 5CP3A 1AXIB 5E2WH 2APWA 3ORJA 5IVZA 4OM0H 5GGTA 5C2BL 2XPGB 1CDHA 3V6BR 2Z8SA 5DQ9B 5F7MC 2APBA 3P9MA 3HC3H 4WU7A 4CVXA 4HS8H 4M5YH 1FO0L 5INDA 2NX5B 4XPTH 4O9HH 5IQ7L 4Y19D 4L9LC 2P4AB 3D0LB 4MHHG 4D0DB 1O0VA 1ZLVK 3AU1B 4KHTH 4OLXL 4UU9B 3S7GA 1XGTA 4V1DE 3QDME 1BOGB 3DV4A 4K2UH 2XOTA 4KK5C 1HH6A 1S3KH 3X12A 2JJSA 3ALXA 3RZCD 1UVQB 5EUKA 2J8UE 1L7IL 2B4CC 2CIIA 4NSKB 5ISZD 4FFWD 3I50L 4WDIA 4QHNA 4R96A 3MNVA 3IKCA 2D7PA 3BH8B 5TDNB 1DLFH 1P4BL 1U8JB 4FFZL 1IGCH 3WS6A 3MCLH 2A9NL 2UWEA 3RTQD 1GGIH 3NFSL 4HH8A 3FN9A 4U6YB 4C58B 2CDGB 3MJ9H 1UJ3B 3VGHA 4Z78B 3VFRA 2ZUQB 1LK2B 2JE8A 4R9HA 3O11A 2E6QA 4GG8B 1IEBB 4P0DA 4I77L 1D5XB 1TPXB 5AWNH 5EUOF 4HBQA 3ZO0A 1ZSDB 3MLYL 4ONHB 3BHBA 4NZJA 4X0KB 3AM8A 5A40E 1Y18B 4YIQB 2L7UA 1D9KB 4MJ4A 4G5ZL 4UT9L 1BLNB 2R0ZL 2DKUA 5DJ8B 3UAJD 2W65B 2VDRH 3GIVA 2H8PB 2OJEA 2YEZB 4GG6E 4XP4L 2W9EL 4FG6C 4N1HB 2VLMD 4K2UL 3QIWC 5IHBA 4MCZA 2WM0A 1UCBL 1AXSB 2R4SL 3VFSB 4FZEL 3FQRB 3M8OL 1NDMA 4R26L 5FA3A 2ERJC 1F4YH 1JTTA 4U1KA 3OQ3B 5E8PB 1A6TA 4AH2A 1EA9C 4WW2C 4KKAD 1RZFH 3MUHL 1HKLH 5I1AB 3GSOB 3BGFB 5MEPB 1Z9MA 1DBMH 1R5WB 3FFDA 3ARRA 5DRNB 1S7RA 3G5ZA 2KQNA 4G6AD 1T4KB 5CBAA 3CIQA 1N59A 1SJHB 3HI1A 1YNKH 4BYHA 4PRAB 1ZWIA 4KZDH 3G04A 4IHOB 4N0YL 5JQHC 3QPQC 2R15A 5DLMH 3WFZA 1ZOXA 1FFQA 1MHPL 5HDBE 1OSPL 4NT6B 4OUOA 2V17L 2ADIA 2ZOKA 3EGSA 4KRLB 3AY4A 2AABL 4X0KA 3D85D 1JYNA 2OJZH 5L8JB 1OAXL 1N2RA 4OD3L 4YXKL 4IOFD 1JCKA 3NPSB 1WTLA 1ULVA 2C3HA 4EI5A 5C70A 4N5EC 2ZUSA 4LQ1A 5CJQH 4G6JH 3ULVH 3CFKB 1H3UA 3LN4B 4LVNC 3VFUA 5IVZB 3W11D 1Q94A 5EA0L 1HEZA 1VCAA 3R8BB 7CGTA 1X5KA 1IGTA 5JHDD 1TJGL 1WBYA 4OCXL 4PB9H 5H2BA 1UM4H 3IJHB 4BFEA 4XVSH 1ETZA 3IXTA 4RDQF 1SEQL 4UOW1 3MRMB 1LEKB 3LKNB 1IT9L 2FIKA 1TCRA 4ORGA 2LV4A 1XGTB 3B3IB 2AVGA 2O5XH 1WCQA 5TF1H 1MHEB 1E27A 4GAFB 4JFDD 3VG0L 3BGMB 4AIZB 4KK6D 1FAKT 4DTGH 2PW1B 4MLIA 1RI8A 2D31A 2ZUUA 1U0QA 1GGIL 1G9ML 3GKZA 4NQCB 3HUJA 4PJ7E 1TJHL 3Q5TA 4XXDB 3KR3H 1YPZB 2CDGA 3V52H 2R1WA 5IESH 3QPXH 3QPQD 3FAXA 3LOWA 3HAEB 4RGOL 5I75C 3MZGB 4CVZA 4XHJC 3MJ7A 1KCSL 4OI9A 5LCVL 5FO9A 4Z95L 4RWYL 1JGEB 1KTDB 2GAZA 3W0WE 1QUNA 2AAVA 4X4XB 4J8RA 1ZT4A 3KYNB 2JKXA 1KXVC 4FFWC 4K3GA 5GJTL 4GAYA 3VFVA 3MR9B 3S6CA 1ZK9A 3E6FB 3MSPA 1MEXL 3M07A 4QHUB 5BCAA 2JJUA 3QXDA 3PHQA 4PJCA 2J8HA 4ZDHB 3MLRH 4NIKB 3TNNA 1CGYA 4KJPD 3HFML 4RSVA 4X7DC 2GQHA 4F2MA 2I9TA 5F7DA 3ZTNH 2NY0B 4KK6C 5JHDA 5DMGD 2WUCL 3BPLB 1SY6A 5GRWA 4WFFE 5J1AB 2HLFD 4UUJA 3CSYB 4L29B 2NCMA 2VDPL 4JN1H 2H26A 4I77H 5MEOB 3O3EB 4DGVL 4O51B 5JQ6L 1W72L 4OKVA 1HQRB 4YBLB 5E5UB 1RHHA 3C6SB 1PQZA 4FQPA 4NOBA 5TDPB 3DUSA 1CG9A 3V52L 3H9SA 2XA8L 3VG9B 1NAMA 3N06B 3E3QE 3F12B 4XRCB 4YHNB 3ZDXE 4PG2C 5I1GL 1BREA 1IGYB 1DBJH 5KSUB 1O7VA 4MNGA 2LTQC 3TBWA 5BRZA 3PXHA 2B7DT 2NY1D 5BQ7A 3L95A 1IM9D 4E41B 1OVZA 3ZE1F 4GRMB 3OKOA 3NTCH 4Y4KA 4MA8H 1MWAB 1C5BH 4LPTA 5K9OA 1CQKA 4M1GL 1KPRB 5HGDB 3V9FA 1DBAH 1F4AA 3D48R 5FO7A 4LLDA 3PDOA 5DJAA 5ADOL 4QHLB 4Y1AE 3MRPA 1NCCL 3MA9L 1CT8B 3TCXA 5FA4A 3QXDB 3F7PC 3L5HA 3IDXL 2CLRA 4N90D 5IB4A 1J5OH 1MQKL 5FIEA 4HJGB 1YA5A 1ZT7A 4YHPA 5E2WL 3SPVB 5FYKL 4U1HA 1HSBB 4LKXB 5DK0A 1OPGL 3WLBB 1CFVH 2VKXA 1JV5A 1A7QH 2Y5EA 3HE7D 4OBSA 4Z9KB 5C7XH 1Z0NA 4PJEA 5C0GA 3Q2CA 4L3EB 3LEVH 4O51A 4IMLA 3FO1A 5JW5A 3WUWB 4X7TB 4QXUL 1FNSL 3MRLB 1U3HD 4Z7WF 4ZG1A 4XT1C 2GHWB 3IVKA 4NC2B 4ZXBC 4NCC1 3WHE0 2CQVA 4P2OC 3CD4A 3RY6C 2D2OA 1OP5H 3KHQA 4XH2A 4OFKA 4MD0A 1DZBA 1KT2A 3DMMC 3L5WA 3QIWD 5T1DH