5E5UB

Crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn6
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
SAYIEDFETKTRSTVSVREGQGVVLLCGPPPHFGELSYAWTFNDSPLYVQEDKRRFVSQDTGNLYFAKVEPSDVGNYTCFVTNKEAHRSVQGPPTPLVLRTDGVMGEYEPKIEVRFPETIQAAKDSSIKLECFALGNPVPDISWKRLDGSPMPGKIKYSKSQAILEIPKFQQEDEGFYECIAGNLRGRNLAKGQLIFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase gamma
publication title Structural Basis for Interactions Between Contactin Family Members and Protein-tyrosine Phosphatase Receptor Type G in Neural Tissues.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion/hydrolase
total genus 49
structure length 199
sequence length 199
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5uB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5uB02
3CVHL 5I1EH 4LSSL 4K94C 5FKPB 1R3KB 3BUYA 3GIVB 4ODWB 4JJHA 4LCUB 5F3BB 4LVNB 2FNBA 4WCYL 3PWJA 2J8UE 2VB5A 4JDVB 1KG0B 4U1SA 3UYRH 3TCLA 3T2QA 1T1ZB 5HYSG 4G80A 4OCRH 2E9WA 1MCOH 5I1AB 4P57A 1EMTH 2VXVH 1AIFB 1YEEL 4HWNA 4DCQA 4N1EA 3PQYE 4KFZC 5D71H 5IB5A 1Z3GL 2D7TH 5FHAL 2HLAA 5KJRL 2RR3A 1I1FA 3IDXH 4Q7DA 5HYJE 3ULUE 1ZOXA 4WY7L 1FNEA 2DQCL 5DJ0B 3O9WB 3HNTL 4ZUWA 1OGTB 1C1EL 2R39A 1C12B 5KG9A 4HZAA 2A0LD 4E9LA 5MERA 2J6EL 4YQXL 2YA2A 4P46D 5I73B 1YYMH 2RFXB 1XF4A 4LCCB 3FAWA 4Q9QH 4MHHI 4PG9B 4K8RL 4S1SL 3WS3A 4AL8L 5DEFA 2P5EB 5C08E 4NRXB 4EUPG 2W0KA 4Z7WB 4JFXA 1BD2D 2GSIB 3BZFB 4X8XA 4TSAL 2D3VA 1ADQH 4GUPB 2YPLD 2FR4B 3WS6C 2X41A 1RQ5A 3PDDA 2AJVL 4HKXA 3UBXG 1V3JA 1FZJB 1CIDA 3TBYA 1KGCD 3WE6B 3BGMA 5T1LD 5EULV 1HXMB 3ROLA 4GMSL 4WEMB 4ZTPH 3AGVA 1EEUA 3QH3A 2H3NB 5T33L 5MEPB 2F8OA 5DFVC 5F1OB 5HGHA 4CADA 4DN3L 4G6KL 2A6KA 5HHOB 4MXWH 1Z2KA 4TSCH 1LEIA 1RMFL 3BP4A 2P24A 4PJ8B 5D7SH 2MSPA 4ELKA 1DL7L 5CBEA 4AG4L 4NP4H 5CD5D 2N7AA 5TH2B 1UACL 5IHZA 4EQ2A 5BV7L 1IJ9A 2X4PA 2Q1EA 3VRIB 3LQAH 4Y4HB 4L8SC 3B9VA 3WN5B 3QI9D 2DYPA 3VG0H 2XFXB 4RMVA 4OLXH 5SWZD 3P77A 3RL1B 5FYLE 2NY6B 3ZT5A 3N1QC 3V5DB 2HKHH 1CYGA 1F90L 4OM1L 3QUXA 4I18A 2DI7A 2WLZA 3C60A 4NQVB 3CUPA 4EOWL 3QPQD 4JY4A 4DN4H 3CLFL 3GIZH 1NMAH 4AM0A 1UWEL 2EDTA 2EIZA 4FNLH 3MLSL 4M5YH 4JANA 4OLVH 2MHAA 1NGPL 2XXMB 5DS8A 2YD9A 3U46B 1A7RL 1DQQA 2FLBT 1XGTB 3RPKA 4QY8A 4P99A 1FH5H 4N8CH 3QIBB 4OV6F 4PY8J 5IVNA 4LAQH 1MCCA 5KSAD 4XCCH 5CEZE 4M7JH 3TZVB 2RCSL 2UZIL 1OLZA 2DKUA 4C4KT 1LD9B 5DZNA 3QJFA 4X9HA 5FO9A 3F58H 1QRNB 3DRQB 2MPAL 3MV01 3DX6B 2MQ3A 5TPWL 1A7BA 3KPRE 1MFBL 4N0YH 1OT1A 3MXVH 4I3RL 5BXFB 4HUVA 2WSKA 3OBAA 3X3FL 5E5RB 5IW6B 1RJYB 1T04B 1UB6B 1QSFA 2IAND 3F7PC 1MY7A 4JFHE 4EI5A 2X1OA 4PP2B 2A9MH 2JJVA 4W6XB 2DLHA 4M62L 2E9JA 1G7JB 2YD8A 2Q86A 3B8YA 3JWDH 4ZXBD 5IB2A 1J1OH 2I9TA 3IETA 1SEBA 1S78D 5AAWA 1XIWA 3VWJB 3LKOA 2BC4B 4FQCL 3UO1L 2DQFA 4BZ2H 5L2KD 3QQ3A 2AK4B 2XZAL 5C2BH 1N64H 1FQ9C 4LLYA 1S5HB 5DR5L 3MGTB 3REVB 1GAFL 4EUPH 3C08L 3NIFF 1T5WB 2JCCB 4AEEA 2UY6A 1RZKL 3JUZA 5JQHC 4O58H 4L3EE 4G8GD 1ED3B 4PRNA 2PYEB 1GHFL 1ZHLB 5E9DB 2NQCA 4AZ8A 3DX7A 3C09B 1JYVA 4HH9A 5CGMA 1CVSC 2AJYH 3O81A 4P2YA 2Q8AL 4AEIL 1J8HA 2BERA 4X5WB 4LSRH 4TQEL 4QYOB 2NY4B 2Z93B 2VRAA 4ODTL 4PJBA 2R0WL 3PDOB 3FRUB 2WNGA 1IEBB 2H26A 5DEZA 3CH1A 4HFUL 1ACYH 3C6LD 1Q94A 2WAHA 1U2CA 4G6FD 2PW1B 5SX4H 4NQDB 3SJVD 3BKCL 4YNYB 3D48R 3GZKA 4YO0A 2BNQB 3EOBA 5GGVL 3SN6N 1QFWM 3QDGE 1H3TA 1NJ9B 4HUWA 4MNQE 2NY7L 1U8NA 2X4OA 4LVOB 5BS0A 3ARDA 4CVZA 4POUB 3BH9B 1G7QA 4KHTH 1MWAA 4BK4A 1NFDF 4BZ1H 3BPLB 2H1PH 1RU9L 2P45B 3P4MA 3GSRB 3QQ4B 4GOSA 2HH0H 5KZCD 4E0RA 2F53A 4JRXB 4ZD3H 5D7KE 3M1BA 2C3VA 3K8LA 4ZS6D 3MQIA 4UU9B 1DANT 4QRRD 1BFVH 3OKKA 2J8UF 1H3VA 1ORQB 3MRCB 3ARFA 5JHDA 1LO0H 1XT5A 5HYSB 4KTEL 5DC0A 1G6RH 4JFDD 2EXYC 3DYOA 1I3RB 2HT4D 4KU1A 2AGJL 5T5NG 2AQ2A 3B5HA 1VEMA 1F4XH 5I8KH 1PDKA 4M3JA 1WFOA 4HSQA 4RMQA 4XC3H 5E6IB 4POYA 2FZ3B 3KNBA 5HVHB 4CJ1A 3QDJE 4O2CB 1HCFX 4I3SH 4DGYH 2FATL 4ZSOE 1SJEB 3DURB 1T03H 2ZCLH 3SGEH 3N1PC 2GJ6A 2H2SC 4XVTH 2E7CA 4D3CH 1N2RB 3VGGA 3VWKB 2VDQH 4XCEB 2B5IC 1KN4H 2FD6L 3FQNB 1M4KA 2CRYA 4Z7QE 3ZT7A 1HIML 3GM8A 2P42B 3VH8B 5CINL 4R2GB 5D96B 1AC0A 4QRUB 4I48A 4EUPB 3CFCH 1UKTA 2YPKB 3U0PA 3FTGB 1MJ7H 5ELIA 1MJUH 3AREB 3OB0H 2APWA 1CE6A 1RZJC 2DLEA 2DWDA 3BKMH 2XNAA 4JPVL 3CDFA 1YN6A 5L6YH 1CR9H 2ZG3A 4NHUA 4HK3J 2ZUYA 1LK3L 1UB5A 1CG9A 5FV1L 2GFBB 3NACL 1FP5A 1CVRA 5K59E 3F7QA 4J3XA 1T22A 4P48A 3CK0L 3SGEI 1QSEA 3FO9B 4LCIL 4JFFA 5TGBB 1JMZA 2QEJA 2VOTA 3MLXH 1WTLA 4QHKJ 4WO4A 3PGFL 4G5ZL 4GRWH 2FGWH 1Q9WA 1K6QL 4PJ5B 4N0UB 5KTEL 3DRTB 1QBAA 3QPXL 2IPTH 1EHXA 1F4HA 1KEGH 2EE2A 4R6UA 2FCBA 3UXFA 2YSSB 1W0WB 5D5MB 1AGBA 4W70A 4GFTB 2Z92A 3Q5OA 4Y7MA 4EKXA 3U4AA 2W65B 4JKKA 5I74B 1Q9OA 4QRPD 5GGTL 5T3XE 4XMLH 3GSNH 3JVGA 4PRBA 1R0AH 4OI8A 3G5XA 1JBJA 5IOPA 4M43L 3HCVB 1J05A 4IRSC 2AS5M 4RNRB 5HHME 3N1MC 1X4ZA 3RJQB 3MCKA 4NO3A 1Q9KB 3ZO0A 1F6AA 3MX0A 5TQ2H 3LV3A 4OUUA 3CLEL 4HJJL 2Q6WB 3VXPA 4HUUA 4NQSB 5BCAA 2DJ4A 5HDQH 4ZFOA 3NTCH 5AUMB 1YJDC 1IGFH 5F88B 5JO5B 4CVUA 5ECJE 5GSRB 1LEKB 4ZOCA 1HZHH 2FJGB 5E5MB 1EHNA 4CMHC 3BGAA 4M48H 3I6KA 3LSOB 4M4PA 5JOFB 5K9OA 5KOVC 5ESQB 3EDJA 3RVWC 4WW1A 1AD0A 5HHOE 1B4JL 4ZPVB 1UCBH 4JRYD 3BP5B 3EOAA 3NH7H 5ADPL 3MGOA 4DJMA 2PF6A 3RWCA 1ZT7B 2P5WE 1AGEA 4TNWF 5KSBB 4NHCH 4IMLA 1RUQH 4NN6B 3DSNA 1V7ML 4HFWB 5DMJB 5D7LA 1HILA 1G7IA 1JUFA 3CFEA 4KI5C 5BO1H 1CFQB 3MMEA 4HJGA 2QHRL 3A6CL 3S37L 1KPRB 3D0LA 3M17B 1I1AB 5E2UL 3FFCD 1AGCB 4YXHH 3GJFA 2OK0L 4P2QD 5FA3A 1M7DB 1HQRA 5HXMA 1DQDL 1P4BH 4LKCA 1KUMA 5GJTH 3BOVA 1MEXL 4YHZL 5E4EC 3Q1SH 2VUOA 1UXSB 1JCKA 2NX5A 5JHLL 5A2IH 3GO1H 1W72B 4RRPG 4Y19A 2CLRA 4UDUB 5D8JH 2DQIH 1CK0H 2WQRA 2IFGA 4EDWL 4GXVL 1WSST 4OFIA 3TPUB 5DFTA 3OJ2C 1FO0H 4R26L 4Z0BL 3VXUA 1U9KA 4EN3C 3K4ZA 4PJFF 4WI2A 2N4IA 4IRJB 4F7PA 2OJZH 4X4ME 4Z7UF 4H26A 4NYLA 2XZCL 5D2LB 4DKEH 4IRZH 1CFVL 5C09A 3GSNB 5B3JF 4ELMF 1JGLH 1EO5A 1MLCA 1J12A 1S9WB 4D0CB 3Q6FA 2WBJB 1IGTA 3L3GB 2A83A 4Y5XC 3RKDC 4S0TD 2FJHA 1NCAH 3GKWH 2YZ8A 3LEVL 2ZWLT 3U4EA 2X10A 1QLEH 1S7RA 4YHNA 2AERT 4F37K 3LCYA 4GW4A 3QZWB 2VZTA 2BFVH 1SVZA 43C9B 3IRPX 3S36X 3G6DH 4BKLA 3D87B 3SOBH 4S1RL 3MJ6A 5D70L 3KYMA 3MXWH 5LAXA 3L3OA 1KNOA 1YEFL 3U7AA 5IMOA 2Y06L 1TZHB 4KK5D 4G43A 3MV8A 3BIBX 4JAMB 1J5OL 2VE6B 4L5FH 2ADGB 3EKCA 4QT5B 5C0BA 2A1WH 2JCCE 1L0QA 1SQ2N 3O3BB 4U1NA 4WUUB 5E8OA 5KSVB 2VZOA 5EZJA 4QTIH 4I0PC 2PYEE 3G5VB 4HGWA 2VXUH 1KTKE 2EZ0C 5E9DE 3SDCD 1OAQL 3CSYB 1T2QH 1OTTD 5ICZB 2X7LA 1DBKL 4P5TC 2IWGA 4CU6A 2ADIA 5GRUH 3VDBA 3CXDL 2DQUL 2HP4A 5EOTA 2EDBA 5KAQF 2VLKB 5GS0C 1AXSB 3VFPB 3V4PL 4F7EB 1QBLH 4RISL 1T66C 4OCSH 4PRID 3U7YH 3S35H 5C0NC 4KI5F 1Y18B 4G9FB 5FYKD 3GUTB 2BNQE 2FDBP 3V6ZB 2LAGB 3QUKB 5IFAL 1CLZH 1N8ZB 3OSKA 1OOAA 5BW7A 3MLUL 4LEXL 4OLZL 4XXCC 4FQXC 3OKDB 2HJFA 5HGDB 2BRQA 4F9PC 3FAXA 3MNVA 4EBQL 4HIHA 4JRXE 1FO0B 3SQOL 1BZ7B 1BIHA 1JHTB 5IR1A 5E2VL 2WWKO 1X5GA 4QWWD 5K59F 1V8HA 4S2SA 2R2EB 3O45B 1IL1A 3BVNB 5C8JB 4J8RB 1LE5A 3MACL 4KDWA 1OLLA 3VJ6A 4NGHH 3C5ZA 1YEHL 1OQOA 4FTVA 1L7TL 4KQ3L 4J3VA 4Y1AB 1T0NB 4NO0A 3ZE0E 3LRSA 3FMGH 2WP3O 2P8LB 2DICA 4J3OC 5EU6D 5F97E 3MRJA 4HS6B 4XRCA 4U1KA 5INDA 4DVRH 4KTDL 4R4FH 3HZKA 5C0AE 5F7EL 5ICYB 1UT9A 1AJ7L 4ZUUA 3WIHL 2AEPH 2XI9A 3F7RA 3BUYB 3L7FA 1E6OH 4XPAL 4RGOH 3TT1H 3PWJB 1OGAE 4IIQC 1DUYA 4KH2A 4MQSB 4BH7A 3TH2T 4M1DL 5T5FH 4U1SB 3TCLB 4OB5H 3WNLA 5D1QC 4G80B 2C9AA 4HBQA 1SEQL 2LFGA 4FA8A 4P57B 4XHJC 4Q9BA 4MA8L 4DCQB 4WFGD 1IGYA 5IB5B 1PYWA 3ARBA 3BD4A 2HTKC 1ZANH 1JPFA 2HLAB 2XTJB 1HEZA 4RGNE 1I1FB 2NTFA 4FZ8H 3BKYL 1PX3A 1FNEB 2OMNA 1A4JA 1MPAL 1CGWA 2UYLA 3K81A 4ZUWB 1ZLSL 1Y6NR 3O2VH 1I9IL 1Y0LA 4J3TA 5KG9B 4OLEA 5EN2A 2GY7B 5MERB 2ZUQB 1M6OA 4GG8A 5DUMH 1AH1A 2E8YA 1XF4B 4JFED 4PB0L 4N0UE 2H32A 2BY3A 3SDDD 3WS3B 5CJBA 5DEFB 2GAZA 2AABL 3GMNB 2QKIA 5D5ME 1JHKH 4HQQL 2HN7A 3QWRA 5C0GA 4HKBA 4CDGC 4OGZA 1OCWL 4HKXB 4HUXA 5IBLC 1DLHA 5IQ9A 4GKOA 3TBYB 3BGMB 4LVOC 1FIEA 1IM9D 3LKQA 4H88L 4L9DA 5F8RC 3ROLB 4U6VL 1J0JA 5A2FA 3RGVA 3TPKA 3QH3B 4Q6IC 4YBQC 3VFSA 3SE3C 5B8CA 1NAML 1O7SA 5HGHB 1IKFL 2XZQH 4CADB 4OCRL 2A6KB 4NM8L 1MCOL 2FB4L 4LLQA 4UT6H 1YNKL 5KN5A 1LEIB 2X4NA 2VLLA 2VXVL 4Q9CA 2EDNA 4B7IA 3BP4B 1PKQA 2P24B 2D7TL 1FNFA 3ZYIA 2Y36L 4ELKB 5CBEB 4XCFL 3GJFK 5SWSD 2WINA 5DLML 3FB8A 5IHZB 4KKLC 1OB1A 5DD3H 2X4PB 2VJXA 5J11C 2DYPB 1KJ2A 5F9OH 4YHMH 3P77B 1E4KA 1BBDL 2VZSA 5KSBE 4PGEA 5CP7A 4MA3A 3ZL4L 1YEDA 2M1KA 4DW2H 2FHCA 3QUXB 1BX2A 1BHGA 5FUZH 4I18B 4FXKA 5DURB 2YEZA 3C60B 4RWYL 4PLJC 5JPNA 4MAYA 3CUPB 4JY4B 2HG5A 1UFUA 2DL2A 3TA3D 4AM0B 5DFVD 4NKMA 2EIZB 3H8NA 5IVXA 15C8L 4JPKL 4JANB 1PKOA 1ZVSA 3UAJD 1PBYA 3RZCC 2MHAB 3IRZA 4M6AA 5D96C 4UIKL 4E41D 5DS8B 4NIKB 1DQQB 4KRPC 3ZKMC 5AZEL 4QY8B 1KEML 2XTLA 3T04D 2NPLX 1MVUA 3KPNA 3UTTD 3D9AL 4RGNC 5GPRA 4I9WD 2ZOKA 1QFWH 5DVKA 3QJFB 5FO9B 5HI3C 1QFHA 4PJXE 2H41A 4URTB 1AQKL 3BWUC 2MCG1 4MVBD 3NBNA 3HZYA 2ZJSH 3UMTA 4HUVB 4X4YA 5CSGA 4BQCA 1NUGA 2W91A 3AAZA 3GNML 1A6UL 1QSFB 4GSDH 3NGBB 3PWUA 5I9QC 4EI5B 2DDQH 3RAJH 5D2LE 8FABA 4I0CC 2QBWA 5IB2B 2Q86B 3LQAL 3GRWH 2I9TB 3RHWK 3IETB 1SEBB 1PVHA 3NA9L 1XIWB 3LKOB 1F5WA 2DQFB 4OLXL 4ZNEE 5I19H 3QQ3B 4WW2C 3T77A 2JIXA 2HKHL 4LLYB 2ERJB 1LO2H 1VDGA 5FGBA 4OQTA 1RIUL 3IJYA 1DJSA 2YUXA 3C2SA 3PQYD 3S5LG 3VXSA 5T1LA 1ORSA 3QQ9D 4XBPA 2W9EL 2W0LA 3QFJD 4LCWE 2OYPA 1QFWI 5HYJD 3ULUD 2OR9H 4PRNB 4UTBH 1AE6L 4OZFH 4I1NB 3DX7B 4HH9B 1HSAA 3EUUA 4K2UH 2YKLH 3AUVA 3LVEA 1ZVYA 2G5BB 1U93A 3E6FA 4PJBB 3T4YA 1SYSA 2H26B 5I8OL 3CH1B 4PP1C 4G8FA 2D0GA 3QIUD 2DQEH 5GISL 5ID0A 4R4NC 1JRHI 3FB6A 5C08D 2MMXA 3FQUA 4YO0B 4JR9H 2Y1VA 3EOBB 1Q38A 4N0YL 4HUWB 5DQDH 3STZA 1U8NB 2X4OB 4EDXA 3VXMA 4KUCF 4X0KA 3ARDB 1IVLA 3FZUD 4OLWL 4XB7A 4ZPTB 3ZE0F 1D9KC 4CVZB 3DTXB 2VLKE 4X6EA 1G7QB 1MWAB 3BDXA 1RUMH 3JWDL 1OAXH 1J1OL 3I02A 3P4MB 2UWEA 5AYUL 4LCYA 2F53B 3U7WH 4J3WA 4L8BA 5AAMA 3M1BB 3TT3H 3WFEH 2C3VB 4F7TA 3BJLA 3HE6C 1INEH 2EDQA 4NT6A 3STLA 1NUNB 3OKKB 3MLPA 3SE9L 5I18L 3GMLA 3QCVH 4P3CH 3ARFB 4TYUA 1I1AC 2HT2D 2J3SA 5JHDB 2E6PA 1WC7A 2VDKL 5JR1L 4X4ZA 4PRAA 2FWOA 4TPRH 1BOGA 2XQYG 1FLTX 3WIIH 1H8NA 3AROA 3KNBB 4QXWA 1RK1A 3W5NA 2VC2L 4P3DA 4PV9A 2GJ6B 5DK0A 1NGWA 3FOLA 4ODXB 1I8MA 4NBYB 4LDEB 4EJ1C 3RUGA 2BY1A 4DQOH 5I30H 4YFLF 5LCVH 1U2HA 3JV4A 5E8PA 2D03H 1N7MH 4Z9KB 3T0EE 1MFCL 2IPKB 3KG5A 4XVUD 3VMPA 4YHLL 4LLVA 2H45A 4PG2A 4Y1AE 1TVHA 3WNOA 4I48B 4J3SA 3GMOA 5HJ3A 1G9MH 4POZD 3KLAA 3U0PB 5JOPE 2LTQC 4WW2F 3CZFA 3B2VH 4RFEA 1TDQA 4KROD 2DWDB 1CE1H 1ZGLM 2XNAB 1OTSC 1PQZA 4OUOA 1YN6B 2H1PL 3D2UD 4OZFB 3GJFH 2HH0L 1P53A 4NHUB 1K3ZA 2K3TA 5GRWA 1UB5B 1YPZA 1CG9B 1UXWA 2J4WL 4TTDC 1BJ1H 5CEZD 2Y5EA 4OKVA 1T22B 1IGIH 2GUOA 2NXZC 3TO4C 1QSEB 3HNSH 4ALAH 1FDLH 4JFFB 5TDNA 4XP5H 4G6JH 2YWZA 1CT8A 1NBVH 2YUVA 3DX8A 1G6RL 3KPRD 2WWMD 4WO4B 4HEPG 1R24A 1GGTA 2XTJE 1Q9WB 1CDHA 2KUTA 3QXAB 4WEBL 4H0HB 4G6AD 3EZJB 4JFHD 3LQZA 1UQSA 1LDSA 5D72L 2YN5A 1AGBB 1NLDL 4QRQA 4AYFA 2Z92B 3DUSA 3ZTNH 2YWYA 3CZJA 2FIKA 1TZGH 3N50A 2EDRA 1Q9OB 3AU1A 4PRBB 4GT7A 3L3DA 3G5XB 1CXLA 3CSPA 5IOPB 1J05B 4W6YB 4WHYG 1GGBH 3MCKB 4HT1L 4U31A 5B21A 3RIFF 2VDPL 1MLBA 4JPIA 4ZO8A 4NO3B 1YECH 5KSBF 1FN4A 5IJKA 2ZUXA 5E8NA 1F6AB 5CIPA 5JW3L 1U8PA 1G6VK 5F7FA 3WSQH 4F8TA 4XVSL 4L3ED 3VXPB 4HUUB 1X5HA 4W68A 4ZFOB 1EDQA 2FHFA 2HVKA 2F15A 4APQD 4KI1A 4BQ6A 1YEJH 4OCXH 3HRPA 3T2NH 2WBWB 3UJJL 5IVOA 1N6QL 1XH3A 2G2RA 3I6KB 1IGJA 5K9OB 1OAKH 4JZOA 4WW1B 1AD0B 3O3DA 1HOCA 4C56B 3FT2B 3S34H 3L3HA 2O5ZH 4MLIA 1OW0C 5T1KA 5C07A 4Q97A 3QDGD 1S5IL 3MROA 32C2A 2HJLA 3MGOB 3RWCB 4IRSD 1AGEB 4PJXF 4MNQD 4M6NL 1L9NA 2JJUA 5C1MB 2O93L 4IMLB 4AY0A 5C9KA 4GRLD 4ZTOL 5I15H 4X6DE 5D7LB 1HILB 4U0QB 4MSWA 4NNPH 1IZJA 1JK8A 1G7IB 1JUFB 2DQJL 3CFEB 3MMEB 4HJGB 3O6FD 5D2LF 2D0FA 5HBBA 4XMLL 3D0LB 3T0EC 4MZ3A 3GJFB 4HUNB 1FRGL 3DMMA 3VXRA 3SGKA 5GIRA 5FA3B 1HQRB 4NOBA 4NZUH 1WUNT 4LKCB 3MLVL 5IK3A 4R0LC 2W38A 1R3JA 4JQXA 1U3HB 1WT5A 2NX5B 3WLWC 4Y19B 2CLRB 5GRYA 1I1CA 4L4VA 2NY1D 3UYOD 5FGSA 1E6JL 2I5YH 4P4KC 2AK1H 2G9HA 4IOSD 1IGFL 1IE5A 4PBVC 2DBJA 2FL5A 3QDJD 4MAUL 3L5JA 1F3DH 2PO6C 1CTNA 2YD1A 4HIJB 3RVXD 2D4FA 4X6CE 3EGSA 3JV5A 4F7PB 3ARTA 2DS4A 2X4TA 4H26B 5DJAA 4NYLB 6FABH 2BMKA 4ZOAA 2E3VA 1KCRH 5C09B 1MCBA 1F8TH 4Y5VC 3NN8B 1MLCB 5CLWA 4LSVL 3Q6FB 4TOYH 1MFEL 2EDXA 1UCBL 1IGTB 2A83B 2OSLA 5MEQA 3IDJA 4K94L 1F4WH 2FJHB 4Q6YA 3U4EB 4ENED 5T5NF 1S7RB 4YHNB 5I71C 3SDAC 4GW4B 3H9HA 1FGNL 1WFNA 4M7LL 1QSFE 4QHNA 2FO1A 4R7DA 1DSFH 4PS4H 4N9GA 4MB3A 4BKLB 2NY0C 5HYIA 1TTGA 5F9JA 1R5WA 3UZVB 2IH1A 3KYMB 2E6JA 5LAXB 3L3OB 2QLVB 1KNOB 1UCTA 6CGTA 4YXHL 5K9KA 2NMSA 4YUEH 1P4BL 4OZGF 3DHJA 3UTPE 4JGMA 3TJHD 5IMOB 2IAMA 4G43B 1C5CL 3MV8B 5EZLA 4YX2H 3Q1SL 3MRFA 5C0BB 5EOQH 4K3EH 4JM4L 3GSVA 3WIFA 5D8JL 2OXGA 5CZXD 4U1NB 4NO2A 1PY9A 5E8OB 4R90L 5EZJB 1TJGH 2OS7A 1FL5A 1MF2H 4HGWB 1VFOA 3O9WD 2SEBA 2X7LB 4JG1H 3VRLE 1FSKB 2EDKA 4MXVE 2ADIB 4XP9L 3KXFA 4QOKA 1J8HE 5EOTB 5T3XD 5JORA 3QQNA 5HI5C 3ROOA 4PJBE 2KDGA 3QEHA 1TTUA 4Z7OE 2YRLA 2Q3AA 4P9ML 3JUYA 3I85A 4JJ5A 1JGLL 4LFHG 5HSFA 1N0XH 1RHFA 4PUBH 4ODHL 1N26A 5JA9A 2P5ED 3IJSA 4JLRB 35C8L 3VXOA 5J6HA 2ZSVA 4D2NA 2NY2B 5IHLB 1CN4A 2XA8H 2WLYA 5BS0E 3OZ9L 1PLGH 1OAUL 2E7MA 3V4UL 3DO3A 3RZCD 1OF2A 1P4LA 3RX7A 4UB0H 5M94B 4WTZA 3MRQA 2FBJH 2HJFB 1I8KA 5JDSA 5ILTL 5CGTA 3MCLL 3T3PF 2AQ3A 1MIMH 3MNVB 3O8XA 3MXWL 4HIHB 5DVMA 5E03A 4TULH 5BVPH 1AO7A 2Z31A 1FNLA 5IR1B 4MYWB 5JW5A 3D85A 3MBEC 1PG7L 2VUYA 2AV7A 4MXQD 3D5OF 1Z9LA 1F02I 2HRPH 5HHOD 4S2SB 4L5FL 2I9LA 5JHDE 1KIPA 2Z4QA 2CKNA 3EYQC 4XTRD 1IL1B 1U6AL 1DBMH 4PJ8D 2P5WD 1LE5B 4U1MA 3TIDA 4JHWH 3JSSA 3VJ6B 2Q76A 4M4RA 2N1KA 4FTVB 2BVEA 1HK6A 4NSKA 1AGDA 1T80A 2ZKHH 1DUZA 4NO0B 5GRJH 5GRUL 2NZ9C 3LRSB 4FFVD 4R4BA 3FT4A 4Y4HD 3MRJB 2AJUL 4XRCB 4U1KB 2F74B 4FQ1H 5INDB 3HZKB 1QR4A 3NZ8A 2DBLL 3UBXI 5JLZA 4ZAKB 2NY6D 2B0SL 4ZUUB 1MY5A 3LPFA 2XG5A 1UH3A 2ESVE 4LHJB 3OAYK 4PJDF 4PB9H 4BH7B 1DUYB 1QBMH 4Z8FH 4H20H 1AQDA 4XVJH 1BJ8A 1LO3L 4ODUA 4KV5F 3U82B 1IGYB 1PYWB 2JELH 3ARBB 3MREA 3P0GB 3WNKA 5I76A 1JPFB 5FCSH 1UENA 1D5MA 1HEZB 2NTFB 1XZ0A 4U7MA 1D5ZA 5DC9B 3B9KB 5DHVA 3QIBD 2DKSA 2UYLB 3PWPA 3IDIA 2AP2A 3TZVD 2D4DA 2O5YL 4K71B 1H3GA 1Y0LB 4JKPH 4LLWA 1BIIA 5EZOH 5BVJA 3T0XA 2E27L 1AXTH 5JW4R 1M6OB 4JFFE 4GG8B 4AIZA 1KJMA 1M05A 1X5LA 4XP1H 1YEKH 3CVHA 4HXAL 1IRAY 4GAGL 3AM8C 2GAZB 2H9GA 2Q3ZA 4AK1A 2QKIB 4X6DF 1A0QL 4YGVA 3EYUH 2NXYC 4F15C 3THMH 1L9MA 5C0GB 4HKBB 5HHVL 2PYFA 1JPSH 4XNUH 3VWJD 5ALBL 4U2YA 1DANU 4M00A 5D7IA 3WO4C 2AK4D 4NZTH 3T2OA 1DLHB 3O2WH 4J6RH 5IQ9B 5F70A 3LKQB 4KHXH 1MCQA 1B0RA 4J4PD 3TT1L 3RGVB 2PKDA 4JGUA 4OQTH 1KB9K 5B8CB 1A7QH 3GJEA 4IS6A 3OKMA 4LLQB 2PYED 5DJYA 5KN5B 2X4NB 5E9DD 2VLLB 5L8KB 2J6EA 1PKQB 5JIPA 4KKAC 1ZANL 2R8SL 2MCPH 4RIRA 1I9RL 4BFGA 2QADB 2D0HA 4FZ8L 1VERA 4XAWL 2V7HA 4ZS7L 5DRZB 4B41A 2WINB 2NY4D 3G9VA 1KJ3H 5HPMA 3IDGA 3WUWG 1OB1B 4X6CF 1FVEA 2NYYD 4ZO9A 2R9HC 3WUZA 4X6FA 4BFIA 4KZDH 5FYLL 3MO1A 4NQDD 1MJ8L 4FFYL 1N3NA 1KJ2B 4PGBA 5IGXH 5CUSL 1KC5H 1J88A 1VFUA 2BNQD 5HHXH 2VQTA 5IBLD 3MTRA 3C5JA 3DECA 4IOIA 4PGEB 3GBNH 5CP7B 3SCMA 2VSCA 1YEDB 4GQ9L 4DK3A 3M45A 3MNWA 4JREC 1BX2B 4FXKB 1RZGA 5D7LE 2BSTA 3IDNA 2YEZB 4GS7C 4MJIB 5JPNB 4MAYB 2GIYA 5AG9A 2HG5B 2BRRL 3P4NA 4NKMB 5BMFL 3RNKB 4AIOA 3FJTA 5IVXB 4JRXD 1Z5LA 2EKJA 1ZVSB 2DQDL 1YMMA 4M1GL 2Y4SA 5CEZL 5TQ0L 3UPAA 5KVDL 4PGCA 2GI7A 2DLGA 4JY5H 4WFFE 3ECBA 5A2KH 4XNXH 4B7LA 4QHUA 2NX5E 1MVUB 3KPNB 5HDOA 1V7NL 4Y19E 4UTAL 1SJHA 4LDLB 2ZOKB 5DK3A 1TPXB 2YD2A 3K7UA 1MQKL 3BUTA 5E6ID 3QUMH 4HF5L 1SM3H 5CFHA 3QUYC 5L7XL 4KUCD 3HZYB 3VXUE 1FCGA 2YBRA 4X4YB 5EIVA 1R3HA 4Y4KA 3VRLF 4E42A 4MXVF 4X7CC 3AAZB 1P7KB 3VWKD 3PWUB 2Y6SC 3CMGA 1UM4H 4PLJD 3B4NA 5DEGA 2RIKA 2ZNXA 1QOKA 5C09E 8FABB 1YNTA 1CGXA 4Z7OF 1HKLH 5E6ZA 1RZJL 5F9WC 5K9JH 4WJ5A 1EGJL 5BJTA 5I1IH 2QSCH 3PL6A 4R2GD 2WIMA 3T77B 4UT9H 3BQUA 3ILQC 5EBGA 2JIXB 4PRHE 1IC5H 4AEHH 4ZQKA 1WEJH 2MNUA 3K2UL 3ARED 3VXSB 5CBAA 3X11A 1ORSB 4XBPB 1VKXA 4NWUH 2DTMH 3LQMA 2J5LB 3MUZ1 4TVPH 2VKWA 2IBZX 3BN9D 5B3NA 4WV1B 1NDGA 4NBXB 1HSAB 2X1PA 4AMKL 4PRDA 2E7BA 3ULVC 1KB5L 4QNPF 3HPJB 1U93B 1TJIH 3MV8E 3E6FB 1L0YA 1XFPA 3MA7A 1LNUA 4HDIA 1GIGH 1GOGA 1SYSB 1U3ZA 5C0BE 5EBMA 5LGHL 4G8FB 4Q9RL 2IG2L 3NMEA 5ID0B 2LVCA 4PJ5D 1BGXH 3QEQE 4Q2ZA 3FB6B 2B1AL 1ZE3C 1BAFH 3OAYH 3UC0H 4YXLL 2ITCA 4PJ9C 3STZB 1U36A 3P30H 5HGGS 4EDXB 3QHFH 4X0KB 3VXMB 4M8QA 4X6EB 3LEYH 2DDQL 1CBVL 3NCJH 1BJ1J 1E4WH 3S3SA 1YJDL 1JRHL 3GRWL 2EYRA 3I02B 1WV7T 2UWEB 4LQFL 4LCYB 2BNRA 5GZNC 2HKFH 4L8BB 3W82A 4F7TB 4NT6B 3TFKD 3V6OA 5E56A 3STLB 1KSRA 4HJ0D 1QFOA 3PHSA 3GMLB 3DGGA 1WC7B 3GI8H 2X9XA 3HRZA 2MKWA 1T5XA 1MCLA 4PRAB 2FWOB 1BOGB 3VFNA 2IBZY 4HWEL 4PGJA 1KT2B 4R4ND 4UTBL 4NQEA 1FFNA 2NY3C 3KHOA 3PV6A 4Z77A 1RK1B 4OD3H 2YKLL 2W1NA 3TO2A 3BT2L 3MV7B 4P3DB 4AQ1B 4PV9B 3EOTH 5DK0B 1NGWB 3FOLB 1DVFA 5IWLC 2KKQA 5ABDE 9CGTA 5GGVY 1C8PA 2FX7L 4XBEL 3RUGB 1T83C 3JV4B 5E8PB 3RDTC 5JXEA 3QA3A 2YD4A 3V7MA 3L6FA 4FTVE 1JZ5A 3HI5L 1PAMA 4F58L 4Z18A 4IOFD 4LLVB 1H8OA 1M7IA 1TVHB 4C57C 5SX5K 3GMOB 5HJ3B 4FQIH 3CZFB 1DLFH 4NPYA 4RFEB 1I1AD 4WTZG 2VN4A 1CDGA 1KIQA 3BESR 4JM2A 5IHUH 1PQZB 4P5KA 3GHEH 4ZFFA 1ZGLP 4L9LC 1HYSD 3K4DA 4XMKL 3U7WL 1YPZB 1UXWB 2W60A 2XG4A 3WYRA 4RMUA 5TE7L 4OKVB 2GUOB 4L8DA 3QCVL 1L6XA 3TH4T 3HI1B 5TDNB 1T7VA 1CT8B 3DX8B 3CU1A 3BAEL 3P4OA 1UEYA 3V52H 1R24B 4QCIA 1IT9H 1P4IL 4IRJD 4XWOD 3LQZB 3SQBA 3PABA 1UQSB 5I6XC 4HK3N 4N0CC 4ONGL 4QRQB 4V2BA 3DUSB 2FIKB 1CDUA 2BSRA 3HB3D 4DUXA 1NMCB 4L3AA 3AU1B 1GGCH 5KW9H 3L3DB 4WU5A 2WBJD 2JJTA 5C9JA 1U41A 3O2DL 1AD9A 4A2MA 4ZUVA 2PXYC 1N7ML 1MLBB 4JPIB 4OBSA 1FN4B 4PLKC 5E8NB 5CIPB 3PXHA 1U8PB 1TQCC 1PEWA 5E8DH 4LPUA 2LAAA 1T7YA 4KUZH 2X4UA 4PRPB 4BQ9A 4O51A 4U6HA 2HVKB 4YHPA 4PTTA 1HI6A 3LKSA 5JMRA 4B50A 2R0KL 3QUZA 2NLJA 4OCYH 1LVEA 1FL3A 5I1JH 2HMID 4KMTL 1XH3B 2G2RB 1MCPH 2J12B 1IGJB 5B4MC 1CTOA 1UYWL 4JZOB 4KJQC 4DKFL 2JB6A 4FABL 3S9DB 2C7UB 3B2UD 4FQLH 2R4RH 5H37G 1OP3H 3O4OB 5EU4A 4GAFB 3U48A 5GS0L 4WUUD 3HHRB 1MHCA 1HOCB 1I1RA 3O3DB 5HVWA 4XP5L 3L3HB 5GGTA 1C08A 5T1KB 5C07B 3EO9H 4X98A 1PKQE 3KR3H 5IIEA 3MROB 32C2B 1N59A 2C1PA 1VACA 2X5PA 3GK8H 4KVCH 1HDMB 5DO2D 3MPCA 3S37X 2VLKD 4FQJL 4MSWB 3UDWA 3MLWL 1CD9B 4U3HA 5ICXA 4MD5A 3ZTNL 3BPNB 1JK8B 3ETBF 4CVXA 4MNHA 5ACZA 1JHLL 3C5ZC 4K9EH 4UDTA 5ERWA 1R5VA 3U0WH 3T0VA 3O3EA 5BZDA 3WNNA 5FK9A 3DMMB 3VXRB 5GIRB 2DQHL 2X2YA 1L7IH 5IESH 1HNGA 4RZCA 3WDHA 3FB7A 4OD1H 2VDNH 5IK3B 3PHQA 1R3JB 2VABA 3RU8L 5HHPA 2YN3A 1BVLA 3WSQL 3NAAL 3KPSA 3UTSA 1HINH 4JO4H 4F80A 4L4VB 4JN1L 5EORH 5IVXE 3GKZA 5F8QC 5HVFB 4YFEA 2YXMA 2G9HB 2PR4L 1IGML 4JFPA 2ED8A 2FL5B 3GI9H 3KS0J 2NZIA 1DFBH 2DI8A 2VXSL 4UUJA 5CJOH 3EGSB 4MMZC 1Z9OA 4KKNA 1OAKL 2R0ZL 2X4TB 5DJAB 2BMKB 1VGEH 3ZDZE 2DWEA 5BRZA 3MJ9L 3RTQA 1MNUH 3SGDH 2HA1A 1L6ZA 3WFBL 4EXKA 3JV6A 4YK4C 4DGVL 1ZA6A 1HHGA 3D18A 2OSLB 5MEQB 2IPUK 2J7LA 3IDJB 4Y1AD 1D3CA 4OLUL 1A7OH 4TSBL 3H7BA 3H9HB 4IEFB 3UJIH 4Z95H 4LPCA 5ADOH 3ALXA 4QHNB 4R7DB 2YC1A 5GGUB 2OM5A 4N9GB 3P11H 3N0PB 5F9JB 1R5WB 1SBSH 2IH1B 1WTGT 1XMWA 3SBWA 4ZFGH 3PF2A 2YS4A 4UBDD 1TNMA 3LD8C 5K9KB 3T09A 3TN0A 4F3FA 1MCEA 4P2OA 2V9QA 1OTUC 4UOW0 5A2LH 1OAZH 3HS0A 4NO5A 5D93C 1ZTXH 2IAMB 4G3YL 4NKIH 1FE8H 2AJSH 4M6OL 3BO8A 3RA7L 1ZHNA 1FFQA 4NCC2 3TNMA 3MRFB 3ZE1E 1U58A 3T0DA 3GSVB 3WIFB 5C0CA 2XTJD 4NO2B 4OFKA 1I9JH 2FIRT 2FX8L 4U49A 1FL5B 3HC3H 2HWZH 5JXAL 1BJMA 5DHVH 2SEBB 2G60H 5SX5H 3IJHA 3KXFB 4QOKB 4F9LA 5ID1B 1LO4L 1S7WB 5CP3A 5JORB 2CR3A 3ROOB 3QEHB 1TITA 1CICC 1NBYA 4NQCA 2DMKA 1F8TL 1NCWH 4JJ5B 3MODH 4NN7B 3GSWA 1IBGH 3VA2C 1HKFA 1HH9B 3IJSB 3CVHH 3QAZC 4LSSH 5J6HB 3VXOB 2ZSVB 3OHXB 3IFOA 1OHQA 3ESUF 3O41A 3MUGA 4XPFL 1I1YA 3SKNA 4WCYH 5JZ7C 2ATKA 4RGMB 1YDPA 2Q8BL 1OF2B 3VCLA 1P4LB 2W0FA 4F7CA 3MRQB 1I8KB 5JDSB 1YEEH 3B43A 3O8XB 1BREA 2UWEE 1B88A 3OXSA 1A5FL 5FHAH 4HH8A 5KJRH 3L95A 1AO7B 2Z31B 3BZEA 1YA5A 5JW5B 3D85B 4N8VG 4WY7H 2WK2A 2DQCH 5ESAA 2AV7B 5FF6A 4M6ML 3HNTH 3MYJB 4UMGA 5HI5D 1C1EH 2I9LB 1KIPB 2Z4QB 4HGKC 1MI5A 4LKXA 4U1MB 4HK0A 2J6EH 3TIDB 4YQXH 3I6LE 1N4XL 2Q76B 1KLFA 2X4RA 4M5ZL 5KVGL 1K8DA 1MF2L 4NSKB 2VDML 1AGDB 4JO1L 1EX0A 5GS3A 3KPLA 1DUZB 4JG1L 3KHQA 3OR7B 4K8RH 4S1SH 5EBLA 4R4BB 3FT4B 3NFNA 5F1NA 2DYPD 1KBGH 1ETZA 2A0LC 4TSAH 3NZ8B 4HLJA 5JLZB 2R2BA 4MA1B 4HCRL 1GOHA 3RUGE 5DGRA 2GT9A 4P46C 3T08A 2AJVH 3PXJA 3JBG7 3BMWA 1JF6A 1A1OA 5JUEL 3QUXD 4HLZG 3IDYB 1ZXQA 5DURD 3ULVH 3C60D 4ODWA 1AQDB 5E5UB 3KPMA 4ODUB 5KVFL 4GMSH 5T33H 2D7QA 2AEQL 4NCDA 1JJUA 3T65A 5I1KH 4LSQL 1B9ZA 4DN3H 3MREB 4G6KH 4TVPE 5I76B 2FBJL 3HE7A 2UUDH 1D5MB 3PP3K 1RMFH 1XZ0B 1MIML 1D5ZB 1PSKL 4IJ3B 3VFOA 5FGBC 5DHVB 4PJGF 1YPZE 2MTPA 1DL7H 3PWPB 5DRXB 4AG4H 4XB8A 3IDIB 1UACH 2VQUA 4LAJH 1BIIB 2HRPL 5BVJB 1T1XA 4AIZB 1KJMB 1RUPH 1M05B 1DBML 2F5AL 1W2KT 1MVFA 4YDVA 3CVHB 4H8WC 4JEGB 3WIHA 3KYNB 2CIIB 4JQIH 4LCCA 1QSFD 2H9GB 4NZDA 4EI5D 1QG3A 5CD5C 3BDBA 3SJVE 1F90H 5GRJL 4F2MA 4OM1H 3BRGC 4YGVB 2BK8A 2WM0A 3OR6B 1JV5A 3BKJL 3OTTA 2RGSA 4FQ1L 2PYFB 4EOWH 1XIWD 3CLFH 5EOCJ 4OGYL 1RJLA 1UWEH 4ZODA 5D7IB 3I50L 4XZUA 2BVPB 2V9TA 3QI9C 3UTPD 1BWWA 3MLSH 2WW8A 3AB0B 2EIEA 2IC2A 1NGPH 1B0RB 2OXHA 1A7RH 2RQ8A 1N6VA 4PB9L 4H20L 2IGFL 3GJEB 2DIBA 1I7RB 3OKMB 2LV4A 1O7VA 3QPQC 5DJYB 4QRRE 1DN2A 2YRZA 2RCSH 1L0XA 1C16A 2UZIH 4NUGL 5IVXF 4RIRB 3VGAB 2APFA 2MPAH 4Z0XA 2V7HB 5TPWH 1J8HD 1UWXK 4ODVL 5DUPH 1MFBH 3H3BC 5HPMB 3IDGB 3F12A 4I3RH 4MX7A 1FVEB 3X3FH 1WFTA 4BA8A 5JQ6H 5EZOL 3MO1B 4KJYA 1N3NB 4M62H 3JXAA 4PGBB 1EIBA 5C07E 5K93A 3ZKQD 4XP1L 3HMWH 3HUJB 3MA9H 3IF1A 4IOIB 3C5JB 2F19L 1EH9A 4FQCH 3SCMB 3ALPA 5FUCE 5BS0D 3ARDD 3HG1A 2XZAH 2FX9L 3MNWB 2EEAA 3V6BR 1BWMA 2XY2A 1MCFA 1RZGB 2BSTB 3IDNB 5DR5H 4IHOA 4MDJA 3QEUA 2ZSWA 3DYMA 2OR7A 3EYUL 2BSED 1GAFH 1NAMA 3P4NB 4M03A 4RFNB 4Y5YA 3C08H 2F53D 1JNNL 1RZKH 4OF3A 2F58H 1S78C 3VXRE 1GHFH 3O2WL 1YMMB 1U8QA 4J6RL 5EPMA 3DI3B 5LWYH 3ZT6A 4PGCB 2R4SL 4LPTA 2OJEB 3ARFD 1NMBL 4CNIA 3ECBB 5JHDD 2Q8AH 3ZE2E 3ET9F 4XI5D 4QHUB 2GY5A 4AEIH 2QQKH 5BV7B 4TQEH 3HZMA 4ODTH 4PJIA 1SJHB 2R0WH 4L4VE 5IHBA 4HFUH 3TVMB 3RKPA 3IXTA 4W4OC 4Y16A 1QRNA 3BKCH 2WIIA 2YBRB 2GJ6D 1R3HB 4M8VA 5GGVH 1JPGA 1WJ3A 4E42B 2NY7H 5DEGB 4P9HC 3O4LA 1YNTB 3GMQA 4CKVX 2EDFA 5D2NA 4K3HA 3C6LC 4WJ5B 3MOAL 5BJTB 1A6ZB 1RU9H 4PGDA 5HHXL 1EV2E 3PL6B 4FXGA 5CCKL 3DYPA 3V6FA 3BQUB 3GBNL 2NY5C 5MEOA 4JKMA 3NCYP 2B4CC 4ZQKB 3RGHA 2VERN 1KCUH 1MHHA 4FHBD 4OFDA 4JO3L 4K7PL 4RQQA 5CBAB 5JMOC 2HYMA 4J12A 3X11B 5FCUH 2ADJB 1JF1B 1VKXB 5I75C 2ICWJ 4M7KL 1X5JA 4KTEH 5AEAA 5IJKC 1NDGB 1YZZA 2AGJH 3EOYG 4RMRA 1JZ3A 4YDIL 1ITBB 3NOIA 4PRDB 4Y4FB 1QSED 4ZS6C 3BHBA 1LP9A 5EOCL 1QEWA 3JTSA 4JN2A 4JFFD 2FATH 3MA7B 2ZCHL 1HHJA 1LNUB 4HDIB 2QQLL 4QEGA 5EBMB 5TFSL 4WO4D 3GBLA 5E6YA 5I1DA 3NFSL 3CDGA 2HVJA 2C4FT 3NCMA 1OAYL 2FD6H 1T20A 3DI2B 4Q2ZB 4HG4J 1G0DA 2HT4C 3QUML 2DJSA 1IC7L 5FYJL 2ITCB 2VIRA 5F6HJ 3BPOB 2I24N 5AD0A 1HIMH 4DFHA 4WHDA 3KXFE 4QOKE 1NQBA 3I9GL 5CINH 1VB9A 4M8QB 3VW3L 1UM4L 1BQHA 4WFHD 1CI5A 1U8OA 2YK1L 1WIPA 3BH9A 4U1LA 1WWCA 4XCYA 2EYRB 3IXAA 5FUCC 5K9JL 1PZ5A 4ETYA 4GXUN 4H1LA 3ZDYE 2BNRB 1RFDL 5I1IL 5HPOA 1IKNC 5BQ7A 4O2FB 4PGZA 2DB8A 4YAQA 1NCDL 4CRPA 1JNHA 3NACH 3Q5TA 4UV4L 3DGGB 2OI9B 1JL8A 5JTWA 2BVOA 3HRZB 1T5XB 4YR6A 4LCIH 4N5UA 3VFNB 3SE4A 1HHKA 2JJSA 3LOWA 4NQEB 1FFNB 3PGFH 4G5ZH 4BQ8A 5LGJA 4JQXC 3PV6B 4Z77B 5HYFA 5GS1C 1AO7E 1H5BC 3QPXH 1IAIL 4PY8I 1FFOA 5D1ZA 3RWIA 1DVFB 2VITA 1UJ3A 1XCTA 3QIWA 5GGTH 1OL0A 1N2RA 3A67L 1E27A 1BGXL 1JVKA 1MUJA 3QA3B 1NC2A 4M43H 2Z8VC 3L6FB 2B7DT 1Z6JT 5C6TL 5D7LD 4DKAA 5BZWA 4BSWA 1K9TA 1M7IB 2ORBL 1N0LA 4GG6E 3U9PL 4QRUA 4NPYB 3LEYL 1KIQB 3CLEH 4HJJH 3FCTA 3WJJC 4JM2B 5FXCH 4YDJA 5T1DL 4P5KB 2IH3A 4ZFFB 3MRHA 3O3UN 4EI6A 5DSCA 4HIIA 3TBVA 4WFFD 4LRNL 3FQTA 2W60B 1P9MA 1TIUA 1JP5A 3QXDA 2NX5D 4Y19D 5DJXB 3B5TA 3EJZD 5A2JH 1FYTA 5FOJA 3IU3A 3GI8L 3WO3B 3VXTB 1KF9B 3P4OB 4MS8D 3ARGA 4BYHA 4QCIB 4Z78A 5ADPH 2W9DH 3QEGL 5JOEA 3PABB 3PWPE 4OD3L 4HZLA 1V3KA 5C09D 1F4YL 1OSPL 1V7MH 2IFFL 2X09A 4U3CA 2BSRB 5F6IC 5F1IA 4WU5B 2CRMA 2YR3A 3ISWA 2CSPA 5C9JB 2QHRH 3A6CH 2W65A 3S37H 3VFWA 1AD9B 1CD0A 3FN3A 4ZUVB 1NDMA 3BIKA 5E2UH 2OK0H 3SDXA 5F93C 3V7AG 1HCVA 1DQDH 1A64A 5C71A 4OCLC 1MFAL 3B83A 4YHZH 2KZWA 4FQIL 5I1CH 1DLFL 5JHLH 4C54A 4O51B 1CD1A 5DJ8A 4U6HB 3ZTJG 5D7IE 4PTTB 1HI6B 1G6RA 3LKSB 1S9YA 3WJLA 2NCMA 3WCYA 1BFSA 4FQ2H 3S4SB 5CKAA 4OCMC 4GXVH 3QUZB 2NLJB 3MV8D 2BVQA 2QSVA 4R26H 4Z0BH 1TTFA 5C0BD 4Y2DA 5L0QC 3ARVA 1GPOL 4N0CD 3LSOA 5C70A 5D1XA 3DV6A 2ZPKL 5EU4B 3ZE2F 1F6FB 1MHCB 2XZCH 1ZWIA 3TBSA 1CFVH 4LK4A 4XNMB 2VNCA 1C08B 4H5SA 4X98B 1WGOA 4U0RC 3AS0A 5IIEB 1A9EA 3HTLX 1KOAA 5D6DA 1N59B 2C1PB 1VACB 1A7PL 3LEVH 2EH7L 4KJWD 4LL9A 2AVGA 5CP3H 5ICXB 3NFPA 4MD5B 4HFWA 2IF7A 4CVXB 4MNHB 1QR1A 2VLMD 5ACZB 1CF8L 4UDTB 5ERWB 1R5VB 3O3EB 1MCJA 5BZDB 5D70H 5EU6E 5FK9B 2NY2D 3Q6GL 4RZCB 4LSPL 1YEFH 4KKCD 3FB7B 4KKBD 1NCUA 3PHQB 3HC0A 2VABB 5HHPB 3NCFB 2AJXL 1BVLB 4KMLB 5SWQA 4LLUA 3W9DA 1J5OH 2B20A 3KPSB 3UTSB 1UXSA 1YEGL 1LE9A 2P4AB 4IMKA 3FO1A 4NDMA 1UZ8A 4H8WH 4JFPB 1B2WL 1I7UA 1OAQH 4UUJB 3BN3B 1DBKH 3CXDH 2DQUH 4KK5C 1CLYL 4UAOC 5E08L 4FQLL 4LVHB 2DWEB 3I3EA 4EQ3A 5BRZB 4QHKI 3RTQB 3WKML 3JV6B 5EIIA 3C5ZD 4FTVD 2ZCKL 3GSNA 1ZA6B 1HHGB 2NR6D 3D18B 1ZSDA 4R97B 4RISH 3KR3L 1S7SB 1QQDA 3PWNA 4NO0D 4OT1L 1GH7A 4GKZB 3BZ4A 3SDCC 5LKNA 2WBJA 1FLRL 4OSUL 4LHQB 3B6SA 2IJ0C 3QO0A 4KVCL 1OTTC 1SJXA 3H7BB 3TV3L 5TF0A 2I60L 3RBGA 2EO9A 2YC1B 5IFAH 4ZAKD 3QISA 4RMWA 3RWFA 3MLUH 4OLZH 2Y72A 3BD3A 1DEDA 2R15A 1IFHL 1S3KL 1TQBC 3ZDYF 3TN0B 4F3FB 4EBQH 4YHKL 4P2OB 3CX5J 3SQOH 3HS0B 4NO5B 1A4KA 4YC2C 5E2VH 4MQTB 4LOUC 3BO8B 1ZHNB 3TNMB 4F33A 3RVUD 1U58B 3ARBD 4MJ2A 4PJHB 4YEEA 3BP6A 4JO4L 2A77L 3K0WA 3MFFA 5I1HL 3B9KD 3HMXH 3ZTJH 4HAGA 1YEHH 4MD0A 2DIAA 1J11A 2VDRL 1L7TH 3D3VA 4KQ3H 7CGTA 1N5AA 4MDIA 5C0FA 5CSBA 4QWWC 4M7ZB 1NBYB 4NQCB 4U1HA 2XWTA 4KTDH 4I8DA 3VFPA 1BP3B 3GSWB 1EZVY 3ARSA 3MUY1 5GGSA 1AJ7H 5FKAA 4CW1A 3RJDA 4JZJB 4HKJA 3O41B 3MUGB 2YMXL 3GBML 4G9FA 1I1YB 1UWGL 3SKNB 4XPAH 5E8EA 3QWRD 1JTOA 1E28A 1NCCL 1NC4A 1A14L 2ATKB 4KK6D 4M1DH 3QWQB 1YDPB 5EC1A 4U7SA 5CHNA 4B0MM 2J2ZA 1Q0YL 4GG6F 3LPWA 3VCLB 2W0FB 4F7CB 1SEQH 1IC4L 3CVIL 5FGCE 1PW3A 4HEME 4MA8H 1PG7X 4ZFGL 4J3UA 3OXSB 3VG9B 3RGVD 3DUHA 3L95B 3BZEB 3V6OE 1S7UA 3QHTC 4S11A 5J89A 5ESAB 4RFNC 1MPAH 1ZTXL 5FF6B 4JG0L 2R0LL 1ZLSH 4E41E 1VHPA 3SO3B 4O4YL 1FNSL 1I9IH 1WCQA 1YYLL 1A22B 1ZHBA 1MI5B 4JGJA 3VDAA 5KANI 3T0WA 2QADD 4HK0B 3WS6A 4XNZB 2X4RB 1R5IA 4NQEE 5C0RH 1K8DB 5IMKA 5HD8D 3WNPA 3KPLB 1VGKA 5F7WC 4YDKL 1JE6A 4ESKA 5EBLB 2AABH 4OV5A 3DLQR 1BQHG 5B22A 3NFNB 4QXUL 3UTOA 4TNVK 5F1NB 5DD6A 1T0MA 4HQQH 1ETZB 4FOMA 2R2BB 5CSZA 4ERSL 1NCWL 1NEZA 2GT9B 1OCWH 1WAAF 3MRGA 1PGRB 1QLFA 1DR9A 4Y4KC 3AS2A 4XPTL 1A1OB 2BY2A 3NIGE 4MNGA 4X7FC 4LF3A 4MAYD 3ZYJA 3DROA 4H88H 3SDDC 2XQBL 3VGBA 3KPMB 4U6VH 1U8LA 5IVZA 1NAMH 4JFOA 4WI6A 3T65B 5IT2H 1DQML 1IKFH 2VZ3A 3MRPA 5D7JA 5IW3A 1RZFL 4NM8H 2FB4H 4LGSB 1YNKH 1ZS8A 3HE7B 2VH5L 3R4DA 4L8SA 3ES6A 4KVNL 4YIQA 3VFOB 3WXVH 2IQ9H 2DLTA 2Y36H 4I77L 3QFJE 3MZTA 1F42A 4XCFH 3TNNA 2GJZA 5DLMH 1EEYA 2HT3C 5DK2A 2IANB 2CPCA 1BVKB 2DM4A 1T1XB 1TCRA 3STBA 3ARXA 3E2HB 4FQHA 4YDVB 4G42A 5L8JB 2CGRL 1QYGL 1BBDH 4UV7L 3VH8G 3ZL4H 5L2JA 2B2XL 4ZUTA 4F2MB 5HYQA 3LB6D 1JV5B 3GMNA 4RWYH 1BOYA 1UH2A 2GYSA 1AHWC 1ROWA 2FHBA 1KBGL 1RJLB 4HWBH 3VXNA 1JNLL 4LFHD 1REIA 3OKEA 4WEUD 2R29L 5ANMA 1S8DA 4XZUB 1KELL 5KS9F 15C8H 2JIXD 4DKDC 4JPKH 5EUOF 2VR9A 5CEXA 1HWHB 2WUCL 4UIKH 1IQWL 3ULVL 1P69B 3I84A 4O9HL 3VXSD 5JNYA 1KCSH 2C5DC 5AZEH 3LDBC 3ARQA 4JFYA 4YWGL 1V5JA 1KEMH 1BVZA 5J12B 3CSGA 1P7QA 5I1KL 3TA3C 1J1XH 1PX4A 1C16B 3D9AH 1AY1H 3MRDA 3JZ7A 4P3WA 1SMAA 4U6TA 4Z0XB 3UAJC 2VLRA 3OB0K 1AQKH 2OI9C 2JKXA 3UROR 1P5VA 3F12B 4MX7B 5DDHA 3KDMA 5FB8A 1Q72L 3AMLA 3GNMH 1A6UH 2YD6A 4HW6A 3KWWA 4YBHA 4KJYB 1RUPL 2BHUA 3NA9H 3IF1B 4X7EC 1OPGL 2PUQT 4MA7L 3DXAA 1O0VA 3VXMD 4JQIL 4MVBC 3HG1B 4PJCB 3GB7A 3O6KL 3BSZL 1F58L 4IHOB 4MDJB 1FJ1A 3FKUS 3QEUB 3ZKND 2ED9A 2ZSWB 4YDLB 4Z6AT 3R8QA 1RIUH 1NAMB 4M93B 5FOBA 2R56L 4Y5YB 1UH4A 1C7TA 1NGZA 2W9EH 1MRFH 3MV9A 5L88L 4H1LH 2MWCA 4LMQI 5F7HA 5EPMB 1U8QB 1AE6H 4LBEA 1I3GL 4CNIB 2ZUSA 5J3HD 1YY8A 3HZMB 1MCNA 3K2MC 5C7XL 1CD8A 3PWLA 3KPSE 4JKWA 3UTSE 3PNWA 3CDCA 3I6LD 4PJIB 3C8DA 3QQ9C 5I8OH 4KXZH 1A3LL 3IXTB 5GISH 2BNUA 3ULUC 4Y16B 3WFHA 5F3HA 1A6TA 3HR5A 2WIIB 5DUPL 4LARL 3BYTA 1JPGB 3WLBA 4GW5A 2E7LC 3TWCL 3F7VA 1MH5A 3DSFL 3GHBH 3O4LB 4KQ4H 4OLWH 3GMQB 4AIXA 1BQLL 1EFXA 5BRZE 1B3JA 1HE7A 5JQ6L 5D2NB 4NC0B 4DK6A 4NOFA 3QIUC 4NBZB 2ITDA 4R96A 1KFAL 4XPGL 4PGDB 1JWUA 3HMWL 4FXGB 4P23A 3MA9L 5AYUH 1CFSA 3V6FB 4GAJL 5MEOB 5KSUA 2QQNL 1MHHB 5EO9A 3QFDA 5C0JB 3U1SL 2CO6B 4RCAA 4RQQB 2RHEA 2EECA 3SE9H 5I18H 4TVPD 3FZUC 1J0KA 1EUTA 2EXWD 3N85H 5E2WH 2VDKH 5TDPB 5JR1H 3JTTA 4KXZI 2F58L 1I4FA 3LH2L 3VFRB 4XNYL 3IDMA 1FAIH 4AH2A 2XWBA 5LWYL 3BHBB 4OTXH 1LP9B 1QEWB 3JTSB 4NN5C 3UYPA 4UNUA 3VMNA 4JN2B 5MI0C 2VC2H 4K3GA 1HHJB 1RUKL 5HHQB 2G5BA 2QQKL 5C0CE 5I1DB 2HT2C 3CDGB 2HVJB 5BOPA 1T20B 1OP9A 4MB5A 4N8PA 5LBSL 3G6JF 2VIRB 1RJZA 5I1LA 4WUKH 5AD0B 5ITBL 1MFCH 4YHLH 3SKJL 1QP1A 1CFNA 3QZWG 4LPXA 3LIZL 5CGYD 4JPWH 1BQHB 1XEDA 2DRUA 3EYVA 3MJ8B 3EJYD 4I13B 4NQCE 4ZPTA 1U8OB 3DTXA 4U1LB 3S36L 4XCYB 3IXAB 1MAML 1PZ5B 2DM7A 4H1LB 4PJFA 1ZK9A 5J06A 2A6DA 5BQ7B 4Z7UA 2BVYA 2ATPA 4YAQB 3BEWA 2VQ1A 1JNHB 1MHPL 4XVUC 3PP4L 1CDJA 3MOBH 2J4WH 4ELMA 1KCUL 4PRPD 3T2PA 2BVOB 4POZC 1CXIA 5FCUL 2XN9A 4YR6B 4O2EA 1QTYT 4HUKB 4KROC 1HHKB 4JM2F 4OZ4A 3MRIA 2F54A 5LGJB 1LILA 3GDBA 4G9DA 3IAGC 1FFOB 4PREA 4WEBH 5D1ZB 3RWIB 3ULUF 3VMOA 5D72H 1NLDH 1T89C 2VITB 1UJ3B 1XCTB 5T1KD 3QIWB 5C07D 1F2XK 4ODXA 5GS2D 5GRVK 4U1GB 1MCKA 5TE6L 1E27B 2X1XR 2WWMC 1MUJB 3GRWA 4OIBA 1NC2B 4OIAA 2M8XA 2C3XA 1B6UA 5BZWB 4BSWB 1X4XA 4HT1H 3SDYL 2VDPH 2PETA 4G6AC 4L3CB 2IPKA 3Q2CA 5JW3H 5JIIA 4P4RA 1QLRA 4W6WB 3KJ4B 3HR6A 3VGEA 4XVSH 4QF1A 3FCTB 5M95B 1D5IL 4OFVA 4P5MA 3DMMD 3TM6A 3VXRD 4YDJB 2IH3B 3RQ3A 3MRHB 4EI6B 2H2PD 5DSCB 4HIIB 3TBVB 1NSNL 2MJWA 1GZPA 3FQTB 3NPSB 1KCKA 4OZFA 3QXDB 3UJJH 4GLRH 1N6QH 3V7AE 3DHMA 1EO8L 4HPOH 3TJEL 4L4VD 3U30B 4JQVC 1EVTC 1FYTB 2F5BL 3IU3B 5H35A 3OXRA 5FA4A 1IEAA 3H9SA 3LN4A 3RWJA 3ARGB 5A3ID 5TDOA 4OM0L 5GGRY 4APQC 3V0WL 3BJ91 4Z78B 5AWNL 1S5IH 1YC7A 4OFYD 4DEPB 4M6NH 1R3IL 3QXAA 4K3DH 4HZLB 4ZTOH 2N56A 4D0DA 4WI7A 2XWJA 1XGYL 5F1IB 3V79C 2VISA 2Z0BA 2DQJH 1NEZG 4BFBD 5IW1A 3VFWB 3LHPL 4NCC1 1NDMB 3BIKB 3MRRA 4F9LC 3RY5A 1FRGH 3SDXB 3VE0A 3WEXA 4WDIA 3SPVA 4LU5L 4EN3A 4GRLC 3MLVH 4GLRI 4LHUA 4TTGA 4XP4H 5T3ZE 4OIIL 1JN6A 2P5EE 3IGAA 3RIAF 3HI6L 4Z7WE 4R9HA 3VFGH 5J13B 1CD1B 3BGFC 3O6FC 5DJ8B 3NIDE 2ENSA 1G6RB 4FQQA 1CS6A 1S9YB 1E6JH 2ICEA 3RWDA 4Y5XA 1ZT4A 2IAMD 2ZUWA 1X5AA 4MAUH 5F7YC 2BVQB 3LRHA 1AC6A 2V17L 2G75A 4XC1L 4Y2DB 5FDYA 2Z9TA 3P3YA 3OKLA 5ISZA 5D1XB 3DV6B 4JFZL 1ZWIB 5HDBE 3TBSB 4H5SB 5ACLA 4C56A 2OP4H 2NY1C 3O2DA 1A9EB 3FT2A 4LSVH 1MFEH 3KXFD 4QOKD 5DRWA 2EE9A 1G9NL 4K94H 5EG6C 3TBWA 1CXHA 2W9DL 2BJML 3RVXC 2X1WL 3NFPB 1FGNH 4M7LH 1QR1B 4YBLB 1IILE 1GGUA 3K1KC 1DCLA 2VXQL 3N1FC 4NZJA 4RAUA 4B5EA 4I0PA 1ZLVH 1YY9D 3IS0X 2WUBL 4X4XA 3HG1E 3HC0B 4ENEC 4P5TA 2HLFD 5SWQB 4LLUB 1C5CH 3W9DB 3CGTA 3B5GA 2F8XC 1X5XA 3QXWA 3F7YA 1U3HA 5I1CL 1LE9B 1FFPA 3S8WA 3O8XD 3FO1B 4JM4H 4NDMB 3MLYL 1UZ8B 1K2DA 3SO5A 1AO7D 2Z31D 4R90H 3RP1A 1EBPA 3D85D 1I7UB 4FQ2L 4GRWB 4LVNC 3MUJA 2MFNA 3OKNA 1Z0NA 2K7PA 5EU7E 3VI4E 2VLJA 3W2DL 4XP9H 3TJHC 4GRMA 4HIJA 3KAAA 4KDTC 3ME0A 4PBXA 5IFHH 4D9QD 2VR4A 5EU3A 4FFWC 5C86A 4PJIE 5EIIB 2A9NL 4LRIC 5CZXC 4FQXA 4P9MH 5I16A 5IKCA 1ZSDB 3NN8A 2DQGL 1QQDB 1W0VA 3PWNB 4F9PA 2PN5A 1QRNE 3BZ4B 3O9WC 4KPHL 4ODHH 3V8OA 1I85C 3B6SB 3QO0B 35C8H 4L29A 2YHGA 2P8PA 3HZVA 1D5XA 5C0EA 4EVNB 3WBDA 3O4LE 3OZ9H 1OAUH 3V4UH 3RWFB 5I73C 5J6GA 5D2NE 1FFRA 5EA0L 2GCYA 2A2QT 5DA0B 5H8DA 3X12A 4LCCC 5B39A 1T7WA 5ILTH 3MCLH 3BD5A 1I3UA 2E5EA 3H9ZA 1GSMA 1A4KB 5LXGL 2AK4E 1U91A 4YE4L 4YHYB 2CRZA 1PG7H 3QCUL 4F33B 2B39A 4S1DC 2J8OA 3BP6B 1MFNA 3MJ9A 3MFFB 1YUHA 3ZKXB 1GJIA 1GGYA 1U6AH 4C83A 4D8PA 5IBUB 2C3GA 4H8WL 4JFEB 3PWPD 3FO0L 3P73A 4MD0B 3D3VB 1VFBA 5GJSH 3JWOC 1J0YA 3D39A 1J1PL 1LP9E 1N5AB 5FEBA 4G7VL 4IIQA 1AI1L 4MDIB 1FZKA 4UINL 3V8CA 5C0FB 1T1YA 3H42L 4MXQC 5D1QA 5ITFA 2AJUH 3HAEA 4U1HB 2XWTB 5EO1A 3QT2A 1WZKA 4XTRC 4L4TA 2IBGA 4PJ8C 5DC4B 2DBLH 5GGSB 4KGJA 5FKAB 2B0SH 1RIHL 4CW1B 1QO3A 1BFOA 4NQDE 4RWHA 4HKJB 4Z7QF 5F7UA 1J86A 4X5LA 4G6ML 5E8EB 4JLRA 2MQCA 1E28B 5IG7A 1EHAA 1NC4B 1BEYL 5EC1B 2WANA 4LOUD 5CHNB 2EC8A 4FFVC 1LO3H 4TVSa 1FZMA 5EO0A 4Y4HC 3WN5C 2EDHA 1MCRA 3ZSSA 2NY6C 3CU7A 3QDMA 4WWKA 3IFNH 1KPVA 4KGLA 5HGBA 1S7UB 5EBWA 3TH3T 1U8MB 1TNNA 1MCDA 1KENL 2O5YH 1ZHBB 2DJUA 3E8UH 4KTYA 4QO1A 4GBXA 2CJUL 2E27H 1INDL 1CL7I 2XRAL 1GC1C 1WIOA 2ARWA 4XMPL 2EDDA 1SMOA 3HMXL 1R5IB 5IMKB 2HJKA 2YZ1A 1VGKB 1I8LC 1KIRA 2VDOH 3CXHJ 1XGRA 3QIBC 4HXAH 4GAGH 4AQOA 4YXKL 3PWVA 4OV5B 4Q6IA 4PYGA 3TZVC 1MRCL 1A0QH 3SE3A 5DD6B 1T0MB 3MLTA 3OPZH 4QGTA 5HHVH 3WDIA 2F74A 5CSZB 5E1HB 1NEZB 5KOMC 5ALBH 5IB4A 1K4CB 3SCMD 3MRGB 1QLFB 4HMDA 4ZAKA 4MNGB 4CU7A 1YC8A 4LF3B 3DROB 3O6LL 2CH8A 3AXLA 5CZKA 3VI3E 4DTGH 2NNAA 2X89A 4CN1A 1U8LB 2CMRL 5IVZB 3EFDL 1NEUA 4JFOB 1H3WM 2MKLC 4Z7WF 3MRPB 5D7JB 3W9EA 4LSUH 3VWJC 1ZS8B 4L8SB 1YMMD 3ES6B 1T21A 3MRKA 5ACMA 4YIQB 4LSTL 4MQXD 2R8SH 5C0IA 4D9RE 1I9RH 4BSJA 4XAWH 4ZS7H 3TNNB 5J8OA 3B9KA 3UP1A 2GJZB 2C4FU 1EEYB 5DK2B 3MJGX 1NFDB 4J4PC 1W0YT 4Q58C 3W0WA 4OLYH 1D5BA 4K3JL 5LQBL 4LVEA 3WL9A 5EC2A 4P9HL 5C0AA 3TVMD 2OBGA 1TCRB 1X5ZA 5FYLH 1MJ8H 3S96A 4FFYH 1XCQA 4FQHB 4HCRA 3C09C 5CUSH 4G42B 1OGAA 2J8UB 4Y4KD 5C0RL 3RZCA 2NY5L 1GGIL 3LS5L 4PJ5E 2B4CL 5L2JB 2P47B 2NY4C 2ZG1A 4ZUTB 4GQ9H 5DT1L 5HYQB 1HSBA 3MBXH 2NYYC 2HFEA 2BRRH 3VXNB 1WISA 5BMFH 3OKEB 3PL6D 5ANMB 1S8DB 3OV6A 3UBXA 3BQUD 4D9LH 5CEXB 2FSEA 2RBLA 1TXKA 4OZFG 3SDXE 2DQDH 5HDLA 3DIFA 4M1GH 4ODSL 3CMOL 3RY6C 1EAJA 5CEZH 5TQ0H 5JNYB 5KVDH 5ALCL 4JFYB 1FCCA 2HT3D 1JFQL 3VFMA 2ZUUA 4V1DA 4NWTH 2DLIA 3BPLC 1V7NH 4N0RA 1P7QB 4UTAH 5IT2L 4HMCA 2R1XA 3MRDB 1F00I 1RZ7H 2JB5L 2DF3A 4BH8A 2EDJA 1MQKH 2VLRB 4HF5H 3WXVL 4OGAD 5L7XH 2IQ9L 3H3PL 2OZ4L 4WW2A 1DBAL 1NL0H 3WXWL 5DRZA 1Y6KR 1JWSA 4HMEA 5DDHB 3KDMB 3L5XH 5FB8B 3QNZA 4TUKL 2FBOJ 1V05A 2GK0A 1BM3L 3KWWB 2XPGA 4GH7B 1BQUA 1KCLA 1XF1A 1I9EA 5FM4A 3HC4L 1QA9A 1RZJH 1FNGA 3KPOA 2CK0L 5E6IC 4OJFL 1EGJH 3EO0A 1JZ8A 5HVHC 3DXAB 3GB7B 1AR2A 3MCG1 2QR0A 1HNFA 1FJ1B 1ITCA 3K2UH 3VWKC 3C6SA 5FOBB 4MJIA 3X3GL 2EH8L 1RZ8A 2BNRD 1C7SA 3OKOA 1NGZB 3MV9B 4HWBL 3LMJH 3SHSA 3L5HA 3G9AB 1R3LA 3WHE0 3NPZB 3RNKA 1Q9LA 2J88L 3OL2A 4UNTA 5HTSA 2EICA 3TBTA 4LBEB 1OM3H 2EYSA 3KYAA 4R2GC 4BQBA 4AMKH 3VFUA 1YY8B 4BUHA 1EJOH 1KB5H 1KCSL 1PG7W 1DE4A 5D4QA 1K85A 1CWVA 3PWLB 1D9KA 3AREC 1IC1A 3PNWB 4XAKD 3WD5L 3D1MC 3IS1X 1F2QA 5LGHH 4NQED 3X13A 1J1XL 2AXJA 4Q9RH 2IG2H 5D6CA 3A6BL 4FG6D 1AY1L 2BNUB 2JCCF 3BN9C 3WFHB 5F3HB 5TJWK 1A6TB 3HR5B 2B1AH 4GRWE 1TMCB 3G04A 2R1WA 4YXLH 3WLBB 3HE6A 4HIXH 1JYXA 4GW5B 5DYOA 1DVFD 2PTUA 3ZZ1A 3F7VB 1LP9F 1MH5B 2BDNL 4I0KA 1EFXB 1P7KA 3B9DA 5JXED 1CBVH 5HVGB 4TUOA 4L1HA 2ITDB 4R96B 4H0GA 1JWUB 1JRHH 1YJDH 4K7PX 4P23B 4JCMA 4WHTA 4LQFH 4C4KO 1E0OB 1CFSB 5E00A 5KSUB 3RZWA 5EO9B 3QFDB 4ZG1A 5I74C 3QCTL 4HS8L 4JM2D 4EEEA 4WIQA 2P49B 5CAYB 4PJXA 3HKFA 2B5IB 2EC9T 5CZVH 2AI0L 3L3IA 3JTTB 1MRFL 1EHLL 4HWEH 1I4FB 2COQA 4LPWA 3IDMB 4WV1A 4AH2B 2XWBB 3DV4B 3V0AC 3KPPA 1ZHKA 3TFKC 3GGWA 4CUCA 3BT2H 1JTTA 4HJ0C 1FL6B 5MHSD 2BOCB 4W4NA 3HPJA 4TRPH 2J1KA 5DMYA 2IBBA 2H8PA 2FX7H 4XBEH 4HPYL 5I1GL 4WUUE 4Y8DC 5GHWH 5I1LB 1RJZB 4KY1H 3D3VE 3HI5H 1UKSA 4F58H 3OJDB 1CFNB 2I27N 3F5WA 3VGDA 5B38B 3TO4A 3EYVB 3GHBL 4KQ4L 2AQ1A 3W39A 2Q20A 3EDDA 5INCB 4PJFB 3RY4A 4K7PY 2A6DB 2X70A 1GXEA 3OAUH 4Z7UB 3ARPA 4M1CD 2ATPB 2WMPA 4XMKH 4NN6C 3BEWB 2VQ1B 4G9FE 4HS3A 4IOFC 3IAQA 4CJ0A 4DGIL 4ELMB 5TE7H 4DVBA 5HY9A 2XN9B 4O2EB 4PD4J 2XACC 1RV6X 3N85L 5E2WL 3QUZD 3BAEH 3S7GA 4OZ4B 3MRIB 1EEZA 2F54B 1G1YA 1KT2A 2VZ1A 4G9DB 1HYSC 3QUMA 1E4XH 3VRJA 1FZOA 4ZUSA 1P4IH 4PREB 1FAIL 4R7NA 2A6JA 4OTXL 3V4VH 4ONFL 5T3XH 3MV7A 4ONGH 3S97C 3HLAA 1A8JH 1SVCP 1HXYA 1H3PH 3FL7A 1IAIM 5DJ6A 5I8CA 4OZGA 2IEPA 2A73A 5E70A 1JPST 3O2DH 5A16A 2WWKT 1KIUA 1FIGL 5D9SA 4IRJC 1KJVA 4WUKL 4XWOC 4CMHB 3NIFE 1OP5H 4XPHL 5J1SC 1WZMA 3RL2A 3KYKL 4P4RB 1YEIL 3L1OL 4ZYKB 1QLRB 1SY6L 4JPWL 3QYCA 3HB3C 4QF1B 3TYFA 2BOBA 4P5MB 4RBPH 5D5MF 5FFLA 1JGEB 2WBJC 4XPBL 2EO1A 1RVFL 1OW0A 4Q0XL 1GZPB 2WP3T 2YOCA 4HBCL 1T2JA 1E4XI 2R0KH 3SDXF 4JHZA 1Q1JH 4KMTH 3KPSD 3UTSD 1BMGA 1K3IA 1UYWH 3MOBL 4TUJA 4DKFH 1AKJA 1MREH 4FABH 5IQ7L 2VAAA 4N5ED 3BX7C 1VADA 5H35B 3OXRB 5FA4B 4Z7VA 4ZMAT 1IEAB 5GS0H 2EE6A 3H9SB 3OG6B 3LN4B 2EEDA 3RWJB 3HI1A 2YA0A 5TDOB 1X5IA 3T0EA 1IEHA 4P49A 3QG6A 5J0BA 5C3TA 2HMIC 4R0LA 4X83A 4D0DB 5BRZD 5E4EB 3RTQD 2Y07L 2XWJB 2EEBA 3OAZK 4FQJH 3MLWH 2VISB 1M71A 3B2UC 5F72S 1ZGLA 3PDGA 2NW2A 5IW1B 1JHLH 3DVNA 3MRRB 4P4KA 1FYHB 5FYKL 3D0VA 3VE0B 3WEXB 2DQHH 4WDIB 3SPVB 4PV8A 3T1WA 2F9BT 2PO6A 4EN3B 5DO2C 1B90A 4LHUB 3NZHH 4OCWL 3C2AL 5CLTA 4N0FA 1JN6B 3RU8H 3IGAB 1QPPA 5GGQH 3NAAH 1GC1H 4Y5VA 5DF0A 3TN0D 4PRPA 4JN1H 4FQQB 5ANME 5KVEH 2ICEB 4P2OD 2VTFA 3RWDB 2ILLA 3SGJC 2PR4H 1IGMH 4PIRF 4Y5XB 1ZT4B 2V2TB 1KLUA 2YUWA 1G7LA 2G75B 3SDAA 4X80L 2VXSH 5HGAA 3OKLB 4HPOL 5C0CD 5ISZB 2ICWA 5FO8A 4FN0A 3PUCA 2R0ZH 1HHIA 1J8KA 4UI2A 1S7XA 2C7UA 5HHMB 3MJ9H 3WFBH 4PJDA 4XP6L 5I2IA 2P48B 1BF2A 3QHZH 4DGVH 5DRWB 3IFLL 5FDWA 2VLRE 1UJTA 4WI5A 5IROC 3TBWB 1JZ4A 1S7QA 2H6PA 4GRWF 4OLUH 4LPVA 1EAPA 3O6MH 3NCEB 4K3DL 4TSBH 1UG9A 2VXTL 1HDMA 4NQCD 4E5XA 1HN1A 4NRZA 3HAEH 4KK9C 3CC5A 4KZEL 4A6YL 4OCNC 3ZHLA 1EUUA 1J10A 4YGAB 3RIFK 4RAUB 4I0PB 4Y8AA 1BZ9A 5EWIL 4KK8D 3F8UB 4X4XB 3DXAE 3SE8L 4P5TB 5CJXC 3QR2A 1P6FA 1IARB 1GVIA 4XP4L 3CDYA 4G3YH 4RRPA 4M6OH 2GK2A 3WMSA 3RA7H 4YEFA 3F7YB 3VFGL 1FFPB 3O0RL 5F89A 2P5WB 3MV9E 1K2DB 2CXKA 2FX8H 4JHAL 1RSFA 5DWUL 4Y0GA 4UBDC 4X6DA 3T8XA 3H3KA 3OKNB 5JXAH 2VLJB 1WLHA 4P2RA 4GRMB 5F7LB 5D7JC 1LO4H 1MI5D 4MGXA 3Q3GA 4OFYA 3MLRH 5EU3B 4LLDA 2V5YA 3N9GH 4FQXB 2XTJC 5I16B 5IKCB 1MRDL 2OP4L 4ORZC 1KLGA 3H6JA 5K9QI 1YNLL 1ES0A 1W0VB 2YPVL 1MCSA 1NAKL 1OY3B 4L29B 2P8PB 2DLFH 4XPFH 3OB8A 3HZVB 1LDPL 2AKRA 3MBEA 1D5XB 1ZEAL 4HUMB 5C0EB 4CBPA 5DI8A 1IGCL 2ZUQC 3UZQA 5GGUA 5J6GB 4OGXH 1RPQA 2GCYB 3L9RA 1P1ZA 4I2XA 2Q8BH 1L4IA 4DZBA 1B6DA 3X12B 5B39B 1ZAGA 1RUAL 3T4AA 2X42A 1X5YA 4S1QL 4P59L 4X6CA 1A5FH 1JYWA 3GFUA 1U91B 1J9CT 1MQ8A 4M6MH 3HE7D 1FORL 1G7PA 4FFWD 3B9AA 4A2LA 1YUHB 4C83B 4D8PB 2D7PA 3SKOA 3P73B 1N4XH 2CDEA 4M5ZH 1QSZA 3OKYA 1U42A 5KVGH 2V5MA 1VFBB 2VDMH 1NGYA 4JO1H 3D39B 4R8WL 1OD9A 1WCBA 3L3JA 4IIQB 1FZKB 2OQJA 1T1YB 5DZLA 5D1QB 5ID1A 1S7WA 5ITFB 3HAEB 5IFHL 5CILL 1XGQA 1RULL 1X3DA 2W07A 5EO1B 3UPCA 1B4RA 3I3DA 3ZYOA 4L4TB 4GKSB 2AXHA 3KS0H 4HCRH 3BPCA 1QO3B 1BFOB 2EKSA 1MFDL 4ACPA 3RWGA 5JUEH 5T3ZD 1HH9A 4NC1E 4R3SA 5IG7B 3OHXA 3LKNA 3OGCA 4WWID 3KJ6H 5EFIA 5KVFH 1FZMB 5EO0B 3INUL 1QNZL 1AP2A 1DBBL 2AEQH 4S1DD 2JTDA 4LSQH 4DUWA 4JDTL 5TF1L 1XR9A 4PJFE 3SKMA 1EA9C 3QDMB 4WWKB 1KPVB 4Z7UE 1PSKH 3UZEA 2CD0A 2F53E 3QUXC 5HGBB 4I18C 1ZLWK 4O5LL 3OAZH 1W8NA 3C60C 3AM8A 5B3JE 1BF8A 4ELME 5EBWB 1A6VL 4LIQL 2CKBL 1CLOL 4UOW1 3CFJA 3U2SA 3MYJA 4GBXB 1MJJA 2XN9E 1CGVA 1NGQL 4OF7A 2F5AH 5J56B 1CXEA 2HJKB 2F54E 3K74B 4CMMA 4XHQA 1KIRB 2QTEA 1XGRB 5EIQA 5GJSL 5H2BA 2HTLD 1XF5B 1NCBH 3AVEA 3PWVB 1MCIA 4Q6IB 4RMSA 1F45A 3OR7A 4Y2OA 3MLTB 3CFKA 3U79A 3WFDL 1TETL 3BKJH 2GJ6E 2XKUA 4LSDA 2O5XL 1CL7L 1TCMA 4OGYH 5IB4B 1FGVL 3I50H 5DFWH 3HG1D 4LGPB 3C9NA 3L5WA 3AXLB 3NGBC 4YHOL 2NNAB 4EI5C 4MJ6A 2QV2A 4YFLI 4BUGA 2IGFH 4FP8L 5SX4I 4P23C 3W9EB 5IMMA 1XIWC 5J11B 2B1HL 1OWRM 4HGMA 1JGUL 3MRKB 1T21B 1QBBA 2R23A 3HFML 3ULUL 4NUGH 5CS7A 3M07A 2GKIA 5C0IB 3KVQA 1U92A 2ERJC 3IFNL 1KV3A 1U0QA 3QB7C 4RAVA 4ORGB 3P0YL 4ODVH 3W0WB 1JGVL 1D5BB 4OZHA 4NFCA 5DRXA 3WL9B 1CZ8L 4XGZA 5EC2B 3IYLW 4FFZL 5C0AB 3P0VL 2X05A 1QFPA 1DZBA 1Q0XL 4ONOA 1QSEE 4KI5E 3E8UL 3H9SE 3IKKA 4Y16D 3S96B 1UZ6E 4NJAL 1QRND 1XCQB 5DD0L 2ESVA 3RI5K 1OGAB 3RZCB 4LNRA 2F19H 4IDJH 2VDOL 1A6PA 3KYNA 2CIIA 4KRPB 4UOJA 2LABA 3O4LD 2FX9H 4NKOA 1HSBB 5F7NC 1RIVL 5HI4D 3TYGL 2HFEB 3OR6A 3MLZL 2WZPD 3OPZL 4RGNB 4AJ0A 4OAWB 1JI1A 2DD8H 3UBXB 1JNNH 2DTSA 4HWUA 4NC1C 2FSEB 4WFHE 3QUYA 2BVPA 4W81A 3U4BL 3DIFB 2D31A 3ARDC 2R4SH 1W72H 1FG2A 1NMBH 4DTGL 3VFMB 2BSSA 3S98A 5I9QB 1ZKAA 4V1DB 3LKPA 3JV0A 5CJQL 1I8IA 1I7RA 4WI8A 2R1XB 4HG4K 4LSUL 5DVLA 2KQNA 4BH8B 1IAKA 4RX4A 1N5YL 2D7NA 3D6GA 4WW2B 1MELA 1WQVT 3CPLA 2FEEL 5DJZA 1JWSB 4NZRH 3ARFC 1VFMA 3QNZB 5ISZE 1U95A 1A1NA 2GK0B 4OLYL 4XI5C 2CLVA 5DMGD 4JZNA 2XPGB 1P2CA 4EIGB 5E99L 5L9DH 1QA9B 3RNQA 4OI9A 4C56E 3SEPA 1FNGB 3KPOB 3EO0B 3MOAH 3FQWA 2VAJA 3SY0A 2V5SA 3HUJA 5CCKH 3S88L 1FC2D 1NKRA 2QR0B 5F7KC 3PJSA 4JO3H 3C6SB 3MBXL 4K7PH 2P7TB 1RZ8B 2R1YB 3OKOB 3GMRA 4RFOL 5F7DA 1R3LB 4M7KH 1Q9LB 3DVGA 4PFEA 4D9LL 1RI8A 1P84J 1JGDA 4K7FA 3TBTB 2EYSB 4JO2L 3BYYA 1S7VA 1KCVL 4LLAA 3TEUA 3M8OL 4YDIH 3VFUB 4PJ9A 5EOCH 1DE4B 2OJEA 1D9KB 2ZCHH 3EYSL 5MEN