5E5UB

Crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn6
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
199
structure length
199
Chain Sequence
SAYIEDFETKTRSTVSVREGQGVVLLCGPPPHFGELSYAWTFNDSPLYVQEDKRRFVSQDTGNLYFAKVEPSDVGNYTCFVTNKEAHRSVQGPPTPLVLRTDGVMGEYEPKIEVRFPETIQAAKDSSIKLECFALGNPVPDISWKRLDGSPMPGKIKYSKSQAILEIPKFQQEDEGFYECIAGNLRGRNLAKGQLIFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase gamma
publication title Structural Basis for Interactions Between Contactin Family Members and Protein-tyrosine Phosphatase Receptor Type G in Neural Tissues.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 199
sequence length 199
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5uB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5uB02
3MLPA 4QOKD 1YJDH 2W0PA 4DK6A 2B0SH 1VFAB 5HI4D 4PJCA 2ZJSH 1XEDA 5LCVH 3TZVC 2Y7QA 2O5YL 3QRGH 3VWJB 1I85C 5AYQA 4ZXBA 3WNLA 1EHNA 3PJSA 4G7YH 1X5FA 1WC7A 4TTGA 2GTWA 5DR5H 4Y4HC 3BT2H 2NY0B 4BH7A 3QFDA 4HS8H 3CFJB 1R5WA 3NIDF 5T3ZH 3SKMA 3CFKB 1JGDB 1RUML 3WDHA 1YYML 4QO1A 5FYJD 1CR9H 3RHWF 3EZJB 2PN5A 1FGNH 2B1HH 3LRSB 4CN1A 4N8VG 3QIUD 2H3NA 1UWGH 5E2JA 5KSAB 5C0EA 3O11A 4G3YL 2AJ3B 1QSEB 2DQDL 4YUEH 4DGYL 3MGAA 1CFTA 3FO0L 3KVQA 4TUKH 5HYSG 4L8DB 3VXTB 1BQHB 2FHFA 5I74C 4OUUA 4PGCA 3VI3E 5DO2D 2IPTL 4HZLA 5IHLB 4FFVD 4RCAA 2VQUA 1GGCL 1SVZA 1WFUA 4M5YL 2BNQA 3U2SB 2FIKB 5HVHB 4M7ZC 4UQ3B 2NXYD 1MI5A 1TZIB 1JP5A 5EO1B 5C08A 1RZKL 5DRZA 2Z92A 1JNLH 2XG4A 5D7JC 5BRZE 1AQKH 2VISA 5C07B 2L4OA 4QHKJ 3WJLC 1R3KA 3C6LD 3FT2B 3UJIL 3GI9L 1FG2B 5GGTL 3TEUA 4PP1C 4PPTA 4KI1A 4QRSB 4WJ5B 1KN2H 4I5BB 5E2UH 1MJJA 3G5XA 4FQIL 3QXDB 5HHXL 4OJFL 4U1SA 4KKBC 4EN3D 5KSBE 3D2UA 3KPSB 2W60B 3SDAB 1KYOK 3TYGL 1BECA 1M05A 3U4AA 4CVUA 2HJKB 4OF5A 3CZFB 5CINH 2VZTA 4RAHA 4YE4H 2E7BA 4GOSA 1Q9KA 4RMWA 4X99B 3TZVD 2JK5A 5EU4A 4JHAL 4HUVB 5KSBF 4ZSOB 2EDOA 1NBVH 3D3VA 2WQRA 1BD2E 2P8LB 3FFCE 4I3GA 4KKCC 5FO7B 4JFDE 5CLWA 1ETZB 4K2UL 4L9DA 2I27N 4GJTB 1C12A 4PJCB 1PY4A 2FJFB 3FCTA 2J12B 2VO5A 2Y7QB 1D9KA 5D1QA 2NLJB 4ZO8A 2ZCHH 4KY1L 3K4DA 4LLWA 4ZXBB 4OF3A 4GRWE 3PJSB 2CR3A 4I0PC 2EH7L 1WC7B 2Z8WC 4X7CC 2GTWB 2AJSL 1FBIL 3O6LL 1T6VN 4K3DL 3MUZ1 4XPAH 3RBGA 4HHAA 1WCBA 2NX5E 4BH7B 1MCWM 3QFDB 4WWKC 3MUJA 1R5WB 5HYFA 4GRWF 1U8QA 3DXAB 4JG1L 4M1DL 1AJ7L 3LKSA 2GSGA 4IM8A 4FG6C 2H3NB 4IDLA 1XZ0B 5LBSL 2HFGH 1AC0A 2APBA 4OIIL 2APTA 4BK5A 5IW1A 1CFTB 3B2VL 5DD3H 2ITCA 4LGSB 3IT8D 4OUUB 1FL6A 4PGCB 5D7JD 1BWMA 4HZLB 1AHWC 3BPLC 4KFZC 5AZ2H 5L0QB 1N6VA 5GS0C 1RIUL 4DKEH 4OBRA 1F13A 3FJTA 4GS7B 1DBAH 4M5ZL 2BNQB 3JWOL 2D31A 2VZ1A 4KKBD 3C60A 2WIMA 5C08B 3U7WL 4Y4KA 5DRZB 2Z92B 3ZTNL 3CFDA 2R4SL 2VISB 3AU1A 1R3KB 4LCCC 1CICA 3VG0L 4BKLA 3V52L 4NT6A 2HFTA 3G5XB 4U1SB 2L7JA 4KKCD 2P42B 1UYWL 4P3WA 4Q2ZA 2AQ3A 5HHMB 2FBOJ 1M05B 4IRSC 1CLCA 2AERT 3JZ7A 4OZGB 4XVTL 5EIVA 3DVNA 3PHQB 1Z9MA 4CW1A 2VRAA 4JFFD 1Q9KB 1HHHA 1OLLA 3PGFH 2JK5B 4CVXA 4G8EA 4ODUA 4XHJD 3MOBL 3D3VB 2H6PB 3KXFE 4NP4H 4HK0A 5BMFH 4I0PD 1X5YA 4DGIH 4PBWD 2JB6A 3NN8A 2VZUA 3FCTB 2WNGA 4PRBA 1D9KB 2A77H 5D1QB 1IGJA 2QR0A 3BDYH 2ARJQ 1IRAY 3TN0A 2NY5L 5DMKA 2Q8BL 5FCUH 5I1JL 2J8OA 5C0FB 1HIMH 1J8HB 1EVUA 4HH9A 2BX5A 3GHBL 5EUOF 4UBDD 4HHAB 1WCBB 3CU1A 2W1NA 3QFJA 3RVWD 4WHYG 5LWYH 1ZLSL 3G9AB 4MXQC 5EIQA 1U8QB 1ZLUK 4YHZL 1INDH 4Z77B 2VH5H 5JW4N 1KIUA 5GS2H 3LKSB 2GSGB 4LSTL 4KQ3H 5JHLH 5FKAA 2VWEC 4XWGH 1NDGA 4XZUA 1FE8L 4EUPG 3JVGC 4RRPG 4FFWC 4LASL 4ORZC 2H26A 4OSUH 2FECL 4Y88A 5IW1B 1GC1L 4NHCH 2Q86B 4UAOC 1W8OA 1HKFA 2ITCB 4MVBC 1FL6B 3BSZL 3T4AA 5IJKA 3WFEL 1BBJA 1IM3B 3FMGL 5DJCA 4X6DA 5I1AA 1A6AA 3DETC 5DRNA 3QDJE 2F74A 2D31B 4GMTH 4P46D 2LU7A 3SE4A 3S4SA 1MCJA 1JZ3A 3C60B 2X7LA 4Y4KB 5ESQA 1FLTX 3BKYL 4HC1H 3CFDB 1NAMH 3RI5K 4M93B 2IFGA 3AU1B 4ACPA 4LIQE 4EDWH 4HIIB 1FYTE 5D2NA 4KHXL 1CICB 4ELKA 1T7YA 4CVZA 4BKLB 2ZG2A 3WNNA 1CG9A 4NT6B 3FN9A 4HIXH 4K94C 3BD5A 4A6YL 4Q2ZB 5JQHC 5DT1L 4NQEA 1KLGB 4QGTA 2P4AB 4JFPA 3UTZA 1N2RA 2VDPH 3DVNB 2A0LC 4CW1B 3BKCL 1P69B 4CVXB 4G8EB 4ODUB 1K8IA 4M7LT 1PBYA 3EDDA 1YEJL 4HK0B 3LEVL 3R1GH 5DA4A 1A02N 5BOZG 2JB6B 3NN8B 4KKAC 3TIEA 1AO7E 3FOLA 3IKKA 1UXSA 4PRBB 1HXYB 2LQRA 2BSTA 1IGJB 2OJEA 2QR0B 3HG1A 1HK6A 3TN0B 1RY7B 5B21A 3UZEA 4WCYH 5I1KL 5DMKB 4OF0A 2I5YL 1U3HA 1F90H 4P59L 5F96L 5JHDD 3MACL 3RZWA 5T1DL 4IDJL 1CDJA 4HH9B 1OT2A 1OTTD 1R3JA 3QFJB 1U9KA 3FL7A 4HD9A 4FFWD 4HKZA 4FTVE 3U9UA 1XF2A 3OG6B 3V0AC 4TULH 1NCDH 3AS2A 3RY6A 4LEOA 3ARDA 3ULVD 4MVBD 3SDCA 3O6FD 1MFCH 4K3JL 4PS4L 4K55A 4I3SH 5FKAB 1KLFA 1KUMA 4CU8A 1NDGB 4XZUB 4OB5H 5HYJA 1RULH 3QDGA 3QHZH 4XH2A 3V8CA 2WW8A 2QSVA 2H26B 1NAKL 2BVQA 5ENWA 4HJ0D 4O5LL 3PABA 5K9QI 1MCSA 1FIEA 3Q6GL 4GSDL 3BUTA 3T4AB 3VFTA 5IOPA 1I1AC 3X3GL 5J12C 3LD8B 2V9TA 3KG5A 2CLVA 5EC1A 1B2WL 4BZ2L 1BBJB 5DJCB 2YD6A 4X6DB 5I1AB 1A6AB 5DRNB 3O6ML 5FOBA 2F74B 2I07A 4HH8A 5DUMH 2MWCA 2X7LB 5ESQB 2YRLA 2XWBA 3D69A 3V6OC 2E7HA 3QBTB 2F53E 1JYXA 1DL7L 3S8WA 5CZXC 3H8NA 4M7KL 1CD9B 4NRYA 4ELKB 4CVZB 3IXTA 4ZG1A 4XNUH 1CG9B 1CDUA 5D72L 1CWVA 2P8PA 1BQSA 5DJAA 2QKIA 4JDTL 4JFPB 3UTZB 3KPLA 1N2RB 4JPVL 2YD7A 5E7FA 5T5FH 5I1EH 1UEMA 5DD0L 4ZAKC 4KKAD 5FUZH 3ZKNC 1NCCL 3MNZA 1TVBA 3IU4H 5KVDL 3H9SE 3O4OB 3T2PA 4ODHL 4J3OC 2AXGA 2HYMA 2R9HD 2YPLA 1EO5A 2OJZH 1OP5H 5DJ0A 3IDMA 1QNZH 3UYRL 3TIEB 2FHCA 3IFNH 3FOLB 3S34L 1UXSB 5HHPB 2BSTB 1QSFA 1E4KC 1QBAA 2OJEB 3HG1B 3T0EE 1IAIH 4FQLL 3RU8H 4AL8L 4D9LH 1QZ1A 1U3HB 4OCRH 2YK1H 1UWXK 4L4VE 4ONHA 1I1YA 2X1WL 4TUJA 5KVGH 1J8KA 4LHQB 4KTDH 2R0KL 2GHWB 1R3JB 2F5BH 4HGWA 4HKZB 5CD3A 2BP3A 3U9UB 1XF2B 2YUVA 5AD0A 4OZIA 4PFEA 2DLIA 2ENYA 2YWZA 1SMOA 4LEOB 4YIQA 1DLHA 1QFUH 3ARDB 3ZTJH 1A6UL 2DQTH 1HKLL 3SDCB 3CIQA 4Y16A 4JFXA 1DSFH 2M26A 3C5SA 1IAKA 5HYJB 3QDGB 4XH2B 4Z5RB 5MP6H 2GFBA 1S7UA 3MV11 2BVQB 5ENWB 5IMKA 3PABB 5FAAA 5IV2B 2GJ6A 3SN6N 4X7FC 1WBYA 3SOBH 3VFTB 5IOPB 4O51B 1T4KA 3OAYH 1UJ3A 3OGOE 4XHQA 5EC1B 2CLVB 3IKCA 5CZXD 3MJ9H 5D7SL 3OPZL 5HI3D 4B5EA 5JOPE 4G8IA 1I8LA 5FOBB 1NMAH 2I07B 3KR3H 3T2NH 3N1GC 1KTRL 2XWBB 4ZFGL 3EO0A 4M1CC 2VLRE 1TZGH 3BHBA 3ULUD 1FO0L 4X7DC 3KS0J 4FXGB 4NRYB 1EGJL 3IXTB 4J2XA 1E27A 4LPYA 4R90H 5BJTA 4Q9RH 2P8PB 12E8H 5DJAB 2CMRH 2J5LB 4YNYA 3ARFC 4HF5L 1FSKB 3MLSH 3IDYB 3KPLB 1IC5L 5F9DC 1A5FH 4B53A 1P9MA 3C5ZA 3CJJA 3MNZB 1TVBB 4A6YA 1KJ2A 5E95B 5F7LB 2AXGB 3AROA 2DDQL 1T20A 2YPLB 3VD7A 5D7IA 3IU3A 5H8DA 3SJVD 1CD8A 5DJ0B 3IDMB 1AQDA 2D7MA 5L88L 4NQCA 3DIFB 5IJVA 4LSUL 4P2QD 2DBJA 5M95B 1B6UA 3SDDA 1QSFB 3MBXH 1JHKL 1IC4L 3QG7L 1BIIA 2GQHA 2Z8VC 3UPRA 4HT1L 1I1YB 4TUJB 1MEXH 3U46A 2C5DC 1GSMA 3RX8A 1AFVL 2LABA 4KUZL 1VERA 1WWWX 2AXJA 5CGYC 5CD3B 1FORL 2IFFL 3K1DA 3WNOA 3MROB 5AD0B 4OZIB 3TA3C 4NUJA 4YIQB 1DLHB 4GRLC 4NNXA 5SX5K 2L7UA 2VC2H 4APQC 4Y16B 2EDQA 4JFXB 3C5SB 5D8JL 3U9PL 5D7LD 3BPCB 1IAKB 2C7UA 3GBLA 1YJDL 1JF1A 3MJ6A 5E6IA 4G6FB 4R97C 5LGJA 2GFBB 4X6FB 1S7UB 1DVFB 4XB7A 5IMKB 5L7XH 2DLTA 4LPVA 1W72A 1F6FB 2GJ6B 3FQNA 1WBYB 5F72S 4PY7A 3TCXA 1T4KB 4PJ8A 3W81A 1T1XA 4HKXA 5KTEH 3ECBA 1UJ3B 3NFPA 3IKCB 1QLRA 5DR5L 1UB6A 5FB8A 5C0AA 1MCOH 1VENA 3BT2L 4RGNE 4PJIF 4B7LA 3EJJX 1RUQH 3LVEA 1NSNL 4HS8L 2Z4QA 1EK3A 4J6RH 1X5ZA 4X7TA 1J9CT 3L3JB 3ARFD 1ZLVK 4RBPK 3RGVC 4PGEA 1CR9L 3EO0B 4AEIH 4P2RA 2BC4A 3BHBB 3HMXH 1A7RH 1SBSL 2WWKT 2NY1D 1CZ8H 3HMWL 3WIIH 1MFEH 1F97A 5IF0A 4JKMA 1E27B 5I76A 5BJTB 5B38A 1HZHH 2DL9A 2E9IA 1IGFH 4YNYB 1PKQE 3CSGA 3O3BA 3S3PA 4F7PB 2QHLA 3C5ZB 1K3IA 5IB1B 1A6VH 4BUHA 4CNIA 4F33A 1KJ2B 3QEQA 3ABZA 3F7YA 4OV5A 3GBMH 1T20B 1KGCD 1G7QA 3TV3H 3RZCA 3IU3B 2VERN 1GZQB 5IT2L 5LAXA 1G9NH 5EU6D 1AQDB 5JQ6L 4GBXA 1OTSC 1EJOH 1I7ZA 2OL3A 4HAGA 4NQCB 5BW7A 1TNNA 1Q0YH 1XCTA 3KHQA 1DTUA 3G5VA 1MCPH 3STLB 3TA3D 5E2UL 3QUYA 1BIIB 1QEWB 2WMPA 5JOFA 1G7HA 3HUJE 3U46B 5F1KC 4RNRA 4TQEH 2ZUUA 1LHZA 3EYSH 3HFMH 5CINL 5J4MA 4H8WL 5AWNL 1NGZA 5E8OA 4ZS7H 5MHSD 4YE4L 2HT2C 3ISWA 4Y8AA 1RZJH 5T3ZE 3MNWA 3HUJF 1VSCA 1NBVL 4NNXB 4FFZH 3VFWA 1JWSA 1HN1A 4K7PH 3U79A 2J6EH 4PGDA 4BQCA 2C7UB 5IESH 3MLVL 1JF1B 4JVWA 5E6IB 3CH1A 5LGJB 1B4RA 5I71B 1NCWL 3F7PC 4JO2H 3CSPA 2ZCHL 1BZ7A 1JTTA 1W72B 1GVIA 3FQNB 4OGYH 1RMFH 2Y06L 4PY7B 1AH1A 2JTDA 2R23A 4PJ8B 4GG6F 1T1XB 4X7EC 4HKXB 3ECBB 3NFPB 3U30C 1QLRB 4PJFE 3BD3A 1UB6B 5FB8B 3C2SA 5C0AB 4YQXH 2K1MA 4XTRD 1HHKA 5DJ6A 4FFYL 4UDUB 3VRLE 4EEEA 1RZ8A 4HIHA 3BP5A 1YYLH 1U92A 3IS0X 3TBVA 4PJFF 4PGEB 5IHBA 3B5GA 4P2RB 1ZXQA 2BC4B 3QISA 3VRLF 3B9EA 2WBJB 3LS5H 5E99H 4MNHB 3DVGA 3AGVA 5IF0B 5CLTA 1VACB 5I76B 4YZFE 3MJGX 2QBWA 5F7UA 5CUSH 5FM4A 5B38B 1NCAL 2ILLA 4MA3B 5DD3L 4RA0C 5FYJU 4GXUM 4M6OH 4XNZB 2FH6A 1DBKH 1DN2A 2WSKA 3O3BB 4X5XB 4DEPC 2YRZA 4YZFF 2JF1A 3MUY1 4CNIB 4NN7B 4F33B 1DBAL 1NLBH 5F89A 4OV5B 2BRRL 1PX3A 1G7QB 3RZCB 3W82A 5D1ZC 3C8KA 3SBWC 3O2DL 4NHUA 5LAXB 4GBXB 3UZQA 1I7ZB 2OL3B 1XCTB 1KCKA 3G5VB 1ZTXH 3QUYB 1UFUA 3QIBA 4DZ8B 1XCQA 1N4XH 2AJUH 5JOFB 3SDYH 1RAMA 1G7HB 2C1PA 4RNRB 4UT7L 3UXFA 1MAML 2NY7H 4WFFE 1IFHL 3QDMA 1IZJA 5C07E 1NGZB 5E8OB 2V2XA 1UKTA 5ESVA 3O8XC 3RVTC 3L5WA 3LN4B 5J13B 3MNWB 2G60H 4XVSL 2N7BA 2Z0BA 2BY0A 2XKNA 4KRPC 1JWSB 1QR4A 1G9MH 5ELIA 2GT9A 4PGDB 3D85B 4YH6A 4JQXA 3MRRB 2LVCA 3CH1B 5HGAA 1LDSA 5EPMA 3TJHC 5BZDA 1GCFA 3CVHH 4RAVA 5CIPH 3KWWB 4P9HL 5IP4A 1BZ7B 2CGRH 4JN2A 2R23B 1KBGH 1X44A 3LN9A 4MQ7A 5IFAH 1OY3B 4UNVA 2VDKL 1A6TA 1L9NA 2EKSA 3KJ6L 1HHKB 5DJ6B 4ZYKB 1K2DB 2XTJE 3SHSA 3WKMH 3WSQH 5KSVA 4OLXH 1RZ8B 4HIHB 3DI2B 3GRWL 4PJCE 4R2GB 1WT5A 3PP4H 2E7MA 4OCSH 2R15A 4HW6A 3TBVB 4ETQA 4AYFA 5CSZA 1CGXA 2XXCB 3HE6A 3TYFA 3EYVA 5JIKA 1FC2D 4PJCF 1MFAL 4XWGL 3DVGB 3FHAA 4WFEE 4P3CH 2E7CA 2NTFA 4AEHH 3Q5OA 4OSUL 3ARPA 1ZT4A 2VZ3A 1PEWA 3STZA 4OCYL 4G6KH 5D1ZD 3DXAE 3FAXA 4J23A 2JJWA 3BH8A 4ZXBC 4F15B 3VRJA 2ZUQB 4XVJL 4WTZG 5DURD 4HFWA 1YEDA 2VLKE 1PZ5A 4OCMC 3LB6C 4X0KA 1NL0H 3NCBB 2OK0L 4XCCH 4HC1L 3PG2A 4WW2C 3C8KB 3BKJL 1E6JH 4E5XA 4NHUB 3QEGH 4KVCH 4EDWL 5DQJB 5DK2A 3ARBC 1YEGH 4G7VH 3GUTA 4G43A 3HB3D 2LAAA 3MBEA 3O8XD 3RVTD 4HIXL 3VGFA 1KFAH 3QIBB 1Z0NA 1JVKA 1XCQB 4WI6A 2C1PB 1FFQA 3JTSA 1QBML 3UTSE 4RZCA 2MQCA 1J86A 2VDPL 3QDMB 2E6QA 2V2XB 1K6QL 2HN7B 5ESVB 4QYOA 2CLZA 2F54E 3L5WB 2UUDK 2ED9A 1PX4A 5I6XB 3GMQA 2XKNB 4XRCA 4Y4FD 2X4OB 4J4PD 2GT9B 3GM0A 3LKRA 4OZGE 5DZOA 5HGAB 5F1OB 5BZDB 2FX7H 4P5MB 5E6ZA 4RAVB 1XFPA 5GJTH 5E94A 4ZOAA 4JN2B 1QSZA 3QIWA 4IRJA 3CMOH 1OGAE 1OARL 5FUOH 4MQ7B 5IMOA 2W92A 2NY2B 4HXAL 3H3PH 4OZGF 4R4NC 5DC0A 4P23A 1A6TB 5GGRY 5KSVB 4JRXA 1QRND 4J3TA 2P5ED 4Y5VA 1FNLA 2VXQH 1F4YL 5FO9A 4ETQB 5CSZB 1U8LA 3HRPA 5TQ2L 3HE6B 1JMXA 3TYFB 3EYVB 4I3SL 5C3LD 5DQDH 5GGRA 4JO4L 5ADPH 1NUFA 2DQCH 1J8HE 1RULL 3QHZL 4MB4A 5HYEA 4N0FA 3VD9A 2NTFB 1T0MA 1ZT4B 1NEZA 2OTUA 4KZDH 5DUBA 4BQ9A 3STZB 5EU3A 5D1QC 5T5NF 3WD5L 3DGGA 3BH8B 5I1LA 3VRJB 2PF6A 3D0LA 4HFWB 5SWSA 4D0BA 4G9FE 1PZ5B 1OQOA 4X0KB 1FLRL 5DUML 5F6HI 4I48A 3DRQB 3TH2T 2E9BA 4O9HH 3WJJA 4OTXH 3RX7A 2F19H 3I84A 4UT6H 5DK2B 5DVOA 3GUTB 1H3WM 4KPHH 2KZWA 2VDLL 4G43B 2V9RA 25C8H 5GRZA 3VXRA 2MHAA 2XN9A 3MBEB 4XNUL 5JPMA 4H1LG 3TFKC 3O2VL 4AH2A 4WI7A 3MV7A 3T1WA 1JRHI 3VWKC 1OM3L 4RA3A 1V05A 2XZZA 3JTSB 5IVXE 5BQ7A 3DUSB 3MZGB 4RZCB 2AABL 3ARQA 5EZOH 4OM0H 4LLUA 3BDXA 2DQHH 3CMGA 5KAQG 1S7XA 2CLZB 3K8KA 4Q6IC 1H3VA 1CXLA 2BNRA 1LD9A 4XRCB 2FATL 1R0AH 4PLOB 5E1HB 4JFZH 1D6VH 2OJZL 2PYED 3LKRB 4Y4KC 4IOSD 3WIFA 1S5IH 5TPWL 1FIGH 4F57L 2FDBP 4DN3H 3N1FC 2VDMH 3GHEL 2OP4L 1IEBA 1BOGA 2A38A 4XMPH 2HWZH 1GIGH 1IAIL 2YN3A 4UV4H 4D9LL 4KJYA 4ZUTA 3QIWB 4IRJB 1O7SA 5JR1H 4PJ7E 1I1CA 3GDBA 2CLRA 4NWUH 5IMOB 1G7JA 2E8YA 5DLMH 3QSKB 4OQ1A 1P7HL 1KENH 1WVZA 2F5BL 2CDEA 5L2KA 2BVOA 4JRXB 1T5XA 3LMJH 4FP8H 4JG0L 1OAZH 2NXZC 4PJ7F 4Y5VB 3CX2A 2AEPH 2VLLB 1ERNA 3QI9D 2P44B 3ZKMD 1L9MA 1U8LB 4RFOH 4F9LA 4U3HA 3DI3B 2P24A 2WBWB 5GGRB 1U41A 3QQ4A 4NBZB 3GRWA 1RZFL 5HJ3A 3NCMA 4KQ4H 3OKOA 1JUFA 2UZIL 4N0FB 3V6BR 5CP7A 1T0MB 5EO0A 1NEZB 2OTUB 3PNWA 3PWPD 5DUBB 2PR4H 3QXVA 5EU3B 3Q48A 3E3QC 3SOBL 2A6JA 3DGGB 3E0GA 1S8DA 5J56B 3EO1A 4GLRH 3D0LB 3MJ9L 4M6NH 4KK6C 1T83A 4OZHA 5SWSB 4XPBL 4D0BB 2LU4A 3BZ4A 4HUNB 1NMAL 4XPGL 4AEEA 2APXA 3UTOA 2O61A 4I48B 3VWKD 4Z7VA 3EBAA 4IMKA 4PRHB 3ROOA 2XACC 2CRYA 4N90E 3ALPA 1J5OL 1ZOXA 4KMTH 3VXRB 1IGIH 2MHAB 3B9DA 5JPMB 4YFLI 3OXRA 3ULVH 4AH2B 2B1AH 4PGBA 5HVFB 4P5TA 2CMRL 4C57C 3JV5A 2I60H 4HUUA 1S3KL 5T1KA 4Y2OA 5EU5A 2DD8L 4L4TA 3SCMA 4LLUB 3VXPB 1A5FL 1RZIA 1J1PH 4MQXC 2XNAA 4KVNL 1S7XB 1FFNA 4MGXA 2MCG1 1T0PB 5FGRA 1P6FA 2BNRB 3KGRA 2J4WH 4WUUE 3SE4C 8FABA 1EO7A 1GPOH 2A1WH 4MNGA 3DX8A 5I15L 1EZVX 1A3QA 3WIFB 4HEPG 4L3AA 3AFLA 5E08H 1FZMB 1IEBB 4K8RH 1BOGB 5D2NC 4LNRA 1HNGA 3MBXL 3BPNB 1RZKC 4KJYB 5C09A 2WIIA 4U2YA 1TTUA 5EOTA 2CLRB 1MEXL 5TDOB 2VQ1A 1G7JB 2GCYA 2Y23A 4XC3H 1WF5A 4XP1L 1A64A 1C7TA 2CDEB 5L2KB 2BVOB 1T5XB 3RTQC 1JBJA 2Q3AA 3P77A 2BJMH 4X6CE 3S7GA 4JREB 3HG1E 4OCNC 5BRZD 4FRWA 2LTQC 2P24B 3MLTB 1A3LL 3GGWA 3QQ4B 1OP3K 3CK0H 5HJ3B 3VXMA 2PETA 1AIFA 4KK6D 3OKOB 4JY6A 5DJ2A 1JUFB 5HGDA 1SBBA 2QL1A 5CP7B 5DJYA 3Q5TA 4KAQL 3RWFA 5EO0B 3OKLA 4NRZA 4QRPA 3PNWB 1GXEA 4HX1A 5TFSH 5HHQA 2PNDA 3CUPA 3KPNA 1WZLA 2A6JB 1J0ZA 1RUAH 1KEGL 1S8DB 3LV3B 5KTEL 2RJMA 1U3HC 2YPVL 4FQPA 3FO2A 4M61A 3NH7H 1C5CH 4OZHB 5K59E 1NANI 3BZ4B 3PP3H 4YBLB 5C6WH 2EDWA 1BD2D 5BS0A 1NMCB 3FFCD 2O61B 3X3FH 4DUVA 3AAZA 2VXSL 2XXMB 1WV7T 4Z7VB 3H9HB 3ROOB 3HC3H 4JFDD 5K59F 5J9PB 5KVEH 3HAEB 3WUWA 4G6AC 3ZKSD 1CZ8L 1BQHG 3WIIL 1MFEL 3LKNA 4JM2A 5GSVA 1KCVH 3KDMA 1VPOL 3OXRB 4HS6A 1GJIA 4PGBB 3FN0H 1AXIB 5C0BA 1F4AA 4HUUB 2ED8A 1JZ6A 4D9QE 2Z31A 3BOVA 5T1KB 3NZ8A 5EU5B 4O2FA 3SCMB 2NX5D 4YHOL 1IC7H 1RZIB 3O4LA 3P0YL 2D9CA 2XNAB 1YEEL 1FFNB 1DQTA 1WGOA 4KGLA 2IBBA 4C4KO 5SX4I 5IUSA 1EPFA 8FABB 3B8YA 4MNGB 3DX8B 2OZ4H 5I8OL 1WAAA 4AY0A 1BMGA 1G9NL 1HWHB 5FK9A 3PWJA 4CAGA 4H20L 1AGFA 3RTQD 3JWOC 4PJEA 1T21A 5FA3A 3BGMA 4GXVL 4LNRB 5K93A 3FO1A 5F7EL 3LHPL 4PTTA 4N0CD 5C09B 4UINL 2WIIB 1SM3L 3ARYA 3W9EA 5HD8D 2VQ1B 4TQEL 2GCYB 3QO1A 1DQMH 1MLCA 3I3BA 5SWZE 1SY6H 4O2EA 1MRFH 2CXKA 3HAEH 4ZS7L 4AK1A 3U0WL 2IAMA 1RZJL 4YBHA 3P77B 3GK8L 1TLKA 4NKMA 3MRCA 5F7HA 5I8KH 3CDFA 3O41A 4FFZL 1U6AL 1KXVC 5DTFA 1CGSH 3VXSA 2YD5A 4NO0D 5F8QC 3GGWB 5B8CC 2J6EL 5JORB 3VXMB 1Z9OA 5DSCA 5C9JA 1AIFB 5DJ2B 4JY6B 2RR3A 5HGDB 5DJYB 3RAJH 2OXGA 3RWFB 3OKLB 4NRZB 3B9KA 4QRPB 5JW3H 4HX1B 4JO2L 4UTAL 3RDTA 4OZIE 5HHQB 1FNHA 1FNSH 1UT9A 3KPNB 4YPGB 3IJSA 4HBCL 4IEFB 1NKOA 2DWEA 1XGRA 3OZ9H 1IEHA 4G6AD 3FO2B 1PJ9A 4YAQA 4M61B 4ODVL 3PL6B 1NGQH 1KACB 4OZIF 4MQTB 3DMMD 3BISA 5ECJE 1UZ8A 3WS6C 1OCWL 3VFMA 3KXFD 5BS0B 2NY5C 1YYLL 3AAZB 2EXWD 5D71L 5DZNA 1ITCA 1G9EA 5F7WC 3AC0A 1A7PL 3D39A 5E99L 5CEXA 3LKNB 3HCVA 4JM2B 5GSVB 4BH8A 3KDMB 3LEXA 4HS6B 1CS6A 2V5RA 3V8OA 5C0BB 1QSVA 4QXUH 4MX7B 3OB8A 2LU3A 4NQDA 1I7TA 2Z31B 3V2AR 5I1GL 2G75B 4OT1H 4O2FB 3CD4A 4C4KT 3ZSTA 4BSVA 1K5NA 2A9NH 3O4LB 4O58H 1GC1C 3OGCA 1NLBL 3CDCA 4I13B 3WIHL 5AEAA 4QRRA 3T3ME 1G6RA 4RX4D 3FB5A 4N9OB 2YA0A 3V95A 2DBLH 4Z0BH 5EORL 2FJGA 4UT9H 1AGFB 2CKNA 3T3MF 4PJEB 1L0QA 1T21B 5FA3B 1ZTXL 2QQKH 3BGMB 3FO1B 2Q6WA 4PTTB 4NQTA 2AJUL 3W9EB 5GRUL 5FUCC 1X5AA 1MLCB 4O2EB 1GGIH 3EOTH 1WITA 4Q7DA 3QDJD 3D87B 4HXBH 4NBXB 1TXKA 2IAMB 1WICA 2F9BT 1P9MC 4WO4D 2AK1L 5MENA 4NKMB 3MRCB 2BDNH 1IAIM 2BCKA 1MCIA 1LO5A 2YWYA 3O41B 3BMVA 2YKLL 5BVPH 5DTFB 3VXSB 2XY2A 2YD4A 3WHE0 1FYTD 5ANME 4LSDA 5C9JB 3CCHA 5DSCB 2DYPD 2HTLC 3TWCH 4GW4A 3NBNA 2W65A 3RA7H 3B9KB 3PWLB 3GSNA 5DC9B 3RDTB 3VJ6A 4WENB 1MQKH 1E4JA 3OG4B 5I0ZA 4HG4J 3SDDC 1WTLA 1YPZA 5DVLA 1TVDA 2DWEB 2BSRA 4BSWB 1ITBB 2DL2A 2FYYA 4HPYL 4YAQB 1UEYA 4PJ5B 5EBMA 1FCGA 3VDBA 3WKML 3MCG1 1TTFA 4OLXL 4PRPA 1L7TH 5ALCH 1UZ8B 3G5ZA 4CADA 3VFMB 4HWZA 4HV8B 3FRUA 3PP4L 4OCSL 4MB5A 2E27L 4LCUA 4LLQA 4M7LH 2C4FT 1LO2H 1T1ZA 1AO7D 4PGZA 3D39B 2OR9H 5CEXB 3HCVB 2H2PD 4MDJA 4P3CL 2JB5L 4NKOA 4EXPX 3LEXB 3ZE2E 4RWYH 3V5KA 1MAJA 2IADA 4Y1AA 1I4FA 3MLZH 1MIMH 1NQBA 1CBVL 4NQDB 1I7TB 1MCFA 3MRPA 1EIBA 4QWWC 5IG7B 4HSQA 4YHIB 4IJ3C 1PYWA 4BSVB 4FTVD 4EBQH 3TPUA 1FC1A 4CDGC 1ZA3A 3OGCB 4U3XA 5ERWA 3T0EC 2CPCA 4QRRB 4XCCL 4YFDB 5J1TC 1G6RB 2GI7A 2I25N 3FB5B 4MA1C 2FGWH 1JFQH 2B4CC 3NPZB 5F9WB 2FJGB 3BQUD 2BERA 2LFGA 3Q5YA 3S3JA 3S37H 4HMCA 1FAIH 5J3HD 4NM8H 2E6JA 3MXWL 1UADC 3MCLH 5DZLA 3OL2A 3CNKA 4PV8A 1KT2A 3CLEL 5E2WH 5F9OH 2ZG3A 4JY5H 2HTLD 4DGVH 5DMIH 4PJHA 1NFDA 3PWVA 4LCWE 4RQQA 1CFNA 4ZPTA 2BHUA 4I2XA 2BCKB 3QPQC 1UCBL 3MRMB 4RSVA 4PJAE 2F53D 3VGHA 2GSIB 5KW9H 1NC2D 4LLAA 4XBGA 3RZCC 1WEJH 4GW4B 4MAUL 2W65B 4HUKB 4WVRA 3HE7C 5BW7C 4LHUA 1TTGA 3GSNB 4LCYB 4PJAF 3SGJA 3VJ6B 1LEGA 2CRMA 1MWAB 4JPIA 4UOJA 5JZ7C 3CMOL 5GS1C 1YPZB 3OR6B 1G6RH 3TO2A 3OSKA 3X11A 2FYYB 1KB9K 5ISZA 1RZGA 2IH3A 5EBMB 1BF8A 4CJ0A 1MH5A 1CFVH 3H9SD 4PRPB 1KTDA 3G5ZB 4CADB 5I8EA 2X1OA 3FRUB 1ADQH 3P11H 3D6GA 3T09A 2EO9A 1MAKA 5DQDL 1BWWA 2B2XH 5H94A 2WUCH 1QPPA 1DE4B 4Z7OE 4MDJB 3T0ED 5EBGA 4EI5D 1FGVH 4HDIB 3V5KB 4KZDL 4GQPH 4PB9L 4F9PA 2EE3A 4L4VD 5MERA 3BI9X 2VN7A 4UMGA 3AREA 1U8NA 2ESVA 3MRPB 4JB9H 4Z7OF 4FQJH 3S4SG 5FF6A 3HNTH 1PYWB 4QLRA 3V4VH 2ZPKH 4KROC 3MLWH 5AAMA 3TPUB 2ICEA 4O4YH 4N0UE 1ZA3B 5FKPA 5ERWB 2MNUA 4B7IA 4MMXC 1B0GA 4DWHA 3FB7A 3SY0A 5A16A 4QOKA 1LK3L 2NY6D 4MJ5A 1MWAH 5GSRA 3MGOA 2IANA 4O9HL 1FFOA 4OTXL 2F19L 3O9WD 4Z95H 1YQVH 3WIHA 5DMYA 3MSPA 4NN6B 5E5UB 3ZMRA 2EDFA 4XX1E 3QPQD 4PV8B 5I1HL 4ZMAT 1KT2B 1DBMH 1VFBA 4NWTH 3KJ4B 3PXJA 5C0IA 3A6CH 5JOPD 1T0NA 5TJWK 1E6OH 4PJHB 3PHSA 3LSOB 1NFDB 3PWVB 5J0BA 4RQQB 1CFNB 4ZPTB 2B39A 2HJFA 4I2XB 3JTTA 1AY1H 1ES0A 1L0XA 2YA1A 3QIUA 2EIBA 4H25B 1QHOA 2WANA 4IIQA 5JZ7D 3B4NA 1PY9A 1J88A 1OSZA 4LU5L 1JZ4A 2VLRD 3GO1L 4AJ0A 2AVGA 2X9XA 4XBGB 3N9GL 3UC0H 3O3DA 1MHPH 5JMRA 4RGNC 4JFFE 5B39A 3F5WB 4JVUA 3FZUC 1B0RB 4LHUB 2IGFH 1GGBH 4WY7L 4XMPL 1IKFH 4ZUWA 4UV4L 2C3GA 4JPIB 1MJ8H 4GKSA 2D4DA 4QT5A 3TO2B 1LGVA 4X83A 5E8NA 5ISZB 3NVQA 3OBAA 4B41A 3L1OH 3RVUC 1KENL 1RZGB 2IH3B 4LLYA 1MH5B 1S7SB 3WN5A 2R29L 1OP9A 2NMSA 1RIHH 4NC2B 4F80A 2OM5A 1CGVA 1OAZL 1UENA 4O02H 2JKXA 5I8EB 3C6LA 5F1IA 3FAWA 2QHRL 4WHYH 2D9QB 4NFCA 1U3ZA 4A2LA 4OGXH 2XICA 5L2JB 3S37X 5TF0A 3DTXA 2DB8A 3O3UN 4S1DC 1J0JA 2I24N 2FEDC 5H94B 4EN3A 3P2TA 4JFYB 4PIRF 4I77H 2DLFH 4JQXC 4YHKH 1R3IL 2AK4A 1FNFA 1V5JA 4EUPH 2F8OA 5MERB 3AREB 3TZVA 1U8NB 3T3PF 2ESVB 5ALBH 2Q7NA 3AVEA 5D93C 1J1OL 4NKDA 1I85A 1YJDC 4NJAH 5FF6B 3EDJA 4M6NL 5F7FA 4UUJA 1OP5K 1A9EA 2ICEB 2RHEA 2YPKA 4U1GC 1B0GB 5HY9B 3FB7B 5F6HJ 3SY0B 5A16B 1CU4L 4QOKB 3RIFF 4EZMA 4Z7UE 5INCA 4MJ5B 4CUCA 2QQNL 1OAUH 3DSFH 2IANB 3IDXH 1FFOB 2HJLA 2BVPA 4MA7L 1MELA 1UG9A 3ULVL 3O6KL 2YD2A 2B1AL 4LPTA 3NGBC 1MPAH 1VFBB 4JEGB 4KTYA 5GRXG 3RWJA 5C0IB 5DD6A 4GT7A 4XI5D 3KLHC 1P4BL 1LO4L 4M62L 4TSAL 4OI7A 4D0CA 1R5IA 3JTTB 3QIUB 1PLGH 1JGVL 2EIZA 4IIQB 1KULA 4AG4L 4ONOA 1OSZB 3RL1A 4XC1H 3O3DB 5GRYA 5B39B 1V7NL 1FHGA 2CUIA 3HR6A 5E08L 5D7JA 3QUZC 4YHLH 4K8RL 3FRPA 5DFVC 4ZUWB 1U8MA 2VTFA 5T1MA 4QT5B 1BOYA 3GB7A 3FQXA 2NXYB 2BY3A 5J1SC 2VABA 4LLYB 3VE0A 2KQNA 3BGFB 3Q3GA 4XMKL 2X05A 3WN5B 5DMJB 1FDLH 4NN5B 1S7VA 1NGXA 2H8PA 1F58L 4H0HB 3C6LB 3QXUA 1YZZA 4S1RH 2BJML 4L8SB 4N0YH 3WXWH 3DTXB 3OAUL 3QNZA 3CK0L 4H8WC 3O0RL 1YMMB 4EN3B 3PV6B 1EZVY 3KPRB 5CJQH 2F58L 3PQYA 5DD5L 2AK4B 1AKJD 2Y36H 3ULVE 1UJTA 1S9XA 1CLYL 5TFSL 4UZGA 3TZVB 3QUMB 5CD5C 1RUAL 2EC9T 1MJ7H 5IFJB 4NKDB 1ZANH 5JW5A 3NH7L 4UUJB 1A9EB 4I0PA 4P23C 4TRPH 5T3ZD 5C3TA 1RHHA 2BOBA 2A74A 5HGBA 5M7QA 5JMOC 4WWKA 5INCB 4JPWL 2W91A 5DQ9A 4U49A 5HHVL 1YEIH 3RIAF 5IMMA 2HJLB 1S7QB 1NJ9A 1T22A 1F8TL 2BVPB 4U1MA 5GGVL 5KVEL 4IOFD 4JFQA 4TNWF 5CKAA 3K2UL 4LQFH 4NZDA 3VFRA 3C8DA 4L29A 3SE8L 1BPVA 3Q1SL 1K8DB 3I50H 3BD4A 1X4XA 3JWDH 2X09A 3RWJB 4PRHE 5DD6B 4KK5C 1IC7L 5D1XC 2E3VA 5I74B 1G7PA 3VGEA 3AM8C 3QUZD 4Z8FL 4D0CB 1EV2E 1R5IB 2RCSH 3VXRE 5DFVD 3WS3A 3I2CH 1F3DJ 5E2TL 1NLDH 3RL1B 3UTTA 1JGUH 4LPWA 3LOWA 1IBGH 3OJVC 4M7ZB 3QUMH 1KCUH 2XTJC 2X40A 3DVIA 4EXKA 1KN4H 3F65A 1UM5H 4KJWD 3H0TA 2APWA 5D7JB 2XZCL 15C8L 2V2WA 4LCCA 4LDEB 1U8MB 3CLFL 1IQDA 2JLLA 4JCLA 5T1MB 5TF1H 2AJYH 3ULUL 3EFFB 5IBLD 5FECA 3FQXB 1DQML 1KC5H 3GFUA 4HLJA 2VABB 2YHGA 2NPLX 4MJ6A 1BEYH 4ALAH 3VE0B 3Q3GB 1LK2A 4ODSH 1NGXB 2H8PB 3MYJA 2YBRA 3OQ3B 3BZFB 1V8HA 3QNZB 4M6ML 3VXNA 1A2YA 5TGBA 4XBEH 1CIDA 1N59A 2CDGA 1RZ7H 4Z78A 4U05A 5KZCB 3PQYB 2AEWA 3H6JA 4XCFL 3EOAA 3IAGC 1IE5A 1S9XB 3QAZC 3OAZH 1OD7A 1EFXD 1X4YA 3QJHB 3WNPA 5CFHA 1BJ8A 4Z18A 2EECA 2XY1A 4WFFD 3OZ9L 1CE6A 5C07D 5EA0H 4RBPH 5ACZB 3B2UC 5D5MB 4I0PB 1PSKL 1H5BA 1RHHB 4P9HC 1U58A 2BOBB 2A74B 1JI1A 4WWKB 5DQ9B 4G6JH 4KV5E 3UYPA 4KDVA 1T22B 1NJ9B 5B38G 5D1XD 1F42A 5JHDA 4R6UA 4S0TD 1AE6H 3VD5A 3VFRB 4OZHE 4KV5F 1OF2A 3C8HA 3FQRA 1DFBH 4L29B 3JVGA 3NIGE 5F8RC 4WNQA 5BV7H 1NUNB 3WCYA 2R1WA 2XQYG 1I3UA 4X4MA 3EYQC 1H0DA 4OZHF 5BVJA 1AD0A 2AKRA 3P73A 1G7PB 2N7AA 4PG2C 1K4DA 4LRNH 1BZQK 1AHWB 3O6FA 3NIGF 4ZODA 3EDFA 3WS3B 2IBZX 2XQBL 4Z7VF 3G6JA 4M48H 4PJ9C 1LP9A 3UTTB 4GAJL 3BN9C 4BQBA 4J8RA 1BBDL 4NPYA 4WFED 4OZ4A 3H0TB 5HYIA 3X14A 2B20A 1TETH 2QQKL 5FV2A 1DQDH 2V2WB 4LCCB 4Z0XA 3D18A 1IQDB 3DXAD 1FCCA 2P8MA 4P5TC 5DUPH 4DKFH 5FECB 4XT1C 5MEPB 1VEPA 4MNGE 2NW2A 3EOTL 4PBVC 1LK2B 1JGLL 2R0WL 4H26A 5I9QC 3UP1A 4HXBL 4X8XA 3MYJB 3MREA 4XP5H 5D2LA 2YBRB 2X89A 4YHPA 4LAQH 5EZJA 1KV3A 2WBKA 3VXNB 1A2YB 3BP6A 5TGBB 1N59B 2CDGB 4BFGA 4Z76A 3TWCL 3B2UD 4Z78B 3V9FA 4WHCA 5I2IA 2VL4A 1OGTA 3L5IA 3NOIA 2BNQD 1KB5B 1MQKL 4U6TA 1U8HB 4D8PB 5B3JE 5GS0H 1HCVA 5FOJA 3P4MA 2C3HA 1CE6B 5HVGB 4RISH 1GHFH 3ZL4H 2F54D 4FS0A 1FJ1A 1KJVB 4KJPD 3WDJA 2ZUVA 3HRZA 1FVCA 3QPXH 4X9GA 1U58B 1AD9A 1T7ZA 5B3JF 2Y1VA 5GS2D 3HI6H 3E2HB 3W11D 4XCEA 5GGVY 3HZMA 4M7LL 4Y7MA 2PTTA 4X9BA 5KVFH 1LO2L 2CK0L 1TITA 3KYOA 4KH2A 5KS9A 1U2CA 3VFGL 5JHDB 4FZEL 3F7RA 3QDHA 1MJUH 2VXTH 4XCNA 1OF2B 4RWYL 4FABL 3FQRB 5F7YC 5CWSA 4PJ9D 4WNQB 4XX1G 3DJ9A 3MLZL 1QA9A 1CTNA 4V2CB 5KJRH 1EERB 4BFBD 4UAOB 1H0DB 3G08A 5BVJB 1AD0B 5C6PB 4MD5A 2AKRB 4XP6L 3P73B 2D03H 4EBQL 5K9QG 5BO1H 3O6FB 1ZGLM 2D7NA 1VHPA 4Z6AT 3G6JB 1LP9B 3UDWA 1ND0B 2AEQH 4Y5XC 4PUBL 1KB5H 4G9DA 2FGWL 1JFQL 4J8RB 1J8HD 4NPYB 5GRJL 3V4PL 2AJXH 5JXAH 4JM2F 4Z7WA 3S37L 3V6OA 3MXVL 3X14B 2RB8A 4OF6A 3MR9A 2XIDA 4Z0XB 3W2DH 5F97E 3D18B 1CK0L 2P8MB 2HH0L 3IYLW 2DJUA 5F9OL 4JY4A 3MLRH 4J1UA 2DQJH 2CKBA 1ZSDA 4G9FD 4XAWH 4ZOCA 5L8KB 1Z0MA 3PGDA 5ID1A 5FCSH 3MREB 3WKNA 5D2LB 5AYUL 1MFBH 4YHPB 2YXFA 3UEZA 3QCTH 5KBNC 4PLJC 1WAAF 3BZDA 1PGRB 5GRVL 4MAYD 1F2QA 3C6SA 5K9OA 3BP6B 5D6DC 4Z76B 5DEZA 1HILA 1WEJL 2A2QT 5I2IB 3CC5A 3R8QA 1OGTB 3MA9H 3V7AG 3AXLA 5EZIH 4LVHC 2UY7A 4ENED 3C60D 2K7PA 3P4MB 3GMOB 2V17H 2BHYA 5JW4Q 2X44D 3B6SA 1FG9C 1HHJA 3U6RA 4ZNCD 2NW3B 1K4CA 2H32A 2X1XR 3B9VA 5JDJA 5CJOH 1FVCB 3SJVA 3OWEA 1AD9B 1FVDA 1CXEA 1H3UA 1T7XA 4MA8H 5EG6C 3P11L 3BE1H 4P2QA 4XCEB 3HZMB 4LKCA 2PTTB 1EO8H 3P0VL 1OL0A 2B2XL 5I1DA 4K94H 3S96A 5KS9B 1MF2H 2WUCL 1MCEA 2DIBA 2J8UB 3AMLA 4PJ5E 4RAUA 4XCNB 2Z91A 5CWSB 5GGUB 3GKZA 4KI5C 1DBJH 4LIQH 1QA9B 4PTUA 5GXBB 1U8JA 5IM7B 1YDPA 1CQKA 4FQJL 3QDAA 1ZK9A 3V4VL 3NCCB 1I1AB 4OBSA 3TVMC 5J12B 3D39E 5CGTA 2OQJA 3K4ZA 3ES6A 3MGTA 5D7LA 4J3UA 1CD1A 4O2CB 3TN0D 4D9RE 3W5MA 1I9IL 1NKRA 4MXVE 5BZWA 4OIBA 3ZYZA 5LXGL 4BFIB 2XA8H 1HINL 4KXZI 4U7SA 1RQ5A 2COQA 3IB4A 1HSAA 2IWGA 3MR9B 2ADJA 1CE1H 5TDPA 4JM4L 4MXVF 1P1ZA 1X5XA 4PLJD 2PO6D 5H37G 5IBUB 4ONGL 2CKBB 1ZSDB 3A6CL 4MB3A 3ARFA 5F1NA 1E6OL 2R39A 3FONA 3NABH 3CSYA 3ARRA 3PGDB 1JNNH 5ID1B 4UTBH 1MOEA 4XMLL 1AY1L 3QCUH 3JSSA 3SO3B 4N90D 5FHBH 3TBTA 3C6SB 3UC0L 1MHPL 3OF6D 3I6KA 1CVRA 3LY6A 4DW2H 1HILB 4NQVA 3U4BL 3CC5B 1HH9A 5GJSL 3VD4A 3AXLB 2IGFL 2O5XL 4OIAA 1H3PH 2EXYC 3I3EA 5EN2A 3IFLH 3B6SB 3U6RB 1HHJB 5T33L 1RK0A 2BVYA 1K4CB 3L1OL 4X80L 5C0RH 5IGXL 2H32B 3VW3H 3NCJH 1RIHL 3UTPE 1FVDB 1WWCA 2JCCE 4O02L 3EJZD 5EU6A 4U3CA 4WUUD 3HC4L 2WP3O 4P2QB 4ODBD 3TA3A 4LKCB 1NEZG 3OKDA 4NC1E 4KKLC 1IQWH 5I1DB 1QFOA 1YN7B 2JCCF 1MIEH 1A4JA 4APQA 4XP4L 2VYRE 2CKBH 2DLFL 2CUMA 4RAUB 4YHKL 2AJZA 2Z91B 4KMLB 3A6BH 2N1KA 2W07A 2BRQA 2HMIC 4H0IA 4E41E 1Q8MA 3L5XH 1OSPL 4PTUB 2VAJA 1U8JB 3EFDH 1YDPB 4TVPH 3WE6A 5TE7L 2C4XA 2FJHB 5C71A 4N8VA 4LHJB 4PJBA 5I18H 2OQJB 3ES6B 3MGTB 1DANT 3BRFA 1CD1B 2KL6A 3HG1D 1AI1H 5D4QA 1OAUL 4PLKC 2WK2A 4HGMA 5BZWB 3FQUA 3ZLQC 3RGVA 4DOHB 1HSAB 3F58H 2ADJB 5TDPB 2DM2A 3C08H 4OLEA 5CS7A 4KMQA 2DQFA 1P1ZB 2OMNA 4QHNA 3BDBA 2DTML 1CLZH 1MRDH 5CJBA 4ZTPL 4X5LA 4RMRA 1OPGL 3ARFB 5F1NB 3RVVD 3S36H 3VFSA 3FONB 3MOAH 2F15A 1CXFA 3CSYB 4HFUH 3KPTA 5HDQH 2VLJE 1PLGL 5AG8A 1KLUA 2EXYD 3TJEH 2B8OT 3TBTB 1IARB 3GSRA 3K4AA 5E8EA 3I6KB 1TPXC 2VZOA 1AGEA 4KZEH 4FZ8L 1XR9A 1VGEL 1HH9B 2IH1A 4YHLL 5EFIA 4OQTH 4WGWB 2EIEA 4PJHE 1NFDE 4Y19E 1SJEA 3L5HA 4S0SD 5SV3A 3EYOA 4D9QD 4I2XE 5EN2B 4NZRH 1WWBX 5A2KH 5F9JA 5E1AA 1G9NC 4G42A 1RK0B 1N26A 1KG0B 4LVNB 1NC4D 2YS4A 4PJHF 2WP3T 1NFDF 1UA6H 1FDLL 4TPRL 4HUWA 3SQOL 5EU6B 4HJJL 4PR5A 1E4XI 3V4UH 3TA3B 1MNUH 3OKDB 5ITBH 3B3IB 3VD3A 5HGHA 2EC8A 2DQUH 4XXCC 1I9JL 1MVFA 1A4JB 4APQB 4JQIL 1INQA 1JWUA 1RZJC 2AJZB 4QXTA 1A1NA 3RIAK 4LGPB 3I75B 1KTLA 4JKWA 4R97B 2YPLD 4PLKD 3SGJC 5SWZD 4CMHC 3WE6B 1A6WH 2V5TA 1ZANL 3KPPA 4XPFL 4RMQA 4PJBB 1QYGH 3TM6A 4AENA 1HYSC 4TRPL 3CFCH 1XIWC 2XZAL 3GSUA 5ACMA 2V7NA 1CFBA 1YEIL 3FQUB 2ESVE 4X4ZA 4OLUL 1EMTH 4ODXA 4WI9A 3T0VA 3RGVB 1SJXA 3CZJA 1Y18A 1OVZA 4LQFL 3VXUA 5E9DE 3EYUH 3SDXE 4YO0A 3U48A 1CT8A 2DQFB 3HR5A 4TNVF 4ZS6C 4QHNB 4NCC2 4MNQA 3DX6A 3T0DA 1KXTB 4H1LH 3JWDL 4Y16D 2Y07H 4DN4L 1TQBC 2IANE 3AREC 1WISA 2XRAL 3VFSB 2V6HA 3VA2C 3I02B 2FSEA 5D9SA 3DHJA 1L0YA 1DVFD 5A40E 3GSVA 3I2CL 2X4RA 5CJ8A 1KLUB 4P0DA 2GJ6D 5J6GB 3GSRB 3BEWA 5HI4C 2ADFL 5E8EB 2ATKA 1I3GH 1XR9B 2PW1A 1LE9B 1UM5L 5D1ZA 2R4RH 2IH1B 5EFIB 3SBWA 2P49B 5IFHH 4NOBA 3NZHH 1N3NA 1SJEB 3EYOB 2EICA 1ZS8B 3MV9B 2AJYL 4P4KD 1BZ9A 5LJYH 4G42B 5KOMC 3P9WB 2P48B 1IVLA 2PXYC 4LSVH 4ESKA 1FZJB 3MRDA 4ODSL 4GMSH 1LDPH 4HUWB 1I7UB 3ZE1E 2NZIA 4PR5B 4HWBA 1K3ZA 3O8XA 3QIUC 1MCRA 5HDBE 2QSCL 1MRCH 5HGHB 2VDQL 4FMFA 2WAHA 1RZ7L 1I75A 3C5ZD 3ZE1F 1INQB 3P3YA 1JWUB 4QXTB 4TSBL 1A1NB 1XIWD 1JZ7A 5HDBF 3GM8A 1KTLB 2UWEA 1NCBH 3VRIA 1IGCL 3IF1A 4L3EE 5EA0L 3KPPB 3MRBA 4AENB 2ICES 3MV8A 3U30B 1YMME 4J4PA 1MREL 3H42L 3KPRE 4MLIA 3WUWG 1QLFA 2EKJA 1IGML 3E8UH 2AK4E 4JR9L 1KYOJ 2V7NB 3MC0A 1T1WA 4G6JL 4NFDA 4OD3H 5IBTL 3WFDL 4PJGB 3BZEA 1N0XH 1UM6L 3QNXA 4Q0XH 1ZHNA 1E4XL 1Y18B 1AE6L 4HG4K 3VXUB 3BAEH 4K3HA 3M8OH 1WBXB 1CT8B 3HR5B 2YEZB 4MNQB 3DV6B 3DX6B 1BIHA 4AZ8A 4PYHA 5BV7L 2QSQA 3PE9A 1QRNA 4MWFA 2P5EA 3O3AA 1RD6A 1WIPA 3I3DA 1E4WL 3VG9C 2DKSA 2HKFL 5D96C 5I19H 4F2MA 5E6ID 3NIDE 4F7EA 5D9SB 4DEPB 1ZHBA 4JFEA 2X4RB 1U2HA 2OCFD 4NO5A 5DJXA 4ELMA 3NPSC 4ERSH 4LCIH 5C86A 4NZUL 2WUBH 1NMBH 2R1YA 5C0JA 1T6WA 2ATKB 3QEUA 3TLRA 2PXYD 2A9ML 2PW1B 2AJVH 3JUZA 3MRKB 5D1ZB 4WW2A 4EIZC 1YEHL 1TETL 5L6YH 1FPTL 3ARBA 2YR3A 1N3NB 5DURB 4F37F 2AW2A 3MRIA 2ZUTA 5IQ9A 5DUPL 4DKFL 5I73B 1AGDA 3GSXA 4G6MH 2WBJD 1CF8L 4U1IB 3MRDB 3V7MA 4K3EH 2DKUA 1RSFA 5FHAH 3RNQA 3ZT6A 1PD6A 4NQXB 1YNTA 3ESVF 5HHOE 2Y4SA 3MJ8A 3O8XB 1D6EA 3L9RA 1A1MA 3T0AA 5IB5A 5J11B 2ENSA 3MV01 4KRPB 5LKNA 1DZBA 1EUUA 4YDVA 4N5ED 4AQOA 5GISH 3K0WA 5EOCH 1IGYA 3W0WA 1QHPA 3SE9H 2UWEB 3VRIB 3O45A 1Q9OA 3VMOA 4X5WB 4NQUA 3IF1B 1MQ8A 5DJZA 4FHBD 4K9EH 3MRBB 4RISL 1GHFL 4LCWD 3MODH 3MV8B 3VDCA 5C2BL 2PYEA 1F11A 4QKXB 3OV6A 5LGHH 3GJEA 4PJDA 3HI6L 2HT4D 4ZFFA 3WDIA 2DAVA 4YC2C 2XWTA 5F71A 2CR6A 5DA0B 2E7LC 2WINA 3QNXB 3BZEB 3LPGA 4QXWA 1A7OL 2CIKA 1OAQH 1GOHA 3FB6A 2VXTL 2W9DH 5JXEC 5D5ME 2ICCA 3NTCL 5FYKH 4UV7H 2FECI 1EVTC 3K81A 2I9LA 3HZKA 2D7TH 3IFOA 4BZ1H 3BKMH 1QRNB 2OR8A 4MWFB 5GPRA 5KJRL 2P5EB 3MYZA 3O3AB 1W0VA 2V2TA 1GOGA 2XA3A 3QI9A 3D85D 5D5MF 3INUL 4F2MB 2D03L 1VFMA 4XHJC 5BO1L 4F7EB 1JPTH 1JF5A 1HYRC 3DO7A 2IG2H 3GMPA 1ZHBB 4JFEB 1RUKH 4HQQL 2VKWA 5DJXB 4ELMB 1ACZA 1DQJA 3PWPA 5C0JB 3QEUB 2F8VA 2M2DA 2AJXL 4IRZH 2YMXL 3SKMB 5CJ5A 1F2XK 1WIOA 4WW2B 1JYVA 4W70A 3M17A 4UOW0 4UB0H 5DFTA 4QHMA 3ARBB 3RUGA 5GZOD 3W2DL 3WHXA 5CAYB 1KNOA 4UBDC 5IQ9B 1IJ9A 2MSPA 5C0EB 3O11B 4GUPA 2JELL 3RVWC 2Q20A 3MLXL 4L5FL 4I0CC 3GSXB 3VWKA 1S9YA 3IGAA 4XAWL 5JA8B 1UWEH 4OD1H 5JIIA 5HDLA 4X7SL 3AB0C 1YNTB 4HUMB 4I8DA 1MFBL 3LQZA 5MEQA 1HE7A 3MJ8B 4Q6IA 1I9RH 1D7FA 3GMRA 3L9RB 3P4NA 4WDIA 3U0TA 4WFGE 1P53A 2V9QA 1A1MB 1SQ2N 3EKCA 5F44A 5IB5B 4DCQA 3OKNA 1MFNA 4U1JA 4BJLA 2HFEA 2QJDA 1I1RA 4YDVB 4OI8A 5E0QA 1MI5B 2D4FA 1RUPH 2G9HA 1QFWI 5ESAA 1IGYB 3QH3A 5IIEA 3AY4A 3GI8H 3DHMA 3W0WB 1X7QA 1KCRL 3O45B 1L7IH 1Q9OB 3I9GH 5DHVA 2JIXD 1EHAA 5DJZB 4PRIE 2VDNH 4HKBA 1MJJB 4P46C 4R26H 3UX9B 1UM4L 1J87A 5JXED 2PYEB 1F11B 4D3CH 3D2UB 3VCLA 1MFDL 1BJ1J 3GMLA 5DXWA 5CEZH 1JHTA 3GJEB 4MA8L 1Y6MR 4PJDB 4OLYH 3QIBD 1SJHA 1EFQA 3BE1L 4ZFFB 1YNLL 3IS1X 5CILH 2XWTB 5EOCJ 4AT6A 4HPOH 1KF9B 4EQ3A 1DUZA 5EU4B 4YGVA 1MF2L 2CIKB 3FB6B 4FQQA 3DV4A 1JPST 1JL8A 5I17A 1DBJL 4LIQL 2I9LB 2K3TA 3HZKB 3IFOB 1C12B 2K7QA 1KSRA 2FWOA 1QKZL 1W0VB 2V2TB 2FGZA 3SO5A 5EUOE 3QI9B 4P4RA 4XNYL 5GRVK 2XG5A 5BRZA 1I1FA 4LLWB 3DO7B 3SGEI 3GMPB 4RGMC 3WLWD 1H5BC 1AR2A 1HWGB 4JDVA 1Q72L 3DSNA 1FRGH 1DQJB 3PWPB 3WFBH 2Y5EA 1J1XH 2A83A 2P45B 3E2HC 3GZKA 4U6VH 4HJGA 4R4FL 3M17B 1KEML 4QHMB 3RUGB 3WHXB 2J88H 1UQSA 1IT9L 1KNOB 2MPAH 1OTTC 4GUPB 2ZUXA 1BD2A 2P43B 2PUQT 3FFCA 4Y2DC 4QTIH 3VWKB 1S9YB 3IGAB 2BOCA 1Q9LA 3NABL 1SEQH 1WCQA 4KJQC 8CGTA 3QUXC 3ULVC 1N5AA 1TJIL 2FEEI 3O6FC 3G6JF 3LQZB 1RJYA 5FHBL 3TT3H 4Q6IB 1G7LA 3BXNA 3GMRB 1INEH 3P4NB 4LHUG 1P4IL 4WDIB 3U0TB 5IR1A 3DARA 4LSSH 4DCQB 3OKNB 4U1JB 2HFEB 4DW2L 3WBDA 3VMNA 1JNHA 2RAMA 4HJ0C 2G9HB 1AC6A 3RJDA 4DAGL 3QH3B 5IIEB 1X7QB 3OTTA 3WLBA 4EKXA 1H3PL 5DHVB 2X9YA 3MRFA 1LO3H 3SKJH 4U7KA 1QR1A 4HKBB 2F8XC 1XGTA 5C0RL 3NCJL 2EDEA 4K8RC 4RMTA 4FQ2L 2ZNXA 5D2LF 3VCLB 2OR7A 3GMLB 1JHTB 1IL1A 1J10A 5GGTA 1BQUA 4JKPL 4YDJA 4CBPA 2NY4D 1SJHB 3RTQA 5HPOA 5TE4L 4ORGA 2NXZB 2DM3A 4RFNB 1BREA 4AT6B 1HHHB 1DUZB 1RVFH 3W9DA 4YGVB 4GW1A 1JHLH 1FP5A 4DKAA 1MIEL 4FA8A 1CXIA 2NR6D 2ICWA 4UILH 1KPRA 3A6BL 1CL7H 5I17B 1IGTA 3L5XL 1YECL 1HHGA 1QFWL 2R0LH 3SE3C 4N8CL 2OS7A 5TQ0L 4R0LC 3WXVL 1DN0A 4P4RB 5B22A 3HHRB 4JRYE 5BRZB 3A6OA 4NO0A 5I18L 2R9HC 3HZVA 4M02A 2J8UE 5K9JL 4GH7B 4ONFH 1AI1L 1L6ZA 4JDVB 3QIWD 4IRJD 5FEBA 3LS4L 4C56A 1UKSA 5GZND 4Y2DD 4TSCH 2A83B 5F88A 1QBLH 4N68A 2J8UF 4PJXE 3GEWB 4KJQD 2ZCLH 3QUXD 1YEKH 4LPXA 1F4WH 4LK4A 5C7XL 5IB2A 3F58L 2GK2A 2IPUG 3A67L 5IVOA 3C08L 1UQSB 1U8OA 3CVIH 1MRDL 3N85H 3DMMA 5FGSA 3AS0A 2VJXA 4PJXF 1WK0A 1BD2B 3KXFA 4F7TA 3FFCB 2VDRH 1WWAX 2JJSC 4V1DE 4GAFB 3SGDH 1A9BA 3MOAL 3KS0H 1N5AB 5DEFA 3V6OE 4ZNEE 5B39G 1V3KA 5J8OA 1RJYB 1G7LB 4S1SH 5DD1H 1UACL 2B4CL 3BXNB 4YHML 5IR1B 3UDWC 2Q3ZA 4QXGL 5CP3A 1KELH 5T1LD 4NKIH 7FABH 3S4SB 4NM4H 1JNHB 4HCRL 4K8RD 5IW3A 5SWSD 1ZT7A 4C83A 2DMBA 4RGOH 4XAKE 3WLBB 1F4XH 4MMZC 1REIA 5F7NC 3MRFB 2AXFA 5D2NB 4PRHD 1U42A 2O5YH 4TVPE 5HI3C 3NMEA 1ODAA 1XGTB 4RX4A 4V2BA 4OLWL 4JHZA 4YEEA 4HKJA 1OT1A 3VXRD 4U33A 2HT3C 4EJ1C 1IL1B 4NQEB 4YDJB 5HTSA 2OMBA 3RTQB 3ULUC 3LEYH 3MOQA 4PB0H 4ORGB 1MNUL 2FEEL 3SO3C 4X9IA 3W9DB 2IBGA 2DQUL 4GW1B 2V7HA 2LTQB 1K8IB 5B8CA 2ICWB 1VKXA 5DS8A 3CXHJ 1KPRB 1IGTB 2P7TA 4S10A 3QDJA 1BAFH 4G8FA 2E9WA 1HHGB 3NAAL 4WO4A 2DQDH 1A6WL 4DGYH 3UMTA 4TNVK 1UKQA 5DJDA 2DJ4A 1RJCA 3DYOA 2IPTH 3HZVB 1FYTA 3CFCL 4G8GE 2DYPA 5CEYA 5A2JH 3WS6A 2NNAA 1T3FA 3D25A 4C56B 1OQXA 4X4YA 5F88B 4NSKA 1EMTL 2HKHH 1RZKH 1QOKA 4JQVA 4LFHD 3U7YL 5IB2B 2EH8L 5EWIH 1X5LA 2MCPL 4RMUA 1U8OB 3GI9H 4S2SA 3DMMB 4BZYA 2CIIA 3KXFB 3SEPA 2GKIA 4FQIH 3RFZC 4OJFH 1XGYH 4LP4A 2CQVA 1A9BB 4AM0A 3TYGH 1V3JA 4DOHE 1AO7A 3CXDL 1JCKA 4ZFOL 1EX0A 2KDGA 2VNCA 5DGRA 3WFCL 2RIKA 3GIVA 3FRPG 1I3GL 1GAFL 2A6IA 2VXUL 2QV2A 3QP3A 2HT3D 2R69L 1ZT7B 5IFHL 4C83B 3D69B 2G2RA 4K2UH 3NZHL 2ZSWA 4FTVA 4P3DA 2AXFB 1P7QA 1Z3GH 1UGNA 1QO3A 2H41A 2XV6B 4UI2A 1OLZA 5DHXB 4KY1H 4KK8D 2BMKA 5KG9A 2WWKO 4BELD 2FB4H 2QKIB 2EH7H 2DOCA 2AJSH 1FBIH 4DZBA 1U8IA 3O6LH 1LEKA 4XPHH 2LV4A 2W59A 4H5SA 2DQGL 2D3VA 2NY1C 1IZKA 5I1IH 3UO1L 1A7NH 4JG1H 4POYA 5A1AA 4PBXA 4RDQF 3V0VA 4JPKH 5B8CB 1VKXB 1NGPH 5DS8B 1ZWIA 1FH5L 4J3XA 4YXLH 2P7TB 2W9EL 3TF7C 1B4JH 4OIIH 4G8FB 4NRXA 3VMPA 3TO4C 5CZVL 3B2VH 2F53A 4LVNC 1TJGH 1FYTB 1NC2A 2R56L 4ONHB 2DYPB 3D48R 5CEYB 4JRWA 1RIUH 2ZKHL 2NNAB 1T3FB 4HGWB 4X4YB 3JWOH 4OD3L 3BYTA 3G5YA 3OX8A 1Q1JL 4NSKB 3A0OA 4KTEH 4NZTH 2R4SH 3IXAA 1A1OA 5KAQF 3M8OL 1GGUA 2AI0H 4R8WH 4YXKL 1A7QH 2VZVA 4S2SB 4OUOA 1D5IH 1NGWA 1BVZA 3H9SA 3VG0H 2CIIB 4NNYA 3V52H 2B0SL 2EDXA 4LSRH 2ZJSL 2W9LA 5LCVL 3TBWA 3RHWK 5FDWA 3QRGL 4PJBF 4PJIE 3DBXA 1ORQA 4F37K 3FO9A 4LLVA 4XVTH 3MX0A 4G7YL 4KK9C 4E0RA 4UNUA 1EAJA 4GO6B 4LCIL 3T0EA 1S9VA 3H9ZA 4G80A 1Q9WA 3GIVB 3OAZK 4G8IB 5DFWH 5HHNA 3MOBH 4L4VA 5T3ZL 3PL6D 4YHNA 2A6IB 2FZ3A 1KJMA 4J12A 4QEGA 3M07A 2G2RB 5L6YL 3FB8A 1D3CA 2ZSWB 4FTVB 4P3DB 1FGNL 2B1HL 2X4TA 2FH8A 1P7QB 1UWGL 2N4IA 2NY3C 1KOAA 4MD0A 4XTRC 1LNUA 1VGKA 43CAA 1QO3B 1XGQA 5CJXC 4G6ML 2ICWJ 2BMKB 4YUEL 5HBBA 2Q8BH 3HLAA 2V5MA 4JM2D 4K3EL 4TUKL 5FHAL 3O9WA 4DZBB 1U8IB 1LEKB 3GHBH 2WZPD 4H5SB 1MLBA 4OLZH 3RBSA 1ZLSH 3OKEA 3TO4D 3MV9E 2PW2A 5ICYA 4JZJC 4PP2A 4A6YB 1RURH 3ZT5A 5EH1A 4YHZH 3ZHLA 1H15A 2RFXA 3P9LA 3V0VB 4LSTH 5D7IB 3UPCA 1JNLL 1ONQA 2FD6H 1AQKL 1FE8H 4WW1A 1V7MH 4NRXB 2X9WA 3HE7A 5IJVB 1GC1H 1E28A 3EJYC 4MHHI 4K9EL 3SDDB 2QADD 1KN2L 3BRDA 5GS1A 2F53B 3BSZH 2VLRA 4LSPH 5LGHL 3UPRB 5IKCA 3WFEH 2IF7A 4GAYA 3FMGH 1FFRA 1QFWM 3KPOA 3ARXA 4JVPA 3G5YB 4DJMA 3OX8B 1TFHA 3BVNA 2XT1B 4NUJB 3BKYH 3QWRD 4UIKH 3IXAB 1A1OB 2DIAA 4CU7A 4KK9D 4KRNA 5FYKL 4UV7L 2PTUA 4K71C 3HNVH 4KHXH 1NGWB 5IVZA 3TP4A 3H9SB 4NNYB 5HPMA 4GG6E 1CQYA 3K8MA 3QXTA 4JKLA 3TBWB 4BK4A 3B83A 5FDWB 1ORQB 4A6YH 1TCMA 4PJGE 1KJ2H 1JPTL 3FO9B 2D7PA 4LLVB 3VH8A 3B9KD 2DS4A 2B7DT 3DNKA 4IJ3B 4E0RB 3VXUE 2YD9A 3LKPA 5KVMC 2AS5M 4XPAL 2NY3D 1S9VB 3RI5F 3T0EB 4Z7NE 4MNQE 1TENA 1Q9WB 4PJGF 3ESUF 2Z4QB 4TTDC 4XVUC 5HHNB 4BFEA 4BYHA 1D5XA 4IRZL 4MA1B 4KHTH 4PJ5D 3LQMA 1YEJH 4YHNB 4X7TB 2FZ3B 4R7DA 4UB0L 5GS3A 3FB8B 4Z7NF 3F12A 5CHNA 1VADA 2H9GA 2FL5A 4J3WA 4OV6F 4MD0B 2HTKC 4NC1C 2HFGL 1LNUB 1VGKB 1XGQB 2C3VA 3RP1A 4QHUA 1OW0C 3D39D 2I5YH 5F96H 3MACH 5T1DH 3ROLA 3CX5J 4IDJH 4OD1L 3O9WB 2G5BA 1FO0A 1H3XA 4D9RD 1EGJA 1MLBB 5AZ2L 1ZMYA 3OKEB 1ZKAA 2ZOKA 4DKEL 3EJYD 2PW2B 5ICYB 2CO7B 4PP2B 1P84K 3KHOA 3QEQB 3F7YB 1QSEE 1H15B 3P9LB 5E4EC 2VKXA 4K3JH 1M7DA 1W72H 5F3BA 2IEPA 5FYKE 4QRRD 4WW1B 5E03A 3EDKA 3HE7B 1E28B 1GGYA 2X6MA 3L3GA 4O5LH 3N0PB 4DQOH 3Q6GH 5GS1B 4F3FA 5I73C 4EQ2A 2VLRB 4IBLT 5CEZL 5IKCB 1B2WH 3N50A 4BZ2H 4GAYB 4F7MA 3VGDA 1FN4A 3GBNH 4ZUUA 3O6MH 3KPOB 5CILL 5J1AA 2UWEE 1RU9H 3HB3C 3PGFL 4P9MH 3BVNB 2X1QA 5J11C 4U6XA 3VFWB 5JNYA 4NP4L 5BMFL 3MV8E 4HK3J 4MD4A 2UWEF 3KPSE 4M7KH 1B6DA 1YUHA 5IVZB 4DGIL 5CSBA 5ABDE 5HPMB 4FQXC 4BQ8A 4XVUD 4TTDD 1XR8A 1PEZA 5C6TH 2C9AA 5D72H 3FOMA 2JJTC 3IDJA 2A77L 3M1BA 3BDYL 3UTPD 3PF2A 4ZSOE 4S1QH 4C55A 3VH8B 5D6CA 5FCUL 4Y4FC 4XNQA 4JPVH 4OZFA 4KROB 1HIML 2GUOA 3LKPB 4J4PC 2HTKD 1FRGL 1AKJA 5KVDH 3WFBL 4YDKH 1J1XL 5LWYL 2OL3H 4WIQA 1D5XB 4RMVA 5DYOA 1EBPA 3V5HA 3HUJA 3BP5B 5DMGC 1T7VA 2DJSA 4XBPA 1U92B 5IBUG 4R7DB 1INDL 2VH5L 2VSCA 4ODWA 4E41D 6CGTA 3F12B 5CHNB 1VADB 3LKQA 4KQ3L 5JHLL 4MSWA 2H9GB 2FL5B 1VFUA 4FXLA 4OM1H 3UPAA 4BSJA 3E6HA 4ELME 2C3VB 4QTIL 4AL8H 4FQLH 2Z93A 4HWUA 4NHCL 1CN4A 1OAKH 3ROLB 4LLMA 2G5BB 1FO0B 4L8CA 2IALA 5CEZE 1G0YR 4HGKC 4ELMF 3BRGC 4JN1H 5TH2A 3KYKH 5SWQA 7CGTA 3HPJA 1INEL 2ZOKB 4CRPA 3STBA 4AMKH 3GKWH 2PYFA 1DCLA 4W4OC 3X17A 4GMTL 5F89B 1A6UH 2X4UA 1HKLH 4GAGH 4K7PX 4WW2F 3LN5A 4PJFA 1M7DB 3LZFH 4LSQH 1AGBA 4BQ6A 4M4PA 4RGNB 5F3BB 1PG7W 1NAML 5E00A 1ZEAH 5C0CA 2XZQH 3H9YA 2W0LA 3QUZA 1IAII 3BWAA 2MTPA 3L3GB 2EEBA 1N6QH 2H2SC 5C1MB 4F3FB 1FL3A 2BNQE 1FAKT 3BPOC 3ZHDA 2VLJD 3K1KC 4ZUSA 1MI5E 3UCRA 3ZT7A 5C08E 1NH6A 3OB0H 1FN4B 2Z8RA 3ARSA 3H2WA 3OPZH 4ZUUB 3W0WE 3CFJA 4FQXD 1RFDH 1XT5A 3V5DA 4ZFGH 4U6XB 5JNYB 3SGKC 4UILL 4Y19D 4AQ1B 1FZKA 3R1GL 5F7DA 1CL7L 4MD4B 3RX5A 1FO0H 3H7LA 1YUHB 5HHME 3NA4A 1QPXA 2R0LL 1T89C 3FKUS 1T80A 4RMSA 1XR8B 2MKLC 3FOMB 5EPMB 3IDJB 5DMGD 3M1BB 3DO3A 2CD0A 5ADOH 4WCYL 5D93B 5D6CB 1P7KA 3QZWA 1F90L 1P5UA 1IC5H 3D3VE 4OZFB 4PJDF 5BXFA 2GUOB 2N56A 1MCHA 4U1GB 3SPVA 2EKSB 1AKJB 4F7CA 3V5HB 1DLFH 2FIKA 5DYOB 4IOIA 2DDQH 3HUJB 1EFXA 1QBLL 4TULL 1NCDL 2QQLH 4XBPB 5FFLA 3U82B 1QP1A 1YEKL 1P2CA 4ODWB 5C07A 2KKQA 3TH4T 1MFCL 3LKQB 5L88H 4MSWB 5LG1A 1QBBA 3N85L 1JJUA 4LSUH 5ETUA 4OB5L 4QCIA 3E6HB 1X5JA 3NGBB 5HDOA 1IC4H 2VDRL 3S5LA 4X8JA 2Z93B 1ACYH 1MUJA 4HT1H 3EYFA 3QI9C 4LLMB 3ZKMC 5F6IB 3VFPA 4L8CB 2IALB 5EOQH 1AFVH 5D1XA 3AM8A 3MPCA 5TH2B 4RDQG 3JWDC 4X6BA 5SWQB 2IFFH 5DD1L 3HPJB 2ESVD 3D1MC 1YEDB 2PYFB 3QB7C 1ZT1A 2H2SD 1QD0A 1NCUA 4NKIL 7FABL 4POZC 2X4UB 1CDHA 4AIZA 3LN5B 5E9DD 4PJFB 5DDHA 3RUGF 1AGBB 1I7RA 5D8JH 3U9PH 5JLZA 2MKWA 5E00B 4E5XB 1F4XL 5C0CB 3IDUA 2HFFA 4FQHA 4ZO7A 3QUZB 4OZFH 2EDYA 4YLQT 2FJFA 3BWAB 2IAND 2NLJA 4JO3H 1FL3B 3O2DA 4ZUSB 1PG7H 4U1NA 2O26U 1KCSH 4J3SA 5T5FL 5I1EL 2VB5A 3LEYL 1NSNH 1GGTA 3B5TA 3HI1A 4PB0L 4B0MM 5FUZL 1WFOA 4QYOB 3RWDA 3IU4L 3CPLA 4NDMA 3DXAA 3GMQB 5CCKH 3V5DB 1JYNA 1U93A 1WTGT 3JWNC 2D0HA 1FZKB 5F7DB 1SBSH 1XZ0A 3HMWH 1A7BA 1QNZL 1I3VA 2VLKA 3AY4C 4P2OC 1CVSC 1BAFL 1JF6A 3IFNL 1PW3A 3QWOA 1UXWA 5E94B 1H3GA 3RU8L 1P7KB 3QZWB 4OCRL 2YK1L 1JNJA 5BXFB 5KVGL 2SEBA 1HSBA 3CFIC 4KTDL 4P23B 5C0DA 1BVLA 3SPVB 1I8MA 2NQCA 2OBGA 4F7CB 3VI3F 4OLVH 4IOIB 5ILTH 4RFNC 1EFXB 4PREA 4PLNC 2HKHL 1UZ6E 1OTUD 3UTSA 5FO9B 1QFUL 1P2CB 3TNMA 2QEJA 2DQTL 3E3QE 5IT2H 1DSFL 5EWIL 5JQ6H 2F54A 1BGXH 5ETUB 3GMNA 4L3ED 3NA9H 2WM0A 4QCIB 1UZ6F 2Y6SC 3N06B 3S5LB 5MP6L 2DKMA 4X8JB 3QFJE 4M1GH 1XGYL 4JANA 4POZD 1MUJB 1ORSA 1YMMD 4K07A 2FO1A 1H8NA 5H37H 3KPRD 3LH2H 3EYFB 3VFPB 2AK4D 4OZGA 4PD4J 5D1XB 4PG2A 3PHQA 4H8WH 5AWNH 1VESA 5I1LB 5BV7C 4X6BB 3QWQB 5MEOA 3R4DA 4HULB 3UJJH 1ZT1B 5F93C 4PJ9A 1OGAA 2ZG1A 2H6PA 3NIFE 4AIZB 3L7FA 3KR3L 3T2NL 1RK1A 5DDHB 1T5WA 1I7RB 2IQAA 4KRLB 5JLZB 2XTJB 4Y4HD 3MLVH 2HFFB 4FQHB 2EE2A 1TZGL 4C58B 1NCWH 3NIFF 1Z3GL 1YC8A 1CFSA 2W0KA 2XN9B 4X6DE 3WMSA 4HC1A 4R90L 3RWHA 1NAMA 1JZ8A 2X5PA 2Y06H 4Q9RL 12E8L 3MV7B 2BZDA 2FB4L 4I18A 5C0FA 4HIJA 1CGWA 1J8HA 4U1NB 5BQ7B 4XPHL 1MY5A 2ITDA 3MLSL 4P2OD 3LDBC 4FFYH 3HI1B 4X6DF 1DQQA 1C7SA 3MNVA 5I1IL 3RWDB 5D2NE 1DJSA 3CPLB 4NDMB 1A7NL 2Q76A 2OI9C 4Z77A 1U93B 1A0QH 2B5IC 5FXCH 1LD9B 4JPKL 4LMQE 1NGPL 4LP5A 4YXLL 32C2A 4G9FA 2VLKB 4OKVA 3ZZ1A 4NQEE 1B4JL 4AIXA 4MLSA 4WEMB 4TOYH 1ZVHA 2Q86A 3QAZB 3IJYA 1NCAH 3QWOB 2HLAA 1UXWB 2ZUWA 2J3SA 4ZUTB 3U4EA 4MAYA 1TJGL 3RY5A 1CCZA 1Q0XH 5LGKA 5HHOD 2SEBB 5CBAA 1HSBB 3T08A 1IM3A 5C0DB 1BVLB 1I8MB 4PP1D 2HVJA 1ZHKA 2Y6SD 2BRRH 2DQIH 1IEAA 3I6LE 2L0DA 4PREB 5IVXA 4KTEL 4NZTL 3UTSB 5IHUH 3TNMB 4KGJA 4N0CC 2VC2L 3O2DH 2AI0L 4R8WL 5HD8C 1A7QL 4HIIA 2F54B 5BOPA 1D5IL 1QFHA 3GMNB 3H3BC 3DX9A 1J7VR 4M7JH 1IILE 4UNTA 4LSRL 4Y5YA 4C56E 4NFBA 4JANB 1ORSB 1PG7X 1YQ2A 3FQTA 5L7XL 3TC9A 5KZCD 1KLGA 3PQYD 4UT7H 4F8QA 1MAMH 3ARUA 2WLZA 1IFHH 1QG3A 1NBZA 3EO1B 3ET9F 2MFNA 1MCOL 3G6DH 2ERJC 5MEOB 3K7UA 1RUQL 1C5BH 4J6RL 1OAYH 1C8PA 5HYJE 4PJ7A 4PJ9B 1OGAB 3QDGE 3JV0A 4FQCH 4XVSH 3BP4A 4Y5XA 3L7FB 4JE4B 1RK1B 4PRDA 1T5WB 2IQAB 4AEIL 3HC0A 4NKQB 3HMXL 4WWKD 5F3HA 1A7RL 5F70A 4U2ZA 1HXYA 1CFSB 1CXHA 4P9HH 3DMMC 3RRQA 3VGAC 2DIJA 1FNGA 3RWHB 1NAMB 4P5TB 1HZHL 4I18B 1IGFL 4FG6D 4HIJB 2EXWC 3D0VA 2VDKH 2ITDB 4LOUC 5DGQA 5I9QB 4OLZL 3KJ6H 1S5HA 4L4TB 5H2BA 1DQQB 3GRWH 3MNVB 1A6VL 1RURL 2Q76B 1U3YA 1FQ9C 2PO6A 3GBML 4YHYB 5D6DA 4XXDA 4YDIH 3TV3L 5T3XH 2FD6L 32C2B 4G9FB 1MFAH 5GS0D 4OKVB 1WUNT 1V7ML 4OFKA 5FYLD 1EJOL 3UTTD 1Q0YL 2BVTA 3T1FA 3IJYB 1A14H 1MCPL 3VGGA 1X5HA 2HLAB 4YGAB 4OCYH 4A2MA 3T04D 3U4EB 4LSPL 4MAYB 2VR4A 5EOTB 3OF6A 2IQ9H 5DWUH 5CBAB 2BVEA 4XVJH 3EYSL 2YPLE 1FYHB 3HFML 4WFGD 2HVJB 1ZHKB 1IEAB 2OK0H 1BFTA 5IVXB 2ADIA 4UIKL 1QSFE 2CRZA 3BKJH 4IRSD 1NUDA 1DUYA 4K7PL 2HAZA 3HNVL 4WUKH 5IESL 3DX9B 1G0XA 4PRID 5A43C 3ZDXE 4Y5YB 4WUUA 4WO4C 2VQTA 3FQTB 1KJ2L 4C54A 3CUPB 4OGYL 1QBMH 1RMFL 3ZDXF 1NBZB 1MCQA 5E2VH 3TVMA 1K6QH 4YQXL 3V6ZA 4WV1C 1EJ6A 3ZYIA 3N1QC 4PJ7B 1FFPA 3BP4B 4MZ2A 2OX5A 4Y5XB 4KHTL 4PRDB 3MJ9A 4JQVC 3PV7A 1HDMA 2GJ6E 2IMNA 3HC0B 4LOUD 4P2CG 3VU2A 3WUWB 1JPSH 5F3HB 1IAOA 3LS5L 5HHPA 4X6CA 1EHLH 4MXQD 1AGCA 1FNGB 5CUSL 1WJ3A 3NCEB 4B50A 4YXHH 1OARH 3L3KA 4HXAH 4M6OL 3D0VB 3MRNA 1DBKL 2MOVA 3NZ8B 5H2BB 1S5HB 1K85A 3ZDYE 3FN3A 4MJIA 4XB8A 2GITA 1Z5LA 2H2PC 3QT2A 4PG9A 2EO1A 1F4YH 2OTWA 3ZSSA 2PO6B 5TQ2H 3F8UB 2D7OA 4XXDB 3ZDYF 4JO4H 5FUCE 1W72L 2GJZA 5J7CC 1GH7A 5FK9B 4Z5RA 3DETD 3PWJB 3CFEA 4LVHB 3T1FB 5I75C 4DQOL 4HUXA 5IV2A 1G1YA 5DK3A 3WD5H 4DTGH 4O51A 1N4XL 3G6AA 3SDYL 4M6AA 2VR5A 1QFPA 3QO1B 2VXVH 2NY7L 5D7IE 2ORBH 4YJZL 3GBNL 3BFOA 1S7WA 1F45A 3B9AA 3BQUC 1I8KA 3MRGA 3IETA 3NCYS 1RU9L 1FLRH 5J3HC 4NQCE 4P9ML 3KPQA 4HLZH 1IC1A 2ADIB 4OI9A 2G60L 4OFYD 43C9A 5D7IF 1DUYB 1G9ML 3DRTA 2A0LD 3W5NA 1NC4A 5JOEA 2VDLH 2X89D 4FXGA 4U6HA 4NJ9H 5C6TL 3O2VH 4WUUB 3S6CA 3CVHL 3QEHA 1OM3H 1WZ1H 3X12A 2CGRL 4S1QL 3ZKQD 3IJSB 4URTB 1KBGL 2AABH 4WI3A 1XGRB 1IM9D