4PN6A

Structure of the cytomegalovirus-encoded m04 glycoprotein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
b'YRHPLGCYFKGINPTKVPSSGSHTILKCTLPVVKVNASWTLEWVVVKLQNSVDVTSYYESSPNSGPTFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M04
molecule tags Viral protein
source organism Muromegalovirus g4
publication title The Structure of the Cytomegalovirus-Encoded m04 Glycoprotein, a Prototypical Member of the m02 Family of Immunoevasins.
pubmed doi rcsb
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2900 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pn6A00
2MIZA 4PN6A
chains in the Genus database with same CATH superfamily
3KYOB 4J5VA 4XPBL 1KXVC 3U6RB 4M29A 1ITBB 1A4KB 1KXHA 3JWOC 5CLWA 4ZTPH 3FT3A 3BUBA 3TO2A 2RBLA 4I9WE 4LL1A 4P23A 2YPKB 3L7FA 4U1IB 3RDJA 1XHHA 4Y2LA 3NZHL 1P7HL 2G9HA 4M3JA 3UBHA 1I7ZA 1OP3H 1ZT7A 1OL0A 1XR9A 4B96A 3GJFK 4LGPB 3ZRCC 1ZA3B 2NY2C 3LZFL 5DMJB 1WSST 4U3HA 2AJUH 1J12A 1NUGA 5K9KB 3SYAA 2XIBA 3DTXA 3OXSB 4AX3A 5TE4L 2X2HA 1F8TL 5T8IA 3WIIH 5CLXA 3S8FB 3DVGA 5JORB 5EG6C 1D7BA 3ABZA 2DTMH 3HB3B 3QRGH 1NGWB 3TYGH 1KYDA 4HV8A 3PGCB 1N4XH 4PJGA 1J0YA 1HH6A 3KL3A 2YPVH 3H54A 1J5OL 3DSFL 4AV0A 5CSBA 1H8NA 4G8FB 5AAMC 4NN6C 4BHUI 2VDQB 3T2LA 4GAGL 3ZUNC 1E8WA 3VG0L 1Q1JL 1N19A 2J1ZA 5IK3B 3QUXD 2IMMA 2VLJA 4XNUL 2CIKA 1T1WA 3O8XB 5DZLA 2HKFH 5EC1B 3FN0L 1UD2A 3JYCA 3MLZL 4GMSL 2ZUQC 4XHQA 4MJ4A 5EB9A 3U1SL 1OVZA 1JWMA 3QFJA 1Q72H 4KXAA 5I0YA 3F6LA 2FHFA 3K8KA 5JUEL 1OTSD 1SLVA 4EAEA 3HC4H 3PE9A 2KUTA 2F1AA 2R0ZL 4XCNA 3HC2A 1OY3B 1GSKA 4MMXB 3DX2A 3KJ4C 4AGMA 1A8JH 3H2QA 3B9KC 3MRJA 1I53A 1E5AA 5E95B 4Z7WE 1AZUA 3APMA 3QPXL 2EUXA 5F6HJ 3K1DA 3FU0A 3M8OH 4E5XA 1BXUA 3NCJL 5JQHC 1FIGL 4WW2A 1LHZA 3GSNL 4Q2ZA 4UDTB 4J4PA 1RKRA 4ZFGL 3AREC 3WJMA 3TOPA 1NLDL 1QFWL 1FZJA 5AB0A 1CFNB 3D69B 4AKOA 1ZV5A 3NIGF 5HGAA 1T1ZA 2CDFA 2DV6A 5DT1L 2IAND 5FOJA 1AXSA 3QNXA 2VDRB 3HAEA 5AG9A 2IIJA 1EXHA 3QZMA 4F80A 5GSRA 2A9CA 1HXYB 4HWZA 1QRNA 2OSYA 1NCWL 5J3HD 3TNNA 5KS9A 5C0BD 1AHWC 4KNUA 4FNQA 1FVDB 1UATA 2Z31B 3B3BA 5CKGA 3WD5L 4OFYD 4R8WH 4W9DC 3MRMB 3FO0H 4LGSB 5T3XD 5IB3B 2W59A 2BZDA 2WBXA 2Y5EA 3V9CA 4DP0X 1XSIA 2CBTA 5EUKB 3IXAB 3VDCA 1AMXA 3MLSL 4D8OA 1Z6JT 3MOQA 4HCIA 2JMRA 2JQMA 4LVNC 4JKPL 2HRPH 4Q6IA 2PCFA 5F7FA 4L1LA 5BQ7B 2V3DA 5IESH 1I8LA 1UM4L 3HZMB 3LRSA 2IAMC 3SQBA 4A2HA 4HU8A 4M8QB 3QUML 4JRYA 4TKWA 3DPBA 3SJVD 1DL7H 1USZA 5CJOL 1PDKB 3L3OC 3TBTA 4PJCE 4BK5A 4QTIH 4CMHB 3EBIA 2QPSA 2O5YL 4Z0BH 3TBVB 3FCTB 4D0CB 3MRNB 1N8ZB 2CDEA 1DJZA 4GKSA 3PHOA 1WFUA 1KWKA 3ULSB 3WFZA 1DQKA 4KROB 1COBA 4WWID 3FFCA 2DS4A 4PJFF 4JGNA 4FE9A 4ELKB 4DUWA 5EC2A 1W8NA 1NCDH 1SOKA 1Y6NR 2HWZH 4G59C 5AD0A 1ICTA 1UJ3B 4WVRA 2BOBA 4ZFFA 1UOKA 4X9YA 3EOBA 1WFIA 4I89A 3FRUA 3D87B 4PJBE 3WXWL 4QNPF 1ZLWH 3EDKA 5CLZA 2JJWA 1FC1A 1CLYH 1HCVA 4N0YH 4PSRA 1L0XA 1XXDC 5ANME 5HI3D 1EGJA 2GABA 3LD8B 2WNWA 2WY3B 1OF2B 4EBQL 3ARDB 3B1UA 1DQLH 1ADQA 3LIUA 3VXSD 3SGEH 2EYSA 3DX7A 1R33A 5ICZB 2E27L 1PD0A 1PG7L 1U8HB 3R7QA 2JI1A 4B5ZA 3TX4A 3L3HA 1GKOA 1CDBA 5D7IB 4C4KT 1A6ZA 1VIWA 4IBYA 4Q8BA 4AL8L 3DECA 3OHXC 2J8UE 4RESB 4JM2D 1U8IA 3X14B 1DN0A 4URTB 3X13A 4EUPH 1CD1A 5IJKC 1X4XA 1VESA 2VE6B 1QTPA 5D7JB 3JT2A 2CNZA 2BMKA 2VKXA 4OJCA 3CX2A 15C8H 3C6LD 5FDWB 4AYEC 5ADPL 1BM3L 5IOPA 2QQKH 4NQDB 2GHWB 5FX3A 5HDBF 1T6BX 3D34A 4G7SB 1QQDA 1S3KL 2FD6H 3DXAE 5HI5D 3RBGA 1ZHLA 5ICZA 2EVIA 2IWEA 4N3TA 3QEUA 1JZ6A 3RTQB 2FATH 3KLAB 1HTYA 3RAJH 4GP4B 2PXYA 2OMTA 1U4EA 1TNMA 3O3AA 4F5CE 3HIZA 1KDIA 2V7HB 1S7SB 2OV0A 4DSYA 5KSAB 3CVHB 3QPQC 1MELA 3QUZA 4GB9A 1AG0A 4EQ3A 4QD2E 4HJGA 3QRGL 1DANT 1OGAB 3PWUB 4RIRB 3X1NA 5BPPA 4LSQL 4DKFH 4ETQA 4UQ9A 1DJIA 2ZKYA 5GGSY 4QO1B 1JDDA 2HVBA 2CHWA 2E7CA 2MNWA 3EO1A 1R3KB 3GPEA 3N91A 3NJLA 5DRXA 2ENYA 2APVA 3NACH 1I9IL 3LKPA 1MY7A 4M5ZH 5IMMB 4Q6YA 2PABA 5F2FA 1EZSA 1E65A 1MFEH 1MFBH 3CHQA 4P9ML 4P5KA 4U05A 4WHTA 3QWRA 2X5PA 4P5TC 1V54B 3E9TA 1PKOA 3LPPA 3D2UA 4N2OA 1SFDA 4J12A 3IRPX 4ZTPL 2X53A 4KY1H 4QYAA 4B9YA 3VXNA 2Y36H 4HXBH 4FKEA 3DV6A 1F3RB 1YN7A 2C3WA 5GRUL 3IYLW 1UTDA 1MW1A 4GG6B 1PKQA 4N6RB 3BPOC 4OQ1A 2UVEA 1Q9WB 1S6NA 4V1DB 1EHLH 1D9KD 5D1ZC 3ARPA 1WBZB 3BWUC 1W6LA 2DMHA 2FLMA 3PHQA 3IDUA 4WF7A 5HGBA 1A7OL 3OL2A 4ANVA 3B2XA 3L1OL 43C9B 5ITBL 2ED9A 3OZ9H 5JIKA 4BCZA 4ATWA 5AB2A 1YSOA 1QNIA 4UM8B 3H9SE 3QJFB 3LPGA 5FV2A 4ATTA 2IV8A 4R90H 3ULUF 2EH7H 12E8H 4MHHI 3KDMB 4UT7H 1DEEB 4W9ZA 5GRJL 2FIKA 2OZ4L 2RALA 1MAJA 3EYVB 4FQHA 2ZUQB 1A6WL 4I7ZC 3TH2T 3RWEB 4UT7L 4LVEA 3MBXL 5LCVH 4CC1A 4NBZB 1UGNA 2C9XA 4PG2C 5C7ZA 4LKXB 2QSQA 3T0XA 4ZAKA 1OT2A 4GUQA 3TA3C 4PG9B 2J4WL 4P2QA 4XHJC 2A6IB 2IAAC 1U33A 3L6FB 5GIRA 2ZJSL 4DP9X 2PXYD 2XZAL 5GJTL 4GKOA 4TUJA 4LHUA 5FAAA 1RQ5A 3MYJA 3UMTA 5E6IA 32C2B 2EEFA 2WTPA 4GG8A 4KI1A 3PAZA 2G30A 4PEEA 4EE2A 4HUUA 4UAHA 3C2AH 3MC0A 4NCDA 5IVXB 4KQ3H 3C5ZD 1E28B 5JYMA 1E6JL 3EYSL 5DWUH 1JGEA 2F54D 1MUJB 2VDPL 3RPBA 2OYKA 1OGAD 1AOZA 5J06A 1Q38A 1JFQH 2Y07H 3S34L 1EWHA 1MCFA 3B9EA 4M1CD 2NXYC 3HBZA 2NY0D 2ORBL 4NM4H 4N8CL 3KYNB 1FV1B 1KXTB 4NBYB 4F7KA 1QSFD 1DDHA 4ANXA 3C60D 2BNUB 5HYFA 4GRMA 2G5BA 1M7DA 3P77A 3L9BA 5E6RB 4JZOA 5IWLA 4GFXA 2F8XC 1KGCD 3HMXA 1KF9B 5KSBE 4JL1A 5DJZA 3NGBC 3V6OC 3HCVA 4WWKD 4G42B 1W0YT 4OJAA 4B7IA 3RE0A 4DN3H 2P7TB 2FSEA 3MU3A 3CXDL 1XGYL 3FQWB 3QIUD 4XCCL 3WSQL 1QPPA 4EIUA 2KZ1B 1KJ3H 2BY2A 1IL1A 5BS0B 4QI3A 3F8UB 3FU7A 2Y69B 1P2CA 3H7BB 2HRHA 2ITDA 2VXVL 1WISA 15C8L 5D2LA 3W0WA 2J88H 2HT3C 2E86A 2ICCA 4FQXA 3VTMA 1BZ7B 3P1VA 1Z2KA 2HTKD 2WXQA 4F8TA 2X2IA 4FYQA 2CPCA 2Y0SA 5F3FA 4GAAA 3NZUA 4QWWC 2C7UB 1L0PA 4P4KD 2R7EA 5EO1B 2APXA 4IM8A 1JZ4A 2HG0A 3QC6X 4DGWC 3BP7A 1DSYA 3HI5H 2Y6SD 5CUSH 3EJPA 1GL4B 1E9OB 4HD9A 1S9YA 1RSYA 3MGOB 4Q74A 4R3SA 4IOFD 4R84A 2BP0A 4HZLB 3GMOB 3FB7B 1VFOA 2BSED 3NZ8A 2XA3A 4MZ2A 5D2NE 1O9VA 3NJGA 3UABA 1PFOA 2YPKA 3L7FB 5ENWB 2BXYA 3I75A 5DHEA 2JIXD 2NY4B 2YAFA 5E2WH 5EEWA 1H6EA 1ZS2A 1MCWW 4LLUA 3CX5J 5AENA 5DJ8A 5KVGH 1DSFL 1FFPB 3E6HB 4CJ1A 4TVSa 5DWUL 3O11A 4WV1B 3MCG1 3NIFE 1FO0L 1FLRL 3LRSB 2CKBL 1BYPA 3U0WH 3GSVB 3BYTA 2Q87A 1LO0L 1UUSA 1QHPA 3W9EB 4N28A 2CO7A 3WN6A 1FJ1B 3RZCB 2P8MB 4ODUA 1RHFA 1CGSL 3DJSA 5I1IL 3BAYA 1SYVA 2A83A 2EC8A 4HS3B 4L2LA 3S8WA 3VDAA 3ARVA 5KG9B 2Y72A 3MHZA 3GRBA 5DYFA 1JXGA 5FHBH 1F5WA 3O6FD 4XMLH 4OI7A 1OD9A 4Z0BL 2BSEA 4H7VA 5EU5B 4JPIA 1FZKA 4ZMVA 3RNQB 1HE8A 3ARYA 3RIFF 4ZFQA 1LE9B 3EOAB 2EH8L 5F21B 4X6CE 2DQJL 4LLWA 1CFMA 3VXUA 3VI3B 1CZ8H 3GBEA 5DHVB 2VDKH 1SJEB 1JUFB 2XYBA 4BQBA 2DLIA 4LLDA 2WNXA 4DGYL 1BOGA 2HFFA 3ESVF 3VXSE 1OP5H 1MCEA 3KPSA 3FAWA 1DUZA 1AIFB 2EDQA 3ZE2B 5E8OB 4AEIL 2FHBA 2GJ6E 1IAKB 1A3ZA 4FQIL 1AY1H 4Y1SA 4NQEE 4YNYB 2XKSA 1L6XA 1AXTH 3I6LE 2OLDA 5FW8A 2XIIA 2ZOUA 1JV5A 3ZX1A 3X3GL 3AC0A 2X9WA 2K78A 4JKLA 5EZIH 1VZGA 3QG7H 4FNLL 3T6ZA 1A1NB 5GISL 4J3WA 3S98A 3D4CA 4JRWA 3PNWB 4YHYC 1SJXA 4K5OA 4OCYH 1TQCC 3Q2LA 3DOSA 3S6CA 1T0MB 3RKPA 3IDYB 2I9TA 3DMMA 4NAJA 2QSCL 2AK4B 3ARQA 1A6VH 4LPWA 4QAWA 3SE8H 3SYCA 4XCEB 4OGAD 3NCBB 3QYNA 2FE0A 1TZIB 4Q7DA 1FIGH 1KZYA 2HN7B 5I9QB 2CKNA 3LVEA 3UTQB 1W6WA 3WEXA 3LX9A 3R06A 3S5ZA 5IQNA 1GJWA 3QIWB 1MCPL 5EOTA 5KVDL 3SQOL 3RUGF 4ES8A 4NWUL 4ODVH 3QHFL 4BK5C 3UBXA 2JIXB 1NJ9A 1GIGL 4OUUA 3DX3A 4WY7H 5FFLA 5E6IB 2IH9A 2J55A 3AVEA 5HJDA 4L4VD 4MQXD 2BS8A 1AZBA 1YNLL 2IG2L 4K3JL 1HC1A 4M1GL 3B9AA 3ETBF 1NEZA 4I0PA 2OYPA 2EE9A 1MIML 2QADD 1HVXA 5I75C 5LN4A 2CZNA 3OAWA 2G9KA 3GKWH 4CDHA 4G6FD 3O6FA 1JZ3A 2CA3A 3IGKA 4GAGH 1XR9B 4C83B 1H3PH 5KZCD 4R96B 3UTQA 1DJXA 4L8DB 3OZKA 1U8MB 4XPTL 4ZW8A 4Z3TA 3PABB 3ATEA 4ELMB 3FQTB 5D6CB 4KRMB 3J2PA 1BD2B 3MLUH 5B7FA 4JM2F 5J5EA 1W0VB 4V1DE 5DUML 2R0WL 1NFIA 5HSFA 2GG1A 1GYVA 1G7LA 4TM9A 4NUMA 1MF2H 4L8BA 1H0DB 4GNKB 4MXVF 2QGBA 4ICWA 3L3JB 3N0PB 5E5MB 3B6SA 3EDDA 3TT1H 2MEJB 3PL6A 4NXKA 1WEJH 2WXIA 5I6XC 5KEZA 1R3HA 2DYPA 5AAWC 3GSWB 1WPCA 5L0QB 3FN3A 5AW7B 1KENH 5TE7H 3TS8A 4LSSH 2CUAA 3UJTH 3DX7B 1ZDSA 2OMZB 4L8DA 2OMVA 3RVTC 1XIWC 1G7HB 3L1GA 2J5WA 3O8XA 4FMKA 4EPSA 1O6VA 2CCWA 3RVXD 3CQFA 2FJGB 3KPLA 3ZDZF 4KRLB 5KS9E 2CK2A 1GHFL 1ZVNA 2YLKA 4JQIA 3CFBB 3ILPA 1XVSA 3LN9A 3BEWA 3CU1A 4L2YA 1SVBA 2PCPA 4L1TA 4OH2A 3WFEH 1J9SA 5JHDA 3F6IA 5I1KH 1WC7A 2D7TL 4QHNB 4QCIB 3T0EE 2FEEL 3F12B 2W9EL 1W8EA 2PTTB 5EO0A 3L3IB 3L5HA 2Z0BA 3ESNA 2FO4A 4GFTB 4DAGL 1Q0XH 1A14H 1XGQA 4RA3A 1JE6A 1K8IB 5EBWA 5LBSA 4G3YH 4GRLB 4AYFA 2PXYB 5JW5B 2JCCA 4QJ4B 1NBQA 1FNFA 5F88B 4NN5B 2AXGA 3C08L 4NRYB 1SBSH 4PV8B 5KSAA 3SDAD 5KOMC 5JLZA 5A2JH 4MSWA 4HSAC 4UV4H 4FEIA 4WI6A 1SJMA 4PHZA 3WDHA 3LS5L 4UT9A 3RWEA 3OKEB 3GMLA 3N40P 1IRAY 4BJLA 4Y9BA 1URIA 2X4UB 2H32H 4HBQA 4WWKA 3HHSA 4F1SA 3DYMA 4LKCA 4ALAH 2I5YL 4OF5A 1EGJL 3FRPA 1ASPA 4OM0L 2CR3A 4TNEA 3HS9A 5MERA 3OKKB 3LRLA 2HT4D 3IDMA 4Q6IC 4Y19D 3QI9A 3N06B 4OFPA 3U2SB 5JW4M 3QDGD 5KYWA 1HJBC 2GB2A 2DM2A 2LQRA 3QIBD 4DGIL 4C56E 4NKQB 4K7PH 4HEME 2AP2A 1J9TA 5FYJD 4C4BA 3TA4D 2HG5A 3QIWC 4GBXA 3O3DB 5ERWB 3RTQD 3QEQD 3F7QA 4F7MA 4M5ZL 4PCKA 5AW1B 5G4MA 1YEIH 1BJ1H 3W37A 1N10A 4FFYL 3PHQB 4DW2H 5J9PA 5C0BB 2OZ4A 3ROOA 1WHPA 5GS3A 5HI3C 2AQTA 3SJVA 4J8RB 1J8RA 4CSTA 1I8MA 1VJSA 3V6ZB 3VWKD 4Z7VA 3L3KA 5D5MA 1T04B 3OR6A 5DK2A 4PRHA 4I3RL 1E9PB 1QAWA 4I5BB 4UBDC 4NRXA 3HC0A 1WD9A 2ZXQA 2OMYA 3NA4A 3CG8A 1T20B 5DJYA 3WEOA 4KHXH 1YMHB 4FZEL 4KWUA 1L9SA 4FNRA 4YC2C 3KPPA 1PPIA 1XGPB 5I2IB 4NDMB 3CN4A 3QRBA 3ULVE 1UJ3A 4YPGA 5CD5C 2BS9A 4OJFL 1U93A 2IBZY 4POYA 1MWAL 4TNWK 2PWHA 5HHQA 3FB8A 4QXUL 4R26H 1XBRA 2GTZB 3DKHA 3SDYL 1KT2A 4N25A 4CVZB 1J0ZA 1QW8A 5D7IE 1ZTXL 2I7SA 4OAWA 1U8HA 1SLWA 1EHKB 3CDGA 4ELDA 1EJ6A 2J8UF 3COOA 1MIEL 4GQ9H 2EYSB 3ZMNA 2AFNA 5FC9A 5KSVB 2D7OA 4HPYL 5KJRH 1RUKL 4TULH 2YKLH 3A6BH 3MI6A 2PO6D 4YFLI 3VJ6B 1HL5A 4MDIB 2KL6A 2ITEA 5ELIA 4Z7UB 1RIVH 2BOCB 1WYJA 2OMNA 4J2XA 3EGXA 4RRPG 1H3VA 4XB7A 4MHHG 3GXUB 8FABA 4MASA 4S1DD 2ILLA 3UOAB 4FG4A 5A2KH 3LAFA 2UUDH 1S7QB 5DI8B 4PJ7B 1RZFH 3T0VA 1UB6B 2QQQA 4LGRB 2MCPH 1BDYA 4M7JL 4RMBA 5DQJB 3ZSTA 3ULVF 4X5XA 5EIIA 3F7VB 3PXJA 5FUOH 1FBIH 2V6HA 3X1EA 4NPKA 2G0LA 3DI3B 2JF1A 1LEGB 3O3AB 2C1PB 4CA4A 3IJ8A 4PRBB 3LH8A 3P11H 4AQZA 2DMCA 1HKFA 1JP5A 1NCNA 3SCMC 3KGTA 4X8JB 4AM0Q 4NOFA 3RY4A 5IMKB 4OCMC 4EF3A 4PY7A 1JWSA 1VGEL 1BA9A 1VSCA 5LNDA 3ARFB 4AK2A 4FLQA 3P9MA 3MLPA 3I3DA 5DUPH 5E8PB 1KCSL 5BOPA 4KFMA 3LHPH 2A1WL 2AXWA 4S11A 5I73B 1HWWA 1EHAA 3X3FH 1U41A 4A7GA 1E5UI 4HWBH 5HHPA 2DIJA 4HJJH 2QHLA 3TASA 1MCLA 4HMCA 1UACH 2UUDK 1QBBA 2WXPA 5AW5B 3QXAA 4XXCA 4EJ1C 3ZO0A 4C4UA 3W1ZA 3QORB 3T4AC 4WGVB 4QDGA 4U1MA 2BINA 5K9KA 2JXMA 3DTXB 3OXSA 4KDVA 4LSDA 4ZQKB 4F27A 4AZ8A 4B97A 1WV7T 4U1LB 2OQJA 1GXEA 3SDCD 1E4XI 1T0MA 3IMVA 1INEH 1G9MC 3QYCA 4KKAD 5A40E 4F37F 1BJMA 5I1IH 3VFOB 4G6KH 1H15A 1DQQB 2D7TH 2FWOB 3BH8B 4FMVA 3VW3L 1K4DA 2EE0A 3RGVC 3SIKA 1S7UA 1GC1H 1L3NA 4N0RA 1FYTA 1CDYA 3BD3A 2ZCLH 4L3FA 5LWYL 3B3IB 1Q90A 3LZRA 4KPHH 2FWLB 3TJEL 1HH9A 1X7QB 3AXHA 2B4CC 2X4SB 4JFSA 1QFWH 4AGPA 1UOWA 5ILTL 2J2ZA 2O61A 4JZJC 5E00A 4NPYA 5JTWA 4XXCC 1CGXA 3FH5A 4KK6D 3ZDXF 4YDKH 1P1VA 5AUMB 1RI8A 4XBEH 1YMMA 4PY8J 4HW6A 4O9HH 3SDAA 1IEHA 3P4NA 2IANB 3AMKA 3OLDA 4F8OA 5I76A 5FA3A 5L9DL 3N41B 5GGSA 5IJBC 3VXRD 2N0MA 4KUZH 3KEDA 5AWNL 1K5WA 5FS5A 1IGML 4HX1B 3BWAB 1BD2E 4YXKL 1J0IA 1E42A 5C0AD 2YC1A 4MNGA 2GK2A 1T7VA 5JPMB 2FVNA 3CTTA 5L2KB 3EJYC 1M1SA 1U0QA 4FX5A 3F04A 5I18H 1BVKA 3PWPB 5DQ9A 2JH2A 5B4MC 1NCIA 1OALA 4JFHD 2J1YA 1JPFB 4QXGH 3U7AA 4Z3GA 4I1RA 1QFOA 1OM3H 1CMOA 1HSBB 5SX4I 1FDLL 1YEEH 5F9WC 5DEGB 1MJUL 3HEIB 1MJUH 2HJKB 4D0BA 1TF4A 1T3FB 5GSRB 2VN5A 5FA3B 1MFVA 2XUWA 3TIDA 4RAUA 5BVPH 1IAIM 2VDQH 3BPCA 3S3BB 1WZMA 1EEYA 3EJCA 1Z9MA 4I3RH 2XXMB 2DDQH 1KNOB 1U8JA 3K6FA 2FNWA 2WVUA 1AH1A 2H47C 4OF0A 1JHLH 4KZCA 1IM9B 2O6CA 2QEJA 1R75A 3GSXA 3L4VA 3UJIL 5HP5A 4DGUA 4LP5A 5BO0D 1ET8A 1BLNA 4LO9A 5AKVA 2NTSP 4JEGB 4FG0A 4PJBB 3BH9B 5B7EA 2O5ZL 3L4UA 2APWA 4ZW6A 2Z7YA 3GSOA 3QORC 4IOSD 1A64A 2SEBA 3CN1A 3D9AH 4MB5A 4WUUD 2VLMD 3MRLB 4QHNA 4YDKL 4RMWA 5DR5L 4HQQH 4YDMA 5L2KD 1MREH 5SWZA 4CC4A 1T4WA 2EYTB 1A1MA 4EN3B 1NMAH 4MS6A 1TQBC 3CC5A 2XX1A 4NPJA 4MDJB 3PHOB 2EVFA 1M57B 3CLEL 3FU7B 3ZPDA 1LEKB 5IB4B 3QT2A 2OM5A 4JO3H 3UTOA 4H0GA 1KTKE 2R2HA 4Z7WB 2F8VA 4MDIA 4LBEB 3HNTH 4LASL 1J8HD 2QKSA 4X83A 1TDQA 4PGCB 2OL3L 5KSUB 4MD0B 2LLNA 4MSWB 4MLSA 3BSHA 2C4FT 5DLMH 4HUMB 2CUIA 1TOXA 3BAKA 4P5TB 4XX1G 5I16B 3F01A 4I77H 5DMIL 1WF5A 2IADB 1HHKA 3PUCA 1SBSL 3PGCA 3X1GA 4PJGB 5AVZB 4ZUUB 1KSRA 5FYJH 4DTGH 3KCWA 1WP6A 1KB5H 3V4VA 3B5GA 2VISB 3FRPB 4LOUC 1SN0A 4LXFA 4DVBA 3K91A 4OBSA 5CJOH 5I15L 4XNZC 2ZAHA 5HHME 3VQMA 4NQXB 3FOMA 3O0RH 1CK0L 3KPSE 2JB5H 4PLJD 2RD0A 3UBGA 5D6CA 3ZHKA 3DK2A 1KJ2A 2Z4QB 3C9NB 2XQYK 2ZSWA 2VLJD 2CU9A 2XHNA 3TWYA 4HS8H 2GTWA 4ZFOA 3W56A 3LQAL 1EMTL 3NJHA 1WO2A 3NPSB 3HMWH 2NCEA 3CMGA 3Q48A 3RWJB 4AQ8C 4QF1B 4L9DA 4FG2A 4GRWH 4JFUA 1VKXA 1QLRB 1BEYL 1N70A 4HH9B 1A3LH 4LDLB 4E41A 3OKYA 5AOMA 2NW3A 3BN9C 4YHPB 5CNHA 5DHYB 3Q8BA 4QRPD 3D12B 5B1CA 5PAZA 1WRFA 1BMWA 1UT9A 1E43A 1E5ZA 1ETA1 2IQAA 4NBXB 4X5PA 4YS4A 3FHAA 4MD5B 2WO4A 4XX1E 1UVQA 2X41A 4QRUB 5KBPA 3AXIA 2X4QB 4JAMB 2IGLA 2P48B 2H6UA 5C1MB 4MFHA 1ONQB 2FX9L 2H41A 3KLDA 5GS2D 4OLYH 3MVSA 1RCYA 4RFEA 3TV3H 4HZAA 1NDTA 2VJ0A 2Y2YA 3B56A 2NY3C 3NBNA 3LEXB 4A7TA 4ZBJA 2I25N 4BV1A 5IJDC 3GXPA 5TGBB 1OSEA 2GAZA 2VR8A 1OM9A 2CR6A 2MHAB 2AV1A 3DOIA 4BUQA 3WE1A 1AKJA 3M17A 3VXRE 2H2SD 4JFTA 1BIIB 4WHTB 1NFAA 5IHZB 3NN8A 1UVQB 4QRUA 3MNWA 3DI2B 1H3PL 4MJIE 2FATL 4X6EA 3MRHB 5LB1A 1DBKH 2H3NB 3P4OA 4M8RA 4XNYL 4AQAB 1JNLL 3WOVA 1AS7A 5HHXL 4L4TD 1A6UL 2I60H 4UF7C 1YEJL 1I3RB 2PETA 2YD6A 4U1GC 5D4QA 3QFJD 1Q9LA 3P2DA 4ZDHB 1VPOL 5C0EA 5IQMA 5CZKA 1A47A 1PFCA 4U4IA 4EO5A 1E67A 1I7ZB 3MRQB 3L1EA 1PZAA 1A7NL 3GHBL 2G2RB 1I7UA 3QDAA 4N2NA 4OFDA 5D7LB 3BSZA 4LRIC 3FUNA 5HI4C 3RPIB 4FA6A 5D4JA 2DKUA 4IBUA 4N2MA 2W81C 4MMYA 3EH4B 5TQ0L 4MJJA 1UA6H 1X6NA 2BVOA 4NHCL 2BP5M 1P6WA 4I18C 4Q9QL 5GGTA 3QJUB 1N2RA 3P73B 5F44A 3S3JA 2HZHA 4PJHB 3U30B 4CDGC 2L7JA 2EUVA 2ICWJ 4UINH 1JPEA 1NC4B 3R4RA 3SE8L 3WIHA 4APQA 1XSJA 4X80H 3V6BR 3ZHFA 1QLFB 3TA3D 3FTGB 4XTRD 2GJZA 2RQ8A 5H37H 5HBBA 4WHDA 4JJOA 4XP4H 5IV2A 2CE6A 4PJDE 3NDZE 4EOWH 5E4OA 2WM0A 3ZDZE 5LGKA 2VLJB 4PBXA 4NB7A 3UG4A 5I5MA 4R96A 3L3KB 5D5MB 2HWZL 1B4RA 3MLWL 4O5LH 2WO3B 1QSFB 1A6PA 3VFTB 4I18B 1MCKA 1PY4A 4FXGA 1SJHB 1QPXA 4PJ8A 4PJIE 5EU7C 3VB9A 4N8PA 4Z7WF 1OTUC 3QXUA 4Z0XB 2IDUA 4WKXA 2VQTA 2L4OA 2XKNB 3L5XL 4U4BA 1XCTB 4YBQD 5CILH 5EU7E 4N8UA 2GY5A 2IBBA 4NO5A 5CSGA 1FI8C 1P6AB 5G4OA 3MV8B 4ZMAT 4HLEA 1YYCA 5MEQB 1R3HB 2DYPB 5HVHB 2Y5TB 1UYWH 2YR3A 1CYWA 5IESL 1Z3RA 1G0YR 3B3IA 1AC0A 1WUNT 3AG4B 2OSWA 1KB5L 3GTNA 4YH6A 2L7EA 4ZMPA 1JK9A 6FABL 2ALWA 3WJLA 2DQTL 5D1ZB 4TQEH 2NMSA 2A74C 4UV7H 3B2DC 4IRJC 4OFVA 4Z7UA 4FXGB 4M5SA 4PJ8B 5DMIH 4MA3A 3IGAA 3GNML 2CLVB 2OCJA 4HOXA 2R4RH 3ZRSA 4EVNA 2WNGA 4HT1L 1CU4H 3REWA 2HTLC 1FUNA 2ZSVB 2ITCB 1LO0H 3DV4B 2BSSB 1QVOA 4IIZA 3EFDL 4L5FE 1KTLB 4O4YH 2ZUUA 1AVAA 3QQ4B 5A2AA 3S2CA 1CI3M 3ZE2F 4OZIE 4YE4L 1JTPA 1MHCA 4XN8A 3BVNB 2B4CH 3QZWA 5HYQA 3D39A 3QDJE 1C1EL 2HFEA 4PGEB 4I0KA 5T1LB 5BUAA 4LHQB 3OB0K 1IFRA 5FGCB 5J1AA 1HZHH 5FO9B 4UTBA 4P46A 1MH5B 2FYYB 5CJBA 2RJMA 1AE6H 1MREL 2X2UA 4PQXA 3BAWA 1OAQH 4N2DA 3PP4H 4OZIF 3D9AL 3RPKA 4JJ5A 3PF2A 1B9KA 2K9FB 3VRLE 5KSAD 2XZQH 4I88A 5F7MC 1QLEB 5FYLL 3WKMH 4K9EH 1NUNB 4ONGL 3LKQA 2VDKB 4H0IA 3SE9H 3BAJA 5CZRA 3HS8A 1ZHBB 2DQUH 4HWEH 4NZTH 3GMRA 2UY7B 1ZT1B 4F9PA 1JMZA 3O9WB 3RGVA 3NESA 1K9TA 4FYRA 1UKTA 3P3TA 2DQEH 3VYOA 4AJ0A 1L9QA 5L2JB 1QSED 4NZDA 1SEBB 3QG6A 1OSPH 4PS4L 5DD0L 1YJDL 4XOCA 1FPTL 1TETH 1AR1C 1B0RA 3EJZD 4GUPB 5BMFL 2BNQB 5GRWA 3SPGA 1MFNA 3SO5A 3QDMB 1YG9A 1ZANL 1LILA 2QT6A 4OIAA 1NBZA 4OLZL 4X7SH 3ZTNL 1DR9A 3ZYOA 1OAJA 2ZXGA 2J88L 1MH5A 1X3DA 3I74A 3L08A 4N2GA 4X5WB 3VI3E 4AEEA 4XNUH 1FORL 4U1MB 4I9WD 1FFOA 1PZ5A 1TO4A 1M2VB 5E5LA 1NBYB 1SMAA 4RAVA 3HI1B 4CC4C 2VYRE 1QSEE 3H6JA 2CDFB 4PJ6A 5I1JH 2K3HA 3VXRB 2OMXB 2XWTB 5H8DA 1QWUA 2VDOL 2F54B 3ECBA 4HOMA 4LNRB 3TBYA 5KVFH 3WTUA 2CHZA 4I1PA 3MPCA 2VAAB 1O75A 2WUBL 2GAZB 3QRFM 4K3EH 1SLXA 2V8LA 4MAUL 4LLMA 1KCLA 3EYOB 5IB4A 1LEKA 4YHLL 2X6MA 4NWUH 4P2OA 2P3YA 4F2MA 3THML 2V9TA 3CUPB 4WI9A 2HLFC 1MCRA 3QQ9C 1R0AH 4PIBA 3MRDB 5KBMA 1NGXB 5EUKA 4F92B 2XTSA 4H8WC 4BZYA 4O9HL 4MCZB 5ANMB 4WK2B 5FO8A 3AGWA 1IC4H 3BAEL 1DN0B 3X13B 5H94B 1T03H 4JPKL 3Q2CA 4BFOA 1GAFH 1XR8B 2ESVA 2QVTA 4XZUB 1NSNL 2XG4A 3HNSL 4FYSA 4JO2H 3DO7B 1KIQB 1HZHL 4QOKE 1AIFA 3BAXA 1Z9NA 2YXVA 1RK1A 2VITA 2FX7H 5F9JB 4UIMB 3SSGA 4JO5A 4FNLH 3WKQA 4HEMA 4FLOA 2VJXA 3MV9D 1WT5C 3BZDA 2DQIL 3C5ZC 2AK1L 5D7LA 3TTSA 3C09B 4Z3JA 4P2OB 1HOCB 4W68A 1K3ZA 3QORD 4JE4B 3V0WL 2AK4D 3WFBL 3EGXB 3W2DH 4F57L 1RJLA 3MLRH 3MRCB 2WWMD 2JKLA 3MV11 2IOOA 3NCFB 3W11C 3G08B 4KH9A 5DRWB 2YD8A 4WKZB 4QRRA 2R4SH 1PCSA 2FQFA 3KR3L 3IKKA 2OMBA 4A1RA 1PYWB 3DMMB 2CO3A 3ZTJH 2MNJB 1UM5L 4I2XA 1NFDB 2DBLH 3BT2H 1EZVY 3HG4A 4YHPA 2P8PA 4TLUA 3NAAH 4TSCH 3MJ9A 3UTSD 1JTOA 3KPNB 5TE6H 2D7MA 3SKJL 4OZHF 2VJ8A 1AJ7H 4I4WB 4ZMWA 2VLKD 3VGDA 1EBAA 5FKAA 1UXSA 4UQDA 3VFTA 4ZZFA 3LD8C 1C5CL 5CZXC 1BHGA 3SPHA 3K46A 1LXMA 4K0OA 4NOBA 3WO4B 2IXQB 2XSKA 4LPYA 2KMWA 2FB4L 2W94A 3NG5A 1KCRH 1IARB 4MJHA 4QRPE 4XX5A 1C12B 5HPOA 4PCYA 4R4BB 4APXA 1GMIA 4DFHA 3FYEB 1PL3A 2CKBH 3KVDD 4BM7A 3A4FA 4BSVA 1HH6B 4B9ZA 4F7EA 4KXCA 1OPGL 5E8PA 2NXYD 5SWZB 1DVZA 1L9RA 5DT1H 2H1LM 2DH3A 2AGJH 1FBIL 4OT1L 4QAMB 3UZVB 5JOFB 4PB9H 4PJ9B 5EA0L 2D31B 3HZVA 3KNBA 1MZYA 1G9NL 3M86A 3PQYB 4GQZA 1BQSA 4X80L 4PJ5A 1DLFH 1TVDA 2MOGA 3LQZA 4UOZA 2R2HB 3HPLA 3IGFA 1QBMH 2H3NA 1MWOA 1I1AC 2PLTA 1RPQA 2OR9H 4H4NA 4TL4A 2DL9A 1ZSHA 2F1EA 3KHQA 2RHEA 1WA1X 3HBQA 3QHTC 4I3SH 3MRGB 1BQKA 2ZYHA 4FQPA 3BVWA 1U8KA 2ZSVA 1MWAA 4ZAKB 4HJ1A 4ZDHA 5C0EB 2QV4A 1RD6A 2BPBA 1JNNH 1ACZA 5C0DA 1U8CA 1OP9A 1ZLDA 3QK0A 5TDNB 5C9JB 1M05B 1SUHA 3P69A 3F7PC 3VXPB 3DX9B 3M1OA 2ZWNA 3I2CL 4NENB 4WEEA 1FVEB 1XZWA 2OP4L 1T0NA 3FO9B 5FPIA 2X6CA 2GSIA 4EMZA 1EFXD 5ADPH 5H37G 2XJLA 5MEOB 4XXDA 1OOAA 1AGFA 3PLYA 1S9XB 4OM1H 2QZ5A 4Z6AT 3C8DA 4DO5A 1O9ZA 2VSDA 1R5WA 3MACH 2IC2A 1YN7B 2B14A 4TNGA 4DKEH 3EH5B 4GO9A 2HKHL 1P5UB 2VSCA 3GXNA 4ZUSB 1P6FA 5CHNA 4IKKA 4YN3A 3FKUS 3N04A 4Q97A 4PVMA 1RVFL 1WBZA 3BWAA 1G43A 2GIXA 4JRLA 5DHYA 2XETA 4RBPK 2XZZA 2AQSA 1PZSA 4KVNL 4I48A 2P46B 4YOKA 5C09D 5CJ5A 2XVBA 2PR4H 5F9AC 5EIIG 1E2WA 1UCBL 1M9SA 1A65A 4HC1L 2OK0L 1JDAA 3ZRFC 5DJ0A 1DQLL 3S36X 1CTMA 1F00I 4ZS7L 1JIBA 3FT4B 2C1OA 1IGTB 1N18A 2X9YA 2F7PA 2HKHH 3O41A 4G71B 4I85A 4K7FB 4ZXBB 2BWDA 5HJ3A 3RWDB 4D8PB 2JWYA 4PB9L 4RGOH 4G42A 5EA0H 1TTGA 3VFPA 5C8JA 2WYHA 4ZNEA 4QHMB 4XO9A 2BLFA 4Q4EA 1UH4A 4XN4A 5L88L 4NX0A 4PRHE 1MFDL 1UD5A 4IKIA 3FCTA 3GD1C 4GKZA 3BVDB 1ZMYA 4LU5L 5C0AB 2BSRB 4ZT1A 1KNOA 1U8JB 3GBNL 1S46A 5DEJA 4B50A 5CBEB 1BIIA 4MRCA 1GGBL 5I5JA 1JNNL 4DFIA 4FTVE 4JN1H 5BOZG 3FQRB 3WY1A 1DO5A 3MODH 1UC6A 3LXUX 2JB6B 4MA3B 2WGNB 4S1RL 1E6OH 4M48L 4MMZA 5ISZB 4LSUL 4AKQA 1S78C 3EOBB 3T3PE 1HKLH 5DJAB 4JFPB 5A7EA 1ZXKA 5IG7A 3R0NA 3OG4B 4UQIM 3GSOB 3UAFA 3GMPB 1A6WH 1U21A 1GYUA 4HZLA 4MGXA 4XNXL 5I8OL 2HRPL 2HPOA 4G3YL 3RY6A 1NGPL 4ESKA 3X1FA 1JYVA 5I8CA 2UXVA 4HALA 4WO4A 4UIMA 5JOPD 4PRIA 4ODXB 2MQ0A 3QI9C 2CO1A 4DZBB 4WEUD 3TBBA 2WK2A 1TZOA 5IZ7A 1I4FA 5DD1H 5EOCJ 2AGJL 3OR6B 5DK2B 1AQDA 4HKBB 4ZX4A 1F13A 1T5KA 4P3CL 1JRHH 4MWFB 2Y23A 5CO1A 5E8EA 4QHLB 1T21B 3MX0B 4PTUA 3BYYA 1X5JA 1CI5A 2XWBA 3NCYS 2X0UA 3OG6B 3QHZH 4KJPC 3ZDYB 2AS5M 3TFKC 4ELMF 1F1AA 4O2EA 3MCLH 2JKWA 3A4EA 3H6AA 2WZPA 4AJYV 2G3XA 4OD1H 5MENE 1J10A 4WUUE 5J13C 2WBJD 1PLBA 1HHJA 1WITA 3CSFA 2ENSA 4NNXB 4JKKA 3VWKC 2W60A 5DZAA 5D7JA 2DI8A 3GSQB 2A5UA 3AS0A 1QOKA 2AEQH 3TBWA 1X5GA 2R59A 1DBML 1W15A 1L9NA 1P4BH 4ZNCD 1ZSDB 3EJTA 5C6WH 1IC4L 4AYDC 5EEYA 5E1HB 3DUSB 2VLKA 5C0NC 1ET5A 1RV6X 2W0LA 4U1HA 4PJDB 1XB8A 4PRPA 4ZS6C 3VTAA 1E2ZA 4G9DA 1X5KA 4PV9B 2Q3XA 2XICA 4CVXB 2NY1B 4Z0XA 3ZR6A 1JD9A 5D5ME 1TJIH 3O6ML 4AEHL 4TPRL 1TJGH 5EN2B 4QF1A 2FO1A 4P2RD 3LHAA 2GTQA 2VAAA 1IEBB 3GBML 3UG5A 3ZZSA 3WFBH 5ITFA 4X6DA 5J0BA 2XY2A 5IHWA 2DB8A 5DFAA 3BH4A 3GXMA 3EG9B 4L1BA 1I9RH 4TV3A 1FE8H 1JZ7A 2GQHA 1M53A 1B4JL 2IOMA 1D9KC 3UP6A 4LL4A 2LFGA 4MZRA 2WVSA 4P5KB 4AQOA 1J5IA 4JFZH 4OLXH 4JFZL 4NYLB 4C4KO 5T33L 2AKRA 5D7JC 2M2DA 3K6IA 3V0VB 3AG2B 5D9SB 2NT0A 4ZMZA 2QR0B 2QQKL 2H3XC 3FB6A 1ONQA 3CDZA 3O81A 3I9IA 1EO8H 4AXWA 4QOKB 4ODSH 2ITFA 3IDJB 3OJMB 2MCMA 2IG2H 4J3SA 4NO3B 2AEIT 4WK4B 4XZUA 3ETTA 1INQA 3DGGB 3DPDA 1MRCL 2PO6B 4CNIB 1HI6A 1WDAA 4N8VB 2AV1B 3GK8H 5TE4H 5EV7A 3P3SA 1HWGB 2OZNA 3NPSC 4MJIB 3PV6A 4HCGA 5A16B 3BVNA 2X9ZA 3BGMA 4PCSA 1CR9H 3TEWA 3UEQA 5E9DD 4Z76A 2CMRH 4AIOA 3MJ9L 3LNDA 5TD4A 1IVTA 2PYEA 1KDJA 2AMGA 1UZGA 4L1DA 3FNKA 4WW1B 3RJDA 3G5YB 4WUKL 5IMOA 3SDDA 3MNDA 2VZOA 1NAKL 3I9GH 3NZHH 4L05A 2NSXA 3VGAB 2AC0A 3MZGB 1H9VA 4OCXL 3OSKA 4Z3EA 3U46A 3QI9B 2XWDA 4JFEB 3K8MA 2NT1A 1GGIH 5AOJA 3OR7B 4KX7A 1QFHA 3BO8B 3JZYA 3APCA 5AAMA 3FAXA 3WXWH 3ZYIA 2B4CL 4I0PC 4OZFG 4XRCA 1HZKA 4WI2A 4F7MB 4K94C 1QRNB 3BRDA 5LAXB 3EGDA 4MMXC 2AI0H 4FI8A 3GBMH 1LO4L 2CGYA 5CU9A 1SHSA 4JRXD 3DETC 2ALAA 5JR1L 4TNFA 5I0XA 1YUHA 1OWRM 1H3GA 2XIDA 5IM7A 2XG5A 3FO1B 2J1KA 3TPUB 3BUYB 1JVLA 2DLFL 4HWEL 1HAUA 1HQ4A 2B0SL 2ZCHH 2HJFA 4PTTB 3MLXL 2YHGA 3N55A 1BXAA 1DLHA 3C5XA 1P9MC 4ODBD 1CO1A 3L95B 1ILSA 3IN0A 1Z9SB 1SDAB 1MFAL 3MXWL 1UWGH 2B3RA 3AU1A 5CR8A 4HPOH 2A1WH 1ZA3A 1NGYB 3OAZK 4JZJA 1KELL 1TXKA 4P48A 3KJ4B 3ULSA 5L6YH 4IBVA 2G9HB 2VXUH 4ZQTA 2QGCA 2JI3A 5J13B 5DJ2A 3ZQ9A 1XF4B 4YR6A 5GRVL 3RU8L 5JW3L 1EAQA 4RFNC 2DQHH 1IM3A 1ADQH 3HA0A 4YL9A 4BFFA 1SJHA 3CQQA 3ELQA 4H44C 1FYTE 3MLYH 1MFCL 2HTKC 3Q8FA 4HIXH 4HT1H 4X7CC 5E1GA 2F15A 4LPTA 4JFDA 1F4YL 3GMNB 3B9DA 4H5SB 3SGDH 4HHAB 4KDWA 5EORL 4PLJC 4WI7A 1ZHNA 1XR8A 2ESVB 3L4YA 3B43A 2Z4TA 5DD1L 2EKJA 3MRPB 2CLRB 2WZ6A 3L95A 2KLRA 5I66A 2NY3D 2KERA 2YGVA 5I1HH 5D1XD 2Z31D 5DFVD 4HGMA 1OCWL 5DVLA 5I82A 4F3FB 1XGZA 1F4HA 4HHGA 4LCYA 3KYKH 5E9NA 3GSNH 2QHRH 4PJAE 1TJHH 4YHYB 3NCJH 4KY2A 3O0LA 1U2YA 4OLWL 2ZONA 4ZUWB 3BHBB 1I1YA 1WHOA 3R0MA 3V0DA 3BDYL 4M56A 4L8CB 4HISA 2ITCA 3ORJA 5ACMA 3IFNH 4BFJA 1D6VH 1EAPA 3IPEA 3WJLC 1RP9A 1XL4A 4X6FA 4ZAKC 1OAZL 2ATKA 3ARTA 3IDIB 4IQHA 4WEMB 1DVTA 5DC2A 3RBSA 4Z5RA 3GBNH 5B1KA 4IDJL 1KV3A 3B5HA 4L3CB 3VCLB 4CL7A 5JHBA 4CGTA 1NUDA 4XT1C 4IYKA 1BVLA 2NR6A 1T66C 1G1KA 3RWFB 1XGYH 4FI6A 4EOWL 5B38G 1MHEB 3OPZH 4OJFH 3WEAA 4FA7B 2C1OB 4ZYKA 2VH5L 3QZPA 4BEIA 2P43B 1FFTB 3N0AA 4F2EA 1R3JA 3EDFA 1MVUA 1NCBH 5FOBA 3SY0B 1VZIA 3HB3C 2XC8A 4HJGB 4ERSL 3O9WA 3RGVB 9CGTA 3Q43A 2K8MA 4H8VA 3B2MA 2WXFA 4E68A 4AGQA 3Q8EA 1QR4A 1I3VA 1X5YA 3CFMA 2YZ1A 3CPLB 4UWQB 4LEXH 3N40F 4YAQA 2W9LA 1U92A 1KCVL 3C5ZB 2IAMD 3MUUA 3G6JB 3MCKB 2ZCKH 3SDXB 4DIXA 2R39A 4U6HA 5FW7A 4J6RL 4PJ9A 3GLZA 1P84K 2Z91A 2O26U 3MA7B 2OFQA 2GJJA 4WFED 4WW2F 4XC3H 4CU8A 5I19H 4XXWA 4HAGA 3MR9A 1AO7E 1QHOA 1IC5H 1MCOH 3DSNB 4NIYE 4ZMYA 1FF5A 2CALA 5FF6B 1KPUA 4KXZH 4OGXH 4WGWB 5T3XE 4YL4A 4H8WL 3BZFA 3V6OA 1E30A 3MUHL 4QXVA 1EV2E 2IBGA 3EBGA 3QUYC 4JM0A 4KTDH 5AB9A 5KSVA 5CP3A 3MJGX 4DP1X 2JJSA 3NABL 4XTRC 3WUWB 1GS7A 2A6DA 5E8EB 3ETBJ 3T9WA 4AIXA 1ZLSL 3S96A 3UYRL 2G4GA 4F8NA 3HAEH 1SVZA 1T0NB 1R3IL 3SDDD 2J72A 5LCVL 1FZOB 5JNYB 4Y2OA 4UNIA 4Q4IA 2IWKA 5BQDA 1I1AD 1CT8B 1NMBH 1U3NA 5CCHE 1DE4B 1X4ZA 5CN2A 5IMLB 4PJ7A 3IFLH 5PCYA 1PD6A 3CBKB 1A2YB 1KPUB 5AZUA 2DBLL 3BT2L 5KVMC 1J0KA 1OWWA 3KVPA 5EU3A 3AQYA 4RGMB 1FFRA 2HVJB 2OL3B 3BRGC 4M1DH 3Q1EA 4X6CA 1AZCA 3J27A 2AHIA 4XODA 1DQJA 3B9KD 4K7PY 5EORH 2NNFA 1J88A 5J6HB 2KPNA 1AHWB 1NAMB 3VRIA 2UZPA 5B39B 3QRLA 1SQ2N 2GYSA 2MPVA 1A66A 3FT2B 3JQOB 3NOIA 4UZSA 4L5FL 5D7IA 2XG5B 1I8AA 3FO1A 4KRNA 2PMZA 3BZ4A 5JNYA 4Y4KC 1CXHA 3IJYA 3PAVA 2ZWSA 4J3VA 4GRWB 2HX7A 3LQAH 1U93B 3G5ZB 3HG1E 3UPRB 5DS8A 3BVUA 4HAKA 2QVMA 1WFJA 2WINA 1WS8A 5C8JB 4KKNA 1O5PA 1MFAH 5IW3A 3WEBA 5CZVL 2EO9A 2DQFB 1KN2L 3HMXH 3O6FB 3UC2A 3JSSA 4KTEH 2XQ0A 2OMWA 3MN8A 3QXAB 3FDWA 1MFBL 1MFEL 3PWLA 4A6YH 2QTVA 4NN7C 3U4EA 3EHBC 5G4NA 1H8LA 4NQQA 4YXHL 1GW0A 4MB1A 4KI5D 1N5AB 1HN1A 2ENQA 4NKIL 3ZKND 2HMIC 2IFGA 3OXRB 1Q9OA 4Y4KD 2B1HL 3JXAA 2E4FA 2BOCA 4MAUH 1J1PL 3C6SA 3VFGL 1HYRC 1ZGLB 2P80D 1JHTB 4WRLA 3P02A 2AI0L 2BIOA 2OXHA 3STLA 3PDOB 4WJ5B 3QFDA 1BAGA 4R6UA 3LJ3A 4G8EB 2EVJA 1EZVX 1T7XA 1DVQA 2NY4D 1R3KA 3T8VA 2DQCL 2GCYB 3VI4F 1S3KH 2ZICA 3BCDA 3FFOA 3T08A 4BRJA 4Y4HC 3PQYA 1M1XA 2Q20A 1PU0A 3U9UA 2IJ0C 4JO2L 4MJID 4DVBB 5L4JA 4DN4H 4BGLA 2J7LA 3HN8A 1K5NA 2XA8L 4OLZH 1BQLH 1U6AH 2WXRA 1YNLH 4JY5H 4K3JH 2IPTL 4L4TB 1U9KA 2C34A 3FU8A 3MBWB 5DQDH 2PWFA 4WUKH 3PWJB 4GYBA 1IFHL 3UZQA 1BF2A 1UENA 1F2QA 2ZUXA 1A5FL 1G9EA 1MCWM 1JWSB 2R56L 2IDTA 1MJJB 2PCPB 5IR1B 2NDFA 2RGSA 3GIZH 3O45A 3P4MB 3TH4T 3LS4H 2H8PB 1NDMA 1Q9KA 2ICEA 4S1SL 4FJZA 1B3IA 1HYSC 3QJFA 4GUCA 4JPQA 2APTA 4WNJA 2WWNA 2NX5B 1EHNA 4F2FA 5EBMB 1NIEA 5JPNA 3NIFF 4JKMA 4ZO7A 2W0FA 5FUCC 2F68X 5ILTH 1AGFB 2JCCB 1FVEA 3FO9A 4K5LA 4PJDA 4UB0L 1CFTA 4CBPA 3VD4A 1D5IL 4X7EC 4ZYKB 4AZ8B 5HYJA 4KGLA 3Q05A 1KXTA 1K6QL 5ECGA 4AJVA 4EXPX 4L3EB 2HLFD 3CPUA 2ZXDA 3WUZA 1GGYA 3HZKB 4Z95L 2YAMA 3GXTA 5D70L 3VFRB 3GINA 3AACA 1YA5A 4LSPH 4CADB 2BNQE 2H1PH 1AY1L 4MVBC 4K73A 4LSVL 1RURL 5J89A 5KVDE 1SYSA 1TEFA 3A0OA 4PS4H 1H5BC 2ICWA 4IU2B 5DD0H 3AY4A 4X4ME 3ZIYA 5GS0L 5TK2A 5E8NB 1QFUL 5TFSL 3AADB 3HS0B 3Q13A 5JPNB 1E4JA 5CIPB 3VYNA 3IM1A 4EZMA 2CGZA 4JRYE 2CH8A 2MOVA 2CRYA 3OJ2C 32C2A 4LAJH 4F58H 2XZCH 3B9VA 1U8LA 2DD8H 2WLLA 5EBLA 5FYLH 1JGUL 2QR0A 2XRAH 4NXSA 3WKML 1CZ8L 4A6YL 1XH0A 4ZMLA 3MTXA 1KTRL 3ZBMA 5IB1B 2FHCA 2D03L 3UZEC 4W9GC 4PIRF 4AGNA 1PG7W 1YMMB 4OY9A 5IF0B 3ILEA 4IKJA 3N44F 3VXMD 3L5XH 3OMNB 4QRSB 5FHBL 3D25B 3ZHDA 2W38A 5I66B 3LRHA 3MJ8B 1MKFA 5MI0B 4LPVA 5F8QC 3O4OC 1X4YA 4MCMA 3O3EA 3RIAF 3ZTNH 4N6QA 5CF3A 3MRMA 2ETWA 4WNQB 1CD0A 3BFQG 4ACTA 1A7QL 3KYNA 4GI8A 1FV1A 4E36A 3WNPA 1UFGA 1K72A 3IMTA 4WW1A 4FQ1H 5HDQL 5GGVL 4U6YA 2A6KB 4W93A 2NY7L 3QNZA 3BP5B 3MRFB 1H6UA 3P11L 4P5TD 3RFRA 3SY6A 3RA7H 4NN5C 1JRHL 3Q9PA 3NTCL 1JCVA 1EIBA 1NDGB 2Q76B 2E56A 2P7TA 2J6EA 4FADA 5I1DA 5L8KB 1U2HA 3X12A 2FWSA 3ML9A 1A2YA 4L37A 1MXDA 1YQ2A 2WQUA 4GW5B 4RGNB 4UTCA 4JG1H 5ADOH 2HVKA 4N87A 4PBDA 4WO4D 5K9QG 3MBEC 2X40A 3P2TA 4UYPA 5I8CB 4FNTA 2N0KA 1T0PB 1VAHA 5HTSA 2R15A 1J5HA 4X0KA 4ENED 2I7OA 4G1EB 1J8HB 4C56A 2XTJB 1NUFA 2QV2A 5CU5A 2LT9A 4Z78A 4IRZH 2GK0A 4MXVE 1E7VA 5EEUA 2YGQA 4OW6A 4XVJL 4PTUB 4J3XA 2KLSA 3ZXAC 3FUHA 5I71B 2CHNA 3LSOB 3MUZ1 2YN3A 2WANA 5JQIB 3N1GC 4CMMA 1AI1L 4KXBA 4WI8A 5E6ZA 3NJVA 3T1FB 1ZTXH 4MNHB 5LCVA 2AQNA 4LLVB 3ZDXB 1GW6A 4Q58C 2OJZL 2QZQA 1YNKL 2VITB 5BNXD 3P30H 5L4MA 4MLIA 1UWXK 4FQQB 4LFHD 4TLSA 5C09B 4HG4K 1CE6B 3BIAX 1RFDL 3E80A 4O02H 1F02I 1RUQL 3FU9A 5I6LA 1M3IA 2WCPA 4WWKC 3B8YA 4Q89A 4ZD3L 1HL9A 4N22A 1HDMB 4M8VA 2BWIA 4WAFA 4DT2A 4TOYH 4S2SA 3PP3K 5E8OA 3MFFB 1A6ZB 4ZX5A 2BW4A 3G08A 4QRRB 5C0AE 2ED8A 4RQQA 4TQHA 3NCXA 2VSKB 1SXCA 3NH7L 1CBVL 3AB0B 5DF0A 2P8MA 4D9LL 3IVKB 3KBPA 4I8DA 2K4AA 3TT3L 3GMNA 4H5SA 3WCYA 4BKLB 2ED6A 1Q8MA 3RUGE 3STLB 2WTRA 5K69A 3DROB 4HJUA 3NIFB 5DO2D 1WH0A 1HU8A 4LLQA 4HIQA 1AGEB 1ZVSA 4OZHA 5FKPB 5KJRL 1UCTA 3Q3GA 4XO4A 2JTYA 4JPIB 4KAQL 1X9LA 1NCCH 1FGNL 4U1GB 2D4DA 3VYPA 4AVHA 1XF1A 3SKOB 1AZVA 2WSDA 1ML0A 3LIZL 5LG6A 3LNEA 1U36A 3H3KA 4QOKA 1P5VB 3H2WA 2JXMB 3C2AL 3CK0H 3L8QA 4GRMB 1OAUH 1TYEB 2WBKA 2OTWA 1IQWL 2WUCL 4HJ0D 5I17B 2YMXH 2AQPA 3JVFC 5FK9B 2IFFL 1QX1A 1P7BA 4OFKA 5F8RC 2GITB 3PP3H 1J87A 2OR7A 1W72H 3PQYD 4ADJA 1E8YA 2YJQA 3HRZB 1ETZA 1VLXA 2KKQA 5HGDB 1O7DC 1BQHB 1BWWA 1ZTMA 1F6FB 4LAQL 3JTBA 5CD3A 4BCXA 3QUZC 3MZTA 1L9TA 3V52L 3L3DA 1AQKL 3N2JA 3WN5A 3HG1A 2UYLB 3K2UH 5I23A 3IXAA 1MAML 3MV01 3GKZA 2IWFA 2ID5A 4MCNA 1A7RL 4XAWH 4HXAL 4F8LA 2VABA 1MI5B 3OHMB 1ZRUA 3U7WL 4FQJL 4LESA 4IBTA 5E03A 2P49B 3ZR5A 4E9TA 1XB6A 3WYRA 2UZYA 2F2HA 2Y25A 4P5MA 3RA7L 5DLML 3FU3A 5B1AB 1FNSH 3Q6GL 4J28A 1O0VA 3C5ZA 5DJXA 4LCIL 1ORSB 1YY8A 3RKDC 3ATFA 3ZYJA 2FR4B 5IHHA 4YDIL 5DD6A 3HKFA 1A3LL 5E8NA 3QIWA 4GBXC 3HS0A 2FH6A 3P9LA 1T4KB 2EADA 1HQ4B 4PTTA 1N9PA 2DIAA 3WLBA 4ALAC 5BZWA 1S7RA 1DFBL 3E6HA 3O4LA 2OMZA 3BIKA 4MAYA 1G0DA 2OMVB 4JHZA 3FRUB 1DN2A 2VLLB 1D9KB 3NA9L 5F7UA 4YSRA 2RB8A 2IMNA 1OP3K 4PGDA 1L0QA 4QRQA 3F6JA 4C83A 1QI3A 4ZUTA 4BK4A 1BWMA 1YEWA 4JMNA 2O6PA 1S8DB 3MRKB 3BN9D 4FRWA 1YN6B 4QJ3B 1MRFH 4N0UE 3BGFB 1VDGA 1CICD 4P49A 3M45A 3LB6C 4KK6C 1CGVA 4YUEL 5CINH 2XKUA 4OF7A 1T1YB 3QUMA 5IFAH 4B9FA 3AREB 4OD3L 2XN9A 4YHOH 5HJ3B 3ATDA 5BZWB 1IFGA 1V55B 4WFFE 1ZHNB 3APFA 2BSSA 3PJSA 1KCUH 3NRPA 3MRJB 2OAAA 4M7LH 4OIIH 4GXFA 1YRKA 3GKWL 5F88A 4XPAL 3QH3B 3QP3A 1R5VA 2DAVA 2EYTA 2ENJA 2EUWA 4B95C 1MQKL 2NXZD 4OCXH 3O6LH 5AVVB 5EUOF 2DY2A 3WGVB 1MCSA 3U2JA 4AWJC 2P47B 4UT9L 4G1EA 4M6MH 5IGXH 4GSUA 1CG9A 4MJ5A 2UZXB 3ZE2E 3P3RA 4DEPB 1IX2A 4Y2NA 1OLZA 2O6EA 1CR9L 4F33A 4OZIB 1A0QH 3ZGHA 2XN0A 1AXSB 3RP1A 2AQ3A 4NSKB 5BV7L 2HRLA 1Y1UA 2YWYA 3CFBA 3ILPB 4P2YA 4LSTL 2XKNA 2Q9OA 4M02A 5DA4A 1LJMA 2IDFA 4NQVB 1QR1B 1CBVH 4RMQA 1PG7H 2EJ1A 3FQWA 2HT3D 3VI3F 3EFFA 4UIKH 2N1KA 4X6DF 5KWYC 5IBUB 3FTSA 3EBHA 4TOYL 1N6VA 4P3DB 4JLRB 1D2OA 2WV3A 2VN4A 4B0MB 4DZ8B 3A67H 4RAHA 3BJLA 3WTWA 3MNMA 1JSYA 4N86A 5IJCC 3WU1A 4XBPA 5J8OA 4PVBA 3ARGD 4MXWH 4P07A 4J3OH 3GLDA 4F1ZA 1KCUL 4BFIA 1D3CA 3LV3A 4M7ZB 5IQ9A 1GYCA 3U83A 3K6SA 4UQEA 5EO9B 3QIBB 3QQDA 1WGVA 5HYIA 4HIJA 3US0A 4QRFA 4BZ1L 5AOIA 5HHMB 4OUOA 4B6ZA 3MRNA 1E9QA 4RLDA 1IV8A 4J6IA 3KPPB 3KPMB 1A21A 4GH7B 1WAAF 4UTAH 5AZEH 1U92B 1N5YH 1MDAA 1RZIA 4FZ8L 5FKPA 43CAB 2KDGA 3CZNA 3VXUE 4M43L 4RWHA 5AYQA 4BH8B 4XN5A 5KYUB 4N2KA 3RWGA 1JMXA 1R1CA 2VDML 1VHPA 4OCNC 5F3BB 3KLHD 3ZOAA 2VN7A 1YECH 2Y6SC 3AW5A 4P2RB 3FSVA 3T0AA 3GEFA 2ZF9A 5EIQA 4Z3HA 4K9EC 3VACA 3VVWA 4JJ5B 1FFQA 3MLSH 2W1NA 1P69B 4H26A 4P05A 4GMTL 4Y7MA 4FMFA 1W72A 1KCSH 4OCYL 3WY3A 3UTTD 3EOYG 3SHSA 4PUBH 5C92A 3VRJA 5CJXC 3SJVB 1FO0B 1KJ2L 2H7WA 2V7HA 4BXVA 1JGLL 3TEYA 2Z9TA 1K4CA 4P9HH 1X7TA 5FECB 3FONB 2DYPD 3KHOA 5IHZA 1OB1A 2HLAA 4N2BA 3TIEA 4L0ZA 2HSIA 2BM3A 3UTZA 5HD8D 3D3VD 2A2QT 3U7WH 4GSDH 2WBJB 3F5WA 4WTQA 5KVGL 3PRZA 4OGYL 3T77B 4UQCA 2ZOOA 2ADFH 1U58A 3T0EA 2YZ8A 3IWVA 2EXWC 3U4BL 1XIWA 1JZ8A 2HFFB 1ZLVK 1IEAA 2OL3A 3IRZA 1OGSA 5FDWA 3MROB 4NUGL 1FSKB 5SV4A 1HKLL 3II3A 2EDMA 4LAQH 2N7BA 2UWEE 4YLBA 3DHPA 1LL1A 5KYYB 2GC4C 4HKZA 3VDBA 4Y1AE 3LNHA 2AXFB 2WJ5A 3IU3A 1MPAH 2NNAA 2VTFA 3K2KA 2X87A 3G5YA 3UTSA 1OB1B 2HLAB 4RDBA 3TIEB 2V2TB 1NQBA 2Q3ZA 1F0LA 3G9VA 3QUZB 2BVOB 4N4YB 2H1PL 2DMKA 2WLLB 8CGTA 1ED3A 1NC4D 4PBVC 4DUXA 4M62H 5JW5A 4MCZA 1ULVA 5ANMA 3RDTB 4JHUA 2FL5A 2G75B 3MLZH 4GMSH 3ZE0B 5L88H 4APXB 4BKLA 1HHIB 2XNAA 2WTRB 3PXHA 4XP6L 5GSVB 5EN3A 1AP2B 3SQBB 5FM4A 5DSCB 4QY8A 3MBEA 1DEEA 2FSEB 1AFVL 4DQOL 5F9JA 1ES0B 1TYRA 1GZPB 2WKOF 1J5OH 1CD9B 1N3NA 1TPXC 2X2JA 2Q7NA 4LHJB 1N5AA 2F53A 2XFXB 3I85A 4J4PC 4GKSB 5IKCA 1NM4A 4ZO6A 3O4LD 1F3DJ 1U3YA 4YE0A 1ODAA 1LO2H 3WIIL 3H7LA 1AZRA 1T80A 1LDPH 1XXFC 2OTWB 1N7ML 4DW2L 3R4DA 3EYFB 2HX9A 2VUYA 4N6RA 5CBAB 2RFXA 2PF6A 1A7NH 2WN2A 1A5FH 4N8CH 3A6BL 3LZFH 4I2XB 2CO6A 2QADB 4D9RE 3H3PH 3AQZA 1YQVL 1QZ1A 5FV1L 4X7DC 3VG9B 2PYFB 5E1AB 1F58L 5JHLL 3C2SA 4QHKI 1I85A 1KACB 1DYZA 1JNHB 2NX5D 5E7BA 4DF9A 5DHXB 3CFDA 5JHDD 3VB8A 4XPBH 5TJWK 4W4OA 3P4NB 1V3LA 1JZIA 1ZIAA 2Y3AA 4HUNB 4MB3A 4TVPH 1J8HA 2YSSA 3PY9A 2EINB 2K70A 1SXNA 1U95B 3LKNB 4PLOB 3EJJX 1P4LA 3U48A 5DD3H 2ZKWA 1KB5A 1KIRB 4HCFA 4NQED 4PJFA 1F11A 2HH0H 4DN3L 2XDHA 1VCBC 4BELD 4ZW5A 5F6IC 3CSTA 4YHKH 4XBGB 1RIHL 5EZOL 5SX4H 3ZO9A 1KBGH 1DBJH 4XVJH 3SQRA 3K0WA 4GP8B 3AXLA 5AW0B 3QXDB 4ABWA 1IBZA 4BFRA 5C0ND 2A6IA 4GINA 3S3DB 3WXVH 5IVZB 2I07A 4BUGA 2XPGA 2NX5A 3OLEA 3OKNA 5AW3B 2VL5A 3V4VL 1ZVHA 1TFHA 3VH8A 1GA2A 4MD4B 1EO7A 2EEDA 2BNRD 4WW2B 5JPNC 3E3QC 4YHNB 2HUEA 4DH2A 1OTUD 2QPDB 4G80A 3IKCB 5D1QD 2CHDA 1G6VK 4LEOA 3C5JA 4NUJA 3BKML 3HUJF 5E00B 4LF3B 2Q8AL 5GS0C 5CZVH 1XSKA 3VTTA 3FB6B 4TXVB 1F11B 5IW6A 2JI2A 4R97B 3HFML 3S4SB 3LXBA 1DFBH 1X5ZA 3NFNA 3EBAA 4X9FA 2YUWA 1WCQA 3HLKA 5IIEA 1B2YA 3LPOA 8FABB 1HE7A 5GGVH 3GRWA 4G83A 1F4WL 1FFNA 3F3HA 5I73C 3W5MA 4P9HL 4OM0H 1PY9A 1J9RA 1SXSA 3HAEG 4DEUA 1OT1A 2HRGA 4PM1A 3I6LD 2R2EA 1YPZE 5DRXB 4IRJB 2XZAH 5E6YA 1KC5H 1X7SA 3D09A 3LZQA 4AIZA 3ZGIA 4W9CC 3EGSB 3JV4A 4PJHE 1C16B 4KY1L 4XVUD 5E99H 3EYQC 1IKNA 3VFNA 1A1MB 4EN3A 1KBKA 3U4KA 5MEOA 4HXAH 2VZVA 1P0SE 1A7RH 1W16A 5D2NC 4WJG3 3S2AA 4P2QE 3QJVB 1HSBA 2M8XA 1CN4A 3IFLL 2UXTA 5DYOA 2HJKA 2ZCHL 2V8MA 3NSCA 2IPUK 3IRCA 2CG9X 2Q3AA 1IL1B 2LGNA 3GMLB 4NC0B 1N5YL 1VB9A 5CCJA 3KR3H 3P9MB 3DO4A 4PRID 4J3OC 4LSQH 4DKFL 4PY8I 4A7GF 3ZT6A 1MW2A 1LO4H 3L1OH 4G72B 3UYOD 4MB4A 4YFLF 1BQ5A 5EOTB 1BFVL 1F6AB 1RIHH 5EZOH 2EIZA 1EJOL 1LWRA 5AYUL 2IFFH 2CDGB 4OZIA 5A6MA 2B7DT 4OTXL 1PZ3A 3MUGA 4JO1L 4X7TB 4PJAB 1OANA 3UG3A 3GRWH 4N85A 4QTFA 2GSGA 2Y36L 3DIDA 3ABLB 5BRPA 4IJ3B 4A37A 3EKCA 1KLFB 4MA8L 5I1GH 1IBGH 2OS7A 1CJYA 4G7RB 3ARDA 2J8HA 1KENL 1NAKH 3I9GL 4NFBA 3A23A 4L3ED 5KYNA 4Y5XA 3CHOA 4P4KB 4F15C 2GK0B 1BAWA 1Z5LB 4EQ2A 1GOGA 1F1GA 3K1KC 1HH9B 1OLLA 4WTZA 4JCWA 4LEXL 3M07A 4LBEA 5J12C 3SDAC 5B3JF 4TTDC 3NH7H 4N2IA 1W8OA 1VA9A 5C71A 2WLNA 2GT9A 3WKYA 4XO8A 3ZTDC 5KVFL 1IM3D 2TAAA 4ZPTB 3DIFA 3ARDC 1KJMA 5AUMA 3KCPB 1E28A 1EDHA 4MQ7B 1JZDC 4UQ3A 5DMGC 1FZMB 2IGFH 2F9BT 4N20A 3TO2B 3J8F7 1A7BA 1X9UA 1RY7B 5DHMC 5LGHL 2EIKB 2VRAA 2B1AL 3MRRA 4NC1C 3ULUH 3FT0A 1AHWA 5B39A 3DJRA 3QEUB 1MIMH 4F3FA 3RB7A 5D55A 3N50A 2YQGA 4NQXA 1CYGA 5JA9A 2Z65C 2YEVB 3T6XA 1FC2D 3FF8A 3LKSA 4L48A 3F7RA 3HRPA 2F1BA 1E27A 4M9PA 3RL1B 4BDVA 5F9OL 4HETA 3HBGA 3DRTB 4GOSA 3TCLA 3SN6N 1U3JA 1OAZH 2NOYA 1GY2A 1J1PH 2W0PA 4BIKA 1IE4A 4E9VA 4GY4A 4PRAB 1J8KA 2WKGA 5DI8A 5DS8B 1EAPB 3DIFB 3ET9F 4NZTL 1IBYA 1TO5A 1IBFA 2F53E 4DGYH 3RWIA 5I1CL 3PV6B 1WWBX 2NY1C 2ROYA 3N85L 1K4CB 4MD5A 5T1KB 4Z5RB 1U3HC 1JF1B 2Z35B 4NZRL 4WV1C 3Q6FA 2DMBA 2VDLL 3WY4A 5LNGA 5IK3A 3OD3A 3PP4L 3TPKA 1EEYB 4BYHA 3WNOA 1Z3GH 2C1PA 2ZYRA 1F97A 1X44A 2K6WA 3OKOA 2FECL 4NQCA 4NWTH 3SKMB 2A9NH 5T3ZL 4JPWL 3VXSA 1XTMA 3PNWA 4PJBF 1G84A 2R51A 4JCLA 3RIKA 4LHUG 4TLTA 4GSDL 2JTDA 4PRPB 5SWZE 5GISH 3IXTA 1QUNA 2LU5A 3DRTA 4PJXE 4YE4H 2VDRL 1XGTB 2R8SL 4QKTA 2LVEA 4KFZC 4BQ8A 1VADB 4QTHA 5FYLD 4O4YL 2NY7H 4HD5A 1A4CA 1CFQA 2J5LB 3EHBD 1DZ0A 1CU4L 2DQHL 1FNHA 1S5HB 1BQHA 2R69A 5B22A 1FNSL 3GBDA 1M71B 3Q6GH 1KJ2H 3TVMD 3X1BA 1U2CA 3FQXB 3PJNA 4TSBL 2YD1A 3VRLF 5ISZD 1IAII 3G5XB 3PWVB 3IAQA 5AVQB 1TEYA 2VLME 1L7TH 3NN8B 4QRPA 4Z7VF 3V0AC 5E2WL 3V5DB 4EI0A 2WWOA 3FT3B 3PDDA 1ROWA 2NX5E 3DHJA 2WXOA 2FO8A 3HN3A 5MENB 5I30H 2YIHA 2M1KA 4MA1C 4PSPA 2OQJB 3CWGA 1Q0YH 3U2SA 4AXWB 1NMBL 2FZ3A 3VWJD 4YJZL 2GJ6A 4O2CB 4QJ5B 2G3MA 1R17A 2DYSB 4PMFA 1TQBB 4S1RH 4FZ8H 4KGJA 1XZ0A 2OX5B 4CBZA 1S7UB 3GB7A 4H1LA 2TSAA 3NABH 1ES0A 5BRZB 3RVVD 1S3RA 3ARGB 1KBGL 1G9MH 2ZCZA 3AROA 5FWRA 1SYVB 1GGBH 4WWOA 3NIGE 1EPFA 2GI0A 4JVUA 3P9LB 1I8MB 4NZJA 4UT6A 1ACCA 3RWGB 3BQUC 1E9PA 1OT4A 1KB9K 5GS1C 3SDDB 1D5MB 3QEHA 4NHUA 4Z95H 2FX8L 3DVNA 3VMPA 3FN0H 2XQYG 1D5XB 5C08D 3NDYE 5F1IA 4M5YH 1A1OB 1T1WB 1IVLA 4X98B 1AD0B 4RRPA 2BRQA 5GXBB 4R4FL 2AXHA 3DGCR 4FG6D 3VA2C 1P4IL 3FTUA 4JO8A 4HFWB 3IGAB 4J6RH 4P46C 4D94A 1RJZB 4LT7A 2F19L 4I1NB 2D7PA 3GXIA 4FGMA 4OKVA 3ARGA 4I9XA 1JPSL 3TC9A 4WK0B 3WI9A 4GSRA 2MNUA 4ONHB 1IAOA 4KZDH 4IOIB 5FUZH 1XMWA 3SPJA 4BH7A 4MBOA 2BJMH 2H5UA 3FUFA 4B3EA 5JHAA 2XN9B 2IDQA 4K3DL 3GLAA 1NCHA 5C08A 1RVFH 3INUL 5EOQL 2MFNA 4U6XA 1T1YA 5AALA 1P7QA 2G0KA 3LNFA 3GHPA 1LWHA 4R7VA 5D1QA 2ARWA 4XE0A 4TVPD 4H2AA 3SYQA 2YA2A 3C6LB 2ATKB 3D52A 4F8QA 2WWMC 1IIKA 4ZTOL 3MMEB 2WPGA 3UPRA 5I9QC 4WI4A 3WJMB 2I9TB 4H1LG 4RAUB 4IGBA 5BW7C 5EF1A 3BPCB 2KI6A 5IREA 1M9WA 3B2VL 5D7LD 5TGBA 3UXFA 5GZOC 4XNYH 5IBLD 3NIDE 3L5WB 4LVNB 2DH2A 3ARDD 2FLRT 3ROLA 1AQDB 1RU9H 2V9UA 2PWEA 5TPWL 3GTTA 3KH4A 4O58L 1CGYA 2G60H 3UBXB 3AS3A 5DEFA 1WAAE 2F74B 3ISYA 1JI1A 3S4SA 3GEWB 2W92A 2EDKA 4RBPH 5KSAC 4TPRH 4AUUA 2O30A 1D7CA 1DJGA 3QDGB 4M4RB 1T1XB 1QA9A 2MTPA 4NRXB 4FF9A 1RUAL 5GSVA 5FFOA 1BEXA 1KB3A 2H26B 3ZDYE 2H1XA 1JCKA 3GSRB 1NGQH 1G9NH 4OR1A 2QSVA 4R90L 2NY6C 4IMKC 3JV4B 1XT5A 2J3SA 1ZPUA 2HJLA 4OLEA 2XFXA 5HDBB 2IAMA 1KTDA 3QJQB 2MCAA 2OKMA 5FGCE 2O6DA 1CDUA 3RUGA 3RI5K 2VDNH 1CIDA 3ZKMC 3KLSA 1BF8A 4BFIB 4HIXL 3DTDA 1E27B 3RL1A 5K93A 4Z7UF 3JV6B 3FK3A 2Y7QB 1JK8A 3PU7A 3GXDA 3BZFB 5D1XB 5DYOB 1FJ1A 4KQ4H 2BWQA 2BO0A 1EANA 3JTSB 4FL4B 5E4EC 3T65B 5C0JA 5AD0B 2J20A 2ODIA 1XX9C 3CLWA 4HULB 2WHVA 1WZLA 4HXBL 4KDTA 1QEWB 2J4WH 5HPMA 2Z64C 2NY6B 5CM1A 2ZPKL 1RZGB 2WJ7A 4KZ0A 4OGZA 5E0FA 4XGZB 4RFNB 2ZOLB 4YIQB 3BP4A 4JFXA 3P0YL 2JKRM 1PZ5B 4NP9A 3W5NA 1F42A 3C60C 3HPLB 2DD8L 1WAPA 5J7CC 2OZ4H 1YVLA 3FUJA 3S4SG 4HVBA 2ZT9C 3MYZA 1CFTB 1BZ9A 1IJ9A 2BSTA 4YHIA 2NLJB 4ZK8A 3FB8B 3OHXA 5CLTA 1AGDA 2W65A 4BUHA 2PUQT 1FO0A 4Y4FD 3GBLA 2W9EH 3SODB 4L0YA 4XP9L 1FVCA 4LLQB 4F2ME 5FA4A 4M8UA 4FS0A 4JHWL 4KXDA 4QCIA 3F12A 4YHKL 3QCUL 2DQIH 5HJGA 1IC0A 3ARFA 5L2KA 1S2EA 3VXPA 3B8SA 5F3HB 1RIUH 3E6FA 3HLAA 4X7FC 2HT2D 5C07D 1CF1A 3FH7A 3BP4B 5IFHH 3KPQA 4ODTL 4MZ3A 5LNEA 1ZIBA 4K3GA 1LO3L 4OZGA 3VWKA 3LRKA 3A67L 2IANE 3V0GA 2H2PC 5FLUA 5A43C 5H35A 2WIMA 4UTAA 3SPIA 1UXSB 3RY5A 2NUPA 2ZZUT 2BCMA 4YFDB 1PIFA 4WGKA 4XC3L 2WLYA 1QRND 4U31A 5CHNB 2XG4B 2W9DH 1JPTL 3CVHL 1UZ6F 4KHTL 3T2QA 1BQRA 1K8DB 3CZUB 1GCFA 2EKSB 4A2LA 3FZUD 2Z8WC 1R0AL 4ZOAA 2AXFA 5BV7H 3I50L 3F64A 3GIZL 5F1OB 5CWSB 3P40A 2R56H 3L3GB 3ZDXE 1GTFA 4XBMA 4Q14A 1JHLL 2WD0A 4GRWE 4XNMA 3HG1B 4WUUB 2DF3A 4WI0A 5AZ2H 5GGUA 4U3SA 4AM0A 2F5BH 4XN7A 2JKNA 3BUYA 3POCA 2C7FA 5GS0D 1V3JA 2C3GA 3LB6D 1IGFH 4MX7A 4N0YL 9PCYA 4Y19E 5I8KL 5DZNA 1CTNA 1BZQK 2PO6C 4L18A 1T5XB 4X4XB 4AIEA 4LFHG 1RZJC 4J23A 2ZOKA 3HW7A 1OM3L 3R8BB 3VX1A 4D3CH 2NY4C 3KPNA 4RMVA 5C0AA 1G7MB 2ZKHL 5FHAH 2YAPA 4U7SA 4Z8FH 1XQ4A 4JFYA 2AXJA 2N7SA 3DUUA 4UI2A 3QJZA 3VFGH 1F90L 4J3OG 4J3OF 3L45A 2BSCA 3DNKA 4PP1D 3HPJB 5JMOC 1G9ML 3GSNA 3UTPE 1MRFL 2PNDA 3D07A 4MNQA 4PWHA 4R0LB 2G5RA 1OTTC 3MUJA 4E0RB 1NCUA 1OB0A 3TESA 1KBWA 4MA1B 5CEZD 3RKDD 1D5ZA 3QYMA 3ATAA 2ENPA 2J57A 4LCWB 4F7CA 5DMKA 4KO9A 5IB2B 1NEUA 3H0TB 1UM4H 3CFKA 3GS0A 1P4BL 4WFGD 3TVMC 2X3AA 3W81A 1WVZA 2XVGA 4JO4H 2DJSA 1L9PA 4ZMOA 1RSFA 4FKHA 2IH3B 2ERJC 1ACXA 1CLYL 3GI9L 1BZ7A 3O2DH 1LQSR 4HKBA 3VXOA 3HZVB 3FOMB 3LPWA 3ROLB 2ESVE 2OSLA 3U1QA 1U91A 2WYTA 1ZLUH 3B9KA 3QG7L 2COQA 4OD1L 3MOBH 3WS3A 4XBGA 3QQ9D 2FQGA 3QR0A 4LQ1A 2E6QA 1KB5B 1UOVA 2VCOA 3PCYA 4LHUB 3PQYE 4MNQB 2I32A 1YPZF 2VERA 2A73A 3OKDB 4GW4A 5CGBA 5T1DL 1WJ3A 4AMWA 4M93B 1B3JA 3RWJA 5GGQH 4PVLA 2P5WE 4AOFA 2VDRH 5K1JA 3FCBA 4WDIB 3GNMH 2DJ4A 1KEML 1JZFA 4TQEL 4PGBA 1IAIH 1R5VB 3CFKB 3O2DL 1PY0A 1NLDH 3BKCL 3C6EA 3GTVA 4P5SA 4Y16B 2CJUL 5C0DB 5EUOA 4XMKH 3DXAB 4EIBA 4C54A 2E7LA 2DMGA 5F7AA 4CMHC 6PAZA 4JPVL 4E41D 1E4WH 1QHQA 2WQVA 5DD5L 1S7XB 4G80B 5TE6L 3N5AA 5TF1H 1U30A 1WIOA 4XI5D 2WOYA 4KKQA 5IVXE 1JRHI 1QTYT 3X3FL 2B0SH 3E2HB 1JAEA 1XCQB 2YEQA 1KIPA 4AC2A 2LTQB 3K3QA 2PCYA 1U8IB 3MODL 3FO0L 3X14A 3U9WA 2XJKA 3ZDWA 5E94B 1XF5B 4YBLB 3WD5H 1MHCB 1BW8A 5FM8A 4LSVH 3ZZLA 1NDMB 3OX8B 5EMYA 3T2PA 3RB5A 2OMUA 3LN5B 4LPXA 4LU5H 1JF1A 2Z35A 2RH0A 4HFUH 3Q2VA 3T3PF 2ATPA 2KH2B 4R7LA 3BUPA 3B7SA 3ZQXA 1I1RA 4QRRD 4J1UB 1NAMH 1T5WA 2Y1VA 4IKLA 4ZO8A 3TLRA 1S7XA 2A7BA 3VG0H 3CXFA 4LLWB 1FZJB 4K8RH 5BV7B 3ALPA 3F85A 4H88H 1VFMA 1Y6MR 2SEBB 4LLDB 4OB5H 3RVUD 2XXFA 4FI7A 2AJXH 2UY7A 7FABL 1R4XA 5JOPE 3ERXA 1EXUA 3QR2A 1E9QB 3TYGL 4OCRL 4W9FC 3EAKA 5ALCH 4WFHE 5JIDA 1GOFA 3U0PB 4RCAA 2V3FA 4FTVA 3RHWK 4Y8DC 4ENZA 3QPXH 3WV0A 3LS4L 3H3BC 1XEUA 1N64H 4UNUA 2A0LD 3CSBA 2CBPA 2H6PA 3I50H 3IFPA 4L4VB 1J9QA 3VD3A 2X4RA 4ERSH 3DX6A 2WLKA 3DYPA 4LEEA 2FJFB 5LQBH 1MRCH 4E5XG 2XCMC 2Q8BL 5ISZA 2EO1A 4M6ML 4PGCA 5ID0B 1A3QA 1HZLA 2I24N 4MKTA 2JB6A 4OFYA 2YRLA 3U46B 4BFGA 1Q72L 3FCUB 1MCBA 3G04A 4DN4L 1DQDH 3DPBB 1KLFA 3SDYH 1FAKT 5D71H 1N6QL 2EDNA 1BZEA 3L17A 5B4MD 2G4EA 2PPCA 3MRGA 5L2KE 4Y4KB 3I6KA 2QGDA 2VLRD 1CWVA 3MA9L 4FTDA 3UTTA 4YX2H 5JDSB 2YPVL 3A6OA 4IMLB 4UOW0 4JFFD 3MX0A 2I27N 3DJTA 5EC2B 2F7OA 4QPEA 4FG6C 1EFXB 4XP9H 1KGUA 1UA7A 5AOZA 3UPAA 5BXFB 3BOVA 3ESPA 4B9JA 3OBAA 4KK5D 4HUKB 4MJ6A 4PYGA 3S5YA 1R9FA 1G7PB 5FM5M 1BF5A 5ICYA 2N56A 3CFUA 4XXDB 1E4KC 1Z9OA 4HH8A 3MNWB 1XCTA 1G6RL 1KN4L 3D05A 1KJMB 1SHMA 5I1HL 3HVNA 1GGTA 3BPOB 4X4XA 4KTEL 5F72S 5JXAL 5DGQA 4HYTB 4NNPH 1NM9A 2LLLA 5F97E 5CCKH 4WHYH 3M1BA 5I0VA 1FG9C 1QSFE 3HZ3A 4M7LT 3WNNA 4LMQI 1KIUA 3TIDB 3QZNA 3SPVA 4KKPA 4KQ3L 1XMEB 1DUZB 4C56B 3VGHA 3PABA 5JQ6H 3T3MB 2LAAA 1YY9C 4G2AA 4PWGA 5E2JA 4LSRL 2DTSA 3CHRA 2IPKA 2VZ3A 1FAIL 1FAIH 4X42A 1DTUA 2VQ4A 2BSTB 2X3CA 3EFDH 2J6WA 4LSRH 4Y5YA 4R97C 2VXUL 4XCNB 3QZLA 2ARJQ 2P28B 3AY4C 4HPOL 2PP8A 2QQLL 3VO0A 4PJ5E 2P80A 4GIOA 4UV7L 4JMXA 2WKOA 4DPAX 4ISVA 4NUQA 3R1GL 6FABH 4PH8A 3M1BB 3AWGA 4JFWA 2EDBA 4E2OA 2EDTA 1E4XH 1SRDA 4WU7A 4JRXA 3AT0A 2I26N 1A22B 2ARJA 4WIQA 2NNRA 3AQXA 4PFEA 3KPQB 4QRTA 4DTGL 4ILDA 5CIPH