4PN6A

Structure of the cytomegalovirus-encoded m04 glycoprotein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
YRHPLGCYFKGINPTKVPSSGSHTILKCTLPVVKVNASWTLEWVVVKLQNSVDVTSYYESSPNSGPTFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords M04
publication title The Structure of the Cytomegalovirus-Encoded m04 Glycoprotein, a Prototypical Member of the m02 Family of Immunoevasins.
pubmed doi rcsb
source organism Muromegalovirus g4
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2900 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pn6A00
2MIZA 4PN6A
chains in the Genus database with same CATH superfamily
1HXMA 2VAAA 1RLWA 2G2RA 43C9B 1MG3C 4KXAA 4CSSA 4PCKA 3I9IA 4MAUL 3IE9A 1NC2A 1XGYL 4I1NB 2OMUB 1VB9A 3AWGA 4HIIB 5DRZB 2JQAA 4NQTA 4OD2A 5EV7A 3ULVH 3KPQB 5MENB 3BH9A 1HHHA 4ZOEA 3OMNB 1OQXA 4HMDA 1F6AB 1GL4B 3N9GH 3V8OA 1HZLA 3J2PA 2CBQA 4QRRE 4BFBD 5JORA 2OJEB 4QGTA 4EKJA 4MQXC 3HG0A 3VXQB 1J86A 5KG9A 1P69B 3BSHA 1QLRA 1TQUA 4JPIB 3MQIA 3HUJF 2Q76B 3MOBH 1VFMA 1M71A 5IMKA 5E2JA 3VYOA 4RAUA 3LX9A 1KXTB 4X6FA 4I87A 1ZT1A 4N22A 3E1F1 4X98B 2D3LA 1DVYA 3HNSL 5IVOA 3BVXA 3NBNA 4PRIA 3UP1A 2G60H 4KI5C 1D9KD 3UPRB 4XMWA 3TA3B 1ZWIB 4DZ8B 3S9DB 4BQ9A 1WBZB 1X5YA 4XMKL 2JK5B 3MV8B 1EHLH 1U3HB 4UCFA 1ET7A 5E2UH 1DVFA 1U2CA 3FKUS 1G7LA 4U1KA 5LHDA 3II1A 1JF5A 1RUML 3OZ9L 4IDJH 4KJYA 3MYZA 3L3DB 1KV3A 3KJ4C 1NMBH 4JFFD 3HBGA 4LARH 1LMIA 3B7YA 4F15B 2JI2A 4RIRB 4HW6A 4PTUB 4HT1H 1A9BA 4PJEE 5FHBL 4CW1B 3GO1L 1CI3M 4N5ED 1D5ZA 4XMUA 1TDQA 5CF3A 2KL6A 3P4OA 3Q2LA 3JWDL 1YEDB 3IKKA 4UIMB 3W11D 2IANB 5DJ8A 2HG5B 1W8NA 4JFDE 3SKNB 3ATFA 2GHZA 3DDFA 4X4KA 2AXGB 1YO4A 4AYSA 2WLKA 4YWGH 2P49B 1VACB 4LVHB 5C6PB 2NXZB 1HHIA 2AEPH 3FRUB 4J6IA 1QYGH 3KXFE 4LCCB 2P8PA 5AVRB 4C4KT 1HOCA 2ROXA 5F3BA 3B4NA 2VLMD 5F7WC 4AXWB 2TRHA 4TUKH 4MXWH 1QASA 5KYNA 4E41A 5EO0B 4FCAA 3ML9A 3LEYL 1DLFL 2FNBA 4HBCH 2Y06L 4BFOA 1P5UA 4EIGB 2XLLA 4HP5A 5DLML 1QKZH 4PLNC 4JFTA 5T1JA 4FG4A 1UD3A 5IQ7L 3DX0A 4UTCA 3FZUD 5C0ND 4YNYA 2VC2B 2HH0L 1WFMA 3J8F7 4R4BA 1TEYA 3OX8B 1MCDA 4KHTH 4KRPB 1AY1H 3WNPA 4Q8BA 2Y7LA 4NRYB 1QSFE 2WUBL 4M03A 3GDBA 3IJHB 3VRLF 1AGFA 3KYOB 1WZKA 1JN6A 2OS7A 2E4FA 3FH7A 1I8IA 3E3QE 4MA8L 3ZE0F 2YD7A 5C0BD 2ZE0A 3TBSB 3TYFB 2ORBL 3WU1A 3DRQB 1QSED 1K6QL 1L9TA 4JLRB 1ZGLP 4NUGL 3G5WA 1CQKA 3D25A 3UTTE 3JZYA 1IC5L 3T6WA 2X6VA 4FXKA 1HWGB 3CVHA 1LE9B 4Z7UB 2VXTL 2EDBA 3FUNA 3F7VA 3VXRA 4KROC 3JTTB 1OGPA 1RLBA 2VDML 3QEUB 5I9QB 4TLSA 3QQ9C 1WTLA 4JO8A 1KEGL 5BVPH 3CLFL 3HS0A 1U30A 2J72A 3E80A 4OFVA 3D69A 3QUXA 5E9DB 5HYEA 3K71B 3F12A 3QJHA 3TEYA 5HDOA 2OX5A 1RZIB 1INQA 2H3NA 1R5WB 2XTJB 4JFFA 1C8QA 3G5VB 4AYBA 1P6FA 2QZQA 4AEIL 4TUJA 5FOBA 1UD2A 4HS3B 2H0FA 5FYJU 1ZVSA 2A99A 2NZIA 3SO3C 5D71H 5I30H 5DTFA 5DJCB 1PX4A 1BGXH 5HBBA 3T08A 4EO5A 2EIKB 2BJMH 2NY4C 4MXQC 1JGDB 2QGEA 3WUWG 2IOMA 3AS3A 3QBTB 3HRZC 5A2AA 5GRXG 4HZLA 1UZ8B 3QFJD 4YBQC 4NZUH 3S3JA 4BYHA 4M7ZC 5DEFA 4RGOH 4P5TB 1RXLA 2QVTA 5AVQB 5IEHA 2LTQC 1S3KH 5HHVL 4CJ1A 3KNBB 3PABB 3RURA 1JZDC 3P9MB 1I3RB 2F54D 2ZTBA 5FLUA 5AOIA 4WW2A 5HVHC 5FGSA 1GIGH 3UBXB 4YHNB 4XPHL 2YBRB 5DS1A 4BSWA 4APXA 1JWUA 1VFBA 5EORH 5DXWA 1XIWC 5KVGE 3FUDA 3HPJB 3TBVA 1P4BH 1IV8A 4AEHH 1MIEH 1L5GB 3RVVC 1U8JB 4QUOA 3U0WH 2XV3A 4ISVB 1XXDC 3CFNA 4LLVB 4JM2C 2FYYB 4RAVA 1X5GA 2GI7A 3GBNL 5MERA 1JERA 4NUJB 4OF3A 2B59B 3VXOB 5LBVA 4LQFL 4UZGA 4RQQA 3UTSA 1USZA 3WY3A 2O5ZL 1FYTE 1SXCA 4PGCA 4UB0H 4TPRL 2QHLA 4A6YH 3GGWB 2CPCA 3WD5H 3QR0A 3TH3T 1CDBA 1IAIH 3U0PA 3O8XA 4X8CA 1RPQA 5DF0A 5C0BA 1F58L 3RIFK 2XIDA 1JZ4A 5EC2B 4KK5D 1SF5A 4KKBC 5IW3A 1CXIA 4QNPE 1FH5L 5CILL 3HUJA 1I3GH 1AC6A 4WI9A 5B3JE 4AM0B 2XWRA 5KANG 3ZY7A 5AL0A 3O3BB 1BQ5A 1OP9A 3DYOA 1YMHA 5GGQL 3NZ8B 3HBPA 3VCLA 1WC7B 4PRNA 4N2NA 3KAAA 5I16B 3MA9H 4A2DA 3M88A 1CVRA 3G5ZA 1A0QH 3Q2NA 1NAKH 3QC6X 5DVPA 2W0FA 2NY1D 1OT1A 2E7LC 3HC0A 4OIFA 4LIQH 2HLAA 4ZPVB 2NY2C 2YBGA 1NCAL 4LCWA 2X9XA 5ITFA 4G8EA 4OF0A 3PL6A 3T6ZA 4Y4FB 5B3NA 1IAII 2F7QA 1H3PH 2VLLA 1ACYH 1QHOA 3K4AA 4ZT1A 1NIBA 4C56E 3U83A 1OCWH 3RVWD 1XCXA 3ARWA 2A6DB 3NFNB 3FN0H 3SKMA 2P7TA 5L2KD 1HNFA 2JXMA 1NSNL 2NR6A 3LPGA 4IJ3B 4Y89A 5B7FA 1BLNB 3VE0A 2C5DC 3GINA 4RMUA 1N2RB 1KBBA 1XMEB 2Y3NA 2E9JA 2ED9A 2I27N 3U36A 2D4FA 3B9KB 4ANXA 1S7VA 4BXVA 2QFRA 3CMGA 4WUUB 4FLOA 4KY1L 3RZCC 3HZYA 5CMAA 1J0IA 1IB5A 4Y19E 5EBLA 2OP4L 2DLIA 3D87B 3F85A 3I6GA 1ZA6B 2WKGA 2DQIH 3LZPA 1INDL 4GXUM 4E9QA 3MGOA 5KSUB 4FLQA 2QLVB 2LU7A 4X42A 4LBEB 1PKQA 1VZGA 1F3DH 1NCCH 1E6JH 3MREA 5KYWB 3O81A 2MHAB 3T6QC 3WE6A 4WSGA 3MRFB 4PEEA 3SKOB 3SQRA 4AZ8B 1FNSH 2R9HD 1RJYB 4FHJA 4QF1B 1RU9H 3VJ6B 3J7HA 4MZIA 1BOYA 1GGTA 3PU7A 3U6RA 2HA1A 4U6VL 4UOQA 1BVLB 3VI3F 1C16A 4KWUA 2DQTH 5I8CA 2A83B 3F7PC 5H8DA 2YAHA 5CD5D 3QUZC 5ADPH 5DDHA 2MTPA 3QUYB 4I2XB 3T0WA 1GMIA 1DBKL 3TBWA 5I24A 2X1PA 2N0KA 5TF1H 3IFOA 3A4FA 3LYRA 2C4FT 4IRSD 5C0RL 1N5YH 4R3SB 2FX7H 3NN8A 3SYQA 2DAVA 1HE8A 3FO9B 1DANT 2F74A 1G7PB 3QWRA 1YEEL 2D73A 5CGYD 2PPEA 1HYSD 1CZ8H 1XH3A 2H6PB 3GZOA 5C0FB 1IFRA 4LSPH 1NGYA 2EDWA 5EZIL 3F58H 4HIXL 5LGHL 5MHSE 3AXLB 1MCWW 4MTMA 4PLJD 1GC1L 4Z3TA 3MRHA 1V3KA 5GS2H 1HL4A 3C6SA 1LLAA 4EN3A 3ARGC 1I1AA 3MLXL 4LSRL 2VMEA 1H6UA 1UD4A 3MBEC 5FYLD 5D7HA 3IDJA 4OJYA 3SE9L 3ZHFA 2HWZH 4M6OH 1CL7L 1SN0A 3VWJB 3QZNA 1BF8A 1CI5A 4OVVA 1Q94B 4NRXA 1BIIB 2I60H 2AK4D 2BX5A 4WI0A 2XQYG 1G9ML 1YQVH 4G8GB 5D1XC 1E6OL 4AVHA 3GYRA 4FQPA 4OJCA 3D51A 3P3YA 4M8VA 4AYID 2XFXB 2BVQA 1NL0L 2ED8A 1M53A 3TIDB 1KPRA 3FQUB 4YHKH 1SLXA 5IOPB 2HVKB 4YFLF 1AZVA 1QQDA 3KCWA 2I85A 4I3GA 1EV2E 2YC1A 3W2DL 1ED3A 3CCHA 5AG8A 4I13B 3B5HA 3U7YH 5D2LE 4QLRA 5JPMC 5K59F 3E2HC 1Q0XH 4GSUA 5LDSA 3WNOA 5J8OA 5I6NA 1SJHA 4FNUA 4B9CA 3W9EA 4Q52A 1NKOA 5JXEC 5GGTA 5F9JA 4V2BA 5HYQA 1T3FA 1MQ8A 2OJ1A 2JJSC 2XHNA 1ZEAH 3HNVL 4IKJA 3RTQA 5I19L 4XCEB 3FB7A 2R69H 3ABLB 4PS4H 2O6EA 4PRAB 2CBMA 3D2TA 4R7NB 3VM5A 1OSZA 4FFWD 5LBSH 4PJ9D 2Z64C 2BNUA 3P9LA 8PAZA 3KJ4B 4XNAA 3VXTB 1S7TB 3QB7C 3BVNB 4MNQE 1I9JH 1BZEA 1WD8A 4PIRF 2CRYA 3FFOA 1J9QA 1TXKA 3B2VH 1HXYB 2VZ1A 2RMNA 1W8OA 4AQEB 4V1DE 1V55B 4K3JL 5C0JB 2HRLA 1U8CA 1Q90A 1GMEA 1ZLWK 2GTWA 2JTYA 2FATH 2P45B 4QRPA 3VD2A 2XZQL 3W37A 2D03H 5J11B 1VA9A 2HKFH 5C8JA 2EABA 1PZ3A 3MJ7B 4ZTOH 5CGMA 4HOZA 3GMMB 3ISYA 1E4XH 1BJ1H 1JHTA 4HGKC 1KXHA 1T5XA 4QTIH 1WS7A 3FQ1A 4YSSA 5D7JD 3UTQA 3MA7A 1YEJL 4WSJA 3TV3H 1SMOA 3TONA 5BVJB 3GSXB 1L7IL 4N0RA 1AE6L 3EO9H 4MMYA 3QORD 5E6UB 2JB5L 4ESKA 5FAAA 4YVUA 4BDVA 4WFEE 3L4YA 4GKSA 3NGBC 4KVCH 5CUSL 2EZ0C 3UC2A 1S7QB 1DN0B 1FDLL 2EDYA 2Y7NA 3EJCA 3FUFA 1VERA 1XO8A 1V27A 3DBXB 3HAEA 4UQ2B 4JJ5A 1G7IB 1L6ZA 2WCGA 5CJ8A 1JRHL 2GBAA 4HCFA 5TDOA 2RIKA 1DDHB 1F2QA 4D0CB 4PI2A 1TYEB 1KBKA 3VFPA 4L8SC 5C0AA 2NQ3A 4F92B 3ZLQC 3D4GA 1NCWH 2DWEB 2PABA 5J7CC 2IALB 4TYUA 2VGLM 1JZIA 1IFHL 2WP3T 5LN8A 1R46A 5FUZL 5IFJB 1KBWA 1R3LA 2AQ2A 2X3BA 3BZFB 2Z6FA 1OHQA 3L3HB 3GRWH 3QARA 1FFPB 4GBXA 4NQCE 4RVBA 1K4CA 4KTEL 3V0AC 4P5MA 5EEXA 1J5HA 1FUNA 5EEUA 2FJFB 4Y4KC 2BHZA 1UCBH 3C5SA 4RSYA 4ZQKB 5EOTA 3CNKA 1AXTL 5G5DA 1MRCH 4JBSA 5BZZA 5E8EB 2WQAA 1KIQA 4J6RH 3GC3A 4UQ3A 3HFML 1M9WA 1YC8A 2K78A 3SO3B 1QFWL 2DLTA 5FYJD 2NY0D 4UQIM 2XN2A 2FB4L 3ULVE 1EO7A 2EIMB 2KLSA 3MV9B 4H8QA 4UDTA 2JELH 2NY4B 2A6KB 1C5DB 3O3AB 3V6ZB 3NCBB 3PIQB 3WEBA 5ITBL 2W65A 3HI1A 1RUPL 3N41B 4M7ZB 3WJJC 1AHWC 1ADWA 4KH9A 4JHWH 5F7YC 4WI6A 2DMGA 1TVDA 5FIEA 1JBJA 3DHMA 1J8HA 3LRGA 3ZKNC 3GIZH 1R0AH 2H2SC 2OMVB 2EDXA 2X6MA 2ESVB 3BAIA 4OT1L 1VRSA 2VDNB 1KFAL 3JVGC 3QIBC 4MA3A 2VDPL 1RHHB 1XIWB 2D8KA 4XHJC 4GG6F 2NOYA 2IBZY 3FQRA 4UDUB 4KX8A 2XY2A 3FTGA 3V95A 2PLTA 3MLYL 2CO1A 4TM9A 4OJAA 3HZKA 4TUUA 1CIDA 3QS3A 2KZBA 4JM2B 5F6IC 1IZJA 3ZDZE 43C9A 1IGYA 1Y7VA 1U36A 1UZ6E 3T65B 1J9TA 1IGIH 4UT6A 1BD2B 1AFVL 1AZBA 4JRYE 3RX9A 4NFBA 1E5ZA 1JVKA 4X4MA 3OAYH 5DRZA 4E36A 3BSZA 2PNDA 5BXFA 3KPQA 5MENA 2CE6A 4LPYA 2WYIA 1HFUA 4G8GE 1VPOH 4XAWL 2ZG1A 1UJTA 1F6AA 5I6XB 4JEGB 1ASPA 1LNUA 2C7UB 1GGYA 1RFDH 1ADQL 2OJEA 3KLQA 4Y7MA 4X4YA 4Z7OB 4TTDC 3Q06A 3N44B 1G1CA 3BP6B 1YJDC 1N0LB 4OGAD 2V4LA 3NIGE 3VXQA 1WWWX 2M8XA 4Z7WE 5JR1H 3CFQA 3AGWA 4JPIA 3T0EC 5IJBC 1XV8A 2Q76A 5IBLC 1Z3GL 1LD9B 5GGTL 4XE0A 3KYKL 5KBPA 2V5YA 5HGDA 1YN7B 1KXTA 3SO5A 5A2LH 1MDAA 1TJGL 1SVBA 1Y07A 2W9DL 4X98A 5DD5L 4WW1B 2WWMD 4JVPA 1QABA 2OXHA 4PJGE 2NZ9C 4P2QB 5DQ9B 3VXSD 3ROOB 4QHKI 1DBMH 3C12A 2HX8A 1F6LL 5F7FA 4ABWA 1JTOA 2XZAL 1Q1JL 2BVPB 2OM5A 4R7XA 1QX1A 1WBZA 4ODSL 2JK5A 4A63A 3MV8A 5CKGA 5I0WA 2C9VA 3A5VA 5FA3A 1NH6A 4XBPB 1C7TA 4DGIH 1AHMA 3KL3A 3MTRA 3RB7A 1MRFH 3IXAB 2V3EA 2YPVH 3L3DA 4Y88A 1JPST 3D52A 1Y18B 2K3TA 4Q9QH 4PTUA 3LJ3A 1J7VR 3FU8A 3X1GA 3NH7H 1TPXB 3H53A 3X14B 3K74B 4LL4A 4CGUB 4HJJL 4F8NA 1IIIA 1EZVY 1XH0A 3WFZA 5KSAC 5I1AB 4G6KL 3R1GH 4KNQA 5IROD 3HE7C 1ZGLM 5B7MA 5F97E 5SWZD 3S34L 5DJDA 4HPHA 3NPSC 3V0EA 2HG5A 4R9HA 2Y36L 4NQEB 3SKNA 2AXGA 4NNPL 4PUBL 5INCB 2V17L 4JO3L 1U2YA 3RZCB 4I3SL 2D7PA 1MWAB 1KJ2A 4FXTA 3TEXA 4MDIB 5I6MA 5AVTB 5HHXH 5FWRA 3LNGA 4EJ1C 4X9HA 2HT3D 3A4DA 3FRUA 5FYLL 1UM6L 1ZIBA 3Q01A 1M6OB 5K1NA 4WWOA 2VDOB 2EYSB 3GMNA 3NA4A 5A6LA 3ECUA 4DUVA 3NEOA 5DSCB 5DVOA 3HNSH 3T8VA 1S7XB 5DD0L 3LQZB 5EO0A 4XMLL 4A2GA 3B7UX 1U93B 4Z7VE 4KK8C 1NDMB 3D39D 3RWFB 4XMKH 2ZNWA 3EKCA 3LKRB 5B8CC 2NSXA 3ZHKA 4TNWK 4ZS6C 4QOKB 2GAZB 3OZ9H 1KGJA 2PO6D 1ZA3B 2V33A 3KPNA 3X11B 3UIZA 3ZSTA 4CA4A 2A4EA 3QUZB 4JQXC 1N3NB 3KYOA 5FFGA 3FCBA 5FHBH 3MVSA 4FQXD 3GO1H 5AVYB 1CDJA 3ET9F 3TBSA 3TYFA 1GYCA 3DRQA 2EIJB 1FHGA 1MAJA 4HSAC 1FRGL 1QAWA 1RPKA 2X2JA 3KL0A 2ITDB 4FULA 2HN7B 5T5FL 3TESA 3JWDH 3K2MC 1N6VA 2EXYD 2O5XL 5DRXB 1JHKL 1J5OH 1LE9A 1XF5A 4TQ8A 2Y7MA 4MMZB 4P2YA 1TYJA 4GMTL 2EEBA 3JTTA 4PJXE 2WBXA 1R3HA 1YY8B 2C3XA 1KZQA 1YMME 4HIPA 4R96B 1YAZA 4L37B 5CN2A 4NXSA 2G75B 3HI6L 4DEUA 3OKLA 3UTPE 2F7OA 2DRUA 4N90E 2J1WA 2HKHL 4I7ZC 1NWPA 2RD0A 2XV0A 3VG9B 4YDKL 4HH8A 2RCSH 3OB0K 1CXKA 3MC0A 2X41A 3MRJB 3NFSL 3NCCB 3IFNL 5TGBA 5D7LD 1DLFH 1DYZA 4OGQC 2CU9A 3LTVA 2Y06H 4MD0B 3TT3L 5DJCA 2OBGA 1F4YH 2A9DA 5DLMH 3SCMC 1UZGA 5GSRB 3MV9E 5IQ7H 4KK9D 5SWZA 2D3VA 2DOCA 3MCLH 4ZTPL 2HH0H 1CB4A 4GQPH 5IW1B 2YZ8A 1E50A 4A2FA 4M6ML 4N3UA 3LRHA 4P5TA 1OAXH 3HHRB 2KH2B 1XT5A 2WUBH 4JY6B 3V9EA 2CR6A 3KNBA 3PABA 5C3IA 4GT7A 3P9MA 5BV7B 3E2HB 1T03H 4ELKA 4LSTH 2ORBH 5KANI 2DQHH 1R3JA 4YHNA 3UBXA 3PS6A 3ZR6A 3KMDA 2YBRA 3K0WA 3D7PA 4NUGH 4GG6A 1B0RB 4J3SA 3QEHB 4KQ3H 4KY2A 5DMIL 1BG1A 3GIVB 1EEQA 4GSRA 1IC5H 4PVMA 2J1ZA 3ZK0A 3QQ3B 5GRZA 3IDNB 4QJ3B 1C1EL 1GYVA 2VXTH 2WBJD 2H6UA 8CGTA 4TXVB 4DVBA 2R56H 2VDMH 2VT0A 4LLVA 4LIQE 2WO3B 3WE1A 4GB9A 1KEGH 3CLFH 4U05A 3TCXA 1UYWL 2B59A 4WHDA 1G9HA 3VXOA 1JGVH 1X5MA 3NZSA 3AU0A 3V5DB 5CIPB 2PO6A 3RVUC 1OTUC 2YQ3A 2A6IB 4HIEA 2X0VA 1IBGL 3TT1L 4AEIH 4DFIA 3GGWA 1RK0B 1YA5A 3LDBB 2IDSA 2WVSA 5F3HA 2G5UA 2NMSA 2K3HA 4KJWD 5D1ZB 4JR9L 4YDVA 4QTFA 4ABQA 3MXWL 2APVA 4NO5B 3T3PE 5EC2A 3CMOL 2BP5M 3EJYC 4E9XA 4MBOA 4HZ1A 4AM0A 4POYA 3HPLB 3TZVC 3CN1A 2YAPA 1MSPA 3O3BA 3PNWA 3NA9L 5J6GB 5ETUB 2ZKWA 3NZ8A 1W15A 1ZE3C 1AR2A 5HHVH 1RJLB 5JOPE 2CGRL 3BUYB 1WC7A 3KJ6L 5I16A 2CK0L 4PP1D 4TQHA 1M2VB 5FYJL 5A3IC 3C09B 4R5XA 5KSBB 3FRPB 2BVEA 1T7YA 2PR4H 4XPHH 3PP3K 2O6PA 3L8QA 1JCKA 1GPOL 3U1QA 3LH9A 4ZPVA 1I8AA 1EAOA 3IM1A 3NGBB 4D9RE 4ODUB 1A3LL 2C4XA 2YRBA 4WEMB 4Y4FA 4HX1A 1AXSB 1JXDA 3AM8A 3JUYA 3TS8A 4D2NA 4HK0A 2UUDK 2H26A 1OCCB 4PVNA 1Z5LA 3GBNH 4UNVA 5CLZA 2KBGA 3L5XL 4XTRD 3NFNA 1GH7A 3VXMD 3C5XA 4LQFH 3OAWA 2WIMA 2O5ZH 2WWKO 1LWHA 3RIFF 4LOEA 2YD8A 3FHAA 1BLNA 1KPUB 3R7QA 4PRDA 1KJ2L 1N2RA 1PD6A 1SXSA 2D7NA 3SPVB 5JA8B 2GBTA 1IIKA 3B9KA 2KDYA 4CSZA 3DUSB 4OZFA 4ZI8A 2N1KA 3HB3C 5I15L 5D96C 5LXVA 4LASL 3NJKA 4BE5A 2OZ4H 4IMKA 2ICWB 2X2UA 1FH5H 1ZE3H 4MCNA 2ZXCA 1N64L 2A77H 1CT8B 4D3CH 2N56A 3MRMA 1J0KA 1ZA6A 3EH2A 2VXUH 5GGQH 3T2PA 1A66A 4Y4KB 2F1EA 1PQZB 2VN4A 1KG0B 4NGHL 3CVIH 3TVMD 4ACPA 5JW4Q 1TETL 4LBEA 5DZLA 5KYWA 2QVFB 3C6LC 4N8VA 3K80A 3MRFA 2G3MA 4LVNC 3SKOA 3I50L 4AZ8A 1RJYA 3VJ6A 1Q8MA 5HD8D 5J9PB 1MHCB 5DQJB 4ZFFA 3LQAL 3N0AA 2VJ8A 1NCAH 4FQCH 5IKCB 4IRZA 2DS4A 1YYCA 3ARFD 3BPOC 4UOJA 4FERA 1BVLA 4J3XA 4XP9H 3T2QA 5DI8B 2GITB 1TZOA 2E7MA 4J7RA 4N2KA 3U4EB 2XWZA 2DWTA 3NMEA 3C8KB 3N41F 1SGKA 5FB8A 2XNAB 4PYGA 4ZDHB 2PYFA 4WTZA 1F6FB 4UINL 4LLYB 2R8SL 5AVXB 2H47C 3HC3L 4NAQA 1E0OB 2JI1A 2G3NA 3DGGA 3SPIA 3PJNA 4R3SA 4OGZA 2KI6A 2VSMB 3FBQA 3SDDD 2AKRA 5IB2A 1X4YA 2IQ9H 3QIUD 3QIBB 1G7PA 3EGDB 4PU2A 3SYAA 2H6PA 1XH1A 4KY1H 4ZXBC 5DJAB 4MCZA 4QLWA 3FTUA 2OP4H 3Q13A 3NIDB 4GQQA 3D85D 3T9WA 2CCVA 3VMOA 1IBDA 3WDHA 4B96A 2FEJA 5EWIL 1MI5E 2DKUA 1DSFH 3BLBA 3UEZA 2F53E 1UOVA 4XOEA 3HZ3A 3VWJA 2WXPA 1UATA 4GAGL 2BO0A 3BP7B 2QHRL 1BIIA 1AR1C 3D4ZA 4M4PA 3I3EA 4PY8I 4XGZB 1NJ9B 5AOZA 5I5IA 3ML8A 2VMFA 1UUNA 3D48R 5D1XE 1HIML 3GZKA 4YHYB 3GSVB 4JDTL 3P02A 4G80A 5CEXB 2FECL 4NEHB 3TIDA 3FQUA 4B53A 2C8NA 4U6VH 1WUNT 3RGVD 1HCYA 2APFA 3VXUE 2Q87A 4Z7OF 3MCKB 1FAKT 4KH2A 4HJEA 3BAYA 1MHEB 1OPOA 1RMFL 2UZYA 3QQNA 4G9DB 3ZE1B 1TJHL 2DD8H 4QRAA 4J8RB 2RACA 5EZOL 3TCLA 4FNLL 4J3OD 1JS4A 4Y9CA 3BMVA 1U58A 4C55A 4S1SH 4ENED 4Q58C 1HJBC 4K7PX 2GI0A 1AO7B 2LU4A 4R8WL 3RDTC 1SVCP 2CG9X 2NNFA 3O4LB 5T3ZE 1D3CA 3TVMA 4CVUA 1NWOA 2IPUG 1JI1A 5E2VL 1SOKA 3H85A 3U9UB 4E5XA 5EN2A 4XCEA 3KHOA 2KZWA 3MU3A 1OGAD 4PRAA 4L3CA 4MMXC 4WGKA 2VDRL 2IAMD 1A65A 3O2DL 4YDLB 4NWUL 3JV4A 1GC1H 2OLDA 1FJ1A 4MVBD 5HVWA 1U8OB 3MLXH 4TSBL 3NTCL 4LSRH 3X1FA 1OIOA 4FABL 4KKAD 3QZPA 3PNRB 1U91A 3SE9H 43CAA 3K1DA 2ZSVB 4M5TA 4GUQA 1HXYA 3ATEA 4KKZA 5HHOB 1DVUA 3Q6GL 3A6OA 2VR5A 1G9MH 4R4FL 1E6OH 4TS6A 5I6LA 1OTSC 1DVTA 3WNKA 3DX6A 2YEVB 3VXPB 2UXTA 2B20A 2NPLX 3REWB 1NL0H 4AENA 3QO0B 3QRGL 2Z7ZA 4UBDC 1ZGLA 4WNQB 4PWHA 4PS7A 4HQQH 3WOVA 1BMWA 1IMHC 4XNUL 3L13A 4N6QA 3ILPB 3W2DH 2FWSA 1DANU 1JGIA 1KF9B 4AH2B 3K6SB 5IV2B 4EKXA 4NYLB 1I4FB 4BFGA 3D85A 3GSXA 1NANH 2CHDA 4ZAKC 1YQ2A 5DK2B 4UV7L 5GQBA 3WHE1 5KSBE 3HR6A 1CPUA 2CBOA 1ORQB 2P24B 2XXMB 4M9PA 3HNVH 1FG9C 1S7QA 1KJVB 1DN0A 5DFVC 2MQGA 3DBXA 4UQ2A 1CL7I 4QRUB 1G0XA 3RNQB 4JZJB 4Z1PA 3CFIC 4I3RL 4R7LA 2B2XH 3W9DB 2KHAA 1BX2B 3MJ9A 4NOBA 4P5RA 5LCVA 2R0LH 1DDHA 5C1MB 4GEJA 3TJHD 4JKKA 3IDMB 3G9VA 1O7DE 3RGVA 5TTRA 2Q10A 1E5AA 3QXDA 3EJJX 4JN2B 2V2WB 5TPWH 1AS6A 1G7HB 2I07B 2ZCKL 5DC2A 3WGUB 1BCIA 4K3JH 4OLWL 3DIFB 5IFJA 3MX0B 4H8PA 4TLUA 4PJCB 1SPDA 1CFQB 3HG3A 3NJFA 1KTLB 4S1QL 5CZXD 2GSGB 3W0WD 3VSUA 2XZQH 3L08A 5T3XD 2Y4SA 3DNKA 5GGSY 1U2HA 4G3YL 1FFPA 2DQGL 2H4EA 3DWTA 4XXWC 1OALA 1JZ6A 1M3IA 3P73A 3DX1A 1JK8B 3WKYA 1OGAA 3D0VB 4OZ4B 4U6YB 3L45A 2G5BB 4M6AA 2YWZA 4PTTB 4X7EC 5FM5O 4K9JA 3LPOA 1JE6A 5T1MB 1TLMA 3QG7H 2EDFA 2GJ6B 2WK2A 1N9PA 3T3MB 2VH5L 1OB1B 3TIEB 4E9WA 4LP8A 3BRFA 1F0LA 1L7IH 4F8TA 3K5SA 2W9EL 1AE6H 5AKRA 5F8QC 4G1MB 1GS8A 3O9WD 3KCPB 2NY5L 2JB5H 2ZQKA 4ZW8A 5AVSB 1HHGB 3H3KA 4LF3B 3BRDA 2XCMC 4X8XA 3EGXA 4YLQT 5CUSH 4MQTB 3Q7JA 3CJJA 3SCMB 5DMJB 3FS9A 4YVNA 2MNWA 3N55A 5EUOE 1DQLL 1FDLH 4OZIE 2A6KA 1C5DA 3PLYA 3U30B 3KLLA 5EO1B 1F11A 3UDWA 1AZNA 4K9EL 1JRHH 3L4VA 4OJEH 2N1TE 3Q43A 2YA2A 5C0EB 3WS6A 4S2SB 3MXVH 1I1YB 5E56A 4PJIF 4JG5A 5JHLA 4QO1B 1EDHA 2WXMA 3QSKB 1WAAF 4YDNA 4P49A 2ESVA 4PV8B 4Y9GA 4Q4EA 1GVIA 1IFHH 1SZNA 3N2JA 2JIXB 1XF3A 1R33A 3FT1A 4XVTL 5FUZH 3RL1B 4FYRA 4HALA 1RHHA 3ZDXE 3V0FA 1QSZA 4UDUA 3VAEA 3ZMRA 1MQKL 1AYRA 3QJFB 1UKSA 3F5WB 3B8SA 4M8UA 4OKDA 4TNEA 2AANA 4L48A 1CFVH 4Z3JA 1XDTT 4JZNB 3S5LB 3KPSB 3T65A 1BD2A 3OKDB 2ICWJ 3S98A 1CYWA 2A3TA 2HT4D 2OULB 3AG2B 4BZ2L 2BY3A 4I9WD 4B60A 1X7SA 4HWBL 3QG6A 4CN1A 1JRHI 4K23L 3IFLL 2ZX7A 5IF0B 2XTSA 1I1RA 1QFWH 1TCRB 3OWRA 1T7WA 2AZAA 4U1NA 5IHHA 2C7UA 3KH4A 2XWTA 3VD1A 2FB4H 1Q1PA 1MCKA 2EE0A 3QIWB 5A6IA 3BP6A 1N0LA 2W07B 3P4LA 3QUMH 3W0WA 5ITBH 4NQQA 4BFKA 3HCVA 1RUPH 3U4BH 1ID2A 2H0EA 3C60C 1LD9A 3T0EE 2HTLC 1VGEL 1E7VA 4ZK8A 1II4E 3HN3A 1WZMA 1BFSA 2WNWA 4Z76A 3RWIB 3VD0A 3OC5A 4WW1A 3B2PA 1GOFA 2NNRA 3H4FA 5EDXA 5DQ9A 3FQTA 4P2QA 3GBLA 4OT1H 4JPVH 5CZVH 1Z5YD 2NY6C 3MNMA 4L29B 2CNZA 1KFAH 4J12A 2BVPA 2YQGA 4GMSL 3W39B 5BMFH 4H8WL 4FA6A 2A4CA 2HRGA 1Z1WA 3OGOE 3LVTA 5E5LA 2P5EE 5JW5A 3FCGA 2XPGB 4QEGA 5FA4B 4XBPA 1F4AA 2EKSA 3LD8C 5BPPA 5DHVB 2MMXA 3QQXA 3MLYH 4GRLC 3SGKA 4EOWH 2P8MB 2MH4A 2KKQA 1SXZA 3P9WB 3IDXL 1A7RL 3X14A 2YOAA 5IEKB 3M17A 3BW9A 1EFXB 1SXNA 3OZLA 2GTZB 3L4XA 4G9FB 3WLWD 4BM7A 1KYFA 3IRZA 4G43A 2R2BB 2PTUA 2VRQA 4M29A 4N0CD 4WI7A 4NQEA 1ZTMA 1ADQH 1KBVA 1MUJB 1U95B 5BRPA 1H9VA 3SJVB 4D0DB 4BFNA 1UA3A 4JANB 2PTTB 3F7YB 5SWQB 1MWAA 4MDIA 2HKAA 3HG4A 5LVEA 5DK3A 4KJPC 25C8L 3VD9A 1PSKL 1M6OA 3ULUF 1Z3GH 1IM9D 5E6IC 3WFCL 4Z5RB 2RFXB 4UQ9A 5C0CE 1VENA 3KYKH 3EOYG 3ZDYB 1B88A 4GKLA 1G7JB 4N9OB 5E7FA 5DD5H 3BDBA 4UYQA 4TL4A 4AIZA 1E4KC 2Z4QA 1TZGH 5DZNA 3PWPD 4R4ND 5ABDE 2KLTA 4GQ9L 3QYCA 5LCVL 2B7DT 5INDB 1U93A 4G8IB 4LVNB 3KLSA 1Q1JH 3WO3B 3IGKA 1NDMA 2X3CA 4P2RB 2GUOB 3P2BA 4ODSH 5ACLA 2Z93B 2CDGB 2LABA 4NQSA 3CQFA 4PR5B 4K3DL 5HHMD 5EF0A 4FLSA 4QOKA 5EOQH 3BZDA 2GAZA 4NHCL 1SJEA 4CJ0A 1D5BA 1M56B 5KVEL 1ZA3A 4KNTA 4M48H 2VDKB 3U48A 1WF5A 4FQ2L 4ANUA 1F56A 1IKNA 1M7IB 3P54A 2ZOUA 5H4YA 3UJIL 1I9RL 3AG3B 3OHXA 3CN0A 1OARL 3LSOA 3MRLB 4HJJH 3LKQB 4M3JA 3UTZB 4G6KH 1MFDH 3ELAT 4K2UL 2HN7A 1N8ZB 1NKRA 2Y69B 3HLAB 3L95B 1HT6A 4RGND 3S34H 2QTVA 4LOFA 5DRXA 4TLTA 2XYBA 2BVUA 3WL9A 2Y36H 3S37X 1GCFA 4PUBH 4YGVB 4JO3H 2IH3B 3C08L 4MMZA 3RDJA 4I3SH 4ZXBB 2EDKA 1YY8A 3LXBA 4L37A 1B4JL 2BOBA 2G75A 3AG1B 1RIVH 3GI9L 4QGYA 5FYLH 1UM6H 4KZCA 3KLHC 5IG7B 4UOZA 3GXFA 4OQTA 1FH2A 5IREA 3NIDF 5HDQL 3FPYA 1L3NA 3N85L 1NPUA 2FL5B 4JCWA 2MJWA 5DHMC 2PXYC 3BCDA 3MRJA 1ZLUH 3SQOL 1SYSB 2D7QA 3CUPB 3F05A 5DD0H 5LB1A 3CXHJ 1H3UA 4MD0A 1L9PA 7PCYA 5JHDE 5GSRA 3VI4E 2FBJL 1JWSB 2G9HB 5CR8A 4IS6B 4BK5C 3AQXA 4WAFA 4JFEB 2W0LA 2VMDA 1NCUA 3DRTB 4B0MB 4X6CE 4U1MB 4A55A 4PJIA 3CSPA 4R7DB 1XR8B 4JRXD 3PYCA 3L3IA 1BQLL 1WAAA 3C2AL 3L5HA 4JY6A 5JUEL 2XYCA 3G5XB 2DYSB 4MASA 1F90L 2WSDA 2ZYIA 3IGAB 5K33A 4PJEF 4X6BA 2QQQA 1L0YA 1JHLL 2B5IC 3V6OC 3PWUA 1KGUA 3VD7A 2R1XA 1FRGH 2IC2A 2K6WA 3IJ8A 4QAWA 5T5FH 4W9DC 1B0RA 1MIML 3QEHA 2EUZA 2GEQA 3GIVA 3ULUD 3TFBA 3SDAD 1JHKH 3EADA 3KLAB 3PWPA 2I5YL 3GSNH 4WEEA 1K2DB 2A9CA 2X7LB 3VRJA 3VA6A 4NUQA 1M3JA 4QXGL 3V5KB 2BNRD 3IDYC 5F6HI 2N01B 5F89B 4W9IC 1X9UA 3CK0L 1U8LB 3VNYA 3HI6H 4PB9L 4MAYB 4L5FL 1FG2A 2HKHH 1SLVA 2W1NA 4AIXA 5FK9A 3PWLB 3NIFB 3B34A 5CKAA 4Z0XB 3GSOB 4YDKH 4LCUB 3AMLA 2Y23A 2V5MA 3A6BL 4NPJA 3NFSH 4JCMA 5TE7L 5LNGA 3IFNH 2X89D 1DJZA 2XSKA 3L4TA 3GNML 3SGDI 1H3VA 5E5UB 4DAGL 5T3XL 1YY9D 5AL8A 3KWUA 5D1ZA 2H41A 2ODHA 4NO5A 4KO6A 1CICD 1RCYA 3DV4A 2CUMA 4W4OA 3EDDA 4NO0B 3H9YA 3QDGE 1S5IL 2YLKA 5GHWH 1GY2A 1BJ8A 4FMVA 5CU9A 1WH0A 2ZT9C 1MCJA 3K46A 5J6GA 5ETUA 1L4IA 4X99B 1AG0A 5CD3B 4Y2DC 3Q5OA 2JNZA 4ZD3L 5B1JC 1RJLA 1GOGA 4DP9X 2ITFA 3BUYA 3S3DB 3E1ZA 3DPBA 1NMAH 1CE1H 5CN1A 4QRRD 4ELMB 4F37K 1M2VA 4ZAKB 1G6RL 3ZKMC 4UU9B 3VU1A 4ZMXA 5DMIH 3T2LA 5LKNA 4JPWL 5EIQA 1L9MA 5A7BA 2DH2A 3I6SA 5DZOA 1UWFA 1XGQA 5FDYA 1FZKB 5IQMA 4XP6L 3RWHB 3MNWA 4S1DD 1IAKB 4YHOL 4J3OG 3KBEA 2H32B 1UYWH 3ETSA 3U0TB 1UB5A 1HEHC 1ZHKB 3O0LA 4JKNA 3WY4A 5CLTA 1NDTA 1BAWA 4L8CB 5E1AB 4FA7B 1J0HA 1IBGH 4JRXA 1IE5A 3ZGHA 1KPUA 5K9KB 1IBZA 4H1LB 2XVLA 4RAHA 4G5ZH 4YHIB 5DWUL 2OK0L 2CMRL 3DUSA 1S5HA 5AOKA 4JRFA 3CFJB 1FFNA 3ESPA 3MXWH 2FEDC 5HHPB 4CAGA 3WNIA 2C1PB 1M1XA 2BCMA 3G04B 35C8H 3CMOH 2W0KA 4L9LB 4U3XA 2L7UA 3OJMB 3SDAA 4FYTA 1HEJC 1VEMA 1CT8A 3L5WA 1ROWA 3S97C 5GZNC 3BEWB 4GXVH 3NA9H 1DL7L 1ZCRA 2QADB 5D7IB 3QWOB 1EJFA 4IJTA 5DK0B 1FNEB 1XGRB 2CGRH 1PQZA 5BRQA 1KG0A 2DBLL 4XNBA 4AGQA 4EAEA 3KJ6H 2CK0H 4JFDD 4AV5A 2V0AA 2XIBA 1OM3L 4LEBA 1RUKL 3G7TA 5CEYB 5HY9A 4G8FB 3GXUB 1ZXKA 2ZKHH 4FI8A 3U79A 2F8VA 3ALWA 3T3MF 1HK6A 2X89A 5DQJA 1T20B 4HWNA 4RRPM 3KXFD 4YFLI 5BW7A 1H3TA 4KXCA 1Z0MA 2CK2A 1IFGA 3EYQC 1A3LH 2AS5M 3X3FH 1DHKA 5DI8A 2GITA 1CICA 1ZT7B 1WT5C 1M57B 4NI3A 1IO4C 3U4EA 2OL3H 3S8WA 3HZMB 5D9SA 3C8KA 4C83A 1JWMB 4Z7NE 3UZQB 5CJXA 2DEYX 1AJ7L 4DK5A 2AEQL 4AYGA 4LLYA 4UIKL 3EG9A 4OGYL 4W9GC 2YRLA 5IUCA 1WIPA 1VZHA 4XP1H 5FFOA 5J89A 2DJUA 4P2OC 3ZIMA 4BBWA 2J3SA 3JVGA 2R29A 2NY3D 3ARBD 3CIQA 4P8QA 5I15H 2C3HA 3AITA 4Y5VB 3SYPA 4LASH 1BSIA 5DJAA 4WWPA 3CU7A 4AV0A 4OZHE 2J6EH 4PW3A 5IHUL 1N64H 3TYGL 4OV6F 5B3JF 4HJ0D 4BFIB 1KV7A 1FZJB 1BVKB 3BVUA 4Y9EA 4RZKA 4BHUA 2ICCA 1RIHH 2PP8A 1BREA 4NGHH 3UTTD 1LP9E 1SJXA 1JZ7A 1LEGB 4H40A 3BP7A 3MRKA 1Q0EA 4PSPA 1SFHA 2VZOA 4P2AA 3U1SL 5SX4I 1KTRL 3ZSSA 3EHBC 3I50H 5K5YA 5FXCH 1KGXA 4POUB 3GSVA 5AW2B 5CEXA 4TTGA 5IESL 3VYNA 1QO3A 4PJDB 4DN4H 5JMOC 4F9LA 4DW2L 2EXWD 5KBMA 1RULL 4JKPL 4CU8A 4LSVL 1MHEA 2YMXH 4G9DA 1D6EB 2EDDA 1BVNT 3C5ZC 1O9VA 1Z6JT 1CLYH 3C60B 4PJEA 2WCSA 4I88A 3ZQXA 4DKAA 3F7KA 2UXFA 1X5LA 3GJFH 2VLRE 4UINH 3V4VL 2R8SH 1IGFL 2P5WB 4L8BB 3K6DA 5DT1L 3CFMA 2NY6B 4N1EA 4GI9A 4QHMB 5DC4B 4E68A 2E6PA 5C0GA 3KVPA 3B9AA 3RPBA 3ZTJG 4ES9A 5DUBA 2YUXA 4MJIE 1T0OA 3ASNB 3MO1B 5FM8A 3SDYL 3N1FC 4EIUA 2R51A 4MD4B 2GJZA 3CX2A 4OFPA 3KXFA 1CDGA 2Y5TA 4F7EB 4GRLB 4GKZB 4B9IA 1U8OA 2R0KL 1HWWA 4X83A 2WM0A 4KJQC 2XX1A 3GF8A 5D2NE 3OLGA 4GAGH 4P05A 2QHRH 3GXDA 3IN0A 2BIPA 4HJGB 5IW6B 5BS0B 1T0NB 3ZOAA 1Q9KA 2OTUB 2DKSA 4V33A 5IJKA 3KYNB 4M5ZL 1AS8A 3FU7A 4HXAH 3VXPA 1CC3A 3EJRA 4IKNA 4XXDB 4QYAA 4ZSOB 3REWA 3UAJD 4FA8A 1KIUB 4ZMAT 3QO0A 4W4NA 4LLQA 1FYTD 1RMFH 5C08E 1CDYA 1LO2H 1CWVA 4UNTA 2OSYA 3ILPA 4LDEB 4AH2A 3NYKA 4FNLH 1E4HA 4WV1C 5HYIA 5KYXB 1WZ1L 4NYLA 1I4FA 2NYYD 1F3JA 5L88L 2A5UA 4WO4C 3VFRB 1MJ8L 3EJZC 3ZDYF 5DK2A 4QJ5B 5DURB 3SDXE 4BA0A 2ZXAA 3MLWH 3L3GB 2W80C 2YZ1A 2P24A 1ORQA 1WCQA 2ZD0A 3T09A 5E2VH 1KWGA 1R6VA 1RZGA 2F8IA 3B3IB 3EFOB 3QO1A 3X13B 4WHCA 1KJVA 3L1FA 2M2DA 1KSRA 1P7QB 5JMRA 4FNPA 4I0PC 3ZDWA 4QRUA 2OKMA 5C86A 2VDRH 2YGNA 4JZJA 4NWUH 3DX8A 2PMZA 4U7SA 4QY8B 3UOAB 3BAWA 3IDMA 3BWSA 4OCRL 4AJ0A 3UO8B 4TSBH 2XBDA 2BY0A 3NTCH 3VFNA 3F2LA 5EZPA 2FECI 2F1BA 4ZNEA 2HTKD 4WFGE 5JOFA 2WYHA 4LCIH 3SE3A 2I07A 3ESOA 4K8RD 1PTZA 4Q97A 5IT2L 3DIFA 3OR6B 1SY6H 4R4FH 4XC1L 2VKXA 3MX0A 4RWYH 3WEAA 3AQDA 4WWKD 4TNFA 5KWYC 3IMVA 2GSGA 4C56D 3CFDA 1N26A 2P47B 1CS6A 3PQYE 3GTTA 3QRGH 1ZT4B 4JDVB 1A3RL 4L4VB 1JV5B 5E6SB 3RTLA 4AVJA 1UXMA 4X0NA 4EI5D 1NCHA 4LMQI 3T4YB 4X0KB 3D0VA 2BFGA 4OZ4A 1LDSA 3O2VL 4U6YA 4XNUH 4PTTA 4O51B 5EU6B 4ZJ9A 3AREC 4ONHB 5T1MA 1FFOA 1S9YB 2GJ6A 3FB5B 5H35A 3WN5C 3FHQA 3HHSB 1OB1A 3ES6A 4DQOL 5HVGB 3L7EB 4UV7H 4YOKA 3KCPA 3N40P 1KPVB 1HHGA 1PYWB 4LF3A 4XMPL 3G6JE 4Y19D 1MVYA 3LIZA 1EUUA 4HC1L 2Z3FA 1N12A 2IV8A 5DJZB 3SY6A 3CBKB 2QSTA 4B50A 3KGSA 4JFPB 5EO1A 3CDGB 2DI7A 2EAEA 5HGBA 5EIIB 4I3RH 1E9QB 1QOKA 2NNCA 1RY7B 5L2JA 4FHKA 3KH3A 1XXFC 3OHMB 4BRVA 3DXAE 1I1YA 4MCYB 3OV6A 5DJ2B 3GT6A 3PWNB 2ZXWB 3HR5B 2WQSA 3KGUA 2ZCKH 4X4XB 2ERJC 3NZHL 5G4OA 2FE0A 2JIXA 1BHGA 4OLWH 5J3HC 2XN9E 1CURA 3RL1A 1EEYB 3EGSB 4X80L 1OP3K 1DR9A 3OB8A 3MNVB 4S1QH 2DQUL 1FYHB 4Y5YC 4ZQTA 3RFZA 4WKZB 5ISZE 2R0ZL 4F2ME 4OF7A 4DUXA 2W9LA 4G3YH 3F5WA 2DQGH 2IWEA 2QEJA 3IDYB 3O6MH 2YGVA 3QXAB 2XN0A 2NCMA 1H6TA 3KPSA 4K73A 5JDJA 3LEVH 3MJWA 4HUNB 1WZLA 4JG1L 1ZJAA 4AKOA 4OFDA 4BEIA 4AMXA 3DO7B 1OWRM 4F7KA 5HJ3B 3PHQB 3UAFA 1OGSA 4BKLA 2VH5H 3NIFF 4G6FB 2W9EH 5MHSD 4Y1AE 5HTSA 2P9RA 3JTBA 3O6FD 2NY5H 5F1IA 5E1IA 3D34A 3FUJA 5B4MD 5C09E 3PWVB 3QIWA 4Z0BH 1LWRA 3S3SA 2W07A 4XBEL 1ML0A 1HKLL 4LGPB 4Y9FA 4JMNA 4WWKA 4K9EH 4B6ZA 4C56A 3W57A 5A40E 1J1XL 2QPEB 1QLFB 5IM7B 4MJ5A 5HJGA 4DZBB 1ZD6A 1QVOB 2ADFL 5HI4D 3RWIA 5KVFE 3T4AB 3GJEA 3FU5A 3RILA 3BPNC 3T0AA 5IY5B 5MEQB 1NFDB 5JLZB 2W95A 4PI0A 3MRQB 4L29A 2PW1B 3BI9X 3CBJB 3MGTB 4ELMF 1ES0B 3BN9C 4XVTH 3D0LB 3W39A 1SQ2N 4LHUB 5HI3D 1WLHA 3RGBA 3ZHDA 2OAAA 2XPGA 1P9MA 4LRIC 1MQKH 1EPFA 2Y2TA 3EBGA 3PFUA 5FA4A 4Y19A 5DVLA 4BZ1A 5FC9A 3AABA 5DHVA 5B39A 5TE6L 2P52A 4HPOH 1MCHA 1AHKA 2J8HA 2ZX8A 3BO8B 4JPQA 1NGWB 2CRIA 2C9RA 2P44B 5ENWB 1T2JA 1INEL 5IEKA 1WITA 1EFXA 3JWNG 4OLXH 4UNUA 3WNMA 1MFMA 2GTZA 3ZL1A 4H0LC 2DYPD 4HWBH 2DL2A 4G9FA 4XVOA 4K23H 2FBRA 4JREB 5E95B 2R2BA 4ZFGL 4S0HA 1OF2A 4A1RA 1BVNP 3MSPA 1KMGA 3BX7C 2EDLA 1MUJA 1U95A 2N7AA 4LOUD 4EBQL 3CSTA 3U2SB 1RUAL 1G9EA 4D0DA 3LNIA 4NS0A 3VVWA 1EERB 2PTTA 3F7YA 4O2FB 2Z0BA 4MNQD 5F7AA 4WVRA 4PS3A 2JJTC 3KM2A 4POZD 4JM0A 5JHBA 3IAGC 4YSQA 5FGCB 1ND0B 1P4UA 3QEGL 2OMXB 4DO4A 4Z5RA 5JHMA 4ENZA 2RFXA 4V1DD 1NCOA 2XETA 5F71A 5HGAB 4YMPA 5ID0B 3KW8A 4QR7A 1TIUA 1G7JA 3RZWA 3GMQA 5D7IF 4DFHA 3TTSA 1BOGB 4KHXL 2LFEA 1CGWA 4JVWA 3UYOD 4FKKA 3CVDA 4HCRA 5INDA 4G8IA 4GMSH 4F5CE 5DWPA 3EYVB 3M7FB 4YE4H 1G7QB 4L1HA 2GUOA 4H8WH 4KZEH 1MJJB 5I0ZA 2Z93A 2DWXA 2CDGA 5F1NA 3O6FA 4PR5A 1GCYA 3ZRCC 1UFUA 2J8UE 4Q9RL 5ID1B 1BVZA 2BNQB 4G59C 4M62L 2Y6SC 3ARPA 4I77L 2NX5E 1A7QL 4NFDA 4RRPA 2R4RL 3NSJA 2HPOA 1M7IA 3ZDZF 3IDXH 1UZ6F 1A7RH 2ZX9A 2FHBA 4NQDE 1L9QA 4WFED 4IBZA 3MRLA 1KB5L 3LKQA 3RPIB 3TFKC 1N8ZA 3JWOL 3L95A 3RWJB 4UM9B 2AEOA 1ZHBA 3E8UH 5E99L 4BUGA 3OF6D 3ULSA 5KJ7E 4F57H 4AGNA 2ICEB 4P4RA 1OT2A 2H8PB 1DJGA 4RGMC 3RPKA 3VH8A 2WQUA 3DROB 1BQHB 4F80A 4JFHD 3P3RA 3UC0L 5DGQA 5JW3L 3DGDA 2L0DA 3ME0B 2XC8A 4TLKA 2KUTA 25C8H 3W1ZA 1PSKH 2CJTA 3ZXAC 5IG7A 4P23C 1W72L 3WFCH 4AGLA 3UROR 1CVSC 3P30L 1NAML 1KCLA 2W8CA 4PRPB 3FSWA 1S2EA 1SYSA 3BVVA 3CUPA 2A0LD 1XGTB 4ODVL 1JFHA 3RB5A 1UM5H 3LZLA 1QPPA 4GQ9H 4YXKL 1ZV9A 1JOIA 3IJEA 3FT2B 4NQCD 2DYPA 4N9GB 5GGVH 5DJ0B 1AQ8A 4MS8C 5AOJA 2G9HA 1QRNB 4IS6A 1C12A 1GYWA 3V0GA 1D6VL 4K3DH 1Y0LB 2YMTA 3FU0A 4AC2A 2FIRT 4KX7A 4IBWA 1E27B 2J8OA 4NHCH 4U1MA 2AITA 4J3OH 3V6BR 4U6TA 2XFGB 5AALA 4D94A 5KVEH 2HFGL 2Y1VA 1LO4L 3QR1A 3S3PA 2Z1KA 3KWWA 3C5ZB 4PBDA 3FFCB 2Q2EB 4PV9A 3UJIH 1I9RH 1SN2A 1FVCB 2OYPA 1OARH 4V1DA 3SY0B 5CEZE 3ULVD 2UY7B 1IVLA 3QJQB 3O3EB 1T22A 3V6OE 1F8TL 4K2UH 3HN5A 3T6XA 3CLWA 2IPTL 1T1XB 1T2XA 3QQDA 3GBMH 1IILE 2IOOA 1WBXA 1K2DA 1UG9A 3MPCA 5KS9B 5E2WH 1A7PL 1OGTA 3C08H 4GLRH 3V5KA 4ZW7A 2MIZA 3AFLA 4H20L 4AC4A 2X4TB 3ZUNC 2VXVL 1U8LA 4HAFA 3GI9H 4NX0A 4MAYA 2CWRA 5AWNL 2NW2B 3ILQC 4AMKH 3K3QA 1TMQA 2OA9A 3PWLA 1XX9C 4K8RL 3GSOA 2DJSA 1UXLA 5HDQH 1XZ0B 1L6PA 3N85H 4LCUA 3VTAA 4MDJB 3SQOH 3UCRA 2APWA 3Q2WA 1L0QA 5IQ9A 1V7NH 3VA2C 2J25A 3S35X 1DVFC 3P2TA 2EDTA 3ZE2B 4DKTA 2ZKXA 4Z7VF 5TDPA 4R2GC 4HEPA 2QGCA 2FBJH 1ZTXE 4NO0A 4HLZG 4S10A 4EUPB 5JZ7D 1L9RA 4FE9A 4JGMA 4JRYD 1AP2A 1EXGA 2Q86A 1ZV2A 2HPTA 1XSOA 4PWIA 2B77A 3QAZC 5I17A 2BOCB 2XIIA 4YS4A 3GWJA 4Z7QB 5JUEH 1JI2A 3APMA 3O2WL 4X7DC 4L4TE 1G5AA 3TNMB 1F90H 3H9SB 4WV1B 3UFIA 3QWQB 4ELMA 3DHJA 4WO4B 2I9TB 1CGTA 1DBJL 4LPUA 5L4IA 3UCQA 4HLEA 1IGCL 5KTEL 4U31A 4PV1C 4WEUD 3NCMA 3OMZA 1XSJA 4WO0A 3IPBA 4RESB 1FVDB 2NTFB 1TQVA 5EO9B 2I5YH 4BUQA 2YXMA 4G42A 4JHBA 5JQHC 3VUAA 5C92A 1K3ZA 4JQIL 1AC0A 1NBZA 4QXGH 4DP2X 4LSSL 3T1FB 1FZKA 4HLJA 3ZX1A 4AG4L 4EZKA 3CK0H 1KJ3L 1IAKA 1JPGB 1N19A 2F2HA 4J23A 4HKZA 2H32A 4L5FH 4XOBA 3U0TA 1UM4L 2HXAA 1EJ6A 4ALAL 4QHUB 1BWWA 1TMCB 3SBPA 1P5UC 3Q48A 3QPXH 4C59B 5AAMA 5HYFA 1N6QH 4YBLB 5DD3L 1LGVA 4FP8L 1SYVB 1IEHA 5TE7H 2AV1B 5EG6C 2OMNA 3C2SA 4YL4A 1CXEA 4GP4B 3GNMH 2R0WL 4YHIA 5ESAB 3V8CA 4DAGH 2VUOA 1PX3A 1IAOA 2R27A 5HHPA 1QBBA 5EU5A 1EUTA 4LSUL 5HHQB 4L9LA 1OZTG 1S5IH 3Q1SL 2IFFH 2BFVH 4DEWA 2WLHA 2XKSA 3RYMA 4F37F 1KXQA 3BEWA 2KMWA 5I8KL 4DT2A 3TO4D 5D7IA 3QWOA 3BPLC 5DK0A 4ZD3H 1PNCA 1FNEA 4NLHA 2LQRA 2PYEB 3AREB 1IARB 3COOA 3NZUA 4PG9B 2FT7A 3QULB 1D9KC 4YSRA 5IQLA 4BH7A 4NWTL 4FXKC 3STLB 5LGJB 1G6RH 4ZUUB 5GSVB 3GSQB 4FTVE 5KAQF 1LTXA 1MJUL 2FRGP 1WFJA 1DQML 3QPQC 3ZTJH 5J12B 2WXLA 5C71A 5K39A 4JPWH 3HS0C 2XBZA 3UYRL 3QUXC 4Q6KA 2VR3A 4N0YL 4OF6A 3VWKD 1ACXA 2X9YA 1G0DA 3N3EA 4XP6H 2Q3ZA 3K2IA 5GGRY 5JIIA 2JJUA 3IDIA 1QBML 4JG9A 4AUJA 4RMQA 4RDQF 1JWMA 4JRYA 4OKVB 5JOEA 4BELD 5I1DB 1OCZB 3OMIB 4X4YB 2B4CL 4DJMA 4Z3FA 1NMCB 3E9UA 3DURB 1NLBL 2ERJB 5DWUH 3W11C 2JKNA 3I6KA 2VYRE 2VLKE 3LPPA 2AJ3A 2D7OA 2IMNA 4BWUA 4NQVA 2Y9RT 4Y5VA 4Y5YB 2BSRA 2HB0A 5F0PB 3I75A 3WUWB 4IIQB 4ZO8A 3CWGA 4NHUB 4FD0A 2QLYA 3MJ8B 1T7VA 3TJEL 4FJYA 4JFSA 2BVOB 1DL7H 4A7UA 4BFIA 5FECB 5HHNB 1E3ZA 3WCYA 4WW2C 3ILEA 1FZJA 1BVKA 5IJVA 5EBWA 4ZFOA 3FT3B 3VD3A 4F7MA 3W82A 1LEGA 2R1YB 3GUTB 4ZYKB 4HZAA 1OM3H 5DC9B 5SX5K 3BT0A 2ZAGA 2X4PB 2ADIB 2ODIA 2YQ2A 1YMMD 3M1CA 4KROD 5I18H 3KDPB 4O02B 3FB6B 3RBSA 1BQKA 2LU3A 3D4CA 1UB6A 3NJLA 3UTPD 4UM8A 3WHE0 3GM0A 4N90D 3FZUC 4LGRB 1LYQA 1JPEA 1EZLA 4UAOB 1BQUA 3HJ0A 5I1EH 2J20A 2XVBA 3KGTA 3K72A 4LDCA 4X6DB 3QVAA 1MCCA 4X50A 1D6EA 3RA7H 1M05A 3VRIA 4BINA 4WU7A 2VO5A 5I71C 2GB2A 2I7OA 3O8XC 3LQMA 2AEQH 1EGJH 3IDGA 4UIKH 1MCFA 3R4DA 4BH8B 3FU9A 5HYJE 2P5WA 1RL1A 1X5XA 2IQAA 2ZPKH 3EFDL 1Z9PA 2QPSA 4EN2A 4QHMA 5PAZA 3OPZL 3A0OA 1NFDF 2EH8L 3FCSB 4YBQD 1CTNA 4WNJA 2VW6A 2AXFA 2G5RA 2PUQT 2OMWB 2VKWA 4XP5L 3ABMB 3BFOA 3LNDA 1E40A 2ZP0T 5I1CL 1WFTA 3MO1A 4NZJA 4YFEA 2H3KA 3I2CH 1M4KA 5IHUH 4MD4A 2XXFA 2AXJA 2VZVA 4AL8C 1NUDA 3T5WA 1WIOA 4K94L 1QA9B 3VWKA 4GKZA 1X44A 4B9GA 1A4AA 4G70B 2VXQL 1I7RB 2PPCA 5E6YA 4BKTC 4ZW6A 3E6FA 3WAKA 5C2UB 1ZXQA 4OFYD 4ETYA 3C87A 5GISH 5F7KC 3RNKA 3VD5A 5HSFA 3ARDB 5IW6A 2VM9A 4HJGA 4Z7VA 3IJYA 3IJSB 3UG5A 2OTUA 3QZWA 3U1SH 3WG7B 3RVVD 3JYCA 1QHPA 1G4RA 3BQUD 3PL6C 1J8RA 1YEGL 4Z8FL 2ZZUT 4XXDA 1GSKA 4ZSOA 5J06A 5IESH 4CN4A 1KIUA 4MZ3A 1NEZG 2DIAA 2FSDA 4DW2H 2DQDL 4XBGA 1RULH 2BMKB 3PRZA 4JKPH 4Y2LA 2UWEE 2KDGA 4JZOB 2NR6C 3Q8CA 1RURL 4FQHB 4HKBB 1S7WB 3CSGA 1G1OA 3G08B 1AKJB 2YRPA 6FABL 1I7ZB 3D2UD 3GXIA 4DWHA 5KYXA 1LEKA 1HCFX 2BZCA 4IGBD 1S9WB 3OR7B 4QTHA 4HV8B 4MFHA 1TKWA 4R7VA 5DT1H 3VVVA 5DO2C 2E86A 2JV6A 3L3GA 1SEQH 2E76C 4ICWA 4QYOB 4N20A 1KUMA 1EIBA 1HCZA 4YAQB 3X13A 3HG5A 4JPSA 4AL8H 2F18A 3MV7E 1A5FL 3GKZA 5JOPD 1RZFL 3U4KA 1FZOB 1MPAL 4KXDA 3UZVB 1FAIL 5K9QG 3QDMB 1OP4A 1PZDA 2VDMB 2E46A 3OG4B 3ULVL 4NN6B 5ERWB 2HLEB 2I69A 4PJ5E 5T5NF 2WXOA 3B2MA 3KPRB 3N9GL 1RZKL 4LP4A 5FCUL 2DIBA 4D9RD 2NY2D 5KJRH 4CADB 3GTNA 4I0KA 1PZBA 4CMHB 4FZ8L 2GBVA 5A16B 3ZVVA 3OR6A 4I0CC 4A6YA 3ZQ9A 3S8FB 3BEVA 1KB3A 1JZEA 3VGHA 4GAYB 3SBWA 5ECJE 1QTPA 1E3XA 3THML 2QKSA 2OSLB 3MOBL 3GSRB 4RGMB 5FWQA 4JDVA 2SEBB 4D8PB 1WDAA 1OHZA 3WXVL 4Y8AA 3ERXA 1EXHA 4TRPL 1MH5B 3SQBA 3T4YA 4X0KA 3TWCL 5EU6A 5I1GL 2F7RA 3BRGC 2CKBB 2KLRA 5IHZA 2CBTA 5I75C 3FB5A 5L88H 2VABB 2J88L 2V5TA 1QNZL 1MJ8H 1T6WA 4IQHA 2KQMA 4M43L 4MRBA 2Y07H 4ZX5A 2NY1C 4MNGE 3L7EA 4YUEL 3D3VE 1VFAB 3IGLA 4F9PA 1EHLL 1PYWA 4XAKD 1OLZA 2FHFA 1A1OB 3D18B 4HKJB 2OMZA 4IDJL 1XCTB 4FKHA 5DJZA 1YPZB 3WS3A 5JIPA 2F68X 3BQUA 5AW8B 4EN3C 1I1AC 5T8IA 5EIIA 5MP6L 1NQBA 1E9QA 2H5UA 1SDAB 3L3OA 5L7XH 1BVOA 5GS2D 5LJYH 3RVWC 4PGBB 2HX9A 4OCRH 4OD2B 1CD0A 3GLZA 4MCYA 1H15B 2GTQA 3BH9B 4KXBA 5IMOB 3JWNH 3BDYL 3RX5A 3NABL 1WE5A 5I0DA 4X4XA 5JORB 3D2UA 5IT2H 4QCIB 1CD1B 2PCYA 4MJ6B 4QHKJ 1EEYA 4XC1H 2DZEA 3EGSA 3ZTDC 4UTAH 5M7QA 4DEPC 1FGVL 3MNVA 5C07E 5A2CA 4ELDA 3HC4L 1QLRB 2V7HA 3AXIA 3WGVB 3OKEB 4OW6A 4GFTB 4XO8A 4NZRL 4K3HA 1A3RH 5KS9F 2GK0A 4RAUB 2E7BA 3VFOB 4B9YA 3SGEI 4ES8A 3QXAA 1ZT1B 2AV7B 1MY5A 4TUKL 3OAZK 4MXWL 2ILLA 1FL5A 3UJJL 4P46D 3QJVB 5GZOA 1E3FA 3DO7A 5HJ3A 3PHQA 3DOIA 4WJ5B 4LB8A 3RTQC 2J73A 2NQDA 1UEMA 4XNMB 2EXTA 4YX2L 3NCWA 2R9HC 5F7LB 5HDWA 1OAZH 1TNMA 4NM8L 4XMPH 1BBJA 1DVFB 1T66D 3KPLB 1G7LB 3BOVA 3PPEA 4HC1H 4L3EB 4NM4H 4KHTL 1AY1L 4TQEH 4URTB 4KJYB 4R2GB 3ZE2F 2ZNXA 5IVZB 3OAUL 3ARGD 5C7XL 4E0RB 2J21A 1MI5D 1VF5C 5E8DH 3MBED 2F53D 2QBWA 2HFTA 3CIAA 4KRLB 4M8RA 1QLFA 5CD5C 3QISA 5LG1A 3RHWF 1KCVL 1D5ZB 3QAZB 1PY4A 2D2CC 2K7PA 1IL1A 2BWDA 5ICXB 5D1XD 3T4AA 3SHSA 4Z7QF 5DJ8B 3LS5H 1NFDA 5MEQA 5JLZA 2VM3A 2GEEA 4AOFA 2HT2C 3MRQA 5B7EA 2PW1A 1ES0A 3D0LA 3VXUD 1RJZA 4X80H 1TENA 4LHUA 4XOCA 4G7VL 3UPCA 4PSRA 4J4PD 2X4NA 1B9ZA 3QZMA 4FQ1H 1THAA 2R0ZH 3IN2A 3LXCA 4LLMB 2ICES 1UH3A 3DVGB 5F3BB 3ZU8A 1PIGA 5AKSA 1BPLB 4C8XA 3ARTA 2IG2L 3N40F 5T3ZD 1E8WA 4JG1H 4O2CA 5ENWA 5JXED 4PJAE 2IDUA 2DQFB 5EZJB 2CDFA 2NZ1A 3SOBL 1ZKAA 2NXYD 2WGNB 1OTTD 4R4BB 4OJFL 3U2SA 1W0WB 2X1WL 1QEWA 3IEAA 4IBVA 3S8GB 4XBEH 4O2FA 3EYOA 1TQCB 2H1PL 1S3KL 3ZT6A 4AEFA 4OZIF 3MRRA 1AGFB 1J1XH 2EYTB 4LAJH 3UMNA 1JN6B 2FQFA 1EAJA 3S5YA 3HE6D 1BAFH 3GSUA 4ONFL 4PJFE 3VQMA 1HOEA 1D7DA 4DKFL 4LLWA 3NK4A 1KY7A 1XD0A 3LS4L 4LNRA 3EJQA 5AYQA 1J5IA 4P46A 1D9KB 3QDHA 1P4BL 3CVHB 1WHPA 1Z9NA 2Y1ZA 5E51A 2DWYA 3EYVA 4PRHE 4XOAA 1F1AA 1G7QA 3K8MA 3WFHB 4GBXC 3U0WL 1MJJA 2F9BT 5JQIB 5KBDA 4OB5L 4BZYA 3GBDA 1XAKA 1VGKB 3MLVL 3ZDXF 1F4HA 3QJHB 1BZ7A 2BIHA 2OX5B 3NP4A 2BNQA 4OLYL 4PJ9C 5TE6H 1CQYA 3OQ3B 3ZYOA 2Q7YB 2R69A 1NFIB 3NRPA 4JFFB 3SN6N 1WISA 5IVXE 4UB0L 5B1KA 1GJIA 1RQ5A 2EO1A 5FDWB 5BRZE 2R7EA 3BZ5A 5LBSA 2VM4A 1ZVSB 2F53A 4BCYA 3GHEL 4ZMZA 1UGKA 4ACTA 1INEH 2JKWA 5DTFB 5F0JB 2N7BA 2HSIA 3RPIA 5TQ0L 3T2NH 1JZ5A 4UM9A 4ZFGH 3TP4A 4F27A 4HZLB 1I3GL 5A6MA 4X9IA 2JCCB 4KTGA 1KCKA 2ICEA 4HLZH 5DEFB 5ILTL 2H8PA 1RUAH 5ANHA 4EBQH 1ETB1 3DROA 1DFBL 3GDCA 1BQHA 5M94B 5J57B 1B9KA 1OAYL 1Z2KA 3V0WL 5IEHB 3H2WA 2VDQB 2X87A 4J4PA 1BLIA 1DE4B 2VDLL 3MFFB 5B1AB 2D4DA 3QEGH 2BXZA 5E8OA 1QFPA 5I1IL 4MYWB 3QJOA 4XP4H 2WUCL 4DKDC 2F15A 1AANA 3OQRA 2IOIA 1AGEB 3QRFM 4LIQL 3DETD 1FV1B 4V11A 4KHXH 5DFTA 1A8JH 3EJUA 4F58L 2X10A 3ALPA 2Q8BH 3TBVB 2F58L 5L8JB 1F13A 1C5BL 2JI3A 3IBEA 3T8MA 2AI0L 2HG0A 1TQTA 4N9GA 5EIVA 5CZKA 2VN3A 4RAVB 1AQKL 1GZHA 1QRNA 2OXGB 5MERB 1OCWL 5T1LD 2RAMA 4GRWB 1Y0LA 4Q9RH 1E27A 1A2YA 1WPCA 3FN0L 4MB4A 4M62H 2P1YA 3TN0D 2ZUQB 4NSKB 1Y6KR 4GSQA 5AW6B 4JFZL 2R4RH 1SHXA 1ZLUK 4RBPK 1P6AB 2I9LB 3FFCA 2F08A 2E27H 2QELA 5I71B 1FP5A 1OSPL 1UQSA 4DPRA 3HE6A 5C0BB 1QSEB 3O3EA 1MHPL 3PP3H 3AUVA 3JWOH 4M7JL 1X6LA 3O6LL 4WLCA 1CTMA 3BWZA 5E99H 1ETA1 3CFKB 5SWSE 4QHLA 4NZ8A 3PAYA 5KS9A 5AB0A 3LHPH 4MRCA 4XN4A 4Z18A 2CJ3A 1T5KA 1YMHB 2IGFH 1ID5I 1MXDA 1PAMA 5JW3H 2IADA 2FO8A 5FGBA 3GRWA 1CBJA 1HJCA 2H2SD 1W72H 4PCYA 1E6JL 1HINL 4PRIE 5ACZB 3P30H 2W0FB 1K85A 1NAMH 1QP1A 4ANVA 3U7WL 5FPIA 1X3DA 1RU9L 4AV4A 3AWFA 3FTXA 2DLFL 4ODVH 2J56A 4PN6A 2LLNA 3DUHA 5AYUL 4H2CA 4YXKH 4G8EB 4OF5A 2K8QA 3FPXA 5T1KD 4PCTA 2VLLB 1LO3H 4LK4A 1RAMA 1D6VH 2O6FA 3SE6A 3QFJB 3SKMB 2P7TB 1DZBA 4JUSA 2J6WA 1LO4H 2BOCA 4N6RB 5CBEB 4NCDA 3O4OB 2QV2A 2JFCA 3HZVA 3Q9QA 1AQDB 2FX7L 3H9SA 5DGRA 3U36B 2F54B 4CUCA 4XO5A 2GUYA 2I9TA 4J3WA 4F7TB 4DCQA 4I18A 2EDEA 3G6AB 4TTDD 1F8TH 3HZYB 4XN8A 3ESUF 4JFYA 2VDOL 2IPTH 1CO1A 1YUKB 4LVHC 1FVDA 2NTFA 2NXZC 4ZUTB 2HVJB 4OI9A 5EBLB 4MQSB 3T0ED 5IBLD 1A7PH 2NYZA 4K7PY 2E9BA 4NCC2 4LEOB 1I53A 2VXVH 3NDZE 2A74B 3MGOB 2O4EA 1JPGA 2AJUL 2X1QA 3T6VA 2HWZL 4M6OL 3L4ZA 4L4JA 2YGQA 1OE1A 5AWNH 4E41E 2WOBA 5FLVA 2I60L 1TT6A 3TN0A 1AOHA 1XB8A 3AACA 2Y7QB 4PJ8D 3TH4T 3T0DA 5I6KA 1SYVA 2P5ED 3MOAL 2AV1A 1CN4A 1ODUA 2C3VA 1HZHL 4AUUA 3S36L 3WDJA 3U6RB 5ESAA 3ETBF 5IB3B 4ODTH 2MKWA 2CA3A 4OZIA 1C16B 5HHQA 3KG5A 4OGAC 1ACCA 1V3LA 3LQAC 4YLCA 5TDNA 2NYKA 32C2B 5DDHB 4M00A 4NUPA 2DPKA 4K7PL 2X4SB 1DDTA 2CD0A 4RNRB 5KSAD 3TBWB 5LQBH 3HE7D 3O2WH 2PYEA 4HAGA 4WK4B 1DQJB 1H8NA 2WWMC 4OFIA 1FE8L 1EJOL 3QXWA 1FO0L 2A9ML 4MZ2A 1ZEAL 3STLA 1DBJH 2NY1B 3L6FA 1DQTA 4PS4L 1IGCH 3QZBA 5KTEH 4PY8J 2FIKB 1XCQA 3VXRE 2DH3A 2ZAHA 5CZRA 4DERA 1S78D 3RWCB 5C0CD 4JQIH 1YCSA 4HWEL 1BF5A 5SV3A 1NDGB 2VDPB 4LSSH 4B9FA 5ALBL 5T1KA 4AG4H 3BZ4B 4NENA 3H7BB 1KJ3H 3IDJB 2UV3A 5TF0A 1J1PH 5D1QE 1LILA 4O4YL 2X88A 3CFBA 5L2KB 4NRXB 5IK3B 1T7ZA 1UM4H 2YPVA 3TBYB 4ALAH 5I1DA 3QH3B 2XDHA 4WI0B 2OI9B 1YYLL 2NT1A 1T2QL 4KK8D 4XCCL 5DD3H 4FP8H 3DURA 1GJWA 5GXBB 2BVQB 1XQ4A 4LSDA 1HX0A 1KPRB 2HKFL 2R0WH 5KUMA 4BV1A 4ZTOL 3BDXA 1XZWA 3MCYA 5KYUB 1B4TA 4H25B 4P5TC 4DEPB 4LSUH 2IXQB 4QTIL 1EAPA 3QUKB 3Q1SH 2ZWLT 5KBLA 2A9AA 3WUWA 4IIQA 1S7RA 5T3ZL 3US9A 5E5MB 3AQZA 1UWEL 3VFWB 5TK4A 3TV3L 2FGWL 3EDEA 3II2A 5HHNA 3BKCL 1KJMA 1AVAA 2OR8A 3F62A 5BZWB 2D7TL 1BYNA 3FT3A 2OCFD 1TTGA 2VLME 3W9EB 3P3SA 3ECBA 2LV4A 2CDEA 3B3BA 5EU7E 4ZYKA 3QXTA 5C9JB 2H9GB 4KVCL 3KPMB 4JQVA 4ZUVB 2X4PA 3IK2A 5MI0B 2ADIA 3H3BC 3RBGA 3TC9A 4PJ8A 1MJUH 3FT0A 4YHPA 1DQMH 2B0SL 3QNYA 4DGYL 1ITBB 1AIZA 1OSZB 5EF3A 2PWEA 5D70H 3TX4A 3QHTC 3UYRH 2HJFB 1F1GA 2BNUB 3OKOA 3P9LB 4IHOA 3ZHNA 2ATAA 1WS8A 3DYMA 2FTAA 2PO6C 1PY9A 4RDBA 3UTSE 1B90A 1NBYA 5AEAA 4NIYE 3VD4A 1CR9L 2OW6A 4H44C 1NCWL 1QBMH 1P84K 1CLOL 3GMOA 3F83A 3BLPX 1DVSA 2ISDA 2B16A 5EUKA 5JHDD 5J1TC 1AG6A 2B4CH 2EEXA 4XVUC 2GTWB 2X0UA 3WV0A 3HVDA 1W2KT 3NK3A 4IRSB 2WXKA 1B6DA 3HG1E 5C8JB 2UZXB 2VMJA 3IXTA 3FCSA 2C9PA 3HUJE 4HIJB 4IK6A 3KVDD 4KFZC 5DJYA 1WWBX 3UJTH 1S46A 5CXPA 1UCBL 2XKNB 2GPZA 4PBWD 1QA9A 4PJHB 1R9FA 3GJFK 4PYHA 1YEKH 2EKJA 4MMYB 2UZIL 3P4MB 1N67A 2JQMA 2D2OA 3ARDA 4BDVB 4P5KA 4GKSB 4E9SA 2AK4B 3IJSA 1HI6A 4LCWE 1PFCA 2XTLA 4Y4FC 3D33A 3D50A 4GQZA 3AM8C 3N42F 3U2IA 4RFNB 3WKNA 3DYPA 1HQRB 4DGUA 1RVFL 1E5CA 2IH9A 4RX4D 5I1LA 4LPCA 2X40A 2BMKA 2YN3A 4PPTA 3UBHA 1MEXH 3RVUD 1OTUD 4M1DH 4AYEC 5J6SA 3FXIC 4HD5A 2ADYA 3HN8A 3NFPB 3V7MA 5B22A 4NJAL 1I7ZA 2J5LC 3H42L 4YSDA 3B9KC 1TO4A 5AAWA 4EIBA 4CVZA 4HV8A 3MDJA 4IMKC 3QDGD 4KKCC 1CCZA 3EFDH 4LP5A 4QYOA 1U6AL 3OPZH 4RH4A 2EH8H 4YAQA 1SUJA 2DEXX 3D07A 3ZKXC 1K4CB 3TZVD 3LKPB 3VSQA 2WBJC 2CHWA 4XP5H 4IU3B 3W38A 4G71B 1UCTA 4UOW1 2VSCA 4Q74A 3LEXB 1G43A 1FZOA 4IIZA 4PJ9B 4HHAA 4OZHF 1J87A 1MZYA 5G5DB 3UZVA 5KZCD 4K94H 3QDMA 4XMTA 1TF4A 4P2CG 1KIQB 1PKQE 3DVNB 5CCJA 2VXQH 2Y1YA 3BVTA 1I3VA 2Z7UA 3RX7A 3UADA 3FH8A 4ZFQA 5I82A 3X2QB 1QFWM 4CADA 5A16A 2VLJE 4HUXB 1QTSA 4X7TA 2J57A 1YEGH 3BQVA 4Z8FH 1ODAA 2W65B 1MF2H 3HI1B 5FO8A 2E56A 2PWFA 5JR1L 3LPWA 3VRLE 1K8DA 2OSLA 3GSRA 4BSVA 2JCCF 3ZE0E 2DQDH 2E9GA 2SEBA 5EB9A 1RURH 1KCBA 2MOGA 2O5YH 2VR9A 5HJBA 2XRAL 4UQAA 5D7JB 6FABH 2YK1L 1OAKL 1U3JA 4PP1C 2VABA 2CUAA 1J0YA 3HB3D 1GGCL 4MA3B 2XV6B 3NUKA 3WIAA 1VFAA 4AK1A 3QORB 3FONB 3D18A 4HKJA 3F8UB 4GO6B 2ZOLB 1MRFL 1E9PA 1XCTA 2X4QB 2WXJA 5BZDB 1IT9L 2ADJB 2X1OA 3ZTEA 5BQ7A 2WQXA 4Q9QL 1A5FH 1IGYB 2QPUA 1HILB 1RZFH 5IZ7A 1JXGA 3NH7L 4N2CA 1Y1DA 3HMXL 2WWKT 4RX4A 4ZMTA 1MPAH 1FAIH 4GRWF 3FSZA 4OM0L 3VWJC 4PGBA 2FEEL 3EIFA 3G6DL 3C6LD 4DQAA 5BXFB 3R1GL 1H15A 2QSVA 4TV3A 2Q6WA 5IMOA 3IMSA 1YJDL 3O3DA 2IH8A 1T80A 2YXWA 1XF1A 4B9ZA 1RZKH 5FCUH 1LNUB 4D7BA 5DYFA 3F7LA 3LY6A 5E4OA 1P53A 2VERN 4FZ8H 1CD1A 4QCIA 4MJ6A 1Z9SB 4Q9CA 4IEFB 5ELIA 3MJ6A 2WQVA 2XQYA 2XWDA 5HHXL 4JDZB 2LT9A 3QDGA 1PKOA 1MFBL 4IU2B 3OKEA 3THMH 3BGMB 3LV3A 3KWXA 5HGDB 3VFOA 2BW4A 3WXVH 1A02N 3FRPG 2AV7A 4TRPH 2OXHB 3TWCH 5I1GH 1U8PB 3TVMC 3MROA 1YHPA 2YD1A 2J88H 4HKXA 4WJ5A 1QNZH 4M43H 3OD3A 4XNMA 4YUEH 2ZG2A 1WG3A 4NJ9L 5C7ZA 4QKXB 5FA3B 3QDJD 1IBYA 3CZUB 3KPLA 2NY0B 4L3EA 1E9OB 1TZAA 5IVZA 2ENPA 2A7BA 1T1ZA 2DWDB 3ASOB 3KGRA 4E0RA 1UT9A 5MP6H 2TAAA 1YRKA 2WJ7A 3PAUA 3Q3GA 3BUTA 5AQ0A 4MYPA 2BRRL 4F2FA 1PMYA 2WV3A 3MUY1 1AR1D 4OLEA 3U46A 1CLCA 1QATA 5EEZA 4IK7A 5ICXA 1KTBA 4FFVC 4OD1L 3Q6FA 3BDYH 4AKPA 5DJDB 1PJ9A 2X42A 3NABH 4HISA 3S6CA 1J5OL 2A1WL 4QRPE 5J11C 1ERNA 4G2AA 1B0WA 1J8SA 2YO3A 3DHPA 3IWUA 4QRSB 3ZUCA 4NKIL 1NGPL 1A3ZA 1A9EA 1KJ2B 4XO9A 1QFUL 2JE8A 1FGVH 2VSDA 2BSBA 3HC4H 3QJZA 4AY0A 1X9RA 4KNSA 4AJYV 4LLMA 4NZRH 4PJ7B 3RUGB 2VLRD 3DVGA 1DUZA 3GMNB 4PREB 2IBZX 4BK8A 3WHXB 3UAAA 2RCSL 2ZG3A 2PWGA 2K9UA 4FI7A 3RDTD 3UJJH 4YSTA 1CFSA 4JRLA 5F1OB 5ANMB 5IBTL 2P8LB 1F41A 1TVBB 5IB5B 3P77A 5I23A 1NC4D 1F4YL 3MLRL 1WQVT 2DQFA 5EZJA 4MJID 3ARQA 4PGEA 4IBSA 3WFBL 4YX2H 1MW3A 4ECNA 5AKVA 1TTBA 3MCLL 1VSCA 2BRQA 4NM8H 1ZPUA 2V9QA 4NZFA 2Z31D 1W0WA 5FFLA 4HJUA 4OZGB 1F86A 2D3JA 1OAXL 3CGTA 2BSCA 3KPNB 3RGVC 3RY6A 4JFVA 4JFQB 3OAUH 4NQUA 5C7XH 2Z92B 1E5BA 1L7TL 5D72H 2EYTA 5FOJA 3NSYA 1B2WH 1RSFA 2YPLE 5C0AE 3V79C 3B2UC 1KCVH 1T03L 3L1EA 1O9ZA 4JO1H 4LSTL 2A38A 4BGLA 2DQHL 2UVEA 4AI7A 3D06A 4UZUA 4B41A 2Z65C 2OTWA 5CSZA 2WGXA 4KQ3L 2ZJSL 4P48A 3NEEA 4PMFA 3VXSB 2K70A 1D9KA 2TSBA 2CO7B 1KGCE 2EE2A 1XF5B 2ZUTA 2D0GA 4ADJA 1KTKE 3WFHA 3MN8A 4UBDD 2R56L 1WYJA 1R3HB 2KZ1B 4OIBA 3ZR5A 4G7VH 3IS1X 2HCZX 5C08D 3IAQA 1BXUA 4OV5A 1MCNA 4OZHA 1VGKA 3CHSA 2YS4A 3OKLB 3QDJA 5GJSH 4CMMA 5BJTB 1JGVL 3Q9PA 3C6EA 4KKRA 3VMPA 2Q7YA 1NFIA 4MVBC 4A2EA 2ZKMX 1W80A 1MHHA 1BW8A 5J6HB 1EMTL 5FDWA 2IG2H 4UYPA 4YDJB 4KKAC 3VSVA 2AHIA 4P06A 4FNRA 1XH2A 5FO9A 5TGBB 2DYRB 1KN4L 3KPTA 3ZMNA 4P04A 4LLDB 4OU3A 1WA0X 4QI3A 5GRVK 3VI3E 4B95C 3NJNA 3DMMD 4JKLA 3SOBH 5SWZB 1CXHA 3UDWC 1JF6A 1EZVX 4FX5A 2JCCA 4HS6A 4OJFH 4BFFA 2L04A 4AZUA 5I5JA 4JGJA 2E75C 3WS6C 4UT7L 2WZ0A 5F9OH 2Y7OA 4F1SA 2H1PH 3OGCB 5E03A 2K1MA 4WFGD 1DE4A 3MFFA 4YC2B 2F8XC 1PDKB 5HGHB 1J8HE 2EE6A 2WNKA 4ONFH 4ELKB 4X8GA 5E4AA 1R3JB 3QEQE 4DKFH 2PR4L 2J2ZA 3LS4H 4EQ3A 1AGEA 1XWVA 4GG6B 2FWLB 2UVFA 1FV1A 2BDNL 3BYTA 1ETZA 4KTDH 1D5RA 2NDFA 3PQYD 3CLEL 3D8MA 2RGSA 3B9VA 2WNXA 4HIHA 5E00B 5I74B 5CP7B 3BUQA 3D39B 3BN3B 4DVBB 3NSDA 2YD6A 1YEWA 3QHFL 4MJIA 2QVIA 3FCTB 4HOXA 4OB5H 4TF4A 4DIXA 2OXGA 2WOYA 5EFIB 4FG2A 3MLVH 4YPJA 1NINA 4OLYH 2Z31A 1E42A 3WNLA 4BE6A 2PO6B 3TJHC 4QRQA 2GSMB 4NSKA 4HIEB 4XX1E 3VXNB 4X4ME 5IB1A 3SDCD 1KELL 1T1YA 4H26A 2I9LA 5E1GA 5MENE 4NB7A 5D2NA 4L3FA 3GHEH 4OFKA 4FQXB 4W6XB 5F3HB 5I6XC 3LRKA 3U2JA 3VMNA 1ZLVK 1ACZA 4YDVB 2XACC 1QSEA 4GAJL 2X5PA 1KZYA 5TQ0H