4PN6A

Structure of the cytomegalovirus-encoded m04 glycoprotein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
167
structure length
167
Chain Sequence
YRHPLGCYFKGINPTKVPSSGSHTILKCTLPVVKVNASWTLEWVVVKLQNSVDVTSYYESSPNSGPTFLRAILNFTPMHGLRTKNLLKVKDGFQVDNSTDNGNGGNLYVYPNATTGSADSVRCRLRMCPWTSNSKMTAPDEEMLRKMSEVLNLPNYGVPDLTPPRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M04
publication title The Structure of the Cytomegalovirus-Encoded m04 Glycoprotein, a Prototypical Member of the m02 Family of Immunoevasins.
pubmed doi rcsb
source organism Muromegalovirus g4
molecule tags Viral protein
total genus 33
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2900 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pn6A00
4PN6A 2MIZA
chains in the Genus database with same CATH superfamily
1AJ7H 1HU8A 4Q9QH 3N0AA 3VXME 3R06B 3VM5A 1UM4H 3DHPA 2YFNA 1W80A 2DPKA 1ADQA 4PR5A 4XNMA 4EXPX 5I6XB 4Q52A 4F9LC 5FF6B 4JAMA 1WPCA 4RISL 4YHLH 1H8LA 2D9QB 2V9TA 2VH5L 2OULB 1ZGLA 4TQEH 5BJTB 2PP9A 5LWYH 3CZKA 1SJHB 2DY2A 4IOFD 4W9KC 5EC1B 5J1TC 2LLNA 5DVMA 5TF1L 2V7NA 1CXKA 1PDKA 1CXLA 5GRUH 2WIIA 2WHVA 2BSDA 1LO2L 2CJ3A 3ZN6A 3GXMA 4BZ2A 3UJTH 3RB7A 1BWMA 1D5RA 4GRLD 3C5ZA 1OGAE 4NKMA 5IIEB 2B8OT 4P06A 3S5LB 4D9QE 1RJYB 5TDOB 4OCSH 1HI6A 3PNWB 4NWTH 2CCLA 1VADA 1HZLA 3R8BB 3T6VA 3BUYA 1SHMA 1KYUA 5DD0H 1F5WA 4LLQB 4OGAD 2Z35B 4GQ9L 4ACTA 1QBBA 3MCLH 4AYEC 3GEFA 4UCFA 4OUUB 1USZA 5K59F 2CQVA 4U6HB 2H0FA 2C4FU 4Y8AA 3HG1E 1IFRA 1RULL 2X2UA 1JHKL 3DX3A 4J3OH 3IFPA 4U6XA 1NMCC 3U25A 3VVVA 2DQHL 1MVUB 4KGJA 3ULVF 3GHEL 4BKTC 1IEBB 2CR0A 5DJZA 3QORA 1XGYL 4WFED 3QFGA 3CVDA 2AABH 4JFOA 1KYOK 5IQOA 5CINH 2FR4A 4M62L 5ESAB 4OFYD 1OP5K 3HBQA 5GRVL 3WLBA 2CKBA 8PAZA 1ZTXL 1A7RH 3OZ9H 1NCAL 5A2FA 4XCEA 5HVWA 5DRXA 1BBJB 2PTUA 4MGXA 3TL5A 2IMMA 4M1DH 4M5TA 1AGFA 4P2AA 4E9YA 1KGWA 2BLFA 3E80A 3PWUB 4HJ1A 3IBOA 4PVLA 4ZOEA 4DP7X 1MHEA 3GS7A 4KKCC 4G7YL 2ID5A 4YMPA 2CJTA 4XMZA 3PWNA 1N7ML 5C0CE 3S3DB 3WKMH 4YX2L 5FO7B 2K4AA 1AKPA 4A7SA 1QRND 4XOEA 4QHUB 3V0IA 4XAKE 3PDDA 4XPFL 1A8ZA 1LM8V 3GZOA 3Q2CA 4MMXA 5F9WB 3FO1A 3HZMA 5B8CC 2WWMC 4MNGB 1PAZA 1XGUA 3ZHNA 4JFED 4RGNC 4R0LC 2MKWA 5C0JA 3Q6GL 3OG6B 2WZ6A 4OGYL 1J9RA 2ORBL 3ZTNH 1E5ZA 3B4NA 3B7UX 1S7QB 1DBAH 1AOHA 4IRZL 3VAEA 3FU3A 4ZXBA 1F6FB 1QSED 3MUZ1 3C8KA 4OJFL 4YXLH 3SE8H 1K8IA 2VL5A 3PJSB 5LG6A 4FHJA 4R26L 1DJYA 4YDKL 4V1DB 5IJVB 5DMIL 2V5YA 3O2VH 2AANA 4ZJ9A 2FX9H 5HHOE 5E5RB 4B60A 1AY1L 4Z0BL 3OAUL 5FO8A 3OC8A 2P5WE 4EKXA 5J12B 4RAHA 3B9KA 5I28A 1WA2X 4N2FA 4XPAL 5DMGD 4IS6A 4GB9A 1AGCB 3L1GA 4ZFOB 4FZEH 3FFCD 5EZJB 1FA4A 1X5HA 2VZ1A 4UM8A 4NP4L 3HE6B 2I27N 4M9OA 2EDLA 2TAAA 2P44B 1Z9SA 3L3JB 2VXVL 4J27A 4APQC 4Y0GA 3MPCA 1IM9D 4MB5A 3EYVB 4ANWA 5JOFB 4Y2DC 2ZX7A 4KI5D 4M6MH 3VDCA 2QHRL 4QKTA 3GSVB 4G5ZH 3U7WH 3V0JA 3VACA 5F3BB 4PJBB 2OK0H 3DTXB 4OTXL 5I6NA 4ICXA 4LSUH 4K9EL 1YVLA 3QA3B 2HLEB 2OMYA 4KTDL 4Q9RL 3HS0C 3ZE1B 3PY9A 5IT2L 2O4EA 4L4VE 1MH5A 1INQB 1QFWI 4YS4A 4YZFF 1FH2A 3VYPA 1IX2A 1L9RA 1EPFA 3NESA 4LB8A 3C09B 1NFDF 3FQNB 2OJZH 3RJDA 4E9RA 3MNZB 4ZTOH 3MXVH 4IJ3C 3RHWF 5IB5B 3CMOH 3QDMB 1ETZB 4N6RA 1THAA 4Y1AD 5DWUH 3MACL 3S5YA 3VJ6A 3ZIMA 3QEQD 1J87A 3NCYP 3QUKB 4RMVA 4U2ZA 4TVSa 3LKOB 5D4JA 1RZ8A 3N42F 1P7QB 2ZPKH 3QQ3B 4X6EB 4F93B 1YDPA 1NCWH 4B9YA 4KI1A 1NDGA 3T3PB 1J9TA 4G9FA 1EJ8A 3OGOE 1UA6H 4ELMA 1OP3H 4PLKD 4X4YB 4ZAKA 3SPIA 3DOSB 1MEXL 1M7XA 4WW2C 4XXCA 5LCVH 5KG9A 4YPGA 4Y19B 3TN0A 3VWJC 2GK0B 2AMUA 2WUBH 4A04A 1IRAY 2GCYB 2JK5B 1VKXB 2WLLB 2WXRA 4DCQB 1JVLA 3BKJH 4O2FB 3KL0A 4PV9A 1H8NA 4PJFF 4MMYB 2FSEA 1AD0A 2GJZB 2F19L 4GBXA 4HLZG 4XCYA 4Y5XB 3M88A 4IBUA 2XYBA 4BYHA 3ZR6A 4MCNA 1GS7A 3HAEH 1UJTA 2DWDA 3FT2B 1KLGA 2OTPA 1WA1X 5KYYA 5D1XD 4LSVH 4DP2X 2D7PA 3RIAK 5E2JA 5F3HB 2A73B 5DJAB 3B2VH 1U3HD 4KRLB 1YJDL 5I8EB 3GSWB 1UFGA 2O72A 4ZUVA 2Y36H 5IMMB 1NCCL 3MRMA 2MRYA 5L2JA 1LO0L 4K07A 2QFRA 4D8OA 3ZKXC 4FQLH 3BKYH 4MX7B 3S36L 5CLYA 1I31A 4D3CL 2P52A 4JZNB 3FK3A 4O02A 4K7PL 3FL7A 1KTBA 5M7QA 3MU3A 2OBGA 5LLIC 2WXOA 2BS9A 5FECA 1ORSB 1P9MA 4WTQA 4P5MA 2VITB 5LN4A 3Q5TA 3H3BC 3H3KA 3BVNA 3RJOA 1I1AC 3QPXL 3DVNA 1TZAA 4Y4FC 2XG5A 1SYSA 2EC9U 4I9WE 1H9DA 4OCWL 5IB3A 4S1RL 4MQSB 4TKWA 4AXWB 3G6JF 5CAYB 1YYLH 4PJEB 5SWQA 4DFIA 3QQ4A 1KXQA 3I50L 2IGFL 1F1AA 2ZOLA 1FNAA 2J6EA 1AGBA 1MCLA 4XCFL 5DJ0B 1ZWIA 2ITDA 4KWUA 1O6SB 3MRBA 3EGDB 1A4JA 1FZMA 3WIHA 1U8NA 3N43B 3M46A 4FQCL 3PQYD 5FGSA 3V8CA 1UD3A 3VGBA 1KT2A 4Y89A 3GSUB 3KPSB 3OMNB 3MJ9H 5B1JC 5J06A 1LP9B 3BZFA 1NBCA 2YPLE 4NQSB 5CEYA 1PD0A 5GGQH 5I8OH 4RZCA 5D55A 3IDMB 1LMIA 2F18A 4C4UA 1GGUA 3I6SA 2BCMA 2FJHB 2V3DA 5T33H 5EO9B 2BNQA 2IVFC 4LOFA 3VI3F 3T0EE 4XN1A 2CXGA 2LTQB 5I5RA 3CFCH 2PLTA 3H1ZA 4JUTA 4G8GB 5KVFL 4PJIE 1MNNA 1H19A 3ULUF 2AFNA 1NBZA 2Y22A 2P8LB 1P1ZA 1L3NA 1U8IB 1KOAA 2V8MA 4LF3B 5E1HB 4XTRC 2OMTB 1M1SA 1FN4A 3D39E 1DO5A 3ISRA 3EHBC 1YMHA 3U0PA 2MIZA 3RDTD 4PVNA 2BX5A 2D0FA 3NFNA 4PP1D 2CUIA 4Y1SA 3VFWB 4PRDB 4S0TD 4EIGB 1F13A 2AC0A 3T2NH 1OD9A 4URTB 4M4RB 3IU4L 4JFXB 3RIFF 2YSSA 3D05A 3X14B 2PPEA 4QJ5B 2BOCA 3L16A 3QIBD 2H8PA 2XQYG 5T5FL 4JRFA 1EDQA 5TGBA 3LQMA 2VAJA 2J6WA 1EV2E 5AW7B 1F8TL 4S1DC 3BFWA 2J72A 4Z3EA 4OF0A 4KRPC 3D4GA 4IBWA 5B1AB 4PCSA 1E65A 1R5VB 3O81A 1QFHA 3CZUB 1DN0B 3MV8D 1FGVH 5ELIA 1G6RL 2DAVA 4QO1B 4GG6A 2HAZA 1D9KD 3UEQA 1YUKB 4X7TB 2I85A 5A2CA 1A5FL 3ISWA 3CLWA 2WUCL 2L0DA 3CZGA 4GINA 2ENSA 1AD9A 5CU9A 4DZ8B 1KFAH 1N18A 1OL0A 4MMZA 2UZYB 5C0AA 1VENA 2N59A 3WFCH 5DJ2A 4TXVB 1RHHB 2V0AA 1QWUA 4AG4L 4A2DA 2IDQA 4KKPA 4PJCE 5D7LB 4NUJB 1DDTA 3BH9A 1AP2A 3LRKA 1FHGA 3OSVA 4I77H 3BWUF 1SN2A 2D3JA 1NFIA 3EJSA 2ZSWA 2DJSA 5L4JA 5J13B 1OP9A 2OXGA 4LEOA 4N68A 5I17B 1YNLL 4AW4A 4UOW0 4MJJA 4JGUA 1FNEB 4P04A 4UILH 2XTJB 1M9WA 2ZCKH 3L5WB 2ZAIA 5IROC 2Y25A 1ZE3H 1CLZL 1JZIA 3BDBA 5MENA 1XIWB 2OX5B 3FS9A 1PU0A 3SD5A 2FWLB 1C8QA 4YC2C 3BPLC 2HJKB 1XF3A 3C5SB 4H88H 2ALWA 2JF1A 5DEGB 4XMPH 2DLHA 2OLDA 4J12A 1NMBL 5IREA 3DV6A 4KVPA 5K9KA 1F0LA 1V05A 1GOFA 3MOAL 1HCYA 3GB7B 3HRZA 2NW2A 3V52H 3D34A 1G1OA 1S9YA 3NCWA 3EYQC 1M53A 3IETB 5EZPA 4MNQE 1SBBA 4JO2H 2FIKB 1A6UL 2MPAH 1CQYA 2FJUB 2JJTA 2AXGA 3Q0HA 3TT1L 4L37A 5I74C 1A7OL 4XR8C 4WUKH 2ZXEB 5F88A 3N55A 4R8WL 4L3EA 2EDQA 3NUKA 4U6VL 2VERA 4YDMA 3S37X 1W8OA 2WKGA 5K9JL 2YD6A 5J1SC 3MLSL 3DURA 2AF2A 3CV5A 3WXWH 4ABVA 4HJEA 1KGJA 3OGCA 3BH8B 4WEBH 1S7RB 1UXWA 1QBMH 5CHNA 2VDOH 3AY4C 3QSKB 1KENH 3QCUL 3F3HA 4CKQA 3U4BL 4Z3FA 2B1OA 2G2RA 3PG2A 3RTQB 5FGBA 3ARFC 5DD3H 4BKSC 3VNZA 1A9BA 1KCUH 4KROC 1O7VA 1WT5C 2R0KH 5HGHB 3MRRA 1YQVL 3K72A 1J8HB 3LEVH 3JT0A 1HDMA 4ZUSA 3E0GA 2AK1L 1HL8A 3RUGB 3MOQA 4HGWB 4AGLA 1YC7A 3D2TA 3OZKA 2D2CC 4OM0L 5G2NA 1VFBB 2VDNH 5CLWA 4M6NL 7FABH 1XD1A 4HAFA 2IAND 3LQAC 3Q8FA 5T3XE 3GD1C 5FGRA 4XC3H 1BD2D 3CFNA 4HZLB 1RUQL 4JRYD 5D1QB 2M83A 2VLRD 3PABA 2IPUK 2J8UB 2VDKH 3FB7A 4YHIB 1ZLUH 2BFVH 5KSVB 2VWEE 4G6MH 4HHGA 3NIFE 4KVCH 4XO8A 4Y1TA 4ZX5A 3SJVE 1C16A 4G82A 2W9LA 1BW8A 2W9EH 4NQEB 3QIWA 4FYTA 2YN5A 4A67A 4PRNA 3VGAB 5L8LB 1COBA 1NICA 2EO1A 5HVFB 5F7MC 2X7LA 2QZQA 1G87A 1EGJL 2CLVB 3SGJC 4DW2L 4OR1A 5CIPB 2XXMB 1S9XA 4P46D 1BM7A 5TFSL 3EBAA 4IIQC 2R39A 5DQ9A 3PWPE 3CHXA 1QR1A 2K3HA 1DQLH 2RQ8A 2VC2B 3O2DH 3BZDA 4H20H 1JPEA 4OFIA 4PD4J 4DN4L 2GEEA 5BOJA 4HOXA 3HI1B 4WW2F 2R1YA 2Y7NA 4IBVA 5DI8B 3N85H 2AQ3A 5D1ZA 1I8KA 2XOTA 2JXMA 5KSAD 3DX6A 4BBWA 3ESOA 4N0CC 3VU1A 2ZIDA 4DEWA 3MV9D 4YWGL 5EG6C 1FH5L 4U3CA 2DM2A 4JPQA 2HFEB 2Z8VC 3CSTA 4FXGA 4NT6A 4OAWA 3S97C 4YHML 1BXAA 3L3OC 5JOPE 1Z66A 5G5DA 5HHMD 1B2WL 4WFGE 4JVUA 5GGSA 5CCKL 1PY4A 3EJJX 3ZHFA 2BIQA 2DOCA 5F9OH 4HKZA 5E24E 2EADA 4EZKA 5I19L 2FO4A 1HHJB 2XZAL 5TK4A 2FQFA 1URIA 1O6TA 2GC4C 3QUYD 1WZKA 2DWXA 1HHKB 4X4ZA 2WCGA 1I1RA 2BVEA 4JDZA 4PV1C 4BE5A 3S8WA 3VSVA 3GIVB 2R69L 3TVMA 2AJSL 1I8AA 3D1MC 1ZHBA 1ZHLB 3IDGA 2VRKA 2RFXB 2W0FA 2WVVB 2ZUXA 5HHQB 5DS8A 2YD3A 3VMNA 2K9UA 5KJRH 4A7GA 3T2QA 5F7DA 5IW1A 1J8RA 3FQWB 4QWWD 3D51A 2J44A 4U1HB 4C56E 1E28B 4XE0A 4WWKD 1TZGH 3UP1A 3QULA 2AK4D 4XMLL 3U1PA 1F11B 3VCLB 1UGNA 1CICB 3VI4B 1IBFA 3TIEB 1RL1A 2KC0A 2QADC 4HUWB 1DUYA 4LLWA 3VFSA 1JV2B 1T2QL 3QUGA 1XBDA 3VXOB 1A8JH 3BO8B 1CF8L 3VXUD 2C4FT 1ZA6A 5T3ZD 2QKSA 3GMNA 3VD1A 2TSBA 4NM4H 2GB2A 4Y8DC 3RY6A 4DPAX 4D9LH 2R29A 1QOKA 3DX1A 3THML 5CLTA 3DUSA 5BQ7A 4JN2B 2LFGA 1BMWA 3LS5L 4K23L 2X4PA 3T4AC 5F1IA 4J4PD 5JHDD 3FCUB 2X4OA 3RWCB 2C1PA 3AS1A 3ECWA 4E41B 3EJZC 1WFIA 4M1CD 4G59C 1LK3H 2CDGA 5E9DD 1MW0A 3E6HA 5IHZA 3QUMA 5KWYC 3QZWB 1OWWA 3TBYB 5LO7A 3HNSL 5FYKU 4X7SH 2ZUQB 4LLYB 2Z8RA 3UTTD 4QY8A 5GS1A 2WQVA 3JV4B 5ABDE 5J9PA 2YAPA 2IBZY 4A7VA 1GJUA 1XCXA 4N2GA 4NZTH 4QRPB 1MCHA 4Z7OE 3AMLA 2G4GA 3TBTB 3TVMD 4P5TA 1N5YH 3NG5A 5LGYA 4JKLA 3DETC 4A7QA 5CEXA 3HBZA 2WD0A 4R7NB 1AH1A 1HQRB 4YQXL 1AZZC 4C4KO 1NL0H 2HFTA 3IVKA 1M6OA 3DJTA 1SVBA 4XNUH 1AHWB 2IH1B 4O51B 1TVHA 1BP3B 4M7ZC 1FC2D 3BQUD 4P4KA 2YC1B 5CBEA 2ZF9A 5DJ8B 4F58H 4X9FA 3BRGC 1S8DB 3QRGH 1FFRA 3HC3H 2BXZA 1IAOA 3SDDB 4N2NA 1QUNA 3PHQB 4MVBD 4MZ3A 5JQ6H 5JPNB 5IVNA 3L3HA 2BY3A 2Y5QA 1FG2B 1KXTA 5K1JA 4ZTPL 1OCZB 4EIUA 1EEQA 3APMA 3BXNA 2YOAA 2ADGA 1S46A 1KBPA 3C60B 1A1OA 2OSWA 2Y7MA 1YN6A 1T5KA 5JPMA 2YD0A 3ARTA 3BH4A 1HH9A 4OCYH 5FR3A 3GSRB 1MN4A 3K2UL 4RQQB 2HT2C 2H45A 3ULSB 1CD1A 1IVLA 1SN0A 2X3CA 4XP1L 5BQDA 3V9FA 3RIKA 5IB2A 2C3VA 3Q06A 2H6PB 5BVJB 4ENEC 2B1AH 5C0GB 5C2BL 3S3SA 2UWEF 2CXKA 1ED3B 4BHUA 5EEXA 3HG0A 4NWUH 4NO3A 1NCDH 1VZGA 2NW3B 2R1XB 3B7SA 3L81A 3GBEA 1I75A 4PCKA 2EDDA 2OM5A 4KKLC 2FL5B 3CPLB 5DUML 3LN5B 5ESVB 2IXQB 4CBPA 3HB3B 3ZDXB 3NOIA 4L5FE 3HLKA 4DGIH 1E4WL 2NXZD 4F7TB 1T5XB 5GHWL 1T7XA 2VAAB 3P30H 1AZBA 4FP8H 2R23B 5K33A 1FVCB 1CVSC 3F05A 5F93C 4Z7WB 2B7DT 5EIQA 2WLJA 2XVLA 3F5WB 4YSEA 1GGBH 4MYPA 2A6KB 3TO2B 3NDYE 5JHDA 1FPTL 4P2OA 2QSTA 4EQ3A 3CCHA 3ECQA 3BOVA 1M1XB 4RVBA 4X6CB 1HOCB 2D31B 4UOW1 4Z6AT 4MA1B 3T6WA 1A6AA 2HT4C 5TPWH 3MREA 1K4CB 1Y0LA 4HOZA 2NY0C 4NN6B 2GTQA 4EIZC 1E4HA 2V7HB 3ARBA 3Q3GA 4OB5H 3KL5A 3P9MB 5IMOA 1KXHA 4BSVA 5B39B 2G9KA 2NQCA 1YPZA 2WBJA 1DSFH 3UTQA 4X98A 2CGRL 5C0BB 1MNUH 3RGVB 3B43A 3OKEB 4HXAL 4LSQL 3W39A 1Z5HA 1MFAH 2N0MA 2Y07L 2P1YA 3DPBB 2XIIA 1E7VA 2DB8A 4IGBC 1X9UA 1C9SA 3ARGA 4HIEA 2EEXA 1SY6L 2E9WA 3LXUX 5CUSL 3T65B 4RESB 1IB5A 4HYTB 5ADPL 2YQ3A 4B27A 1HHGB 5SWSA 1FZOB 1BZ9B 4I2XB 4JFFB 2R59A 4PJ9D 3BYTA 1MHPH 1LWHA 3BC9A 1XL6A 1KIPA 4B50A 2B4CH 5J11B 4MA3A 4ZS6C 2JKIS 4QOKD 4XVTH 4QTFA 1Q1PA 1VFOA 3BN9C 1TETL 4XI5C 2ESVB 1G7PB 1OM9A 4ODHH 4QCIB 3K6DA 2Q8AL 1WA0X 3BIAX 3OKLB 3DNKA 4HS3A 3K8LA 5E7BA 2ZOUA 2VDRH 3DVGB 4DTGL 2ZWSA 4NIYE 4LCWE 4JL1A 5D7KE 5FW7A 3VB8A 2I32A 2BHUA 5HD8C 1QSFE 1GYWA 1IZKA 2CPCA 2XACC 2PXYB 4HAGA 4Z3IA 3BLKA 4KJWC 5DEZA 1LNUA 3VGFA 1E9QB 3B34A 3IAQA 1DQDL 2WZ0A 5DUPH 4BKLA 4FQJH 1LYQA 3UYOD 2EVFA 2WWKO 5EZIH 1CZ8H 1J0KA 4UNVA 1MCWW 1FZJB 5F71A 4WI0A 3SGEI 4LSRL 4XWGH 3D7PA 3V7AE 3L1OL 1YRKA 1AE6H 2O6FA 1NCGA 2AJVH 1AGDA 1CLCA 2FEEL 1W8EA 3DHMA 5HDRA 3VFUA 4E2OA 4OZHE 3FKUS 1T1ZB 2CG9X 2W81C 2UVFA 4RAVA 1GYUA 2I26N 1SHWA 3G5YA 5CWSA 2R7EA 5F2FA 1YEWA 4KO9A 4XT1C 4J28A 2ENJA 1UQSB 5BO1L 2H6UA 1ADWA 3QWRD 2VB5A 1URLA 2HRPL 4NZRL 3CDGA 3VXSE 1JPGB 5AW5B 3SGDI 2CHXA 1NSNL 4JHVA 4K8RD 1TTAA 3CJJA 1PKQE 4X4XB 4AENB 4K9EC 3LRLA 3SDXA 2DQJH 1OARH 1QW8A 2P5EB 4YDZA 5LCVA 2PW2A 3CC5B 4NNPL 5E5MA 4OCRH 4GW5A 4Y5VB 4FGMA 4KHTH 2Z93A 3UO1H 2X40A 4G8AC 2Z8SA 2HVKA 2CBMA 2X89A 4HGKC 3SCMC 5C08E 4GMSL 3QNXA 3ECUA 3HAEA 2P8PB 3S4SG 3AY2A 1II4E 2J43A 3H9HB 2BIPA 3SBQA 3O6FD 3P0GB 4OV5A 1TVBA 3WL9B 4PJ5E 2P80D 2WXJA 4XP5H 3UG4A 4MA8L 5AVUB 5KSUA 1VSCA 2X9YA 2XN9E 3O4OC 3TO4A 1JWUA 4HV8A 4X4KA 5C7XH 2HN7A 3WE6A 1KN2L 4HD9A 4TVUA 5EU3B 1MLBB 3RZCA 1ID5I 3LHPL 1T20B 1CFNB 4YSCA 5JHLH 4HOWA 3Q5OA 4XB8A 2L4OA 1S78C 3HLAB 4WFHE 2R15A 5JNYB 4ZPTA 5BPPA 3BWSA 3K6NA 1IC0A 3MV7B 1AACA 4HKBA 3CXDH 3IDYC 4OZFA 4FQ1H 1RUML 3APCA 1J05A 1D5IH 4FNLH 4BV1A 1JYXA 2EZ0D 1RZGB 3QCTL 1PZSA 3TBBA 1PYWB 1JV5A 2VDPB 4MXWL 1MY5A 1TLMA 4X50A 1TSRA 1H3TA 1H3PH 1U30A 3OR6B 2CSPA 2D8KA 2J25A 4TUOB 4WNJA 4YXHL 4LCUA 1YJDC 2XZCH 5GGTH 5IJDC 3FOMB 5F89B 4YHZL 6TAAA 1X5IA 1IUZA 3IXTB 3DLQR 4M29A 2EC8A 4D7BA 1FFPA 3MLXH 4OD2B 3BVVA 1I9JH 3TYGL 2A0LD 5DFVD 4NRZA 4XMVA 4QR7A 4DJMA 4XB3A 4TSAL 3C8HA 4R7DB 4YLBA 2ATAA 2AXWA 2GY7B 3UPRA 2O6CA 4H2CA 4KHXH 4B96A 3CXFA 3QAQA 4V1DD 1DBKL 3NZHL 2DH2A 3MJ9A 4OJCA 4F5CE 4Z7VF 5KN5A 1AO7E 2ZNXA 4POYA 2WAQA 3FH8A 3MNMA 5CXPA 2NYZA 3E6FA 3V4VH 2WBXA 4ABQA 4DQAA 5IFHH 4AYFB 1PVHA 4DGVH 1OD7A 4W1TA 1Z3GH 3VVWA 2E7MA 4PWJA 1RQ5A 1G7QA 5E6ZA 1RUAL 3HE6D 1NFDB 4FKHA 1NM9A 1BQ5A 2J5LC 2X0VA 5ADOL 4JFZL 3VMPA 1MHCB 3HUJE 1IEHA 1RZFL 2VDQL 5BUPA 4UNUA 3PWLB 3N42B 3KHQA 2LU3A 3QJRB 1EQWA 2Y6TE 5L7XH 3MRHA 4NFCA 2MFNA 1PKOA 2AQQA 1T0NB 4KY2A 3KJ6H 2HA1A 2AJUH 3RFZA 5TDPB 4QRBA 3U6XA 1TPXC 4GKZA 5I30L 4X5XA 1YECL 3ROLB 5HJDA 2R2CA 1U2YA 3HN3A 5D2NB 2R1WB 4FF9A 3RHWK 1WV7T 2FZ3B 1C5DB 3IDIB 4L29B 4A68A 4MNHB 4I0PB 4LVOC 1HSAA 4PJFB 3P77A 3QDMD 5F1NA 1AS7A 4IYKA 3MCKA 3U4AA 5DEJA 4U1LB 3WIFB 1CFBA 5DO2C 4G70B 1P7QD 3OSKA 4P23A 5G4NA 4P2RB 5F72S 4KK8D 1EMTL 1H3XA 5KYNA 4PGJA 2ATPB 3DDFA 4FNPA 4CNIB 5F7BA 4J7RA 5EIIA 1SOQA 2CO7A 2CA4A 5ACLA 1ZEAL 2FYYB 4Y19D 2C9AA 5D7JB 5IJCC 1DVZA 1WP6A 1XH2A 1CXEA 1FSKC 4Q58C 1S7UA 4G1MA 3CFJB 4PJ8B 3ZKNC 1U8HB 3EZ8A 1EEZB 5IEHB 2A83B 4PQXA 2NZIA 4XXWC 4NZUL 5M94B 1A9VA 2FB4L 4JFQA 3QWQB 2V9QA 2OR8A 3DJRA 2JIXB 3VXRE 4WHDA 5C70A 2PYEB 3OJMB 1HL5A 4FYSA 3IJYA 3MRQB 3PPSA 3V55A 3G6JB 3JUZA 1RSFA 1S7QA 4MJ4A 4Z77B 4K55A 3O45A 2BHZA 1AKJB 3HMWL 4TRPL 2CUHA 5F6HI 1N3NB 4TF4A 3VD4A 1EA9C 3MLWL 2VISA 4U7KA 4JK0D 1NINA 2DDQH 1N59A 4R7XA 4XX5A 5IJVA 1D7BA 4RGOL 1F3JA 3G5ZB 3FU5A 4MJ6A 1A47A 1QNIA 1BQHA 3S88L 3K0YA 1BBDL 3P69A 2BSSA 4PH8A 1NZRA 4GO6B 1FUNA 3BLPX 4PJ7F 4JFDB 5AWNL 3IPEA 3U1SH 1T80A 3TPKA 3CFKB 3CK0H 2X05A 2W91A 3P40A 3LDBC 5JZ7C 3MR9A 2CDEB 1SYVB 2GUOB 4LCVA 2K3TA 1YEEL 2PO6B 3KZ8A 2CWRA 1OB1B 1S6NA 25C8L 2NR6A 4NQDB 3L3JA 1Q9LA 4Z7NF 1KTRL 3VI3B 5IR1B 5E08L 5J6GB 4N2MA 2WLNA 2X1WL 2KDGA 4XNAA 4WJ5B 5I6LA 4PJBA 2QQLL 3U2SB 5E2WL 1TQBC 1GC1H 1YMMA 3O11A 4F8NA 3QA3A 1T1XB 2OI9C 5FFGA 3KPSD 4FQXB 3GLAA 5FYJE 1KTJA 3SQBA 4NPYB 3MZGB 4BDVB 5H94A 3KGUA 4OIFA 2DQCL 2WXLA 3RZWA 2F8IA 3RWGB 4R4ND 3JT2A 1T2XA 1UXLA 2JKWA 2MOGA 3EOBB 3L8QA 5ALCH 43CAB 4FXTA 2NUTB 1R17A 3PL6A 2H2SD 3FBKA 2Z7UA 2OZ4L 3MTRA 3I9AA 3QUKA 1OSPL 4MS6A 3LKOA 4JVPA 4YGAB 1T22B 4ZMZA 5I0VA 1QLEB 4FMKA 4X6EA 2VJ8A 1MHHA 3E3QE 2EDXA 1SBSH 3QDJB 3OJVC 1G7HB 4F1ZA 2GI0A 5FUCE 3GMLA 4GRLC 1N19A 3OV6A 4UQCA 1EANA 2GK0A 1M4KA 4PJHE 1GIGH 2GCYA 1JMXA 1VA9A 3TEXA 2WLLA 4LCYB 4XVUC 2AEOA 3W2DL 2X9ZA 3VFVB 2WZAA 2OYPA 4BK5A 4L8CB 3WEBA 1ZLSL 2RHEA 32C2A 5FGCE 3UZEC 1JGLL 3HFMH 5E1QA 4F9PC 3OXRB 3U9PH 2ZKHL 1Z0MA 2I5YH 1VEPA 2F53D 4RBPK 3QGVA 4JGNA 5F3HA 3JXAA 1GS6X 2ED8A 4HH8A 1DJSA 4TS6A 2NSXA 1GRWA 3JV0A 4UI2A 1EXGA 4KOBA 2FO8A 5IMMA 3WHE0 4WEMB 3H9YA 4MSWB 1CE6A 3SE9L 1DJWA 3GIZH 1KDIA 1IEAB 3TJHD 3IGUA 1INDL 5KYUB 1R75A 4FABH 3NJXA 4BFOA 5DVNA 1ZK5A 4UDUB 2WB1A 3O2DA 1ORSA 2CRZA 2HRHA 4IRJB 3TBVB 4OIIL 2CE6A 3CDYA 5AD0A 1ZLEA 5D7LD 1KCSH 3BJLA 5EBMB 4PY8I 1Z5YD 4AXWA 2QBWA 1IM3A 1RZKC 4TUJB 1G4MA 3O41A 3NA9H 4XZ4A 5CJXA 2EDHA 3HE7D 4MXQD 1X7QA 3WGVB 4L4TB 4N0UA 5GQBA 3C6LA 5EZLB 3U83A 1JIBA 1KC5H 5BV7B 1EZVX 1KWKA 4HKJA 2X87A 3KR3L 3Q8BA 3Q6FA 2CIKA 3ELAT 2CHNA 2HTKC 2XTJD 4TPRL 3TYFA 1MJ7L 5I1JL 5IQ7H 2W5PA 5TD4A 4WKZB 5B8CB 1M3IA 1ZA3B 1KPRA 1P0SE 2WAHA 5I8CA 2GJ6B 1J7VR 1I4FB 4R0LB 4RGNB 1OGTA 5CP3A 3RGBA 1R3KB 1CFSB 4G6FB 2DQEL 4YVUA 1C7SA 1MAML 1T5WB 3IDMA 4HS6A 5TQ0H 4KJYB 5DQDH 3ABGA 4RDBA 4UT7L 5D6DA 3UPAA 2A6IB 3GMRB 1F00I 1WHPA 3ZT7A 3PWJB 3MLTA 5EOQH 3UTZB 4KK6C 1JPST 3T8XB 4PJIF 3U48A 4ABWA 4G8GA 1GTNA 2TRYA 1DJGA 2LHAA 2GBTA 1RJZA 3DXAE 3ZTEA 4ZYKB 4JFSA 5FOBB 1G9MH 1IGMH 2IPKB 5CCGE 3NH7L 4PS8A 4NRYB 4NI6A 2O5ZH 3LZQA 3QZBA 4GUPA 1TG8A 4RCAA 3GXPA 1MWAB 2HUHA 2XJLA 3BSZH 3O9WA 4UV7H 3N1GC 1KJMA 2A2QT 4M7LT 3TCLA 1DE4B 4JPIB 3I6KB 3LH9A 3U4EB 1QVOB 2LU5A 3SQRA 5GJSH 4H0GA 1HCVA 4M4RA 2AXHA 4JFXA 2D2OA 4QMEA 5FCUH 1OM3L 4APQB 4DOHB 4H8WH 4QLWA 4Y2DB 5T5NF 4ZUWB 4NAJA 2W60B 5ITFB 1B4TA 2V8LA 3ZQXA 1S7XB 3TPUA 3M1BB 1U92B 1I82A 1MDTA 1TZIA 4MKTA 5EU7C 1C1EH 3BZ4B 2D3VA 1JP5A 2EYRB 1I85A 1M05B 2C7UB 5KAQG 3GSQB 3KVPA 5CD5D 5T3XH 3NJHA 3HS0B 1LLAA 3GYRA 5LVEA 2UZXA 2X0UA 1J8HD 3VXQA 4GI8A 1VLXA 4QO1A 2F15A 4A2LA 1KB9J 4ADJA 2C8NA 4IJ3B 4DZ8A 4TTDC 2NX5D 1S7SB 4HSQA 4LASH 1T0OA 1BAFL 1XT5A 4DP9X 1WO2A 5BXFA 5IF0B 2HG5B 4PJCF 2QVTA 4OZIE 5MEQA 1TU2B 5AVRB 2YD4A 2FWOB 1D6VH 3UDWA 4MAYC 2CBOA 2MCMA 3W1ZA 4D2NA 1XB6A 3A24A 4WW2B 2OL3H 4OLVH 1UCTA 4QXTA 5FM5O 5LGJB 4NQED 4RFOH 3VWJB 2HMID 4DGUA 1K4DA 2AZAA 1CMOA 4N0RA 1S3RA 1FNGA 3HCVA 4BZ1H 3B2DC 2BNRB 5H37A 2GHWB 4MJIA 2OW6A 4Y2OB 5ICUA 3EW3B 1V7MH 3BGFC 1P84J 1PFOA 3FO9B 1NPUA 1TJGL 1F58H 3WS3B 3C6SB 3H3PL 5I76B 4P9HH 1ZLWH 4KKAC 5LHDA 3EJTA 4X9BA 1XIWA 3MNWB 3M17B 3MRCA 3FFDA 2F8VA 1DSWA 1WISA 1Z7JA 2HJKA 3C5SA 4X8JB 1A6WL 3WLWC 5HYSA 5JXED 1N0LA 3N1QC 1HZKA 1WWCA 4G6JH 4AY0A 4L8BA 3KEDA 2VMJA 2QQKH 3ZKXB 2XPZA 4IOIA 1W9XA 2NYYC 4G8EA 1RK0A 5GIRA 2DRUA 4XN2A 4YBHA 3T08A 1TFPA 4U1NB 3JTTB 1SHXA 4JPSA 2D0HA 3GBML 1NOFA 2AQRA 3K80A 3T4YB 3WNPA 2FIKA 3VG0H 1YSOA 1GMIA 1XXFC 4PCYA 2GABA 1RPUA 1IJNA 1BM3L 1I1AB 1WBZA 4NUMA 1ZDSA 4Y4FB 1UKSA 3L3DB 3O3BA 4IRSC 1I8IA 1Y18A 5H37G 2OP4H 1GZQA 2RMNA 2RJMA 2LLLA 1EJOL 3WFZA 1MFNA 1ZD6A 1IGIL 4JO4H 1OCOB 1XGQA 2VERN 7PCYA 3MVSA 3L5IA 5FA3A 4LZKA 1NCJA 2GITB 3P73B 1OHZA 5GS0D 2EIZB 4U05A 1CN4A 4Z7OF 3BPCA 4R90H 1RZKH 2GSIA 4UUJB 5E8DL 4Z0XA 3EO1A 4UIKL 1PZ5A 1Z5LB 3S37L 3RTQA 5HYSG 2FJGA 4LSTH 6FABL 1JZ6A 1ETB1 1WJ3A 1VPOH 1TTUA 2QT6A 3QJQB 4PJGE 5HGHA 3RL2B 3W11D 4FFVD 1NIFA 3P4NA 4MQTB 1Q0XH 4L3CA 1FIGH 4AQ1C 4CGUB 3NZ8B 3W0WE 5DUBA 5L9DL 4RBPH 1V3JA 3OLDA 2K8QA 3FU7B 5HGBB 5AVTB 4TMPA 3US1A 4X5PA 4I5BA 3NAAL 1ZMYA 2F1BA 2H0PA 4FMVA 4FTVE 3UYRL 5LN8A 4Z95L 4NDMB 3AG4B 4DP4X 1ASPA 2OMZB 3LZRA 5D1QA 4F8TA 2J8UA 5GPRA 1XF5A 2YBRA 4KKZA 4OD3H 4ZPVB 2YQBA 3STLA 4QRSA 3EHBB 3AMKA 5EU6A 5KANG 1A65A 5FKAA 3X12A 3F85A 2E75C 5I1CH 2H32B 3X3GL 3GRWL 1G0DA 3EFDH 1AXTH 1HKLH 4LT7A 1D5BA 1GPOL 3SY0A 3A6CH 3NEEA 4M9PA 3T1WA 1E2WA 1OAKH 2P42B 5GSVB 3P9WB 5SWZE 3O3AB 1R33A 4E41D 1IC7H 4L8SA 4NQCD 1C5CL 4Z7UA 3UAJD 3QYCA 4JZOB 1YHPA 2ADFH 3AWEA 2LT9A 3Q48A 2IPUG 3OWEA 3QUXC 4B9GA 4WUUA 2OFQA 4ZMLA 3L1EA 2XKNB 4N28A 1LILA 3S98A 4KRPB 4RA0C 4XCCL 4EI6A 1NKRA 5GZND 1D9KC 2DYRB 5JXEA 4I3SL 3QNZB 3EO0A 5DI8A 1FJ1A 5IWLC 1NUNB 5ISZE 4WU7A 5CZVH 5E8PB 3FT4B 5K39B 1RSYA 2IWGA 2A9ML 3QT2A 2VXTL 1KEMH 3FH5A 4BFKA 5FDYA 4K3DL 1W6WA 3QJFB 4QRPD 5HHPB 3VFOB 2ZJSL 1U3YA 2DKMA 4DETA 4DN3L 2XV3A 2P48B 4FFYL 2EH8H 3OQRA 4G7VL 4X6BA 4G6KL 4UNTA 4EBQH 1T6VN 1E27A 4AMWA 1AQDB 1ZV9A 5BOZG 3O6MH 43C9B 4YHNB 2E46A 2F54E 4HT1H 4YFDB 3WN5A 4JM2A 3WU1A 3CNKA 5L4MA 3VMOA 4ZOCA 1HHJA 2HWZL 2VDLH 1RFDH 4DUVA 5LGKA 2UWEB 2XPGA 5D7HA 3I2CH 4JPVL 1KJVA 3LN9A 3SDDD 2X1XR 3V0DA 4WI8A 5J56B 2VLJA 4G6AC 2VKWA 1WE5A 3TFBA 5CILH 5E4EC 3D3VE 3FSZA 2H26A 3QNYB 5JIIA 1F4WH 3KPMA 2VMEA 2HFGH 3C60D 3HG1A 3K2IA 1OAZH 1RXLA 1WG3A 4YC2B 3BPLB 3FQWA 3H53A 2D03L 2GTWB 4ZSOE 4Y4KC 2R4RL 3GMPB 4I18C 2DQDH 4GAGL 2CJUL 4NKIL 2W88A 4YL9A 5DK0A 3VCLA 3H54A 1DEDA 3WHE1 3BX7C 4UTAA 1CICA 1SF5A 3VI4A 4GH7B 4XOBA 3TIEA 3OJDB 4Y16A 5FDWB 1ERNA 2SEBB 4O4YL 1FVDA 5I66A 2NQ3A 3HB3D 3BEVB 4G83A 2L7EA 1OY3B 1ZPLA 2A5UA 1D5XB 3CBJB 5I74B 4F27A 1PZAA 4NXSA 4BE6A 1YEHL 3V6OE 5BMFL 1SGKA 1VCBC 4W6YB 4A37A 5JHLA 4ZOBA 2GFBB 2RCSL 2BVPB 3UTSD 2FHBA 3QJOA 3QXUA 4QNPE 4X80H 4YHPA 4Z7IA 1OTSC 2EEFA 1UB6A 1UFUA 1DQKA 3HZVB 3ARZA 4F24A 5F7UA 1IGYB 1DJZA 3E8UL 1EEYB 1LO5B 1V5JA 2C7FA 4QXUL 2MQ0A 3ARFB 2AJXL 3ZSTA 3ARUA 2AJ3A 4XC1H 2PUQT 2EILB 3O4LE 3QZWA 3TBYA 3IKCA 2FATH 4OKVA 3NJFA 5C0BD 2Z1PA 3RGVD 2OTUA 2H3XC 3B5GA 1H9VA 2AEWA 4GY4A 3UJIL 3F7YB 5GGTA 3QO0A 2OYKA 2D7TL 3Q9PA 3L54A 3IFOA 1G7LB 2L04A 3JV4A 1RZ7L 5JO5A 1GYCA 4KZEL 3QR2A 4JN1L 2KYIA 4N0YH 5HJGA 1V27A 3KH3A 4H1LH 4PWGA 2YK1H 2UYLB 4R7NA 1U93A 4H13C 3VRIA 3QDGB 1EHLH 1DQMH 2IAMC 3MROB 3QG7L 3HNVH 4UQ3B 4OKDA 3WTYA 1IGFH 4HG4K 3IJSA 1NUGA 2HPTA 2W65B 1M6UA 1UM5L 2P24B 1KGCD 4GKSA 3ILPB 2JI3A 4JG1L 3AROA 1JFQL 2VE6B 1W72B 3HBGA 2VQ1A 2H1PL 4P2QA 2PXYD 1KTCA 3QZWG 3H55A 1MJ8H 3AXIA 2LAAA 2J73A 1OSZB 4EIBA 4IIQB 5IMKB 4KPHL 4R4FH 3W9DA 1GXEA 3MOBL 5K9QG 4U2YA 3HN8A 1FYTB 3ULSA 1IQDB 5EEVA 4QRRB 1E9OA 2H6PA 3GNML 2ROYA 3FPYA 1BQKA 1MCRA 4TLKA 5C0GA 1JPSH 1CIDA 3KEHA 4RNRB 4PGEA 5BS0A 5BRZB 3OKDA 1K9TA 4GRWF 3T2LA 4L18A 3RG1C 4P9MH 1XCTB 1LXMA 4HJIA 3I02B 3WD5L 3CPLA 4XAWH 4UWQB 4PS7A 2F68X 2NNAA 3EYUH 3HG5A 1KEGL 5AUMB 2CDFA 3L3OB 1NUFA 5AYUL 2HTLD 5EOTA 3GI8L 4AH2B 2WXQA 2Z92B 4HCGA 1ZHNB 2ZCZA 3NK3A 1FFNA 1O9VA 3LKNA 3ULVD 2BP0A 1U8OB 5TE4L 4B5EA 3Q13A 2A6KA 4JR9L 4JL2A 2YJQA 4AL8C 3EYSH 5EO0B 2P5ED 1RV6X 3VFMB 2PN5A 1WC7B 2E6QA 3UJJL 3CDZA 3GXUB 2G75A 2QV2A 4X6CA 3OXSB 4XN9A 3LH2L 1TR7A 2X4UA 4YDNA 1I7TA 1WK0A 1K4CA 4UM9B 4UIMB 3TASA 3HC0A 2WWNA 3JZYA 3NJGA 5F7NC 3SGEH 4X8GA 2Z1KA 1PZUB 3DI2B 1CCZA 5EO1B 4Y9BA 2ETWA 3IE4A 2NY7L 4HH9B 5J3HC 4PRBB 3TBSB 2EEDA 3OR7A 3A4DA 5C6WH 4ERSL 5ICXB 2D73A 1TXKA 3A3YB 3OL2A 4HA1A 4A7TA 4M1GL 9PCYA 1LDPL 1KZYA 1XZ0A 4L48A 1D5MB 4PJDF 1FNSL 2WO2B 4JFFA 3KWTA 1OLLA 4KZCA 2QADB 3VXMB 4U7SA 1M7DB 4BQ6A 1CFMA 3LEYH 1P7KA 2B59A 2IWKA 3ZYOA 5A2LH 4K3EH 4LRIC 4EI5A 4NOBA 1EBAA 1Z32X 4P3DA 4W9DC 4OLWH 3MV7D 4ODVL 4LHUB 2WLKA 3DJSA 1KYOJ 2ESVA 4WZ9A 5CSZB 4YLCA 4O02L 2Q6WA 4J4PC 5AVZB 3SO3C 1OAYL 1KJ2H 3ZMNA 3EYFB 3APNA 4Z7VB 3MMEB 4J3UA 3C5JB 3FQ4A 4UT6A 2VZVA 5FUCC 3T4AB 3PGFH 1M7UA 4Z8FH 2FIRT 4LLVB 1I3GH 1PLGL 3WY2A 1N6UA 3V5HB 1PSKL 5B39G 5DLMH 4EN3D 4GMTL 3L17A 4MJ5B 1HHIB 2VLKB 2VR9A 1HAUA 4W6WB 1BIIA 1CTMA 3MRNB 3VFNA 3E7JA 4BCZA 3QHZL 2J6EL 2HH0H 4J8QA 1SFDA 1KB5B 1F4YH 1FZJA 3KCPB 4NGHH 3WEXB 2C9VA 4WFEE 3AVEA 3MLYL 1T7VA 1YO4A 5LQBL 2EJ1A 4LNRA 2KERA 4OZHF 4CVUA 3PGCB 1NGYA 2FGZA 5BZDB 4GAAA 1FP5A 2IAAC 4QHLA 1YEKL 4G9FE 2GAZA 1T1WA 2RTTA 4NQUA 4ELME 5T1LA 5IFJA 3U9UA 3T2PA 3O0RH 3NPZB 2I9LA 4WI9A 4DUWA 4ZS7L 2VXQA 4YVNA 1FAIL 4KQ3L 5D71L 1K85A 3GLEA 1QO3B 4Y9GA 4IU3B 4KK5D 1QRNE 3JWOL 4WF7A 2YUXA 1X7TA 5CZXC 1PL3A 4BINA 4M7ZB 4XX1G 5GS0L 2IV8A 2AQ2A 3AREC 4KGLA 1U3NA 4M7JH 2YOCA 4MD0B 4Z76B 2ITFA 4J3OD 5GS3A 4IMLB 2APSA 3U46A 2J21A 1UH4A 1YEGL 4Y5VA 3RPKA 5JQHC 3LNFA 4NZ8A 4J3WA 4POZC 4M8VA 4RWYL 5L0QC 4BCXA 3L45A 1EHKB 1G7MB 3CGTA 4GI6A 2D9CA 1AOZA 1DVFA 2PCXA 2A4CA 4PRHB 4WO0A 2G9HB 1Y1DA 2BWDA 1JMZA 1DEEB 5KYXA 3WFEL 1JGVL 1YUHB 3WL9A 4PUBH 2E47A 5IJKA 4IK7A 4YGVB 2DV6A 1P4IL 4IQHA 4PV8B 1CDHA 3WEMA 3QHFL 3SPCA 1F18A 3D2UA 4P2RD 1HINH 1TZHB 1HWGB 4MTMA 1MLBA 2WTRA 1SLUA 4ZDHA 1CFNA 3RWDA 1SHSA 1HVXA 4OW6A 5AVXB 3RTLA 4PREA 3KL3A 5D7JD 2WGXA 3RVUD 3Q9QA 4I48A 5L88L 1KXQE 1K2DA 3L2NA 3FTUA 1BIHA 5E5UB 5C6TH 2NY3D 3S7GA 3VRJB 4FFWC 4JG0L 3BUPA 5TTRA 1BVOA 1FRGH 5EU4A 5B4MD 1P2CA 5CEZE 4AEHH 5JOEA 5IHUH 1HILA 4A55A 2P5WB 2FT7A 4PJ7B 2JIXD 1OTUC 3II3A 3ILQD 3QQDA 1NJ9B 1JCVA 3H9SB 5F89A 2E7LC 1MFCH 2PYED 1IL1B 4F7MB 4Z5RA 4UOZA 4HXBH 1TCRA 4OD2A 1U8JA 1LEKA 5IEKB 2ZYSA 1DJXA 4Z9KB 2YMXH 3N40F 3MKGA 1AKJD 4NFDA 3V4LA 4B9FA 4Z7NB 2HLFC 2IDSA 4MRCA 4YDIL 3GINA 2BNQE 5CLXA 3L9YA 3V4VB 4QD2E 1JZ4A 3IU3A 4QTIH 1KLUA 4X9YA 4NBYB 4BRJA 4E9LA 1VACB 1DBML 2JV6A 4QHPA 1I8MB 1BFOA 1NGWB 4G8IA 2CO4A 4IGBB 4ZX3A 3UBXI 4JFDD 1HIML 4PSRA 1QFOA 1YEDA 4CADB 3WENA 1MRDL 4XVSL 4HBQA 2VN4A 1MPAH 3ABZA 4L4VB 4OF7A 5H2BB 1MFDH 5HYJB 8FABB 5TH2A 2PO6D 1T7YA 3V6ZA 5DVOA 4YDLC 2CPUA 4NQDD 5CJQL 5FYJH 4H40A 3X1EA 1L6ZA 3TZVA 4ZO7A 1DBJH 4KVNL 4AGMA 3HUJF 5GRVK 1QA9B 1MHCA 2QSCH 1JWSA 2QJDA 1RURL 1IV8A 3UERA 5C71A 2UZIH 1DYZA 3C75A 5EH1A 1DVUA 3PWLA 5FK9B 5C07B 3WNKA 1B0IA 1A02N 2AV1A 3OAYK 4NUQA 4Z7QE 5IFAH 3DMMA 4DP5X 5I1GL 1QI3A 2DQTH 2CA3A 1CXHA 1MXGA 1J1OH 3ES6B 4WI6A 3OWRA 3S96B 4WCYH 5DJXA 4EZJA 2A6DA 5D2NA 2R1WA 5FUOL 1E8YA 3WY1A 5I6XC 4L29A 5MEPB 4I0PA 2JQZA 1R24B 3CHPA 5KSBF 5B7EA 1W91A 1CJYA 4GO9A 4OGXH 4PJFA 1L7TL 2E3VA 5MP6H 3L7EB 1CL7L 4U1LA 1CDYA 1L7IH 1T66D 5C0AE 4A6YA 1JNJA 2QELA 4JPKL 5A16A 1KLFB 3RWEA 1LEGB 4ZW3A 1F02I 3VSUA 5HHXH 2JJSA 2EUXA 2JCWA 4CNIA 2NT0A 1MI5A 1IBZA 5DVKA 3BEWA 2G3ZA 1CK0H 4C4BA 3IJHA 3A6OA 2DL9A 1T7ZA 1CBJA 1GA2A 3JV6A 5L4IA 4K2UL 5I1IH 1ZS8A 2CR3A 1XZWA 4PJXA 4NZFA 5F9DC 5KVEE 1UWFA 2M26A 2VXUL 1U8HA 3A4AA 4PJ8A 1W0WB 3GO1H 5GS2D 5HGDA 4UQ2A 3U6RB 4HDIA 2I60H 3OLEA 3ASOB 3K6SB 3GUTA 1SN5A 4PRID 3LXAA 3SDCC 4CVZA 1FGNL 3GKZA 5KVMC 3PQYE 4M43L 3KXFB 3EKCA 4M4PA 3QS3A 4LEXL 4ONHA 3N9GL 3V4PH 3CMGA 1JF1A 1NFKA 1HCZA 1VGKA 3CC1A 5MENE 2F74B 2QKIC 3BGMB 2XHNA 5T1MB 1HQ4B 4BZ1A 3D25A 4R4BB 1MFBL 2WN2A 5ID0A 1H6FA 1MW3A 3MYJB 3BRDA 4FC3E 3SCMB 4L0YA 2KQMA 3ZE0F 3OAZK 4U1SA 3O6FC 1BQLL 3WMSA 1AQ8A 5D4HA 5DR5H 2HFFB 5EBLA 5E6UB 2MCG1 2VO8A 2YPKB 1DVXA 3AWGA 4P99A 3NJIA 4XBPA 1KCWA 4W4NA 4Q8BA 1P53A 2VXSL 4IRJD 4FLQA 4I1NB 4EDWH 5KBNC 3BWAB 3ARVA 3EH3B 3O4OB 1KJ3H 3UMNA 3DVFA 1AR2A 4RIRB 3CFKA 5HYQA 1CGTA 5DJDA 3TA3B 4FA7B 1DFXA 4OLXH 5D70L 4Q2ZB 4LNVA 1SYVA 2YPLB 3FH7A 3GXDA 1NGZA 2EKJA 1SQ2N 3FCGA 3EJPA 3L3KB 4L3EE 2TSAA 2YZ1A 1OB1A 1E4XL 4LQFL 1DFBL 9CGTA 4PBDA 2DTML 5I1HL 1MCBA 3T0EB 3DX8B 5DD1L 4LU5L 2WC7A 5J6GA 2BJMH 3IDYB 4AQOA 1XH1A 2ADJA 4PJIB 1A66A 3G04B 5IVXF 4KZDH 4EF3A 4ADIA 3RE0A 4A38A 2FBJL 1MIMH 3D0VB 1OK0A 2MHAA 2BOBB 1ECZA 3QARA 4HBCL 2WWMD 4AIOA 5I16B 4FQXA 4EXKA 3B1TA 4NPYA 2GJ6D 1J5DA 4RGND 3T2OA 4WRLA 4NKOB 4IBQA 4D7PA 1X5JA 1UD4A 4G6FD 3MRLB 4ONFH 2FEEI 1AFVH 2PR9A 4JE4B 4KX8A 2CLRA 1UWEL 3P0YL 1A1NB 4I3GA 2CO1A 5IB4A 1E67A 3KGRA 4OCLC 4F9LA 1LO3H 4XH2B 4H44C 1NUDA 5JIHA 2AV7A 2ZYRA 1HC1A 3VD5A 3IXAB 4HS8H 2ITCB 5IGXL 4FJYA 5SX5H 5BZZA 1HOEA 3QDJA 1I1YA 1G7HA 4BWUA 1U95B 5B3JE 4LLMB 2X6MA 3KWWB 2Z0UA 2NRDA 2NXYC 1U41A 2Y5TB 4HKXB 3TBWB 2G0KA 1IGTA 3GI9H 1UVQA 5IOKA 1R3IL 1A14H 3D07A 2XY2A 3ULVL 4F91B 4WEUD 2YD1A 3A0OA 3FRPB 4L8CA 5CGYC 4JHBA 4GW1A 4BWWA 2J5LB 3GJFH 2KS0A 3JWNG 4APQD 4WDIB 5IMLB 1E4KC 2OS7A 2QMKA 3EH5B 4YH6A 5C2UB 4FNTA 5JYMA 3QFJA 5FUZL 4F3FA 5KS9F 1P1VA 3U7YH 4FCAA 3CH1A 3O2WH 2A1WL 4PJCB 3RWHB 4RISH 3ALXA 4X6FB 5AFAA 1FO0H 3SDAD 3P4OA 2ICEC 4MQXD 3WSQL 5DTFB 1TPXB 3NN8B 3V10A 1I9RH 4HUUA 5I75C 2R29L 4P5RA 1MCQA 1EK3A 5TF1H 2Q20A 1IEAA 4LVOB 5KYUA 3D50A 3NABH 4YDJB 4KK8C 3CLEL 3GZQA 5CZRA 4D0CB 3U7AA 4RWHA 3VXTA 1ROWA 2WVTA 5AAWC 3D6GA 1TJIL 1KV7A 2VSKB 3N40P 1NGQL 3BP4B 1WWBX 4XNXH 3VO0A 1RIHL 3ZTDC 4M61A 3BAYA 3QUML 3MODL 1G0XA 4G7QB 3LVTA 4F37F 1JL8A 3MN8A 3WIIL 3VWJD 1WAEA 4L4TA 3OB8A 5B1CA 1NOAA 5EZLA 1FSKB 4FJZA 2EIKB 1JHKH 1GGTA 3X2QB 2BINA 2OAAA 3LNHA 5FAAA 3QFDB 3V0WL 5IJBC 3RL1A 4PS4H 3QG6B 4QT5A 4MNQB 3COOA 3F7PC 4OJYA 2QR0A 1XGYH 1BF2A 2ZT9C 3GM8A 3VWKC 1IE4A 2A6JB 5B8CA 5CMAA 1SUHA 4UQ9A 5CF3A 5A2BA 1CFSA 3BGAA 4TQPA 5J57B 3V6OC 1T5WA 4YHLL 4F33B 4GEIA 1KIUB 2G0LA 1PG7X 4O58H 3GMRA 1LD9B 2DL2A 5LWYL 3D85A 4HHAB 3PWJA 5FM8A 3BDXA 1WQVT 5DHVB 1KG0A 3CZFB 4GIAA 2D7MA 3ARYA 4Z7OB 5FOBA 2IADA 2XZZA 2XBZA 4IOSA 1JSYA 1F45A 4XPFH 4UMGA 4Z3HA 4JRYE 4F8LA 1I1AD 5BOPA 3OKOA 1DSYA 1MLCB 2CLZA 4Y4FD 5EN2A 3WAJA 1TT6A 4DESA 3LDBB 1DP0A 3GHPA 3LS4H 4GS7C 3Q6GH 4AKPA 3ME0B 4JCWA 2ED7A 5EULV 5DD0L 2VLMD 1UA3A 4LL9A 3MCLL 1RLWA 1RK1B 1Y6KR 1MCJA 2XT1B 2FBOJ 2OMWA 4IRZH 2BP8A 1HESA 2IQ9H 4JFHE 2E9GA 4Y2DA 3AM8A 5SX4H 2FX7L 4OJFH 5TQ2H 2IGLA 2K0RA 1KCLA 1S7XA 4ISVA 4R26H 5IVZB 1BXXA 1B0GB 2X6BA 5DMIH 4IW4C 3EUDA 2UX6A 3F6JA 3GMOA 3F2LA 1TQBB 2WP3T 4DIXA 4ZI8A 4PFEA 3SJVB 4KO5A 2OI9B 2WSDA 2AABL 1AS6A 1PZ2A 1NEZB 3U2JA 1CE1H 4MDIB 4PTUA 5CINL 4OI9A 2H2SC 4IEFB 3FB5B 4I88A 1A7RL 3OZ9L 2FX8H 1CI3M 3B6SB 3MRGA 5KBMA 3LZFH 1X3DA 1EXUB 4A2HA 5FX3A 3ZKSD 1CGXA 1NC2B 4OLZH 4BFJA 1S5IH 3VD0A 3GBNH 4K5NA 1JVKA 1T89A 4L23A 4NM8H 3VD3A 3LRSB 1HEZA 4DP6X 3V8OA 1BQSA 1SEQH 4JQIL 1B3JA 3O8XB 1T1YB 4HK0A 1ZLVH 5LGJA 4GRLB 1I7UA 3ZRCC 3TF4A 3LIUA 3WUZA 4NB7A 4ODWB 4YE4L 1ANUA 2X10A 1XH3B 1JK8A 5GISH 4XO5A 2BNRA 3ORJA 1PGRB 3PYCA 4KTYA 2Y1AA 6PAZA 3PJNA 3X11A 3SGKA 3G5WA 5HGGS 4HX1B 2H3NB 2HVJA 4I1RA 4LCWA 2CALA 4Z78B 5HDBE 2XICA 1U8LB 3S3BB 3MACH 2BSCA 5LBSH 2VRAA 3DUUB 1Q9KB 3D4YA 3IB4A 3MNWA 1EVTC 4UTCA 4S1DD 4Y5YA 2V6HA 2G5BB 3Q2LA 4PW9A 1WZAA 4YXLL 3A4EA 3STZB 1O7DC 2EDYA 5IP4A 3TX4A 3O2VL 2FX9L 1URZA 3VSTA 2QEJA 1OCRB 3PGDB 3DX0A 3WIAA 4HJUA 1E2VA 4MMXC 5GGVY 3LQZB 4V2CB 3P2TA 2J1KA 4MCYA 4Z3GA 1UHVA 4C83B 3JTTA 4PGDB 2HB0A 4NAQA 3UAAA 2J2ZB 4QGTA 3RBSA 2XU9A 3ARDB 4YFLI 4LAJH 4ETQB 2YIHA 2GPZA 3WNMA 3RNKA 4U1JB 3CH8A 1TYRA 1QWNA 4O2CA 3CN4A 5T3ZE 2VJXA 3L3DA 4JB9H 3HE7C 5GZOA 4LBEA 3U7WL 4G5ZL 4MXQC 3VW3H 3QEHB 1CD9B 2AQPA 3MRKB 5CO1A 3LRGA 4LARH 4C56B 2OK0L 5CFAA 1T3FA 3DGGB 4LSUL 3RAJL 4KAQH 3JYCA 1NCCH 3OKMB 4FDWA 1RIVH 1LO0H 2MJWA 4KY1H 5IOPA 5JHDE 3C87A 5AVSB 4D3CH 2C9RA 2DMCA 4K7PH 4KXBA 2ZE0A 2ZXBA 5AW2B 4N8UA 1U8KB 3CFDB 1MCCA 3X1GA 4ZTOL 3MXVL 2W8CA 4DFHA 5AW6B 4HPHA 3CMOL 1JXKA 3UABA 4H5SA 5B1JA 4AUJA 3EO9H 5DC2A 3FSOA 2YHGA 4JCLA 1L4IA 5EUOE 1PNDA 1YPZE 2ZPKL 2EE3A 1QSEB 2X4NB 4S1RH 1WUZA 2WXFA 4HWZB 1NCWL 4PJ5A 1UA6L 5LJYH 1H0DA 3KM2A 3I50H 2XSKA 5C09A 4RA3A 4QHMA 2Y3AA 3BP6A 3FF7A 4CJ0A 5SWSE 2ZUWA 4FQCH 1KGXA 1CS6A 3KE0A 3KW7A 4ZPVA 3FFCB 3DIFB 1T4KA 2APWA 2X4TB 4ZNEE 3IDNB 3F7KA 2C1OB 3REWA 5I71C 2UY6B 5EEYA 4XNZC 3INOA 3NK4A 3L95A 4XWOC 3K71B 1ZSDB 3S35H 3SE6A 2YEVB 4I9XA 4LSVL 1W15A 4ZFGH 3IMVA 3BIKA 1J0IA 1E43A 4HIIA 1U91B 1CLVA 4PRPB 3B2VL 5I1LA 4GOSA 2Y36L 1LE5B 4ZAKC 1HXKA 2Q0ZX 3BPOC 4G72B 4XXCC 3L4WA 4ENZA 2BC4A 3AU0A 2ZX5A 4FQLL 1CDGA 3TN0C 3BKYL 4L8DA 2I07A 3WFBL 1H6TA 2XKNA 4UF7C 2RR3A 2AI0H 4N24A 4EI0A 2CBTA 2E7CA 3WGUB 5ERWA 4DP1X 1R6VA 4GBXC 1RPQA 3LHAA 4ZMXA 2GSGB 1IAIL 3AS2A 4HFWB 2UXFA 5E8PA 2G5UA 3R0NA 4GP8B 3VFGH 5JHBA 3D4ZA 3QEQB 5E51A 3R8QA 5F97E 1EEUA 4F7KA 3II1A 4MDRA 4OLYH 3VQ2C 2R0LH 1YYLL 2BVQB 4H0LC 2B0SH 2I25N 4HWUA 3G9AB 2UXVA 3O3EA 5FFLA 3WTWA 3QHTC 3QDAA 5HVHB 2VDLB 1AQDA 2AZUA 2HMIC 3QDGD 3B2UD 2LW3A 1LE9A 4YHNA 2ZXQA 2Q86B 4GUCA 4MAYB 1AZRA 3ZT6A 4XVJH 3CZNA 1SM3H 5B22A 3L7FB 2BP5M 1Q1JH 1YNKH 4UT9A 4NC2B 3I85A 2J7LA 1G6RH 1XSOA 3MJ9L 4GRWB 3CUPB 4J6RL 5FW8A 1N10A 1XGZA 3BGFB 4AIZB 3QYNA 2ZSVB 3PV6A 4FRWA 3DROA 5I8OL 2VR6A 5F7WC 4NNXB 2W38A 2B9BA 5A1AA 2NY2D 3L5HA 4NCC2 4XP4H 5IROA 3O6KH 3BW9A 3TTSA 4BEIA 3B7TA 1CGVA 2CKBH 4X5WA 2E4TA 4AG4H 4BGDA 1WFOA 3CFCL 1QTSA 5HDWA 3TIDB 2X6UA 5DC0A 4NQQA 1UB5A 2BCKA 3IJ7A 1DVSA 2C9QA 2A74A 3V0HA 4QRRD 1G1CA 3OAWA 1JHTB 1JVOA 4AVJA 5BRZD 2EVIA 4AV4A 1IARB 5BCAA 4AMKH 1DBBH 2PETA 4G9DA 4QYOB 4OZ4A 4XN5A 1NCNA 4WGVB 1UXSA 3OJDA 5JUEL 4N0CD 3UBGA 4F2MB 4WW1A 1MCFA 2NW3A 2SEBA 2V9UA 4OCXH 2A9NH 2G5RA 3V5DA 4L9DA 5EHFA 4CU7A 3FTSA 1OOWA 3T2NL 3UBXB 1MFMA 5ICYA 1V7NH 1XWVA 1DR9A 2AS5M 1JGDA 2A9AA 3MJ8A 3JWOC 4IRSB 4AYBA 3WUWA 2V17H 3CE1A 3QI9A 2QVMA 3MUHL 1JGEA 3A4FA 4B9CA 1PQZB 4MB1A 1PX8A 1PZCA 4QNPF 3X13B 3V9EA 4XBGA 3R1GH 4PJDB 3SYCA 1FGVL 1A4BA 4RMWA 3UOAB 2CUAA 2O61B 4KNUA 1U42A 1GSKA 4UM9D 4XCNA 1YN7A 4FFVC 4HISA 4KDWA 3RFRA 2X6VA 4XHJC 4MLIA 3ARFA 3HG2A 4P57B 5GSRA 2WOBA 1DCEA 2VR5A 2VL4A 4PRAA 1M7IB 1WT5A 1XQ4A 3BAJA 3WFCL 2ZUTA 3TT1H 3FN3A 4BFIB 3UZVA 1A0QL 4LLDA 1FCCA 1LWJA 4JRXA 2WQ8A 4K7FB 4H1LB 1OEZW 2XWCA 4GW4A 4KDVA 4U6VH 5C0NC 5K9JH 3I9PA 4I77L 1QSFB 1ZT4B 3HPLB 4M00A 4ALAH 5JMOC 4HUXA 1T7WA 4NO5B 1DANT 2QADD 1PMYA 1BZ8A 1VDGA 3VXMD 4HIJA 4UQDA 3AW5A 3QCUH 4HLZH 3UGXA 4FG2A 1HXMB 2YSTA 4QTHB 1HYSC 2VSCA 4QRQA 4UILL 4UQ3A 3OLIA 3X1BA 2IEPA 3Q2NA 4LHUD 1O75A 2ZCKL 4MMZC 1RHFA 5DVPA 3CSPA 1BZ7A 3VXNB 3DO7B 1YQVH 3CFEB 2W65A 1AIFA 3DX7A 4G1EB 4NRXB 1SVCP 4H88L 4OI7A 2XVKA 4XMPL 3T3MF 2ZXDA 3SGJA 3ZPDA 3AACA 4M6NH 1IAIM 4U4BA 3U9WA 3EJZD 1UWXH 4CSSA 3LVEA 5GZNC 2N01B 3QUXB 4IIQA 1G9NH 3BDYL 4UANA 4FG6C 2CO6B 3FBQA 3VXSB 1M56B 1OGAD 1ONQB 2JKTM 4U1MA 3SPHA 1FYTA 1IQDA 1D9KB 4JO2L 1PKQB 1JGUH 5AAMC 1Z9NA 4D9QD 2DTSA 2MPAL 2X6AA 3ATDA 3GM0A 4X6DA 5AYTA 4YSDA 1CU4H 5E4IA 5ITBH 1A7NH 4LCCA 5L4FA 4WUKL 2GBUA 3DRTA 1DHKA 1IT9H 3EJYC 1QYGH 3O6LH 3U36A 3BAEL 1I7ZB 4MWFB 3MNDA 3FUFA 1H15B 3HZYB 1VFAA 1LMKA 1THCA 4UTBH 5C08B 4BFFA 3DETD 3U1QA 1JNLL 1MJJB 4WEBL 4AH2A 5ETUB 1QBML 1ZHNA 2VDOL 3DI3B 3HRZC 2DM3A 5E99H 2Y4SA 1FL5B 4UOQA 2PW1B 2PCPA 3AFLA 3MRJB 5DZLA 1OOAA 3D4CA 5F96L 2OMVB 4X9GA 2X4QB 2EYTB 3FT9A 2XN9B 4BGLA 3T0AA 1WWWX 4P0DA 1KCUL 1ES0A 4BQ8A 2R0KL 3L3IA 4D9RE 3ZX1A 4I0KA 5ID1A 1QEWA 3R19A 3OXSA 4LGPB 3LEVL 2W95A 3LIZH 1PBYA 1SJVA 1JPFA 4HZAA 2R27A 1Q94B 4X99B 5E4EB 4ZFFA 1XD0A 5TE7H 5I5MA 1UCBH 2VDNL 4MCMA 4YHMH 3UZQB 3I75B 7FABL 1DDHB 1EAPB 5C0CD 5J6HB 3BP7B 4HH9A 1B2WH 3TBSA 4XC3L 3LKPB 4HEPG 3V4PA 2L3BA 2X12A 2HT2D 4HEMA 4V1DE 4Y4KB 3U6XS 3KWUA 5ICXA 2JB6B 4G80A 2BFVL 1NM4A 3GJEB 3OX8B 4ENED 1EZUA 4G6ML 4KVCL 2XZAH 2VMFA 4N8VA 1RIUH 2WINB 2H9GB 1DQQB 2YMTA 1D5MA 4AQEA 1EFXB 2W9EL 2DMGA 1E30A 4OI8A 3SBRA 4W9JC 4GQRA 4KKLD 2I9TA 5CEZH 5EOCL 3FJTA 2KL6A 1XB3A 3CWGA 3BRFA 3OTTA 2QL1A 2ZXCA 5B7FA 1MRFH 4N90E 2HLAA 3ZGHA 3PFUA 1P69B 2IALB 5CSZA 3FQ2A 5DFAA 1S7VA 1ODAA 3NEXA 2BSED 3QISA 5LBGA 3OLGA 3V0VB 2GJRA 2VW7A 4JLRA 3B9EA 4NJ9H 5DS2A 5HHOD 6CGTA 4Z7VA 2HJFB 3MMEA 4OCMC 1DQLL 2Z4QB 4PJBE 4YK4C 2P5WD 4FOMA 3T4AA 3MFFA 1LQBC 3VTMA 5F9AC 5IBUB 1G7IB 4R7LA 2R4SH 1P5VB 3H9SD 3LPOA 3IJEA 4XMLH 5INCB 4CMMA 5CD3A 2ZXAA 2EO7A 1MZYA 3WTSA 2VMCA 2VLKA 1HE7A 2HT4D 4LIQL 5DHYA 5B7MA 3QIWC 5KJ4A 4MDJB 3RGVC 1T2QH 3I6LE 3R7RA 1KTDA 3ZTJG 1YY8A 3ESMA 2WNWA 1DTUA 1CGSH 1KCRH 1TTBA 3CVHH 4POUB 5D5MA 1ORQB 1KB5A 2Y1VA 1WAPA 4K94H 1VGEL 2Z4TA 3BT0A 3C5XA 3KCPA 3N6YA 5GGRB 3AXHA 2YN3A 5EC2A 3ZYJA 2J71A 5FLVA 4EDXA 5C1MB 1ULVA 2DI8A 5AB2A 4UINH 4IGBD 2C3HA 1R4XA 5DURB 4X4MA 5F9OL 1U58B 4X5LA 1JYVA 1YAZA 3SKJL 4ELMF 3T3PE 4L4VD 4LHUG 3R18A 5HY9A 5HYJD 1KCVH 1SNRA 5IBTH 4FKKA 2NDGA 1YY9C 4HUVA 2GIXA 4ZS6D 5D7SH 5KSBB 5CBAA 2IAMB 3P2DA 3ETBF 3QXAB 2FRGP 3P02A 4XI5D 2I69A 4FXKC 3VRLE 2GSMB 4FYRA 3VFRB 5JA8B 1DVTA 4N5UA 4QRUB 5HHVH 2X70B 1AQMA 4R9HA 2FUTA 4G8FB 1RUPH 4ZMQA 3HBPA 3VA6A 5DJCA 2MTPA 3K91A 5E00A 1BJMA 5HD8D 1J11A 2X4SA 1VZHA 3BKCH 5JW5B 2VNCA 1I3UA 1AZCA 1TZGL 5DRWA 1NAMB 1L9OA 3GJFA 4KJWD 1L6PA 3DX9B 3JSSA 5DMYA 4AEIH 3LOWA 3I6GB 4B95C 1IAKB 4PRHA 2HKHL 4EZLA 1NWPA 4APXA 4KXZH 2Q7YB 4ODTH 4JPWL 3NFPA 5EMYA 1XF1A 1DEEA 1ZHKA 2VCOA 4JO1H 5E4OA 4AYGA 5FYLE 3TVMC 1RJLB 4OIAA 2R9HC 1FO0A 5KVEH 5C0RH 4KNQA 4NM4L 3VXRB 2B77A 4D9LL 4YXKH 3EFOB 3BVDB 3DRQB 5BRQA 3TBCA 5FHAL 4BJLA 5HHMB 1PLAA 3BD3A 1L9SA 3RYMA 3US0A 1O5DT 4BH7A 1P5UA 1BFVH 4UB0H 4ZTPH 5CJBA 3ZE0B 4YDVA 5D2LF 1ACXA 4N0UE 4DKFH 3VRJA 1ZGLP 1QLFB 1U21A 2ZP9A 3LSOB 3ZRFC 1LK3L 4WV1B 2E7BA 1J0ZA 3K2UH 3BVUA 1P7BA 1NMAH 5AKRA 4XP1H 3KXFD 4OFKA 2J1ZA 3DGDA 4I9WD 5C2BH 1N6QL 3FO2A 1QQDB 3H7BA 1NBYA 4X7SL 3MBEA 4J6IA 1JYWA 5A40E 3T77A 2BSTB 4GG8B 3BP5B 3ZMRA 3QPQC 3QJXA 3SCMD 3ETTA 4NZTL 4AW7A 1FBIH 3ARPA 3K81A 4JGJA 1NQBA 1WZLA 5HDOA 1SLWA 2O1AA 3LKSB 5BUGA 3AG3B 4PTTB 3CVIH 3KDMA 4XP9L 4DO6A 5E94A 1NIEA 2BSRB 4G8GE 5IVXB 2IG2H 2ODIA 1I8MA 3SZKC 1NGWA 2O5YH 4HGMA 2P47B 3QC5X 4DPCX 4I3RH 2Y7QB 1QI4A 1NL0L 2DWEA 2YKKA 3IGAA 4JRLA 4JQXA 4XNUL 5E03A 2DQ6A 4PYHA 3SIKA 3FN9A 5KBKA 3TA3D 2V2WB 3CAFA 1KXVA 4LSDA 4U33A 4EAEA 4F58L 5D96C 2YPLD 2F08A 3TOPA 2IQAB 4LKCB 3QRGL 4RRPG 3DUHA 3P9LB 3HC3L 1ESOA 4AMXA 5DEFB 3WDHA 1FL6B 3PWVA 4JJ5A 3WELA 2ARWA 1S78D 3T0ED 5JQ6L 2M2DA 1UZGA 4Q6IB 4HIHA 4BH8B 4RMRA 3AU1A 2ZX9A 1ZV5A 4P5TC 5SV3A 3ILEA 5FK9A 5C07A 3SO3B 2OTWB 4PY7A 1CDJA 3AQZA 2EDTA 4Z7QF 5FM5M 4OCYL 4EN3C 3SN6N 3OKNB 4FG4A 2DM7A 3DX2A 5E9DB 3D39D 1SY6H 4IMKA 2WLIA 3CHRA 4U1GC 4PJGA 4OY9A 4IRZA 4RMTA 2B1AL 4RLDA 5IB1B 1WBXB 3LNGA 4NWUL 5MEPA 3IDJA 4DGWC 1BVZA 5C3LD 4GG6F 1R3JB 2V9RA 1F3DH 4WO4A 4WHTA 2R2HA 5T1KD 3K7UA 3W0WA 3FUHA 1Z9OA 2QLVB 1NGXB 4A2FA 5DYOB 1D7DA 5FGCB 2EUWA 3MXWL 1RP8A 5KS9B 1TETH 1HYRC 1YZZA 3D69B 2X9XA 1ZVSB 1LEGA 5DRNA 1OPOA 3P30L 3F6LA 4X9IA 5JW4Q 1OWRM 1MJUH 1BFTA 1KPUA 5DQJB 3J27A 4ZODA 2CGZA 5JDJA 1MOEA 4HFUL 2Y06H 1F4HA 3AAZA 1JE6A 3TCXA 4TOYH 5KANI 1XF2B 1CDBA 3ABMB 2QQNH 2DBLH 1YC8A 1IQWH 1IBGH 3DHJA 3D5OF 3V9CA 4OM1H 5IBLC 1ODUA 1DQDH 4HQQH 3P11L 1Y6NR 4AZUA 5TPWL 3REVA 3SKOB 1F90H 4J3OC 5SWZA 4I8DA 1G7JB 4FFZL 3DBXA 3VGGA 2JCCA 1FDLH 3ZGIA 1A9EA 3CFTA 1SEBB 3AREB 1RH8A 3NZUA 3L1OH 1HKFA 1DSFL 1S7WB 3B3IA 2XWJB 4EPSA 1MNUL 3BGMA 4TVPE 4UQEA 2DEWX 1AG0A 2FNBA 1HQ4A 1MFAL 3HW7A 4RGMC 5L0QB 5F7LB 1IKFH 4QF1B 1IE5A 3EYOB 3GSXB 1UOKA 4GSUA 2E7HA 5EU5B 1CTOA 1QW9A 4XNBA 4U0QB 4R5XA 2YPKA 4P2OC 3QXDA 1BLIA 1MHPL 1SOSA 5K5YA 2GI7A 2Q2LA 4KFZC 4Q74A 2DLGA 4U1IB 5TE6L 1I7RB 3T5WA 2B4CL 3WJMB 2YUVA 5HI5C 4FQHB 5DO2D 1XGRB 2X09A 5AZ2H 2Y1ZA 3BWAA 3E8VA 1P4BH 4S0SD 1WFJA 3T09A 3ARBC 4JDVA 3WO4C 1U0QA 4AIEA 4HWEH 2WBJC 1ZXKA 3CLFH 3DSNB 1K72A 4EMZA 3BZ5A 4NNPH 2NY3C 3PJLA 4TNVK 4AGPA 5HXMA 2VDRL 3ZL4L 2WBWB 3F00A 1ZTMA 2R0WH 2KLTA 2R2EB 3ARGC 4OZGA 2AQTA 2MOQA 5IQMA 4GMSH 3ZU8A 3ZKND 3EG9B 3BYYA 3DXAB 1FQ9C 3FHAA 4KFMA 4MNQD 3SZ6A 2Z8WC 4E5XA 4LOEA 4YIQA 5AW0B 4GRMA 2F5AL 4LOUC 4ZO6A 4KRNA 4NKDA 2L7QA 4FE9A 4FQJL 2JJWA 4NYLA 3TEUA 1CZ8L 4U1KA 1OCCB 4Y4HA 1OHQA 4N0FA 1X5ZA 3NCFB 1KN2H 3IF1B 1AE6L 5E1AB 3MRLA 4F80A 3LHPH 4M5ZH 4BFBD 4ZSOA 4NHCL 1BYOA 1GZPB 2P4AB 1UWGL 3EGXA 1P4LB 3RUGE 4PB9H 4UV4H 1ILUA 4WTWA 4M6OH 2ZWZA 4JVWA 2BWIA 1R5IB 4ZX6A 2AQNA 4TULH 2OA9A 5EF2A 4LPXA 1RUMH 1QBLL 2ZKXA 3WTUA 3D33A 5D1QE 3VE0A 5L2KA 4RX4A 2ZOOA 2J8UE 4ZW7A 3RQ3A 1S9KC 2IH3B 3AS3A 2Y5TA 1D5ZA 1Q72H 3TBWA 1JXDA 5BO0D 1FE8L 3RKDC 1IGCL 4YHZH 1NDTA 5EU6E 4FA8A 3FRPA 3TYGH 4YDLB 5AYQA 3D06A 1JI1A 3H0TA 3QQNA 4OCRL 3KPQA 2EE0A 3BKML 4LMQI 4QIRA 3UO1L 3HG4A 4FJ6A 3FTGB 4CW1A 4AVIA 3PDOB 4NCDA 4EO5A 3G6AA 3I9GH 3N50A 4LE8A 2QQQA 4X7EC 5E5LA 5B38B 2OMUA 1E5UI 1IFGA 4WUUE 5DK2A 1XCWA 3SJVD 3IRZA 1TMCB 4N2DA 4YAQB 4CSZA 1LGVA 2APFA 3GSNB 4BK8A 4XP5L 1GMEA 1FZKA 2E9JA 3O4LA 4L05A 4IU2B 1OTTD 4HU8A 5CCJA 1C12B 2O5XH 5C7XL 5T5NG 1HS6A 4HPYL 3GLZA 1T66C 3DSFL 1KNOB 4WIQA 1A1MA 2C9SA 5E8EA 3VDAA 5CJ8A 5D6CB 3SDYH 5JHLL 1ACYH 2QGCA 5ADOH 1FL3A 3CFIC 3CU7A 2NUPB 4JFZH 2V2XA 1NC2D 2AKRB 3LEXB 5C8JB 2ZKYA 3KWXA 3PWPD 1UZ8B 4FQ1L 1WBYB 4JHUA 4PSPA 2EXYD 4MD4B 4HSCX 5CLZA 1D5IL 4NPJA 3O8XD 1ZSHA 3GEWB 3Q1SH 5KTEL 3FRPG 3G08B 4RAUB 4WI5A 1T21B 2J88H 2E56A 2VKXA 2JB5L 5I30H 1OO2A 5D93C 1YECH 3GRBA 1Q9OB 4XVUD 3TO4C 2XZCL 5GGTL 3NJVA 1B3IA 5MEOA 1HH6A 2C9PA 4BSWA 2FGWH 1XR8B 4PB0L 4H7VA 5T5FA 3RZCC 3MLXL 4DQOH 1T0MA 4N25A 2C5DC 4NUPA 4BQBA 3L5XH 3MX0B 1AC6A 1U2HA 2VLJE 3DJ9A 3SDCB 4L1DA 5FKPB 1HSBB 3BWUC 4GT0A 2A6JA 3L4TA 3SE3A 4WFGD 1NAKH 1E0OB 3P54A 3D18B 3RVTC 2EICA 1WEJL 4KHXL 3MGTA 2DIEA 2QKIB 5I24A 2FJFB 2W07B 5K9QI 1G6RA 3KPPB 4Y88A 2ITEA 4E9SA 5CZKA 4F7CA 1KN4L 5KVDE 4IK6A 3BISA 4HLJA 3LV3A 1LD9A 2IDUA 5T3ZH 3O6FB 4HIQA 2DQUH 3V4VL 2X9WA 3LAFA 4PG9A 5DHVA 3SYOA 2DEXX 4IRJC 4DGVL 5J6SA 1Z3GL 3QWOA 3VI4E 1O0VA 3OF6D 1SVZA 2A9DA 3C2SA 3PXHA 3ARDD 4ZMTA 5AOJA 1N0XL 1NCBL 2PTVA 1BCIA 3MLRH 1PG7L 4I0CC 4U4IA 2PYFB 3VFPB 4NZUH 3H2QA 4JZJA 3Q01A 4PI2A 4QRTA 5EBWB 4C56D 1CDUA 3GTTA 4NO0D 3ZHLA 3T8VA 1K3IA 2MCPH 5L7XL 3EFFB 4LOVA 4O9HH 3LKQB 4I4WA 2Y5EA 4U6YA 1RK1A 3KJ6L 4AVKA 1UH3A 2AJUL 3AXLA 4ORGA 3TNNA 4B3VA 3RNQB 4TNWK 3BHBB 4FTVB 4E41E 1CBVH 3BAKA 5IVZA 2HTKD 3WFHA 3NSJA 3CHQA 1BBDH 3OD3A 1S4IA 4KQ4H 2ALAA 5ILTL 1ET5A 1NEZA 1UURA 3FYIB 1F4XH 1CL7I 2UV3A 2A7BA 3W38A 4NENA 4FLOA 2ZUSA 3MLUL 4KTEH 2A38A 3U79A 1WFUA 1XHHA 1SMAA 3ZHDA 25C8H 4GAFB 2BVOA 4KK6D 3RFZC 5E08H 2VDMH 1XL4A 5ANMA 3HHSB 1MUJB 1CXFA 3LRSA 3EOTH 3NP3A 3ZOAA 3DC0A 1YNTA 1J5HA 5EF0A 1S7TA 4GRLA 4NQVA 1S5HB 2NXYB 2B3IA 5ISZB 2DI9A 5D7IA 3Q2WA 4ZQKB 2K7PA 1MAJA 4P23C 5ALBH 4PRPD 5F7YC 1CFQA 5HDBF 4PWKA 1NDMB 1OK8A 1A22B 2OZ4H 4M7KH 3WKQA 3TH3T 4P2QE 1BOGA 1KPVB 1NEZG 3SDAC 3WKNA 4MQXC 3PHOA 2VYRE 2G5BA 4OH2A 1LJMA 2IV9A 3JZ7A 2DDQL 3STZA 2W80C 4UU9B 5EEWA 1HXYB 3U0TA 2F7PA 4FS0A 3KPRB 2ICEB 2BMKA 4FG0A 4OF5A 5E8OA 5JIKA 2R51A 1XBRA 3F12A 4GQPH 5I75B 1SXBA 2GW5A 3U1SL 5FLUA 5JLZA 5D9SA 3LQZA 2G3XA 3CK0L 4OLUH 5BS0E 2ZYIA 4IBSA 4OFYA 4TTDD 3QK0A 4MBRA 4AQAB 1PW3A 4HCFA 1KBBA 4J3OF 3D3VB 1AMXA 5AKTA 5DWPA 2VZSA 4M8QB 4FLRA 1E4XI 2DQMA 1KBVA 4RRPM 4U1JA 5FFOA 2EKSA 4D8PB 2ZKHH 4CMHC 3HR5A 1KULA 2Y72A 1ZE3C 3V4UL 4MAYD 1A4KB 3C9NB 3EGSB 5IZ7A 4Z7WE 1GC1L 3KPNA 3UMTA 3ECBB 1QRNA 1RZIB 1H6EA 1DL7L 5FHBH 4FXLA 4MD5B 4Q0XH 4UTBA 1NC4B 3H2WA 3ZY7A 4AZ8B 3V5KA 1R0AL 4X6CE 4JFEA 3N04A 3L2LA 5ALCL 2LU4A 2J20A 4ZRGA 4KKAD 4Z3TA 4FQQB 1UEMA 1ND0B 3VWKB 2NR6C 4R96B 4ZX4A 1CR9L 3SB3A 1QTYT 3F01A 1YPZF 1FFOA 3OMZA 4HLEA 3BVTA 1DZ0A 1QSEA 1A7PL 1UT9A 2X4NA 3WLWD 4HWZA 4DVRL 2FTAA 4C8XA 3QH3B 3IS1X 4A63A 5LUMA 1B88A 2NLJA 4PP2B 1SBSL 4A7UA 5MHSE 1T83C 3LIZA 4PWHA 3T0VA 3N1MC 4XNQA 4GKNA 2NYYD 3UYPB 2BPBA 4OZFH 4JUSA 4MJ2A 5AOZA 1DLHB 1WF5A 4L9LA 2H4EA 1GIGL 3QJHB 4K3JH 3I3BA 2H47C 2UXTA 1K5NB 4JFFE 4DPBX 2GTZA 5TK2A 1JN6A 3VXPA 4AM0A 2CMRH 2YA0A 4FMFA 4F15C 1OAUH 4FN0A 3QZMA 2XG4B 3FFCA 3DO4A 3O3DA 3PL6C 2CK2A 4PR5B 2X4TA 5IG7A 3HFML 2LOEA 3HZKA 3LYRA 4IRSD 1TDQA 3E38A 3U9PL 5I2IA 1RP9A 3FTXA 2ESVE 4ZMPA 4GS7B 4JAMB 1IM9A 1FYHB 1ETJA 2I5YL 2XWDA 1N8OE 1VIWA